4LSZA

Caspase-7 in complex with darpin d7.18
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
YQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-7 subunit p20
publication title Combined inhibition of caspase 3 and caspase 7 by two highly selective DARPins slows down cellular demise.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 51
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lszA00
3V3KA 1K86A 3GJQA 3NR2A 5IC6A 1RHUA 3D6FA 3H1PA 1NMEA 4IEFB 1PYOA 2K7ZA 4EHFA 2J31A 2C2ZA 3R6LA 3EDQA 3R5JA 4JJEA 4QTYA 4HQ0A 1SC1A 1M72A 3S70A 1GQFA 4N5DA 4HVAA 3H13A 5IAJA 2C2KA 3SIRA 3DEIA 3E4CA 1I4OA 1SHLA 4FEAA 1RWOA 2CJYA 4NBLA 4FXOA 3BIJA 1PAUA 1CP3A 2QLFA 4M9RA 3KJQA 5LU9A 4ZVQA 2HBZA 5IAEA 2XYHA 4QUDA 2WDPA 4NOMA 4PS1A 2QL7A 5IANA 3D6HA 1RWKA 2XZDA 3H11B 3UOAB 2H54A 4LSZA 1SHJA 1ICEA 2FQQA 3V6MA 4N6OA 4D3XA 1RHMA 1RWNA 3DEKA 4PRYA 5LUAA 3DEHA 3RJMA 2J32A 4N7JA 3IBFA 4ZVUA 1NW9B 4JJ8A 4FDLA 3K7EA 1F9EA 4D3YA 4ZVSA 2H4YA 3H0EA 4DCJA 1GFWA 1RE1A 2CNOA 4HQRA 1QX3A 3R6GA 4FGUA 3V4LA 4JR0A 2DKOA 5IBRA 1RWXA 4QU9A 5IARA 4ZVOA 2NN3C 1NMSA 4ZVRA 5IABA 2AR9A 4QUAA 3P4UA 4AWAA 4JB8A 5LU8A 1RHQA 5IBPA 2XYPA 4D3ZA 3KJNA 4I1RA 4QULA 5I9TA 4JR2A 4EHHA 3D6MA 2HBQA 3EDRA 1K88A 1SC4A 4NBNA 1IBCA 2H48A 1RHRA 4QUIA 2C2OA 4NOJA 3PD1A 1RWPA 2CNNA 4N6NA 2CDRA 3H11A 5IASA 4N7MA 1KMCA 4QUBA 4EHDA 1JXQA 1CVRA 3GJSA 3OD5A 3ITNA 3IBCA 3GJTA 4N6GA 1RWWA 5I9BA 3V55A 5IAKA 4NOLA 4JR1A 3R5KA 4PRZA 2Y1LA 2H65A 4JQZA 3R7BA 4EHAA 1I3OA 3QNWA 2H5JA 3S8EA 2QL9A 4NOKA 2J33A 5IAGA 2QLJA 3NKFA 4AW9A 3KJFA 2CJXA 4QUEA 1RWMA 2FP3A 2CNKA 5H0IA 2H5IA 2H4WA 4QU0A 1BMQA 2C1EA 5K20A 1F1JA 1I51A 4NBKA 4QUGA 4QU5A 5JFTA 2P2CA 4EHKA 4QTXA 2J30A 2FUNB 4QU8A 4QUJA 5LUBA 4I1PA 4ZVTA 2QLBA 4PS0A 2XZTA 5IBCA 2CNLA 4DCOA 3R7NA 1SC3A 3P45A 1RHJA 3SIPA 3UO8B 3V6LA 2HBYA 4ZVPA 4AWBA 2H51A 4IYRA 3NS7A 3R7SA 3V4OA 2QL5A 1I4EB 4DCPA 1QTNA 3PD0A 4QUHA 4EHNA 3GJRA 1NMQA 4EJFA 5IC4A 4JQYA 1QDUA 2XYGA 1RHKA 3PCXA 4JJ7A 2Y0BA 2HBRA 3DEJA 2C2MA 4EHLA 1RWVA
chains in the Genus database with same CATH superfamily
1G8JA 1MAHA 1WXGA 4JZKA 3L0SA 3V3KA 1T5OA 2AD5A 1EAMA 1J5PA 1NJ8A 2RI1A 3Q7EA 4JLUA 3U6BA 1YVEI 3TNLA 3V2GA 4YAWA 3TTWA 1K5GA 2VAXA 2CHQA 3EDQA 3UOGA 1UP7A 1E79A 1VPDA 2V55B 3Q3HA 4QTZA 3KWMA 4KO1S 1D2NA 2X9VA 1FUIA 1T9GS 3TMKA 4U3JB 2XKAA 1QR2A 1EVZA 2E21A 2GILA 1POWA 1QGDA 1E5LA 1KQPA 2RJ3A 1SC6A 1FFXB 1DC8A 1ECCA 2FZ4A 4O4JF 1PIWA 3PT9A 1Y3CE 3U7EB 3CS3A 1KU0A 4ETIA 5ULLA 4P7BA 2XKKA 1M2OB 1Q6ZA 2HNAA 3PXEA 2QXTA 3V6MA 2D74A 3GFPA 4MK4A 3PWTA 1JGTA 1TZCA 3ASZA 3BD6A 3QG5A 1Y0BA 3TGWA 4JNKA 5FBHA 2DTXA 3IBFA 2P9HA 2R8OA 1JQ5A 3PC7A 1MA3A 2Q5IA 3WB9A 4ZIRA 2I8CA 1E64A 4A9AA 2QE6A 1NVGA 3V1LA 1E6EA 2CFIA 1QBKC 2B0JA 4IIVA 5EJ2A 3RHTA 4P7GA 4CTNA 1EFVA 4JLOA 3R7FA 4E12A 5BN5A 3WHLA 3DDNA 1JR3D 4MB2A 5I9TA 1AKUA 2BR4A 3QOYA 4ARZA 1WCXA 4H7JA 3VI3B 2CV2A 1FB5A 2VDPB 5JSQA 1NWCA 3AQIA 3KTFA 5B3KA 5K0BA 3M4XA 4IYJA 4NYIR 5TRTA 3T94A 3TR0A 1IIBA 4OQDA 2CMGA 1V3QE 2PRYA 3GCZA 1TEZA 4KREA 1XZJA 1Y3BE 2QPTA 3TNFA 1P2BA 3JPYA 4RK0A 1L6RA 3T7JA 4EG5A 2P7HA 3K9FC 4JROA 3LZ6A 3EEBA 4DV4B 5H9VA 1EFTA 3DL7A 1PFYA 2FMXA 1M7GA 4AY2A 1KL7A 2D4HA 5GGYA 3OPMA 1Z3CA 2FMIA 1QX4A 3AIKA 2VC2B 2B83A 2ES4A 1DJOA 1L7NA 1YUMA 1ONOA 3D8RA 3RG8A 3THSA 1PZGA 1JT9A 1WQ1R 1QXSA 3KQYA 3KKMA 3QVKA 1T5HX 5AK6A 1WD7A 3RJTA 4L4XA 2Z4TA 3N9IA 3TBKA 3UJAA 3UVEA 3V1UA 1FS6A 3WGTA 1J90A 2HA3A 3K3PA 4KR3A 5ALMA 3DE4X 4MVJE 3RVNA 2PSDA 3PK0A 4DUZB 5G40A 3C14C 5AM5A 1JQKA 3F6CA 5HKLA 2VJCA 4OO3A 2BTEA 3BRCA 4F4HA 4O4JB 2Z8YM 4FHEA 4YLEA 3PENA 3FB4A 4MUMA 4M1SA 1PV1A 1BXGA 3C3DA 4UXJA 4L73A 1VYTA 3SZ3A 4G0UA 1ZO8A 3EEYA 3R77A 2ZJOA 1LBIA 1Z28A 2V7EA 4WESA 2XQKA 3LC7O 4KMSA 1DJNA 4QLAA 1TAGA 2HK8A 4ZVPA 2QN7A 3JV7A 1P1IA 3ZS9A 4YN3A 1II8B 4TX1A 4YDHB 3CZPA 2OBMA 4B3XA 5TPZA 1SXHA 1CE8A 1ESNA 2H9AA 3NAGA 4FEYA 4GQBA 1G66A 4PE5B 1NN3A 2PGOA 3U0VA 5KX5A 4YAOA 1Z2CA 4H1WA 3KNZA 2IV2X 3V1NA 4RW0A 1E96A 3TNDA 1M34E 1U9IC 1SIBE 3M9XA 3OPQA 1XD8A 1YS6A 3C7AA 1E32A 3E3MA 5ALQA 1XZQA 2BBTA 2R2AA 1PLJA 2DHEA 1HKUA 1TTHA 3K9WA 5EUQB 1JZSA 1N3IA 5CTAA 1KMNA 2FNAA 2C3YA 2ZSEA 3LL4A 4FR5A 3AESB 1PR6A 1XXHA 1H4TA 1IC6A 3EW9A 5HVNA 5HZKA 3DHEA 1OGIA 3JQGA 2PWAA 3NASA 3ESZA 1HDEA 1QAMA 3EY9A 3NO4A 2CJYA 1JDNA 3AHGA 1FYXA 4BMSA 4LXYA 1W4ZA 4L8YA 3DE3X 4PTZA 5FBWB 3IIIA 5CT9A 3H2BA 4ZVKA 2HKIA 3ROEA 2YYZA 3P71T 2RBEA 1T4DA 1XEWY 2G6BA 3JD1A 1I3LA 4QPJC 4AVYA 3DTVA 2Z6AA 1P80A 3QUTA 1GG2A 4KXMA 1OYWA 3TH5A 1QS0B 1SBTA 3MJDA 1N8SA 3BULA 4WA8A 3L43A 4OGLA 3KJGA 3AVXA 2H2IA 2JFBA 4RKWA 2XEDA 1QC5B 1HLPA 4TQUS 1D04A 1WSWA 1G5HA 2NU6B 2IQIA 1FU7A 2X9GA 5JV5A 3X2FA 4TRMA 1V8PA 4OHVA 4IHQA 3KU4A 4RVOA 3P97A 1XTPA 1KTVA 1GFWA 1S89A 3KWLA 3PXCX 4LZWA 1M6VB 3U1VA 3IL2A 2C83A 4KAXA 3AI7A 4ZI7F 1RSZA 1P74A 1W4BA 1IUPA 1JEQB 1VCNA 2FKNA 2VF2A 3IO5A 3C7CB 4D9EA 5DNWA 3SNKA 4PIVA 3ROQA 4HB2A 3G2HA 4AO6A 3FUWA 4FX2A 4KDRA 4PX2A 2FF5A 3I12A 3SX4A 4NMLA 3CX8A 1F51E 2MHCA 4Q1FA 1U3CA 3LFHA 3DV0A 2DKNA 1ORVA 5HK8A 2J0VA 1JDTA 4I46A 3GK3A 2QTVB 1V8OA 1N2XA 3NGLA 4RKEA 1O97C 2X13A 2ZSBA 4PLTA 2FXIA 3FWYA 3C70A 3EMDA 3K0AA 3KVNA 5EXEA 4BB9A 1GILA 2FWMX 1N7HA 5DGTA 3LDUA 4YALA 1G4UR 1AGPA 2N9UA 3U4QA 1TAUA 2JFOA 1RS0A 4DJAA 2XY4A 4GGPA 4G0WA 2EW8A 2Z57A 3IDAA 1NZFA 3RPEA 4C4RA 1YACA 3W2HA 1G63A 4LF6B 2ZG6A 4N3GA 3QKSA 4D9IA 1KBQA 3OEHA 1UIRA 3C4JA 5CDSA 1KAEA 4HRXA 1KOLA 2RB5A 3QVGB 3LUGA 3TZEA 4FFSA 1HR0B 3KE8A 3WC4A 1ZJWA 2AVNA 4ARSA 3EW7A 3S8EA 4TV9B 2I4RA 3HV0A 2MYNA 1ENYA 5IDVA 2O1SA 3C39A 4P31A 4R0MA 5EJ6A 1NJ6A 5EJ5A 4GMKA 1L7XA 2H5IA 3R0JA 1GTJ1 1DAMA 2J4CA 3FOCA 4G2NA 3AG5A 1V2HE 3FM9A 4UDYX 2XGOA 1J2YA 1QIKA 4NZYA 1PR1A 1HDZA 4HR7A 1WDLA 3MCUA 4XWTA 3K09C 5U4QA 2FDXA 4FR2A 3ZV5A 4BZXA 2CDAA 4RZIA 1PJZA 2GPNA 2V7PA 4UHBA 3BWDD 1U9IA 5IBQA 1TZBA 3HBMA 4D5EA 3D0OA 1C7EA 1KKLA 3D3NA 5PGMA 3TIVA 2YOGA 3QEJA 3GXBA 2WQ7A 2RK4A 1CUHA 4R1NA 5DDIP 5BRJA 1LBHA 1F7VA 1PNTA 1MOPA 2HA2A 2HH9A 1QQ6A 4QGBA 3GPDG 4DABA 2D1RA 2YJNA 3C6XA 3JQAB 4UNQA 4PY2A 5E2AA 1TLFA 5FL7A 2FU5C 3LUPA 4IWNA 4XLTA 3UICA 2CHFA 2OQ2A 4EJFA 1WVMA 4D97A 4JB3A 5H82A 1FRQA 4LJYA 2BHLA 4JJ7A 4BTLA 4ZZ0A 4ZI7B 1G2OA 1KI7A 3AUUA 3OUTA 5CH5A 4BX0A 1W0JD 3H1EA 2B21A 1PS0A 2OZLB 5ALPA 2JH9A 4X1IB 4IIJF 3BM5A 5AVKA 3DNMA 2QZZA 5JYEA 3SQOA 2WG0A 2C2ZA 3HYRA 3OOYA 5IJ0A 1IEWA 2FY8A 2HJVA 4LA4A 2HRZA 3IV6A 2OFXA 2HJSA 3ADPA 3QI7A 1CZUA 1XNQB 4WXRA 2FPXA 1FLDA 1DBSA 4QYMA 4ZO6A 5AK3A 3QHPA 4LJKA 2VSNA 1Z12A 3RUDA 1UJNA 3B13B 1KF0A 2H57A 2RH8A 2VVTA 4HQKA 4IRXA 2IITA 5LP6F 3ILVA 5BT8A 1EFCA 1Y37A 2Q21A 2FN9A 2ZRLA 3Q3EA 5ARCA 1C9NA 5IM5A 1M2HA 3PWZA 5JJCA 1MJNA 3AX6A 1PP4A 4AY3A 4ND4A 3VOAA 4BU0A 1ZIDA 3ZOKA 1BCRA 2FQXA 1YI8A 2FQQA 4BCCA 1GNTA 4X5OA 3D6JA 2I6QA 3EVBA 4CLOA 3NX4A 4J0EA 2VQDA 4RTNA 1VHLA 1Z2NX 4FZ5A 2PX8A 3H16A 3OKAA 4YWJA 5JADA 2CNWA 2CXXA 3PTZA 4MWTA 5KJ1A 2FSGA 4LMBA 4AZWA 3DCNA 3KTOA 3N2NA 4Y9RA 1XZPA 4MQEA 1UBEA 4ZTBA 3ICPA 4U3JA 1G5PA 1H42A 4G0OA 2P35A 1B00A 3FGPA 1VCHA 3TWOA 3UG6A 1E2BA 1YB6A 3O91A 3L7CA 1FFXA 1PT6A 5JXGA 2ZRJA 1ZZEA 5ELLA 1FPMA 1PG2A 2FB9A 3ZCTA 5HR5A 1M2GA 4HEA6 3HBNA 4D3DA 3WA7A 1PEAA 4V0QA 2EF1A 1Z2EA 4N3BA 3KSUA 2BKVA 1XELA 3HYLA 4I9HA 3TCXB 1M2OA 3UHAA 3FNRA 4ZGBA 4WFJA 3K09A 3FRHA 4DMHA 1P91A 1I6KA 4KQ6A 4PV7A 5I7EA 2PN1A 4NBRA 1LV7A 5D51S 4YUYA 1E9RA 5B36A 2IYRA 2JD2A 5AKYA 4Q02A 3ZJYA 3I37X 1D2RA 3NAZA 2Q2OA 2QG4A 2QN1A 4D0LB 1DV1A 3F47A 4DQ0A 3AEKB 3BRWD 3OY2A 4V38A 1GO2A 3FI0A 1BEEA 3G89A 3ZU6A 5AW5A 1U5AA 2B5WA 2FWNA 1DPGA 3RYCB 4PSCA 3VR3A 2Q9AA 2GBFA 3VJLA 1OQAA 4ZU3A 1W96A 1YL7A 2CDBA 4EYOA 1NW6A 3RAFC 1B8PA 4LV8B 1RI3A 5KNDH 4JEIA 4QU0A 1VBFA 4UUMA 3HUDA 3NJ8A 3C7TA 2GJ4A 2YXPX 1JA0A 3A11A 2I4MA 3D54D 4Q7MB 4W1RA 5LP6B 4CQMB 1T9ZA 1F38A 1WZNA 3NTLA 1FK8A 4RKRA 2ZVPX 3ETDA 2D7CA 3HCEA 4TTRA 2ZR0A 1K8YB 3NM5A 3Q40A 1K9SA 1IU9A 1XCPA 1XZFA 2BDUA 3HXOA 1C1XB 1MO5A 3T54A 4MUFA 2DMRA 3IAS6 3BD9A 1XZIA 1SBIA 4XD2A 221PA 4QOSA 2E1RA 3N0TA 4J90A 1DDGA 5GZ1A 3NALA 3F3SA 3AP1A 4X84A 2X9QA 2O5EA 2NP7A 3EVCA 2C94A 3OIUA 5EKSA 3OT4A 3LZCA 1JR6A 3QU9A 4F86A 1Y9AA 3OZBA 2WQZA 3CXRA 3VZPA 3JARB 5HDQA 1CF4A 5TVKA 1U0RA 2HCBA 3PPVA 2ICAA 2XMCA 4DR4B 3HUUA 1B1CA 3C3PA 1K4MA 2IPAB 4MULA 4O4JA 3RSZA 3TRHA 1Y6GA 2JATA 1OCEA 2PJDA 3UWKA 4Z51A 2P30A 3P2EA 5ICSA 1XUOA 2XWJI 1HBJA 3PJGA 4PLGA 2XCUA 3SLKA 1GYPA 2ZK7A 3HZZA 4EOGA 4GPD1 1BEUB 1LK5A 5JO0A 2WNSA 1WU7A 1CY7A 1DIAA 3GLUA 1WSBA 3CNEA 4UCFA 3FMFA 3B6KA 1U0JA 5BWBA 1II8A 1QB7A 3WIUA 2OSBA 3HJCA 4O59O 1JFLA 3OETA 4RK7A 5H8WA 2H8GA 3KPVA 4WV3A 4BEWA 1UUFA 4FNGA 4BFYA 3ZYZA 2QK4A 4FT4A 1FFCA 3WRVA 4YMGA 2ZJ2A 1EK5A 2EYUA 2DUJA 2I7TA 4E2ZA 2Z04A 1RBYA 1X1QA 2AHOA 3GIDA 4Y6OA 5GV7A 4BO9A 2J4FA 2IK8A 4WLOA 4B46A 1TKBA 3QJGA 5AKJA 4DV3B 5KNCD 3UMYA 1ZIOA 2XXJA 3W7VA 1LNZA 1XRSB 3AESA 1VSQA 2QG6A 4WINA 4E5NA 1QWOA 1AF7A 2VKTA 1JIXA 2O7NA 3FSGD 4IG4A 2IP2A 2F3UA 3HEBA 3BQMB 3KJNA 1V11A 2VP2A 3OLXA 2Q4RA 4LTMA 4F5EA 4EHHA 5IH7A 1MX5A 3QRWA 1XXHE 3ENVA 2OK7A 4ZQFA 4EJSC 3Q72A 2E2WA 1DIHA 4G25A 4X7PA 2ID9A 1QS0A 2IU4A 2WIFA 3KU1A 1PLLA 4DV1B 2WSLA 4LC0A 3A70A 1DB3A 3FB1A 1X9HA 3GB9A 2QPAA 4FC7A 4REMA 5DGHA 4URUR 1QC5A 3WLSA 6NULA 5AUOB 4F9GA 3UANA 2NU6A 3PQFA 1RQRA 1GT91 3GWZA 2EJUA 3P0IA 2IEYA 3VTZA 2Y1LA 3MTIA 2VHZA 4QFBA 3NHFA 1O08A 4DR5B 1XYVA 4P2BA 2X0DA 1PT7A 1IOLA 3RREA 1CUEA 1GA4A 2PS3A 3PEUA 3AJ9A 1M6VA 1NLYA 1Q0UA 1JEQA 3W77A 1JKFA 3IB3A 2WWXA 4XR4A 5GPBA 1RAHA 1E0SA 4XIYA 1LSJA 1GD1O 3EIUA 3M3DA 5DASA 1AURA 4X6LA 1PJSA 2CCKA 4BQEA 2XNDA 3FYSA 1L5OA 3WLPA 2QTVA 2VJQA 4NFHA 5LZ4A 4EM6A 4Z0NA 3RSSA 2PFKA 1XN1A 4BBJA 4M2LA 4DTCA 4BO1A 1N78A 1K6IA 1MB3A 2ZDQA 3T3GA 1U6JA 1L5GB 1XCJA 1Y7TA 5C1BA 1FSSA 1HDYA 1XTRA 2W83A 2HWXA 2JGLA 3AHEA 1E18A 2FVXA 2DTEA 3RO7A 3NQ41 5K3AA 4EHNA 2PA3A 5EFOA 5C2JB 4CMGA 3B6JA 4E5KA 1QYWA 4TV9A 2CYCA 1ZN7A 1AF4A 1CT9A 1MB9A 4DLKA 2EQ5A 1OPRA 1HDIA 2ODTX 1BX1A 3JYHA 4JXJA 4KCGA 4TOIA 4YQEA 1RWVA 1H2HA 1J56A 4IZIA 4BDSA 4Y6RA 1K86A 1BMDA 4S2EA 4C2AA 4YRIA 5ILGA 3WO0A 2HLPA 2YWJA 1R2QA 2HM7A 3LQRA 4LW8A 4C14A 5M29A 1GQRA 1X1BA 2JZCA 3KSAC 4UD2A 4JV5B 3NYRA 4P2GA 4QO8A 1UJCA 4QTYA 3HM2A 4JJEA 4C6RA 1O0BA 5BXQC 1X80B 3PR3A 1C50A 3A1CA 4PONA 1W46A 3CR7A 4IEIA 4FYYA 4K03A 1RTTA 2VZ8A 5TNXA 4AS2A 2YRXA 1EUDB 1KY2A 4NBLA 3TSWA 5L4SA 4AS3A 4XIIA 4YCLA 3IXLA 4GUDA 4E7PA 2Y9PB 5DXFA 4X00A 4YUVA 1WOYA 1IZZA 4M38A 3AKEA 1ODFA 2P0YA 2QE7A 2WUDA 4DV2B 5SYNA 4DV7B 1DQZA 3CNQS 4XWOA 3O3CA 4GR9A 2C84A 4WW0A 1XD9A 4ZI7A 3WGYA 3S81A 4EJSA 4QG7A 1G59A 1YTUA 5LP6C 4RD3A 2XUHA 1T9GR 1W4AA 3NAMA 2PL1A 3DAYA 3GRRA 3L1VA 3CPJB 4IW3B 4PRYA 4B17A 4TS4A 4O2AB 4BUJA 4D3FA 1NXTA 3WGLA 4FDLA 2HHAA 1L9XA 4V0MA 1PZMA 3O1IC 4JCCA 4FGUA 1U8EA 2A9RA 3SOZA 2ZROA 4FMDF 3H9GA 4BV8A 4DDHA 4XRRA 2GXAA 3COSA 3GJ4A 4Z6KA 2AR9A 1ZGCA 3CMCO 3KYBA 3NC4A 4YH1A 1G2PA 4CIWA 3V4FA 1TVKB 2L69A 4CCWA 5KHOC 2XWPA 4Z5XA 4MA0A 4OHBA 1I14A 2QNBA 2WVHA 5A62A 2W6NA 1YRLA 3DMPA 3TKAA 1U0SY 2X2PA 3PBKA 4GC5A 5HQ3A 3TLGB 2WWHA 5DNUA 4IIHA 1ZM2A 3GT4A 1KETA 4PC6A 4WTOA 3UTDA 3IQFA 2HV8A 3NV9A 4AROA 2A59A 5LWQA 3IHWA 4KRXA 4IJUA 4MV3A 4MUXA 1OC4A 3W2FA 1EK0A 4EKEA 1TLLA 3J81A 1ADFA 4LEIA 3WMRA 4DIKA 1KO8A 1MPXA 4S05A 5UKDA 1J8DA 3I32A 3OZ7A 4EITA 1AN9A 1JG6A 2BFFB 1M0WA 2XUJA 4OLFA 9GPBA 3WA6A 3HBLA 3TSCA 3CTPA 4TVOA 4A8PA 5JAZA 2PZEA 1JBQA 5C1DA 4H18A 2A5YB 4UUNA 3M6AA 1HE8B 1PGPA 3ESDA 2NSDA 3NTOA 4E1BA 2A1UB 5DXAA 4Q3NA 3RRFA 1YULA 4AKHA 1Y9EA 1X0XA 2YJ3A 4CDRA 3BHJA 1X8JA 5JMWA 4BVJA 3NP9A 2OB1A 3B7PA 3N2KB 4PNZA 4E08A 2FLVA 1GGNA 2DBVO 2DX7A 1UPCA 1SOWA 2FXVA 2VSYA 1TKAA 4R1UA 1XX6A 1Y1SA 1J2JA 2VAPA 2P11A 2R65A 1SQ6A 4NMHA 2W2XA 5K0ZA 1T3GA 3QXXA 1Z13A 4MQBA 3RYCA 3MUEA 4PNHA 2A9PA 3M6FA 5CU7A 3EULA 5IUKC 1VGRA 1B14A 2P4HX 5FNZA 1T2EA 2I6SA 4PBSA 2JRLA 4ISCA 4EUEA 1BXKA 5TJHA 4CTOA 5J47A 1SPBS 1G9SA 3DKVA 4LCBA 5LP6A 4IWXA 4CQMA 3C6YA 1XHLA 1FFHA 4OJMX 1J1ZA 1GSOA 1Z6XA 1FBTA 6LDHA 5AVXA 1SXPA 3WIEA 1B8OA 2BE9A 5JCJD 3IIKA 1C1XA 1PS9A 3OTHA 3TOXA 1Q12A 3H8SA 3L06A 1VJ5A 4DWVA 1UQUA 1YC5A 2J67A 3H1TA 1DBIA 3C8ZA 3LUBA 1B76A 1JW9B 5EXDA 1ZN8A 4ESVA 1PW7A 1L5HB 1FSZA 4QUDA 4CL2A 4X6YA 4RPGA 2P9CA 4FDTA 1ZK1A 3NBZC 4WJLA 3CVVA 3P0RA 1BA3A 1SVSA 4R0NA 1W0KD 3JVVA 3IIJA 1VCOA 3DFIA 4ARVA 4YGXB 1XZCA 2G40A 4G5HA 2ZB2A 4JL5A 2G8NA 2OFWA 3JARA 2MR5A 4UFOA 3W4KA 1WVIA 2LIPA 4DMFA 1BROA 2YXEA 1FP1D 4IRUB 1GFIA 2WABA 2R86A 4AMZA 4Z4IA 2UUOA 3OTQA 4AI6A 3QUBA 3K7EA 3R6WA 5TQ2B 1WBBA 2EHDA 2B9VA 2BGWA 1MPTA 3CCFA 3T7IA 3JRNA 5BNZA 1CVIA 1EM8B 2X2OA 4N82A 1LV8A 3BILA 2Q28A 4EI8A 1N0HA 3OC6A 5TSDA 3AR6A 3E9RA 1BXRB 3ED5A 4Q1EA 1GHTA 1X7GA 5GONA 2ACKA 3UWSA 2V7GA 3PDHA 4ENPA 1GDTA 5IEJA 2XLBA 3IPRA 3HDQA 1N9KA 4FE4A 3IIMA 3PR2B 1Q77A 2H4XA 3M1AA 1QZ3A 2ZTUA 3MMPA 2YVQA 1JHXA 1QTRA 3GPCA 3OWOA 2GK6A 2ZT5A 4KLCA 4WNAB 3TCNA 4BCDA 1I6MA 1PFGA 2AVDA 3OZIA 2ODEA 1KQ3A 4YJ3F 1T91A 3UUFA 4DA6A 1CIPA 5DBIA 1FTNA 1JLKA 1ZZGA 4Q3EA 2OSVA 1FJHA 3M7IA 3RSHA 3V2HA 2EFJA 4RNDB 4BJ6A 1VL8A 3AGPA 1SRRA 3ZQUA 2EERA 1VZ2A 2VNKA 3D4LA 1IAQA 1JR4A 1N9GB 4NCIA 4Q82A 3ZK8A 3C8HA 1F4LA 1K7YA 3E53A 3OESA 4DBLC 3QUQA 1K97A 3WMGA 3OLYA 5A9RA 3B1XA 4DSOA 3EBPA 1C9KA 3A3YA 1MC1A 4CNBA 2GO1A 1SUFA 1E1KA 2FP3A 4RTKA 1JHAA 3FWHA 1D9XA 3DBLB 4G6ZA 5TB5A 2W43A 4ZP1A 4R9VA 2J30A 3FY4A 4FI3F 3HYNA 4CL3A 1T1EA 1JHMA 2Z6QA 4LE1A 2SKCA 2QTMA 2GHQA 2POQX 4MRRA 2A5DA 1YI1A 4B33A 1QJ4A 3V97A 3VTAA 2CLKB 1KK0A 3ZV4A 1OFHA 2QRHA 2V4UA 1GZ6A 1C9EA 2I1QA 4D99A 1FLNA 2B8JA 2PHZA 1VLMA 3HFJA 3NDPA 2AB0A 3L1UA 4LGVA 4Y2JA 1E8MA 2P9EA 4D80A 3UK1A 4YJHB 1KE1A 3P94A 4NNJA 5JJIA 2HSJA 4PGAA 5EUMA 1E5QA 2ZJ6A 1FQKA 4D5GA 3SZOA 4F2GA 3ZGYA 4A0GA 4JDPA 4M9XA 4QBIA 4NPAA 1K0FA 1N7JA 1TFRA 4PICA 4F60A 1IHYA 2I6GA 4JI4B 2R8XA 1D3AA 5BXYA 4KFUA 3RW9A 4QQKA 1G5TA 1YNSA 1DCKA 2GZ3A 2RSLA 3ZUPA 4MH0R 1TCBA 1XU4A 3W34A 4AJEA 1G8SA 3N7AA 1D2AA 2J31A 1ZP6A 3W7BA 3R6TA 4CN9A 1XD2A 4YPOA 2O14A 4PIMA 4BRUA 2QZJA 4PPFA 1FL9A 1PQUA 3CVOA 2LV8A 4QXAA 2RGUA 4ZALA 4LY3A 1YA6A 1QQAA 1TKRA 2W6JA 3F7OA 4HKTA 3FYTA 3FCAA 4AICA 4FJ1A 1WQ4A 1ZA2A 2OBXA 3KFLA 2XMGA 2XXAB 1NLUA 1ZK0A 2DTDA 4GMDA 3A28A 4ZEOA 2IIPA 3ZHZA 4JC5A 2J5XA 3ESRA 1DUVG 5AOVA 5MN4A 4FHFA 2D4AA 4OD0A 5HDBB 3UB2A 2WWFA 1SUDA 2FSUA 3LXXA 3GAZA 4RV9A 3QLVA 4NTZA 2FR8C 2G17A 3FZNA 2C2GA 3RDPA 4G07A 3V2UA 4C0KA 3VDMA 1VKOA 1O5TA 1BS9A 2XODA 5K09A 3GR6A 4IV5A 1DAEA 2ZB7A 2DT5A 1IHPA 2QSUA 3ORQA 4RF5A 5E3JA 2IX3A 1MT0A 1Y9DA 2BEJA 4IMRA 3QVMA 4KWTA 4NH4A 3DB1A 3LLCA 5IT0A 3EQ9A 3KPJA 3ESYA 1HL7A 1W25A 2IYUA 3A4MA 4G0PA 5EJ9A 2Z30A 3KBBA 1SY7A 5DMXA 5EE0A 1TNDA 4A0QA 2JJ1D 3O1HB 3STXA 2Z5LA 4LKOA 4F8YA 3ME5A 4XI9A 3VPSA 4ZCIA 5BV8A 5FWDA 4V3CA 1W44A 2IHBA 2GBCA 2HIMA 3NXSA 2G70A 4CL8A 1UJMA 4EA8A 3R20A 4AUMA 3EGIA 1VJGA 1J6UA 1KWGA 3UMBA 2PMCA 1C0PA 4J1QA 3VAYA 4A8JC 5ALLA 1DTSA 2NU7B 5DU2A 3U3RA 3LNCA 1JDZA 3P52A 4CKZA 1ZC4A 2HJ9A 3L6DA 4KX3A 3AQ4A 3WJ1A 3DFFA 4NC9A 2GEUA 2E4VA 1Z35A 2R6ZA 3A6JA 2O8VA 4M9CA 1D5CA 4O2AA 4J7XA 4YUZA 1KSHA 3OO1A 3ZGXA 2DBQA 3DDUA 5CYOA 1KYYA 3T61A 5JSHA 2Y0EA 3QA9A 3G5MA 3U0BA 2C78A 3E5HA 2XVAA 1P6UA 2PV7A 2EX0A 3I92A 5IP5A 4IDNA 4H3SA 1AH2A 1U3GA 4L6AA 4C7OB 3OHMA 5K3SA 3ZD6A 1HT0A 1B0PA 3ZDEA 5E7QA 5L6LB 1GCUA 4RFLA 1YR6A 1LSUA 4G01B 1YO6A 3V8QA 2ZFUA 1P5FA 2QUIA 4HV4A 4FFLA 3Q6NA 2G76A 4HNAB 4RMJA 1P2TA 1G20B 4JLJA 4PZPA 2YUIA 3EF0A 4O8CA 4FN5A 4QHSA 3AKZA 2FPOA 3I6BA 1ZG3A 2GGSA 1V26A 1IMJA 4I3GA 3WG9A 4A0SA 2X1HA 1S2GA 2HWYA 1Y7HA 3N8KA 4QQRA 3S68A 3CVXA 4Q4LA 3BSWA 2PUHA 4BJ5A 2H1FA 1JLLB 3LUHA 2R68A 3UJ3X 3TTSA 2YJGA 1W2HA 2PS9A 2HDOA 3M34A 5HHTA 4Z0HO 2WRZA 3AR2A 2UYOA 1PR3A 3MQFA 3F49S 4YJGB 4ZPJA 2NO1A 1O89A 5D84A 1C8KA 3KV3O 4U0JA 1UC8A 1WZCA 1F0PA 1ZM3A 1M66A 4R98A 1NMYA 1K06A 1XVLA 2FR8A 2R6FA 1MRZA 3DOUA 4GZMA 5FKJA 5IRCD 5E4TA 2J07A 4EJ0A 5CIWA 3OSUA 3TTUA 1HXHA 5LJLA 2CXSA 2JHPA 3JD2A 4DLTA 2I2FA 2RCNA 4B48A 3U39A 1OWOA 3PV0A 3K9GA 5I45A 2X77A 5AKEA 2FN3A 3PNPA 5DLQC 3N2KA 3LFTA 4QDOA 5EXSA 5CA0F 1OZAA 4Y2YA 1JDBB 2C4MA 2CKDA 2Z58A 3G8DA 3H9BA 4RBNA 3R5TA 4FMCF 2GPBA 1H2ZA 3VDRA 3OF2A 1Q14A 4B5LA 1LH0A 5T4HA 1W5TA 4KJXA 1Q1ZA 2MDTA 3AEXA 3DW3X 3NJ4A 4BO4A 3FUVA 3H5OA 1A97A 4C0AC 1RM5A 1YS4A 2DUNA 1U11A 2ZYRA 2JB9A 2FEMA 3VKVA 1BYIA 4D81A 5ERYA 4ZO9A 3VR5D 5U9CA 4G9EA 4ZEXA 1U81A 1MO2A 2QL6A 2QORA 2XTAA 4F8JA 1Z25A 4JQSA 4GIBA 4ZVUA 3OFND 1DADA 3TQQA 3IR6A 3IQIX 3VO2A 1SEPA 1AMUA 2ZCJA 2RGGA 4JJGA 4ALNA 4IG9A 2V6BA 4RQTA 3KQNA 1BVUA 1FX1A 3AB7A 1DEKA 4M0CA 4MW1A 3KLMX 5D6NA 4ZVOA 1LBSA 1JPVA 2QTTA 5LR6A 1L4GA 1XRNA 5IBPA 5AOBA 3GGOA 3ONDA 1Z0SA 3ZLBA 4Y2UA 3GGGA 1NVVR 1VA4A 2ZR9A 1E1QA 2ZATA 1L5HA 3W5VA 4BFZA 3L41A 5CD9A 2FCRA 1NRJB 2Q6OA 3AI3A 1X6VA 3HRKA 1PJ2A 3NDJA 5EIAA 3HHPA 4B4DA 5FRDA 3W3AA 3TUIC 4CKCB 1UBTS 4BAZA 4L07A 5IKEA 2VHYA 3B2EA 3ZGOA 2EL9A 5CFLA 4LTNA 4JC4A 4X66B 2A14A 5TQ2A 5ADWA 2P1ZA 1NPYA 1G21B 2W6ZA 1ISFA 2WP0A 2ZRGA 4J1TC 2ZJ5A 2ZE6A 1JMKC 1SCUA 3FVQA 3AKCA 3AM3A 5BQFA 2CHEA 2BFMA 1QTIA 2QI9F 3N8GA 4EA6A 4V1CB 4C7VA 4N12A 3VQTA 4EF5A 2CT8A 3SEZA 3UC5A 4RHXA 2CLOB 2ORYA 1KEKA 2CXHA 3FUCA 3IA7A 3IOYA 1OVGA 1PJLA 3UBTA 1UJ5A 2YWRA 1Z2OX 3DLAA 5KNBH 5JD5A 2QT0A 5AM2A 3U3KA 3CUWA 5AJTA 3OFVA 4IBOA 3GAAA 521PA 4CUZA 4JJZA 1DLIA 4OJYA 4PS0A 4WNAA 5HF5A 3V80A 4YR9A 2ZSUA 1R3DA 1M76A 2FLWA 2O0KA 1ZNWA 3V4ZA 1C3EA 3B5EA 2IBSA 2WMOB 1KO5A 3PHJA 1X2EA 3FUXA 4PGHA 2REOA 3WLQA 4FI3C 3Q3CA 5D3KA 1RKVA 1PBTA 2Q5QA 3IVMA 3SYKA 4EY5A 5KOHA 1RXUA 4MS1A 1N9GA 4I5DA 3Q15C 3DZJA 4K9KA 3CR8A 4DY6A 1IXKA 3IJPA 4U5XA 3VR6A 4A1FA 3G3EA 2A0XA 4OMDA 1ML4A 4ISBA 3NRCA 4XVCA 3MB8A 1P44A 2C2MA 1UMDA 4IJ6A 5TX7A 1NE2A 2Z83A 1TF2A 2PRSA 2ERCA 2GMWA 2H8KA 2R66A 3BAFA 1JPJA 2DLNA 3DBLA 4J0JA 4PM4A 2BH9A 1A7UA 1BRTA 3F96A 4P3KA 4XGNA 4XWWA 4MP8A 5IDYA 4YDQA 1W94A 1ZFNA 3WIBA 2ZT8A 5D3QA 5ARBA 4MGZR 5K4HA 2NX2A 2OAP1 2OORA 3ABSB 3WBJA 2N75A 3ZWKA 4ON9A 1OXSC 1U02A 5EZQA 1CP3A 5I8WA 2NSLA 3HWSA 2PMKA 2RC5A 2ZE7A 3M5PA 1MW8X 1H4QA 3OHPA 2WDPA 2IUFA 3K9HA 4E3WA 3NGXA 3H65A 3FVRA 2OECA 4GLBA 4MPJA 4LZZA 1M10A 4FBMA 2NTJA 1CLUA 1OR8A 1I2MA 4IF6A 1XPUA 1L1QA 3ZD7A 2YY5A 3IQHX 1TYBE 2GN6A 3Q9UA 3QMVA 4RD1A 1BDMA 5EKXA 4CFSA 4EO9A 5MDHA 4Z53A 2VPTA 5KYKA 3HCPA 3RGGA 3SQXA 1SK8A 1AKQA 1D4OA 1W1IA 4ERNA 3PHLA 4UHHA 1U9YA 3ZDAA 1AV7A 1T3ZA 4HAIA 2WLSA 4J1TA 5B1DA 5BSWA 1E66A 3K5IA 3K9CA 4KQFA 1BGWA 2WIDA 3W90A 1M2EA 2QR2A 3LPDA 1VL0A 2WYUA 1ISJA 4HEHA 1STOA 1XDZA 1T3LA 2FPMA 3CGWA 3OHSX 4YJ3A 3IILA 4YRSA 2JLQA 3DE7X 5A4AA 5F4ZA 1NBOA 2HF8A 2NOAA 2QLLA 3FHLA 3DZCA 5J5AA 4ECAA 1Z8FA 3L1HA 3RRYA 2AD1A 1R9NA 2J9GA 3ZIUA 5L4NA 3T8YA 4KZKA 3C85A 3L6RA 3LXRA 1LX7A 4XPZA 5DVZA 2HMVA 4BEJA 2QUKA 2F8SA 4YWHA 1HTTA 2IYEA 1CVLA 1Z6GA 2YWDA 4LHWA 4NBVA 3TECE 4P32A 3Q9NA 1DINA 4L16A 4BX2A 4HPWA 1GQ2A 3GJ5A 4LDJA 1UKBA 3EHDA 4JLPA 4PZAA 2R97A 2BFPA 1P4HA 3FDJA 4QYWA 2NLOA 1EVKA 1CULC 4GC9A 3OZWA 4J0DA 1YE5A 1L7MA 3VUFA 1EJBA 1I3KA 2Y99A 5FPSA 1TQHA 2A5JA 3BORA 4PNEA 1A8UA 2R751 5AKKA 3U16A 3RAEC 3E8MA 2IF2A 3MUNA 4FYWA 4HUJA 4BB6A 1FZTA 1V7CA 3GQBB 2RGYA 3NRJA 1OFUX 3DT6A 4PSDA 3AR3A 3WSTA 4B71A 1Z88A 1DKMA 1V7ZA 1FMFA 2QRNA 3ICVA 1U3VA 1XTSA 1I0ZA 2NU7A 4ED9A 4I4TF 1NOIA 1JFRA 1ZVMA 2E89A 2I4IA 3CBGA 2ZUFA 4P4UA 3KB8A 3HDTA 3R8FA 5CXSA 4KKXB 5B64A 2GK3A 1GNRA 4L8WB 1BN6A 4GQIA 3SF0A 3VC7A 1ES9A 2O2ZA 3NRBA 4CBVA 3KETA 1M0EA 4PZYA 1F3OA 5JZ9A 1QE5A 2AUNA 3I2KA 4D82A 4XWKA 3D6NB 3ETEA 3GT3A 4QDJA 3ZW7A 5HBRA 4LWQA 5I4KA 3TW4A 4QUHA 4JD5A 1AQLA 3OH8A 1EQ2A 1NMQA 4I1OA 2I55A 2Y92A 4C7OA 5ALRA 1GZ7A 4ZQGA 1LRLA 1LFAA 1VE1A 1I4WA 3L8GA 5F35A 4X41A 1KR2A 4AU1A 3SM9A 3HU2A 1DCMA 1P2DA 2P5SA 4J07A 4RSMA 4A2QA 4ZOQI 1KDOA 2WG1A 1H6AA 1XU9A 4H2DA 3WNBA 3KVRA 3OA0A 3BCSA 3COWA 3QITA 5E6UB 2YIJA 4BNDB 3VBEA 2JIQA 4HNAA 5D5HA 4FFNA 5TR9A 3WGQA 4DE5A 1IONA 3DT9A 1UZNA 2AHRA 4MUIA 1CY8A 5FUQA 1SNYA 3L18A 1I4OA 2QM7A 3QX9A 3PIRA 2VK2A 4RKQA 3KOYA 4RY2A 5CT8A 4B4WA 3TZ6A 3M3HA 2C31A 3O84A 1PAUA 1WP9A 3P5SA 3STUA 3ZY4A 2X1MA 4B79A 3X2EA 5BUZA 3B8EA 3FPSA 4MHTA 1USVA 3K92A 3CSDA 1N3BA 4EL5A 2QN2A 4Z8YA 1JLLA 1Z0IA 1HLFA 4UMEA 1KJIA 2B3TA 4C30A 5CDHA 4MVJH 2BBOA 1ESDA 5JAUA 3QTBA 1HUQA 1U2SA 3HDJA 4K9PA 4YJGA 1N77A 1PT8A 3WRWA 2J3JA 4MS3B 2P40A 3TSOA 3KO8A 5EVJA 1UEJA 3IODA 2YZ7A 3FF1A 1CR2A 5HW0A 2VF5X 4C3VA 3H8VA 5C8ZA 3TW0A 1I3MA 3HC7A 1JIIA 5EWJA 2ZU6A 1ZHOA 4JA2A 2IGBA 3UMGA 5FBVB 3LTNC 4EL0A 5LU8A 3NYWA 1U8AA 4RFSB 1QKKA 2ZI7A 2X2EA 4P3PA 2O2CA 4ZV7A 3ZE1B 5K8LA 2GERA 1M0SA 3QPCA 5A06A 1AQJA 4KE6A 3SICE 2YMPA 3QLUC 4MKHA 4PO1A 3SZUA 4ZK6A 4JJIA 4URVR 1GGMA 4A6XA 5K3CA 4G4IA 1Z0AA 3N86A 4RS3A 2D5CA 3GJ7A 1RXEA 4LRYA 3LJKA 4AJNA 3GJSA 4EUNA 3U80A 4QXQA 2BLNA 2HU7A 2CZCA 3BSSA 4M46A 4Z1OA 3NNSA 2Q46A 4XCVA 3GNSA 1LQUA 1HPLA 4JIMA 3AUAA 4R8SA 4YAFA 4MAMA 3OOEA 3RNLA 2IDZA 5JBNA 5GV8A 1JHUA 2HHHB 1JR3A 3IE2A 2BGLA 3GRZA 1C4KA 1V1JA 5L3QB 2RGEA 1IBRA 2NXWA 1CJSA 5F64A 4BNNA 4C05A 3RUAA 3MHTA 1Z62A 3LK7A 1R5BA 1ZJZA 5A03A 3EPKA 3WO1A 5KTRA 2HGSA 1R6XA 4JMPA 1QGED 5CDTA 4JEUA 4W4TA 5EP1A 4E4YA 4IJKA 1XSEA 2BELA 3C8UA 1J33A 2VNSA 1DOZA 3I9OA 3OE1A 1T4BA 3L8YA 1EX1A 4H16A 1R1DA 2WF6A 1RKQA 1J09A 1GTL1 3WB1A 4CKCA 1NQXA 2X8WA 3EMBA 1A50B 1PNOA 4FYPA 4NK5A 1QIDA 4W7IA 2J0UB 3A1UA 4BQQA 3Q5EA 2R4QA 4H7HA 2B2XA 3I72A 3GVCA 1R16A 2Z2IA 2IW1A 3ZJ5A 2QJFA 1HF3A 2JFQA 4WZAA 3NYIA 1XYGA 3DAPA 4X94A 3GFVA 3PNMA 5HRCA 2HDNB 3UYLA 3OQPA 1OLUB 1V1MB 4LHXA 4ALIA 4ZREA 4G2TA 2AJTA 5A7GA 4HLDA 4TLEA 4TMZA 1KVUA 1PDWA 2J3IA 4QC2A 1F2TB 1H05A 1M6NA 1SVIA 5AVRA 3JTMA 4ALMA 4BGVA 4DQDA 1NURA 3FOBA 1JHYA 1NVEA 3W5AA 2V6GA 1C7RA 3LI2A 5CA0A 2G77B 2H52A 4LZLA 4NYJQ 3OLVA 5C81A 5IYZB 2W6ID 5AVVA 4V0SA 2FRDC 4CUKA 5I7SA 4WUVA 5FBQB 4H27A 3ZBUA 3EUEA 1XV5A 4GP6A 2WTMA 3EXIA 1GOTA 2PUJA 2JGMA 2QGZA 3HABA 4L57A 4A91A 4DDWA 3QLTA 3N3BC 5KYUB 4RLHA 4JI8B 4WK4B 3EB9A 2DP4E 3L7KA 4FWBA 2N0SA 3GZTB 2YVAA 1ZD2P 5F2NA 5HRUA 3MINB 4NOMA 5E2IA 4UUQA 3T7AA 2AKEA 5ENZA 4IWYA 4E7OA 1A04A 3U19A 1NNUA 3BWYA 2A5GA 2MOKA 2E4ZA 5CYPA 1L2TA 4LY6A 1NNEA 3L4EA 4D4JA 5IWAB 4WPGA 4GOMD 1LGYA 3HWWA 4MWBA 4Y9SA 3M5DA 4R3NA 1ZEMA 5FP0A 4EVIA 4X61A 4JN6B 5DV9A 2YC2C 5DP2A 3E9EA 3SC4A 3HPRA 3COYA 3EGOA 4Q03A 1NR5A 2VP0A 3U4HA 2ORIA 4XVUA 5C5IA 2ALJA 4ICIA 4RMGA 2Z08A 1GCAA 4A26A 1DT3A 3O4IA 5DYYA 2A94A 1TQDA 2EF0A 5THKA 3E9CA 3RS4A 2WTXA 3T4EA 2OVFA 4F3YA 3ZEAA 3B60A 3L6OO 4HYTA 3VJMA 1D8TA 3DMFA 3OM1A 4IVRA 1E2PA 2YJTD 4X24A 3UFXB 1ESCA 3DPSA 3Q87B 1EBFA 2BM1A 4GKKB 2W8BB 1ODTC 1XR3A 2QZPA 3JWGA 4X8MA 2Z56A 3SJAA 4POOA 5EGNA 3CRRA 4DT1B 1BX3A 4G5YA 4EI7A 2QSYA 3SVTA 1IL0A 5JAPA 1VI6A 1U90A 3T3HA 3B6MA 4CV0A 2D5AA 3KUKA 4E5SA 3TSAA 2P9YA 3DMTC 1CV2A 1GNSA 1PSWA 4ZDIA 4J2TA 4XJVA 3HUFA 4UZSA 1DHTA 3JRWA 1JZTA 3F4KA 1G7CA 1YCGA 3IEUA 3NETA 4MKIA 4MVJI 4Y98A 4EECA 9LDBA 1N8TA 2FX3A 1RQ7A 1Z4QA 3OJXA 3OZRA 2WKWA 5J5CA 3FNQA 3T3EA 3HVUA 4M8KA 5DFAA 1QO7A 3JW8A 2PUCA 3HB1A 4NBWA 2A35A 2HQ1A 4AN4A 1E2UA 3CB4A 4X44A 1UBFA 2JS7A 2GHIA 3I2HA 3KUUA 3A6DA 4Y1EA 3I5MA 4UVEA 4N0QA 2ZW9A 4OFXA 5E9QA 5K9ZA 1RHJA 2FRDA 4UEJA 4DSZA 1ZUWA 2FPUA 3K73O 3KYIB 4FYJA 4XARA 2BM0A 1KA9H 4DKXA 2BHTA 1MH1A 3FVVA 4MOWA 3DBRB 1YR8A 4Q4JA 3SBOA 3K0HA 3G1WA 3T95A 3AFOA 4TYPA 1QH9A 1LEHA 1O6GA 3RU2A 4B81A 1HO3A 5JD3A 3UWPA 3WKBA 1HI9A 3OM9A 4JSTA 4F4UA 5BYAA 3FJ1A 1QIEA 4Q7KA 3MXTA 4B2PA 2JGFA 1JPNA 1ACLA 4KTTE 2R9VA 3OCYA 4OAPA 1KJQA 1JSZA 3OOSA 3FDZB 1RI5A 3BQNB 3GQBA 4HC4A 4V02A 2PUBA 3LDFA 3CEHA 4WLUA 5B7QA 2V58A 1JLHA 4HPJB 3CE6A 3EARA 3A3OA 5DM0A 4TKLA 1ABFA 2FEWB 1QRTA 1DC4A 2VP5A 1QPGA 2J5BA 3LO5A 2XE8A 3MYYA 4INZA 2NADA 3PNKA 4O4LF 3MQ4A 3DV2A 121PA 2I7CA 2PH7A 4YQZA 3PHGA 3Q7IA 1QO9A 2O2DA 3AW9A 3LM8A 3PEVA 2J45A 3X1KA 4BZZA 5I7RA 3U3DA 4EKYA 3OLQA 2VAMA 1OTHA 4OK3A 5AM1A 5F21A 5T6BA 5H68A 1DAFA 3G79A 2PL9A 4EFKA 4BB5A 1S8NA 3WK5A 3HKCB 4QQFA 4US2R 3OG9A 5F9MA 4A10A 1SMKA 4DLZA 2J9FA 4LIPD 5M04A 3I1JA 4JYCA 3KQPA 4ZHSA 5FTLA 1P1JA 2AXQA 2WQ6A 2PV0A 1OPXA 1WX1A 3NV7A 1A77A 2QM3A 1OI3A 2R62A 4OP3A 3ZWWA 2BKUA 2QT9A 2IU3A 3NT4A 3IELA 5E6UA 1N7IA 4BNDA 1UEIA 2X5XA 1JBKA 4EQZA 1J42A 1OAKA 1VE9A 1DT5A 3HR8A 5DYWA 3DMTA 4PXAA 3A6FA 3GQVA 4HGZA 5FH9A 3ND7A 1AXRA 4OPMA 3PQ6A 1I6LA 4D4HA 1IVNA 1V37A 3IQDB 4JR2A 3W5HA 5JUWA 1M2KA 2YFHA 1G20E 1XMXA 1L8OA 3BXEA 4G1UC 1XCGB 4B82A 2OCAA 2HNKA 2YXNA 3L05A 3LQKA 2C9OA 3CCCA 2E18A 1U8CB 1PZHA 3QXJA 3PG5A 2B4RO 4IKOA 1WD5A 2WYVA 3AXSA 3AKYA 2C98A 1I7QB 2BVNA 3DMHA 4N6GA 4MS3A 4QGHA 2JEZA 4PPNA 2FZ5A 1W75A 3EH2A 4L4RA 1CFZA 3E15A 2GDZA 2ZM5A 4LHYA 4ZANA 4Y2RA 2VXBA 1U1IA 3OP1A 4BHTA 5BUSA 3WP0A 3PNSA 2I3DA 1NJ2A 2D13A 4ZYVA 1PT5A 1RRMA 2W98A 1THMA 4BRZA 4O4LB 3E61A 5CFMA 4HO1X 5IJZA 4E32A 1CRWG 2W90A 4CGYA 2WINI 4B0PA 1C0KA 4A0HA 1HDCA 4NBKA 1NBMA 3ZZTA 5CVVA 1LK7A 2VCHA 3ANXA 1ILEA 1VSBA 3IKLA 3S28A 5CPBA 5JRJA 1HX7A 4ZVTA 3I6YA 2A0WA 4YJ2F 2IOHA 5K03A 5CP8A 3S2ZA 3HP7A 2BBSA 4KXVA 4PQRA 3VH1A 2GWHA 3HBJA 1JUDA 3UWDA 4BJ1A 1J39A 1WPGA 3PCTA 4AX4A 1QG2A 3CRZA 4O2LA 1A5AB 3U1TA 3U7RA 3PGA1 4QBGB 4QG3A 3GEBA 1JIVA 3CMMA 2JCYA 2LRHA 3QPWA 3QSYA 2CL7X 4CGZA 1MAUA 4IDOA 3I76A 5A5VA 3NP7A 3GJRA 1XMOB 3WGHA 1H0HA 2J48A 3UH0A 3AU8A 2UAGA 5BSKA 5L3QA 4NENB 5TIIA 3HRHA 2NTNA 3GO4A 2E0IA 1RIIA 4FM9A 3V9PA 1IJEA 2JJ8A 3I8SA 1H0KA 2FZEA 4XYGA 4RL4A 3X1XA 2B8WA 3UN1A 4BKRA 1TADA 1YRHA 3F0TA 2TMKA 3HVRA 1N6RA 1LLCA 1ZH6A 5CNJA 2JGEA 3ZU4A 3W5IA 2CL6X 2OV2A 4KWCA 4UAJA 2AYYA 6ABPA 5J2TB 1NQAO 1YDWA 2Z8XA 3P26A 5E7IA 2GK4A 1FMTA 2C2KA 2VWPA 3OSZA 2AZMA 4AZSA 2EG9A 1SKUA 5KQRA 2J0UA 3TJZA 2C8KA 1RZRD 1QH8B 2ZI3A 1A69A 3OX3A 4I4CA 4GD3Q 2FFJA 4J0IA 1JQEA 2CHGA 1SCBA 2W4QA 4U6QA 4Y6GB 5CLQA 5JNVA 3D4BA 3X3HA 1OLUA 1V1MA 1LPOA 2OHHA 3A0RB 3CJRA 1UDBA 1SHJA 4LQCA 3V46A 4BNYA 5L8VA 5KPDA 1FVHA 3U6KA 2O8FB 4MAFA 4PC3A 2HTFA 4WZAE 1G21E 1KDTA 4ETNA 1F2TA 5JRZA 1RXVA 4S1TA 1XVVA 3CYFA 1Z63A 3BJZA 4KYTA 3SBEA 4HLCA 5MGNA 2APJA 2PCJA 1E7QA 2AG8A 2WAMA 4TXMA 3WKCA 5IYZA 2I65A 3QBEA 3B53X 1DDOA 3GZJA 2JASA 3K53A 4KW7A 2W2OA 3RSFA 2XUZA 3T3PB 3T9AA 3R6DA 4E5DA 3UGJA 2PX2A 3IJ5A 4WZBB 1KNXA 1JH8A 3CURA 1U63A 2VJBA 1G8AA 2WV9A 3W5BA 1Q92A 5KYUA 2RJOA 4AAYA 1K8RA 4LYFA 3EFBA 3MINA 3PQ7A 3ORHA 2HXGA 2H1LA 1O0CA 3M9WA 3G5AA 1I9CA 1CB0A 1TTPB 3EGWA 3NATA 3PPXA 1G2IA 1LJUA 4KQXA 3SGLA 3W2EA 2XQJA 3LDGA 4M0KA 3IPAA 4RPKA 4W63A 5ENDA 4DCSA 2ZE5A 3OD5A 4H77A 4X90A 1QIHA 3AP3A 1MV8A 1WCV1 4QTTB 1R8SA 2RAVA 4JK3A 2W42A 2WTAA 1MF7A 3V7NA 2YZNA 1Y1PA 2YDXA 3PWKA 1QP4A 3AVOA 1OWMA 2WR8A 4UVDA 3OM0A 1YBMA 4WOKA 4V0RA 3T4XA 3T41A 3B6IA 5EQDA 3A4LA 1RDFA 1U2PA 2N1MA 2CJXA 2IX9A 1NX6A 2MJLA 3ED1A 3PQEA 3PGMA 3AK4A 1XVTA 2GCNA 2M2IA 4HD8A 2AG5A 3OEWA 2W2PA 1H2YA 2Z5GA 2VPWA 3JQ7B 3UFXA 3AVUA 2W8BA 1JQBA 2UZIR 3FFTA 1KMMA 4O29A 2BISA 1TD1A 3NIFB 4ZYZA 3WJ7A 2GYVA 1IUOA 3L9XA 1D7AA 2QUAA 3A05A 4N0MA 2JGAA 3BGWA 2DQ4A 4G0ZA 3L4BA 4M7RA 5EJ7A 1X70A 2O2IA 2CFSA 2PG3A 2GJ8A 1CYDA 1H93A 2OMEA 2VNJA 3BL8A 4IVQA 4IICA 1GQSA 2G1KA 4RIIA 1JTFA 4ZCTA 4ZDKA 5ALVA 2XCTB 5T7BA 4MW7A 3BWVA 3ENNA 2R5WA 4NAHA 5GGXA 3WWZA 2VSOA 3ICQB 1XZAA 4M0UA 1ZNZA 4JYAB 4IF4A 1WCIB 1JFFB 2GZ1A 2YICA 3KLBA 4DGQA 5C0OE 4W5HA 2CC2A 2A67A 4TUYF 3EWNA 5DTIA 1XRLA 3NTQA 3VX3A 4ZFNA 5HSGA 1VDZA 2FR1A 2VYVA 1UKYA 1SU4A 1JN0A 1RHUA 4NU0A 4P93A 2AW3A 4FIZA 1QFJA 2O0JA 4KQ1A 1FJXA 4LZOA 2QMZA 1E3QA 4YJDA 2PS1A 4IXNA 2C7OA 4LJ4A 4FFPA 3U3XA 4MAAA 4DMCA 4ER6A 3CZ5A 1GQFA 3KQVA 2WNIA 3SCZA 4CU2A 3ASYA 5TT1A 1XLWA 1HQCA 1YSCA 3UUEA 3ZCSA 1KZ4A 4RF3A 3TM5A 3F71A 3ST7A 1M74A 2VTVA 3BKXA 3EZLA 5J5VA 2YV2A 2VQSA 5DI3B 1J20A 1OBHA 5K05A 4M1WA 2GZAA 1ADYA 1YBFA 2P3QA 3MWEB 4KK3A 1FW6A 1SCDA 1UQRA 3LCJA 4RJ2A 1E6WA 1II0A 3QOWA 3TDKA 3U7QB 3GRPA 3C5HA 2VUTA 3TW8A 3CVWA 4X1KB 5IAAA 3FDZA 5G4KB 1GAJA 2QN6A 3WJ2A 4DNOA 3OMWA 4YAGA 3WKDA 3DDOA 4PLYA 1YJCA 3Q2KA 1T8UA 1CY6A 1FW8A 4J0CA 4L8LA 1CTQA 5AJVB 4FGKA 3HNOA 2IDKA 1N0WA 3LOPA 2CD9A 4CI0B 4D6XA 4ZMRA 2QMOA 3G6WA 4WCFB 1JYEA 1SU6A 4X0EA 4B85A 1BNCA 1QVVA 3HB4X 1RVV1 3ZLUA 3HFRA 1ESEA 1C9DB 4NV0A 4LQLA 5EPUA 3STTA 3BZWA 5EC8A 4PYRA 2PQ0A 5I7AA 3NU1A 4RJTA 1QP0A 4YUWA 2GCOB 3AIOA 1TUEA 4K6CA 4UU8A 5KTMA 1F1BA 2NO5A 3PFWO 4OLAA 4JQOA 1AGNA 1FX0A 2FETA 4HDSB 4HF7A 2IZ5A 4L9RA 4LX8A 3RBVA 1XL1A 3ABRB 3C45A 2QAGC 4H7FA 1ORRA 3SZMA 1JJVA 1M2WA 1JMYA 3D8SA 2R00A 3L4SO 1TKCA 2CJWB 4QFDA 5D00A 4MEJA 5HFAA 4NCAA 4TUYB 2ZXEA 3ZE7A 1KQGA 1VC2A 3N7UA 4OQEA 3PX2A 1WS6A 1OH6A 1YUBA 3MRVA 1G41A 1P1CA 2WHPA 3ND8A 1TYEB 2C2WA 2YFYA 2I99A 1D07A 1Z5NA 3VU0A 2GEVA 3QEBZ 1SPXA 4O8ZA 4L3WA 2FMHA 4EKNB 3NOXA 4GLFA 3NTUA 3D0QA 4Q05A 3IPYA 2O5RA 4F6RB 2ACWA 2EX4A 3JQRA 3IMEA 1VIYA 4FN4A 4G36A 1N6LA 5I6DA 5BV7A 3GEPA 4AJ1A 1OWNA 5DXJA 4S1WA 4INJA 1X74A 2PKEA 1AZTA 5EVCA 2HA6A 1ZI8A 1XRJA 5FXMA 3IESA 5LD2B 1G9XA 1P75A 3HN6A 1RYBA 1CNMA 2ECKA 4DEXA 5K3EA 3I58A 2MYPA 2CXUA 4HAZA 5EINA 2Y71A 2V5AA 4OI0A 3FYUB 4PQEA 3N7TA 5B3LA 2ERXA 3DMGA 1GDHA 2GTPA 4Y8VA 3DDZX 4DMRA 1YR2A 4M1OA 5IT4A 3SBXA 5JU6A 1WBDA 1QDUA 3GDHA 3HMKA 4O4LA 3TLXA 4ITRC 1XDUA 4Z2AA 1YFZA 4H3VA 4BMVA 3PQ2A 3UC9A 2C03A 5BY2A 4G86A 3D4IA 2WC1A 1F3LA 1U1EA 3NR2A 4X7BA 1MX9A 1JIKA 3WWEA 5KDOA 3G88A 2QJTA 2HEGA 1DKRA 1JVNA 2QN8A 4HQ0A 1K7FB 1BZYA 4I6EA 1ORIA 3JZMA 3LCMA 1KZHA 3HTXA 3SDZA 1W4RA 1V6CA 3MNFA 2F3TA 1Q2XA 1NUQA 3JQ9C 5T67A 1DS6A 2C5HA 2VKQA 1NBME 2Y05A 3CUTA 3DMNA 3N07A 4PHCA 4AFNA 1ECBA 1S02A 2BGIA 4A2WA 4OXYA 3MWYW 3OCWA 3UYKA 3SEQA 1EK1A 3H99A 4OHUA 5I4IA 4KVZA 3SJBA 2CBXA 1VI2A 3NFRA 1UBNA 2AZDA 3BWMA 5EPEA 3RAGA 3L0CA 1HNWB 2LE0A 4CEJB 3IX7A 3DZIA 2I1WA 3GRYA 2I33A 2P68A 4NENA 3PJFA 2FQ1A 3KXKA 5AVSA 1RPZA 5IKXA 5FOSA 2WSIA 3HY3A 1UXJA 2O2XA 4TTJA 4BLRA 2AFVA 3P9ZA 3H04A 2R7MA 4HDRA 4D3YA 1Z37A 5ENVA 3FCSB 3WI7A 3TIXB 2QTBA 5D86A 2J4DA 4BLSA 1PQYA 5K8VA 4B3RB 2IA5A 4XKJA 1F6WA 4DFDA 1R4NA 1UOOA 3OT1B 3BB3A 4YIKA 3KSDO 2LD4A 1I7LA 3HVKA 4PX5A 3AETA 2C54A 1P9LA 1QH8A 1MJGM 4KUGA 1KQFA 4HYYA 4JVOA 4B3IA 4EA7A 2GN0A 1VMKA 2FZCA 3ND5A 1QHSA 5D1HA 2X0RA 4ZC1A 5GOZA 1MLDA 3HEMA 2C8VA 4B6QA 3I05A 5K4AA 5DTRA 3TOZA 1EE2A 1OXXK 1RP1A 2A30A 2P41A 3K0SA 3P4YA 3R3YA 1G6HA 5FO0A 2VH2A 4P98A 4F4DA 1UOQA 2AIRA 2ZPAA 5AUNB 4JQZA 2J6HA 4CLEA 4US1R 2GBIA 4R84A 1R50A 5LA6B 2CD7A 3GWGA 2WIKA 1OT5A 4MV4A 1SCKA 1SUAA 4HN4B 4YMIA 4NOKA 4H7EA 1U7HA 4WZBA 1UKAA 1DBRA 4D9FA 4EGFA 2E87A 2WFAA 2GN4A 4G4GA 4QATA 4BIMA 1G64A 2D7JA 3CR3C 3SFTA 3KHKA 3F5FA 3M6IA 3OU2A 1V5IA 4XCQA 2FI1A 3MJHA 5CVJA 5EGSA 3ZD9A 3ESAA 3BWXA 5JR3A 5IZ4A 1T8RA 1N25A 1KHHA 3E3AA 3LA6A 1QO0D 2REBA 5B4UA 2XGJA 1Z82A 5EIXA 1P1KA 3KLPX 3LWDA 1GJRA 1HEYA 3KB6A 3MOSA 3URMA 1GKUB 5LDDC 2I3ZA 3BBPA 2ZP1A 4HAXA 2OAEA 1FNSA 2AW5A 5J59A 4RJJA 4WI1A 4RXMA 4ZAZA 2O8EA 2OP0A 2V98A 4BJ3A 1FP7A 1PQWA 4MRPA 5FO1A 4BFXA 3EEFA 1A8SA 4AMGA 4HX2A 5AVQA 1SXJD 1ESMA 2G06A 5IN4A 1DXHA 3GEDA 3L7NA 3PB3A 1A27A 4JQYA 3KQUA 5C7OO 2OGZA 1LF0A 2FN8A 4J4BA 1SA0B 4DDKA 3RC7A 3W1VA 2FMUA 1Q21A 4PF1A 4LMAA 2ONCA 2Y1EA 5FBKA 5D1NA 3T3NA 2HQOA 3IVXA 3MTAA 1LKZA 3E6AA 1N5KA 3E70C 5TQJA 4F71A 1Z7GA 4MTLA 3JQ7A 4OBWA 2BW0A 2H7XA 2P62A 3KL4A 5FTMA 5JI2E 2C58A 5J63A 2JBAB 5H80A 3GPLA 1W2GA 2ISCA 1I36A 1NW3A 5A5EA 4IQGA 4A6PA 2IH5A 3ZGZA 4YFYA 4RDHA 1LI4A 1OYVA 1CZRA 2QP4A 3H18A 3HCAA 3O9MA 3BMQB 3R0QA 1T3HA 4IUCS 4ETWA 3O2NA 3RRMA 2W37A 3OEED 3B3FA 1F5SA 2DPMA 5D7BA 2AEMA 2G1JA 4M0DA 5KMGB 2LVBA 5AH0A 4UXHA 1M8FA 4Y6SA 1VPLA 1CQIB 1P45A 2GDJA 4PQGA 4QJ4A 2H85A 2ILVA 2OFOA 3ANTA 4I08A 5CW2A 5LB2A 2YWEA 4CTJA 5CW1A 1X7WB 4ENQA 2ZSJA 1WCIA 1JFFA 3HL0A 3D81A 2QR3A 5JSKA 2DLDA 2Y2VA 1RZVA 2C8JA 3JASB 1JQAA 4XWYA 1GL9B 4UQPA 2BR3A 2ZJAA 5EIFA 2E3JA 4BRWA 5LIPA 2E6KA 3F74A 2X4DA 3ACBA 3GC6A 3RUEA 1VKRA 4YT8A 1FFSA 4PAOA 3T3MB 1C8VB 3ETLA 2UZ0A 4RL6A 1WB6A 3JQ8B 1V7PC 3MD9A 4ZAYA 3SQNA 2OPHA 3FYUC 3W6OA 4DLAA 4LF4B 3MS7A 4CEIB 3H1AA 5EHXA 4TRJA 4I1RA 4DR2B 4KDEA 4DIBA 2HO5A 1A9ZA 3VOSA 1OB2A 1IIRA 2AJBA 2XBUA 3A6ZA 5KCMA 2H48A 2PEZA 1VB3A 1R12A 2ST1A 2NT4A 1C9YA 1MHPA 2WG2A 1IPEA 4MMXB 2HDHA 2XB2A 1WE2A 3TB6A 4UDOA 1FP4B 4HVLA 2FJPA 4F1WA 2BKLA 2EJVA 2G9RA 1NE7A 2VPXA 4MS4B 5TT0A 2XZOA 5A4JA 4YGYA 3UT5B 2A0KA 1Q0LA 1TM7E 3F9RA 2WE7A 1IZYA 5IK2D 1E7MA 4X1KA 2QMHA 4KQEA 5K7SA 1Z74A 3I9LA 3EGXB 3TX2A 1B8VA 3T12A 5G4KA 5CBKA 3KJXA 1B6SA 3GJXC 2P3SA 4YRJA 4BLOA 5AW6A 4TZ0A 3A3NA 1IHUA 4YXWD 1DMSA 4EG3A 4WCFA 1Y5NA 1KJWA 1D0SA 2C92A 2F4NA 3DKIA 3FMGA 4M60A 5C8DA 2QTAA 1RWMA 4GRIA 1OV6A 4ZD6A 1RLJA 1O6FA 1U7TA 2IY9A 2Y67A 5DOZA 2GO7A 5FFFA 1RPJA 2KLBA 1PQ4A 2WF7A 2GCOA 3SXUB 2GT1A 1YCFA 4QU8A 3VH2A 5KCZA 1FVFA 1MGOA 3LQYA 4HDSA 4MZXA 1K6MA 2D62A 2Q4TA 1JG1A 2W2LA 3T1OA 4PLZA 3TLYA 3WGJA 1OFUA 3O92A 3WK7A 4B9AA 4MVJD 1TJ5A 4Q37A 4D7AA 2CJWA 2PWZA 1XKLA 1C7FA 3LLMA 4KDCA 4TUYA 5KYYB 1I4EB 2WHQA 2DFLA 1BMTA 4NICA 2R6R1 2O5VA 5BO5A 2IXDA 5CGZA 2OGTA 1SH7A 3ND9A 1FC0A 3SS7X 4D4LA 1EWQA 1HTBA 1K6EA 4OHYA 2Y0BA 1JNYA 2BN4A 2XLCA 4L50A 4XDZA 4B6RA 5JEDA 3AVWA 2X9NA 1XPRA 3A8TA 4YP7A 9ABPA 3FYHA 3ZDXB 4NONA 1K7EB 1NMXA 4TMWA 4AJKA 4HGRA 4F6RA 1YFKA 4MIOA 1OY1A 3QJYA 4Q12A 2P7IA 4S12A 2IYQA 3OX4A 3HLTA 4HY3A 1JQJC 2FJ0A 4OUDB 3ZCUA 5JAIA 2QUZA 1Z5UA 3AYZB 1TGVA 4ZJPA 5KBYA 1JFTA 1P0CA 1T3SA 1F4PA 3UXYA 2XR1A 2ZYIA 3NANA 1X8KA 5DULA 3E9YA 4PR0A 3FYUA 5C35A 3CV3A 4MGEA 5JMPA 3G9TA 5CB4F 4WCVA 10MHA 1ODKA 5F78A 9LDTA 3CW2A 2FFAA 3RRJA 1UJBA 5FFMA 3LKVA 2AG0A 2MSNA 3P20A 4CM3A 4K1XA 3ZBPA 2DBYA 3RTCA 2A7XA 2ZWPA 1LLDA 3ROPA 3EVFA 3D5QA 3KTDA 1GPKA 4C0SA 2IIBA 3SJCA 1FXWA 5IHPA 4ND5A 5JY6A 2HMYB 4XQ9A 2F59A 2X7JA 5ER6A 2JG3A 2FTKE 3KJEA 2H4YA 3IDOA 4AF8A 1NRIA 5CLFA 3AFGA 2NXEA 1WJGA 3EN0A 4FGLA 4RGVA 5IBRA 4YR7A 3E7XA 1XMJA 1C0LA 1ODIA 4DCNA 4OH7A 1UZUA 3CH7A 4KQWA 3NWBA 3JWHA 4BNWA 5ETJA 3RS5A 1XU7A 1H9BA 5JZSA 5TLSA 1I1HA 1YDFA 2VT2A 1B8UA 4NBNA 5K99A 2BUCA 3CPEA 3BMXA 3OPYB 1CS4C 3VR5A 1JG3A 1EX6A 2J9ZB 4RX1A 4Y2GA 4MO2A 4CEHB 3HU1A 4B8ZA 4CEJA 1A9OA 2AYZA 3PD7A 3DVQX 5JANA 3KZ1E 4TMYA 3MN1A 4TWAA 4PZZA 3D7NA 1UEXC 2NXCA 1FFDA 5H81A 3CQ9A 4B6OA 4DAEA 3ZQKA 1XA0A 2IHNA 4IL5A 2O50A 4KO4S 3QTLA 4KQKA 3WMEA 1Z2PX 1R15A 3OFKA 4HRVA 1NKSA 3QNUA 4LDNA 4OGWA 3JZAA 1PVDA 1SBYA 3CZMA 3GFSA 2NIPA 3GCXA 4JWKA 1YDEA 1YVRA 3G85A 3EMKA 4WBXC 4ZVLA 1YVPA 4OKSA 2OLEA 3LHKA 1P2UA 1T6NA 3OT1A 1NT4A 1QK5A 1RI4A 4RD6A 1R64A 5JTTA 5HGXA 1E1NA 1TD9A 2OD7A 5T41A 4D4GA 3U4IA 2PKCA 4JEHA 2WPDD 4ZOAA 1UK8A 2CCGA 2C7PA 4GP7A 3OE7D 4PAMA 4ZYXA 5MGBA 3OX2A 2KJQA 2GYWA 4V0OA 3UHJA 3VVMA 5JARA 5IJXA 1CU1A 1L4UA 2AUMA 5IBCA 4Z4CA 5KZMB 3Q9SA 1VGVA 3QHQA 3U9SA 2Y93A 2DPGA 3VPFA 3VNVA 1DWQA 2I6UA 3GP8A 4TWRA 1G1AA 4XASA 2CSUA 5COAA 2YHBA 3TQRA 2EZ8A 2WUFA 2WYIA 5A1JA 1A7AA 1HDRA 1TTQB 2EQBA 1R0KA 1H6CA 3Q7RA 4GX1A 5LA6A 2GTHA 2FSPA 4ZEMA 1NKTA 2GAAA 3K4HA 4LCEA 5KSYA 3N6VA 1E1MA 5BSRA 4EHLA 5GONF 2NO4A 3P9QA 4QVKA 5HF8A 4JU8A 3VPCA 4DBVO 2Q9UA 3DD1A 3K0CA 3ERCA 5FFNA 3FN4A 5HA5A 4BZWA 3W8DA 1WWKA 2QRLA 3H8JA 2J85A 3HGQA 3JAWA 4WZBE 5K0SA 1IVYA 2JNWA 4I1VA 4WRRA 5C9ZA 2D2VA 3UJ6A 1KK2A 4L95C 1W4CA 3OP4A 1HLGA 1ZY2A 3VI4B 1AMOA 4QBHA 3UB4A 2O0HA 2XMRA 4L5BA 1DWUA 2W2VA 1Z5VA 1TMOA 2YHIB 4KHPB 3HB9A 1USKA 1WM1A 4JITA 5F23A 1XJCA 4U2DA 1DKNA 3V1MA 2F8MA 2J41A 3EXHC 4C08A 3IPLA 2H54A 4JI7B 2ZYGA 1TW2A 1N2HA 4V03A 1RLMA 4F2HA 2XUGA 3JZDA 4KIFA 3NBQA 1HT2E 4XUGB 5FYDA 5KQMA 5C5DA 1RXWA 3L7DA 3NJRA 2X0NA 3B36A 3NIWA 2VI5A 2XEXA 3GEEA 4O2RA 5K51A 3WV5A 5EQFA 3IP1A 4MGKR 4X64B 5AVTA 2HIHA 2P9JA 3JR7A 4CM1A 4EG0A 4WN3A 2HQRA 5JCOC 4Q00A 3BTUA 4DG5A 1BN7A 2XE4A 3BGIA 4Z3OA 5D2CA 1KWKA 4YI3A 2JBAA 2JGKA 3E1KA 3VBCA 1T2AA 3JD0A 3BXXA 3RM3A 4JOCA 3BMQA 1E4YA 2ZUUA 4MB6A 4YPVA 1Y4SA 2QBYB 5KMGA 1VG0B 4HZUA 1RD4A 1W19A 2D5BA 4JJKA 1CQIA 2Q3DA 1RRCA 2GSDA 3WL3A 1I0IA 1ZLYA 2RARA 3C1OA 3NHUA 1NVMB 1E8DA 2P78A 1FJGB 2GLUA 4MLCA 3VYRB 1JG2A 2CFCA 3JWIA 4X9XA 2IYFA 2FGJA 3PL1A 2P77A 3JASA 3QU2A 4FLMA 4ZJZA 4PLFA 1M1ZA 1Z0KA 4FCTA 1P7WA 4IO1A 1U7ZA 5IJAA 1E79D 4WDQA 4RJIA 4ZGGA 3AZQA 1RJDA 3ESQA 3I01M 3PU6A 2FUKA 2FH5B 2J87A 4ID3A 4AXBA 4I1UA 1G17A 1KS9A 3A25A 3GMTA 5A3SA 1ETUA 2I6XA 1V0JA 2J9XB 3DDHA 1YV9A 4E21A 1CR4A 3EVAA 1FQWA 4KBGA 3HKEA 1OIXA 1ZUNB 4LRQA 4QLOA 4MI6A 3RWMB 3QWAA 2UZAA 5JZOA 3CF0A 4B7CA 3D8HA 4X45A 2IXTA 1NFQA 2GEDA 2X42A 3PJDA 4HMOA 4HNGA 4IXTA 4KWEA 5CNKA 1W2WB 4OXNA 4Q5IA 4XTCS 3WSWA 3WDLA 2BEVB 2PLNA 2XCIA 5IKOA 3X1MA 4C2TA 1LPBB 4Y9TA 2ZSIA 2HJWA 4YMLA 1GG8A 1MR3F 2PY6A 2WF8A 4MS4A 2YNMC 3UT5A 5DBFA 1QNLA 1EB8A 2GKSA 3P45A 4ZKDA 3ZHCA 3QXCA 3NG1A 3WDMA 5HNKA 5FUMA 1N6OA 3EGXA 3Q1KA 4C6TB 4R05A 4EQ6B 5KJEA 3LX8A 4CMIB 4JJ4A 2QTNA 3E27A 5CHEA 4YCJA 4D74A 1HZZC 1VSVA 3KPYA 4S0ZA 1A5TA 3H1FA 3IQXA 3IUQA 3G5UA 3PCXA 4JWTA 4KMMA 4RVDA 4XX1A 2X19A 5K4GA 3ZVKA 3LXMA 1C9JA 1Y1RA 2A88A 3WLRA 3EXHA 2XAAA 1S4MA 2ZUEA 1TAQA 3ZJVA 1IVSA 3Q3JB 1ZU5A 3B1FA 4JT4A 1HGXA 3SMQA 4QFMA 3THOA 1QIIA 3GBVA 4KQCA 3AR4A 2R8PA 3DD5A 4A3SA 2V0GA 3U7HB 1GNQA 2ZYHA 3AILA 3E23A 1ATZA 3RT9A 3SXUA 3FLMA 2AOTA 2OXEA 4XA8A 3IOMA 4B3JA 5JCOA 4TQAA 4AZTA 1RM0A 2ASEA 2P0AA 3LVFO 1PD0A 1JR2A 4AJ4A 2WA1A 3BIJA 1KMQA 4IFIA 4NDNE 5KYYA 3KL2A 3CF4G 4G8BA 2OL4A 5EL0A 1FTGA 1EEHA 4XOIA 4IOLA 4YACA 4PBRA 5EMJA 2OXIA 1RWKA 4H7KA 2C88A 2ZJZA 2ZYTX 3OWHA 1L5RA 3W5UA 1H22A 2Q3FA 1K9VF 5ICFA 1S2MA 3H2GA 5ALTA 1UBJS 2YMMA 2ZUVA 5B3AA 1UM8A 1GTG1 5JI3E 4LNAA 4WECA 1IPFA 1ISIA 1PSZA 2ANCA 2C1XA 3ET5A 4FGSA 1P2VA 2FSVC 4FQ7A 1QQ7A 3QXSA 1RLOA 2JI4A 4C4YA 4RYDA 2C2YA 1RCFA 3D31A 4L5AA 1K4YA 1RE1A 5FOQA 1QX3A 4PZ0A 5L4LA 3HY6A 4UOEA 4GFDA 5KQSA 4HZIA 3UZUA 1YJ5A 3H83A 1MQAA 2YVLA 4ZVRA 3VA7A 1PJ3A 2DCUA 1VP3A 3E9QA 4U02A 1GRNA 5L45A 2R8EA 1E9SA 4CM9D 5AXDA 1RYHA 2CLMB 2H59A 3RODA 5KTOA 3GDWA 3SP1A 3NIGB 4YAKA 3EJ6A 2X5JO 4QXRA 2IKQA 4NMXB 1PJAA 4GMXA 3T7KA 3P96A 5DNCA 4QUBA 1IRIA 2WD9A 3VPXA 5F7OA 2WAAA 2YW2A 3NAQA 2P2LA 1QORA 3GJYA 4RHUA 2WWRA 1RWWA 3M6MD 5KNDA 2ZIGA 5DISB 5KC9A 3FUTA 5K0NA 1SZPA 1DAKA 2JCVA 2W4IA 1DWOA 1T9BA 2JIDA 2YNMA 3V1KA 4DMKA 2PGXA 1KI6B 2BMAA 3L2OB 5JXIA 3X1DA 2GCEA 1NMZA 3AERB 1MDFA 4TL7A 5JO9A 3TR5A 4ENVA 1K89A 4PRLA 2II6A 4B3SB 1Z8HA 4Y1GA 2IBTA 5LYJF 1X14A 1LPAB 4GLLA 1QYIA 3LKZA 1TT5B 1F9AA 1HZZA 3DTNA 3W78A 1A4XA 4INOA 5KB3A 1Q0PA 3DTVD 5DBHX 2RG1A 3QWIA 1QV6A 4KO8A 2C0QA 4QRIA 4Y1RB 3SHFA 1PN3A 2YVKA 4DUYB 1Z0JA 3HCRA 1OZGA 3A1FA 1E2IA 4CFYA 2I76A 1OF1A 3SSOA 2UYQA 3ZCPA 3K70B 3IUNA 1Y3FE 1H94A 3PGVA 3KAJA 3DYVA 4L74A 3NUGA 5CDYA 1NZDA 4BV2A 2QRJA 4E1VA 5HPYB 4L4SA 1NVXQ 4M83A 1CQJB 2CLDX 3TQTA 1X7ZB 1RYMA 1SN7A 2SCUB 3G2QA 1FXSA 1GAQA 5ILQA 1QHHB 2VBCA 4KE7A 3JQBC 4IY1A 3B89A 3A7DA 1GKKA 2XHEA 2Y9MB 4LPKA 1HYHA 3WLFA 1COWA 3DMYA 4AQDA 3ZTWA 3MJSA 1W5SA 2JAXA 1YZHA 4BQOA 4Z3KA 5A3RA 4AMUA 2P1DA 1TA0A 1JJFA 4EHIA 1KARA 2BI7A 5F1YA 5CIQA 2WFZA 1L7VC 5EJIA 3BK7A 2OV8A 1YQEA 2ERYA 2PZKA 3I1IA 1UP6A 3W9SA 5C5EA 5T6MA 3CJTA 3E84A 1WDKA 4DYDA 5CB4A 2J5RA 2QX8A 5EMNA 4MYCA 4QYIB 5DX1A 1FIUA 2FSVA 3VNUA 2CLCX 1W52X 2QJWA 3M4NA 3OEHD 3UHFA 2O23A 3LMKA 2QLFA 4EATA 4BTEA 2A5FA 3FBWA 5B6PA 3JR3A 2Y68A 4RS4A 2IELA 1BWSA 4GPEA 4KUEA 3QEAZ 3FTQA 3NIBA 3WHKA 1B3RA 3QENA 3NVMB 3LWNA 3KKOA 5HKBA 3TJRA 4G56A 1ZSYA 4WACA 2DY0A 5K6AC 2J0SA 1T1GA 1JHQA 1QPZA 1U4SA 3TNYA 4MKRA 5LYJB 1OH5A 5AJUA 2EKZA 1Z0FA 2W5UA 3DQPA 4G0YA 4LWZA 4NPHA 1EJ6A 2IHKA 5E7MA 1F8UA 3UUGA 4N3AA 2QTRA 1FQOA 4WFKA 4AN1A 7MDHA 4JYZA 1AKNA 2VDNB 1K63A 1QANA 2BPOA 2QW8A 3HHEA 4CG0A 1H1DA 2FEAA 2O52A 3BXPA 1B6GA 1NQWA 1QBGA 2CZGA 1IXZA 1UOEA 2EP5A 3O4HA 3OMXA 4XXHA 5AHKA 3TW8B 4QKQA 1JIUA 2AC7A 4X7RA 1LJLA 2JAUA 2BKXA 1HDOA 2NTVA 2PO7A 5CFPA 4DLSA 5FL7D 2IEGA 4EPVA 5LQCA 4CCAA 5ICEA 3AEUB 3D6MA 2IHZA 4XFDA 4HNHA 5GTDA 4UAVA 2FE4A 1RHRA 2Q5EA 2O5CA 3ANNA 2QTHA 3RUCA 5DN6A 3ELWA 1HMPA 1YDMA 1EXMA 2X23A 4LDZA 1K92A 4UFNA 3DO8A 1LLUA 5D01A 1ZWLA 1NW5A 1FUEA 4XX0B 1W6RA 2PT7A 1IHDA 1ZUD1 4RM2A 1FRZA 5JWHA 2YKGA 2PZAA 5K3BA 5CNMA 4MTCA 1YOVA 1TUBB 3DAOA 5KC8A 1ZK4A 3KKZA 3AB8A 1AZWA 1DFHA 4Q4CA 3ZDCA 3J7AC 4ZMBA 1N2GA 4JP8A 4PZUA 3NM4A 3AF1A 5JOQA 5KVCA 1LW7A 2NVOA 4DMGA 4NRDA 3NHLA 4GT1A 5HILA 2YHSA 1BHQ1 3DEZA 3PDJA 3MCWA 2X7XA 3LBFA 3WGNA 3V7UA 4FFVA 4RTMA 5FPQA 1X7HA 2GLXA 3GRVA 1JDJA 4KPUB 3MJVA 1MW9X 2WM3A 1IAVA 3TSZA 2QBYA 3JYLA 3T1TA 3MPUA 5E9WA 4I99A 1SG0A 5A6SB 5JNLA 3HCCA 4JLNA 1Z2DA 1DHRA 2PUWA 2TECE 4I9UA 4BS9A 1LVHA 5BNWA 2QIPA 5H5JA 3SS9X 1RW4A 1NXOA 1GPAA 1T35A 3VJRA 1NN0A 3LBYA 3QFHA 1SZCA 3DM9B 2G6TA 2ANBA 1D6NA 1XEWX 3MERA 3RRZA 2XBMA 5AHXA 4D98A 2O2HA 3A9SA 1ITZA 2HPZA 2OD9A 3GPIA 3GA0A 3JVUA 1SWVA 1Y1KE 3DZKA 3U5TA 2HMAA 4UE3S 5KO2A 4RXUA 2KBFA 1JH9A 1TQ2A 2C4WA 1KGSA 4JAVC 4P22A 1E7YA 2NXJA 3GFRA 3IXMA 5JZBA 3N2GB 1H3FA 4EY3A 3CNOA 1XDWA 4TS3A 1F6DA 5LBUA 2C7BA 2QSZA 1QZXA 2IHJA 3HY4A 2WI8A 3ONWA 2JPDA 2X4IA 1KYQA 2C7GA 4UTOA 4XDHA 4CF3A 3AVVA 2YZGA 3H8WA 2VA9A 1ECJA 1D7OA 3HS3A 4EYEA 1E94E 1S1CA 5BN1A 1E9VA 4ZJYA 2EJTA 2BEVA 4G97A 1VHJA 1XZHA 1YQDA 3G9ZA 4NARA 4KSBA 4P36A 4AURA 3LU1A 3FFBA 4DJTA 3ZXYA 2EBFX 5D5QA 3SXJA 2XF8A 4KX5A