4LSZA

Caspase-7 in complex with darpin d7.18
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
b'YQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-7 subunit p20
molecule tags Hydrolase
source organism Homo sapiens
publication title Combined inhibition of caspase 3 and caspase 7 by two highly selective DARPins slows down cellular demise.
pubmed doi rcsb
total genus 51
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lszA00
2DKOA 4JR2A 3SIPA 5JFTA 1RHMA 4JQYA 1BMQA 2Y1LA 3V4LA 4NBLA 4ZVTA 3GJTA 3H0EA 2CNNA 2HBYA 3D6MA 1RWVA 4D3YA 2HBRA 4HQRA 2QLBA 3ITNA 4PRZA 3DEIA 4QU0A 5I9TA 4D3XA 2HBZA 1ICEA 4QULA 4JJEA 4QUGA 5H0IA 1RHJA 4ZVOA 1CP3A 4JR0A 4ZVRA 1SHLA 2CNKA 2H5IA 1GFWA 4PS1A 2HBQA 1SC4A 4ZVUA 3KJFA 2QLJA 4NBKA 3UO8B 1IBCA 3NS7A 5K20A 1GQFA 3GJRA 4N5DA 1I3OA 1RHQA 4N7MA 2H4WA 1I51A 2H51A 3DEHA 5IAEA 4DCJA 2CJYA 3V4OA 2XYPA 4EHFA 3H11A 1CVRA 2K7ZA 4IYRA 2C2OA 4ZVQA 1QTNA 3V3KA 5IANA 2H4YA 1RWOA 3V6LA 2QL7A 3D6FA 5LUBA 4PRYA 2CJXA 2QLFA 4NOKA 1RWWA 4ZVSA 4QUEA 1RE1A 5LU8A 1F1JA 2H54A 1K86A 1F9EA 4ZVPA 1RWNA 3UOAB 3S8EA 4EHAA 1QX3A 5IC6A 1RHKA 2J30A 4JJ7A 2J33A 3DEKA 3IBFA 3KJQA 1NMQA 3R5KA 2QL9A 1RHRA 3OD5A 3R6LA 5IARA 4EHNA 3DEJA 1RWPA 2H5JA 2XZTA 2J31A 2NN3C 1I4OA 1NMEA 3K7EA 2FUNB 4FDLA 4FXOA 3R7SA 2QL5A 3V6MA 3P45A 4NOMA 4JR1A 3RJMA 5LU9A 1NW9B 1RWMA 4HQ0A 5IAGA 3PCXA 4FGUA 1PYOA 4QU8A 3H13A 4N6GA 4HVAA 4N6NA 2J32A 1RWKA 2XYHA 3PD1A 4EJFA 4QUDA 3BIJA 5IABA 3PD0A 5IAJA 3NKFA 3R5JA 3SIRA 4EHDA 4QUHA 5IASA 4NOLA 1QDUA 2C1EA 3KJNA 1K88A 1KMCA 2AR9A 3R7NA 4DCOA 3V55A 4QTYA 2Y0BA 3H11B 4D3ZA 4JB8A 2XYGA 4IEFB 2FP3A 3E4CA 4N6OA 4NBNA 4QTXA 4JQZA 4NOJA 1JXQA 4EHHA 3NR2A 3IBCA 4M9RA 3S70A 4N7JA 1PAUA 5IBRA 2C2KA 4DCPA 3P4UA 2C2MA 1NMSA 2H65A 5I9BA 5IC4A 3EDQA 2CNOA 1I4EB 1SC3A 1RHUA 2XZDA 5IBCA 4I1PA 4QUIA 4QU5A 5IAKA 3H1PA 2CDRA 4QUBA 4QU9A 3R6GA 3QNWA 1M72A 4LSZA 2FQQA 4AW9A 4EHKA 2P2CA 4AWAA 4AWBA 1RWXA 4JJ8A 2CNLA 4EHLA 1SHJA 4FEAA 5LUAA 3GJSA 5IBPA 3EDRA 3R7BA 2WDPA 4QUAA 3D6HA 4PS0A 3GJQA 1SC1A 4QUJA 2C2ZA 4I1RA 2H48A
chains in the Genus database with same CATH superfamily
2F43A 5LQKA 1TQ4A 2WQZA 2HJVA 3IKTA 2A1IA 2BR3A 2IOQA 2YQ4A 1U1DA 2O50A 4RE5A 2A1UB 5CYPA 5ESRA 5ITWA 4L0DA 5BSGA 1O95C 1GN9A 1AKWA 1ULTA 2YXNA 4MW5A 3RABA 4CT0A 5CEJA 1J7JA 4FYWA 1ULSA 1PS8A 2P6NA 3F7MA 2AG8A 2HJ9A 4KVFA 3UJDA 2GBIA 1WZIA 4F4JA 1CNMA 3KJGA 3T3EA 3W1VA 4OFBA 1Y8QB 3N59A 2R96A 4OMCA 1S3GA 4IHQA 2KMLA 2FDCA 2FUEA 5DHRA 3EPHA 1RLOA 2CF6A 2FRDA 3TDNA 2DWCA 3I64A 1DAIA 3P2OA 4EATA 1SUFA 1IXRC 3PPYA 3J81A 1PP4A 2Z98A 2PRSA 3E22B 3RVPA 3UT5B 3PX3A 2YRFA 4U2DA 2UU9B 2JIZA 4JSTA 2IF0A 1LQTA 2WINI 1OAAA 3EFOA 3QXJA 3ICVA 4M0LA 2EVWX 2ZT6A 2C1ZA 1IBSA 3L82B 621PA 2PPLA 1QCZA 3ZGXA 4BRWA 5FWNA 5C52B 1WSAA 1VG8A 3WC4A 1GY8A 2IZ1A 2VDWA 5IKEA 3ZEIA 1SCAA 1E98A 2DR0A 1NHGA 5KSWB 1BVUA 1C29B 1WMAA 1YE5A 2I4IA 3HDYA 4DUGD 2HQRA 3QITA 5LLDA 3EGXB 4QOGA 4WZ6A 3RV4A 3E7XA 1FTNA 4RPLA 4C9BA 5HJEA 3WAGA 4JXKA 2ZQYA 4XYLA 4RVNA 1VBFA 4J1QA 1PTKA 4PEVA 4CW7A 4EO7A 4CDGA 2TMKA 1QGDA 3UXEA 1NZDA 3UQYS 3BHIA 2NZ8A 1UT5A 1YUNA 7REQA 3NBQA 3RNOA 1CF4A 2E5LB 4RJIA 1H8EA 1WMSA 5AOAA 5C3MA 5EXSA 3GN1A 4BB5A 1PR9A 2X6RA 4XIJA 5B64A 3A0UA 3NEJA 4Q6WA 3HO8A 2F48A 2AC4A 1PFUA 2ID7A 1Z17A 5G4KB 2DFKB 1JLLA 4ZC1A 4FFNA 1PS9A 1RJWA 3UXYA 3KT0A 2UUOA 3BMQB 1SXJE 1L5MA 1Z0IA 5CFRA 1MAHA 3R7FA 1JXAA 2WSMA 5ALTA 1JZTA 1PQWA 1V6AA 5BMOA 1XD2A 4KGVA 4R8RA 1B3RA 3VZQA 1OB5A 1Z0SA 1MR3F 1R0WA 4G09A 1SIUA 1PK8A 3BTOA 4EF6A 5CEFA 3U4IA 4C2AA 2EQ5A 1SD2A 4A0SA 5JH7B 4AO8A 3Q9SA 1CQIB 1GGNA 3V1LA 2WD7B 4UEQA 4JASB 2I6XA 2PZ8A 4IR7A 1FRNA 3FPCA 4A82A 3H86A 2I2CA 1X9IA 2NZVG 3D7MA 1NG9A 3INYA 3BE6A 1X15A 3ES9A 1A9RA 3ORRA 2IYNA 3H5RA 5CM2Z 4BV9A 2AFHA 3OI7A 1X8XA 3PHBE 5FHQA 1K5PA 3U2QA 4BAUA 3M6FA 4E5MA 2HMTA 1K97A 2ZOSA 3C8UA 2HNAA 2VXBA 3I0MA 1JSLA 2G4LA 1E8DA 2AV6A 1IOWA 2FG7C 2G8LA 3J80A 1TAQA 3V33A 1ESNA 5I7FA 1BROA 4HRAA 3ZXSA 1L8LA 3A1DA 3M2TA 4W5JA 4YRMA 2V3CC 1A76A 5AVZA 3C4JA 3EQZA 2XUAA 3NBXX 1XZIA 2X1MA 5A5DA 4XZ3A 4HB0A 5LMUB 3CS3A 4F3TA 3GJ5A 4PLVA 2EBFX 1GZ5A 1CKEA 1JKMA 4TL7A 3KYDB 2NZWA 2OQ2A 5DLQC 4YA6A 1U1GA 2D2XA 5E8JA 5TDHA 4IXTA 2I22A 4JGBA 2VTKA 2H7CA 4FJ1A 3INTA 3VJMA 4CG2A 3F90A 3TUJC 3JQ6A 4GVPA 4CM6A 3LF2A 3W8FA 1MTZA 3EA0A 5JIBA 2G63A 2OGWA 2AFIA 3G9TA 3I52A 2JFBA 3B3QA 4R4JA 2FHPA 1Y4DE 4O1IA 3RUHA 2BR5A 3RC3A 2Z43A 4HLCA 4CM8A 4PHHA 4HLDA 1XTZA 3ZNOA 4RIIA 1QFZA 3ZVNA 1TL7C 3EF3A 1W0JD 3QBTA 2QG9A 4FVTA 4N5HX 4ETNA 5KNLA 1NBEA 2HF2A 2WFLA 1DZ3A 3W90A 4D9KA 5DSZA 2WOJA 4DA0A 1WRBA 4ERNA 3U26A 3WA6A 3WNBA 3LPAA 3LX8A 4BVHA 1F1JA 3NGMA 3ZW8A 4ZI2A 2ALJA 2BKXA 3E1KA 1US8B 5ARDA 3UHJA 5FEUA 2CV2A 2RGDA 3ZDEA 4D0GA 1QYDA 3BZUA 3OD5A 4N3NA 3G1TA 3EIUA 2OAQ1 3HKEA 1MX3A 3BXFA 3ZGOA 2ZT7A 1TM4E 4C0BA 1LVUA 3EVTA 2H5JA 4ALLA 1JEAA 2R85A 3HBMA 2YFKA 3ZU5A 5JWOA 1E3DA 1E7MA 3GJ4A 2PANA 4Y9TA 2JNWA 4L8YA 5DM60 3OLCX 3LNTA 4DJDC 1MVLA 1FYDA 3RWBA 2FUCA 1D7AA 3SKXA 3WGOA 1BMTA 1A2OA 4KN6A 1GRRA 5JO0A 4BC0A 1SU4A 3EIQA 5ARCA 5H80A 5K51A 3RS0A 3WKAA 1TO6A 3NCHA 4ZDJA 1RNLA 1IWOA 3DCIA 4YCNA 1EZ4A 2AR0A 3TAXA 5D7BA 5KNBH 1A27A 1EU1A 2IQ5A 2QR5A 3Q3EA 4GKBA 4BTEA 4KDEA 3IT3A 3RYIB 3NANA 4JIGA 1ZVVA 1MPXA 3JQGA 2GYVA 3FNBA 2VUUA 4G8DA 5BT9A 4BLUA 5K4GA 1MABA 5EFZA 4R2JA 3M1YA 3TGLA 3BE8A 4GRDA 3OLXA 5IKMA 1Z39A 3DO8A 3OQOA 2XDAA 2G9RA 1UBOS 1E69A 2E7ZA 3NAQA 3Q3JB 4Q03A 4AXBA 5IBCA 4I1PA 1AHIA 1KZ6A 4UOZA 2VK1A 3RODA 3QHQA 1SH7A 2RGAA 1VA4A 2BMDA 3M34A 2V3VA 3S2EA 3K2EA 1AGRA 4KITB 2EP8A 1SCIA 4FS3A 4MJ3A 1Y7HA 2YWFA 3LUJA 5LYYA 5JVDB 1UAYA 3R7WB 1OXVA 1ZOLA 4RE6A 4KBFA 5FAXA 3RIYA 1XIVA 1TF2A 3I6BA 2Q4BA 3N75A 4HNTA 3TI9A 4P36A 3EH1A 4HWOA 4HMPA 4IKEA 4G8JA 3LQKA 1QYIA 3U19A 2Y1KA 1TYCA 4UNSA 3UF0A 2H06A 4L5YA 4PCVA 1E61A 1YE8A 3OPXA 2G1AA 2IHYA 3VPXA 1MJHA 4LZJA 3QX9A 3UUWA 1N8NA 2I99A 2WE7A 4PSVA 2VC2B 2VSOA 3OFKA 3AIMA 4QGHA 3TLJA 3TZEA 2LKDA 3FR7A 3JVUA 3AINA 3BL8A 3H4VA 1R0RE 2AEEA 5EZYB 1L4HA 3U48A 3L8CA 4QDXA 5L45A 2O5EA 1XTRA 1OWPA 4P54A 1B6SA 2HPHA 2WF6A 1EI9A 1OVMA 3S27A 2EZ8A 1ZUNB 4RMJA 3OHMA 4BO4A 2YS7A 1LLCA 1N5IA 1SHLA 2XCUA 4PC6A 4PS1A 1BE8A 1ZU5A 1YAJA 1CSEE 1RXCA 1DO8A 1UMCA 2G36A 2ZAGA 1P0IA 3EQ7A 3AOEC 3HLTA 4LWQA 1G7CA 2FRXA 2H4ZA 3L8MA 5JSKA 4HV4A 1OLXB 4PSAA 5JC1A 1U2TA 1CY4A 3K15A 3H05A 3JQ7B 3C0KA 3HV0A 1H3FA 1YZQA 3SKVA 3GLIB 2QXTA 4B87A 3RVDA 1PV1A 3EARA 1P6UA 3K4PA 4TLDA 5KWIA 1KQOA 4XIGS 1J6UA 1DWQA 2A9JA 1OFGA 4HNRA 4MYTA 4D9BA 2JS7A 3N8KA 4IDCA 5THQA 3GMIA 2VNJA 2O20A 4GC9A 3OKFA 4FFLA 3KELA 4BX8A 1R0XA 5LCXA 2UUCB 1GV0A 3NYQA 1Z4LA 4OJKA 2J6BA 4XSHA 1NQWA 3RIGA 4J7AA 4QKQA 2HCJB 1XU9A 1Z4MA 3G1WA 1USUA 4LXQA 2NO6A 4WESA 4PG8A 1LZKA 2APJA 1GNLA 1RLJA 2RCYA 5IKOA 3S2FA 4GFDA 2F1KA 1AF7A 3I53A 1U8CB 1P0CA 2F3TA 2SKDA 1J23A 2GBGA 1P7CA 3KE8A 3KWLA 2VDLB 2HLDA 3LV8A 1WHTA 4OGGA 1FLVA 1QPGA 2BIFA 1CUAA 4YJGB 5TEVA 2HIAA 1SPXA 1SUIA 1X42A 3ER9A 1LLQA 3JQ7A 4D98A 5K2MA 1UZNA 1D2HA 4FYKA 2BP7B 2JGDB 4Q7JB 5SZKB 3EASA 1YVRA 5K0LA 4RKEA 5IT0A 5I5EA 4AP6A 3R3VA 3ND6A 3O7MA 4FHEA 1E2PA 1VMAA 1RYDA 4OYHA 4PX2A 4TZ0A 2JPDA 1H4VB 4BP9A 5C35A 3VNVA 1QYXA 5EZSA 1KO8A 3N2IA 3PXCX 3MAAC 4NMLA 1YQWA 3SF8B 5I4KA 2O8CA 4X64B 4MQ4A 3H2JA 3KOWA 3GZNB 5B12A 4C01A 1J42A 1SQSA 1UT6A 3VV2A 2K87A 3QEOA 1NUPA 2YMMA 3FTDA 3L7KA 3EA4A 3JPWA 4CMEA 3G1UA 2J0UB 1RHUA 1SCQA 4IRMA 1Y6JA 1QYRA 2RARA 2ZBGA 3NHWA 3BTSA 3VOTA 1DPFA 5ALQA 3W3ZB 2XCSB 2WAAA 3RYFA 1FYWA 1HE5A 1B26A 2WIJA 3MWDB 4Y98A 3V1UA 1KI6A 1PZXA 1JIQA 2GFQA 2ACEA 3RRZA 5JRZA 5GGYA 2PRZA 1SHJA 3VA7A 4FIZA 3ZGZA 1WQ4A 2B21A 1ICIA 3U62A 4EJSA 2ACKA 2H0RA 4F6CA 1ORHA 1KZ1A 1RZ3A 2C97A 2WDPA 1BEZA 3CHYA 2V7BA 4LCJA 1SC1A 1E0SA 3LCRA 2AXNA 3JQBC 5BV0A 1JDUA 2FI1A 4MVXA 2ZBDA 3VR2D 3B8EA 1KMHB 1Q0LA 3SYTA 3JQ9A 4F3KA 5A1JA 5B36A 4LSMA 3W8NA 4ZZ1A 4AJ1A 2VT2A 3UNXA 2AGVA 4HQ6A 1FP7A 4WADA 2GJ9A 5ICFA 1GGEA 1WW2A 3UJPA 1UQRA 2GHQA 2A94A 3LP6A 3TSZA 2VQ6A 3WL5A 5FWYA 1E0AA 1TXGA 3UK0A 4RSRA 3UV7A 4DB2A 2HU5A 1L7QA 3AF4A 4G2TA 1K3UB 4HRYA 4KO2S 3D6UA 4Q1CA 4PVCA 5CLJA 2HV9A 2NTNA 3VU9A 2II6A 4HRVA 4EDHA 3G85A 4LY9A 3HB4X 4ITUA 1PR2A 2CGEA 2OKCA 2ADFA 2BF7A 2X5XA 3MJHA 1BQEA 1P29A 1ZKDA 2IDJA 3W3AD 4BZPA 4LKRA 4EYOA 3ZCQA 4XRGA 1O7JA 3AF6A 3KB1A 2FRDC 3THYA 2WG1A 1LPSA 2E1PA 1NN0A 1ZRHA 2DQ4A 5DT9A 3U39A 3A4LA 2WIKA 2BZGA 3MZ0A 3WHPA 3ZN2A 1WBBA 4D26A 3Q8XB 2VBFA 2HZBA 2PMEA 3KQHA 5E38A 4R16A 5K4HA 1W4ZA 2WQ6A 3PRKE 4WJZA 1K86A 2I5PO 1A4XA 5DM4A 3AV0B 4BKQA 5AJWA 2FWAA 3DHYA 2Z3VA 3Q3GE 4CEHB 2BFBB 4BU1A 3ROXA 3LVRE 1WA5A 5AKIA 5JS2A 3HADA 3THRA 1ESEA 1HTWA 1UWKA 4J49A 4AN1A 1KTVA 1ZXLA 2Q5OA 3ONNA 3GJXC 4RF5A 4RKWA 3X1JA 2B4AA 4O2RA 4RLHA 3K2BA 5DNVA 2NP7A 2VHEA 1ST2A 4GEGA 1LV7A 1VJRA 3RU9A 1QYWA 1P1BA 4YR9A 4BMXA 2AOWA 3CMMA 2P65A 1O97C 3IJ5A 1KO5A 2XQIA 4PZEA 2ZR8A 1K3FA 2Q3JA 1TM3E 3RYIA 2XNDA 1RM0A 2PQMA 2XADA 5TMDA 1JLRA 2RHTA 2V65A 4IMJB 4KXUA 5BMVB 2Q0XA 3TL2A 1P1FA 4X61A 5EAIA 5KJFA 2XTZA 1YR7A 4P0QB 4HUTA 4M8KA 3DEZA 4BB6A 5KQRA 2TSYB 3A70A 5AOBA 5JYCA 1HNWB 3IP6A 2QTLA 1WR8A 3KYIB 4CU2A 3TQIA 3KOYA 1GZ4A 4DM4A 1N1DA 4I2VA 2OT3B 2YZNA 1U04A 4BLVA 4IDFA 5BWMA 2QM7A 3VH2A 1VHWA 5C1PA 1ZJJA 1UQUA 4KQ1A 2GN4A 1ABEA 1YB5A 3NFYA 5T4FA 2I67A 1DRWA 1N8SA 3U5ZB 1PTJC 2CHVA 3PRHA 3JQDA 5A5FA 2Q3MA 2IYAA 2PKCA 2JEYA 2WJJA 3MQFA 4L50A 4X6UA 4MS4A 4QYWA 1SC3A 1S2IA 1VPLA 5FOSA 1SEVA 3LRXA 3FFXA 1U0HC 3QWIA 2J0VA 3K0CC 3Q12A 4FB4A 2HWYA 4ZYZA 1WXDA 3GG9A 5CH8A 2NPOA 2DVMA 1X9GA 5CVDA 1BVYF 1JEQB 1GPAA 1D2MA 3IOBA 3OU2A 3T9AA 4AMVA 3KYJB 1BDIA 3BDIA 2C54A 5AJUA 3G5AA 3RB8A 4Y6SA 1NLMA 1QORA 3M0EA 1TVKA 1XA4A 1YWGO 2JVIA 1DGQA 4TSRA 1J97A 4QXRA 4B44A 3PVSA 2IEBA 4ETIA 3EZGA 5JZVA 2QM3A 1L2TA 4OP1A 4IWYA 1L5VA 2EZUA 3IMFA 3UV3A 1NBAA 5FFNA 2J4DA 1IAVA 4X97A 4UBLA 5IDXA 1P75A 3MSCA 4RJLA 1GPMA 3T5GA 1L8AA 4NP6A 3ZWYA 3CKMA 4RFLA 2FSHA 1ZLXA 1LQ2A 1N2ZA 1E77A 3MRSA 2R25B 2H2FA 3QYAA 3K9NA 4MGHA 221PA 1SQ5A 2VDPB 1M1XB 3M9WA 4XFJA 3ZY5A 5DK4A 2IBSA 3NIDB 1XP8A 4R2WA 4I3GA 3FA2A 5IJ9B 1JJAA 1I8TA 4OY3A 3TTYA 1MMFB 1N9GB 2D8MA 2VHTA 4ZHQF 2I7VA 2QTFA 4U5QA 4W5TA 1ILWA 2K4MA 1M67A 4RKFA 1T3GA 5E9QA 5KNDA 1APBA 4K9SA 2FWBA 3JAKB 1JKJB 4BV2A 4GWLA 2LZ0A 3EGDB 1T6XA 1W5SA 1T8UA 1I80A 3MF4A 2R2AA 2NO7A 5FBKA 5FTLA 4XDZA 1BHJA 2R7NA 3DP7A 3NM6B 4IX1A 5ALEA 4X1OA 5C1DA 3L4BC 4URXR 1YSCA 1RZVA 4XAQA 3EJ6A 3QA9A 2B2CA 1J09A 1Q17A 3UJCA 4MQBA 1IHDA 2BGMA 4F5ZA 2I6QA 3HA3A 3K30A 3LBAA 2BHRA 2O2XA 1PGPA 1Q95A 4R40A 1PHRA 2R8XA 3NOOA 3DEKA 4L5AA 3VR4D 4B3IA 1IXZA 2ICAA 2YMLA 2ODNA 3MT9A 5F98A 3DCJA 3OZIA 2HT1A 3KQPA 3ZY4A 2BY4A 3WVNA 1DBVO 5EMNA 3ZWWA 1Q3KA 4OQXA 1WY7A 2AFHE 3QG1A 3KQQA 1D8AA 3NVKI 3RJMA 4W1SA 3NHFA 5BXYA 1MIHA 1OX4A 1M2FA 2HMSA 3LG2A 5CVUA 5F3DA 2PX0A 1U3TA 2J32A 3HJCA 4JYCA 4MVJE 5D3KA 3SEQA 2XUPA 3RVJA 1YZVA 3B2NA 4K6KA 1C8KA 2DWQA 3ED1A 4RY9A 4J0QA 4EY3A 1E1QD 3NUGA 3QNUA 2PH1A 7REQB 9ABPA 3G0HA 1UXJA 3D54D 2FPPA 3RVRA 4B09A 5CDHA 2ZYAA 4NENA 2PWAA 5B6PA 2ZI3A 3EN0A 1RWBA 3MRVA 5H02A 1E7WA 1MJ5A 4DT1B 2EFCB 4URWR 5I9MA 3PXDA 1DSSG 4R1QA 4A8HA 2WYWA 1DX6A 2O6LA 2Q1YA 4CN9A 2HIMA 2GWRA 3KZMA 4N5IX 1MQ9A 1P6QA 1RT9A 3PUJA 4HLQB 1E4VA 3WIVA 1KEEB 5CNIA 4YUZA 1FJHA 1S8OA 1U9ZA 1RJFA 2GPWA 1WXGA 4NCHA 4YMTA 4KIGA 4Z9XA 3FSJX 3GFTA 2AMLA 2LD4A 4YCCA 1SBCA 1DWOA 2P9YA 3REGA 4K5QA 1F17A 4DIBA 2EW8A 5T8KA 1ZK4A 4P32A 5INTA 1CUCA 3MMSA 1DTWA 2MWMA 1BXRA 2A9QA 5K3FA 1SCDA 2ZXUA 1ACJA 2PUEA 2OBNA 4AJ9A 2QR3A 4QG7A 4EPYA 1NW3A 3N0TA 3N7UA 2F3RA 2V9ZA 3UWMA 4L72A 1FTGA 1V96A 1XZPA 3D1LA 3OX4A 4NS4A 3WMGA 4QGSA 3B9PA 2X41A 4RW0A 4BB9A 1E3WB 4ICIA 4EJ0A 5CA1A 5CT8A 2XGJA 5D51S 1NVVQ 5DIZA 4MV4A 1YDWA 3KQWA 3PCRB 4UKDA 4HDKB 3UXHA 2JLQA 2PQ0A 2X7XA 4IVNA 4MQEA 1NRXA 1BN6A 2B1RA 3O95A 4JJEA 1I6MA 2M9MA 4HDSB 5CX4A 4LVUA 4YAJA 4GPTA 4AJPA 3AOGA 4HI0E 2EFJA 4NYJQ 1MAAA 5ALWA 2IIQA 4J8PA 5HDBB 3ZZ1A 4PPFA 4WOJA 4EIWA 3CW2A 4R7TA 2YRWA 1CF9A 5HCIA 3UANA 4F1KA 2F1OA 3T4EA 1BAPA 1CVIA 1U3WA 4GYKA 2QROA 2VDKB 4X24A 4AZWA 4PX3A 1REQB 3TE6A 3M4YA 5HTOA 1VPTA 4MRSA 1DIOB 4NYJR 5BV2P 1LPOA 2FDXA 5BMVF 4NOKA 3IMKA 3CCBA 4Z4IA 4OHPA 5HF5A 1E59A 3QFFA 1OE0A 3RFFA 3WKBA 5A4FS 3G2JA 5AJHA 1USIA 2DKFA 5L7YA 4L6CA 1K7SN 4B4UA 2H54A 1YB7A 1SHZA 1ZSYA 2ODWA 2OFPA 3K73O 5FFMA 5IU6A 3STUA 1MOQA 1LRKA 3ND9A 2GBLC 2H4HA 1CY6A 4AKIA 2WDZA 1T0BA 2E4AA 4B9EA 4YECA 2BGTA 4QTZA 3RHTA 1H3NA 2FMFA 3PENA 3QPWA 4DZTA 2DCMA 4O3MA 4G5HA 1JL3A 1N5JA 4E5YA 2PLRA 2BUCA 4ENUA 3DXZA 3KKPA 2VTBA 1EK6A 4A8PA 3GEEA 1I4OA 4JT2A 2RGWA 1U7TA 5EOVA 1XK6A 2WD8A 1UJ4A 3C48A 1C0LA 3JQ9C 5D85A 3V6MA 4EPRA 1DCTA 1EH5A 1Y6QA 1DP4A 2FETA 4MPRA 3CRVA 1MB4A 1E3TA 3FKSA 2HGSA 3FNRA 1XNRB 5E8RA 1ZHFA 1HF3A 3UY4A 2GA8A 4NBRA 5A3SA 1ZC3A 3X2SA 3BIJA 5C34B 3SZMA 3MXOA 4NOLA 4MS1B 3DC2A 1PZNA 1JU3A 1M6VB 2E37A 2JCBA 4FI3F 4G1VA 4G5OA 2IPAB 4WLNA 4Q7QA 2ZS7A 1Y5LA 2VNAA 2I1WA 3K94A 4FYYA 4JVSB 5KTKA 1UP4A 3OICA 2ZS9A 5IAAA 5K3OA 3GFOA 4G65A 5EVCA 1KSFX 3KEFA 2XWQA 3B38A 1N2CA 3VO2A 4EHHA 2IPLA 4IP0A 5AVUA 2IH2A 2P9JA 2HUNA 4Y6OA 4IMIB 3DBOB 2NO9A 3NHBA 1S01A 2PU7A 2HRQA 3W3AA 4GXQA 2OZKA 2H07A 1Y0BA 3KJHA 5ICSA 4EKGA 3UBMA 1RBZA 2Y1FA 4A0GA 1SD1A 1G8FA 3IVCA 4J0CA 4Y2GA 4BNDA 3AEQB 3KHSA 1ULZA 1NUQA 2VTVA 3ABOB 4CF3A 1K7CA 3O4FA 5GV7A 1WOMA 5LFAA 4RKRA 1ZNXA 2PGDA 1XB2A 4K6MA 1YF3A 4PLZA 1CEQA 1B6RA 1YASA 2D2VA 4GGPA 4NH4A 3RS4A 1U2SA 3L92A 3OPVA 1PEKE 3OIGA 4JMPA 4KXXA 4LF6B 4F3CA 3AF3A 1Z8FA 2QSUA 3FRIA 3GJSA 1P3JA 1ZJ6A 3LS2A 3ORQA 3B52X 4PGGA 1QUEA 5ENDA 5EJ5A 4PRKA 3TQFA 3HTXA 1Z37A 2JLZA 2XDYA 3VVCA 1GADO 5MDHA 5AK3A 1KDTA 3AERA 4U2EA 1J5PA 4MCAA 5HOQA 4U0JA 3WK6A 4DXAA 3GRAA 1AXGA 3PDIA 2P6MA 4I1UA 4F91B 5JATA 2R44A 5T64A 1M7BA 2BLLA 3FTCA 4KAAA 5J2UA 2C4MA 4DKJA 4IRUB 4L2IB 1X19A 2DBRA 3GEPA 3ZV5A 3RSCA 1QB7A 2RAFA 2V5VA 3T15A 3WP0A 3NC4A 1ECLA 1OTHA 4LG1A 2AZDA 4M1ZA 1RRFA 3CZ9A 4R98A 3I1JA 1NI4A 4JBWA 4JI7B 2PWBA 2OBYA 1EVJA 1FW8A 1NVXQ 1W76A 3H5VA 2Q8QA 4FMCB 4DJAA 5IFLA 2QZZA 1PG5A 3A9CA 4Y6QA 1NNLA 2W11A 1NWHA 5JOQA 1MJGM 5AKXA 5EWLB 2FW1A 1L1FA 3LKDA 2H57A 4KUGA 1WPXA 5KWVA 1PT9A 1W36C 3HJNA 2GNOA 2O2SA 4H31A 3VH4A 1D7OA 2AOTA 2B1JA 4CNBA 3P52A 4DNFA 3IOYA 1P9WA 3DV2A 3SEZA 5C5DA 3HVUA 3DW1X 1C9KA 1Y81A 3PGVA 3ZX5A 2K7FA 1N7GA 2XD4A 3PX7A 2EF0A 3B60A 3HCNA 4IJ6A 2IH4A 1ZJ4A 2H29A 3MFQA 4K9NA 2V9PA 3TLBA 3VZDA 5K9ZA 2GB4A 1IJBA 2ZRNA 4XYMA 2IE8A 4NE9A 5HS6A 3H2HA 4PXSA 4BP1A 2ON6A 2J9YB 4ZN6A 3I32A 2N9UA 1MC8A 2EF1A 4AZ3B 4B3FX 1EJ2A 4WV3A 4HEQA 1KVRA 1N3LA 2W6CX 3CLUD 1ZM2A 2XSZD 1P5ZB 3FM9A 1U1CA 5JYEA 1KEVA 1GHTA 1QLWA 2Y0EA 3DEJA 3M4NA 5D6NA 1GRQA 1CUFA 4JEMA 2CCJA 4TL8A 1HE2A 2IW3A 2Z6AA 4X41A 1S2LA 3P97A 4XASA 2DUMA 3A36A 3L18A 1SULA 1L6IA 1OMOA 4BVJA 1IN6A 4X7PA 3WYBA 2IY9A 4DREA 1VI5A 2FMHA 2ILTA 2R6JA 2IXEA 4BX9A 1MDFA 4GW3A 4JJZA 3TQCA 5IASA 4N0DA 2ZSFA 4Z51A 2W2MA 2FZ4A 4TV9A 1ATIA 1GXSA 2I29A 1X7WB 3R9WA 2VH1A 3E8XA 1W1UA 3FHJA 1VQ1A 4LF8B 1QIDA 1C9YA 2XT6A 4R8LA 3HYCA 4MIYA 4CM4A 3EPKA 4IUBS 3CVYA 4WASA 2DHRA 4D3ZA 1W85B 1QGUB 4LNUB 4Z7QB 3QKIA 1BC5A 5GPBA 4MW9A 1BX0A 1CNFA 1O54A 1TA0A 1HI9A 2BMWA 2DSTA 4Y2XA 3ZUPA 1UM9A 4MWBA 2P91A 2IP2A 3E03A 3MUNA 2G5GX 3QVUA 3TBHA 2GEKA 2RBEA 1E0KA 1N7JA 1OVGA 2PSEA 1U8UA 3GAFA 1E1CB 1GRNA 1GFZA 1KYYA 3KEQA 4Q9IA 3FTEA 3OJXA 1X80A 3DDHA 3ZCSA 3UMSA 2QD5A 4F4FA 5L7TA 2FG6C 1V41E 2D5AA 4TKUB 5K6TA 1QFJA 2HU2A 3OTGA 3DE1X 1NR1A 1KQGA 4G5QA 2ZROA 1E20A 3OOSA 4C5CA 3CB2A 4EG0A 5A3QA 3W5DA 4AS1A 3U49A 2CHUA 2QVLA 2XKBA 3IV6A 4G5SA 4RY0A 1YQQA 3FHCB 4RDHA 1EE2A 2B92A 4QUAA 3L7AA 3DLAA 4PGMA 4JVMA 6Q21A 2PSSA 4QUJA 1YQTA 5EWLA 1IN5A 2IP4A 1T15A 3L0PA 4RZIA 5AW9A 2YJZA 1Z6GA 3IKJA 3KFVA 2OVFA 1M1YE 2W6JA 3HKDA 2W22A 1FDUA 1HLDA 3JQAB 3KWFA 4XB2A 1T0UA 3SYRA 1AUOA 2YFYA 1N9ZA 3EEFA 3G9QA 1ZI8A 1MEEA 1VLZA 3PFCA 4H35A 5B58T 5A9RA 5HQTA 4I8DA 1KHHA 3CCCA 3H3XA 4I4CA 3PGLA 1H2ZA 1HV8A 4R0NA 1DBIA 4U5XA 4DEYA 1BEUB 3TFQA 1WHTB 5FO1A 5B6IA 2SKEA 3R77A 4M1YA 1ZBQA 1JPVA 4GOKA 2A5LA 4TV8B 3T9DA 3BRCA 4CKXA 5CVVA 4M0MA 4HAXA 2XGMA 4JYMA 2KBFA 3D3WA 1OXUA 3NS7A 4C08A 2FAXA 1NTRA 2DT8A 2VZ8A 5A03A 3RO7A 4DM3A 4IZOA 1V1MA 2GETA 3Q1KA 2Q3EA 1XXHE 5AI0A 2GBPA 1GQSA 4C22A 4D92A 4Z9YA 3UMMA 4KNYA 1GSAA 1FUYB 3D8RA 2GPBA 2OGZA 1LW6E 3CNHA 2JFVA 4GQAA 4WA7A 4WKBA 1M66A 4ALIA 1UT8A 2OFXA 1Z25A 3HDVA 2HLPA 1I5OA 3IIKA 4ID9A 3ZCPA 4ETMA 1HA3A 2ZRAA 2EWVA 4YO7A 2FU5C 3ZGNA 1S3FA 2HA6A 4GKVA 5JFOA 1XWIA 3ZJYA 2N75A 3C8MA 3PE3A 1T0IA 4R1NA 2YWGA 2C94A 2RGXA 4WOCA 4Q19A 4F7DA 1UF9A 1NMQA 3CR8A 3I76A 3RK0A 3QV1A 3V48A 3WQSB 5EE0A 3CH5A 1TGYA 1MA3A 1MXFA 3EBOA 1QG2A 1VRWA 4R3UC 2QRNA 1LPAB 3BIFA 5ENVA 2UDPA 2WJ4A 2WR8A 1T9BA 2QRQA 3AHJA 3E48A 4LMRA 1YU6A 5ESDA 5A7FA 2Q9BA 4ZARA 4EGQA 5D01A 4J07A 4UVHA 4S1OA 2A14A 4LGMA 1EPUA 3ODPA 3HFJA 4JLOA 1QFMA 4MKIA 4PBSA 2ILVA 5JXJA 1ODLA 1XQYA 1XZFA 1ANKA 2Q50A 4LHZA 5BQPA 4E88A 3IDZA 3GLKA 1MGOA 1Z33A 2XBLA 2XCTB 5M34A 1L7AA 5K01A 2QVGA 3NTLA 4XUDA 1FX0A 4IH4A 2CEAA 4OTZA 3WGYA 1FFXA 5K3AA 2VJKA 2VZ9A 3BWXA 2OHOA 1CUJA 1NV8A 3OOWA 3PR2B 3QFRA 3FSEA 3OJWA 3TFWA 2HMUA 1RJGA 3QU4A 1CIVA 3IVMA 1YZLA 2TMGA 2BFCA 1V1MB 3EQ2A 5FTMA 3QVJA 1RKUA 4ARBA 4BUZA 2ZRPA 5IBRA 4BNHA 1Y3IA 3P4UA 2ECOA 2WUEA 4NBUA 4Z0HO 4EW6A 3B1WA 2ZB7A 1PI3A 3GPDG 1QV6A 2NXNA 3ORYA 4ILKA 4HX2A 4RSMA 4BIIA 3N6XA 3R8XA 1JSRA 5GJCA 4HYEA 1E2KA 1R1DA 3I2YX 3O9VA 1N2EA 5P21A 2BKLA 3S55A 1TAUA 4QJIA 3BIWA 4UEKA 3F6SA 1HEIA 2VRNA 4GLOA 4MRAA 3ZWCA 5IP5A 2C2YA 4G1EB 3F7NA 4PBTA 1GPKA 2GM9A 3DAGA 1E1KA 4MR9B 4AWAA 3NHPA 4L9WA 4EA9A 4ZCPA 3WYFA 5DNCA 2HFKA 5KQPA 3DD5A 4D9NA 4BZXA 1RM5A 2XTAA 1XVLA 2H17A 2XCIA 4HTAA 4U0KA 1XCLA 2RGGA 3CV3A 3USCS 1BG6A 1XHEA 5AW3A 5HFJA 1Y1KE 3P96A 2DJ5A 1BDJA 2J9FB 3WGQA 3COZA 2DUUA 1MZVA 3BJIC 1GTJ1 1K1EA 2VO1A 3NMUF 1NXWA 2X4GA 3PICA 5F78A 1R8YA 1GTMA 2IYEA 4S24A 3RV3A 3GUZA 3PI6A 2QY6A 4XWGA 3EC2A 3VDQA 5KDOA 5C81A 3SQDA 2PD6A 2J5BA 4QXOA 4ZK2A 3AY3A 4B80A 5A04A 1R6XA 1IG0A 2XQVA 4OPMA 1VC2A 2C7PA 2DHEA 5ELXA 2Z58A 4F1WA 2RH9B 2ZM5A 5JADA 1J99A 3OCZA 1FSSA 3WYCA 4EI7A 5ALPA 1S9HA 2R4TA 1XLUA 2Q3FA 4OGWA 3QW2A 3PIDA 3NOQA 5J47A 1HQDA 5F3RA 1NVAA 3WLKX 1L3CA 2IIPA 5LL6P 5DLDA 1U3FA 1LDMA 3HCWA 1SCJA 2AZTA 3B6EA 4RGQA 1PJTA 2ZWAA 3OQBA 2ENUA 3UA4A 1MIOA 2HF9A 3GH3A 4H7IA 5IANA 1AZWA 1TCUA 4RQUA 4PNZA 4FSDA 1NI4B 4UFNA 3W9BA 5BWNA 4UUOA 2ZE8A 3COWA 3V8VA 5HM8A 1VE7A 3MN1A 4C4AA 1C3OA 2NZXA 3Q88A 1QHYA 4D41A 1A50B 2VYND 3KSUA 4IAOA 2LE0A 1B00A 4H7KA 4JI3B 1P7ZA 4BC1A 4PANA 2ECPA 5KOJA 2WTAA 1DKLA 1TLFA 4FEYA 2JJ1D 1WZUA 4R84A 3RJ9A 1X7ZA 1SVOA 2HQOA 3L06A 3F9RA 2OR3A 3IP7A 1HOXA 4UUPA 1ZFNA 2DP4E 3L4JA 3BAZA 2CLFB 3IBFA 3PQDA 1W6UA 4LW8A 4X1YB 2PEYA 5B3AA 3RS2A 3TM5A 1T1IA 5CX1B 4DA6A 1AF4A 4RYLA 3B36A 3AR6A 4AG6A 2B20A 4FJ0A 3I37X 3CIOA 4R7ZA 4EUKA 5T3UA 4UM9B 2B25A 1XXHB 1XJQA 1XR3A 4M0EA 3K9GA 1UBCA 3KEOA 2JD1A 4G0XA 4RADA 2ONJA 2AG0A 1CUYA 3V1TC 2WFAA 5CU7A 4BVBA 3ND8A 1N1MA 3KB2A 2QU7A 3OJCA 1CEXA 1IWBB 2PX3A 3B1YA 3W7AA 2OG1A 2AE2A 3IODA 4A5OA 5IM4A 2G1JA 2OAP1 2Y1XA 3PPWA 4FFMA 4UTOA 1ZESA 2G4VA 4M22A 5T41A 3HCBA 4AK9A 3H65A 3N2KB 3JQGB 3O3OB 4YJKA 1KDVA 1Z63A 1G1MA 1QGOA 1A1SA 3AP3A 3FPSA 4MSUA 3BEOA 4ONEA 3X1DA 3TRHA 4CKCB 3GWZA 1Z4KA 2P9HA 4TN5A 3O26A 1XEXA 4PXAA 4R3NA 4XX0B 2ZTMA 1P8JA 4KHPB 3NI2A 4CMBA 3LECA 4D4MA 2Z2YA 3UOWA 4B4KA 3EQ8A 3WOVA 2VJCA 3C3PA 1BJKA 2AFHB 1RJ9B 2EKQA 5JRJA 1DWPA 2WZBA 3EDQA 3IHTA 3LKZA 4UQOA 2UXDB 4X7MA 2QTCA 2QG6A 5LJLA 2V54A 1CZRA 2DR3A 3OTOB 3EGVA 1Q74A 4C2BA 3SVTA 3O8OA 1OC4A 4K3UA 4LV5B 5KPDA 1W4LA 4ATNA 2D7JA 3E1GA 3GVPA 4BFUA 2F59A 2IFTA 4YJ2B 2IYUA 2FSPA 4LN1A 2A57A 2M2IA 2C9MA 2V4MA 1O0SA 4A9AA 1J0XO 1GDHA 1WKVA 3BS4A 4IKOA 2ZJ0A 4OOEA 2F3PA 4UHHA 1PO7A 4BLOA 3EGCA 3FYUC 1JVNA 1MJNA 2GJ8A 1EHIA 1MH1A 4RHYA 4YGYA 5AVOA 3FDZA 5COBA 1FMFA 1CR4A 3JAWA 5AK0A 3WZLA 5BQXA 1P3Y1 1SCNE 4CLRB 3HB5X 4HZUB 1J8FA 1H93A 4DPLA 4GF5A 1AB5A 4PQFA 2C8JA 2R00C 4RHCA 3O1LA 3OFNA 2YL2A 5FULA 2BI4A 3REOA 3DT6A 2ZYWX 2BF4A 3LQRA 1C0KA 2DF8A 2OYSA 1OYVA 2ZUUA 5ALZA 1QZUA 4HHEA 1TI7A 4WW0A 2CXPA 3I8OA 1ICEA 4R54A 2J5XA 3GARA 4FCWA 2CK3D 1BHQ1 1DO2A 4IXDA 1Y8AA 4G2NA 1QOPB 4J0KA 3NASA 1QCDA 5FA5A 5ILGA 4NVRA 2VBGA 1JRLA 3KYDA 3OO0A 3QMPA 3Q6NA 2M6KA 1GG9A 4U6NA 1KAEA 1CDEA 1XTVA 1RKXA 4M7WA 4D56A 5EIEA 3GL9A 5CXXA 4ER3A 1ETHA 1G98A 3UJ9A 4BJ1A 4XM0A 5A0VA 4XPZA 2X6TA 2LUOA 3KTDA 2ZBPA 3LVFO 5TC4A 1HG1A 1QDEA 2M32A 5KYYA 2QUZA 3K8YA 5E6RB 1OKKA 3NX4A 1F2UB 4H7DA 1E5TA 4XR9A 1MC1A 2IE0A 1ZH8A 3GWGA 4NI5A 2W2LD 1Y6RA 2FPGA 3HSKA 3M7IA 1V25A 2WU8A 3CVJA 1ZWKA 3R5SA 4KZPA 1C3LA 4UJ5A 1L5NA 1EZ1A 2JGLA 4F93B 1VJDA 2MU1A 3JZAA 5G2OA 2I4RA 5FV4A 3OP4A 2A92A 4OD0A 4IQ0A 5EJGA 5JVDF 3OEEA 2ZAMA 1CUWA 4HN9A 3RSQA 4HVLA 1W2HA 1WX1A 3VOSA 1GL6A 3E3OA 4JR1A 2GGSA 4Q7KA 4DCMA 5CDSA 2GVZC 1O94A 1PQYA 4JITA 5P8WA 2QGZA 3GA0A 1CJMA 4MOWA 1X7XB 4EY7A 4I50F 2XZPA 3G6WA 5EWMB 5ALNA 4BQIA 4IUDS 3T34A 4IDGA 2FEOA 1WMFA 3WK9A 3KJNA 1DAPA 4UEJA 4RJKA 4YDSA 5DN6D 3V8PA 3ZWMA 4DA7A 1W9HA 4R1UA 3P2JA 1TVMA 4A23A 1VPWA 3ZZ0A 3MILA 3LUFA 1UOOA 4DLUA 4DQKA 1Z2NX 4EKNB 1L5YA 1QVVA 5DWVA 4IQGA 2I6SA 4QVGA 1IQRA 1PSZA 3NR2A 1AC5A 4MUHA 1EESA 1KZHA 3JVVA 4BGEA 3FYUB 2G67A 4H3KB 4O4IA 2B8WA 4CM3A 4G5FA 4G9EA 2C2WA 3EZNA 3MGGA 4MVJP 3EGDA 5CYGA 1YR9A 3CA8A 2AN5A 1I4EB 5I8PA 2VSNA 1TJ4A 1Z36A 2VUIB 5B1IA 1PYDA 1SHKA 5EIFA 1B0AA 5COQA 3RRYA 2GHIA 2BL4A 3K0BA 4ARZB 1O2DA 3D0OA 1M5RA 3HJHA 2ZRDA 4TLMB 1UEIA 1UZAA 3EGXA 4NARA 3PPVA 4CMAA 1V1RB 3R0IA 4Q7MB 4AWBA 1K66A 4DQDA 4YT2A 4XDHA 3LUKA 1CZHA 1UDCA 3O3MB 3NQ41 5AKEA 2A78A 4TS1A 2C99A 1HE3A 3FHLA 3LP8A 3RJ5A 4BFCA 3AI2A 3E9YA 2ZITA 3E2IA 2QRKA 3D2BA 3CEJA 1QHNA 4ZZ0A 3U44A 3ZHSA 1C1XA 1WXEA 1A9XB 2FX2A 2WU1A 5B58C 3AONB 2Q29A 1AUQA 2R6DA 2V5AA 3UYKA 4JA2A 1HY3A 1ZP6A 4JBIA 4WCDA 2Q1WA 3AF1A 4NENB 2NXEA 3DB1A 4PAMA 4C0SA 4V1CB 3B1VA 3IV7A 3O1JC 4FOOA 1TW2A 4NMMA 5BNWA 6REQB 1OBFO 1IULA 4BNJA 1EFUA 1RS0A 1U2DA 2J0SA 4EF4A 1SZDA 1U2GA 4ILEA 5EXTA 2C20A 1MF7A 2AYZA 3PUXA 1JQAA 3SDSA 5CB4B 1G5IA 3OPMA 3W04A 1CP3A 4RABA 1QHSA 821PA 1DAFA 4M7RA 2QUJA 1N3BA 4U2BA 5E6RA 1IBCA 3C74A 4NZNA 5DI3B 3NONA 4ZQFA 4KR7A 3AK4A 6ADHA 4M1QA 1T0JB 3MRXA 2H1IA 2QM8A 4MVJG 3N8DA 4YJFA 1FU4A 4LGYA 2SNIE 1IPHA 1T9HA 3QUQA 4LWZA 4ZT6A 2XJ9A 4NCIA 3EAQA 3HPRA 2Q7DA 3ZDYB 4BZQA 1AT1A 1UBUS 1Z8NA 4P3KA 1L4EA 1C3JA 3LLSA 4N65A 1RWWA 2QAJA 3F3YA 1YHZA 1Q44A 1C7QA 1WUJS 3GLHB 3IVRA 3KPJA 3MELA 3OMLA 3T7SA 3UYLA 4BQRA 1ISMA 3OOHA 3TZBA 3O2NA 2V59A 2XUQA 1UDRA 1NXQA 1DFIA 1SIOA 2ZSAA 3EVDA 1X1DA 1EDOA 2H8GA 4JNKA 3JQ8B 4JQSA 1I6LA 1DC3A 4JXJA 4OXXA 3KG2A 4PNHA 4A2WA 4QA9A 1QVZA 1E4YA 3W9YA 4BP8A 1NNI1 5TQJA 4XVHA 3ZYZA 3RS3A 1YCGA 4PONA 3ONFA 4YMIA 3U3RA 3WLFA 4GPIB 1NBME 1VCNA 3QZUA 4L8WB 2AN9A 5ARBA 1L7VC 3DA8A 3E4DA 3EMVA 4Q18A 3ELUA 4QDOA 3NT4A 4EG7A 3EHDA 1Q0UA 4UHKA 4DA9A 5EJEA 4OATA 1KO1A 1CB0A 4POAA 2IXAA 4CE6A 1KI2A 5IYZB 3VISA 3K6SA 2QTWB 3BL6A 4WCFC 2NNWB 4OB8A 3C5WP 3BGDA 4WIAA 2G71A 4MV9A 4O02B 5FL7D 1DUVG 1QANA 2OWEA 3ORSA 1NW7A 1DV1A 1Y7IA 3L8EA 1QOQB 3QF7A 4QGGA 3FDIA 3GBPA 4JI5B 4XB1A 5ER9A 1B2LA 3WSWA 4C88A 5HDQA 2VDNB 4GOLD 2H7XA 3ISVA 3LH5A 1ENZA 4Q9JA 5JQGB 5LP1A 1I32A 1OXMA 4AKGA 2YFQA 2FWNA 3R3UA 4K9QA 4BFXA 2PGNA 2WWTA 1DT3A 4IV8A 3U7IA 1L1EA 1TEXA 2HMYB 2QD4A 2C4NA 2REQB 5REQA 4MVJI 2P1ZA 4QYTA 1KIFA 4Z86A 3EULA 5E4YA 1NX9A 1AOXA 1F3LA 4RC9A 1GL3A 5HMMA 1V9CA 5JEEA 2ET6A 2Q41A 1SOAA 4XX0A 2JGRA 4H0CA 4H3SA 2O4UX 2IQIA 3O8OB 4OLFA 2GYWA 1XTSA 3MJDA 1IYZA 4TXLA 1JAXA 1M0SA 4NFLA 3P19A 2P6UA 2VPWA 3U9LA 1XDWA 4MA0A 2B4RO 2YOHA 1KFKB 2P2LA 1W8IA 4MW6A 4F5EA 2I4LA 3B7PA 3TJMA 3WYNA 3V4SA 3GCWA 4RTSA 2G0NA 2XTJA 3FYSA 1OXKB 1QFSA 2RI0A 4BWVA 3WGIA 1H8HA 1NU6A 3HB7A 5CB8A 3THOA 2NTEA 3KLNA 4MV1A 4R2LA 5AM0A 3USES 5TS3A 3ZC3A 1ONSA 2AKEA 1BVRA 2G6TA 3HVRA 3HV2A 2J9FA 4RAOA 1T8PA 3WZMA 4KH1A 1JR3D 4KE6A 1QHXA 4B6EA 4Z53A 4WCFB 4FM9A 3A06A 2WYHA 1W96A 4PIPA 4QLOA 4PCLA 2ZSHA 4C0HA 4QJBA 2QNRA 4OQEA 2WHQA 3D8SA 4AKHA 4MYUA 4X60A 3LGSA 2ZAOA 3E7FA 2F7SA 4IS3A 3O9MA 4HWTA 3RTCA 1G5FA 2I91A 1UXHA 4ITVA 4FZVA 4ZT5A 1OI2A 1KVUA 4GR5A 1ZW1A 2Y1CA 5KYXA 2P3OA 3A28A 2VSXA 3CUKA 4IINA 4A2CA 1N92A 4KFSA 3C5VA 1DAEA 1QR6A 4X7RA 5ALIA 1RVDA 2N0SA 3L8ZA 3RK1A 3NBZC 2P2NA 4M46A 3DLCA 4BWFB 1M6YA 4WK2B 1UKVY 1JS1X 4JC0A 4XVUA 2IW1A 4N1AA 3LXXA 3P9YA 5EP4A 1KFBB 4UDOA 4GI1A 1RE1A 2W58A 1NYLA 1G38A 2QSZA 2D1SA 2R1ZA 4TXMA 5I4CA 3FPFA 3Q6MA 1LK5A 1U2QA 2CMHA 2E48A 1TEZA 3LWBA 4JYPA 1U1FA 2PAAA 3R6LA 4PZ9A 2FX3A 3RBVA 3AGQA 5GADl 5HIIA 3CUSA 5ERGB 3AHDA 2OTCA 1GCIA 2JHGA 3AEUB 3R7SA 1QZ3A 4E6PA 4OVKA 3VSDA 2D0OB 8OHMA 5LP6A 2HA2A 3IDOA 4RFSB 4Z7OB 1R10A 3Q41A 3LDHA 4F9FA 2A5DA 5JARA 4R7GA 3JCZA 4L0MA 4QO8A 2C07A 4UPVA 2Y66A 2HN9A 3DDSA 3EEQA 3FPLA 3HBLA 1XLTC 2BN4A 4RK7A 4TQAA 1IK4A 1VM6A 1CUSA 2WYVA 1CUUA 4X8OA 4WBXC 2WIDA 1UXGA 2GWHA 3ETJA 2GPJA 3QW4B 5CH5A 4CTKA 2GDJA 4YX9A 4DR7B 3R7NA 4LRYA 5H81A 3TI7A 2WRZA 1FS4A 1H9BA 2YH2A 2F2TA 1ZNQO 2QTHA 3Q3IA 2E49A 2AOXA 1HNXB 2XCQA 2B6NA 2OCAA 4DRZA 3GZNA 3OX2A 4RK5A 3TMKA 2JCXA 1V1JA 3AHCA 2OV8A 2ZJ3A 4IYJA 3PE6A 1QO0D 4D74A 3NHJA 3PEWA 3GGPA 2D1YA 4QDUA 3AX6A 4OQZA 2YUIA 4R2XA 4C30A 3UAVA 4DCGA 4F92B 1NW4A 2IYQA 4A4DA 1H2WA 1AHNA 1U8ZA 2ZATA 3N39C 3DBRA 4O4JA 4DMMA 2IKSA 3AETA 5DOZA 3ONWA 3LUPA 4UMDA 3CLUC 1GQQA 3I9OA 1EMDA 1P44A 3BRWA 5EIBD 1XPRA 2NVWA 1G4HA 4RL4A 3ZWQA 1KETA 1KAGA 1IN1A 2VHUA 3HBFA 2MMGA 1AM4D 1XKXA 2OHJA 4B7CA 3VDMA 1I1QB 2ACVA 3D7SA 1Z4IA 3DONA 1NBHA 2IZ0A 3BMNA 1FX1A 3L3BA 3MPOA 2I3GA 4JLKA 4LXGA 4MPDA 5BY2A 4YP1A 1XVIA 3DCYA 4D9FA 2JFUA 3KSAC 1SXJA 4DBLC 1MBZA 2OHXA 2O48X 4CCYA 4QXQA 1V9LA 3UJ3X 5AM2A 3F97A 1UWLA 3QFSA 4WOBA 5CVTA 3AKEA 2C29D 2WW8A 4EY6A 1JXMA 2QN6A 3DWFA 4IIDA 3ANLA 4L22A 3SN6A 3TO5A 5JROA 2VHQA 4CUZA 3MC1A 3ZE9A 1PZGA 4G3XA 2IEIA 2YMPA 3HVIA 3ZI4A 2CT8A 3WBJA 2IY7A 2Q5EA 4P92A 3WOHA 3F5DA 3ITKA 2B4YA 2JGKA 1VKZA 1UBLS 1TPZA 2VAXA 1KJQA 1TJYA 1OFHA 2VT3A 2VT6A 3GFPA 3L0YA 1XD8A 4HQRA 3V46A 3Q3CA 4ASUA 3BRQA 3VHXB 4OJQA 2W42A 1NUAA 3RSFA 3JSAA 3GFVA 4QULA 4X1KA 1W2GA 4ZVOA 2DG2A 3CNOA 2WZDA 3DZDA 4TZ6A 1S4MA 1KZ7B 5CNKA 1SC4A 4HFMA 3C15C 3WWOA 1E3EA 2BISA 2O2CA 4EI2A 3ESYA 4DBVO 1Q3HA 3LDFA 2G9UA 2O8CB 2RK4A 5DVZA 5HSGA 1PFVA 4PO3X 5K09A 1FQKA 4KLAA 5GWXA 4D96A 4CI0B 4AY6A 4LQCA 3IURA 1YBMA 4B8ZA 4ECAA 3QMMA 3TTTA 3RLIA 2J3KA 4DIOA 2VDVE 1WY5A 4DYVA 2GF2A 3DQZA 3LC0A 5AKZA 3ANXA 3G59A 1ODJA 4LF7B 1KVTA 1GT6A 1K8YB 1RWQA 4KSBA 4URZR 2Q0QA 2Z4TA 4CMIB 3SD7A 4EHAA 4DPKA 4KO3S 1EFRA 1G291 1XQXA 2BEVB 4PZ0A 3OLQA 1D2AA 4NBTA 1UANA 3PFWO 5CA0F 3DDUA 1RXVA 3KNZA 3W2HA 1EEXB 2YXEA 4FXOA 3ZS8A 3I8XA 4TLLB 3ZZUA 5HUQA 4TTJA 2E4YA 2CDBA 2H92A 3FWPA 3OLVA 3OMXA 3VDNB 1SXJB 5HCNA 4YAWA 3WLOA 2CFIA 2RIRA 4KIFA 4P58A 3AETB 4X84A 2A9VA 2ZB8A 4FSXA 4JGIA 4X3PA 4TV8A 1TK2A 3H13A 1NVDA 5GJBA 4DZRA 1CD5A 3ZDCA 2QORA 2XMGA 4ZDWA 4B9AA 2CFOA 3RWMB 1I33A 2WZQA 3W4KA 2XIJA 3RYHB 1GZDA 1VECA 2INGX 5JZBA 4OA8A 1HT2E 4WZBA 3FVWA 3W8DA 3WFZA 4M38A 5JNWA 3H19A 1GZHB 4H18A 4BLQA 4BQFA 4S35A 2JLVA 4LE1A 3HNPA 1XCPA 4HLUC 1XEWX 1T9AA 3IT1A 1YR8A 1DNPA 2P9QA 3GCGA 2K2WA 4X9XA 5AVQA 1GZSA 1D6SA 4ODIA 1D0IA 3L6EA 5DHSA 1OH6A 1U11A 2GXSA 2NSJA 4TVKA 2I3BA 4OXIA 1ULUA 5F2NA 1WBJB 4QQKA 4G0WA 2QK4A 1F2VA 1OV4A 2XB4A 1D1SA 2BJWA 4IIJA 5IJWA 5EXEA 1TYEB 1G6OA 3VTAA 5KSYA 2CWWA 2W70A 4QDTA 2XEXA 5E9AA 3QSYA 4IIEA 4HBGA 3VZCA 1PVVA 3P9NA 5DLPA 4Q16A 4CIWA 3C3BA 4LZOA 3U7EB 4Z2YA 1EDDA 1PIWA 4BNUA 4YRTA 3IYLW 2C9BA 2H4FA 3IQEA 2I4NA 2GS9A 3QUAA 3R6WA 1G5TA 3MCVA 2J4FA 2AS0A 2QZ4A 5CVCA 3NAZA 4B8WA 4RLFA 1QRUA 5HUHA 4HN4B 2ATVA 1G20E 2WWVD 4FUTA 2BHNA 1C8LA 1TFUA 2A0FA 1E3JA 2AJTA 2J5RA 2X2PA 1C4KA 4ZQEA 1BMFA 3HKBB 1DCMA 1GPUA 3PJDA 4N12A 4O2BA 4DMHA 3EPLA 1JVSA 1M5TA 1OWMA 2ORVA 3AT1A 3D7RA 3V1KA 5C51B 4I66A 4MIEA 3KVRA 3E27A 4H2DA 2GEUA 5PNTA 4DWJA 1KPIA 1Q5PA 1T4GA 2NYVA 1WV1A 1LBIA 2JFNA 1GXSB 3DP9A 3AESA 3QXSA 2RC5A 3RW9A 4REQB 5JSYA 4CV0A 3LHSA 3GQBB 1V39A 5ERYA 4AJHA 1RHJA 1KOFA 3KZ1E 4FX2A 4C7JA 1QGUA 3OCXA 4LNUA 4AKSA 1UBRS 1PGJA 3U56A 3VAZA 5CT9A 3ETGA 4G8CA 2GCIA 1BJTA 1UP7A 4Y2UA 2BHTA 5AHXA 2CYAA 1JGTA 2J3LA 1UBEA 2R6ZA 3EUEA 3OZFA 3GGSA 2PL5A 3P9XA 1WUYA 4TVBA 3PQ2A 1O9GA 3QFTA 4LYFA 4FQ5A 1B8UA 1CY7A 4HS9A 4J7UA 3ZV6A 4KPUA 1J8YF 1DQPA 1VSQA 2WHRA 3EVCA 1P9OA 4IDNA 3IVXA 3HY3A 2BEUA 4PYIA 3RBXA 5IWAB 1VMIA 2WVJA 4YQFA 2BFDA 4LMBA 1Q0QA 5CK4A 2YXDA 4D42A 1WU7A 1VIDA 3CU5A 3EXG1 3W5HA 3KL4A 1Y3HA 1EP2B 1PGOA 4R68A 5EGSA 1S3IA 4XWWA 2VZLA 2J30A 1HFEL 4FYIA 4YJHA 3ZHBA 5BVHB 4CIDA 5C32A 4DA4A 4RD4A 4NPAA 4DXHA 3PL1A 1D1TA 2EYUA 4B85A 2PH3A 1FS6A 1FU7A 1U2PA 3L05A 3PQCA 2DB3A 3HCPA 1EIZA 1KPHA 1MNAA 1BS9A 2ZVJA 2XUZA 1ZUWA 1IZ9A 3BMXA 4G4JA 2NUTA 3U80A 3YASA 4DHWA 4DLAA 3KC2A 5HX7A 3T38A 3SQWA 2YN2A 3HP4A 3L6OO 1C2YA 3IALA 4MUFA 5DNEA 5K0GA 3P2MA 2CE2X 5JJ5A 2BELA 4GRAA 2A9FA 5L3QB 1U7XA 3BVPA 3L4BA 2QDKA 4E5SA 2AYXA 5BN1A 3HYNA 3LOUA 4C6RA 1CQIA 1JHVA 5EUQB 3LHFA 3SYLA 1OBCA 5HF6A 2W6NA 4DMUB 3Q8WA 5JXWA 2R9VA 4XWTA 3FTQA 4W5QA 4NABA 1IXSB 2JRCA 3PUYA 4G0PA 4IOLA 3WRXC 2CZQA 3DL0A 4HP8A 1WIWA 3V1NA 4A10A 5AM3A 1X92A 2WOOA 5KYNA 1KY3A 1TZCA 2VYVD 1JDSA 4QARA 4YALA 1OXTA 3HFSA 1JLLB 3T0GA 1SVWA 2O2JA 2PYZA 1XMOB 1UCFA 3EOAI 4HAYA 2B9VA 5JWHA 3PA8A 1R18A 2A6PA 2DQYA 3B48A 1UDAA 1KIMA 5MGNA 3M49A 4LOLA 1XELA 2IOFK 1RCFA 2A3NA 1U6KA 2EDCA 1PLJA 1WLYA 4LOIA 3STTA 3UMJA 3WXMA 4BN0A 2UYQA 2PZGA 3L7BA 4BO3A 2VHZA 3PNLA 5LWQA 2QENA 2X8AA 4ZT2A 5IYZA 3LX5A 2GM4A 2WIGA 4LPKA 3H9BA 1KBZA 2XTMA 3RVNA 1G18A 1ZI6A 3PS9A 3VO9A 3G17A 4HK4A 4V0RA 2PKWA 1UM8A 4MINA 3W7BA 3CUYA 4QGFA 4FKBA 4RHFA 4C14A 4DLLA 2PBZA 4XOIA 3W79A 1SMKA 1ZN7A 2WJ3A 2FWJA 2W00A 2PE5A 4PU0A 2FPUA 1CT9A 2HNKA 2ODQA 1E5XA 1GUFA 1YZYA 2QX8A 3ZE2B 2O8BA 4LVCA 1C1HA 2DPYA 5G1PA 1HQCA 1GPDG 4XQ0A 2VP4A 2AFIE 5CIQA 3GLTA 5LP6C 1VP3A 1JEEA 4LRXA 4TTQA 3TTVA 1H42A 2NSYA 3RAJA 3NLLA 5ITSA 4HO1X 4I1OA 1VKNA 4KX5A 1AZTA 5JD3A 3FCOA 4F5DA 4JI1B 5LNK1 2JLAA 5KX5F 3E2PA 1EXMA 1UQTA 3KSZO 3NJ4A 3IE1A 2C5HA 1JG7A 1YCDA 4X20B 2FKNA 4IXWA 1DTWB 1RACA 2O57A 3DMTC 3P8ZA 4DBZA 3B7GA 2QN3A 3SAJA 1O6FA 3G13A 4LYDA 4FBLA 3OJOA 4MNTA 1ZGBA 1QNLA 2P30A 1Z0AA 1M2KA 4BVGA 2AD5A 2J3IA 1L3IA 1LX6A 1ZJZA 1IUNA 3CSUA 2WU4A 3H7AA 3WBKA 1T26A 1E1MA 2XOKA 2X2EA 3DKVA 3HA7A 4JLSA 4N40A 2BE7A 4URYR 3U09A 2ZRIA 3IUYA 4MVYA 1FL9A 2QRVA 5CFMA 1TCBA 3QLJA 2FF5A 5CA1B 3N2NA 4XI9A 3DFZA 1NMYA 2LKCA 2NVOA 5C4MA 2GD2A 1N2OA 3RAEC 4M76B 2Y71A 2ROQA 2P9BA 4CG0A 1XP5A 1ZJ5A 5IXYA 1FDIA 3WB0A 2GQ0A 4MPPA 4PYMA 4UMVA 1RCTE 1AMNA 4E2WA 3VYWA 1C7FA 2ZRBA 5E7QA 2OUIA 3MXTA 4I8XA 4E7PA 4HPJB 2FPOA 1W5EA 4EO4A 1J9GA 1D4AA 3VAAA 1D0SA 4WK4B 2JFFA 4A8JC 2CNBA 1VIYA 5JCZA 5SY9A 1GQYA 1EWRA 2BBWA 3EGOA 1XE3A 4X20A 2H00A 3B9QA 4YMSA 5E2BA 5AW5A 1DHRA 1Y63A 2D2FA 1Q6YA 2QP4A 4G24A 3VMFA 5ICMA 5KTNA 2P1RA 2VRCA 4K46A 3H04A 4BQSA 4ENRA 1QPBA 3NVDA 2JJ2A 4NRDA 2OHHA 2R8BA 4GZ6A 3WDSA 1SUCA 4F2WA 2Z1MA 1UK6A 1DO0A 1KSJA 1ND5A 2OORC 1E0JA 1ECGA 5SZJA 5SZHB 1HTBA 2C5AA 4AI6A 1T0HB 2C5BA 4ANFA 3OZAA 4DUGA 3AY6A 5KMGB 2IEGA 1C50A 2EFHB 3QF4B 4TMYA 2O8BB 1WUKS 2DECA 1UPTA 2JI8A 1KQ3A 1PJQA 3EXEA 1YGPA 1VXRA 3R1IA 4NULA 4N41A 3CM0A 4RPGA 4IDPA 2NU7A 4HBZA 4CDRA 2RI6A 4F86A 1XZNA 3T7RA 1U8XX 2QTVB 3DNPA 4ZO8A 3FUXA 4BNWA 1AU9A 2YW2A 4MYSA 1HEYA 1DKNA 3FI0A 1AK2A 3SEAA 3ZHZA 4PN7A 3N76A 3K72B 2QA5A 2KE5A 3F8TA 3CIFA 1JT2A 4XIYA 4Z99A 3WMXA 4IXNA 4MJ7A 5DSTA 2H8KA 1YIDA 1CRPA 4A8JA 2B34A 1ULHA 3A7EA 1BX1A 2MSNA 3H9JA 3ND7A 3IAS1 5EIHA 4TMZA 4M0CA 4IRXA 1DXOA 1Y3CE 1R6VA 1T5HX 1X9HA 1MZPA 1A98A 1K0FA 1VCHA 3QF4A 4IGAA 3GGOA 3T7KA 2Q3CA 1CB7A 4AD8A 4KUEA 1Y3AA 3BSFA 5IZCA 1GGJA 1XDSA 4CR6A 4B3DA 2GH1A 1DLIA 2OB2A 3HB1A 1JHOA 3PI7A 1QH0A 1U02A 2E89A 3RUDA 4BLWA 1V8FA 2O1WA 1U3VA 2ZIXA 4DARA 4ECEA 1QKJA 4E31A 2C2ZA 3I8SA 4JOSA 1C1YA 5A06A 1QIMA 3U1TA 5LMNB 1Y9ZA 4PPNA 5FPKA 1OPRA 2R1TA 1J1UA 1B43A 1AKYA 4TWIA 4N03A 1SVUA 2PCLA 2C42A 1SUBA 2UVQA 1G8KA 1FFEA 2EP7A 3E8MA 4JCCA 4NBLA 3U3OA 1KSHA 3RIEA 3RT9A 1F7UA 5KQMA 5DEIA 4Z8XA 4JVNA 4NPHA 1IVYA 2BTQA 2OOSA 5IJXA 4E70A 4WOPA 2QE7A 1I1OA 3L93A 3C1TA 4LPSA 2OY0A 1BN7A 1Y98A 3LSYA 4FR0A 3EMKA 3EZ6A 4KYTA 3DL2A 1UJBA 1FIUA 4X1IB 2BFDB 1E2NA 2I3ZA 1QBKC 5JSHA 2Z8XA 1I3OA 2V8OA 1FFSA 1SUEA 1VFPA 2IPNA 4GDMA 3SFVA 5FV7A 3SZOA 4ACBA 4OP3A 1SG6A 3GFBA 5C1IA 3TR0A 4MDEA 2P0YA 4NU8X 2P69A 4V39A 3KXKA 3JQBA 3WS7A 4B7XA 5EJ2A 2H1RA 2VRWA 3R3SA 2Z5FA 3GLHE 1U3GA 2IZ7A 1SCUA 2ZP1A 2V6IA 3QX8A 4FMCF 4P93A 1OASA 4D4GA 1A96A 5AKHA 2JI9A 1KEZA 3ESQA 1M75A 1SKBA 4D9CA 5B4TA 2DFTA 1BWRA 4B2PA 1EWQA 3BZWA 1QX3A 4A5SA 3ORFA 5GP1A 3VTZA 4Z49A 5AKYA 2GJSA 3ZJUA 1TW3A 3N7TA 1T4BA 3F2VA 4UMFA 4G0MA 4ERXA 4EW2A 3Q7TA 2IYPA 3E9CA 4BMNA 2Y0PA 1BYUA 1D2EA 3RYCA 4ZZ2A 1A8SA 2VLBA 4EB0A 1XEXB 2PPVA 4EA7A 5LQSA 3GLGB 2CXTA 1AQNA 5BR7A 1UBMS 4ARSA 1KJIA 3D4PA 4MUAA 4ZJYA 5AVKA 3UMGA 3UHFA 1RJ9A 3DR3A 3IC5A 5KWJA 4LJYA 4Y6RA 3PVZA 2F17A 1EB9A 4PFQA 1XDZA 5FUBA 2QRMA 2FR8A 4K0KB 1TVKB 1DKUA 2E87A 3SHWA 5HRUA 3QOWA 1UJNA 2AR9A 1CZKA 2P7HA 1TUEA 2DGDA 2WUDA 4ZAZA 3HYLA 5T5QA 5CGQB 4AURA 1Y9AA 2PFSA 5EIBC 4EBFA 5FTJA 2GNPA 1SQGA 4OXKA 4NXMB 3HPQA 4CPDA 3GGJA 2Q21A 3IQHX 3LCUA 4L5CA 4QLAA 4QRDA 5ALSA 4N7JA 3V8BA 3I05A 3SP1A 4TM8A 3ZY6A 3ZOZA 4G25A 1TNDA 3MAGA 2VIIA 1ZCFA 2GZHA 2XKAA 2JAPA 3FZGA 1L7XA 1YQEA 1G9TA 3V32A 1SZJG 2NVUA 1NA5A 4MYHA 3AWIA 4AFNA 2FOLA 3B9RA 1K7XB 3L8DA 3HSSA 4B3RB 4BVKA 2JLCA 1EFDN 1HFKA 4UW9A 1T8TA 3F3SA 4KX3A 3V97A 2UZAA 3O4HA 5K3DA 1YRLA 2Z2KA 1MGPA 5C37A 2IUSA 2HRCA 1HFJA 1DAGA 1B14A 2FOIA 5K1ZA 4AZSA 2ARKA 4XFKA 1RABA 5AW4A 2H1OA 3VR0A 2DBQA 4D4HA 1D1QA 2DLDA 1Z5ZA 3CPEA 3HGTA 2JAQA 1UL1X 4JNCA 1CRQA 4ZAWA 1QWOA 2XVYA 4YR7A 4LOKA 1AV6A 2QPTA 5B3KA 5JSQA 1QRDA 2CN1A 1M6HA 3CMCO 4GVLA 1N5RA 4R9SA 1YS1X 2X0RA 1H22A 2P3LA 2BFEB 3Q7SA 2C9DA 3WICA 4ZVTA 4M99A 1TCCA 2JIBA 4YBRA 2P4UA 3KB6A 3RTGA 5JC8A 5DOVA 4IJVA 3FCEA 3HNRA 3VHQA 3OO1A 1CBUA 3AKZA 2HBZA 3OTIA 4GS5A 2FF7A 1G21B 1QVRA 2FHSA 2JJQA 3QU5A 1Y1SA 4OV6B 4PAWA 5EIOA 3SXUA 5FUQA 2C3UA 5CXUA 3WK8A 2WTMA 2R79A 2W9XA 4BMVA 5LP6F 1JIXA 5CURA 2FX5A 3EF0A 3VAYA 3KTFA 4E11A 5CG2A 3NIGB 5FNVF 5EYPB 4X62B 1Z2OX 2BM0A 4A27A 3VXKA 1GYPA 3DVRX 1G63A 3IOMA 4D5GA 5DGXA 4WBNB 1BDHA 1GQRA 1ESCA 1VE6A 3ETLA 3TJRA 2ZJFA 4D0RA 2FG5A 5LYJA 2ZBFA 4KK4A 4NATA 4RH1A 4TSFA 1RI3A 3VR3D 2QZPA 2WAYA 2JHCA 4UREA 4KPYA 1BH6A 2V55B 4N01A 5MFZA 4QYXA 2AFRA 2J59A 4LHWA 2LBPA 2NXWA 2OFOA 1YUMA 4ENTA 1ESZA 1U0LA 2OV4A 3TB4A 1XZCA 1IDN1 1AA9A 3JRNA 4L57A 3BD8A 3CWCA 2W6PA 4NZZA 1XAGA 4G0QA 1F06A 1L7EA 3S2SA 3U16A 2QW8A 2REOA 1XCBA 1GSOA 3T41A 1VL8A 2OGSA 2C57A 3E05A 3KB8A 2D1TA 2DBVO 1R0KA 2L69A 1YDFA 4MWGA 3RDPA 1R00A 2CUNA 3KBOA 2OWDA 2QKYA 1FYXA 4XTCS 3BH7A 4DC0A 4YAKA 5BSEA 1JIVA 4IXMA 2F62A 2YYZA 3GVXA 1S4QA 1N5OX 4IDQA 1GAXA 1SBYA 1FFBA 1ONPA 1T5TA 2R6R1 2YFHA 3G9UA 3MOIA 3ZIDA 1O4WA 4BCCA 3SWWA 4FT2A 3T06B 1Z5NA 3GJ7A 2AX4A 1W35A 2VLIA 3DZFA 4BFSA 5MFPA 1JUDA 3KXIA 2BTOA 3JR7A 1LLUA 5EGNA 3ZE6A 1F0KA 5BWBA 1P5HA 4I5DA 3OM1A 3TLKA 4ZJZA 3I5UA 3SHFA 2F1IA 3LM8A 2VNSA 3O0DA 4RMHA 2JGDA 4EYQA 3P9PA 1XNHA 2C5FA 4WE3A 4B34A 3GY0A 2CWDA 1DOZA 1SVNA 1RP1A 4FGKA 3UCEA 3AF5A 1NDHA 1N77A 1CFJA 2IIVA 2Q6KA 1IY1A 3N6RA 2DWPA 2LWIA 3ANMA 2HA4A 1NP3A 4B4WA 3WWEA 2GBCA 4Q4LA 2Q5FA 1QG4A 1U8EA 4DLXA 3HU1A 3WGUA 1Q1BA 3QX3A 4QQNA 1DRJA 4YMUA 1J39A 4FCCA 3WK4A 2RG1A 4KMOA 3OECA 2XZLA 3I3SR 4K88A 4TTIA 1W0CA 2FZGA 4JMLA 3D4OA 5FNZA 3G2PA 3VKVA 1JZQA 4P7GA 3BBPA 2IDMA 1OSNA 1EFVA 13PKA 1QVAA 1RLUA 3LLMA 4MLDA 1V43A 4CKYA 3G8AA 4LQ4A 3K09A 4LXXA 1TRHA 1NXTA 1ZK3A 5DTQA 5LQUA 4MUYA 3S1AB 4RFSA 1V4VA 3SSOA 4YV2A 1RHMA 4IMPA 3U60B 5TPZD 1RYHA 4GL4A 5J40A 4DV7B 1ZU4A 1BTOA 3DS8A 1Y7LA 1OAOC 3UHPA 1Z3CA 2LV8A 1PDWA 4HGRA 2FNAA 1UMBA 4GICA 2WJYA 3MWKA 4UAVA 5I7OA 2BFCB 1LW7A 3A6FA 1UBGA 4UHBA 5JVDA 2WHEA 1C9JA 1VGRA 3BXPA 1JR2A 2Y0DA 2H18A 5DM1A 2L18A 1DIHA 3UMCA 4BVLA 4MIKA 4UM8B 3NHUA 1V7QA 1QWSA 4XWYA 2NUAB 1LGYA 3SZGA 3WHLA 4JYAB 2OKGA 4WN9A 3VPHA 1GFSA 2Q0HA 1J2YA 1F5NA 3DEHA 2BZ1A 1DCKA 4B0OA 4ENQA 4ZAVA 3TPCA 3QBDA 1MAUA 3LBYA 1MUUA 3V3KA 1OY1A 1K5HA 3DBRB 3ECCA 1AN9A 2I4MA 3FCSB 1EVYA 1NN5A 2OHVA 4A2QA 3PV0A 5ELLA 1UOQA 3BDVA 5EESA 1QKKA 1Q1EA 3RQIA 4ZQBA 3TLGA 1GKIA 3I0ZA 1QO7A 4LHYA 5HKKA 3OEYA 1U9IA 4YK7A 4OGFA 1L8OA 5EUMA 2V7QD 4RD3A 1X80B 5AVTA 5DX8A 1ZUNA 3C6MA 4C3VA 2WBLC 3H1FA 1IN4A 4IF4A 3TX6A 4L5BA 4WKGA 4JEIA 1SURA 2ZJZA 3L0DA 4YTEA 4GM0A 4DLWA 1T4CB 2GZSA 3HWRA 5M7EA 5ELMA 3C24A 1Y1QA 3ENVA 1NC1A 2YIJA 3ZE0B 4R1TA 3FOCA 1F1BA 3FYHA 1EFPA 2YN0A 4U6SA 1O6ZA 3G2IA 3OM0A 4TUYB 4FFPA 3O2QB 1ZPDA 5K3SA 4BASA 4J0FA 2ESRA 1K3TA 3DE7X 2WPNA 2L19A 4LBVA 2B5VA 4EMUA 4FFSA 2VJYA 2VQSA 3DKRA 3GIDA 3TIVA 2GO7A 3ZHYA 4QPJC 3KPYA 2ZYVX 3TGPA 2YRXA 1GDTA 1DQNA 3DUWA 2OO7A 4A0HA 1JQKA 3RASA 1JEYB 1OJ7A 1RI5A 4LXIA 2BEJA 2Q9UA 4F38A 5B4UA 1UXOA 4UFOA 5ES4B 3AW8A 1L5ZA 2REQA 1N6IA 2LDBA 4EENA 1B8NA 2Z9CA 3WGZA 2OGUA 3T4UA 3UV6A 1CEYA 3DVAA 4LTDA 2WB4A 1QP4A 3QLVC 1IY8A 2XQKA 1OLUA 4Y0NA 4ETWA 2XUIA 1D0VA 4KQIA 5AESA 4KI7A 1IMOA 5LZ5A 4CF5A 5IEJA 1Z2AA 2VPZA 2MSCB 2POCA 3LRTA 3QKSB 2BBTA 4ZPXA 5EHNA 5IDVA 3E82A 4FE3A 4WXPA 1VG0B 1DIAA 3ANTA 1XQVA 1ZMTA 3G8YA 4CKEA 3GRPA 3EIHA 2BRUA 2JIZD 1LSUA 3OBBA 5A71A 4HWKA 3SHVA 1UK9A 4EX6A 5F51A 3ZZTA 4FEEA 2O2ZA 2EJBA 3FZNA 3DV0B 1C41A 3WWYA 4UTNA 3TMAA 5HUJA 2BFEA 4HNHA 3EDYA 1TKCA 3PJRA 1AXEA 1CR2A 4MW7A 2R62A 4JWTA 2I34A 2NTJA 1MG0A 1SVLA 4YS6A 5L4LA 2X77A 1Q83A 1UC9A 3AVWA 2BGNA 4IM7A 1R12A 3IPXA 3KU4A 1BVHA 3IOEA 3EWNA 3PNOA 3KCQA 4YCSA 4N0MA 4R6XA 4BO8A 3AXSA 2P78A 3TE7A 1MHTA 1BXGB 2AN4A 1NJ2A 3T1VA 4C6TA 3HJFA 1CZLA 4RF4A 2I76A 2FMIA 2V5UA 1RJEA 4D57A 4EG1A 3ZDDA 2WIBA 1H8HD 4CI9A 1R6AA 2VK2A 2HL6A 4ZV7A 2F8MA 3R3HA 2WPDD 4MI6A 1XTUA 4YPVA 5HVNA 1XZ8A 3HXQA 3GI1A 4Q15A 3T5DA 3PXBA 2WICA 1O4VA 3A4MA 3L8GA 5KJCA 3LT0A 3NTXA 3U0VA 3AU9A 5C8VA 2ODAA 3BYZA 5EFOA 3ML1A 1W87A 2P8SA 2VH5R 4LTMA 4M6WA 3V6LA 2FSIA 1W0JA 2RH5A 3V4FA 3VR6A 1Y9JA 4PYNA 3C5HA 3D64A 5CLLA 3ZQJA 1XX6A 1H2FA 3M4ZA 3O4JA 3BGVA 4GNRA 2B37A 2W43A 3HUFA 1SBTA 2P27A 3K0EA 3QWAA 1TGVA 3EFEA 3AF0A 5GGXA 1DQZA 5FA6A 4AS2A 1QH9A 4B3BA 4AQDA 1G2PA 1R0LA 4WGFA 1ARZA 2VF5X 3Q87B 5KKCA 3K6SB 4BE4A 2TMYA 1L5OA 4Z5XA 3L1HA 1CUGA 4ZV4A 3Q7IA 1YZKA 5KWEA 1E6UA 3IBTA 4G67A 4M89A 4D4KA 3B1JA 2PGIA 1O96B 3KLOA 2QD1A 1DMSA 3KQVA 4N9QA 3TOCA 4AVYA 4Y2PA 1KFEB 1PSDA 2P0EA 3Q0TA 1D09A 3D3KA 3ZIAD 3TEFA 5C9ZA 1ZCZA 4Y6PA 2O07A 2FFBA 2I2XB 5J4KA 1QAMA 1X8LA 4ZCLA 3WGMA 1Z28A 5IJ0A 1PEAA 1EA7A 3GVIA 5HBGA 4D99A 4KAJA 5KQGA 4YXFA 2CMDA 4TV9F 4KP7A 2QQGA 5FWXB 3DHNA 1PR4A 5BV8A 1G7RA 3WIUA 2VXOA 3D6VA 4S1WA 1DC5A 2VCEA 2VTBB 1KDOA 3ZDZB 4N0QA 5BUCA 3IEMA 5C46F 3ETNA 3I6QA 4KFRA 1VZ2A 3E9RA 2TRSB 3OA2A 4HAIA 4C5AA 3MTJA 1FRFS 4RO0A 5JMOA 3MTEA 4YEDA 3OHPA 2Q46A 3SU8A 5EHXA 3LWDA 4OIFA 3TAHA 1XEFA 3W5SA 4F2GA 2FLVA 4OGLA 1E3MA 4EYGA 1ZN9A 3PA6A 4PNPA 4PZPA 1CJKC 2BYTA 4R9RA 2R5NA 1PDVA 3OZXA 4JI6B 2G08A 1TQ8A 2XRYA 3D3NA 1MVNA 4XX1A 3M6IA 5TGTA 1NBMA 1RADA 3BULA 3OCUA 4B6GA 2GN2A 2EJTA 5AJVB 5K8UA 5KYTA 4NWIA 3GCXA 3GEBA 3KKMA 5H4GA 1P7YA 3HLYA 5EUBA 1X86B 4NNOA 3H8WA 3LP5A 3HACA 5IKPA 8MHTA 2E4UA 2FTKE 4HS4A 5EPUA 3DOEA 4NMWA 2X3UA 3AM5A 4LI0A 1UC5B 4NCXA 5FORA 4BFWA 4HSEA 5IK2A 3S7ZA 4UTRA 1JAHA 3KEMA 3EXEB 1OWLA 2P67A 1ORWA 3GF4A 3RLFA 3ZY2A 2OSVA 3NEYA 3I23A 2ZIXB 2ZIUB 2ZR0A 3IQZA 2SKCA 1T3TA 1QF7A 4P53A 1KO4A 3WDLA 5CDTA 4I5EA 2BSAA 2QAGB 3H18A 4UBKA 1DXHA 2VDWB 5JJKA 3C1AA 5F1YA 2PKQP 5DTMA 4MUBA 3L9XA 4KZKA 2R8OA 1ZHHA 4J6EA 1KP9A 4C89A 3AEKB 1MW8X 2R8PA 1NW5A 4KK3A 1EP3B 1JJIA 1EVZA 1NQOA 1XDDA 4TLBA 4NZOA 3FN4A 3WIDA 1E1YA 4MK4A 2VH2A 4FMDF 4XGQA 2WC1A 2FN7A 4IYRA 4L9SA 4EAAA 2JIMA 4ZYWA 1WZEA 3I0NA 1YFLA 2D7CA 4TT3D 3EISA 2Y1WA 4V1CI 4L9RA 4DRXA 3DZBA 2H5LA 1Z5UA 1PR0A 3CPSA 3PHHA 2XXAB 1JR6A 1U5BB 1URPA 3B1KA 3DLTA 2R4QA 2ERXA 1OYYA 2ZKIA 3AKCA 1ZG3A 1XRRA 3EGWA 3PDUA 4UNNA 1L7MA 1XYGA 4XSVA 5FWDA 4C7OA 2IVZA 4EGSA 1FQOA 2I8LA 3NYRA 4LHSA 2QMUA 1J8VA 1RRPA 2IUEA 4YMHA 1XQ6A 1XROA 4JBYA 3N5CA 4UEOA 5AOVA 1U8FO 3U44B 2GKGA 1O58A 2C7RA 3G82C 3CH6A 3BMOA 1SA0A 3WL3A 1TAGA 3P2EA 2WA2A 1XI2A 2WWGA 4RMGA 4WKNA 5IEBA 1G8MA 1A9ZA 1RYYA 3G2KA 1H1LA 1PYOA 4C06A 4BNKA 3KO8A 1ZH0A 5EC8A 1ECFA 4A0FA 5CRIA 4PPQA 4DV5B 4WN3A 3ZWXA 3HVJA 1Q0HA 4CU5A 5KKNB 1GTRA 1EVKA 3A1VA 4FK8A 3KKOA 1N1EA 2WUGA 1GCAA 2IXDA 2PJUA 3HC7A 1Z6ZA 2J45A 4I5FA 4OIMA 4GM1A 1TECE 3OE5A 3P32A 5I4IA 1UZLA 3O3NB 1QJ4A 1QH8B 3FMVA 3Q1LA 3CX7A 3IAEA 4KFUA 5H8WA 5F77A 2F1JA 4KACA 4OX9Y 1WZCA 2BH2A 1O9BA 3I2IA 5A2GA 1EX7A 2M1XA 1J33A 3CZRA 4MO9A 4DCNA 2RJOA 1CPYA 2QD2A 1W44A 2W0SA 3H42B 4N0PA 1DIGA 4GX1A 1C30A 4NS1A 4Q1EA 1M2JA 3WV5A 3S1SA 4HDNA 1OXXK 3LE8A 4J0HA 1I2MA 3VC3A 4A36A 4INOA 5JJLA 1YQDA 2PLFA 5G1NA 4UD2A 3NAGA 3UAOA 2JJYA 2OEPA 4Q1AA 4DQLA 1KTIA 2IXTA 1X7XA 2CDAA 2XE7A 2C82A 3VYRB 3EB9A 1WCWA 3KKZA 2G72A 1MG5A 1YS2X