4LSZA

Caspase-7 in complex with darpin d7.18
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
YQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combined inhibition of caspase 3 and caspase 7 by two highly selective DARPins slows down cellular demise.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Caspase-7 subunit p20
total genus 51
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lszA00
1SHJA 4JR0A 3UO8B 4NBLA 4QUGA 1M72A 4QTXA 4QUHA 4N6OA 5I9TA 4M9RA 4AW9A 2CNNA 1RHMA 4LSZA 3GJRA 3KJNA 1RHJA 2J32A 3GJQA 1IBCA 2C2MA 2CNKA 4D3YA 2NN3C 4EHFA 4QUJA 2CJXA 1RWNA 4ZVUA 4JR2A 4EHKA 4EHHA 4QU0A 3NS7A 1SC1A 4EHNA 2C2ZA 3H11B 5IASA 3H0EA 3SIRA 3QNWA 4EHDA 3R5KA 2QLFA 4FGUA 3DEJA 2XYPA 4NOMA 2K7ZA 3R6LA 3IBCA 5I9BA 4PRZA 1ICEA 5IAEA 3OD5A 4D3XA 5IARA 3NKFA 4JR1A 4EHLA 1SHLA 2H4WA 2QL5A 4I1RA 4NBKA 1RWWA 3P4UA 5IBRA 4DCOA 4FDLA 2HBRA 2H48A 2H4YA 3DEIA 3GJSA 4QU9A 2CDRA 4JQYA 4QULA 1I51A 1BMQA 1I4OA 4N6GA 2DKOA 3DEHA 4PS1A 4QTYA 2J33A 3SIPA 1RE1A 4QUDA 1CVRA 3D6MA 4NOKA 5IAKA 4IEFB 4ZVRA 1GQFA 1QDUA 5IAJA 5K20A 5LU9A 4EJFA 1QX3A 2QL9A 2CNOA 1GFWA 2P2CA 3K7EA 4QUEA 4EHAA 2H65A 2H54A 4I1PA 2J31A 4HQ0A 1RHRA 3PD1A 1I3OA 1K88A 1PAUA 1NMQA 3R7NA 1CP3A 5IABA 4N7MA 2FP3A 2AR9A 3D6HA 4DCJA 1NW9B 1KMCA 4N6NA 3V3KA 2CNLA 4JB8A 2H5JA 3EDRA 3KJQA 2HBYA 1NMEA 2CJYA 4DCPA 1RWKA 2H51A 3S70A 3R7BA 2J30A 3E4CA 2C2KA 4HQRA 4HVAA 4PS0A 3V4OA 2QLBA 4AWAA 1F1JA 5IC6A 4JQZA 5IC4A 1SC4A 1RWVA 2Y1LA 3BIJA 2C2OA 3NR2A 4ZVTA 4ZVSA 2FQQA 4QUBA 1JXQA 3P45A 3R7SA 1QTNA 4QU5A 3S8EA 3V4LA 3D6FA 4QU8A 1SC3A 3V6LA 2XZTA 1RHUA 4IYRA 1I4EB 4ZVPA 4JJ8A 2FUNB 2HBZA 3PD0A 3PCXA 4AWBA 2HBQA 3DEKA 3GJTA 1RWPA 2XZDA 4N7JA 4D3ZA 1RWXA 2QL7A 5IBCA 4PRYA 3UOAB 1RHQA 4JJ7A 3IBFA 2WDPA 4FEAA 3ITNA 5H0IA 1PYOA 3H1PA 4NOJA 2Y0BA 5IBPA 3KJFA 3R6GA 4QUIA 5IANA 1RHKA 4N5DA 5LUBA 4NOLA 1NMSA 5LUAA 2XYHA 1K86A 2XYGA 3V6MA 2H5IA 3EDQA 3R5JA 4FXOA 4ZVOA 3H11A 4JJEA 5LU8A 4ZVQA 2C1EA 5IAGA 3RJMA 5JFTA 2QLJA 4QUAA 1RWMA 1F9EA 1RWOA 3H13A 3V55A 4NBNA
chains in the Genus database with same CATH superfamily
4PQGA 4P4GA 1DVRA 2AQHA 3A28A 3K70C 1UP4A 2FZWA 1OH5A 4MV8A 4RQTA 3KPWA 3BZBA 1Y1PA 3E18A 4QTXA 4WHMA 1K4KA 3IEMA 1BMDA 1EJ6A 4O1MA 3GF4A 1H69A 3SM9A 2C3MA 3QBDA 4LSZA 2GPWA 4R1QA 4F2HA 2VDWA 3E9CA 4KUEA 3FGNA 2ZBQA 1F20A 3AV3A 2BUCA 3LX4A 1EVLA 4Q4AA 4JODA 2X8WA 3SD7A 3THRA 3X1MA 4Z4HA 4WERA 1PJ8A 1LVGA 3MCTA 4MAMA 2R8XA 4TMYA 3W8DA 2F43B 2YYAA 1E59A 2XIQA 3TNYA 4KDFA 4DSTA 1UPBA 2HRDA 3UB2A 3MA0A 3DVSX 4NVRA 1QHYA 4II2A 4J0FA 1V9SA 4YV2A 3WLHA 5LMZA 3ORSA 4P35A 3B70A 4M22A 4ND1A 1IN1A 2JAWA 1AUVA 3B1VA 1FMJA 3QPBA 4XUCA 4D43A 3FFTA 1FLDA 4CE6A 2A1TR 3MG9A 4F96A 5B58C 3ZD6A 3CB2A 1U98A 4I50F 1R4MB 3K6RA 5BWOA 5CFLA 5HKAA 1KH1A 2IT1A 1D07A 3DJFA 4J0JA 4WESA 1Z37A 4LI3X 3V34A 1UL1X 1T0BA 2EATA 2OK8A 2ZB7A 1ZK4A 2VVTA 3PKZA 5DWDA 4A16A 3HXMA 2FEAA 2UDPA 1SEPA 3DEAA 3M82A 4R1SA 4K3UA 3BFKA 4BEBA 5BR4A 4B3MB 4BIIA 5A04A 2NZXA 1FNBA 1GT6A 2R6HA 1IY2A 1A4UA 2RBGA 3QBJA 4AX8A 4DM3A 3KYDA 4IDCA 5M7EA 3D4NA 1DQPA 5K0BA 1IHPA 1Z2OX 1ZCFA 2ZYTX 5LQJA 1LBHA 1M3SA 5CD9A 4D9GA 4S05A 3EGVA 2DCMA 1OUMA 2VJQA 2ZI5A 3NHBA 4G1FA 2BGKA 2O05A 4HEA6 2ZZKA 4B48A 2D1FA 1VJCA 1XOIA 4ZGWA 3DNFA 3I9OA 4X3PA 2N1BA 2C92A 4CQMB 1KDOA 1O54A 2ODTX 2ZTVA 2QUIA 5B2FA 2QN8A 2BZ0A 4NLLA 1AKEA 1VHLA 3C97A 4B9EA 1N5DA 4BIMA 1M34A 3JQRA 1SUEA 1ECPA 1ZVMA 3SR3A 2CLCX 3F9IA 2OVBA 3DTVA 4JFAA 2I7TA 1U0SY 1XCJA 3GB9A 3F8TA 3R5FA 4Z1MA 3U7QA 4X65B 3N8GA 5EYPA 3FIJA 5EZSA 3R7FA 5JAPA 4PM4A 1XL1A 1EBUA 1ZKDA 2YNMA 2HXYA 4EFKA 2OYCA 4ZVPA 2ECFA 4EVIA 1A76A 2B25A 1TUGA 2QTVB 3FPHA 1WQ1R 4PZEA 4IEIA 1LXCA 2A86A 3D6TB 1MHTA 4PZLA 5I7WA 4ZV4A 2GWHA 2Z3WA 3PHIA 3QBEA 4DCCA 2GCOB 3II6X 4RK7A 4YO7A 5KDDA 3ZJTA 4QE3A 5E7IA 1ZZGA 5JNWA 3SAJA 3LLUA 4HH3C 5JS2A 1AN9A 3FTFA 1Z6GA 3TBHA 3NBMA 4EYOA 4XX1A 3W5SA 2YFKA 1ZXXA 2IV3A 2HRBA 2JLYA 2B8EA 1FXWA 2JLCA 4H7FA 2XVYA 4PRLA 4XVQA 1M54A 4BC0A 5GV7A 1YS6A 1ZW1A 3W9YA 3OC6A 5AVXA 1ULZA 1UADA 2MSKA 1DAMA 2HMTA 4Y2UA 3SIWA 4HDOB 2JB9A 4I2VA 1R9NA 3ONEA 5KVSA 3K1AB 4RXMA 3KSDO 3F74A 3C5HA 5CB0A 1C1DA 3TZQA 1P5ZB 4WLNA 1ZD5A 4I19A 3AI1A 1KXZA 1SHZA 4ZJZA 2GF9A 2UZAA 4HTAA 3EEBA 5B30A 4BX0A 2G5CA 2PS0A 2ZQYA 4G56A 3IV6A 3DMHA 1IY8A 3T5DA 4JVSB 1EP2B 4JH0A 3SLKA 5LQRA 2XUIA 4PZPA 2PQ6A 1O5TA 1A27A 2YJZA 1N0UA 4HAVA 1KJ9A 1L4EA 1SD5A 1TT5A 4JJ6A 3JZIA 4KV9A 4D9CA 2RH5A 1SHUX 1AURA 1OBVA 3GEDA 1K8QA 3NJ4A 1PV2A 3AETB 3ZDCA 3COYA 4WK0B 2IP1A 4PPYA 1KMHB 2W71A 4YBZA 1G20B 1Q95A 4BUJA 1WZCA 4J07A 3C7KA 4H1HA 4KKXB 1UWVA 1M66A 3WAGA 3GJ0A 4NS1A 3GLIE 4XTCS 2WF6A 4IIJF 1U7TA 2OUKA 4QRHA 3DLHA 1KKUA 1PO7A 2OGTA 4O4LF 1KZYC 4KPYA 2CL5A 2P0AA 3L7MA 3KZ1E 4LE1A 4F4HA 2OHOA 4LCEA 1CF9A 2SKCA 4ZCMA 4HADA 4R6WA 4YAOA 1LNSA 5EQFA 4MGIR 4UM9D 1ENZA 4F11A 1X94A 3J80A 1J97A 4QQKA 1QLHA 4AG5A 5ITZB 5KWSA 1SR8A 4KQGA 5BSEA 3PD1A 4DG8A 1BFDA 2FW9A 2HL6A 4CR6A 1OZAA 3EGOA 4HQLA 4MAAA 2X0NA 4ZAXA 5FD8A 3V7UA 3VTFA 1ZUWA 1X39A 1P9OA 3BBPA 2DR0A 3AJEA 4X7PA 4Z7NB 1BWSA 3K96A 4D4JA 4C14A 2R4UA 4TVKA 2I6TA 1ZR2A 4DCJA 3F6PA 2ZWIA 2MSCB 2DTEA 2BFEA 5D84A 1MO4A 1U3UA 2DM6A 2BLNA 2IHYA 3AUUA 3ZX4A 3CVJA 1XEAA 4WBXC 4DCPA 4N12A 5A2GA 3D0KA 1X7DA 3NDBB 2EGHA 5F1KA 4GRAA 1HBJA 2NT3A 3FZEA 4ZT2A 1DGQA 2J0EA 1U3VA 2K87A 3FBTA 4X1IB 4EBBA 4DJJA 3J81k 2V7TA 1QFJA 2FWRA 2GSDA 2ZULA 2ROQA 4YS6A 2UZIR 1RHUA 4RWEA 4BFUA 3EUWA 5EGNA 1S8OA 2UXBB 3I52A 3GCZA 4UUMA 4ARCA 1RWXA 4UTZA 4BU1A 4HUTA 5B7NA 3ADOA 4D9HA 4QO7A 2IHKA 3RDPA 4KNWA 3UWOA 3EZ2A 2FMHA 5K0JA 4RMGA 4TYYA 2WSSA 2YZ7A 1PGOA 4F0JA 4O25A 5TGZA 5K03A 1LF5A 1PR6A 2VSQA 3EQ6A 2A1UA 3EFOA 3DP9A 5IDVA 2BEUB 5TC4A 1MN6A 4URUR 4QFBA 3ZV7A 3B3QA 1E3IA 1OIWA 1TOAA 2Q5QA 4NTZA 1EX1A 1U7XA 1VA5A 3A9SA 2KMLA 3RS5A 2I87A 2X4GA 3DQZA 1ZCZA 4P5PA 1A88A 2PZJA 2Z9CA 3EMBA 4GZ5A 3P1JA 3SE0A 5BSHA 1FFXB 3WL8A 3KOYA 4C0WA 2HW8A 4B6PA 4GRIA 1HDCA 2ZRKA 5K0EA 1DKNA 3I9V6 4B4DA 2OAEA 4HLUA 5KB3A 2E6KA 1Y82A 3GH1A 2IELA 1JI3A 2H2FA 2F8LA 4XD7A 3PT9A 4R9SA 1YQGA 3HUUA 1RLOA 3ZKWA 2VWQA 1QHEA 4II3A 4RHYA 2AKEA 1E3EA 1J56A 3TTTA 2IITA 1SC1A 4XAQA 1SKUA 1BS9A 2AN3A 4M4SA 3IT2A 1UDRA 3K8QA 4L76A 2BE9A 4YJHA 3U6BA 2WJ3A 5TQ0B 1OC4A 4HPXB 5B7PA 4U7FA 5DSXA 4JA2A 4JC4A 5JRZA 2VK1A 1IJFA 1QIHA 5AJWA 4LMPA 1E5DA 3PT5A 3MTAA 5H82A 2ZSUA 4GL4A 3PNPA 3M4JA 4K40A 5IM4A 3CPJB 4C2BA 4N8SA 1T91A 2EP7A 5MF6A 2HD4A 3G2MA 2YC2C 2R44A 2PFKA 3VO1A 2GN6A 3EVZA 5C8YF 4BVKA 1HA3A 1PW5A 1RXCA 4TWRA 5D3KA 5EMHA 3PYXA 5TEVA 3V4VB 3QZUA 4EZEA 3T4XA 3DULA 4H16A 4ID3A 3ZXXA 3K5WA 2WAXA 3OHPA 1O3YA 1O4WA 1U8EA 3AU8A 3VPFA 1YE8A 5CLIA 3L7YA 4CQLA 4RTQA 4Q93A 4CTOA 3R3ZA 5DHUA 3HGTA 1YJXA 3OPVA 4LOIA 2IEGA 3WMXA 4B4KA 5BUSA 1TPZA 3E7WA 1Q3HA 3DMFA 3WGMA 1UXJA 5KYKA 3RLFA 4L6IA 1I2ZA 3LTEA 2BFWA 1XDUA 4MTCA 2FEKA 4OL0A 2LP4Y 1EAMA 2GD1O 5A2QA 3OH8A 2NU8A 4EX6A 1IXKA 1H9BA 1ENPA 5EXTA 1PZGA 3VI4B 4R8LA 1G8GA 2WUWE 3FWKA 4BNZA 3M49A 3Q15C 1F14A 3KV1A 2R7AA 3UHFA 2PGLA 1X80B 1PNRA 1QRUA 3G2JA 4RXUA 3UPTA 2XUOA 2O59A 3WGLA 1OFIA 1YQXA 2J30A 5HE9A 4WBSA 2P62A 1V8DA 1VMDA 3OIYA 1SC4A 3AUFA 2WFLA 3FOWA 1QQ6A 3HEBA 4BCBA 3WGTA 2GR9A 4KCGA 5DO9A 1AF4A 1TKCA 1GSOA 2F17A 3MTJA 2XWBF 2ASEA 2BRUA 4LOAA 4DCGA 2J9RA 2XQJA 1A9OA 1OMOA 4HAOA 3E5HA 1L5FA 3R7LA 1YHNA 4NATA 3SJUA 3T35A 3AWIA 3GHHA 3L0OA 1C14A 4M54A 4MKZA 3CRVA 2F3PA 3IP6A 1AZTA 1NUSA 3JWJA 1IONA 1W85A 4GPD1 3SBOA 3TIXB 1HGXA 3TECE 4BJ6A 2P35A 2JRLA 3I9JA 1S2OA 3PI7A 2MMCA 1SXJC 1NYQA 4OLHA 3SNHA 2DSNA 1N4DA 2FSHA 3LU1A 4MLCA 3TW8B 3QHQA 4YUYA 2JHGA 4O2AA 3KYCB 2RJNA 3H8JA 4MR8B 3W06A 3GLUA 4U5XA 4DA0A 3PICA 4FNAA 4FFVA 4ZPXA 3PFWO 2HWUA 4C7VA 2AVDA 1MEJA 1O6CA 3F2VA 3ZD8A 3Q3IA 3ZIAD 4D4LA 4OPMA 2O8CA 1A4XA 1MJNA 1PTJA 3U7IA 3VKWA 4O08A 4BZWA 1RZRA 3RYCB 4S1OA 1BHQ1 3RRBA 4BLOA 1PDOA 4R1PA 1HTBA 3R0JA 4ISBA 2PPLA 4OJNA 3CPEA 3JD4A 4AZWA 5AXBA 1ZI6A 2BGIA 3PIIA 1QNLA 2NTJA 1E3LA 2LRHA 3FWHA 4XASA 1V7CA 4Q7QA 1N3IA 2QSZA 3A36A 1C8KA 3JRWA 3T52A 2IXGA 4FINA 5DMXA 3R5KA 2A0UA 2A7XA 3F9CA 1D0SA 3FJ1A 4KO3S 1CJVC 3CF6R 4DMKA 3OOWA 3GA5A 1T25A 1DNPA 1SD2A 3RFUA 1Q1BA 2ZI6A 4DBVO 2AA3A 2E0IA 3OD5A 4R8SA 2D1RA 2FFBA 3K32A 2E7ZA 1G3UA 4Y1RA 1NU6A 2X1MA 3I92A 1QE0A 3FCXA 3WG9A 1R6DA 3V4ZA 3TLXA 1RQ7A 4K8OA 4V0ME 1GTZA 1SBCA 3U40A 1KIFA 3INYA 3NC1C 4MKFA 3CU5A 3UGTA 3KELA 2HSJA 2CDRA 3L7NA 4MWBA 2AHRA 1SMKA 1QIDA 2H92A 4BLTA 3P20A 4EY3A 5THKA 2FWAA 1JEQB 2J33A 4F60A 5FT9A 2G0NA 4M6WA 3S0JA 5JZBA 2I91A 3MMSA 4OX9B 3TVTA 3KYIB 4GSLA 1KOLA 3VV3A 5BVGA 1U3GA 1PGPA 4L50A 5IVDA 1XF9A 4CEHB 1BROA 3AP3A 3WHLA 2CXXA 4PO3X 4FP9A 2PSSA 3X0DA 4QKQA 2ZCUA 1KEPA 2B4TO 3VO8A 2JIDA 3D3KA 4KDCA 4J91A 4M88A 5LP6F 2BFCA 4F92B 2O20A 5HTOA 3SSAA 3HWWA 4JP2A 4DR2B 2PZ8A 3K9QO 2AZXA 1H6CA 3U4QA 2V5AA 1TZMA 4NNOA 4RJLA 4W5HA 3NV9A 2XPCA 2DLNA 5INTA 5JO0A 4TSFA 1TIPA 1LBEA 3DDNA 3H04A 3HBJA 1E8NA 3HP4A 2JCYA 2J45A 3HPRA 3HUFA 1X1DA 1PGJA 3TQTA 3VPHA 3BIJA 1PJTA 2HUNA 4WFQA 3OTOB 4ARZA 5GJWC 3TE6A 4CKYA 3L6RA 4BO1A 2NAPA 2VDMB 2WU4A 4PICA 3QU7A 1HY3A 2C03A 4CMEC 1AV7A 3PI6A 1O6FA 2JI6A 3DJYA 5DB4A 1TYCA 1FFBA 4ITUA 3ACCA 1NATA 3GPCA 1NMYA 4K9LA 5B1YA 3D31A 2IZ5A 3B1JA 3DV0A 1XAHA 5IAOA 1WHTB 3WRWA 2ABWA 5IUJC 3V1UA 2CF5A 5FUMA 2QE6A 1RQNA 4U7TB 3WTBA 2OCAA 3K4HA 3HKBA 1Q21A 4FZ5A 5FH9A 2COEA 3UJ3X 2ZJYA 4U8HA 1ZGJA 2WJZB 1BGXT 1UEIA 3OIFA 4QUIA 2RIPA 1CY0A 1DHRA 3RSQA 3NHZA 4V24A 1XTVA 3L0SA 4QPNA 5A62A 2ODQA 4TVOA 2PT7A 1CZNA 3U62A 3AQIA 4TTAA 1SU6A 3K35A 1QRDA 2X4DA 3OM1A 4AZSA 1F5SA 4E2ZA 3P9QA 4DV3B 3PE6A 3IVRA 2BKLA 3OIDA 3H42B 5A06A 3MK31 3VJRA 4MW0A 2ZE6A 1CERA 5K0LA 4CQJA 2FVYA 5KJFA 4MPPA 5DLQC 1DXQA 5AJXA 1T3HA 4EFMA 4ES6A 1H6DA 1AC5A 1N2HA 4E6PA 3E1SA 3IT1A 2IUUA 1LBSA 1TYBE 1HNNA 3ZU5A 4ENTA 5DVZA 1M7GA 4KN5A 1H05A 4MV6A 5ESRA 5JQGA 1IJKA 2XJ4A 1L0BA 4K03A 3NOQA 1G5PA 3CSDA 1LRKA 1ADYA 3T1NA 4UBMA 1AK9A 4QGHA 4URXR 2PD3A 2J3KA 3URMA 2PR2A 4PLHA 1JA9A 1QC5A 2Y1OA 3RS4A 2YMLA 1VL6A 4KUGA 3PCRB 3S8MA 4LQCA 4BKPA 1GP2A 2Z08A 1SK8A 2ZBPA 3WB9A 4C78A 1MW8X 4F5WA 1X2BA 3HC7A 5KYVA 4B71A 4MIEA 5AR1A 1UBFA 3TGLA 1WDLA 1WMEA 4X91A 2XXAB 4MCAA 2B0CA 4GP9A 3PNSA 4MUGA 5JPIA 2HK8A 4PHHA 4QT0A 1YFZA 1AKNA 2I03A 2IY8A 2YWFA 3GUYA 1VLMA 2N0SA 3GXOA 4AN1A 4OREX 1N2CA 1DBPA 4HVCA 3B78A 3L4KA 2DERA 1PR9A 1S89A 3ZCQA 1YMUA 4ZV9A 3H5RA 1M8JA 1QIIA 1QBGA 1MTOA 3CH5A 3D3JA 3MOIA 2P67A 1JJFA 1P3DA 3DCNA 1C1YA 4DGQA 4EARA 1T1SA 3H2YA 4ZHSA 1TGYA 1ZK2A 2ILVA 2Q3JA 1S8FA 2XEXA 5DBGA 3ZNNA 3EEIA 3HUTA 2CMHA 4G97A 3RYHB 2B8JA 4KVAA 2ZI7A 3D8BA 4HDMB 3AH8A 4CV1A 2EFHB 1UKCA 1AQNA 4C7BA 2PXXA 3PTLA 3T06B 1WU7A 3TLZA 3T15A 3W8FA 3EAGA 2H31A 3EBPA 2PEZA 1ICIA 2PMKA 3NHJA 4C3ZA 4Y6GB 3PQ4A 1CPYA 3M89A 4IMIB 1YVUA 2IKSA 4CI0B 4W5RA 1TRKA 2ST1A 3BQ9A 2QQFA 3UK7A 1RAFA 1SB9A 3KR0A 4X71A 2W2KB 4YIKA 2D0PB 5A4KA 2A88A 4W9MC 3PF8A 1VJ1A 3SF8B 2VYNA 3MAGA 1X1SA 1J1UA 4L4UA 4Z0PA 3FAKA 3W2TA 3QXCA 4CIAA 1C3XA 1THGA 4JXXA 2VKQA 3E7FA 5A9SB 5LPNA 3ZEIA 2GERA 2PO5A 4I55B 1H8ED 1OX5A 4RA9A 2APJA 3NHAA 3N07A 4Z99A 1V9CA 5FAXA 1RXWA 1DWUA 2MOKA 2G9UA 3HJHA 5DW0A 3LBFA 3THOA 4FMCF 4N7JA 4BQFA 4DREA 1I6LA 1QF7A 4X93A 3ZC3A 5DASA 1I7PA 3WLJA 3MWYW 2Q49A 1V8FA 2CZQA 5AHRA 2DHEA 1M1YE 2VH1A 3A6LA 1JWBB 2ORVA 1C9NA 4UEWA 1E3WB 5EKUA 3ZBQA 2RI1A 5HCUA 5L40A 3A3PA 2QI9F 1U99A 2XMQA 2BZ1A 3BFJA 1WHSB 1K9VF 4DSZA 3HVHA 4TT3A 1FUKA 4ERNA 3O8NA 2IVZA 3MRVA 4OTZA 2GZHA 3EGDB 1B0PA 1FDTA 1NG1A 3CF4G 2EKBA 2O3TA 2NU6B 2C8LA 3ILHA 3LY8A 5A9SA 5BN3A 4U7DA 1YBAA 1ORTA 7REQA 3A05A 1ZIPA 2KX7A 3WV5A 1G2OA 3TTSA 1QTRA 3L7KA 4DY4A 2C97A 1K66A 3T1TA 2YL2A 5ETJA 2Z30A 1NOIA 2DFTA 3KJNA 3HA3A 1YQUA 2AYXA 4FYPA 1G21E 2D59A 4CEJB 1Q7GA 2XYQA 4EHKA 4LBWA 1QB7A 721PA 3ZGXA 4JZKA 3RHFA 2BI7A 4U3JA 5CCDA 1SCKA 3S7ZA 3VR2A 1O4VA 2OCLA 3OKCA 3ESAA 1E5QA 5F1OA 3QTLA 3REQA 2CLHB 3W34A 4DWOA 5I7FA 5LDHA 1Y6GA 1TVMA 4QEDA 1WY5A 4UXHA 5JD6A 3AQ4A 4OJTA 4P53A 5KI6A 1Q83A 4KU4A 5B6PA 3ETGA 1QWOA 4G2TA 4TQAA 4TS3A 5BYKA 5KC9A 5M5BA 5IT9A 2HMSA 2BCEA 1JECA 4LJ9A 5IYZB 3BTUA 2PYZA 4LX8A 4Y1RB 2QPOA 4C1BA 2BL4A 1BCRB 4FLEA 4FFLA 2JHFA 4GC5A 4R5HA 1HDXA 5ERXA 3TWOA 4UCQA 2IBSA 2GTPA 5DV9A 1DXYA 1QYDA 2AZMA 2OB1A 4AAYA 4N3CA 4AXXA 1MQSA 3KQNA 2B7CA 1J8VA 3CN9A 1SKBA 5IHXA 1AD2A 1WLSA 5EE5B 3U9SA 4FFRA 4PLPA 5HYVA 1Z6PA 1ZNWA 1A7UA 2NLOA 2ZTUA 3QOWA 2D3TA 5CLJA 4LOLA 4KQFA 3WB0A 3WLSA 5G0UA 3AY6A 1EVIA 2Q45A 3AVVA 3VNUA 5J59A 1GNLA 4INJA 2J9XB 1I4DD 1G0OA 1FU4A 1JV2B 5FOTA 1T9GS 1FZQA 1X1AA 2R8BA 3LF1A 1PK7A 3TXYA 5IABA 3O92A 3KU1A 4ALNA 4U63A 1XYGA 3GLGA 2PS3A 4GYWA 2G07A 3EWIA 3ZH9B 2OKGA 3AVQA 3NUGA 2QVGA 1EK0A 5DK4A 2VH2A 4FMBB 5FB3A 2R4TA 3DZIA 3MB5A 1L7XA 1ENYA 4LZAA 3WP0A 4F04A 4K9SA 4K9QA 3LNTA 1Y7TA 2BEJA 2VT6A 3A4TA 2F2TA 3M1IA 3S6JA 1TZJA 1L8OA 2BEKA 4F4UA 3CVWA 3O7WA 5B5SA 1E2PA 4EJSB 2ZUFA 3T12A 1R7RA 4K28A 2PZLA 4KVZA 4Z0TA 4DLLA 2JGLA 3QVLA 5AOCA 5HKKA 5FBZA 2C04A 5EIOA 3R77A 5CTJA 4O0LA 4EHJA 2CFIA 4DA4A 4LCJA 4L5BA 1T5OA 2FMIA 1C0KA 5ECWA 4YMVA 1L7EA 1RQXA 1AA6A 1OH6A 3BK7A 1T15A 1G60A 4E5PA 1SOWA 2IYEA 4DYVA 2WTEA 3GIDA 3K1TA 2QX8A 3BH6A 4N5DA 1RC1A 4LW8A 3A7DA 5HKKD 3O3MB 3TPZA 1GTVA 4P82A 3VH3A 2ADMA 3EPLA 4BNGA 2J3IA 4Q12A 4RIHA 4BO8A 4IGAA 4M8NE 2JHPA 5D6NA 2Q41A 3BM5A 2B1RA 1M1XB 3V55A 1MO5A 2CL0X 4PV7A 2GNAA 5CX1B 4Z1OA 1DJLA 3Q3HA 1H9CA 3CNEA 1AGNA 3QLVC 4J8PA 2E4AA 4E32A 1OH7A 2FEPA 4BP1A 1XTSA 1W96A 2Q1SA 4XIIA 1FFGA 4C04A 2PAAA 3IP1A 5LFAA 1KVSA 4G65A 4X9XA 2RFLA 4EA7A 2F55A 2ATXA 1HYHA 1GZSA 2EOAA 3FRIA 3WGZA 4DBLE 3WGUA 3K20A 4IX9A 4QJ4A 4U2DA 4X8OA 2C61A 1IPEA 3QX8A 1V11A 2DWPA 5F5LA 1FXWF 1YAHA 4MGKR 4QFCA 3SMQA 4IIDA 3WNZA 5ED4A 2BGNA 4ND7A 1HYGA 3TRJA 2HZ7A 1W4LA 3HN6A 1N5IA 3IQGX 3KLPX 1NQ5A 1YAJA 1N0HA 2SCUB 2OHVA 5HGJA 3HN7A 3WLAA 1QH9A 1XQVA 4XGRA 1EXDA 2BD0A 1A9SA 1CQJA 2NNLD 2XE4A 1U2GA 2YS6A 2JJ2D 1R8JA 1FU8A 3ICVA 4GEKA 4MR7B 4DNPA 4LYHA 3GN2A 4WECA 4EVQA 2ZRDA 3NYRA 1VZ2A 3AEQA 3EGIA 3R3UA 4CM9D 4QTYA 3QPUA 4MW2A 2PH5A 2VUTA 1Z88A 3KT6A 4ZTBA 4BMOB 1VCOA 3R3YA 3ZIUA 5FI3A 5H8WA 2O1XA 3RQIA 1RTKA 3BE8A 2C31A 4ZCPA 1L2TA 3GGPA 4RFSB 3AEQB 3BFPA 3KOXA 2I1WA 2EW8A 3REQB 4PYQA 2D5CA 3SC3A 2QPLA 5AFSA 5JCZA 2H2GA 2JHCA 2B82A 3I6IA 2POCA 4UMEA 3KKNA 1CB7A 1EBBA 1UMCB 2QN7A 3OZFA 3WMWA 1OLUA 2YN0A 3AB8A 4EZIA 3QJGA 1E6KA 5FLEX 3RTGA 5EJEA 3EOAI 3RS8A 3STHA 4ZO7A 5DMHA 4US0R 2ZVPX 4PHFA 2P68A 1AKWA 1XPUA 1KRWA 4OXKA 1KI6A 3HXTA 1CF2O 2GA9A 4LXHA 4NYJQ 1QMGA 4QYMA 4RVDA 1B14A 3HI4A 3QTTA 5HDQA 3V1LA 4FFSA 2C99A 1NR7A 1HYQA 3H2JA 4C0JA 3EODA 3V7NA 2WPDA 3QELA 5DDIP 3K6SA 2OBFA 3BICA 2WHPA 1DIRA 1CUEA 1NHGA 3FJOA 5JO9A 1QYCA 3KZXA 4HD8A 3SYKA 1GLVA 3UWDA 4II7A 3LKVA 3RVLA 4QU8A 3IR7A 4LJAA 3FKJA 3LUGA 4RY2A 4MQFA 5J43A 1GZHB 1MENA 3BSFA 1H66A 4NCIA 1V7PC 4E4YA 3O9VA 1DO0A 4ENPA 1WXXA 2OXCA 3CKKA 4D3ZA 4V3BA 1D1QA 2HF8A 1SBTA 3UWKA 4W5QA 1V48A 1KS9A 2XB4A 4QDOA 1NA5A 1X7XB 3WFZA 1BVHA 4HYTA 4FK8A 1KO1A 3TW8A 2V7VA 4GI2A 5DTMA 4JI0B 1YZNA 4R3WA 1HNWB 1RCFA 3OJ0A 2QB5A 3U49A 1O1YA 4JC0A 2E4VA 4WACA 5A5GA 1CX9B 3ZE6A 5AKEA 5IZCA 2O2SA 3JD2A 3FTCA 4C05A 1GL9B 1O9HA 2AB0A 3M70A 2HLDA 2BFEB 2WYVA 5F35A 3RJ5A 2C94A 4UEJA 5ICSA 5M2QA 4CHTA 1VE1A 4LY0A 3ZDQA 3ZE9A 3SWWA 3DDCA 4YONB 4DLPA 2WFLB 3IHWA 3ZU4A 3E8XA 1QGED 4OLBA 1MB2A 2BHLA 2BMFA 2FEXA 5G1NA 1FDWA 4AECA 5JSZB 2BSXA 2YZ2A 3IC5A 2F3RA 3AHCA 5E8JA 4FYXA 4ZXPA 4CVNA 4BJ1A 4JLKA 1ORRA 1FB5A 4WXHA 2O8FB 3PDHA 3NKLA 2ZRNA 1SCQA 2Q1XA 5CR9A 1DWQA 2A9FA 1G59A 4G9GA 1KNXA 4K26A 3OIGA 4OMCA 3KQTA 4Z86A 4F12A 2DAPA 3DEJA 3ZNPA 4D99A 4Z49A 1P73A 4YCSA 1Y98A 2GNOA 2HMVA 2VAVA 2VQSA 4HK4A 3V8MA 1P1HA 5AVUA 2GPBA 4L75A 4Y6PA 2DUUA 4RESA 5L3QA 2AW3A 3O8RA 4EA6A 4KWIA 2I6XA 1Y8RA 2Q27A 4PLWA 3OMXA 2B78A 2O2HA 2ZJ4A 3M5DA 1X86B 4KDRA 2Y1CA 3CZCA 5A7GA 3PNKA 1I7SB 3VU9B 4WZBA 4KO4S 3DLPX 5BORA 3B82A 1LCIA 3BQMB 1TLTA 1IMOA 1NP6A 2EJWA 1SZJG 2VNAA 2DWQA 3FXAA 4Y9DA 2PX8A 1F2VA 3KS9A 4RD4A 5GADl 3H18A 3GJZA 2QRHA 3NASA 1XMQB 5CLGA 1FP6A 4MDYA 2V6MA 1AB5A 2IXDA 2P3QA 1RSZA 3FPFA 2D2EA 3HWRA 4JOSA 4X1KB 5DGHA 4DM7A 3FUWA 3X43A 1QR2A 4D79A 3A2KA 1RACA 4YCMA 4UHBA 2GPAA 2GESA 1ST3A 2JCXA 3LC2O 5IN4A 3PHHA 3LRTA 2YXNA 1N7HA 4KR7A 3GFSA 5FQNA 1JSXA 1HUQA 3NIWA 3D3QA 3QA3E 1T36B 4GX2A 4JLNA 3SMVA 2VATA 1QOPB 3S27A 1W75A 3ROGA 3H3JA 2RGNC 3QUCA 3GL9A 5K1ZA 5BN4A 4DANA 2QYHA 1G4HA 1RAIA 3MT9A 2IIVA 4X61A 4B3IA 3QVUA 4MX8A 4CLXA 5JAUA 2OAGA 4Y98A 2XRYA 5AVWA 1ESZA 5JVDA 4M1MA 3ROKA 4PPNA 2PM8A 3HA2A 2G1JA 2IHVA 4OATA 3TD9A 1LW7A 3HVUA 3RAPR 5HUQA 2OOKA 4IQ0A 1Y7IA 4IJ6A 4MI6A 5CNJA 4CIDA 5FUVA 4I3HA 3F4BA 4S1TA 5CFQA 4LYGA 1OW3B 1MIOB 4BJ3A 4MS1A 4ZVSA 3CEAA 4GR9A 4BP9A 3U0VA 1SXJB 5D5HA 4MKHA 4OFZA 3H86A 1DKUA 3HJUA 4PC6A 3QF7A 1G5IA 4MCJA 4CMIA 3SBXA 3GJ3A 5I8PA 2IDJA 3W8RA 2D1TA 2EW1A 2RONA 3AMVA 2ODEA 3KB8A 1Z6YA 4UBOA 3EXEA 3BOSA 3MGAA 1WVGA 5A71A 3HDJA 4DPLA 4ALIA 4KQHA 1J24A 1KY3A 1HDEA 1WMFA 2M98A 2VPPA 3O1IC 3QFSA 4KFTA 1I6KA 1M2GA 4NK4A 4JYPA 3TF5A 3HDTA 3P71T 5ABPA 1OREA 3VPGA 4RJ2A 4JJAA 1GM5A 4BV8A 4OA8A 4TS9A 2WT4A 5DHRA 5KZMB 1LDBA 3QX7A 1MXFA 1G7SA 4KFSA 1VL5A 4ENRA 4HH0A 3RADC 4FNGA 5JFTA 1W52X 3CLVA 1Z0UA 3E4DA 3PEUA 3AVXA 4KR0A 3H17A 3VA7A 3BSYA 4F1WA 3JQAA 3N2LA 1FVHA 1W5EA 4DXHA 4IMRA 4Z7JA 1XRMA 1QS0A 2I7DA 3AC0A 1A04A 4KQIA 4U5QA 3USES 1G42A 1YZUA 3UJ6A 1JDBC 1RHJA 3TIIA 3UT5B 3ESCA 2EJTA 4KQWA 4ZO6A 4V0MA 4DIFA 2PA0A 4YNBA 5GJVC 4WNCA 4DYDA 3HKEA 2IYFA 4LVUA 1Z2PX 3IR6A 4JENA 4M8IA 4EHNA 4TT3D 3SIRA 1HORA 5SY9A 5AJUA 1YO6A 1Z17A 2CLKB 2OWEA 4BJ5A 3C8UA 3GJ5A 3WDSA 4QNNA 5HJEA 1M7BA 5ES4B 4N41A 1BFUA 3G2PA 2BPOA 3NVDA 5AHWA 3RSGA 1O03A 3ZVMA 1UP7A 1ISMA 3B9BA 3L92A 3VU3A 4BECA 2XA1A 3M5CA 1SUWA 3N28A 2B92A 1JEQA 3IUMA 1TX4B 2E82A 1GADO 1JDVA 2EP5A 2B4YA 5A7FA 2FK8A 1ZBQA 3ZVLA 2BFPA 1MX9A 2J3QA 1KSGA 2HBRA 4F2GA 4N5NA 3PYMA 1M67A 1ENOA 2JI7A 2PU7A 2REQA 2Y77A 3SJZA 4R5MA 3SJAA 3PX2A 1CEQA 4YGYA 3DEHA 1SM4A 1PR4A 3KTFA 3NH6A 5JDCA 3R9XA 5JASA 1NONA 3T7IA 2JH3A 2CGEA 5HK9A 4F5YA 3K30A 3ME5A 4BNJA 3G59A 1YFKA 2QMEA 3R2JA 1R6XA 3WKAA 3D54D 2VHCA 3ZU6A 3R0QA 2XZOA 2X5JO 1X7WA 2HPAA 3IP7A 4ZZ1A 1QO0D 3LL4A 3UK2A 1LFDB 2VZ8A 1WXHA 1Y33E 1C4OA 1T5IA 1PNOA 4GKVA 2FZKA 2Y2VA 2VH5R 4NE7A 4WNAB 1TM4E 4D96A 1KQOA 4MW7A 1AT1A 1EVYA 3K09C 1EFPA 5HZKA 5JH7F 1MAVA 2Q07A 4N47A 2RSLA 2QP4A 3C6YA 4G5HA 4XUGB 2P40A 3W2FA 1N2EA 2I4NA 2REBA 3QUSA 3JYOA 3UB3A 1CR1A 3EVCA 4C30A 2CJWB 2FB9A 3LXMA 4PS0A 2ZQ5A 1SC9A 3BRQA 3UXHA 3R0ZA 4MYUA 3VFDA 5EHGA 1E9EA 5IJWA 4DT1B 2G08A 4Z54A 1YNSA 2NYAA 3ZCVA 5E6RA 2F4VB 1NJ6A 3Q5DA 1IN6A 1DBVO 2C88A 4TTTS 4IRXA 1AZWA 4IXMA 2NP7A 3KOOA 1P1CA 4CEIB 1YH3A 3INGA 2C9BA 3PYLA 3GDWA 3FF4A 1K9SA 1DQSA 1NVVR 3P97A 3U3ZA 3WI7A 2IC5A 2G1AA 4M1TA 1E96A 2GYVA 1M6YA 5FFFA 1XVLA 4RE5A 3W5CA 2HYDA 1JIJA 2C4TA 3KG2A 2PD6A 4FEAA 3PUVA 3T7CA 2REQB 2VSNA 3MAJA 5C80A 3BSSA 3VMMA 1ECCA 3U7FB 1F8XA 2OM6A 1ZOIA 4HQNA 2CWWA 2CKMA 3LUHA 1A82A 4TKVB 4ZT7A 3WB2A 4DQLA 1WX1A 1R0ZA 2ZT5A 2ZAYA 1T8YA 1WVIA 3TOCA 4KE7A 3V6MA 4Q00A 3BS4A 3IH5A 3L9WA 3DOUA 4J6EA 2GN9A 4U6SA 1B74A 5DNAA 3ABIA 2CLOB 2YCBA 3MVEA 4P1ZA 5FOQA 2W6OA 3H13A 4ER6A 3DO6A 4RENA 4PNPA 5AYVA 4MPTA 2VCYA 3OQOA 1Q6YA 2H0QA 3GAZA 1N34B 1YTUA 8LDHA 3W5JA 1BOFA 1SQ6A 2BFNA 4NZOA 2I67A 1WZNA 1U8AA 2DPYA 4IO1A 4IXNA 4XH9B 1YQDA 4BNHA 1JEYA 4K0RA 1U6JA 2XD9A 2C54A 1BQ3A 3GARA 1L7QA 1ZWLA 1DOHA 1XIVA 2GTIA 5H59A 1K97A 5JNTA 3AIMA 1NBAA 3DMYA 2I6QA 3HU1A 2XUKA 4UMVA 3IVCA 4M0DA 3TSOA 2FFHA 2OSBA 1V6AA 4DLBA 4L16A 1P74A 3Q9UA 1U4SA 3PC7A 3CR7A 5UKDA 1Z13A 1UP6A 4NBKA 5M34A 4Q4JB 3OFNA 5BV7A 5LSAA 2BGWA 4BRZA 1FJ2A 4G8BA 1LSOA 1P4JA 3CKLA 5JXGA 2XCIA 5KVQA 5CLQA 3Q2KA 4EG4A 3PA6A 3IEVA 1MB4A 2GZ3A 1G17A 3OOYA 4QO8A 1W9HA 3K73O 2ZDHA 1XRLA 3FCCA 3TOZA 1YF3A 4GXQA 3PFNA 1H2AS 2GN0A 1FBTA 4U9UA 1J49A 2IPLA 5BPFA 1P0FA 3PIRA 3RW9A 3LP8A 2FPGB 5H68A 4X90A 1XN1A 4ROTA 1UXOA 2WUGA 2F7SA 1LZLA 3QYAA 2GEKA 1S6YA 2WR8A 4LBYA 4LNUA 4XFJA 4BXOB 2CZCA 4JY7A 2JANA 1JTVA 3C15C 3UEOA 5DBHX 4I6JA 3TD6A 3JQQA 3TIFA 4IDNA 3L7JA 5A02A 1Z0JA 3CS3A 1FS5A 1Z47A 4WH0A 1T9HA 3H16A 4TVSA 5FLXA 3Q98A 2X0RA 4OSPA 4RPHA 4E3WA 3E5MA 5ED0A 3HJGA 2KPOA 4CN8A 4PGGA 1C7QA 3OQNA 1TK3A 4RHEA 1YNOA 3ORHA 5CTAA 1ODIA 2XVAA 3UK1A 1N1DA 2RIRA 2QN2A 2HNKA 4PO1A 3UT5A 5TIIA 3QVTA 1D2AA 1O94A 4YWJA 1AIPA 3AFOA 4ZT6A 1Y1SA 5GTDA 4R01A 1VG1A 4QPZA 3SS9X 2HWKA 3CIOA 2E2WA 3GGDA 3M4YA 4RCYA 1V45E 3IR5A 2BHRA 2ZTSA 2GCGA 1JSCA 3C2QA 1S96A 1RQRA 1XDGA 2OY0A 3AY3A 3O7MA 4E5DA 2QSYA 1F2DA 5TX7A 1GPLA 3N0XA 4OGWA 2AX3A 4HB2A 2EAUA 4C08A 4RXTA 1D8TA 3AUSA 2ECKA 1IAVA 2O8CB 1E2NA 3NFYA 3DOIA 3IRUA 3H5NA 3HYRA 3WZ2A 3GQBA 4RK5A 4NICA 4DLAA 1GAQA 2NVUA 4L02A 4AL4A 4DTIA 3OJEA 4M9UA 1KI2A 1PJQA 2W58A 1TD1A 5LUBA 4DAEA 4UUBA 2Y99A 4Q19A 2OD7A 2XGMA 4KACA 3AB3A 5EZYB 4D9FA 4Z4CA 1E0JA 1AQJA 4P33A 2QU8A 4ZOEA 1LBIA 1XTBA 4TL6A 3VUEA 3WXBA 4E5NA 4Y2VA 5I4KA 4Q9DA 4EYGA 2XWSA 4L4RA 1CR2A 1NGSA 1U2RA 3I42A 3ZWDA 2IVFA 4IF6A 2YWRA 3Q3VA 4HSGA 1KTVA 3M5WA 3AKZA 4RQBA 1E1DA 1PSDA 4NMMA 5FEUA 3UMMA 2EC5A 1AQUA 4PC3A 3E22A 4IDPA 4EP1A 3H4MA 1YR7A 3WSVA 2ENWA 4CLOB 1J1ZA 2PIAA 1DQYA 1Z73A 4JLSA 3W3AH 4TYNA 1HR0B 1KHHA 4TRJA 3F6CA 5A6SB 5G0SA 1O0BA 2HGZA 1HEYA 4HNQA 1W88B 4O33A 3WBFA 5CIYA 1HFKA 1LPMA 1Q19A 5DHPA 4F91B 5C46F 2YWHA 4TV9A 1FNSA 4YX9A 1GQ2A 5J4LA 5KIAA 4OJQA 1G55A 5EJ2A 1BDIA 1J2YA 3GPDG 3KJXA 1C0EA 4P22A 2DTDA 3KR1A 1IQUA 3A4IA 3P2MA 2XDQA 1FDIA 2VBCA 4GMDA 1E9BA 2LZ0A 4O5OA 5G1PA 3RVJA 3BAFA 1LQ2A 2BBTA 1IBKB 4P0TA 1N3LA 2H18A 2OC9A 3DMNA 2YHIB 2D6FA 2SNIE 3PQ5A 2QD2A 2CFSA 5FOSA 1CRLA 5HUHA 4GKBA 3H2KA 1PFQA 3WMEA 4C4AA 2DMRA 2ZSKA 3W79A 2W6QA 4TT8A 4ZU1X 3RKRA 1USVA 5JCXA 1VE6A 1N8TA 3ZCPA 4EDFA 3VMFA 1LRLA 5FI5A 3ERCA 3FUUA 2IDMA 4AMVA 3TS1A 2XQFA 5F52A 4C87A 5KJ1A 1SVIA 1SU4A 1NPDA 3BIXA 2Q9CA 2W6PA 2V6IA 3Q5EA 1E2FA 4JI3B 4DJTA 1Z62A 4XZ3A 1H5QA 1TKBA 5I9LA 1P1FA 2QRLA 4MUMA 4MV0A 4CN9A 2YJ5A 4FOSA 1RAGA 4MUBA 4DG5A 5AXDA 4EY8A 4CIVA 5B3AA 3Q6MA 5HM6A 2BR4A 1ZUNB 1BE1A 2EFDB 3ELUA 2YH2A 5ALIA 1ZGZA 2WFZA 3SVZA 4G0WA 1DEHA 4O2LA 5KSYA 1BJKA 1BO6A 2VQ3A 4EG0A 3I6QA 2YOHA 2CXHA 4MA0A 4LFCB 4WW0A 1A8QA 3PNOA 5A3VA 2HT6A 2ODWA 4JNKA 1PRYA 3D3NA 5FJJA 3F8SA 4PX9A 1D03A 2QLTA 4FOTA 4QHTA 3L6OO 4RK4A 2FSGA 4CZ2A 1X13A 2FFJA 2OT3B 1JX6A 2W6JD 2WU1A 3OJCA 1KYXA 1Z29A 4LRQA 4D9JA 1LC3A 2IXTA 1OXUA 2W4MA 2XODA 2QLLA 4GH5A 3VNAA 2MYUA 2X58A 3WWCA 1MLDA 2MR6A 3KJZA 5BOSA 2G5PA 3WL3A 3MCZA 3WY9A 4E15A 1U0TA 2UZ1B 4F72A 4FI3C 2HHAA 4BLRA 2PO7A 4WK2B 4WXRA 3PQ3A 1ISSA 3UBMA 5EIEA 4OLJA 1JG3A 2GI4A 2HLPA 2JGEA 3DUFA 3LAWA 4TKLA 4PYMA 4RMHA 4UHJA 1X7XA 3DWFA 4TYMA 5JJLA 5K99A 2WJWA 4NPCA 4V3CA 1RP1A 3ILXA 3OZRA 3ZYCA 2CZGA 2H5LA 4RQAA 4RPJA 3Q3GE 4ND8B 3SZGA 5IDWA 4FXOA 3Q7EA 4MROA 3BXFA 2Y67A 1LU9A 3QLUA 2G1KA 5CEEA 4HMQA 4RDIA 1E7RA 1NJGA 4C5CA 1WZ2A 4UCWA 3HBFA 4W7SA 2GF2A 2FW0A 1Q7CA 2PA3A 5BSTA 4EKYA 2ACEA 3BQNB 4OAOA 3V1NA 1P7WA 1KRHA 1T8UA 1TW3A 3Q88A 2O5CA 3HXPA 2P77A 1JJVA 2ORIA 5LC1A 4FEYA 3FYCA 1AGRA 3RG8A 4R98A 3PX3A 3PHGA 1ZVJA 3F49S 4LXUA 3MWEB 4FX2A 4QLOA 3SZLA 4QHYA 1Y8QB 1D4FA 3BWBA 5CVJA 2NO7A 2FH5B 3STUA 1WNFA 3EVGA 4ZI3A 3O0TA 1MD9A 7MHTA 2VUSA 5DGCA 4LZWA 3UJ8A 4ZEVA 1PR0A 3ZDZB 3JXEA 2O2JA 3BXEA 4JQCA 3L8MA 4LK2A 1RXIA 2NXWA 5E6SA 5IH3A 2BKAA 1QV7A 3BD9A 2C2WA 1JSZA 3PFCA 4JLUA 3VDRA 2XVXA 4H7DA 1KO4A 2ECPA 3KQSA 2W93A 1PX2A 4OLFA 3A31A 4PPFA 1S1MA 2Y76A 3HB7A 1N7GA 1SFRA 1QTIA 1U2DA 1UC4B 4BWYA 4YMUA 1TU0A 1TCAA 4NJMB 5HRAA 5F7JA 2ODPA 3ZGOA 5JJ5A 3PNQA 1N1EA 4L2IA 5DEOA 3NHYA 3UJDA 2PZFA 3IUBA 3QQPA 5AKJA 1MVLA 1N4AA 3B2QA 4U4AA 4YAJA 2J5XA 2XA2A 3OZWA 4IEFB 4CODB 2NO5A 4U3JB 4Q0MA 4H31A 1C1XA 1OFUX 1CSEE 2FKNA 4MVJG 1T4BA 2J31A 4BB5A 1UZLA 1J2JA 3CPHA 1DAPA 2JAOA 2QZJA 3A6DA 3DE6X 3GAAA 4KI0A 4NCJA 1QYXA 2GZRA 2C83A 1SB8A 1YJ5A 4O4JB 3OBIA 1BAPA 3R7NA 2BGMA 4CCWA 1UIMA 4PN7A 3U1VA 4V1CB 2Y1FA 4K9KA 4YB8A 3FJYA 4IWNA 5DM2A 3KSRA 1Q0SA 2W42A 3EY9A 3LUCA 4BMVA 2JATA 1XRQA 3TOXA 1I2CA 2P9ZA 4QD3A 3ETEA 3NBAA 3SXJA 3TLAA 3NOXA 4GNKA 5T3YA 2XUFA 1GA1A 3VR3D 4DLRA 4F5EA 3O38A 1J07A 4HZIA 4X62B 2OGZA 1E62A 1NR5A 3RVBA 3TQRA 5H5JA 2OFFA 4MWGA 2H07A 3MBOA 1S9DA 4KMMA 1L7NA 4MV3A 3ILVA 5C5IA 4O02B 1EK2A 4MJ3A 4X8HA 4BAUA 4BN0A 3I5UA 4OQLA 4F93B 2YHIA 3KXIA 3HCOA 3MQ4A 4TXJA 5FO1A 3VHLB 4ER7A 4QIHA 2QTGA 3K9CA 2ORWA 2C95A 4JJKA 4CM8B 3KT0A 1XZJA 4KG7A 3BB4A 3TAHA 1V7ZA 3ANNA 4LKOA 4B3HA 5BUCA 5EJ5A 1AKTA 1P5HA 2HYIC 3NNNA 3G1TA 4XUEA 1EHYA 5T41A 1KK3A 2SICE 3NONA 1TF2A 1C4WA 2F9LA 1EFLA 2PX0A 4HKTA 3I6ZA 5EXXA 1TUEA 2QRJA 5C3MA 3U80A 3MHTA 1AN0A 3UT6A 6GPBA 4NULA 1F4VA 2P78A 3ZBTA 5EWMB 1UDXA 2JLRA 1Q50A 3UH0A 5KYYB 4AY2A 1TKAA 3GFRA 3TSWA 1B8UA 4QWWA 5CDUA 5IWAB 2VDLB 3FE2A 1CEYA 3H9CA 3O2JA 4O4HB 3OQIB 5K3OA 2EYUA 1BMFA 1ZUD1 3OQJA 3ZGLA 1X77A 4BBJA 5FPPA 3DHYA 2ZTLA 4LWQA 4NX2A 2G7MC 1E1RD 2CNKA 2IH4A 3BXHA 3H0CA 1XQ9A 3JWHA 1SC6A 1MNQA 2EFYA 1OI3A 2PVPA 3CYFA 3GR6A 1ZNZA 3KKEA 5FBHA 3OKFA 1U8XX 2GAJA 4IL5A 3F6RA 4U8GA 4YA6A 1EG2A 2MSLA 2XYPA 3NI2A 1IUNA 2CLEB 5EI5A 4C1NA 3ON5A 2GDJA 4JQSA 4IIJA 5FIUA 4BPRA 4ALKA 4ARUA 3ADCA 4E07A 2XADA 2PV7A 3JS5A 3O8CA 3LOUA 1GN8A 3HV0A 3QPDA 4GX5A 2H1CA 5EKDA 3ZI4A 5L8VA 1ZI8A 5LNK1 2QBYB 2NZ8A 4G0UA 1JDNA 2B4QA 2A4KA 2VXCA 3TI9A 2IS4A 1SBHA 1UC9A 1U5AA 4GBGA 4KSCA 1G19A 2FLVA 1QIMA 1NLUA 4W5JA 1DAKA 4MQ5A 3VR6D 1BQEA 4DIEA 1J0CA 5C8YB 2WWXA 1XTUA 3QMVA 3HHPA 1XQYA 1WMBA 1SBIA 3A4NA 2P2NA 2RCNA 1P18A 3CF0A 5LU9A 1KNQA 1C7FA 1QHGA 4I0WB 1E94E 5E3HA 4EB6B 4P93A 2R60A 1IG3A 1X38A 4D46A 3ONWA 4ZV7A 1NNI1 3F71A 3KZNA 1FY2A 2AOWA 2YQZA 1VECA 2YXDA 4G5RA 3W3ZB 1EPUA 3QU5A 4UUOA 4BZQA 4F97A 3HVIA 2YCLA 2IS6A 5K2MA 1LPNA 3FPEA 2WFAA 3I5YA 1ZD1A 3EVDA 5CA0A 4LVOA 2D1SA 2QF7A 4G5FA 2VDPB 4K9PA 2HQSA 5A0FA 1HFWA 2QD3A 3OX1A 4QM7A 2CJFA 1JFSA 2R6GA 2PKCA 3CX6A 3GT0A 4OQDA 3WLPA 3GFGA 1K68A 3EA4A 5SZHB 2DCUA 2RAPA 2VCHA 3FHCB 4JLWA 2A78A 4AQYB 1A69A 3MIIA 4D6XA 4XRGA 5ELLA 4CV3A 4HAZA 2IRWA 2XCRB 3GEGA 4PXYA 2QJTA 3E2PA 4OMDA 1UKYA 4J3JA 1V3UA 1TCUA 1WY7A 2X6QA 4R2HA 3HI6A 4M60A 3TNDA 5IFKA 3LI2A 3V4LA 1SC3A 2PN1A 1JR3A 2VNHA 4FE3A 1SK9A 3DZJA 3O2NA 4NENA 4MEBA 1WHTA 4E09A 3BMCA 3I30X 4EJ0A 4E94A 3L4JA 3E9MA 1CLEA 6REQA 1W29A 2P9JA 5EJGA 4R71A 3RD5A 3IT3A 1RFGE 4OHZA 1N2CE 5DTJA 4DJ5X 3AJ9A 1MRZA 1WD5A 2C57A 3HCBA 1NQXA 3IAXA 4WK6A 3ROFA 4EENA 4M76B 2HSDA 1WXIA 1K06A 1OZ0A 3ODGA 2R6DA 1F8FA 1W0KD 3L8HA 3M6XA 3PWTA 2QZZA 1U2PA 4V0LA 5FQOA 2ODBA 4GPAA 2WZQA 4YWHA 1HETA 4NQRA 1U0HC 3SHOA 4W5TA 2QVBA 3FR7A 1GPYA 3DF7A 1OLSA 3QTBA 4RTPA 4WJKB 4KQEA 5H16A 3S99A 1ZM3A 4AYWA 2RGGA 2FQ1A 3A10A 4QGFA 4N76A 3BORA 4A36A 3T7JA 1ULSA 4EUFA 4R7TA 3IKVA 1C8LA 3I64A 3GRYA 3PUJA 1DTEA 3ETHA 2Q4DA 5JXIA 2HA4A 1H1DA 4IYJA 2QUHA 1PW7A 3EULA 1VKRA 3A2LA 2JBAA 3L7DA 2CHVA 4HS9A 4JD5A 4BVGA 5BVGB 5I48A 2IH2A 4FILA 3UYKA 3H5TA 3C5WP 4JU8A 3VZQA 3QNUA 4FGUA 4KXUA 4B9AA 2JPDA 1XZMA 1GFIA 1HMPA 5KTYA 1F7VA 2R9VA 2NZWA 3IBCA 4H7KA 2V4UA 1YB2A 2X6RA 1WMAA 4BKQA 4ZP1A 2FTKE 3B8HA 1BXGA 4Q37A 4LXXA 4CT4B 4J7XA 3UKJA 1YZ3A 1LD3A 4AKSA 1I8TA 4JBHA 4PEVA 4X8LA 1U0JA 2J9ZB 3DL0A 1MPXA 4REQB 3VSBA 1UK9A 4KBGA 1GD1O 2O5VA 2P2GA 2VHTA 3INNA 1SPBS 1KBZA 5AO9A 3DG9A 4UAVA 1DC5A 1LDYA 2O0MA 3HDYA 3KVNA 4ILKA 2A9VA 4HN9A 1JI0A 1SBNE 3DMRA 1EVZA 3KKOA 3P7MA 4R51A 3LA6A 3UMSA 4QUDA 1PEDA 2AJCA 3W3AD 5K6TA 3ROMA 1GTL1 4CF6A 2PRYA 4G9BA 4HAWA 3U3XA 1VYVA 3PR1A 4C76A 2CD7A 5IZ4A 1Z5OA 5L95A 4JYCA 4K88A 3CF4A 4Y2SA 1HT1E 3IURA 1L4NA 2MIIA 2WD7B 4DB4A 2WU3A 1WW3A 3QU4A 3EGWA 4RGQA 2P6MA 1LV8A 3F7TA 4HN2A 3OAAD 4KYIB 5FTJA 3U4HA 3G2HA 3W3AA 1EFAA 2FP3A 1FDSA 3JW8A 4WTOA 1P2SA 2O7SA 2ZU0C 1BXKA 3D6HA 3OCWA 5CLHA 4WKOA 4YT5A 4JYZA 1GV1A 2QAJA 3CRNA 1N6NA 2MSWA 3CB4A 5JRDS 2PXAA 2W2MA 3JALB 2VDRB 3H6GA 5DT9A 5FI1B 4F06A 1U7DA 4ZK6A 2GD0A 4W9RA 2YRFA 5BWBA 3DKIA 4G86A 2VDVE 1ACMA 1C7EA 2M6SA 3PFIA 2HJWA 5BQOA 1L4KA 3VPAA 3P0HA 2IWHA 1D0IA 2NSYA 4QBKA 2O2EA 4YN3A 4B1FA 1UM9B 1ECJA 2GPTA 2EG9A 4IH1A 4KAFA 3PWZA 2B36A 3BMNB 3WLFA 4HAUA 4WNYA 5ALFA 4PR0A 3B9RA 3MMZA 2BHTA 4XUDA 4C4OA 3FDIA 3ROTA 2VP0A 3N2IA 4TMKA 1H1LB 2NUAB 2DWUA 5JYDA 3K09A 5CW2A 2O8NA 1SRQA 4HB3A 4K9DA 4CXMA 4MV7A 5D7BA 3AZOA 2IYPA 2D7JA 2WFMA 3HLYA 3V8QA 1RQPA 1B42A 1SG6A 2QGNA 4BB9A 1T2CA 4D56A 3QYJA 3AF2A 1RR6A 1G2IA 4YPVA 1MG5A 3WK4A 3RC8A 1GTJ1 4YRFA 1FLNA 1RHKA 3OM9A 2P9QA 3SQLA 4E5YA 5JZOA 1SA0A 4KHPB 4PQYA 4HMPA 2F64A 3A1WA 4B83A 4F7WA 5K0ZA 3HWSA 1FS4A 4MJXA 1X80A 4BNIA 3AJDA 1XHEA 4CG2A 4Q4JA 2PYDA 3TNFA 4BGDA 1Y4SA 2RHBA 4PANA 2R96A 3UO8B 1AGPA 1YZQA 4U2KA 3ZU2A 5A9RA 2ZWAA 4XDHA 1HZJA 2P9TA 4CCYA 1NDQA 2BM1A 2BEVA 1V96A 4PSCA 2CWDA 5CVDA 3W77A 4Y9SA 4B33A 1M7HA 4H77A 1TMGE 4J2OA 1Z5ZA 4EQ6A 1VE5A 1M2HA 3PWSA 1Q74A 2CJXA 1GY8A 4UHEA 1DAFA 1HL7A 3PJEA 2VI5A 1YCFA 1ZM4A 1MHPA 2ZAIA 3BJZA 1XYVA 3GRKA 5C7YA 4YACA 1TJ3A 3WNVA 5LJLA 1COZA 4IHQA 1Y0BA 1E3JA 2EZ9A 3FPBA 4DV4B 5CCBA 4BFLA 5EJ4A 1ZMTA 3ABSB 3CQ9A 1KY2A 3GMIA 3IILA 4I2NA 3AJ8A 5E6UA 2V65A 3B13B 5DKFA 1XD9A 4TYQA 3WLNA 4Z4QA 4NL4H 2GOYA 3L6EA 3KUXA 1QRAA 2ZAGA 2ACWA 1JUDA 2PXCA 2QA5A 3HEAA 2R00A 2QU7A 3GU3A 1IG0A 3NHPA 4W99A 4AULA 1S5PA 2CMFA 2PMCA 2XGOA 4N9QA 4CL2A 4LE2A 2JA1A 2ZRMA 1T0JB 2CXOA 3AYZB 5BYBA 3QXSA 3TEFA 1NWCA 3LBAA 5TV2A 4X6YA 3BHNA 4N0DA 2XLCA 3MBIA 2B4RO 4GF5A 4AO8A 4YUWA 3O3NB 4NJEB 3VR2D 5HRUA 1AZLA 3EFHA 4F3KA 1O6ZA 4QC2A 2O1EA 1E6UA 1KJIA 4J3NA 4I7EA 4M8KA 3RASA 5ALRA 3D4BA 4HLQB 1QDLB 3WBBA 1PR1A 2OORC 1J2UA 2C42A 3VNSA 3OZXA 4FR0A 4ENUA 3ZDRA 3H2ZA 1JMKC 3LIPA 4J4HA 4R4JA 5JRJA 1CP3A 4UU1A 5LQMA 3OF3A 3FCOA 1I0ZA 1JL3A 1P1IA 2L0XA 1HLPA 1XA3A 4CNBA 4DT1A 4HTFB 3TGWA 4ZFNA 3V48A 3E2MA 1CP2A 2GN1A 4NQZA 2FN3A 3CTMA 2HBYA 5EIBD 4Z7OB 2JFGA 1QF9A 2C2XA 3K9LA 3OU6A 4BO0A 4R2XA 4U9HS 3VXKA 5I4IA 1G38A 1Z2DA 3JR7A 2AG0A 4D57A 4N0EA 1JR3E 1NZDA 3NFRA 3VOAA 4BKOA 1IH8A 3CR8A 4G5YA 1XCGB 3VVMA 2VNKA 3ZX5A 1EFPB 2GFIA 3AY0A 5DLDA 3VU0A 2DPHA 3EXHC 2ET6A 5KTOA 4KIWA 1IRIA 3OU2A 5ESXA 4B6QA 2F1JA 2QL6A 2Y0CA 1TQDA 4DA7A 1C81A 1JPVA 1N6RA 4RTLA 1AKUA 1X3SA 2Z5FA 4FEEA 4QPCA 1TTQB 4RLFA 2UUBB 2WZDA 2QL7A 3N6VA 2C20A 1XF1A 3O94A 3BF7A 1Z39A 3CR3C 1W5FA 4G63A 3DO8A 2O0HA 2H2IA 2DT5A 4TKZA 3TQCA 2CW5A 4UBJA 4COKA 1OI4A 2YV2A 5AKHA 2C7BA 2NSHA 1C50A 4NV0A 4YMSA 3V1YA 4QJBA 1MX1A 3DAGA 4XDGA 2CMDA 1XUOA 4H1WA 3A9RA 1GQRA 3DBLA 4GI5A 5FI0B 1T2AA 1M2VB 1NF2A 1KYIA 2WP8J 3OZUA 5ELXA 1WPQA 3VR5D 1GSIA 3PF9A 2TECE 3F3YA 4PAOA 2E85A 4JLOA 3USZA 4OFXA 1ZL2A 3IODA 4R9NA 4Y2PA 3WDKA 4DYHA 3TKLA 3QV1A 4BQQA 4Y3UA 1DBIA 1LPAB 1DFGA 3WK8A 2ZWPA 1Z7GA 1ZVQA 5DXJA 3HVRA 2P9GA 3N2KA 2RI6A 4HVLA 5LXTB 1F1BA 3OZEA 3Q12A 5AVYA 1QHSA 1SQ5A 4NNPA 3SDBA 1CUIA 3N58A 2Z95A 1DRVA 2WNSA 5HZHA 3RYIA 4ENVA 3GRCA 5MN4A 4MWSA 3NH9A 2C2ZA 2QNIA 3AR5A 3QYPA 2FLWA 3ZOZA 5TQVA 2GVDC 3HCCA 4BQRA 4KQCA 4XWYA 3DWEX 1GJRA 3E53A 4PO9A 2WKQA 5IAEA 3A32A 2EIHA 2EJBA 3JWGA 5FUYA 5HOQA 1O7JA 2B7LA 2AOVA 2QM8A 2Y66A 4RPKA 2H7VA 3DLIA 3QW2A 4JUIA 2HO5A 1XCPA 2Z9BA 4LJ6A 4AY3A 4NF2A 4TL8A 5KWIA 3EFEA 3CT6A 1DV1A 4C4SA 4F71A 1EWRA 3WBJA 1EP1B 4AMUA 5A1TA 3ZQ4A 3H8VA 2ETVA 3JQ7B 2A5DA 3BD8A 2BC9A 2V98A 4ER0A 3VAZA 3LLVA 1OHHA 3I58A 4KXYA 2QS9A 1UOPA 4TV9F 4GBJA 3FB1A 2XBLA 3TRDA 4YHHB 3K9GA 2G9RA 3QELB 3BIOA 2VDUE 4YRTA 1WM1A 3SS8A 3Q2OA 1FDVA 1THTA 1RJWA 1YJQA 4ZCTA 3B36A 2C7VA 5DBEX 4A73A 3GD7A 3GMTA 3LZDA 2CUKA 5FWXA 5LQCA 4IHJA 1ELOA 3MTGA 4IDQA 1OLXB 2HFJA 1OR8A 2I3GA 2JFZA 4OXQA 4D4IA 1P2DA 1LPOA 5ALJA 5C51B 3DM9B 4XSHA 5BP7A 2V7QD 3B12A 3E15A 4JBGA 3FZGA 5M29A 2C0PA 4IVQA 1QVZA 4ZOAA 3AFMA 2P3OA 4XB6B 1RABA 1N5JA 4JHLA 4YROA 3OLXA 4OUDA 1OZFA 4TTRA 3U48A 3GLIB 5CAEA 4ZVTA 4YJ3B 2CYCA 2R86A 2D4AA 1RDFA 1PFWA 4B79A 1M74A 3FGZA 4RZSA 4IR7A 5JU6A 3TTUA 2WF9A 3SHVA 3L0ZA 1I13A 1JU3A 3JVUA 2JLQA 1QVAA 5DI9A 3V1MA 4ZCRA 2PJUA 1CHDA 4HZUB 3K92A 3TJZA 3DFZA 2UYQA 1L5QA 4NABA 1CHNA 1G8JA 5J63A 1LLUA 4RD6A 2PRKA 2I1QA 3R7WA 1XQXA 1XXHB 3KHTA 1RCTE 1GUAA 1DTWA 3NP9A 3R3XA 3L6DA 4HN4B 5HW0A 3LOQA 1WV0A 3JAKA 2VAPA 4MRPA 1GZ6A 1W1UA 3U16A 1DFIA 3WLQA 5JAZA 5B58T 5E6UB 5FPTA 1H2FA 2WSYB 2JLSA 4I8DA 3DC7A 4H3KB 3FPCA 1E5VA 2J48A 3NG1A 3PUIA 4RVOA 1YZVA 4X5OA 4BU0A 1FW6A 2XOXA 4FQ7A 5F3DA 4M86A 3MOSA 4YAUA 4QYWA 1XYYA 4S3MA 3BK2A 5IAGA 3I9NA 3OEWA 3OIVA 4C20A 3DAOA 2YRXA 3IV7A 3T3IA 1V1RB 1MGOA 4G26A 2V1UA 1B41A 4TWIA 2X1VA 1OI2A 1U90A 2YFHA 2ZR9A 2FDXA 1B0UA 4QL3A 4QUHA 1UBUS 3FHLA 1G6HA 4N6OA 5BXQC 1BD4A 4M89A 2BH2A 1DJPA 2CC2A 2GXQA 2BMWA 3LT5A 2VP5A 5E9AA 3TW6A 1BQ4A 2DE0X 1P75A 4PR3A 2ZYWX 1JW9B 3ZZ1A 2VTKA 3QOXA 3PC2A 2CBZA 3AFHA 3O4GA 2P2DA 1SZDA 4C6TB 4AP6A 1NRJB 4MP8A 1TK2A 621PA 1BNCA 1HKHA 3HS3A 3TZEA 4EG7A 1BEZA 1KK0A 1TCBA 3SVLA 5IXYA 5IF9A 5KDLA 5LXTA 2OV6A 1QYRA 4TV8B 1C9EA 2X8AA 4GU5A 2Z2ZA 3STWA 1LWOA 2Y1WA 3I12A 3RTCA 5LCXA 1QANA 3DE0X 4CGZA 3BX1A 3ETNA 4U02A 2Z8XA 2H4ZA 1ZONA 3W4IA 1JHOA 2AFIA 3CUSA 4GQAA 5CFRA 4Q4HA 3FSEA 1KDZA 4DQDA 1UR5A 1N92A 1TYZA 2MU1A 1CV2A 2UKDA 3ILSA 3O4RA 4CIXA 5JCJD 1Z34A 1E63A 1NBMA 1OXSC 2WVAA 4TMZA 3BDIA 5U9CA 2WM8A 1MNAA 3GW8A 3HU5A 3C4JA 4OGFA 5HF6A 1P19A 1SCUA 3BWDD 1HDRA 3RB8A 4NCKA 2NP6A 1QLWA 5HFJA 1QAQA 3GJ6A 2UYOA 1F06A 3N70A 3Q1KA 4ZALA 2HT1A 2P5YA 4NFLA 4IICA 1F3OA 2VP3A 5A4IS 4LWZA 4HQ0A 4IPTA 1OIVA 1JLHA 3AUXA 5JCOA 2IEBA 2GYUA 1O6GA 4OMFG 3MS2A 4C07A 3LYHA 4RETA 1CCWA 5EIWA 5ALVA 2FJ0A 1II9A 3NB0A 4LPKA 5AVKA 2ODNA 5BW4A 1GNSA 4KXNA 4PLVA 4B45A 3IJ5A 4UBIA 2CCKA 1D5WA 4CQMA 1OBCA 2C4HA 4ZOLB 3MQFA 2AD1A 3MJ4A 2WUDA 1JDPA 3P9CA 4KO1S 4BVAA 4R7GA 4F2WA 5K09A 4V1CA 4ZD6A 1GEGA 1H2ZA 3O74A 4AWAA 2ZM5A 1IWOA 2NTVA 3M6UA 3EASA 4XJVA 1IN5A 1DBSA 4DARA 1ZR4A 1RWQA 3D64A 4H4EA 2EBHX 1HNXB 1NI5A 3CW8X 2AG8A 3HQ4O 2IIPA 2FI1A 4RM3A 3UAOA 1R9JA 3KSUA 1XZDA 3PVSA 3D6FA 4OHUA 5T4HA 4UVDA 1WL8A 1VGVA 4BL5A 1U7WA 4PPQA 4DFDA 4GVPA 4CIBA 4DRZA 3MUOA 2GBCA 4LDAA 1XWIA 2MWMA 2J8ZA 4W6ZA 1TM7E 4OKNA 3SJBA 3ZDEA 2PHZA 4PRYA 2PT6A 1ZN2A 1NVXQ 4RIGA 1Z0KA 1I9GA 4JLBA 3TTYA 4AJJA 4B76A 2CCGA 2C7QA 4JASB 1ULAA 3WOHA 3RU7A 2L82A 5HJ2A 1PYOA 2WTXA 2B34A 2BH9A 4PAMA 5IDYA 4MGYR 1ZSYA 3WLTA 5FTLA 2VWPA 4DLSA 5CFOA 2Q0QA 2V74B 3AF1A 1K7XB 3K5IA 3OLYA 4LDQA 3RSOA 3T1QA 4KIJA 5DT2A 1E0SA 1E2MA 4KWHA 4OHFA 1YJAA 3LQFA 4QGSA 2R48A 1JQBA 2WA2A 3V2HA 2JS7A 4H1VA 1TVKA 1YHYA 2VT2A 3VI3B 2ZYAA 3JSXA 3QEMA 3KU4A 1FMLA 3CRW1 1UPXA 1KETA 2VWGA 1G8PA 1Q1GA 2W00A 1IEXA 3D7NA 3OG9A 4PYRA 4ZQBA 2Q7DA 5DBOA 4N5LA 4MB6A 4C4YA 1DIHA 3Q0IA 4BMYA 1SUFA 4OQXA 3B1YA 3PD7A 3F46A 1VL0A 3SKVA 3CRRA 1J5XA 3GBPA 1U5BA 5JDIC 4ENQA 2VQFB 1PJSA 2PFGA 4MIKA 2B69A 1PK8A 1RJEA 3UKDA 2IY7A 2Y4OA 2AQ8A 1YMVA 3PLRA 2OFOA 3G6KA 4H4DA 1L5NA 2Y2UA 3IE1A 1Z16A 2IUYA 2J5RA 3M8KA 4ILEA 4DKJA 5JWHA 1IY0A 1EP3B 1OFUA 1TU4A 3DE4X 1PEAA 1SUDA 3LCMA 3EZFA 3QWAA 3AERA 2UZ3A 3NC4A 4RYDA 4CKCB 3PNLA 2YKGA 1EFUA 3PR3A 1G2QA 4U1RA 1UPTA 2ATIA 3MWKA 3IVGA 4F7DA 3D7RA 4RSRA 1GO2A 4POOA 2VC2B 3RAFC 4WQMA 2QMHA 1EQUA 1W4AA 3B1ZA 1MX5A 1LX7A 1Y4UA 1J2TA 1TECE 2J67A 2PGJA 3E61A 3PUKA 5EIAA 2WSMA 3EIEA 4ZOQI 2HIHA 4UAUA 1O96A 2YYZA 3DFKA 4BO9A 2CE2X 5J5AA 3S28A 2GX6A 3VDNB 2GJAA 3ICWA 5KS2A 4EZBA 7GPBA 1CJBA 3OP4A 3GT7A 1HE8B 1E1NA 1UPUA 2CXPA 4FHZA 4FZRA 4GW3A 4IKEA 3PSHA 4MICA 1O0SA 5P8WA 1AQYA 1OC2A 3EJWA 4A5OA 1T8PA 3AUJB 1USKA 4YCCA 4HYYA 1DMSA 1IQ0A 1NBMD 5B55A 2JFBA 2CK3A 2HA5A 5AK0A 4EG1A 4MO2A 3KEQA 5B7GA 2OECA 1LV7A 3ZXSA 4ZJPA 3F5FA 2YWJA 2H1RA 4ESHA 3LW7A 2FFAA 2X3YA 3ASUA 4MKRA 4TKUA 3U17A 2PWBA 3KDSE 5G0VA 4P84A 1N5KA 4ZRNA 1YSCA 2HSWA 2TMDA 1Z08A 1CTQA 1KYTA 4KR3A 3OWOA 9LDTA 1SXHA 1UBSB 3MCVA 3GUVA 5JQGB 4LVNA 3SQXA 4B3GA 4S1VA 4YRMA 1YZHA 2R1ZA 4L9AA 1S2LA 2ZS9A 1IE3A 3ZE8A 1XAJA 1ZP6A 3G5LA 3H6KA 1RC0A 3R74A 2Z57A 4KYVA 4EGFA 2OZLA 5CCEA 2ERXA 3CZRA 4HQKA 1IPHA 5G4KB 4KR9A 3K5HA 3PTAA 2GN8A 1P17A 2HK9A 4M1QA 5DP2A 4HDKA 2PS1A 1D9ZA 1QP4A 4F9GA 2H06A 1C29B 2QTCA 1BGVA 1Q1EA 4CUJA 5ARBA 3IMKA 3NTLA 4Y6OA 3MN1A 1M8PA 1ODSA 1UKEA 5LZ8A 3TZ6A 1VDMA 3EJ6A 4GL2A 4YYEA 1L4HA 4CV2A 4FWIB 1YWGO 4LMBA 2HNBA 3WZLA 1DIOB 5LUAA 1SKYE 1SH7A 4UVGA 3L1UA 4LBVA 3O1HB 4IWXA 4EY5A 2XDQB 4FZVA 2OZLB 1WPXA 2EWWA 3HXLA 3PQCA 4KZKA 1EFDN 3FVRA 3N2GB 2G40A 1J0EA 4LCBA 1Y4AE 3OX2A 5ALXA 1Y3CE 1MOZA 3FOCA 1OI7A 3GRVA 4IRUB 5CMLA 3PQEA 5IULC 4QODA 2Q4BA 2QRVB 3ZVKA 4XQ9A 4ZMSA 3UGJA 2VDQB 1BXGB 5HUJA 1W0CA 2GQ0A 4XM0A 3KVOA 3HFSA 4OIMA 3F4KA 2A84A 3QW4B 1DJMA 5BYJA 4LSWA 2P27A 5EIBC 1VBNA 1DQZA 2BFBB 3RRFA 3RUDA 1XFAA 4MRVA 1KKMA 5CCXA 2O1SA 5EXPA 2NYRA 4YR7A 3IDOA 10MHA 1Z83A 5DX0A 5DYYA 2ESRA 3NS7A 4S35A 5DOVA 2HMAA 3VSEA 4XIGS 1UDCA 2XBUA 5G2OA 1PUIA 2XB8A 1A72A 3AIIA 4GDMA 1H2YA 4N9WA 1KO7A 1QE3A 4P5EA 4XR9A 2F8TA 2VEDA 2PLAA 3R6DA 3NRJA 4TL7A 4ZRMA 3MERA 1OXVA 3REGA 3BE5A 1XX6A 1W8IA 3ONDA 1CJSA 1P0MA 3MWJA 3MTEA 4QASA 2NU6A 3GNTA 1DLJA 4QJIA 1NVGA 2GM3A 2HMWA 4YCJA 5AW6A 1DS6A 3K0BA 1QPZA 1U9JA 3UENA 4EY7A 3UYLA 1AM4D 1ADJA 3HR7A 3IJEB 4OB8A 4OIFA 1JR2A 1HT2E 1MCZA 1ZIOA 3HBMA 3L8YA 4KUHA 1X1BA 4TQ9A 4AWXA 1GNRA 1IXSB 1E0AA 2CHEA 4ARZB 1LC0A 1R0RE 3PIDA 4HDKB 3HL4A 4AG3A 5IAJA 1KQGA 2LCIA 4OCZA 2CSUA 4EFDA 3EIOA 2VPIA 1TVEA 4X95A 3GVPA 3AM3A 1NBWB 2P69A 3ZLUA 4PC1A 1JDZA 1H0RA 4EDHA 1E7WA 2I54A 2IX9A 2P79A 3EEQA 2CLLB 6REQB 1WIWA 4YRQA 2QTWB 3JQEA 1B7GO 2WHPB 2PIDA 2NVWA 3G8CA 1U7PA 4J29A 1OKKA 3K0AB 3S2ZA 1QGZA 2A59A 1JILA 4IUCS 4UU8A 4Q4CA 5LQAA 3LXXA 4W8HA 3RNOA 4K8RB 1MTZA 1OWPA 3L82B 5K3DA 5T6MA 4A0SA 5CFPA 5ADWA 4PQFA 5HIKA 2WJJA 3QEMB 2DZDA 2X2EA 3V00A 3DMGA 3G85A 4UULA 5AK4A 4Z2AA 4FS8A 2VXBA 2WE7A 3A2NA 2AR0A 1NVVQ 1HMYA 4B84A 5C5EA 1S8NA 1YKGA 1EB8A 4QOEA 4ZZ2A 1UAYA 4NY1A 5TVKA 2O7NA 2Q1YA 3RVDA 1WBBA 2ZZNA 1ZJJA 3CCBA 1FVOA 1ND5A 2B9EA 4HDMA 2EP8A 3ESDA 3VOTA 1D2MA 3DBHB 4BNXA 4B3SB 3FPJA 3D5QA 1EEXB 1ZAKA 1HNZB 1DO2A 4EY4A 4AJOA 1EFHA 2WHQA 4FMPA 2IPMA 4RA6B 1LK0A 2GEUA 2AZTA 2HLHA 3KE9A 3Q1LA 4GBED 2RGWA 3ZCUA 4HX2A 4EYQA 5A4FS 4U6QA 4WCFA 4I4TB 4FYYA 4TMTA 2JJ1A 3LYUA 4WWHA 4KQ9A 1NMSA 1S7GA 2BEWB 3AZPA 3INRA 1LKZA 2HC9A 2AOUA 3GLSA 1EJ2A 1JXMA 4IO0A 3N0TA 4IX1A 2FQYA 2PMEA 3I0NA 5KO2A 2GHIA 3M9WA 1KIMA 3OFVA 4ZYYA 1QZ3A 2RHGB 1QIGA 3W5DA 4UU7A 2V6GA 5E1BA 1IBRA 3MS7A 4ZC8A 3D8UA 3U4AA 2COKA 2B5VA 3M1AA 2OV8A 4AKEA 1JHDA 3MMPA 1KDYA 1WXGA 2BF7A 1UK7A 4YRZA 2H7YA 3H9GA 1A9TA 3IERA 3L01A 4Q4LA 1T9CA 4WVFA 2C2MA 3O6VA 3UG6A 2RGYA 2HRZA 2UYYA 3QXJA 2GYWA 3AI7A 1EGVB 1G1AA 5AKKA 5KNCH 1GN9A 4DG9A 1D1SA 1G5HA 3B51X 3EY4A 3JQ8A 2QXUA 4LHWA 4KQ1A 1NW8A 4R3UC 3B6ZA 2VT3A 5JYCA 1ODJA 1LRJA 1BD3A 4TYPA 1AMNA 1MQAA 3HRKA 4LXGA 4PGAA 5TMEA 1E1KA 4YCLA 3FYHA 4EA9A 3COZA 3R6LA 5D87A 4UNSA 4ZAFA 5DH9A 4YP9A 3VYUB 3JSAA 1RBMA 1T4CA 4O4HA 2WLTA 5GINE 3UANA 3BKXA 4K3VA 1N2GA 1W85B 3ZHBA 1XEFA 3AHIA 1X8LA 4LHZA 5FUXA 4LOHA 1VA4A 2H00A 3TM5A 1TF7A 2VJAA 3ULKA 4E51A 1J21A 1CEEA 1GZ7A 4J1NA 5E2AA 4TSKA 2FLKA 5EESA 5K3EA 4MS3B 2AN5A 4A92A 3RC1A 1PV4A 1BYIA 1KFKB 3DYVA 3IPRA 1K3UB 2CDAA 3DHWC 5KSPA 5FUWA 1XRNA 5DM60 1QLJA 1ZLXA 2B6NA 2YY5A 5JBNA 3A3OA 4EHAA 3IMEA 5CYGA 2KB0A 1TYDE 3B3AA 2QMUA 3GWZA 3NWJA 4J0KA 2J59A 4HNUA 2AT1A 1B8OA 5AOAA 2VTBA 1QOZA 4ZYWA 5E4FA 1LFAA 3F7MA 1LX6A 2AR9A 4LJ8A 4C4ZA 5DYIA 1TLFA 2KE5A 3C5CA 3O2SB 1J00A 2BMJA 4M1OA 4HPJB 2X9GA 3BERA 3EVTA 2IH5A 1FFAA 5MHTA 2A0YA 3LWNA 3EDOA 5E95A 4XJXA 1W19A 3TD2A 4O2BB 2YV1A 5KAPA 3SQOA 4G3XA 4RK0A 1MR3F 1V4BA 1E9DA 1U04A 4PGHA 4A26A 2XSZA 1JHRA 4B3BA 2PBZA 1FUYB 2DPLA 4URZR 3DXFA 2WYIA 2R65A 2X9VA 3G2QA 3WYBA 4F4DA 5I9SA 3Q7RA 1IVYA 3SN6A 5J3JA 3ONVA 3G1WA 2UXCB 5ALGA 2HJVA 2B20A 4E12A 3BF8A 3IQEA 1TMYA 1A9XA 2EF1A 4DDWA 3ANYB 4FFNA 1U3FA 4GYJA 4F4IA 3HDVA 2CXUA 4KE8A 4EJ6A 5DRTA 4L74A 1SN7A 4FFWA 4YJ3F 5CA1F 1GAXA 1PI3A 1WP9A 5EZ6B 4D0GA 5KOHA 2O8BB 2D2XA 2W2LA 1SGWA 4AY6A 5E1MA 3VQTA 4OU4A 2GZDA 5AD1A 2NTEA 1YC2A 1UJ5A 2O3UA 1ETHA 2IOYA 5CGZA 2P4HX 1E1CA 2VR1A 4J76A 3AUTA 4P54A 3B7WA 2XCOA 4MVJA 3IUEA 1Z5GA 1LLFA 2OO7A 2Z56A 4X24A 5CDYA 1YOVB 1JPJA 4REOA 1OXBB 2E5LB 5DLEA 3M1YA 1E2LA 1C2YA 3ECSA 5ERGB 3WIOA 3E8MA 3FMOB 3UWMA 2AQKA 2CYBA 1T8SA 2LWIA 2OCYC 2X7JA 8AT1A 2OMEA 4M0UA 3LS2A 5D85A 5F7ZA 5FLKA 3THYB 1DDOA 1TD9A 3D5EA 3I23A 1STOA 3KKMA 1M75A 5E7MA 2NV2B 3V8PA 1N9KA 3GJRA 3PGJA 1M2NA 5CX4A 5FA6A 5LLSA 3WADA 2PUFA 3TKAA 1C8VB 3TRHA 4BCCA 2F1KA 4LXIA 2ZJ2A 5EUCA 5FEMA 2CVPA 3DDWA 3NBXX 2HOQA 1Y5RA 1L7DA 4GOOD 4C88A 1JDUA 3WMFA 1U94A 1KAEA 3OUZA 5AJHA 2EGGA 2OFXA 4BV9A 1K6MA 4F4FA 2DUMA 3UTDA 5T6BA 5TF0A 2CFTA 1YK1A 2NVUB 5A5EA 5E0OA 1RMYA 4A8JB 5HPYB 3IJPA 3FOZA 2IZ0A 3UAGA 2W2NA 2WDZA 5T64A 1PT7A 1RLMA 3DEYX 3IS3A 3DLBA 2VOJA 3D1VA 1PJZA 4HWPA 1RQGA 3VKVA 1CUVA 1E3TA 4WCDA 3E8SA 3LV8A 1I4TD 5FJIA 5ADHA 1E7YA 4XPZA 3HFJA 5C4IA 4LRXA 1Y6RA 2G17A 1XXHA 4BB0A 4AX4A 2O2XA 3Q6IA 4ESOA 3LLCA 3LOPA 4E70A 4OB7A 5EINA 2CHUA 5GZ1A 3ZDFA 2WJYA 5KOYA 3SJ7A 1NJ1A 4GOJA 1XCLA 2FN9A 4WXMA 3UAZA 3X44A 1WSWA 2DX7A 4Q9AA 5K0CA 2PBRA 4QUEA 4KAAA 4WPGA 3M9XA 2PZGA 4Y6SA 2YMMA 3GT4A 4RGYA 5KQGA 5B57C 5J4VA 1I3OA 3I8SA 2XYRA 1DJNA 3RBZA 2VF2A