1V2HE

Crystal structure of human pnp complexed with guanine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
288
structure length
288
Chain Sequence
ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Crystal structure of human PNP complexed with guanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1v2hE00
2AI1A 1PR2A 3EUEA 4TXLA 4E1VA 2QTTA 5F7XA 4TS3A 3C74A 1ODLA 3OOHA 2I4TA 3LBAA 4D98A 1N3IA 4JOSA 4YO8A 2AC7A 5CYFA 1V2HE 1TCVA 1OTXA 4U2KA 4UC0A 1PR4A 4JP5A 1ULBA 2B94A 4DAEA 3P0FA 4OGKA 3OZEA 2QTGA 4DABA 1U1EA 1Y1RA 4K6OA 1OTYA 1YBFA 3OCCA 3UAZA 3NM5A 3OPVA 1U1FA 3DDOA 3KVVA 1TGYA 4L5AA 4M3NA 2QSUA 1A9PA 1RYZA 1RXUA 4OY3A 1I80A 1RXSA 5F78A 3FNQA 1Y6RA 1M73E 1PKEA 1WTAA 1B8OA 1PF7E 4DA0A 1A9OA 1NC1A 4G41A 2HRDA 1PWYE 3FOWA 5F77A 1A69A 4GKAA 1YQUA 3PHCA 2OECA 1PBNA 1Z33A 3UT6A 1YRYE 1TD1A 4L6IA 4D8XA 1U1CA 3P0EA 4H1TA 4LDNA 1Z35A 2QPLA 1CB0A 2P4SA 3ODGA 1Y1QA 3FWPA 1OV6A 4TTJA 3KVRA 1K9SA 4G8JA 1JYSA 1Z5NA 3KVYA 3MMSA 2HWUA 1PR1A 4KN5A 4TXMA 3UAYA 5F7JA 1YQQA 4GLFA 5F73A 2RJ3A 4F2PA 4WKBA 1T8RA 1ZL2A 1FXUA 1PW7A 2A8YA 1Q1GA 1NC3A 2I8AA 1JE0A 3MB8A 4TTAA 2HN9A 2ON6A 1ODJA 3NM4A 3UAXA 1ODIA 1T8SA 3E0QA 1JDUA 3ONVA 4TXHA 4D8YA 2XRFA 1ODKA 4NS1A 1VFNA 1JDVA 4M1EA 3FAZA 4YJKA 3OZCA 1YR3A 3LGSA 5K1ZA 1V48A 1RXCA 1SD1A 3QPBA 4P54A 4QATA 5B7PA 1T8WA 3EUFA 1ULAA 1PR0A 1RFGE 1ECPA 1V4NA 5I3CA 5CXSA 3BJEA 1VHWA 4BN0A 3BL6A 4QFBA 4OGLA 1QE5A 1SJ9A 4TXJA 1OUMA 5CYGA 4QEZA 4GLJA 4IP0A 1LVUA 2AI3A 2BSXA 4MARA 2OC9A 4NSNA 1OVGA 1RSZA 5B7GA 1V41E 4F2WA 4X24A 4R2XA 4OEHA 4OJTA 1JDZA 1G2OA 4LZWA 3PNSA 3TL6A 4F3KA 4L0MA 3D1VA 4JWTA 3GGSA 3K8QA 4MCHA 4TYMA 1PR5A 1Z34A 3K8OE 2A0YA 3IOMA 4GMHA 3LA8A 5CCEA 2QDKA 3ENZA 4RJ2A 4DA6A 1VMKA 5C80A 3DPSA 1U1DA 1T8YA 4NY1A 3DJFA 1CG6A 4EARA 4WKCA 5B7NA 2IQ5A 2OXFA 4R2WA 4BMYA 5ETJA 4QASA 5EFOA 4TS9A 1Z38A 4D9HA 4DAOA 4LKRA 4M7WA 1PK7A 2OC4A 1T0UA 4DANA 4BMZA 4ECEA 1OU4A 1A9TA 3PNPA 4TXNA 3DF9A 4LNAA 2H8GA 1A9RA 5EPUA 3EEIA 4DA7A 3BGSA 1RR6A 2HSWA 2AI2A 1RT9A 1K27A 1JDTA 3O4VA 1K3FA 3F8WA 5F7OA 3IEXA 1PR6A 3KU4A 3GB9A 3OZDA 4OF4A 3EMVA 4TTIA 1RXYA 1JE1A 3PHBE 3FB1A 4PNPA 4F3CA 4L5YA 1Z37A 3INYA 1JP7A 3O6VA 1U1GA 4QARA 1PK9A 5F7ZA 4DA8A 1NW4A 3NBQA 3KUKA 4DARA 4G89A 1V45E 1Y6QA 5JPCA 1B8NA 1XE3A 5IFKA 5DK6A 4WKOA 4F1WA 4QAQA 3SCZA 1RCTE 4EB8A 5CCDA 5IU6A 4R31A 4PR3A 3U40A 1JPVA 4YNBA 1SD2A 4LNHA 2Q7OE 1TGVA 5CXQA 3KHSA 1LX7A 1C3XA 5B7QA 1LV8A 4MCIA 1JDSA 3NM6B 4I2VA 3T94A 1TCUA 3E9ZA 1A9QA 1Y1SA 1ZOSA 1Z36A 4L5CA 4YMLA 3BSFA 2A0XA 2PGAA 2ISCA 5FAKA 3DP9A 3E9RA 5EUBA 1Z5PA 1Z5OA 4FFSA 4WKPA 4WKNA 2GUWA 3OOEA 1V3QE 3UAWA 3OF3A 4BMXA 1Y1TA 4D8VA 1A9SA 1SQ6A 3FUCA 1VHJA 3OZBA 5KB3A 2A0WA 1Z39A 5F76A 3UAVA
chains in the Genus database with same CATH superfamily
2ZB2A 1ONNA 3ORHA 4DCMA 3X1WA 3WGNA 4RMNA 2P8JA 3RTDA 2AMLA 1BXRA 3L92A 5EMJA 1EE9A 3M0EA 3D8BA 2OV3A 4ODIA 1PVOA 3CNEA 1WSAA 1IPFA 1U4NA 1XI2A 3R0ZA 3NHWA 2PMFA 4MS1B 4EGSA 2J3LA 1OOEA 1QONA 1R88A 4PFQA 3OEWA 1VOTA 1WHTA 2Y1GA 3INGA 3NOQA 3P71T 4FHDA 4PC1A 1U9YA 2CUTA 3L93A 4ZOLB 4N18A 2I4TA 3KJGA 5E2AA 4E6EA 2FFJA 1O87A 4EVQA 2IXTA 1XAHA 1ODCA 2VP4A 2NZYA 3AEXA 1Q1ZA 3VZRA 1BRMA 2ORYA 4A15A 5CFQA 4F5YA 2FWIA 1AVTA 3U81A 4XRGA 5AVTA 1XZKA 1HT2E 1UK8A 1JAXA 3HHPA 4E0BA 4ESHA 1MQ9A 2GS9A 2GHTA 3BHIA 4G5SA 1R18A 4JUIA 4XWYA 1OTXA 3A58B 5DLDA 3SNKA 1P0QA 5DHQA 4Z54A 4ZHQB 4CEHA 2FPGA 1HDXA 2J9FB 2XQVA 3QUSA 4LVUA 2JH3A 1MVNA 2F55A 1M1NA 1KZ9A 2AX4A 5E95A 5ENVA 2IJGX 3OU7A 4PE5B 3T5CA 2ATEA 1W5FA 2NLOA 1L3CA 1IHOA 3GUZA 1LDMA 3N07A 4OFXA 5AVKA 3PQEA 3WMXA 3OLYA 5GVSA 2PANA 3MQ4A 3N0WA 1XJQA 4R9NA 1AU9A 2GZMA 3HG7A 2D7JA 1DFGA 2BFEA 1UPCA 2Z2IA 5FFFA 4JJZA 1TECE 1T5DX 1JHDA 1N25A 1JYEA 1QOZA 3ZHYA 4DIUA 1CJVC 1BE1A 2PL1A 2IUUA 1Q44A 4KN9S 4MZDA 1YBFA 1EP9A 1V0JA 3DEZA 5ENDA 3ZCSA 5KVSA 1XXLA 3OPVA 4P31A 2VUUA 3AOEC 4HPXB 1PO7A 1A8QA 4UVHA 2A1UB 1PR3A 3L0YA 2FZGA 4DMMA 2JASA 4RTMA 4DM3A 1O8CA 3CM0A 3RVJA 3PDIB 2I9KA 1ZFNA 1ZW6A 4MGZR 1Y4AE 3OOSA 2D5LA 1Z08A 1R0XA 3LLCA 4MPJA 5HQJA 2H1OA 2H1LA 2NUTB 4ND5A 3IMKA 4PGFA 2C54A 4BC1A 3ABRB 4U00A 5BOSA 2CLEB 1DKNA 5D5HA 2FGJA 5JH7A 1RPTA 4HV4A 3EXHC 1WTAA 3IPRA 3GGJA 5AM0A 2FXVA 1RQLA 4ZZ1A 3EC7A 3ZXUB 1XJWA 3EJWA 3V80A 1RJEA 2Q7XA 3DC2A 3GLKA 1P2BA 3CWZA 2OMEA 1NJ6A 2YN4A 4B87A 5KYWA 3GVIA 3LRTA 4JR2A 2H4YA 3E9EA 1E60A 4CQJA 3I83A 5FI0B 5B1YA 5K3EA 1A69A 1DAIA 3WRYA 4P82A 3BD8A 4EK9A 4BMCA 4JBHA 4F2HA 2WE7A 5EE3A 1DJOA 1GGFA 2BAGA 3I0MA 2GPAA 1IJFA 2PV0A 2ZULA 1Q5PA 3GRZA 1OGIA 3RBAA 5HIKA 4L8FA 5AOVA 2X4LA 1Y9JA 3W5DA 3G6WA 2OCIA 5DTMA 1EG2A 1EM8A 3SZGA 3UT6A 2VPZA 5I9IA 1TQ6A 3A27A 4KYIB 2NP7A 2WNHA 4OUDA 1VA5A 3BULA 3IOCA 4HFJA 1XCGB 1PL7A 1H2RS 1XZ8A 4MRVA 1JHOA 4GBED 2WIKA 5DCLA 2IYEA 3U60B 1TKAA 2W4IA 3WRXA 3C0KA 3LD9A 3ZHUA 3HKDB 4ZRDA 2BZSA 2H92A 4YBRA 1UIMA 4E2FA 2RC6A 4ZEWA 2BJVA 4CVNA 1ZJYA 4MOWA 3WV4A 3DUFA 4IDEA 1E3TA 1WPXA 2XI4A 3PC7A 3CZ4A 3FRIA 1M1YA 4GYWA 4Y2JA 4U3JA 1EUDB 3VZCA 2D3TA 5K7SA 1N2EA 2Z8YM 4B7ZA 1L1QA 1F9EA 1Y6JA 1JLKA 4DLUA 4M38A 3OFNA 3MMSA 5GAJA 4CLXA 4MUEA 1F4PA 1T15A 3IC5A 1LDEA 1R8QA 2OBXA 1QVWA 1D6JA 1T4CA 1NV8A 2HIAA 4WY8A 2R751 2YY7A 2Q5HA 5F73A 2AJ8A 1CY0A 2H7CA 3LRPA 5JE8A 2Q45A 4QTUB 4XIYA 3VU9B 1JN0A 2C84A 5FOUA 1YZQA 1X7WA 2GVNA 4B3JA 2NSJA 1N9GA 2ZWVA 3JQAB 3NU1A 4D0SA 3TX2A 3AY7A 3K9GA 1QIEA 2IDJA 4GD3Q 1SC4A 4S12A 3SSMA 1N77A 1D4FA 3LJKA 5T67A 1MAHA 2GF2A 1LDGA 2O50A 4MO9A 1W2GA 2HBYA 4R8MA 5I7FA 4ENSA 5B3KA 3HJCA 5CAEA 1GAXA 3VNVA 2JHFA 1YR2A 3ZGZA 4MS3A 1G7TA 1JJAA 3VI3B 2RGAA 4ZFNA 4Q9AA 5TVKA 4JZKA 1SUEA 2FQWA 2J3DA 1Q92A 4G8BA 2IELA 5CLJA 3ENWA 4FZ3A 4XB6B 3GYBA 3EW9A 1GUDA 1NRWA 1ZJWA 4MGEA 4GR4A 4RVCA 3JVVA 3HP4A 4QYIA 4WXHA 2QD2A 3MJRA 2DJ5A 4JB8A 4CIDA 1TAGA 3EGEA 5JZVA 5AVUA 3MWKA 3HR8A 1VFNA 2ZAMA 1MKYA 3IR6A 1EWYA 4H7HA 4I81A 2BELA 1O9GA 2OGSA 1X39A 2C4VA 2B4AA 2ZLBA 5FTWA 3TSYA 4YPOA 4N0MA 3AF5A 1ND5A 1QO0D 4IMJB 1PR9A 3CEAA 5BSWA 1E1DA 1XZHA 1TX4B 4L8LA 3VO1A 3CCFA 1ZGBA 2NGRA 1E3MA 1DWUA 4QFDA 3C3AA 4B4OA 2HPZA 3CMCO 4QTYA 1OLXA 1GG2A 2QL5A 4PNZA 3IMCA 2H1WA 1EGHA 3IRUA 2FJPA 3UOWA 4EP1A 2UYCA 3OZ7A 4XI9A 3C4VA 3RUIA 1G38A 1KF0A 1MNQA 4CR7A 4DREA 3L02A 3H04A 4S0XA 2G04A 3PL1A 1QQ5A 2FR8C 1LDYA 2EEPA 4WN3A 3I62A 3GNQA 3AUYA 3IAHA 4MVJE 4U6NA 1SB8A 3GV0A 4BPRA 1MGOA 1KJYA 4C0SA 1AGXA 1RWKA 4QPZA 4NDNE 3SQXA 1TAUA 2HCFA 3FJYA 4H9GA 1QE5A 4UBIA 1N1MA 1U0JA 1EYZA 2YR0A 3T3GA 4G65A 3MM4A 4YHBA 2JFFA 1IVYA 4JZYA 4EWLA 2JFUA 1Z0JA 2ZQ5A 3S4YA 1YZGA 5DW0A 2YHBA 1F17A 2G8NA 4JLNA 3H5NA 3H2SA 3W7VA 1VB3A 1ESDA 4CM4A 4H1WA 4M83A 1Y1LA 4DMRA 2D74A 2BP7A 3ILHA 3K53A 2XADA 3Q98A 4NG5A 4OQNA 3T7EA 4BRSA 1PI3A 1MZPA 2YFQA 4D41A 3PJRA 3SI7A 4TMZA 2AG0A 3DMNA 3H8JA 3TTUA 3LX8A 4D8UA 3JTEA 2GBIA 3MCVA 4QVGA 1GU0A 2BTOA 2D5CA 2P30A 2Q5QA 1JLLA 2G6BA 3ABOB 1HPLA 2WU0A 3HXPA 4B3RB 1ZLYA 3ZJ4A 4J6EA 2E49A 1HMYA 1NKSA 3SLRA 3QU2A 4GOOD 3DYVA 1G63A 1U90A 2XPCA 3CW8X 1A4RA 2NXJA 3PNVA 2VHVA 2XKJE 4LDJA 4LNUB 4ZT7A 3UMMA 2AEEA 4TYMA 2H2HA 3IPAA 3DHYA 3Q7SA 1EZ4A 1E62A 1A2KC 1Q1AA 3LA8A 3N3AC 4C30A 4DEYA 2GRAA 4F7DA 1TQ4A 4GECA 1YGYA 4JJEA 4BNDB 2EZ9A 1KJQA 1VMKA 4BBAA 1CB7A 2I4MA 4DJJA 1E3LA 2FZ5A 2R2AA 3C8MA 2LDBA 2PLFA 2VDVE 3C97A 2Z0MA 4FHFA 4KWCA 4WN9B 1P31A 2UUAB 2C3MA 3KQQA 2CSXA 3LCUA 2NZ2A 4JASB 2J1LA 5K8IA 2L82A 1Z9BA 2YDYA 2ZJ5A 3BS4A 4A4DA 5JZOA 4FI3F 3FMOB 3R5FA 4NI5A 3TR6A 4G24A 1E2UA 4HMOA 5T4EA 3FKSA 1J0AA 5DRTA 4Z0NA 3OKFA 4R8VA 4HDQB 4IJKA 1T4BA 3WIDA 3R40A 4GI3A 2EF1A 2PMWB 3NBKA 1LPSA 1S3SA 4BMXA 1J4AA 4Y8VA 5AOAA 3ZZMA 4E5UA 1ITZA 1F1JA 1L4HA 4QJ5A 2WNIA 3MFYA 3AUXA 1X92A 3LQKA 5AUQA 2QG9A 1NSTA 2PEZA 3IGFA 4ZOQI 3DMFA 5JAZA 5EKTA 5KKCA 1WZNA 4Y6RA 3DOJA 4YJFB 4JI3B 1NHGA 2BEUA 3TOCA 2BDEA 1SBIA 4TV9B 1PK7A 1DGQA 3E35A 2P4HX 2B1RA 3TVDA 1AV6A 1ISMA 4ALJA 1X94A 4FT4A 2WIFA 4NMWA 3IEKA 3SBOA 2QZZA 4IXTA 3CN7A 3HJHA 1J9GA 4EY5A 2ZBEA 2A33A 3WZMA 2JGJA 3NHKA 3NH6A 4IOJA 1UMCA 4P08A 5J40A 2X1MA 4ZVMA 5LA6A 2XT9A 3C3WA 3V2HA 4DA7A 3QSGA 1FP4B 3DOIA 1AKYA 3BGSA 1KO7A 3OUTA 3LTEA 4KV9A 4BMPB 4MV3A 1O8BA 4IIUA 4F0JA 3R3WA 4EJ0A 5CB6A 2J7PA 3MFQA 2A5JA 2YZMA 3PEWA 4RF3A 3ZD9A 4X7RA 2ZZMA 3BVPA 2PN1A 2I4IA 3ZJTA 4AJ2A 4JD5A 2JD0A 4NC9A 5ECWA 1WV1A 1KTIA 5AK0A 3LT1A 4KGVA 5I7UA 3V8MA 5D6NA 1NLZA 1YVDA 3LMKA 3KM0A 4CG1A 2MSNA 5JAUA 3FVRA 3K5IA 3D8RA 4OI2A 4Q16A 3WB9A 2QX4A 3PGA1 4M1QA 2C58A 1VKRA 1NF9A 1U2ZA 2FPUA 3UVEA 3E7FA 4DCVA 4MI3A 3EZNA 4V0KA 1PSDA 5TMBA 4FCCA 2OCBA 3MJFA 1ZXBA 4NZMA 4D9FA 4Q9JA 1YT5A 4RJTA 4H4DA 2NPOA 3K0EA 3UFXA 2WK1A 3DBLB 3HLKA 4QBFA 4A82A 3D8UA 4B71A 2Y6VA 3PA6A 3WQBA 3I61A 1VMDA 2A7QA 5JCJD 5E8JA 5HVNA 5ALHA 5FUWA 1OYVA 3HKEB 3GZ4A 4QXAA 4X5OA 2OM2A 2QXYA 5DLQC 1HTTA 3WLLA 5CFNA 4KU4A 1I51A 1ULSA 2GPBA 4MJLA 1LSUA 5A0FA 4KQEA 3GP3A 3BG5A 3WGOA 2ZCJA 3UV6A 5KUTA 2XVMA 2YWRA 3DDHA 1HL3A 2XIQA 1KAEA 3EIQA 1KSGA 1QLHA 5SYMA 3VNSA 1F51E 4YTEA 3UPUA 4HWTA 3THOA 2UZ1B 4RXUA 4O4HF 4AF6A 1G3RA 4KDRA 3LWBA 2OKGA 5IN4A 5J4VA 1OSNA 2BL4A 2QRNA 3K4QA 3UQZA 3PLAE 1XU4A 2VJPA 3V8EA 4C08A 1KZYC 2Q6IA 5KYNA 4L8VA 4AZ3B 4OXRA 4RULA 1FFEA 2WFAA 4J1SA 4R40A 3NEAA 1PUXA 3OPMA 4GQIA 5FORA 4EFDA 1KDTA 3LUFA 4FKMA 3QVXA 2XMCA 1YQTA 1HF3A 2WDPA 2H9AA 1ESMA 2C97A 1G5RA 2Y4OA 1NSYA 4N8SA 5IS2A 3J80A 4HDSB 4OOEA 1XPJA 4KIWA 4S1VA 5JXGA 3ZVMA 3U0VA 3NAMA 2P69A 4TUYF 1SRQA 3H86A 4PVCA 4G56A 1WS6A 3C39A 3M89A 4KQ9A 2HMSA 3F2IA 2IEAA 1NUUA 4RE6A 4C4YA 4XIGS 3T9EA 3FVWA 3IDFA 1RHMA 1P9NA 4MV7A 1J2YA 1T2CA 3ELWA 4HSEA 1AXEA 1VE6A 2OO5C 4HEQA 4URHA 3V8RA 3T3MB 3SBEA 4GX2A 1GA4A 2FUCA 1KDVA 4DRXA 3DFZA 3H2ZA 1IDOA 3ZTTA 1FYWA 4XWKA 3ED5A 3RUPA 5MN5A 4P7GA 2BCJQ 3U7RA 3EXEA 1PZHA 4DCUA 3AFMA 5A6VA 4TLAA 2RDMA 2R68A 2Z98A 1CF2O 1NVVR 4HGNA 3SIWA 5FOVA 2QKYA 2PYZA 2ZP1A 5B55A 1N2XA 2VSQA 3ONDA 5DGHA 4XIIA 3ZZNA 1OH7A 4KWIA 4ZCRA 2J3MA 4EKEA 3C14C 1AHPA 2CBZA 2IW3A 1DV1A 2ZBUA 3KE8A 1MX5A 3IJPA 4JN6B 2VXYA 4X6XA 4EKDA 2DH6A 2XSZD 3IVRA 2G5TA 1MT3A 4NPAA 5DX1A 1E2PA 1N7HA 3ZBPA 4DWJA 1X1DA 1XLUA 5KWVA 1D5WA 4C0WA 1JPNA 3UIEA 4JP1A 3K6KA 2AFHB 1SO8A 3DXZA 4B4VA 2ISCA 2Z58A 2Z8YA 4NNPA 4OBWA 1OH6A 1Z5PA 2EZ8A 4Q4CA 2B98A 3ROZA 4DG8A 4WZBB 1NX6A 4Y9TA 5H70A 1EUYA 1Y7TA 2LP4Y 4WKNA 3OM9A 4OSOA 4PG6A 5I7WA 5C1PA 1A9ZA 4O4IF 3IQFA 4RSGA 3BFJA 1I7DA 4TWIA 3OEED 2JGDB 3LDFA 1Z56C 2P9QA 4YQEA 1GZ3A 2X8WA 3CW2A 1BXKA 1XZPA 3BEOA 3E81A 3GH1A 3VPBA 1IZ9A 4Y3UA 2FRVA 1A7KA 3JVDA 2H2WA 3WMRA 3OZBA 3GWGA 4ZDJA 2GEUA 1A8IA 4R0VA 5A7HA 2H2IA 4BOYA 1S8OA 1QYIA 3I0NA 3OLWA 3R7LA 3ZOZA 1Z39A 1O5IA 4D25A 4M1TA 1QE3A 2RK4A 1W0CA 2LV8A 3GC6A 3O4JA 3OI7A 1RLIA 5TQ0A 5FUMA 2QW8A 4YAFA 3UKJA 3A36A 3HU1A 1KEKA 2B0JA 1OTHA 2FX5A 2G0NA 1GNRA 5D3ZA 3QBEA 4ZTZB 1D5CA 1DPGA 2I65A 4V3BA 4E4RA 1T2NA 1I7SB 1AZLA 2QRVA 3F7MA 4O4HB 4XB1A 1NF3A 3PA8A 3UC5A 3DEAA 3AWDA 4K87A 3ZZ0A 1FVXA 1I3OA 5LN1A 1C2TA 2OAQ1 2Z3VA 4J4BA 4B7XA 4ZYZA 1H8HD 3QGMA 5DVZA 4PN7A 1ZQ9A 4J1QA 1M2VA 3A6ZA 1IVSA 4RVUA 4YO8A 1QDLB 4NBNA 4HK4A 1PT8A 2PPLA 4N0EA 4JYMA 4OAOA 4TMFA 5ARDA 3JALB 4PX2A 3WDMA 1Q1BA 5TNXA 5DWQA 5C1BA 3ZD7A 1TYZA 4JJGA 4A91A 3QKTA 3KXKA 3T3EA 3GK3A 2H18A 4BKUA 4MVCA 3HP1A 4TUYB 5E2BA 1OKKA 3WKAA 3PGXA 2VUTA 5L4SA 3FTQA 3E7PA 4KIFA 3ZS9A 4PLWA 1KETA 1I4TD 2AA3A 3NYIA 3ZTYA 4CL0A 2HEGA 4Q4HA 2HHAA 2J0UA 4NENB 4YGXB 3WK9A 1U2DC 1FDWA 1M6EX 3FGPA 4Z9FA 4DABA 1WETA 3RD5A 1I6LA 4CT5A 3AOGA 5AM3A 2AKYA 1RYNA 4RMHA 1PGQA 2AE2A 1NG1A 2G5GX 1MZVA 1FVOA 3MGCA 3S1SA 1E58A 1JNYA 1X1EA 2ENWA 2IHUA 2QM7A 3GD7A 4HLUA 3RHSA 2PEYA 1SHUX 1TUIA 4Q48A 3R9XB 3I39X 1HL7A 3ENKA 3QBJA 4JQCA 1KZGB 1QK4A 1KMNA 4TQAA 2JJQA 4Q3BA 3ZE7A 1NQVA 1KQNA 5TX7A 3K9WA 3KHTA 1YVUA 1QGUB 2PRIA 4YRFA 3ACCA 4UM8B 4F6LA 6CHYA 1T2FA 1GU1A 3A6EA 4LHXA 4XGKA 3SD7A 3SS8A 4C6TB 1UC8A 1NKTA 5C2JB 1E1CB 5DM0A 3HK2A 1FTQA 2BKEA 4FYIA 2IYFA 4WI1A 3UJ9A 1N1GA 2VQ6A 3PGJA 3DOUA 2C8LA 3EFOB 3LBNA 4P2BA 4BYGA 4BE7B 1UPAA 1B43A 1L4BA 4D45A 2E85A 1FPQA 1FS5A 1KWKA 1FQWA 3GPIA 2HA2A 4Y0AA 1HUQA 2H29A 2OKCA 4MQUA 5IXYA 3JRNA 3LYHA 3PXEA 1WXHA 5KEIA 1HKHA 1KH1A 1WL8A 3QMWA 4MKGA 4UE2A 4X95A 3ROEA 1CPYA 4QELA 3WMEA 4W5JA 4CKBB 1A97A 2C4KA 4FZJA 5DXAA 3DZGA 5KHAA 4P38A 2VP0A 5TGTA 2ZUCA 4HADA 2DAPA 2JFWA 2DPXA 3E3LA 1NW6A 2FN9A 5IVIA 5AW1A 3ZU3A 3TFOA 2OECA 2Z8XA 1Z33A 4ZO7A 5FBZA 1WDTA 2YL2A 4O4IB 5TMEA 4BFYA 4E5SA 2ONCA 1J1UA 4WK2B 2JEZA 4K2HA 3D8HA 1RLTA 4Q34A 4NMMA 4BNFA 2NUBA 4RCZA 2XCTB 5LD2B 4ARIA 1PSZA 1AV7A 3SOPA 4IH1A 1H94A 4Z2AA 3S8YA 4PZPA 2QU7A 4RHCA 5L3SA 1C2YA 1X1SA 2PXAA 2FWMX 2X8BA 3E1SA 4B3FX 3SICE 3WO0A 1EM6A 3DD1A 4CDGA 5K6TA 3EGDB 2ZRKA 4FBGA 4N6NA 4PXYA 5CU7A 1N78A 1LFDB 3BGVA 5JDIC 5CT5A 2PCJA 2POQX 4KOAA 1Q0PA 4DCTA 2O2XA 5K3SA 4UNNA 5A5EA 2A58A 3ZC3A 4D4IA 3AW9A 4PPYA 4X20B 5HZGA 1VPWA 2B8EA 1E7QA 2F62A 2OVFA 2FJUA 3LS2A 4DNQA 1CERA 4ETNA 1P8AA 4FQ7A 1USUA 4J4TA 5IN5A 2AQKA 4D6PA 2ONKA 2ZUTA 4BFLA 1T3ZA 4TXMA 1K75A 1AURA 3ELYA 3I4FA 3H11A 3JQEA 2HD4A 3BEDA 4GYKA 5BN4A 3AIOA 3RC9A 1X80A 1H1LB 1XYVA 4MQEB 4ZEMA 4XDZA 5D2CA 5G3ZA 1XRRA 3B48A 5C4IA 5LWQA 4FI3C 3U5ZB 1ZL2A 3O90A 1GTZA 3BF8A 3ZEAA 3PRJA 4RADA 3PD7A 4Q4LA 2C3YA 4IXNA 3PQ8A 4ZVRA 3SOZA 3SXUA 1JHPA 1JSCA 4FDVA 5IAKA 1JBEA 4WJKB 4H18A 4PLHA 1G5TA 4KTTE 2VP9A 2PJZA 4PLZA 6NULA 3RSGA 3MB8A 3OF5A 1SC3A 1Z8HA 3PHJA 5JUWA 1N3BA 2LCFA 3V4RA 1H0SA 3PQCA 2GEBA 2XYQA 2ON6A 5JAMA 1P0PA 2WUGA 3TB4A 3HO8A 5GINE 5JS2A 1Y9EA 4OM7A 3TD9A 2EU8A 4AKSA 3W2EA 1PJ8A 1J8YF 2GLXA 2JAPA 3C3MA 4A8TA 1A7AA 2BMEA 1G20B 1GLGA 1X1QA 3CUTA 1MB3A 4JUFA 3X1XA 2E48A 3ZWAA 3AVTA 2CK3D 3ZGYA 4HDNB 4OYYA 1W5BA 5LYJF 3DW1X 3B1YA 1VCOA 4INJA 3NALA 4KYVA 3OTQA 2YH2A 3ILXA 3KKZA 3VHXA 4WASA 3WIVA 3PHHA 4MVJI 1SOAA 4UAUA 3NHMA 3WLQA 4ZJPA 4PAGA 3H99A 3C3BA 3UJAA 2EZTA 3BXZA 1MC8A 2QWXA 5IBRA 2WAOA 5LZ8A 1TM5E 3C3KA 3QIAA 4HNHA 1BJKA 3W04A 5CJPA 5DF1A 4OKNA 4WCFC 3B2NA 4X94A 1TPYA 3RAGA 3PEYA 1YDMA 2QV0A 4O0LA 2NYVA 4L3WA 1EIWA 1F8XA 5F1KA 1YZFA 4FWIB 4MRSA 1G5HA 4RHTA 5JSYA 4NWIA 3SZUA 5AI8A 1MDBA 2BONA 2FRDC 4XB2A 2ZYIA 2Y92A 3RROA 2PLAA 1CIVA 2Q4OA 2IYNA 3OOWA 4BX2A 2GN1A 3QE2A 2ZIAA 3HFGA 3PE4A 3WIEA 5JRJA 1BWPA 1QCDA 1TC2A 2VP5A 3DNPA 2C2ZA 1KOLA 3T7JA 3TRIA 1UP6A 5FLYA 1UT6A 2ZJ1A 1LDBA 4F2WA 1E5QA 5K4GA 1N7IA 1R50A 1UJ2A 2QM3A 3OF2A 5JS7A 2YV4A 3HJBA 5B4VA 1JDZA 1JQBA 2RGCA 4M22A 2FMXA 3I9NA 4MS1A 4FFWA 1Z4IA 3NBYC 2GWHA 4OB6A 4C3VA 2R86A 5B5SA 5FQOA 3RUCA 3I2IA 2ZRCA 2ONYA 4UCWA 3WLRA 4L0MA 1YUMA 3D1VA 1I5EA 2AOUB 1JI0A 4FWTA 4BAGA 5DNUA 3DVAB 2REQA 4BKOA 4QFMA 2GPJA 4CF5A 1B73A 3E9MA 5LDDC 2HA0A 1E96A 1GCUA 4V03A 1S2GA 2XQFA 1YONA 2Q3LA 4UU7A 2ZB4A 4F4IA 1L8XA 5K3CA 3SWWA 4ZHQA 2IBTA 3T52A 2J9FA 2NYAA 4R6WA 4ME6A 5EZ5A 4JNCA 2DQKA 1M1YE 3NC0C 2FLKA 5DO9A 3TUIC 3VAZA 1AQYA 3M9XA 1F0KA 1XKQA 2YZ7A 3SEFA 3AMVA 1SHTX 2PO7A 3R7WB 4L3OA 3IBCA 4XUDA 5ESWA 4PTLA 2H65A 4B4WA 1TLTA 4E94A 5ALWA 1ZUNB 4IO0A 2R8YA 2UZ0A 4IIJB 3TCXB 2WVAA 3VYSB 1FTGA 3I2FA 1VLVA 3NORA 4Q6WA 4BVEA 3WFIA 1CG6A 2QN3A 1LUAA 1N1DA 4OM8A 2Y2VA 3UK1A 1Q77A 1M75A 1QHHB 3EXAA 4JB0A 4RMJA 4R1NA 4WKCA 5CW2A 1R4ZA 3QNUA 5IF3A 1QG0A 1B15A 4WW0A 4H15A 3SR4A 2E4UA 4B85A 2BH2A 4M9XA 1ULHA 1VE3A 4OHWA 3LWDA 4OJNA 4EA9A 1XNGA 1CETA 2IYAA 4F4CA 1DC7A 1XKTA 2QA5A 3D64A 1A4IA 4BGEA 5A6SA 4NULA 5F51A 4KX3A 4PRKA 3NYQA 1M1XB 4IDFA 4P4SA 1JXOA 2ZTHA 1QSGA 3TGWA 3VHLB 3GN2A 3ZGXA 4Q7LA 3GEMA 2ZJ7A 3QQ5A 3ZIAA 4A6PA 4UKDA 1SHKA 1WW3A 4KXMA 4YRLA 4YDQA 2QJTA 3AUJB 2PD4A 3B1XA 5DE3A 1KC3A 2HIGA 3E1KA 2FR0A 4FLFA 2ZJ6A 1H69A 1ZSNA 2XQGA 2OCDA 1UZAA 5AOCA 4MYDA 4CV0A 4IZOA 5CGQB 4R8KA 5A1JA 1E32A 4G2TA 2WHYA 3OE4A 2B7BA 1OX4B 1CF4A 1I2CA 1MFPA 1OXUA 4DCNA 4YV7A 3LZ6A 1HDIA 5I48A 1RM5A 1EHYA 4IZ6A 1PV1A 1I4OA 1POXA 1ZM4A 5EPUA 1PV2A 3ER9A 4HDKA 4BAUA 1ZJ4A 4KQ2A 1RR6A 3KPWA 1RT9A 1K27A 1I6MA 3RTAA 5IKPA 5LC1A 4ARVA 3HR7A 1GNQA 1GAJA 2TMKA 2QYOA 3R0XA 4YJ2B 3H3FA 2EW8A 1QZXA 3QPUA 4P58A 4L5JA 4NYMR 3N58A 1JKMA 3PS9A 1PR6A 1ZA1A 2HQOA 3HY3A 3OZDA 4Q21A 2P27A 4CV3A 1PTJA 4O4JA 3GMIA 3LDUA 3JR7A 4L0QA 3ENQA 4O5AA 5J2TA 3WQHA 4MVYA 4KEAA 3NTOA 3PHBE 2R6DA 3PX3A 2YNMD 3P52A 3WGTA 1BA2A 1EUDA 2H17A 1EA7A 3IQGX 4JKOA 1UM9A 3NNSA 4U9HS 4Y30A 1Z37A 4Y1GA 2O4UX 4PSUA 1XCMA 4B74A 5K8LA 1L4FA 2HSZA 4UHEA 4OO3A 1P0IA 2W7TA 1V5WA 2AX3A 4TL8A 1FFDA 4ZAWA 4Q1EA 5AWFC 3SXJA 5CITA 1PK9A 4ZC8A 2BDUA 4KQGA 1KA9H 4P4GA 5FOXA 2LUOA 4L4XA 4IZHA 1BG6A 2YV1A 4C3ZA 4YV1A 1JGTA 3M5PA 3VDXA 5IPFA 2CVPA 3DL0A 2A86A 2NV0A 1KJNA 4CIBA 2N42A 5I7VA 2WWYA 1U9JA 3MOSA 4ZQHA 1YJ8A 4Z9YA 3WYBA 4R8SA 1P4SA 4O2BB 5LP6A 4EUSA 1Z74A 2XDQB 4HZIA 5EHGA 1JR6A 2NU6B 2PRZA 1WABA 2C57A 3JQ8A 5AK4A 4WBNB 3EEYA 1Z5ZA 1CUGA 2DWPA 2X4IA 3OM1A 2LPMA 1LY1A 5DTEA 1Z45A 1BJRE 1R0ZA 3HUDA 5FA6A 2H3HA 3K92A 3R5XA 3WLOA 3JWPA 3O94A 2GM5A 1JG2A 2OL4A 1KDYA 1QJCA 1RJWA 5DTRA 3ZW8A 4JYZA 1GGNA 3C3CA 3HYSA 3R4VA 4DSUA 3B5JA 4BFZA 5ALSA 2C5SA 5KVAA 1GZ7A 3VI4B 2G80A 2RHLA 3NT5A 2IYOA 2GAAA 1M2GA 2XUGA 4L1KA 2V6FA 2HDNB 2ZIXB 4GLLA 3HUUA 4KVZA 2C0PA 5HR5A 4L0DA 4MRAA 4Q15A 4K9LA 4J2TA 1NXXA 1W5TA 3D3QA 4A8PA 3OQ6A 4GSLA 4JSYA 3R7SA 4B79A 4PR3A 4Y1EA 3M4NA 3U40A 3GOHA 3HFSA 3ADOA 4FGWA 4UAVA 4PO9A 4UDXX 4DHWA 4N48A 1ZQ1A 2X3FA 2XYRA 2N46A 1MAWA 1JHXA 4HMPA 3LV8A 4KQ1A 1ZM9A 4TZ0A 3HACA 3KZOA 3LPAA 1NI4B 1RZRA 2QMEA 2ZE7A 3CTPA 4MV5A 4Q0MA 3K0KA 4JI0B 4L27A 1DKOA 4IIDA 3AJEA 1COZA 4WVLA 3UPDA 3ET4A 3O75A 3RRFA 3D5EA 3WWOA 3EPKA 1EWVA 1H8EA 1I30A 2ORWA 2XXBA 4M0MA 3WJAA 1SZPA 4CE6A 1NU6A 1KMHB 1ZM7A 1HNZB 2ZBDA 4BS9A 3RRYA 3ETJA 2JL1A 1SQSA 3RG8A 2JAUA 4FGZA 2ZR0A 1YZVA 1Z28A 2PS9A 4EW6A 1M7HA 2XX3A 3LG2A 1RADA 2P2ZA 1W29A 3F6SA 3P2JA 2M2IA 4LOJA 1Z5VA 1TJ3A 1CJCA 2IHNA 1N3LA 4A0SA 3C6MA 1U7WA 2BEKA 1E9VA 2WFMA 1TI7A 3F90A 4HNAA 2GR9A 3GY0A 3SFZA 3UA3A 4CTKA 1KK2A 4DDHA 4WOCA 4PFKA 4FGKA 1ISJA 1UWVA 2XNSA 3NASA 4UARA 1SPBS 4ND7A 3WGLA 4YAKA 2XMRA 1JQ5A 1YCHA 4A0FA 1FU4A 2LIPA 4RPCA 3ROXA 4OB7A 1CUDA 2PX0A 1ZONA 5DBGA 2JLUA 2WM8A 2BC9A 1CP2A 1U2PA 4C1NA 3KUDA 4TWRA 3PD1A 5B58T 4E2WA 1JFTA 2VPWA 4D56A 2QB5A 4H7IA 1F38A 4IRMA 3MCUA 1S2OA 3PGVA 2AHRA 1CY6A 3A2MA 3U44A 1XCPA 2KQUA 2M1XA 4OU4A 4QO7A 2DCUA 2BI7A 2X77A 3KELA 4LJ6A 5IWCA 1VBFA 1XVVA 1CUIA 1NN0A 3U13A 4UTVA 5F7XA 4EO4A 4X92A 3Q6MA 4RH3A 4PONA 1XLTC 4UFPA 4FMCB 5BN5B 1E8NA 1D2RA 4NYJQ 3ASUA 1G3MA 2FPMA 3AGPA 3GLRA 4WADA 6LDHA 3L7NA 3CVXA 5E3JA 1IPEA 1BU8A 4WUVA 3EVNA 1D0SA 4CU2A 4XTRA 5HTOA 2BBWA 3TLZA 1V2HE 3KD3A 1V3TA 4V1CA 2CZQA 3L7LA 4K46A 3EUAA 3O8BA 4BY9E 3UJCA 2ZCVA 3THXA 3ZH2A 4UC0A 3DOFA 1IK6A 4LS3A 4Y2RA 5FKJA 3Q3IA 3EA4A 3QVMA 1V1RB 4DAEA 3P94A 1XPUA 4LZOA 4JIGA 1E2FA 4ZZ3A 4OP3A 2NYUA 3EW7A 4XXHA 5JMTA 3V42A 2W00A 5BSVA 1HDGO 3U31A 3W2GA 4BRWA 3A37A 3SMQA 4AKHA 1R0LA 3L7DA 3R0IA 16PKA 1V8PA 4D92A 1SVWA 4KQIA 3PWSA 4C2BA 1NJSA 4Y1RA 2VDNB 5H7XA 3C6BA 2O8DB 1NMYA 1GZSA 1MOQA 3FPJA 1F3LA 3FZGA 3MF4A 4M4SA 4EH1A 4M1OA 2E6UX 3MMNA 2DSNA 1DBRA 2YN0A 4LKOA 2HHCA 1QZTA 4I1OA 4OH7A 4RHXA 4EUEA 2QP9X 3R23A 4ZU3A 5HP4A 1UQRA 4MKIA 1I80A 2P1DA 2ZRLA 2XMZA 3H1FA 2GTIA 4WINA 3OJOA 4IOLA 2CWWA 5HE8A 2ZWAA 5DNWA 4UW9A 4NHEA 1YB4A 2GXQA 1AD2A 1PF7E 5I7HA 4MGHA 3FOFC 3RR2A 1KI6B 2H1FA 2ZPTX 3LVQE 1M5RA 1NBOA 3SJUA 4R2MA 5L3QA 4A73A 1DBQA 1XAJA 3T5MA 5JHGB 3SM9A 5CVDA 1L7BA 1OQAA 2EKDA 4UPEA 3KCNA 1NJ2A 3FOWA 3RS8A 3C5VA 2GO7A 3JCZA 5AKJA 3T9CA 4NK4A 5C34B 3EPLA 2YV5A 4UE6A 4P0PB 3L2OB 1UFOA 1AK1A 2HHJA 2I78A 3A3YA 4KI7A 4BP8A 4F96A 1U81A 1R74A 1YE5A 3PNOA 1FRZA 4J3JA 5GTDA 4PPFA 1SVKA 3IAUA 3MWGA 1U0TA 4EHIA 4DG9A 1Z26A 4V0SA 1M8PA 2HL6A 3B1ZA 2QTNA 4ISBA 3GFFA 4FDMA 1P6QA 2XQJA 3U09A 3UMCA 1XL0A 4L4UA 3HPQA 5HXAA 3F6BX 4U6QA 2VAWA 1KZ1A 2OCLA 1HMPA 1NRIA 3HDVA 3UMJA 1U4OA 1CB0A 2AK2A 2XGMA 1G60A 4C4SA 3JD0A 3NMUF 1T9HA 3FWPA 3HCDA 1CY2A 1D7AA 3UJNA 4EELA 2PSSA 5C8ZA 4QD3A 4IQ0A 2ONJA 1BYUA 3BRQA 1JIXA 3UH0A 1FA9A 1C0PA 1S7GA 4KCGA 5B58C 1E59A 5JFOA 1W5AA 2Q21A 3EHEA 1Z5NA 5CBPB 1A82A 4X7BA 4ARBA 3IEVA 1XZLA 4C89A 2BGTA 3QXCA 3I4CA 4V3CA 5ADHA 3OPYB 1RMTA 4W6ZA 4MHTA 4EG8A 3P0HA 2WU3A 3EQ8A 5EJGA 3RB8A 5THXA 3PWTA 3BCSA 3N39C 3HXKA 3Q3EA 3QA9A 5G4KA 5JO9A 3I6QA 3VU0A 1F48A 4RKRA 3SC3A 4B17A 3DLAA 3LQQA 5JY6A 2GBLA 4HDMA 3T7DA 3BWMA 3D4OA 4OGWA 1Q1GA 4KUEA 3QG1A 3I64A 1GO2A 2VQEB 1KK1A 4OIMA 4WLUA 4M53A 1A8UA 3RFUA 4DSZA 3M5CA 4FDUA 2ODTX 3ZUGA 1O95D 1NC3A 3DBRA 3H8VA 1K98A 3FBGA 3QU9A 4MYHA 4W1SA 1BMFA 3F71A 4N12A 5T6BA 2WVJA 3UK2A 1XTQA 3FYCA 3HEAA 3CEHA 1ENYA 1I4WA 5ALUA 2YVUA 3WVNA 3QWHA 3BWBA 3DKVA 5DBHX 3SC4A 3DZIA 1ODIA 2AFVA 4HATA 1DIAA 5TVGA 4GEGA 2PUGA 3H6HA 1THMA 3HCBA 3GFQA 4FU0A 1SUAA 2CNWA 2XNJA 3G0IA 8AT1A 3DLBA 2NWQA 2V6GA 4GG1A 3MCWA 4IJUA 3IE2A 4BFUA 3ES9A 1QP7A 2FEOA 2PMDA 1MQAA 1VLMA 4M1EA 4OHBA 3TTYA 2PZMA 1FEZA 3P9RA 4D6YA 3M4ZA 4G97A 4J75A 4ARZB 4OXNA 4M7OA 2EVWX 4WXMA 2ZIEA 4YRSA 2CB0A 2FA9A 5K3AA 2VSNA 1VRWA 4BNGA 1Z6YA 5K1ZA 2EKLA 4YRKA 5I4KA 2GARA 4UHBA 1JKJB 1A27A 3E9QA 3HXQA 1S2MA 3DV9A 5KYGA 1MX9A 2B92A 2IXGA 3B85A 4PZAA 3P27A 2WA2A 4HWRA 4HVTA 2NUPA 4I9HA 3WNVA 2DWUA 4F72A 2H51A 1XVUA 2OZLA 1QRAA 3W9BA 3ANYB 3ZDYB 5B7PA 3PX2A 3V8BA 5F1PA 3VM6A 3ZE9A 4KMMA 3RTGA 3PKZA 1K6XA 1X7ZB 2QTRA 2M32A 2ZAYA 5AR1A 5BMVA 3TNJA 1CUYA 3DFMA 4YLEA 5DGDA 4R8LA 3K70D 3DBVO 3FSEA 3O8OA 2FN7A 4IGKA 1XBTA 4RXTA 2ZDGA 4TXJA 1E2LA 4IFTA 3PF8A 1DPFA 3D1JA 4C7OB 1BS9A 3OZUA 3RHFA 1BZYA 2WWWA 4IP0A 4W7HA 1ZCZA 2NVUA 3QHPA 3VR5D 3EAGA 3THYA 2YNMC 5FNZA 1ACJA 1L5WA 2SKEA 2FUNB 5HA5A 1G8MA 2Z08A 1VMAA 4KQWA 4M1WA 3DE1X 1ZOPA 4R2XA 1JIQA 1G3UA 3ML1A 5HPYB 2ZJBA 3UHJA 4M55A 4QOHA 3H13A 5FOQA 3D2LA 3CV3A 4U2EA 4RK7A 4LG1A 4ZOCA 1DC5A 2C2MA 5DW3A 4JBNA 2PWZA 2FN8A 1DG1G 2V6JA 4KV7A 4AZ0B 4B4KA 5A5FA 2AW3A 2Q0HA 2CD7A 2E37A 2NO9A 1A8HA 3RC2A 3PICA 1G5QA 2CCKA 3COSA 3PFFA 4NAUA 5DWDA 1M83A 2EKZA 3NV7A 4HTFB 4XARA 4ZJZA 2O14A 3R20A 4QGGA 2VXBA 2WUEA 2D06A 4HJXA 1U4SA 1FTWA 1UJ4A 4KQXA 3WL6A 3UTDA 4BZPA 2P1RA 2X2OA 2Z1MA 3GLHB 2IRWA 4RV9A 5BSGA 2HJHA 4FB4A 5JS8A 1BDIA 2MWMA 3L9XA 4I8XA 3ZDFA 3D0QA 1NXSA 2VBFA 2WEKA 3AEQB 4GX1A 5EWMA 3RS0A 5ED4A 2VI5A 1YHNA 3VVBA 1UAGA 4DLSA 3NIGB 5AUOB 1I14A 1Y5NA 4GM0A 2PWPA 1MB2A 3FI0A 4KHPB 1XT6A 1II8B 3OFND 4KLNA 3SAJA 4CV2A 2OHJA 2G9NA 3FOEC 1KVTA 3R9XA 1OZFA 3ABQB 5KPJA 2ZYSA 1E4VA 2B2XA 3Q8XB 3MW8A 4MV8A 5EL0A 4AQYB 3HDHA 3JTMA 3ZK7A 4ZQGA 4AMYA 2IZ5A 4CPDA 3OSZA 4KJZA 4GOLD 3A2NA 3VJRA 3RBVA 1ZD3A 3BTOA 5JI2E 4G36A 1KE2A 2OUKA 1GOTA 5EFOA 1FB5A 3R5TA 5CK5A 2DQ4A 3OESA 2C99A 5KKNB 3OQOA 1JVBA 3F98A 1E0KA 2WJHA 5ESRA 2AF3C 1PS0A 2ZUVA 3N59A 2QSZA 3EOZA 1G6OA 1IBLB 1YRAA 4MUNA 1IULA 2ZM5A 4FUQA 1NY6A 5IBQA 1JVSA 1RWOA 2GTPA 2L69A 2I2CA 2BMJA 3GJTA 3HYTA 3SFVA 5JR3A 1I7QB 3LDHA 1QP0A 4IJ6A 1FLVA 2BJHA 3GEGA 4YX9A 5IT5A 5HWSA 2IW1A 2ES4A 1AC5A 1H2EA 1VM6A 2WP8J 5ALNA 1P39A 1AQLA 3IAS1 3GCDA 3PUKA 4P22A 3QELB 1GFZA 2PZKA 3OBIA 3PNPA 1IZ0A 3MBOA 2IEYA 2VS1A 4A5SA 3JATB 1K8RA 4K6HA 3OLQA 1O3YA 2UZAA 4ZQBA 1E79A 2BCEA 4CFYA 4EI8A 2QNIA 3LF2A 4F6RB 4HLNA 3M6IA 4W8OA 1T0PA 3O4VA 3ABSB 2DUWA 4UOQA 3LQ4A 3WYGA 3HCRA 5HKAA 1S8AA 4HAOA 2NZUG 3W5HA 5FQNA 1K97A 1WXFA 2P11A 1UK6A 4HEA1 1DKRA 1DAPA 2DUJA 2I9PA 5LLSA 4AS1A 4IIFA 4GSYA 3K09A 4G07A 2IF0A 4B6PA 2G0TA 5TQ2A 4WV3A 5IAOA 2FY8A 3PEUA 1BJTA 1MF7A 5K6RA 5AHWA 5I7OA 4D4GA 2Q1WA 3H9JA 2R97A 3N05A 4PWYA 4BAZA 1XDUA 1QRSA 2AJLI 1C9KA 5C5CA 1V11B 1UKCA 1BXZA 3IXQA 1J9ZA 4K81B 4UTXA 5JZ9A 4QC2A 3FMGA 4HRXA 5IM5A 1SURA 4DY6A 4NJMB 3ROMA 2VHQA 1SKMA 2V6MA 5IDQA 4QHTA 6Q21A 2R47A 1SU4A 1MR3F 3ED1A 2DG2A 5JWRA 3QE3A 1RFLA 3O4RA 2ADFA 1XZAA 5AHRA 4GP7A 4MJ3A 2PZFA 3EB9A 4MZXA 1E66A 2Z9CA 4HAIA 2NO4A 4N65A 5CH8A 3W5JA 1P1IA 2AJDA 3D3EA 1ZUIA 1O96A 1SM4A 5LMNB 5KYXB 5CMLA 4N1AA 1AKRA 3K5HA 2ZTUA 3QEBZ 1NULA 2ISQA 1YNOA 4CMEA 2VHCA 4PAMA 4C2TA 5GY7A 1ISIA 3KKMA 1SWWA 4IMIB 4P5EA 3TIXB 1NXQA 1I3KA 3COWA 1KYVA 1MH9A 3V9PA 3IPLA 3FFAA 1G8JA 3G1TA 1FJGB 1OXKB 3M6AA 2IYLD 1P7CA 4PGAA 3OCZA 2CXRA 4YYZA 2NADA 1QGED 4YP0A 1QOPB 5IFKA 1KJ8A 1Z0SA 4KAJA 5DM1A 1P1BA 3C8ZA 4G5QA 5KQRA 3HCOA 3K8ZA 4PZDA 5BWNA 5JATA 4H7JA 4Q39A 4B75A 3N7TA 3OFKA 3M49A 4BQNA 2P91A 4REQA 1A5BB 1DWOA 4H27A 4PIPA 5FA5A 4QBGB 1IONA 2EW1A 3JVIA 2HMWA 1L4MA 4OU5A 2Z1NA 2LDXA 4EJSC 1Y42X 1KO1A 1FFAA 4R7GA 3IUNA 1G1AA 3F47A 2VPIA 1U3CA 3N2GB 5LQDA 1JR4A 3NIWA 1V26A 4N5MA 4X44A 1OAKA 4EI2A 2GM4A 1SD2A 5E6RB 5KQPA 3A4LA 2RIRA 1RQPA 1ZN7A 4OQYA 1R6TA 3DBHB 3IHKA 4QREA 3RASA 4YQFA 3CRQA 2ZTVA 3ZH9B 4BNHA 4F2DA 2I33A 2UYQA 5BNWA 3UG7A 1VHTA 3ND8A 4OHZA 1LDNA 4PW0A 1E0JA 1W1IA 2C7BA 3QVGA 1UPXA 3DJYA 4JVLA 1Q95A 4ZEVA 3V7WA 1Y37A 4I9NA 2VNJA 1N4DA 3TE6A 1E0SA 3H6GA 4LZAA 4M21A 3VO2A 3IP6A 3FLMA 2H7VA 4KSYA 1T8PA 4BNXA 4U1RA 4YT8A 2CB9A 3OTWA 2CJXA 1HI9A 5LR6A 2PUDA 3IKJA 3L3BA 1AQ6A 3A0UA 2B3DA 3O38A 5IXJA 1KZHA 2L42A 3GLFB 1WDKA 4K9NA 2W8BB 4ILEA 2FP3A 5JQGA 1XZCA 2N9UA 2B1GA 3OE7A 4FFDA 1QPZA 5GJBA 2J8ZA 1W46A 5A4FS 1NX9A 2I7DA 2RKBA 2WJGA 3K0CC 1GILA 4RELA 2GDZA 1R00A 4G5HA 4KQCA 5FLEX 4HS4A 3MWDB 1O6CA 1DLJA 3EN0A 5J4HA 3R5KA 1I24A 3OQPA 1XGKA 1QTRA 3BXHA 3EA0A 4D3FA 2RI6A 3R6WA 5LZ5A 3ZY3A 3D5QA 3KTAB 5CVTA 2GUWA 4TZ6A 4YCDA 2ZAIA 2NOAA 4P7KA 4XEUA 1W0KA 3AUUA 4ASUA 2WYHA 2NTVA 4HS9A 2D4AA 2HV9A 1FLDA 3PDCA 5IC5A 5CFLA 1QG4A 3K1AA 3JVEA 5LXTB 3NWJA 3K73O 2B34A 2XNHA 4PV7A 3GD5A 2J6CA 1CUUA 4BO3A 1LI7A 1BCRA 1X38A 2SCUB 3M1LA 3ULKA 1SXJC 1E4EB 2QOEA 5KOJB 2VA9A 4RY2A 2XIJA 2H1CA 4YRJA 1IN8A 3PVZA 4XIJA 4DR7B 1NPDA 1XHEA 3OZFA 4UDOA 3UT5B 1W93A 3WO1A 2BZ1A 2XWJI 3KLPX 4WX2B 1VSTA 4E1AA 3LNCA 2YVKA 3WB2A 2VWPA 1R9JA 4DV5B 2NX2A 3W34A 1CC1S 1YMUA 2WYUA 4BCBA 3QUBA 3N8GA 5HIMA 1ZISA 2ZIWB 3BHNA 3CBGA 4HPWA 4QXPA 3JWJA 4U2GA 4ZALA 3VVMA 5D3MB 2ORED 3NXSA 4DY4A 3AF3A 1RQNA 3JQBA 4ZYLA 1P29A 2XUDA 4D57A 2F1IA 2Q62A 4MQBA 2HA6A 2W6OA 4FIDA 4MUIA 4A2QA 1QIIA 3IR5A 3TR5A 3G3EA 4FMBB 2Y1KA 5C8XA 1RWVA 1Q7TA 2YOFA 3S2EA 2FX3A 3DEJA 3I5MA 1TQDA 1QHHA 1NW9B 4L7QA 3KR9A 4QOSA 4EG7A 5BVGA 1Q19A 3M34A 1L4UA 2IA5A 5E7JA 3QMPA 2I6TA 2RHBA 4P8RA 3NTVA 1DU4A 2JI8A 3I32A 4YT4A 2Q0XA 2OCGA 1XJ0A 2XCUA 2YICA 2L17A 4L72A 1FMLA 4TYYA 1O95C 2GHQA 2QPAA 1JPJA 4P7FA 2QAGC 3TBKA 4DV1B 4CM9A 3G8DA 1OI3A 4PC7A 1AH2A 4B6QA 2PGIA 3LX6A 1C9DB 4EGFA 5F2NA 5JXWA 4IW3B 1KY4A 3QF4B 1AUQA 1XV5A 1Y8AA 2HCTA 2HMAA 2UVDA 4KRGA 1T0IA 4EECA 2I1VB 3GA0A 1KDOA 4M1YA 1VSUA 2IITA 5KOYA 1OI2A 1Z4KA 3H75A 3IO5A 4ZODA 5BYBA 5L7WA 4RORA 3LO8A 3O2SB 1GA1A 2XYHA 3NM5A 2QQEA 5BXYA 2YWBA 1T5LA 2Z9DA 2V7EA 3GZTB 4UAGA 1ZSYA 5LVAA 1RPAA 1GKLA 2QTWB 1NNSA 1N2HA 3RKSA 1A04A 2IOQA 2UVPB 2Y1CA 4RGVA 3BRSA 3NVDA 1Z0KA 3T5PA 3VQTA 2YYZA 1JYFA 4BO2A 3CVUA 4M9UA 1EIZA 1FFXB 2DFNA 2HMTA 2Q2NA 3C5HA 4C87A 4RH1A 4YJHA 1ZDMA 5JVDB 4II3A 3ERCA 1VMIA 5FXMA 3NV9A 1V8ZA 2C7VA 2OY0A 3EQ2A 1GNTA 3I04M 4B45A 4NCKA 4BUJA 4RQAA 2XUFA 4AKIA 5LQUA 1R8XA 1T43A 3CVWA 1GNPA 3TOSA 1SA0A 4JBLA 3E4CA 3COVA 1GVNB 1GY8A 1NQOA 1QH8A 2J59A 3F6EX 3MTAA 3OAAD 1IHDA 2C1EA 1KH3A 2X13A 3A6JA 2YJNA 4FT2A 1RLMA 2HRDA 3EGIA 4PS0A 4XM1A 4BNTA 3TXAA 3QVSA 5TPWA 3K70C 7REQA 4F04A 4C7JA 3WA7A 4EMUA 1KEPA 1JEYB 1MUUA 2D0PB 1DCTA 1EZZA 3WWZA 4Z1MD 2XGSA 2HDOA 1YB5A 3B1FA 2MMCA 3FOZA 4D9EA 1N7JA 3ZCUA 1WUIS 2J67A 2NACA 2GBGA 1LW7A 3ICVA 4JJ8A 1FC0A 3SK0A 3SX2A 4Z6KA 2RMKA 1SCJA 5AM2A 2RAPA 1I1OA 1R6DA 2DYKA 4H1TA 2ACEA 4PBTA 3L1UA 2CV0A 4F9TA 2X6RA 5FIUA 1PIWA 5DT9A 5A71A 1R4MA 3PUVA 4MV0A 4KREA 1NNI1 1YMQA 1SQ0A 2CNLA 2V65A 1BCSB 3MGKA 4HPJB 2A4KA 4CDRA 3LTNC 2YJGA 3GLIA 2UYHA 3ASVA 2ECOA 3NXKA 1C1HA 2PIDA 4YRBA 3PPXA 3P0IA 2QX9A 4UVDA 2UUOA 3NT4A 5IUKC 3HZOA 2FG6C 3G5MA 1VGQA 3RUAA 1Y1QA 3DOOA 1MOPA 3LGAA 3OOYA 1DBWA 1V9SA 5AHOA 1EFLA 5FL7D 1OVMA 4D97A 1ZCJA 4JI5B 1DXHA 2C2OA 3FLBA 4G0ZA 1WUJS 1SUIA 5J5AA 4DR3B 4BQRA 2VPQA 3B13B 1JHYA 3GCZA 3NI2A 5DHPA 3G82C 2OP1A 1KI9A 2H5EA 4PANA 3ZLBA 4W9MC 1YBMA 1E6UA 1YBHA 3AH8A 4GZ5A 4OQEA 4AS2A 3G1WA 1LCIA 1W8DA 2YOGA 4YMHA 3P5BA 4I4TF 2G07A 1DBVO 4KFRA 2XOKD 3FWZA 2YZNA 4AP5A 5IXSA 2QROA 3DLPX 2PX3A 2LR0A 3D6JA 4JJIA 4PYRA 1E4OA 1RCFA 2C29D 3JZFA 1CHNA 4FEAA 4NCIA 5DHRA 1DTSA 5E6UA 3SBXA 5CFRA 5B3JA 1ILWA 5IDXA 4RNDB 1NQAO 3BXOA 3AZPA 5KMGA 4CUJA 3A2LA 4EAAA 2OOSA 2R7MA 1A5ZA 1XOIA 1Z63A 1IMJA 4R9VA 4B6OA 4TTAA 3V4PB 3WDKA 5C5EA 4KH0A 1NGSA 2RHGB 1GCOA 1OBCA 3O9MA 4PIMA 3P4XA 2GYVA 2Q2OA 4HAWA 4YAOA 5LD2C 2R1ZA 1Q0HA 1NI4A 2G72A 4IM7A 4M7RA 1XZDA 4JL5A 2EFJA 4ENRA 1OE0A 4OP2A 1JIJA 1T35A 3HS3A 4BKRA 3K2QA 4G8DA 4R7TA 4ZPJA 3H1TA 4HUJA 1GTL1 4KWTA 2EP8A 3DFKA 4RYLA 4DRYA 1IEWA 1QYRA 1XU7A 4YT5A 2H52A 4BLSA 3UPTA 1JEEA 1OF1A 4KQMA 1Z6QA 4E88A 1R27A 2ZJ4A 1W35A 2BFBA 2HT6A 4GP9A 4F4JA 3CLKA 3HPRA 5LJLA 1RP7A 1JMKC 3KS9A 4RZUA 4DNOA 1UBLS 4FC7A 3ZWWA 2QZPA 3N2LA 4L95C 2B2NA 3F78A 3U48A 1G8HA 2ODQA 2WYIA 2WR8A 2EHJA 2GWRA 3DWEX 2YOHA 3L06A 1ZI9A 5A9SB 4GL4A 4BBZA 4W5TA 2WWVD 1J21A 3QUCA 4M9RA 3O8RA 1H5NA 2QLBA 3NTQA 3FSGD 1GKKA 4NABA 2ZRHA 2NIPA 1SOUA 1P6UA 1ZZEA 1UADA 1WQ3A 2ZUBA 1HEYA 4I2NA 3UWMA 1PR0A 4CW7A 5AVXA 2CN1A 2GOYA 2VH2A 3VAAA 3DYBA 4B3HA 2RG1A 4CZ2A 1W36D 4LY3A 4NPHA 1QFZA 2XZTA 4NCNA 3UG6A 4DDTA 2J07A 5F5XA 2DPYA 3Q5GA 1XUOA 1UJ6A 3Q6IA 3PSHA 1Z4QA 3AUFA 3BIOA 4ESOA 2FW9A 3I9FA 3PQ5A 1P9WA 1WDWB 2KI5A 3AHFA 6GPBA 1XNJA 1FYEA 1R3UA 5JYCA 1TEVA 3CPHA 4XD7A 3WP0A 2C61A 1LLFA 5AJVB 2IHZA 3MS4A 3GGDA 2P9GA 3KSDO 3K0HA 2B8WA 3EY4A 4X71A 4X24A 2XWSA 1V47A 3WLMA 3LP6A 4OJTA 5F2EA 3AUKA 2Q4TA 4FM9A 1CTQA 2F3SA 4REOA 4S1NA 4TMWA 4MDEA 2IP1A 3AI7A 1GPDG 2XYGA 3ZU5A 3HA3A 3IXMA 3NHLA 3I6ZA 5IZCA 3HVRA 3K6SA 4ZYYA 1B6TA 4M99A 1LNSA 5JYDA 2V9PA 1NM5C 1VYUA 3AU9A 2X0RA 2ZSJA 5E4YA 3U56A 2XMPA 1GJRA 4RXMA 5CTAA 2RHWA 2AK3A 3K8QA 4ZK2A 5HMLA 1LZLA 4TV8F 5ISMA 1TEHA 2Q3HA 3X1JA 2IL1A 3WLNA 3RC7A 4ENPA 4I4TB 1CX9B 1KIAA 4IHAA 1Q2UA 1E2GA 1N8TA 2IYQA 2OBYA 4FVTA 3DWGA 1STOA 4W9NC 3ZDCA 3UBMA 3QZUA 1EWTA 3ZQUA 5LM3A 4KVAA 4DB2A 2Q2WA 2Y3IA 4P4UA 2VEDA 3TLCA 3IH5A 4DIKA 4HNVA 3O8QA 4CKWA 3DWFA 1QZUA 4E46A 4MUXA 1L7NA 3SX0A 4RTJA 4Z9BA 4AWAA 4CQLA 2VT3A 1Q1QA 5BSUA 2ZM6B 2C07A 2G4LA 3HNPA 1Z4MA 2Y1EA 5CLLA 3GG9A 3HABA 3OZGA 4UTZA 1DOAA 1SKUA 1XD2B 4MJXA 5CFPA 4GQBA 1I1NA 4W8HA 2QMOA 1L9XA 2F43B 4X1YB 4LBVA 4BJ5A 2ALJA 3C1AA 1Z5UA 5U1PA 5JCZA 1S1CA 1OR8A 2JGEA 4IWNA 5JDCC 3Q40A 4CKCA 1NSFA 1OWPA 1PHRA 4N5IX 1DG3A 4BN4A 1JHQA 1OU0A 1F0NA 2O2GA 3GZNB 4N5DA 3NTUA 1LWOA 1XEXB 3RJ9A 4DLWA 2ZUFA 3CNBA 3QRWA 3LQFA 4QTZA 3I05A 2ENUA 2JFGA 5FWXA 4BV3A 2BGJA 3QE4A 3T34A 4N3CA 4EHFA 3ICPA 4M1MA 3L7OA 3CF4A 5U9CA 1YJCA 2W6ZA 2DR3A 13PKA 1Q20A 3I2JA 2H11A 1XX6A 2AHOA 3KBOA 3BGDA 2V0GA 2FMKA 1Q3TA 1XTTA 1G7SA 5ABPA 1HORA 3Q7EA 1VIAA 2XE6A 3SU8A 3MTJA 1XKXA 5FPYA 1Q0RA 2C7PA 1DKQA 5A02A 2QVLA 4WAUA 4HTAA 5GV8A 1OLOA 4CLOA 1U0HC 4NICA 5EWLA 4B31A 1XRPA 2ZIFA 2VP2A 4G26A 1XQVA 4PC6A 1ZNQO 2ZW9A 4RFVA 3BPSA 1MXFA 4L9SA 2FPLA 1NP6A 1Z3CA 4LDPA 3T7KA 3GVXA 4URXR 3Q41A 1DOZA 4RD3A 5DI3A 3CEJA 1UXKA 3H5VA 4U8GA 3VVCA 2GVZC 5L4LA 4XDYA 4GL2A 1KHTA 5HBRA 3ZU2A 3NFRA 3D7MA 2WF8A 1CR6A 5BORA 2V59A 2O3JA 1T6XA 1RAFA 1IUPA 5IANA 4L6CA 1L6IA 1FBTA 1RAEA 4J0IA 3TSAA 5IVHA 2I91A 3WICA 5G1PA 3BMNB 4IIEA 1DFHA 5FOWA 3A9WA 1ESCA 1XWFA 4BLPA 1RQ2A 2PWBA 1N36B 1UZLA 5JO0A 2B20A 5J58A 5FYQA 4RD0A 3BZBA 2O4CA 2P3OA 3M81A 3O7WA 4LOKA 4ZVQA 2XCRB 4FE4A 1M74A 1EK2A 4ZEOA 2IYVA 3IDOA 4AUMA 3WLKX 3FSRA 3I9JA 2VJKA 4G63A 4JX8A 4NYIR 4C0JA 1NR1A 5E4JA 1BHSA 3R74A 3T5BA 3AOEA 4V0NA 5AOBA 3VDRA 3L01A 1HM5A 4JXJA 3ZHBA 1EB9A 2ASVA 3CLTD 3MXOA 4EKYA 3EXG2 2B21A 3C16C 4F4FA 1HEUA 3MWEA 1TVCA 1ORDA 1ZJ5A 3BJIC 1UPFA 4HCJA 4IJMA 3NCHA 1EQAA 1V5FA 2FK8A 3N2IA 5LIRA 3F7NA 5IP5A 1KVRA 5L7TA 4ZI7F 4KXVA 3AR5A 1N0WA 2IDKA 2Q3BA 3JU3A 2C9DA 3TVYA 2CNKA 1T0JB 2E5FA 1MVLA 2K5UA 3I8SA 4FXPA 4NAVA 2ZBFA 2RBEA 2ZYGA 3PUXA 3EVTA 2C5AA 3EXHA 3R09A 3C5WP 3CRMA 4PZ9A 1YULA 3U17A 4PVDA 1C3OB 3VHQA 4A8JA 4BB0A 3WAGA 3EGXA 2M1ZA 3V8NA 2CFSA 1SVSA 3C43A 5DLYA 5LNK6 3AFIA 3VBEA 4MICA 3K0AA 5TMDA 3MSCA 2JFNA 1H4VB 4OD0A 4B6GA 5EJ4A 2JGLA 2AMJA 4B7AA 4EO9A 3WYDA 4H6VA 4F2GA 5DK6A 2CXNA 1KPHA 4QAQA 1GCAA 3VKUA 4HQOA 5EP2A 1FW6A 4WCVA 5CA0B 3I1IA 3I12A 1GDHA 4CLRB 4ZVUA 3I04A 2WVGA 3WLHA 4AZTA 2OCXA 1F8GA 1YA4A 1VHLA 2VH1A 4ABYA 2Q5CA 4TL9A 4O59O 4UM7A 3U7QA 4E2XA 4YRNA 1DEXA 3LP5A 4FE7A 3B1VA 2ZVPX 3IT3A 4TSKA 1RWWA 2ZJYA 1D1QA 3GEEA 4LSWA 5LDHA 4RK6A 5HK8A 3WR5A 4EY3A 4XFJA 5AM5A 1TGVA 2G17A 2ZJ2A 4WTOA 4CN9A 5H3CA 4KAXA 3I1YA 5ED0A 3VISA 4MCJA 4YPVA 5KDOA 2O48X 2I2XB 3ACDA 2FAXA 1O5TA 1Y7IA 2CJWB 3IRVA 3HXLA 2FSUA 1TKBA 5HMMA 4AJNA 3OIUA 1AQNA 1QH1B 3RDPA 1T1JA 1G42A 4QG3A 3LXMA 3R7BA 1VMEA 3L8GA 1P0CA 2GN6A 2PT7A 2TMDA 3WKDA 5HJ7A 4POOA 1ORIA 2ID8A 3W8RA 2F48A 2ZYRA 3NM6B 2H0QA 2VCYA 3AX6A 3DTVD 1U8UA 3BDAA 3OZTA 4I2VA 4MROA 2GJ4A 5LL6P 4QO8A 3NW9A 4YRTA 1LPNA 3QM1A 4M36A 3A1EA 4BQOA 4LF8B 1EFAA 3U7IA 2XQKA 5F23A 2EZ4A 2P2CA 5KX5A 2OFOA 2O7SA 4Z7QB 3DONA 3EK2A 5AFSA 5FYDA 1BD4A 1WQ1R 3GJ8A 2VYNA 5AMXA 3ABZA 7AT1A 2DFTA 4GBJA 2D2FA 2H63A 3L6BA 3OUZA 4HEJA 4FFSA 2JEYA 4FYJA 4XEHA 5DNDA 5EMLA 1DAHA 1S8FA 2D59A 4CL3A 3LT5A 2WAMA 1U5BB 2XCQA 4RD1A 1OXBB 1QTQA 2PKEA 5EZYA 1OX5A 3OY7A 4UNQA 3NQ41 1EFRA 5TEWA 4TMKA 1ZN2A 3U19A 1DXYA 1DJMA 5BW6B 4PHGA 1UIRA 2ZAOA 3I1FA 3C48A 4DLKA 1W34A 3GFSA 4PS1A 4WIAA 3EUWA 4RD2A 4HZUB 1F6WA 2EATA 4OMFG 3BD7A 3OZRA 2AXPA 3MLAA 2OV4A 1S9HA 3WE7A 1SCIA 5AW3A 5AJXA 3PFGA 2X2FA 4X6YA 2WJIA 5KDLA 1NVVQ 4C07A 4QUGA 2XTZA 3EUEA 4R9SA 4E1VA 2FDXA 2MDTA 2R1UA 3DVSX 4XVQA 3TQOA 3VSCA 1F0PA 2YWEA 4AKTA 5LPNA 3DZFA 4TYNA 3KFLA 4WESB 3NS7A 4TS3A 4ZI7B 3UB4A 2X6TA 2QD4A 2OFFA 3B6MA 5BPHA 1D7OA 4GHWA 4ZANA 3EXFB 4X62B 2AG5A 2OCYC 1FDTA 2KLHA 1FU8A 2ZAGA 3CZCA 4KFCA 4JQYA 1W4LA 3Q1KA 3JYLA 4IFEA 4R84A 1G5PA 2YY5A 2ZVJA 5ILGA 3VMFA 4DZRA 1Y4SA 3IUYA 2AC7A 2CZGA 1HR0B 4C4PA 2VDLB 3HJTA 1LH0A 5FRDA 2FR8A 1KEEB 5FI5A 2VF8A 4DIOA 2UXBB 3KLNA 2JGNA 4RDCA 4EHNA 4G1EB 4CQMB 2QY6A 4AY6A 3QX9A 1SU6A 2HC9A 4PM4A 5EINA 5KVQA 2H5LA 4BWGA 3VR4A 4K0KB 3TIFA 3BIJA 1NFQA 3LC2O 1V4VA 3PGMA 5C31A 3OZEA 3MJTA 5EESA 4YCMA 4UQOA 3RJMA 1EUQA 2ZWOA 1EESA 5AKYA 5FPKA 3B8HA 2O3SA 1ARZA 2O06A 1JIUA 3HU5A 4JUDX 1U1EA 4X7MA 4Y2GA 5K45A 2QZ9A 2JLXA 5A2GA 4QPDA 1E3JA 2VAVA 1DQZA 4HVCA 1DG9A 3IIKA 1DC4A 1ZIOA 2GHRA 3I37X 4Q4JA 2OAEA 1O97D 3L7IA 2OXTA 4MVJF 2XWPA 4MV9A 2FW1A 2HWYA 5JPIA 2FSHA 3I8XA 3KYDB 3NBUA 4V38A 3R9IA 4KSBA 2DFVA 4MVJP 1O4WA 1CF9A 1QR2A 3JY6A 1X8KA 2MHCA 2BFWA 4MI9A 4GGOA 1PGNA 3DMYA 4EO7A 3ESQA 4I1YA 1KQPA 5H83A 1M73E 5JS6A 2CLDX 2NXCA 1OZGA 4M6WB 4AURA 3ETDA 1H5UA 1Y5LA 3MTIA 3UH1A 1K2WA 2CFCA 1X8JA 4KPGA 4RFSB 3SKXA 3CT6A 4W99A 4J7UA 4LBWA 1BOOA 4AQDA 1VFPA 5J9FA 2KMLA 4HQ6A 3L7JA 1ZICA 3HCFA 4P86A 4TYPA 3W8DA 2IHKA 4QUBA 1W36C 2G1KA 3BXGA 3ELUA 4F9FA 2C2HA 4BDTA 2O1EA 3LH5A 1YMVA 3OQBA 3WK8A 4QA9A 4XQGA 2X1LA 3PE3A 4D74A 5FUYA 5J43A 1XG5A 4K88A 3RYIA 2FP4B 1VL2A 2OEPA 1GXSA 1SC6A 2YHUA 3SPXA 1UBHS 4UQPA 3T1OA 3OD1A 4Y2YA 1QHSA 2BE7A 2JK0A 3LU1A 3P0EA 3RIYA 3PIRA 4Z53A 2JJ8A 2RHMA 3NFYA 4UZFA 4E31A 5ICSA 3I73A 3PVCA 4D43A 1LEHA 221PA 4O4LF 2XB9A 1CEQA 3KB6A 3MWYW 1AA9A 2OSVA 2QPLA 3ANXA 3E8XA 3OJEA 4WXEA 5H16A 4CNQA 1SOVA 1UBMS 5EIFA 2VHZA 2XLCA 3CW9A 4HLDA 4YP7A 3CNNA 4S0ZA 3VZDA 4MDYA 2ZUEA 4JLOA 3ER6A 4YROA 1PGPA 2VK8A 2YW9A 3BE6A 3I76A 3C7AA 2BR5A 2R8ZA 2AD5A 3FETA 1PS9A 3D4IA 4KBYA 1YOVB 5D00A 1J97A 1WMEA 3PPIA 1ULUA 1JYSA 4JIMA 3PJEA 5ALVA 2JIPA 3GELA 3TLGA 4DA4A 2O5CA 2M6SA 2OD2A 2PWYA 4P34A 3M4XA 4LZLA 1E8MA 2O8FB 1U7PA 4ZAYA 2ZK7A 4O2AB 5AO9A 5AIAA 1XALA 3EZ7A 3K32A 4GLFA 2C5BA 1Z82A 5FJJA 5CLQA 5IJ0A 1T1GA 4FJ1A 1RPZA 2PJRA 4PY2A 1GADO 4R98A 4PYNA 2PUHA 5DIFA 2PU5A 3O47A 2PO5A 3WBBA 2ZU0C 2IT1A 4PXSA 4WLOA 4Q7JB 3KV3O 5G0UA 1RWMA 2X8JA 4X1KB 4V1CI 2OB2A 2YWGA 2R66A 3RV4A 5JU6A 1OFTA 3FYUC 4HWOA 2JZNA 2O8CB 4QICA 4ENTA 1CY4A 2ZI6A 4YXWD 3K5WA 5B1SA 4A16A 4LC1A 3HV2A 4DHEA 3ECAA 4KK3A 3JQPA 1CT9A 3T7RA 3ZHVA 3QV1A 4LHYA 4Z3DA 2NU7B 5JZSA 3KDPA 4QQ8A 1HDOA 4HQRA 4ZPXA 1C3EA 2WLTA 2ZJ3A 1C1XA 2BKVA 3UMFA 3WZLA 3WGVA 4RVSA 3DTNA 1P5HA 3IP1A 3SJCA 1YK0A 3RRBA 1YOBA 6AT1A 1EQ2A 2PUJA 2DGDA 3DD5A 4D8YA 2Z5LA 2VWGA 3CGWA 3E6AA 1YDEA 5DNEA 5GONF 1AB5A 4LQ4A 2OOKA 2GA8A 3MJVA 1Y33E 4YJKA 3QW2A 1SR8A 4LDQA 4W5WA 3EDOA 4F7WA 2O52A 1E2KA 1MRZA 2ZR9A 3V48A 2PNFA 2M9MA 2A0KA 1CY8A 2YFYA 3OU2A 4IUYA 1MRSA 4ZK6A 5LP1A 2YX1A 1V48A 4LF4B 3VKVA 3B6ZA 3GDFA 1VGRA 2QBYA 1AUVA 3PZRA 4TVKA 4MP8A 2BKXA 3TZEA 2QN7A 1IHPA 3HWRA 2C9OA 2DQZA 1PK8A 3K0FA 4KQKA 3JS5A 4XX1A 1E98A 3SG0A 4PAQA 5ES4B 2ODNA 5M29A 4BLWA 2YRWA 3KTAA 2QN6A 3IAEA 4DW8A 1GYQA 5CFMA 5ADVA 1T8WA 3ZJUA 4TTSA 2UUBB 3UXHA 1VJGA 2AG1A 5CXSA 3KYJB 1K9VF 3RT1A 5IFLA 1VLQA 3ABIA 2N1BA 1EB8A 2OPBA 2XDAA 3AIIA 3GF4A 3S2FA 3KVOA 1IE3A 3ETNA 1KVUA 2R6R1 5EKSA 2WT8A 1X7YA 2GK6A 3ESYA 1PCXA 1L5MA 4TZKA 1ZOOA 3NHSA 4H0CA 1BIFA 3LW8A 4NBUA 4BGVA 1JIIA 1QPBA 3KAQA 3QF7A 4GSKA 1SG6A 4O4LB 3TAHA 1CVLA 3QITA 3UMBA 1NF8A 5CLIA 1XPRA 2YJ4A 1CYEA 5FP0A 2OC9A 3PJGA 3BRCA 3WGKA 3UGKA 3H5RA 1W6RA 3EASA 3TIGA 4B6RA 1C14A 4Z4CA 3D31A 2WAYA 2OO5A 2ZBVA 1ISRA 3FTNA 4RVHA 3LBYA 3AP1A 3FDZA 4I99A 1HOXA 3CH4B 3CLTC 4C76A 4ZZIA 5MGNA 2TRSB 3BGWA 4WXRA 3SZRA 3IBTA 4H6WA 1WSWA 5C32A 4JWTA 4J1TC 4K03A 4QOGA 1VG1A 1YR9A 3OA2A 3SHOA 3T7CA 5JARA 1NBMD 2FUG6 4MQLA 2W6ID 4D6XA 3QUQA 3GLIE 1RXVA 1R1DA 3CINA 2JH8A 4IG4A 3CEMA 4EW1A 1MA3A 1Q0SA 3HBNA 2I6SA 1FS4A 2VJBA 3A4MA 1JQ3A 3GEIA 1R0KA 1FNNA 1U7UA 2FMUA 2VUIB 2WINI 5FTMA 3RODA 3VR6D 1J2UA 4DLRA 3JQDA 4KO4S 2HLHA 2ERXA 3AR7A 1WB5A 2QDKA 2QPTA 5DM2A 5EJMA 4ENWA 5CB0A 1UJMA 2D13A 1THTA 3QTBA 1DS6A 1JV2B 5A5GA 4ZVTA 1MCZA 8OHMA 5HQTA 3AILA 5I8PA 3KDAA 4DDVA 2FSFA 3UQYS 3GUUA 2GFHA 4XSGA 1J1IA 4CMIB 3RTCA 4QT4A 5C8VA 5K0FA 4PRLA 3EBOA 4GUDA 721PA 3PI6A 4CI0B 5K8CA 2DJIA 2QRPA 3D4PA 5I9MA 1TQ8A 2I3AA 1ZITA 3V1TC 4NATA 3SE0A 3CU5A 2CD9A 2IYPA 3HKCB 4XTCS 3RVQA 4B40A 3DG9A 4CCYA 3FVVA 2JGFA 4MVXA 1E2EA 3EMBA 3QNWA 3V8VA 4ITVA 2J0QA 1TMKA 3RFTA 1T25A 4LZJA 4DV2B 4B2LA 2QVZX 5GM1A 2VT2A 4TS9A 3JQGB 2G9VA 3ZOKA 3WGUA 3NUQA 3ON5A 2YMLA 3FB4A 5EIEA 3EVCA 3M3HA 5TIIA 5JNLA 2ZYWX 2XUPA 1Q14A 3TBHA 3WV5A 3M1AA 5B53A 5E9QA 4BV9A 4X91A 1NZFA 4YMUA 3DMTC 1ZD1A 3BTSA 1MO4A 2PM8A 3E0XA 4RF5A 1JEQA 2BE9A 3VX3A 4BIIA 1BMFD 2DM6A 3ICCA 1ZM3A 1K8ZB 3OT1A 4LTDA 1KSFX 2FSPA 5F12A 1PNOA 1OGYA 1SCUB 5ADWA 5CDHA 4R8RA 4FMPA 3PQFA 1Z3IX 4ECEA 1W19A 4ARAA 4E32A 5AW5A 1D6SA 1OAOC 4K9SA 2PH1A 1G6KA 4YRMA 2CNWD 1MJNA 2DULA 4QBKA 2QY9A 1PG2A 4BATA 3EXIA 2LXNA 4QYMA 3EEIA 3IA2A 3PC4A 3U7HB 3USES 1K7EB 1M6HA 1QPGA 4ZARA 5K0CA 4J7AA 1T6ZA 2EF0A 4ENVA 1HRKA 3I42A 5FWDA 5JC1A 1ZNZA 3HB7A 4FFVA 3KYCB 2OTCA 4OMDA 4XQ0A 4Z9AA 1SBZA 5JTUA 4JOCA 1PJLA 4HOYA 1PZMA 1TT5B 2NO6A 1IZ7A 1VYTA 2JIMA 5DV9A 1V7CA 3NAGA 5U4QA 2OAGA 4A23A 1VIVA 5AKKA 3LE8A 3AQIA 4AKEA 5L53A 2EFEB 3ZV6A 3WY9A 3KKPA 3KJFA 1ZMRA 1EFDN 4K6FA 5ARBA 1ZD5A 1LU9A 3NP9A 4EPVA 1XKLA 2OCKA 4MVJG 4F9GA 3STWA 3ZXIA 4DLAA 4EVRA 1U2DA 3AM3A 4WGGA 3OCJA 3G2PA 3EZXA 1ZSVA 4WA7A 4Z0HO 4YHHB 2IOHA 1P7PA 3U3KA 3CIOA 1NZJA 4UNRA 2VAXA 5KSPA 3QG5A 2Q5JA 3BH6A 1WKCA 2HSEA 4LDZA 1MB0A 1FJ2A 1Y80A 2VTVA 3NBXX 4IOMA 3R76A 1AK2A 4L16A 4EUKA 1M2OB 2FOXA 2J32A 1L7PA 2WTNA 3IE0A 1AQJA 1WP4A 2BUAA 2EDAA 5SZKB 5A9RA 3PNYA 5J3JA 3THWA 5ALYA 4YJ3F 1QO0A 3EXG1 1NQ5A 1P2GA 4LAFA 3AERB 2K2QB 1M10A 4QDZA 3UWOA 2JJYA 5B64A 2H4FA 1SNYA 2O8EB 2QE6A 5ELMA 1G2PA 1JZQA 1E2MA 2HJ9A 4WZAE 3EARA 1RMYA 3F3KA 4G4IA 4CT0A 5JRZA 2Z09A 4MUBA 3RW9A 1QG6A 3KUKA 5K3DA 1Y6FA 1RJGA 2KPOA 1GT6A 4RLHA 4X0EA 4Y1FA 2JBHA 3ESRA 3UHPA 1WQ4A 4TVSA 4NYMQ 1X0VA 2XD4A 1PLKA 1WAMA 3FYDA 3MCZA 3ZLTA 3AKDA 4LYAA 3SZMA 1CLEA 3PPVA 2DFLA 3E84A 4G5RA 2QP4A 2UKDA 5IC4A 5E9JA 3EE6A 2E9SA 2ZRNA 3FW1A 3IUSA 1ILEA 4GOMD 3VR1A 1C8BA 4Z3KA 2XVAA 4QVKA 4OQXA 4EB3A 2FGKA 3L1JA 1SKYE 5EP4A 3GOQA 4F21A 3SXPA 3UW1A 2R84A 4I9FA 4KXFB 4I1VA 4LOHA 4OFZA 3QFHA 5AJUA 3W1WA 4PX3A 4DSTA 2CV1A 4BXOB 1J5PA 1E7SA 2DY1A 1VKNA 3BT7A 3PUIA 3OQMA 3UJ8A 1A50B 4LXHA 4W9RA 2QJFA 5GV7A 3RK4A 3ZW9A 4KLAA 2Q7OE 1O97C 4EX7A 3PQDA 4XWAA 2LGJA 3DHVA 3SFTA 1KQ3A 4D42A 4Q00A 5JXHA 1H05A 2J5XA 1HZZC 2AF4C 2QGZA 3P9PA 4IX9A 3GMSA 2IP4A 2RI1A 1Y8QA 3T6KA 1W48A 4FYYA 2H1VA 3NANA 3U1TA 8GPBA 1C3XA 4Q1FA 5JSKA 1KP9A 1PD1A 1USGA 1XRQA 1QGZA 3DPIA 5JADA 2DX7A 1LV8A 3PT5A 3RCBA 4N8EA 5JV5A 1M34A 3IESA 4I9GA 2X2PA 3TEJA 121PA 1DC3A 1S9DA 1F12A 2WP0A 4C6RA 3LY5A 4ILKA 1DLIA 3O9VA 4BU1A 1B6RA 3UJPA 4N6OA 4EBFA 2CVOA 1QORA 4GT1A 3QVJA 5AYVA 4KBFA 4DRZA 5BW8A 5HSGA 3W8FA 3PXCX 4Q93A 2E18A 1FYDA 4Q4AB 3W5SA 5BVHA 3ONEA 4F86A 3L8MA 1X15A 2A84A 3LUGA 3PITA 4XCQA 4ZRNA 5AI9A 1DBPA 4KRXA 1HETA 3TSOA 3TTSA 3VTFA 4B1FA 5IH7A 4AZSA 3HO6A 5JQWA 1U8YA 3E9RA 3Q4GA 2IU6A 1XEWY 1NVFA 2ZBQA 2PZJA 5FV7A 2VH5R 2HBZA 2ZJFA 4RTNA 1GZ5A 2QMHA 2Y66A 4LYYA 4ENQA 1ZHOA 4DUGA 1OXXK 3IAXA 1SUFA 4KJXA 3AFOA 2XZLA 3NLLA 5K01A 3LY8A 1XCJA 1QX4A 3PUYA 3T7AA 1QXSA 1CQJB 3FMIA 1R0BA 1JBKA 1C4WA 2O3RA 3I9LA 4JGGA 2ST1A 3ROKA 4NNOA 1MAAA 4D96A 4CIAA