1V2HE

Crystal structure of human pnp complexed with guanine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
288
structure length
288
Chain Sequence
b'ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Crystal structure of human PNP complexed with guanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1v2hE00
4IP0A 3OF3A 4TXHA 4LDNA 1TCUA 4M7WA 2AI2A 4M1EA 1U1FA 5EUBA 2OXFA 4DA0A 1Z35A 1Z36A 3BGSA 3OOEA 1B8NA 4YMLA 1RXSA 1ODIA 2I8AA 1ODKA 3BL6A 4R2WA 4I2VA 2AI1A 1A69A 4QEZA 1JDVA 5EPUA 3BJEA 4OY3A 2OC4A 1PWYE 1PK7A 1Y6QA 4GMHA 4LNAA 4MCIA 1QE5A 3KVYA 4L5YA 1G2OA 1SD2A 2QTTA 4PNPA 3LGSA 2QSUA 3NM6B 5IFKA 3U40A 3F8WA 1VHJA 4U2KA 4GKAA 4TS3A 1FXUA 1OV6A 3OZDA 3ENZA 4NY1A 1RT9A 3O6VA 5F7ZA 3DP9A 1VFNA 3SCZA 5F7XA 1Y6RA 3OZCA 2P4SA 1Y1TA 1K9SA 1T8SA 1PR6A 1ZL2A 2OECA 3EMVA 4L5AA 1K27A 4DA6A 4WKBA 5F77A 4TTIA 1RSZA 3P0EA 1LV8A 1OTYA 4EB8A 1LVUA 3IOMA 1ULBA 4YNBA 4F2WA 4NSNA 1JDZA 1JYSA 1CB0A 3ONVA 4DANA 4YO8A 2B94A 1SJ9A 4GLJA 4D8YA 3OZBA 2ON6A 1TGVA 4QAQA 3DDOA 4F2PA 3E0QA 1V45E 5F73A 1TCVA 1NW4A 5B7QA 3UAWA 4TTAA 1I80A 1Y1QA 3D1VA 5FAKA 1RR6A 3E9ZA 1ODLA 3NM4A 2OC9A 4TXLA 4TXNA 3GB9A 4QARA 3TL6A 2IQ5A 1T0UA 1PK9A 1ODJA 1Z5NA 1JE0A 4TXJA 5F7OA 4G89A 1A9QA 1T8RA 2RJ3A 2A8YA 1SD1A 5F7JA 1Z37A 1U1CA 1ZOSA 1TD1A 1U1EA 1LX7A 4TS9A 1A9TA 3FAZA 4L6IA 4F3CA 4D8XA 1PR4A 4QASA 4X24A 5ETJA 5F76A 3UAXA 1B8OA 4OEHA 5EFOA 4D9HA 1Z5OA 5JPCA 1V4NA 3KU4A 3LA8A 1JDUA 1PKEA 3EEIA 3OOHA 4JOSA 4EARA 1C3XA 2A0XA 4RJ2A 4E1VA 4D8VA 1YQUA 3QPBA 4TTJA 1A9PA 2AI3A 3FNQA 4DA7A 3UAZA 1V2HE 1YQQA 4UC0A 4TYMA 4D98A 4LZWA 2A0WA 4ECEA 3EUFA 5IU6A 1OTXA 2ISCA 4WKOA 1PF7E 2QTGA 4DA8A 3P0FA 4PR3A 3NBQA 2HWUA 4G41A 1Z5PA 3PHBE 5B7NA 3FOWA 5DK6A 1JP7A 1Y1SA 1N3IA 2QDKA 4WKPA 4BMXA 1OU4A 2GUWA 3KHSA 4K6OA 3O4VA 4F1WA 2HRDA 3DF9A 1JPVA 3BSFA 4G8JA 4R2XA 3C74A 4H1TA 4NS1A 1NC1A 5CCDA 3KVVA 5C80A 1RXUA 4KN5A 4OJTA 4OGKA 1JDTA 5CXSA 4DARA 1V3QE 3KUKA 3PNPA 1M73E 1V41E 2H8GA 3E9RA 4TXMA 3OZEA 1WTAA 1OVGA 5CYFA 3MB8A 4F3KA 4QATA 1U1GA 1RFGE 1PR1A 5B7PA 5I3CA 4MARA 1A9OA 3KVRA 3DJFA 3OPVA 1T8WA 3FUCA 2PGAA 1CG6A 1Z38A 4MCHA 4QFBA 1Z33A 1RXYA 1JE1A 1YBFA 2XRFA 1PR5A 1SQ6A 3NM5A 4FFSA 3K8QA 5KB3A 4LNHA 3EUEA 1T8YA 1Y1RA 1VHWA 5B7GA 4LKRA 3FB1A 3INYA 3UT6A 2HN9A 4R31A 4BMZA 4M3NA 4BN0A 3UAYA 1PBNA 1Q1GA 3FWPA 3PNSA 1V48A 4L0MA 1NC3A 4DAOA 5K1ZA 4WKNA 3DPSA 4DABA 4P54A 4YJKA 1Z34A 1TGYA 3OCCA 1PW7A 1Z39A 4JWTA 3IEXA 2AC7A 1YR3A 3T94A 5CYGA 1PR0A 2I4TA 3UAVA 3K8OE 1A9RA 4L5CA 4BMYA 1K3FA 5F78A 4OGLA 2Q7OE 1JDSA 1A9SA 1VMKA 1U1DA 2HSWA 2QPLA 4WKCA 1ULAA 2BSXA 3PHCA 1XE3A 1YRYE 3GGSA 4JP5A 1ECPA 1RXCA 4GLFA 5CXQA 1OUMA 2A0YA 4DAEA 1RYZA 5CCEA 4OF4A 3MMSA 3ODGA 1RCTE 3LBAA 1PR2A
chains in the Genus database with same CATH superfamily
1QZUA 4ARIA 2OFFA 1ZN7A 2QRPA 1JEDA 3DKIA 1A9XB 2SBTA 1Q91A 3ESDA 3EVFA 3R5HA 4OQMA 1AHNA 1VKZA 2Q3JA 1QGED 5EXPA 2POQX 1F2TB 4MRAA 3V2HA 1EK2A 1KH1A 1WDLA 4RCVA 4XJTA 2VZ8A 3ADDA 1CV2A 5GINE 4KTVE 4YCSA 4P31A 5FEMA 3STYA 4KXYA 2AR0A 1ZZEA 3TVTA 1G2PA 3LVRE 4A6PA 1Z36A 1WJGA 3A1NA 5BV8A 4A6XA 3X1JA 4ZMSA 1YIDA 2PRIA 4YJGB 4YMLA 1UKEA 4FUTA 2QJWA 3R5TA 4RORA 3K09A 1IPFA 3TBFA 1EG2A 3BL6A 2EP5A 3WLJA 4PPNA 4B33A 3GLGE 4JBWA 2ZTLA 4G6ZA 3TIVA 2R8YA 4C43A 1PE0A 4X20A 4ZU6X 1K6IA 3R77A 1WP9A 2HA7A 1YO6A 3L8EA 4CL2A 2QTZA 2HEGA 2WP8J 4FKMA 1Y6ZA 1YUBA 3ZQKA 2NPFA 1KZ9A 1CVIA 2HBZA 4QEZA 5EJ8A 4L73A 1E5XA 2JBAA 5ED4A 1P45A 1CZLA 4IKOA 4HXEB 4YLEA 3M4YA 2FSHA 2PD6A 4N54A 5EJ4A 1W59A 1LK7A 3BAZA 5KKNB 1EP1B 4G4JA 4CV1A 1BOOA 2IHYA 4C04A 5J1SB 2IP2A 1JX6A 4GVXA 1LI4A 3VPGA 4DR3B 3FGOA 1RE1A 1UMCA 1U2GC 3G0HA 1NBAA 3MS4A 2JAWA 1Q2UA 2GM3A 3LKBA 3VTFA 3ZNQA 5JJKA 2Y3IA 2C9OA 1ANKA 1JECA 1W76A 1NWCA 1KK1A 2ZU0C 3VI4B 3EGWA 1TQ6A 4PXYA 2J6HA 3V4OA 1V5FA 4ZCTA 2HMAA 5IJWA 5JRJA 2DPHA 3O95A 3GEHA 2Q5JA 2JNWA 5K3FA 1IBCA 1Q6ZA 1AKTA 3FCXA 2WZBA 1GPKA 4RA9A 1JB9A 1EGAA 1QIKA 4F7DA 2A9VA 3OZAA 5FYDA 3H2ZA 3MJDA 4EHNA 2P5UA 2G5CA 4R2HA 5HBRA 3QG5A 4GBGA 3VNSA 1HPLA 5EWLB 3FPBA 3RFTA 1I9GA 2GPSA 1N5JA 1TEVA 4F4HA 2GZAA 3B5IA 4RYLA 5JQGF 2YDYA 2FXVA 3PIRA 4D9KA 3PQ8A 2ONZA 2AMFA 4AJ9A 5IG2A 1QFMA 4CQMB 1Y3IA 2WMOB 1T9CA 3AONB 1DV2A 2QXTA 4QOFA 4YS6A 5CITA 3GPLA 4D74A 2W6IA 1T8PA 2IEIA 3NBUA 2OHVA 5JCOA 3PHLA 2V6JA 3FTNA 1E62A 3I64A 2FEKA 4II3A 4ZVPA 5SYNA 3BHNA 2HMVA 3WZMA 4C4PA 5HIMA 1ZP6A 2I7CA 2BBTA 3D2BA 4BFLA 4UPEA 5CK4A 4NI5A 5CDUA 1Z18A 2ECPA 4OI2A 3VDNB 1XRNA 1DP4A 5K8UA 1MC1A 4WN9B 3MFQA 2PZMA 5JSKA 5C81A 1DWUA 2ORYA 4IH1A 4WOCA 1PR6A 1ADGA 4KE9A 5ICFA 2O6LA 4AQDA 1F1JA 1L7VC 1RACA 1TYBE 3HKEA 4CDNA 4HNUA 1RI3A 5CFPA 4WJKB 2B4AA 2VF4X 10MHA 3HKBB 1QLJA 4P7JA 2RD2A 2G7ZA 3A4MA 3CZ9A 4P58A 3II6X 5B36A 1Z25A 3MWGA 5A0FA 3F2VA 4KU4A 2BRUA 2C94A 2OB2A 4IICA 4NFLA 1L4KA 1JVBA 2X15A 4H59A 1EE2A 3A3KA 1R12A 3BUSA 1CZRA 3HM9A 3T1QA 2G77B 5BSUA 2VYNA 3GZJA 1BGVA 1TE2A 1YQXA 4MXDA 2O7RA 4Y2XA 2IXEA 4C4TA 1X0XA 2JA2A 1OGYA 2OILA 1KEEA 1NFRA 1ACJA 1DPGA 4RF2A 5DT9A 5IDVA 1E3TA 1S02A 1V7CA 4E5VA 2HQRA 1L8QA 2XUAA 3B1FA 4TT3D 3LXRA 2Y05A 3HJNA 4RTSA 4F6RB 4QTTB 4FXOA 1JDZA 2ERXA 3QK7A 4MUEA 3CLKA 2IWRA 1UIRA 3WLNA 4BNTA 4WK4B 3V4PB 4J1QA 3UA3A 4NJEB 1U9JA 3C8MA 1N2CE 1P17A 1SU4A 5FQNA 3TR0A 4DQDA 4A03A 1HTTA 2QX8A 3HUDA 2AW3A 4OSOA 4YI3A 4UQPA 1Z06A 5HF5A 1U2PA 1QONA 1WHSA 2OMKA 3PZRA 3IEIA 1PJTA 3FLBA 2X8WA 2Y4OA 1HFEL 5JD3A 1TF5A 1Z4OA 4RS4A 2ON6A 3F74A 2YW9A 3G13A 1GNQA 4ND4A 2P1ZA 3TUJC 4RNCA 1R0LA 2H16A 2YBEA 4OATA 2PKXA 5DXFA 5FUWA 1RI1A 2JG3A 4WT7A 3QBTA 1GYRA 2X9NA 4G56A 1PEYA 1U7WA 3O47A 4WK6A 2ZJOA 4CM3A 1HM5A 4QTXA 2WWRA 1JS1X 4LXTA 1M75A 1QHYA 4XIGS 1UPTA 1SIBE 4IDQA 5TB5A 1E0DA 2QVZX 5FPQA 3STUA 2DR3A 4R41A 5KYGA 3IIKA 1RR6A 1D1PA 1G8AA 5HUHA 2B36A 4UFNA 4N1AA 2HBYA 4MKRA 2X8JB 3HADA 5T4FA 1WQ3A 4DQKA 3UVEA 2VJCA 2XVMA 1A5ZA 1UEXC 5KAPA 1A9YA 1G17A 1V16B 1HG0A 1VE1A 2IQ5A 3DLTA 4K1XA 2CY0A 2VDVE 4A3SA 3U9TA 4AO8A 1W4RA 1H1DA 4MVWA 2VP9A 1RI4A 1XTJA 2AFRA 3HL4A 1YVUA 1ZVKA 3V8RA 1BTOA 3VKGA 5HZMA 3PUJA 4PX3A 5PGMA 4BV3A 3BH6A 1T8RA 2FLWA 3A6DA 3QW4B 3DFZA 2XI4A 4IF6A 4RPGA 4B2YA 1EK1A 1CP3A 1FFSA 2V5AA 1ESDA 1FL9A 1V0JA 3M81A 1ENPA 2BCEA 3KQOA 4IZOA 3M89A 1G1MA 4L3WA 4UULA 2UUPA 4JHLA 4RL4A 4C7JA 4LXXA 2YKGA 1W5FA 3MMNA 2L2QA 3ORHA 4HFJA 3EGDB 1SQSA 4KXQA 1AM4D 3RCBA 4PLWA 4B6QA 3F7OA 4B3CA 5JS8A 1RPZA 2LBPA 4FYMA 3M2TA 5F64A 3BMOA 3LYUA 3GYGA 1SXPA 1NNI1 5DYIA 3PRJA 3ANSA 3Q1LA 3WO1A 1DBRA 2PA0A 3AIOA 2QE7A 2XQKA 4C21A 1Z22A 1Y80A 4AWAA 5ISMA 3Q3IA 1BMFA 1X1CA 1PQ4A 1JZTA 4H2DA 3AR9A 2HPHA 2CUNA 3H0CA 3EWSA 3S3TA 2QYTA 1U3WA 1C30B 3L07A 2BVNA 3LTEA 1BEZA 1S7GA 1N5RA 2GWRA 4JJZA 3WMEA 5JNRA 4PZ9A 4XCVA 4MAAA 1M2EA 4HQKA 1E2BA 1JJFA 3LLCA 4BQFA 2HV9A 2ZPUA 4I1YA 2BSAA 4DIOA 3SZGA 1Q0RA 2OMEA 3HCPA 1M2OA 4CQLB 1LS1A 1SPBS 3G0BA 2RHGB 1GEGA 4HVAA 1E6WA 4ZU1X 5C5CA 5T6BA 3ZQJA 1NNEA 3AIMA 3I0ZA 3EFHA 1DJMA 4EKIA 4I9UA 3U7IA 4DPKA 1TRKA 1AMNA 2CNNA 2YXNA 3AR2A 1KHHA 4LW8A 1UJ4A 3CZPA 4NXNB 4EPRA 2AZXA 3UTDA 4O8ZA 1PI3A 5DU2A 5FBVB 5KYXA 4KR6A 4EECA 3DOHA 4PINA 1M2VA 4OHBA 4B3IA 4KPYA 5F1PA 4LBYA 3BOSA 4ENSA 1T4CB 5BN3B 1J24A 5JH7B 4RJIA 2A5LA 2H4FA 2ZSJA 2G28A 1GR0A 1SBNE 3RQIA 3WGVA 5IUJC 1KO7A 1N36B 4BWGA 2AFVA 4NEHB 4CU2A 3DVAB 2DG2A 5HCNA 1ZBQA 5IBPA 2BGTA 3BB3A 3D2LA 5ADWA 1ZWLA 5CA1B 3GOHA 4ZCMA 5CH5A 4D98A 1VYVA 3IDFA 5LPNA 1Q7BA 4O2BF 2Y1CA 4IXWA 3RVRA 4PHTA 4EI7A 2VP4A 4MUAA 2PL3A 3CPHA 4HWSA 4N7JA 2G6TA 1ICIA 1TQ8A 1SURA 3M70A 4X8OA 5D2CA 4EA7A 2BGMA 1ZHOA 1YS9A 2BY4A 2JCSA 2ZKIA 3BICA 5AVOA 3S2GA 1TQ4A 1J00A 1UQUA 1XU4A 3HGTA 3NWPA 1QIEA 2ZULA 4ZV4A 3S28A 1N0VC 4RTKA 5FO0A 3H65A 3NBQA 4MPJA 2BEUA 1I1HA 3AUXA 2COUA 2RAPA 1OYWA 4P3XA 4C6RA 3PXUA 1CQPA 3S8EA 3OP1A 4X3PA 3GC6A 4IZHA 1JB1A 3WY9A 5LU8A 2RHDA 5D6NA 3OZUA 1ZAKA 5DK6A 5M2QA 4JLVA 1SAYA 4L8FA 2LNDA 3FZQA 4J0EA 5LJLA 2PDAA 4D3XA 5IHPA 3QNWA 4QL3A 4N5IX 4K6OA 4BDTA 1RYHA 3QE3A 1WU8A 2G1JA 1XL0A 2Y1DA 5L4SA 2LTAA 1H22A 3D2AA 4N0EA 4NS4A 4TVOA 4QJ4A 4YCJA 4YVFA 5EIWA 3ZE1B 1E2PA 3DPUA 3MF4A 4PZYA 4FX2A 1DQPA 1QHGA 3AXTA 1YRQA 2QORA 2RB4A 1A5AB 1NVVR 1V2GA 2G72A 3DL4A 4EMBA 2PAFA 1SOWA 4KQXA 3B48A 4CEHA 2BV3A 3RTCA 1NQVA 2FWNA 2RH9B 3FFAA 4Q1EA 5JD5A 5IVDA 3PGVA 2IP4A 2I1QA 1JA1A 3D8BA 2C9CA 1KHTA 1E3MA 2Q1UA 1IN1A 4DM7A 3PHHA 4IZ6A 4B5LA 2W2QA 3A1EA 3IDSA 1F4VA 1YFKA 1UJ6A 2NOAA 2P6NA 3EJ6A 1UPFA 1N7JA 1X1TA 3FWHA 1YB6A 4P92A 4ARZA 3E2MA 5IHXA 5CHEA 2X6TA 5MHTA 4CIVA 2Q4RA 4N5MA 4ZRMA 5FF9A 4AULA 1UBRS 4OSEA 1EAYA 1OLOA 3TTUA 3NJRA 3C4QA 1L5RA 1ZUNA 4NV1A 1NYQA 4TWBA 3LFUA 4BNMA 4Z4HA 4KWIA 1YH3A 2BFMA 2H4YA 4ND6A 3P9ZA 3QUSA 4Y9RA 1HURA 5HDBB 5KHLB 3RVDA 4KPEC 1DAFA 1IPEA 2H07A 2IYYA 3TIGA 1O6GA 2GDZA 3EGXB 2Q5IA 4RS3A 3T3HA 1U7PA 4DPLA 4OKNA 4YMGA 2J8ZA 3RYCB 3PJEA 3DOIA 3SE7A 1K6XA 3LPNA 8ADHA 4C2BA 3AJRA 4X45A 5E7IA 2GM9A 3HYRA 2JJ2A 3ZHZA 2JK1A 2X9VA 4RMHA 2ALJA 3M6LA 1P6QA 3TB4A 1A9OA 4AZVA 4J0IA 4R71A 4RXUA 2AN5A 3B2EA 2PIDA 1M67A 2FOLA 3C16C 1H23A 5KWIA 3VH4A 4PXAA 3AR8A 3DXXA 2WTEA 4EFLA 3NYQA 3I9NA 2EF1A 5LZ8A 3B13B 4KSYA 1Z28A 4BNYA 2F1JA 3OCJA 4G2TA 4BIMA 3AF1A 3AILA 2WU0A 2C84A 3E9YA 2BIFA 3FTPA 1SC3A 3H5OA 3OHMA 3TSYA 5H83A 3W06A 2WSIA 4RHEA 4Y7CA 3K09C 2CXHA 2RSLA 3IILA 3SKYA 1QQAA 3CB4A 1IY9A 4BBZA 2QLTA 3LPAA 5EWMA 3HTXA 1LNQA 4V0SA 4JFAA 4LIPD 5J2UB 3SBXA 2QR3A 5CBPA 4LK2A 4I5DA 4OLFA 1RBMA 1V37A 3NHWA 1PYDA 2VFAA 3WB0A 5ANRB 5FHRA 1Q7EA 4OM8A 4WI1A 3V8MA 1TMOA 2YY6A 3MPOA 2X9GA 1BHO1 1YS7A 3BE6A 1TTQB 4OGFA 2VXOA 1QC5A 3NBAA 2OWDA 3JRNA 1DJNA 3TCNA 4R5HA 4R31A 3UYLA 2FQQA 3LBNA 3T1VA 1JEYB 2FGJA 4MULA 3RYTC 5BOSA 4BN0A 3ZJTA 5C8ZA 3DDNA 4MTCA 1XAIA 2O4UX 4LWQA 3KVNA 2RGXA 4C6SA 1XX6A 5DO9A 2GASA 3H0KA 1NLFA 2HCBA 4QYIA 5EMNA 4YP7A 5K3BA 1PUXA 4XWKA 4GYKA 3RHSA 2ACEA 4MSUA 4NMHA 3T7JA 2VQEB 2EZ9A 2DKOA 3OLVA 4KKVA 4NCIA 1WB5A 3UMBA 1ZR2A 4RFVA 3MLAA 3OLZA 4P54A 4XPIA 1MEOA 2LVBA 1QIDA 4IOJA 4P7BA 5IKOA 2SKCA 4ZOLA 2AYYA 2BZGA 5GM2A 1YFLA 1WPQA 5AW0A 4C4ZA 1GPMA 4JWTA 4UDOA 1WPGA 2VHJA 1EFPB 1HF3A 2OLJA 3T35A 3V8EA 1OX5A 4J90A 3ZH2A 1JVNA 3R0ZA 1W88A 3RG8A 2H7CA 4YAIA 2H52A 5PNTA 4COKA 3CW2A 4PZLA 3W5HA 3HVIA 3U56A 3ED1A 1ABFA 4AO6A 3UC5A 2CF6A 1N9KA 5JCOC 3L92A 3FZYA 2Q7OE 1XQ6A 1J7KA 1IG3A 3HI4A 1YA8A 3TOXA 1QQ5A 1Q0PA 1MABA 1THGA 2QNBA 3HSSA 3SQDA 4BLRA 3N2EA 4QDTA 3BD6A 5C8XA 3F6CA 1ZX1A 3RDPA 3CX6A 5ECDA 1VL0A 1CUFA 2GHIA 1SXJD 4BV2A 3NDIA 1YRYE 3IX7A 2FR1A 3MRTA 4FB5A 4JP5A 1RLMA 1SUDA 2JCXA 5FD8A 5JZOA 4EQZA 5CGZA 4LKOA 3ECCA 1T91A 3KAJA 4KP7A 1S1CA 1KYXA 4F5YA 4YT8A 4NK4A 4OXXA 4TWRA 1XZKA 4B4VA 1CK4A 2X2OA 2X42A 3HJUA 2VJAA 1NPDA 1SEVA 1RS0A 1SVUA 2Y1FA 3NS7A 3PFCA 2B8WA 2NM0A 4IDPA 4URXR 3BD9A 5IUKC 4XB6B 4ZI7F 5JD4A 2JVIA 2EL7A 2ZTSA 1L4LA 3EIEA 3LX4A 1KC3A 1JLLA 1NVDA 5JW6A 2BRUC 4JJEA 1VLZA 3WI7A 3K7EA 2Q3CA 3LBAA 4R9VA 4CR8A 4DIFA 3V8VA 4NCXA 5TXGA 1RPTA 1J56A 3OOYA 4PU0A 3SFTA 4OQ4A 3D8RA 2Y0EA 2XCQA 1YOVB 2DWQA 1N9ZA 3CLSC 3SGLA 3VZPA 4DWVA 1K0FA 3W6NA 2HA4A 3W5DA 4CTJA 2DUWA 2Q41A 2VUUA 3LVFO 4MGHA 4EO4A 4M1EA 2DT8A 1FMLA 1WBBA 3W3AA 4JJ6A 4BJ3A 2IZ5A 3RASA 2CUTA 1TZKA 2PHZA 3NUGA 5H3CA 5JCJA 5IULC 1GCUA 1TFRA 3ICOA 1THTA 4KRFA 2C2YA 1EK6A 1UC4B 4ZCSA 4KB5A 4HDMA 4PPQA 4X90A 1YRBA 4B32A 2WE7A 3K92A 4P7FA 4Q6WA 1Z82A 4PZZA 5UKDA 2CYBA 5KDOA 1MEEA 3EZ9A 5JSQA 5KX5F 1R88A 3K1JA 3SS7X 4A6EA 1KYYA 3PGA1 1YZQA 2CWWA 2AKAB 2B69A 5BYKA 4BO8A 4X1IB 3W3ZB 5LDDC 3IEMA 1Z0UA 4HXFB 5CRIA 2ZUTA 4G65A 3VNAA 1TJNA 4MYTA 4YWJA 1PK7A 4HGOA 4Q7MB 3ZY2A 3FI9A 1BXGA 2FFAA 3EIWA 3FCSB 2NO6A 3NWEA 1EZ4A 2XUZA 3U7QB 3VTKA 4XDGA 3M1YA 4KE7A 4E88A 4MO2A 2VIIA 5JD6A 1FDTA 1NMZA 4OMDA 4LF7B 1KERA 3CKYA 1ISHA 3JR3A 4JJKA 3LQ4A 4MITA 2BI4A 1IY2A 2P62A 4KIFA 1R0ZA 2VSXA 3L5KA 3A4IA 4ACAA 2HB6A 1KFJB 1DBPA 3U3RA 2PX3A 2AXQA 1BWRA 3FKSA 3UPTA 2PL1A 1DAEA 3QKRA 1JI0A 1MAUA 3IERA 5IH7A 1NUHA 4J3JA 4PXSA 1JL3A 4ZRNA 1XTVA 4TQGA 1BHSA 4KN6A 2PPVA 2QHXA 1ZW6A 1XMPA 4U9UA 1ZESA 4R68A 3CNQS 4DMFA 2TYSB 1N2XA 1Z2CA 2Q4DA 4WASA 4M8KA 3E9QA 2PUWA 3UQYS 1BXRA 4Y98A 1Q1BA 2XCUA 1JDBC 3JXEA 3JTMA 1J2JA 3JVDA 1P39A 2TMKA 3V1YA 1DIOB 1P9WA 4LHEA 1R0WA 4OO3A 2W6ZA 3LQ2A 4TN5A 5DNEA 2B4YA 4MVJG 1AT1A 4L08A 4NDNE 5MGNA 3MWKA 2VATA 1N57A 4AJHA 3IP8A 4Z3OA 1L4BA 5CD1A 2RAUA 1BKYA 3HWX1 1U3CA 1GG5A 3D8UA 5H1YA 3AZQA 2WEKA 4R1PA 3TW4A 3THXB 4C76A 3KNZA 2UYQA 1DNPA 1E7QA 2VQDA 2BBOA 3A58B 2MYPA 4M60A 2GRUA 5TR9A 1C8BA 4F8JA 2IUFA 4YJ2F 4NMMA 3PEWA 2NZWA 4JUCA 1D9ZA 3KIPA 4B2PA 1ZIYA 4BLVA 3BREA 1EEXB 2PWAA 2UZ3A 4KVAA 1T8SA 2N9UA 3V97A 1ZL2A 3VVMA 3QVJA 3V3TA 5GY7A 4MW2A 2JKZA 3TTXA 5KTTA 3VYVA 2AZ4A 5C1OA 2Q6LA 3WGZA 1Y8RA 3CR7A 3DL2A 4WESA 2CE7A 2J7KA 2XEDA 2AFIA 4FW9A 5MDHA 3S29A 5BW8A 1ZJ6A 4W9NA 1I10A 2AD1A 2Z2JA 4KAAA 1BCRB 4WBNF 4UHCA 2PUJA 4TUYF 4C1NA 1LVUA 4IVNA 1WF6A 4GPBA 2V3CC 1XU9A 2CL0X 1G9TA 3SC4A 3CA8A 2RHWA 4W1QA 3KZCA 2ZSDA 2BEVB 2QS9A 1NPTO 1RJFA 2PWPA 2YMMA 3A70A 2XUIA 3E3MA 3HN6A 4ZHQA 5KINB 2YWXA 4RHTA 2Z58A 3IAM6 3V55A 4MGZR 1YB1A 4U6SA 4O0MA 1OLXB 1MH9A 5P8WA 3AR4A 2DE0X 2EJTA 5KQPA 3JR7A 1OFTA 4QEKA 1BX0A 2DBYA 3H1PA 2J3HA 1O03A 4JS0A 2DCUA 1QAMA 1MVOA 3CZ5A 3LHKA 1NMQA 1KDVA 5EE5B 3TRJA 2HADA 4LMRA 1LEHA 4JU9A 2OOSA 2Z8YA 3L0PA 3R5JA 1FUUA 4KN8A 4RZQA 1Q1QA 3ACBA 3ROZA 4CCSA 2B99A 4Y2VA 1T1GA 3I0NA 5F2OA 5FADA 3RAPR 4ECAA 4U7HA 3MT8A 1VPDA 2I3DA 2F62A 4NBLA 4F2PA 3KSAC 1NVGA 2JLUA 3VAYA 4IJWA 2ILVA 1OPRA 3NVMB 3K1YA 3EVAA 5FOVA 5L6MB 4J9VA 4KQMA 1JI3A 2FW6A 4LJ8A 3CUYA 5H7XA 3RFUA 3THOA 2PMCA 1YJXA 2YXBA 1QRUA 3SJUA 2NU9A 4JSRA 1KE2A 2NZXA 3DMTA 3O3MB 3UH1A 3E9ZA 2UVPA 3IV7A 3TRDA 3NGMA 2BGWA 3HBNA 3OIYA 4ZTUB 3GDGA 5FOUA 3OE5A 4PYKA 2BFBA 2FMFA 3V7NA 4LF4B 1O08A 4P3NA 2WWXA 4TV8A 4UATA 2A9RA 1UP4A 5EXEA 4IIJB 2BZSA 3MSCA 4M1YA 2Z6AA 1J0XO 3PDWA 3NHSA 4FE4A 4N01A 4M4SA 1S9HA 2V6FA 3S44A 3E9EA 1LQUA 4QD3A 2FZGA 4L22A 3N3AC 1L8XA 5CW1A 3BIXA 1RZRA 3SC2A 2A8YA 2ATXA 1KNQA 3W77A 1R5JA 1SUCA 4D02A 4RHFA 2A5FA 3CPJB 3QF4B 1YR6A 1AHHA 2OBFA 4GOMD 4LA4A 3WNDA 4IRUB 1FTNA 4RGQA 2DEUA 3DHYA 3FNFA 4PG4A 4IJMA 5BWBA 5JARA 1CW2B 2EW1A 4UJ3A 4X8LA 1RPNA 3DBHB 2G1UA 1R9JA 3AXSA 5DCUA 1G21B 4NOLA 2ZWPA 4EATA 3VYTB 2IZ6A 5ALXA 2XMQA 1RI5A 3FHJA 1OZ0A 1GZ5A 2P91A 2X5JO 2J85A 1AKMA 1A7KA 2ICAA 2ZUWA 3EVBA 3UOAB 1YGPA 3OM1A 1QE3A 3R5XA 1QX3A 3ZNNA 2OT3B 3UQZA 1CQJA 3IDZA 4L6IA 2W6OA 1UDCA 1P7WA 1UDXA 1H4VB 2UV8A 3LPCA 3OHSX 4WDQA 3VZRA 2H0QA 5AOCA 5FQOA 2JLZA 2IPAB 3D1JA 3PJGA 2D2IA 4W5NA 5HS4A 1CUBA 5J23A 3RSZA 5BPFA 3GFPA 2GYYA 2QD3A 1UBLS 1ML4A 5AUQA 4BO0A 4EHJA 4G24A 4HNQA 3EC7A 1NRXA 4HAOA 3OQBA 5BWLA 1XCLA 3CNBA 4OEHA 1H2XA 3UV6A 3WP1B 4E5YA 2G4CA 4MPTA 5HUJA 2FPPB 3FIJA 4MS4B 5HZGA 4DTIA 4DMGA 3ZGZA 4IG9A 1L6RA 3R7LA 4CT0A 3VR4D 1JDUA 1GPLA 3KZVA 3OOHA 4ZJUA 3C97A 3W04A 1DCFA 1W73A 3BA1A 5HK8A 1IZ7A 1J8VA 5EEHA 1YQUA 3P4UA 1BVUA 2DB3A 1VKJA 2W2MA 1QSGA 3U60B 4ASUD 1XAJA 3FNIA 1JKFA 1KJNA 5H02A 4GKJB 1E32A 2VPPA 3DSRA 4FU0A 2YZMA 4KE8A 2NZVG 3SQOA 1P0MA 4EX6A 1FQKA 4Q16A 4JYZA 4U4AA 1VI5A 3ETHA 3UWKA 4UDXX 5J4LA 4PIPA 4F4UA 4KPUB 4YRSA 4US2R 4WLEA 4XLTA 1JA9A 1FDSA 3JZDA 3OX2A 3RS8A 5JCZA 2B82A 3OJCA 5GIPE 4MQFA 1HNZB 5L3SA 2ZXEA 4JWKA 4UZSA 3DKVA 1KK0A 4EA6A 1R4NA 4UFPA 1I7SB 4OP1A 5L7WA 1C3JA 1B41A 2BMWA 1SD5A 1K08A 1E5VA 3L2OB 1JXOA 3DGFC 3PDIB 5CB0A 5ILOA 1U8EA 4DJ5X 4HWPA 1VXRA 4CM7A 2CCJA 3ZD8A 1C29B 2A1UA 4AICA 1N1EA 1XTRA 3EVNA 3FPGA 4CFYA 5IWCA 3QFFA 3RNOA 3G8DA 3UV3A 3OX3A 2FTKE 5E0OA 3H2YA 3P5SA 1NVKA 4J1NA 3ML1A 2B5VA 3LKVA 2JZOA 4E22A 3UBTA 3HU3A 2QTBA 3LHSA 4P33A 4LF6B 4O4IF 4F91B 4YDRA 4PG6A 5E9WA 4J03A 4XB1A 4X91A 2XRMA 2OVBA 3EYAA 4RJLA 2HRDA 4DG8A 5GZ1A 1I7PA 4DLUA 4CTKA 4GL4A 2HL6A 1HXHA 4AZTA 1P3DA 1U5AA 3G0GA 3OUTA 3QVSA 3EIQA 4AURA 4DMRA 2C1EA 1YIAA 3EQ9A 2ZDHA 3I83A 3KL2A 4MJ7A 4QWWA 4BUZA 4Q9LA 1HNXB 1NBOA 2X7XA 4HATA 2I2FA 2JJ8A 2QOEA 3IOBA 3KVVA 2W6ID 3RF7A 5ICGA 4KN5A 4BL5A 4N6NA 3WK4A 3IP6A 4Y1RB 4KMSA 3MXTA 5JHGB 2B7LA 4GVPA 4MICA 3LYLA 3NYIA 3BJIC 4IF4A 5JXIA 4OHVA 4FHGA 5NLLA 5LQRA 5BXYA 1XCJA 1DAPA 3K31A 4RBNA 3OTHA 3UT5A 3STHA 4UE2A 4PW0A 3G9TA 3ND5A 3ZCVA 5CXXA 4A2PA 4PQEA 4FI3F 3CY6A 2KX7A 1T4GA 1GKIA 1M73E 2VJMA 3QZUA 4G4SP 3EVCA 3H2JA 4MS3A 4UFOA 3ROMA 4OJKA 4E12A 3H9GA 1IUNA 4IQ4A 3AFHA 3ESQA 3K70B 4FMCB 4LS3A 1EINA 4D3ZA 4YCBA 4DDUA 5L53A 2XMRA 4JODA 3WK9A 3PNYA 1M5UA 1Y3HA 1OVGA 2FPIA 1JG1A 4R1NA 3WK5A 4ND5A 2F64A 1ULSA 2I66A 3C8DA 2L82A 2LZ0A 1SHTX 1O89A 1ENYA 1W2HA 1JFFA 1USGA 4B31A 2V6BA 1P8JA 2G04A 1RFGE 1ZH6A 5KWEA 3CX3A 2BT4A 5CFRA 1PGNA 1H3NA 1Q83A 1TVEA 2NTVA 2QQ0A 3PQ5A 5K6RA 4AM8A 2F55A 3A1DA 5E1DA 5DLQC 2Q4OA 5DTIA 3GDFA 1EYZA 3CG0A 3IKVA 1DKUA 3EEBA 5HMLA 4JD5A 3IIMA 5EWJA 4KX3A 2RJNA 5EKDA 2R9VA 1NDUA 3N59A 2J48A 4LMAA 4WH0A 2CDCA 3TAHA 3L1JA 1YUMA 3K9WA 3ZCUA 3TEFA 3GN1A 2CCKA 3UC9A 2PX6A 2MSNA 3B5JA 2BF7A 4TLEA 2DLNA 5JZMA 5H8WA 1FJ2A 1PFGA 1SQ6A 1ILWA 5CURA 3DBIA 1ZSNA 1E3WA 4DILA 1PW5A 2XMGA 5KB3A 1GFIA 1YQDA 2ZSBA 4CM9A 3EDRA 2NSLA 1OJLA 3NV9A 4W99A 1GAJA 1PJ2A 3RUDA 2ZSEA 2GNOA 4FS3A 4RD4A 5EIHA 1C8KA 5TMEA 5C7IO 4FILA 4O08A 1IM8A 1GPH1 2ZCVA 4QGGA 4DLBA 1ZUIA 1F8UA 3RLFA 4MB2A 4NOJA 1N33B 3C1UA 4HH0A 2FN3A 4PIMA 3PP8A 1TRHA 4NHOA 5CFMA 1MMFB 1DKLA 4MR7A 5CLQA 3EK2A 2CJXA 2DVMA 2GCIA 2R8EA 1S01A 3DDZX 1OH7A 3UOWA 1XK7A 4QU0A 3R7DA 2FZVA 4HGYA 1EGMB 1V3VA 5IUNC 1YIOA 5D1NA 1RU3A 3D0OA 3DE5X 2OYCA 3THYB 4WKNA 4JU8A 1TPYA 4KXMA 1XIVA 3QVKA 3KQPA 1KU0A 1FYVA 1I8TA 1OAKA 3RS0A 5B6PA 5I4IA 3IMFA 1B4DA 3EOBI 3IVMA 3AYZB 3ADBA 3ZYZA 5ER9A 3GO4A 3BFVA 2O54A 1MGOA 2Q8PA 3KR2A 1F5SA 4MK4A 3P8ZA 4GYJA 5ALLA 2OXTA 3WGJA 2XZPA 1SFRA 2WHRA 3ZEIA 1Y5IA 3UB4A 3HJRA 4WCVA 4RLQA 1KZGB 3CUWA 2QRZA 3ZDZB 1SC4A 3IE0A 3EFOA 1G38A 4B3SB 4K9SA 3CONA 3UHJA 2XDAA 3U1VA 3GLRA 4JMLA 4DQ0A 3OO0A 3VU1A 4F04A 3K35A 4Y18A 3OIDA 1EVLA 1EFTA 4QRHA 3ZDRA 4Y6LA 5I4CA 1XNJA 2FPRA 3CGGA 5EZ5A 3RFVA 3V4FA 5A3RA 4M9XA 2IXFA 4PQGA 3M9XA 3PHCA 1B43A 2VDWA 4GC9A 3HGMA 5J2TB 3ZBUA 2ZS7A 1FP1D 1W4CA 3A05A 1BMFD 4JKYA 3KD3A 3JSXA 4L85A 1DBQA 2Q6VA 5TT0A 3GLFB 4MQUA 1ONOA 3DTVB 3DTTA 1RQPA 3P32A 4RHXA 3TW6A 2HIHA 2C88A 3OCUA 1KMHA 3FGNA 3PG5A 2VRNA 4WIAA 3W5BA 2HAEA 4YPFA 2VPXA 2R96A 4OXQA 5H82A 2AN3A 3ZWYA 1NOIA 3EE6A 4W9NC 1EVKA 3B1ZA 5HPYB 1K7CA 2RONA 4M8IA 2K7FA 2CYAA 4UZEA 3GCGA 1SO8A 2HXGA 2HTEA 4GT1A 1LV7A 4NCHA 3PXDA 2F3SA 2Y4NA 5CT4A 5KDLA 4LJ6A 3UFXA 5BN1A 2AFIE 1VYTA 5LQJA 1V1JA 2JC3A 1TCUA 1QG6A 2SICE 1DHTA 4G0YA 3GPCA 3RWBA 3LUJA 4MIOA 3B8HA 2ZQZA 5C2JB 2PCJA 1AMUA 3G0DA 3AY6A 4ZANA 1MW8X 2WUEA 1GXSB 4Y2PA 4FZ3A 1O96A 3SZ3A 3VX3A 4ILEA 3EQZA 2XECA 4C7OA 4UTVA 1HLDA 3AERA 3K0FA 4DV2B 1V11A 1LI7A 1VECA 1L4MA 2OVFA 3DBOB 1CZOA 1ODIA 3PKZA 5LQDA 3I09A 1Z2AA 4I46A 2CC2A 1W9HA 4PICA 4QSMA 5BO5A 2BWJA 2FZWA 4XYEA 2VLBA 3X0DA 4Z1OA 5JMTA 4DV5B 4N18A 3DE6X 4E5DA 4NQRA 1BFKA 4X94A 2ZWIA 2R47A 3QYFA 2B9EA 1ULHA 1CEYA 1ISMA 3FOCA 4RESA 1OZHA 4GE0A 5G3ZA 4D4MA 4QKQA 5KHOC 3KKQA 4AZ0A 3C6YA 2OC4A 3JALA 2A5DA 2DSNA 3V9AA 4BTLA 2OHGA 5KYYB 1OI2A 4G0OA 1CY8A 4MVJF 2FWRA 3GAZA 3HPQA 2OO5A 3RPEA 3QUTA 5HF8A 1MO3A 3LNTA 4M88A 3R9XA 1KJYA 3KJEA 2MSWA 1PGOA 2ONCA 3DMTC 1JTEA 2CJWA 4ENUA 1EHIA 2XUDA 4Q93A 2ZBGA 3BRSA 1PJRA 4GP7A 1I6WA 1II8B 1SD2A 2AQHA 4HZUA 1HQYE 3RSGA 5JPDA 2O23A 3QV2A 2NT4A 3VUEA 4AY2A 3LGSA 1WVGA 3JQEA 3PFFA 3QJGA 3ORRA 5A9SB 1W75A 4QYSA 3RTEA 3CLTC 4ZICA 1C1XA 3OQIA 2BFWA 3THWA 5AM0A 4BNIA 2P4UA 4A82A 2FJUA 4L4YA 4KODA 1ZG3A 2XYGA 3MMZA 4RPJA 4B4DA 4G5HA 2R6JA 5CVCA 4I66A 4AJNA 2FP4B 2ZETA 1VB3A 3PX2A 4IDDA 3WL6A 2G0NA 1IONA 1NP3A 1VSBA 3PQ6A 3UG7A 4S35A 4JA0A 2HSGA 2G9RA 1F8XA 3O9MA 5K51A 2C4NA 3ZJ5A 4BO1A 5BSVA 1XRMA 1KEWA 4GSYA 5FI1B 1NFFA 1UBKS 2DBRA 5ALTA 3RIMA 4V1CA 3U7RA 1JVSA 2WBLC 2FR0A 2IELA 4R8RA 2NU6A 1UZAA 3KKPA 3NATA 2FZ4A 2JFVA 5AW3A 2FB9A 1SZPA 3FMVA 4K6FA 5JCXA 1ISRA 2CEAA 4GPZA 4D96A 3JWGA 3DB2A 3NI2A 2CXUA 1GPYA 3DZHA 1PZXA 2I6TA 3QLUA 2PX4A 4KR2A 1YD7A 5IN4A 5U9CA 2E4XA 4JGGA 2ZRKA 1T2NA 4DCTA 1NF9A 4CLDA 2REOA 1DWQA 1U6KA 4OUDA 1EESA 4TLAA 5ALHA 2FV8A 1DKPA 3NWBA 3I5YA 1CLEA 1SUFA 4MVJH 3KOZA 4EAQA 5JASA 5KTPA 3PPWA 4K03A 2PLRA 4BMNA 2VLIA 2ZG6A 2ZM5A 1WE2A 3Q7EA 1Z08A 4MQ5A 3WIDA 3KHKA 5CIWA 2X6QA 3NPAA 1NF2A 1RW4A 1JZSA 3MD0A 2P0AA 4WBSA 2IH4A 1ZLXA 1RPJA 4I55B 1GL6A 4MX8A 5HF6A 4EB8A 4O4HB 2BR3A 3IOEA 1A1SA 1B1CA 2XE8A 2ST1A 4LBZA 3W2GA 1KK3A 1LA2A 1ZUWA 1AV7A 4DPMA 1URPA 3BA6A 2FA9A 4IILA 3P20A 1M2FA 1YU6A 3RD5A 4ZZ1A 1YQWA 5ENDA 4D41A 1G8YA 4M0UA 3CF4A 2ZAYA 2G06A 5FLKA 1M1YA 4CKEA 1ZJWA 3IMCA 4MWSA 1WMAA 4RTOA 4EQ6A 3DTYA 4NSNA 1EJ6A 4PVCA 2BOVA 1MJFA 2BMFA 1IXZA 1JYSA 2XBLA 2YNMA 1SVIA 4KITB 2SKEA 2A67A 3V8PA 3BT7A 4ZQEA 1Z8DA 3IO3A 2IP1A 2VYVA 1PNTA 1EJ2A 4FFDA 5EJAA 1WM1A 1WLYA 3DE7X 4ISBA 4BKRA 3I6YA 3BGWA 1PUJA 4XR4A 3F4BA 1ZD3A 4HNAA 4CBVA 2QTNA 2J0QA 3KALA 4X93A 5H3HA 2MTBA 2XGMA 2XJ9A 3WOVA 1DIGA 4ZV9A 3TVYA 1DL5A 1PBTA 2WA1A 2JB9A 3EF0A 5CM9C 3DT9A 2O19A 3DZFA 1I3KA 4RXMA 4YAJA 4N3BA 5DB4A 2MMGA 1NPYA 1S8NA 3F49S 4UXJA 1L7EA 4FFRA 2CDNA 5IT0A 2X3YA 4X63A 3R7WB 3T0GA 3AF6A 2QTRA 1DKNA 3GNQA 3IKMB 1NRJB 1HEYA 2BUBA 1I4TD 2NSDA 2XQIA 3UT0A 2O0MA 2RGUA 4BWVA 4F38A 3PHJA 3TLCA 2AFHA 1UR5A 4S24A 1BDMA 3QXGA 4LE0A 1V8PA 2ZLBA 3TR5A 2B5WA 2I2AA 1R5NA 1CQWA 1RADA 2DPGA 3KPVA 4G37A 2R7MA 3M82A 3ZLTA 3T3PB 2PNFA 4TSRA 4C0XA 4M9ZA 3O2JA 5BR1A 5KU7A 3E1SA 2RH4A 2X2EA 4EW2A 1QYXA 3MAJA 1YAJA 3O0TA 2HDWA 3NP7A 4H7KA 2QQEA 3SICE 3WSWA 4ZDJA 3TLJA 4NZMA 2CNWA 5KWJA 3IMKA 4B80A 2FWBA 4NAUA 4D8WA 1JU3A 1CUUA 3EZ6A 1SUBA 2V45A 3OFND 3ITDA 4QXPA 2PYDA 2OD9A 2PXCA 2Q5LA 3OJEA 4Z8YA 4CCWA 3NHLA 3KVOA 4ODIA 4OB6A 3VJMA 3S2EA 2HCRA 1PJCA 1OIVA 4GPD1 5AW4A 4A4DA 3N7AA 4HAWA 2DCMA 4DIBA 2ZJ3A 3H2GA 1OHHD 3L7IA 3ZBQA 3W9YA 2OHJA 2HK6A 4IKEA 1RRMA 1W6RA 4G5FA 4NYIR 4DRZA 4B45A 5F4BA 1VL2A 4G5XA 3L9XA 1VHQA 4KIJA 4Z9AA 4C14A 1OX4B 4FEYA 1AIPA 1BMDA 2BTQB 2ECOA 4QGAA 4TV9F 4D4LA 2JLWA 3WZLA 3GZ4A 4ZIRA 2G25A 3A1CA 4BNXA 3HDJA 1NVEA 4R16A 2C5AA 3HXLA 1Z63A 1U1EA 1P9NA 3WQQA 4PFSA 1A9TA 4HDSB 4LXYA 4ZYLA 3S68A 2E0IA 2WUFA 5ICCA 1BH6A 4MZDA 4RY0A 1NFQA 4YPOA 1LI5A 1EXVA 2QSZA 5ARBA 4PX2A 1OILA 1B2RA 3DF7A 2QVGA 4RC9A 5EP3A 2M6LA 4ZJZA 3LBFA 4PLZA 2VDOB 1M5RA 1G8MA 4N7BA 3ZDYB 1QH1B 1Z7YA 2GLUA 3DNFA 1K06A 2WYOA 3RM3A 5EG5A 1MO4A 4I3GA 4H7IA 2OAQ1 4MO9A 1JBEA 3DAHA 4AAYA 3D3EA 1Z5OA 4N82A 3UW3A 1E5LA 5CFNA 4P83A 3FAKA 2CMHA 1Y48E 2H4ZA 2PZGA 4KVZA 5DIZA 4FHZA 4GKKB 3LX8A 1EBUA 4L7QA 1MEJA 1U0HC 5LSAA 2RI6A 5IS2A 3LPMA 5IMSA 3WGGA 1E5DA 4J7CA 3ESZA 4MDYA 4YCAA 3UXEA 3KLOA 3LM8A 5IPFA 4YAUA 2Q99A 3W3AD 5HSGA 1NLZA 4NE7A 1VSVA 4BJHB 4RJ2A 2YFKA 1ZVVA 4D8VA 5JCJD 4MV9A 5T4HA 4RKRA 1XJQA 1M0EA 2C61A 4F97A 4U1RA 4CMIA 4F3NA 3U19A 2G17A 2SNIE 5KNDD 2VHYA 1V7PC 4MA5A 2KWIA 4NU0A 1YJQA 3T52A 1ECFA 4YUWA 5ALVA 5ICSA 1OREA 3M0EA 4CIBA 3N0VA 2QQFA 4XDZA 5I7AA 4N6GA 1GZDA 1E1CB 2B98A 5MN4A 3G5LA 2A0WA 3DMYA 3RJ9A 1VDMA 2IZ7A 2NTJA 4XUCA 3TX6A 4A5SA 1AV6A 4PF1A 5J5VA 3UATA 1S2GA 4PC2A 4EENA 4JXZA 4MS1B 2BE7A 1PNVA 4Q9IA 2OFPA 1E3JA 2ZAIA 4OAPA 1TAUA 1EHYA 3AG6A 1S4QA 3UWDA 2DFNA 5IBQA 1XTUA 2ZCJA 2GAFA 3BFJA 2P4EA 4QM7A 2JAXA 4NZYA 3RHTA 2QTGA 4DA8A 4F9GA 1U02A 4PSVA 5IJZA 4BIIA 3V48A 3PC6A 3VZDA 3NOOA 5CB4F 3DWFA 4EHAA 1B0AA 3ZZNA 4ALIA 3W2IA 4K88A 2ZK7A 1ECLA 1NKVA 1LC3A 1G41A 3BD7A 3JQBA 4BQQA 1L3IA 2GJAA 1RZUA 5JWOA 1GPJA 4RTMA 3FKSD 3DCNA 3ZD9A 1VP3A 4CV2A 3L40A 4MV7A 1R9GA 1M83A 3H7AA 1GUBA 1XZJA 3LY8A 4HK4A 1A5SB 4TQUS 2QP9X 4TWZA 1Z0SA 2A7XA 4AO7A 1IN4A 3QV1A 4YT4A 5I3ZA 2H65A 3DD1A 2G09A 2GI4A 1JPVA 3OTQA 3VR6A 2Y71A 2OCYC 4QNRA 1W1UA 2L69A 1CUHA 4KK4A 3DTNA 5CTAA 1X70A 4WZZA 1EQUA 1M7BA 1PLJA 3QWBA 4KR9A 1JBKA 2FSUA 2J3EA 2AXEA 2DHQA 3A0UA 5KTKA 2QGZA 3DBRA 2ZSAA 4AP9A 4AK9A 1R5BA 3WK7A 1EFDN 3KKZA 3W6UA 1HTBA 2B2NA 2J08A 2G08A 5JISA 5FLEX 3CPSA 3B3JA 4EI2A 5I4KA 4WA7A 4PC6A 4R1OA 3TI9A 4RQAA 4QOEA 2GTIA 1PT6A 2GJ9A 3C7AA 3S99A 3SNHA 4OLAA 1NL3A 2O48X 3FSEA 2HC9A 4HAIA 3QI7A 1I5RA 3VMMA 1W7AA 1A4XA 2A3RA 1OI4A 4BVJA 1J7JA 2YW2A 4L51A 4UUNA 1G20A 1PGQA 2EFGA 2ZAOA 2R8BA 2REXB 1MG0A 3FCOA 3G1WA 3DT8A 3HDHA 1ISFA 3NB0A 4Q4AB 5I9MA 5KOIA 2B9VA 4IMIB 5LZ4A 3FBWA 5I9SA 2NAPA 3G2LA 1W581 3I39X 4HJRA 4OMCA 4MUYA 3T7IA 2VHTA 4LDPA 3WNVA 4WACA 1WTAA 3EWNA 3I9V6 2QW0X 1LPAB 3GLHA 1FB5A 2ZE8A 3MB8A 1NQXA 2JFWA 5CYFA 3U6KA 2I9KA 1H4SA 5F9FA 1A76A 4RZ3A 4EHIA 5FRDA 2V58A 1KYWA 4MIYA 4W7IA 5E2AA 4IXNA 3WIOA 4DGSA 4B3BA 3H1FA 4LZZA 4U2BA 2QX9A 4QT4A 2JVKA 5ELMA 2AX4A 3GFQA 3ORYA 5GGYA 4B4OA 2CE2X 3U9LA 3K70C 1DRVA 1NJSA 1KKUA 3OD5A 3ORQA 3ANTA 1EWYA 5KPJA 1YACA 1JQJC 2FSVC 4YDQA 1RRKA 4OD0A 5HF9A 5DCWA 2P8JA 3OBBA 4IXTA 4HFRA 5B1HA 1YBFA 3KQTA 1CE8B 3G2HA 5AHWA 1JTVA 5F51A 1H8HA 4E5MA 5JNTA 1S8AA 4E2WA 3OPMA 2DOKA 4O4JF 1J5EB 3DHEA 3GNTA 3BN3A 1ZVJA 5C3MA 1ZRHA 2NWQA 3GR6A 4FVTA 3N05A 3C45A 2P9FA 3FOBA 2ZVJA 3P9SA 4Q00A 3X2EA 5I7RA 2R8XA 1O95A 3ON5A 3QXSA 1T9KA 1EB8A 3W9BA 5B3LA 3QMVA 1PRYA 3EZYA 4FC6A 3O9VA 4X97A 2JHCA 3CUVA 4PG5A 2CL7X 2OO5C 2ZR7A 1EGVB 3EZNA 3PL1A 2VP6A 5C5DA 1DC4A 4IUCS 5LZ7A 5A02A 1Q1GA 4RE5A 4KWTA 4J3FA 5A6VA 4INAA 2P9BA 4A2CA 4WNYA 5LXTB 3W8DA 1PVDA 1I1OA 1CR4A 2C5LA 1FP6A 1FFAA 5K8VA 3FFBA 2Y6VA 1C8LA 1WSWA 2DJ5A 1KDTA 2OTCA 3CLTD 2AE2A 2AGVA 3CS3A 1Y42X 4RDHA 4W1PA 5H4GA 1ELOA 1IFXA 1MUUA 2H00A 2Y9MB 3O93A 5CDHA 3DLHA 3UJCA 4TMTA 1QB8A 1UDRA 1YR3A 2WJGA 3PA6A 1LTKA 3LO5A 1VMAA 3KQLA 5ECYA 1J20A 4NABA 5DBOA 3ZJ4A 4ADSG 3V80A 1MQ9A 2MOKA 2R1TB 1P9LA 3G88A 1KXZA 2PU7A 5G0VA 4R1SA 2WWVD 1Q7CA 1X6VA 1CUVA 2BFEA 4U7JA 3V8BA 4ZTZB 1QV6A 4NQZA 4PV7A 4Z9BA 3KEOA 2QPLA 5L4NA 3SX4A 2SHKA 2D0OB 4YX9A 4JI0B 2IDZA 2PGDA 3OTGA 3QLUC 1RKXA 5JALA 4DR5B 1SHLA 1VDZA 3GMIA 4DA9A 1DIRA 2JCYA 3D3NA 3CM0A 4MAMA 5T64A 2LDBA 4R54A 4LQLA 4YP0A 5KQMA 2PRSA 4YGXB 3SHQA 4BU0A 1PR3A 3PNMA 4L4ZA 2J09A 2XWPA 1GRQA 4AN4A 2VQFB 2PJRA 4JQYA 2A0YA 3IAM1 3HCDA 3IQDB 1YA6A 2EQBA 3VSBA 3WTBA 4MUIA 3UIEA 2JIZA 3EZLA 3KWJA 1HE5A 2H0RA 3QKSA 1UAGA 9LDBA 1XDBA 3K96A 3ZYCA 2XQGA 4LSWA 2FW1A 1W85B 3A2MA 1T0JB 4N3AA 2I9PA 1TUBA 4KO1S 3NBXX 4LRYA 1KK2A 1OBCA 2D8AA 4HGQA 3E53A 3E9MA 4N0MA 2JPDA 4JCOA 2GNAA 4B4UA 3BX1A 5LZ9A 1CIPA 2BKLA 1E4OA 4R0NA 3ZVLA 1NHGA 5KTYA 5L95A 5LVAA 2H1OA 1GUDA 2C5BA 1S9DA 3I12A 5BQ3A 1LLQA 1UJMA 1F2UA 3N8IA 2D59A 4XYGA 3NHPA 1P6UA 4ZOEA 2OXFA 2BTOA 5YASA 3WGTA 3CR3C 1ZXLA 1E2DA 2C9BA 2YNMC 1YNSA 1YQEA 4BVFA 2H29A 2XVZA 4WKGA 1WMBA 2Q3MA 1K1EA 3AUAA 3L46A 4PFJA 1W87A 2I8AA 4L4UA 1MAWA 221PA 3GJ0A 4V3CA 5BR8B 1X13A 4NZPA 4LBVA 4UZFA 5DGCA 5HXAA 4H08A 4JZYA 4G84A 1P6XA 3EWIA 1M6VB 2EWMA 4GC5A 2D0IA 3AVWA 3R7BA 5FWDA 3VOAA 4HVCA 4EHHA 3BJEA 2VWQA 3I58A 5BYBA 2GF9A 5AJZA 5A9TA 1RI2A 3RRMA 5HKKA 4GMHA 4JB0A 4JASB 4BE9A 4R0MA 1ZH2A 5IF9A 2XA1A 3AT1A 5K3OA 2AWNA 2WQ7A 1QR6A 4B5KA 4KDEA 4HR7A 2PCLA 4XSHA 1JG3A 3S55A 2C78A 3QUCA 4B85A 1E2NA 1SB9A 2X5NA 5JSHA 1ODCA 3KKKA 4YFVA 1GFWA 4N7RA 1FNDA 5M04A 1QQTA 4JR2A 1AC5A 2AOUB 5DTQA 3AW9A 1LD3A 2AFHE 3MYYA 4URZR 4KYUA 3TDMA 1X3SA 3K5HA 3L6BA 5FFFA 5MN6A 1SK9A 3QJYA 3U7HB 5FI0B 3D4NA 1YQTA 4Q9DA 1XDZA 5B1YA 2PM8A 5L40A 1JHMA 5BSTA 4N48A 1HDIA 5ALZA 1H2FA 2IKQA 2P2NA 2A0FA 3TRHA 4G2NA 2GEBA 4B43A 1PQYA 2YHIA 4NFYA 4EO9A 4M0LA 2A7QA 4H1UA 1E1LA 2XTZA 1A8PA 1DFHA 4DB2A 3WRVA 1G6HA 5TJ9A 5EHIA 5K3CA 1IBKB 2AMVA 2ENUA 1JLRA 1BU5A 3A9UA 4ND8A 4YRMA 5M7EA 1FOEB 1XQXA 3V7FA 5JQGB 1G6OA 4IWXA 4PPYA 3T9EA 2QROA 4Q9HA 3V32A 1DUSA 1Z4PX 2YRFA 3OKPA 3VKUA 2VTBA 4EY6A 4ABYA 1CJMA 2W4IA 4QUDA 1VGRA 1LX6A 3U37A 1JR6A 2Y8EA 2AR9A 4EGAA 1GKLA 2XSZA 1JSCA 1U3TA 2AEMA 4U7PB 2A5YB 3Q8MA 2GO1A 3EIOA 2QT9A 1SVMA 1GDTA 4IIEA 1T0HB 4NZZA 4CDRA 3AESA 4YGYA 2GF2A 2HPAA 2PT5A 4TMFA 2PZEA 4XSGA 1WG8A 5TJHA 3WB2A 5I01A 4OHYA 4JLJA 1CF4A 3L05A 4GOXA 3TQRA 3LRTA 1KAGA 3GEGA 1NW3A 4MQLA 5FO1A 3CWZA 1EI9A 3VDQA 1DEXA 4GS5A 3QU2A 3KZKA 1PP4A 3B3FA 3H1TA 3SC6A 2C8KA 1OXVA 2QTAA 3BWYA 1QWSA 3U1BA 1Y8QA 1M5TA 3QLVA 4YUVA 3RVOA 2CNKA 2QAIA 3LS2A 4Y9UA 1DBWA 1MIOA 2EX0A 1ORRA 5ALPA 4TQ9A 1D0VA 2ADFA 5C7OO 1VPWA 4F2WA 2C92A 2Z1MA 4QYMA 2LKCA 4W8GA 5AJVB 3RK1A 3NKVA 1OWLA 3N2ZB 5K8JB 4HAUA 4FXPA 5LIPA 3NUQA 2ZU6A 4UNIA 3RFCA 1E3DA 4KLRA 3QEJA 3IELA 1XZLA 2QUIA 4EYEA 5A7FA 5FWXB 2AT1A 3O21A 5IAJA 3I4LA 2YRWA 4POAA 4HDKA 1L4HA 3Q6MA 3ZWOA 4CM6A 2QD2A 3G2PA 2ZJZA 1RM0A 4BTEA 1H6AA 1NG1A 2QL5A 4I99A 1CT9A 1IEQA 1QG2A 1C9EA 2EJUA 3E2IA 4JB3A 2F2TA 2P79A 5EIAA 3QSYA 2WIDA 3GJ5A 3LC7O 1BXZA 3OTIA 3FYUB 4KWEA 1K9VF 5F3RA 5KEIA 3ZNOA 2G9NA 3F6YA 4MVJI 3WRWA 2DQ4A 2IYUA 4YQZA 1HETA 4QSHA 1ZLYA 1VXOA 3VJKA 1EM8A 1CERA 2PBRA 4DDTA 1Q15A 1R15A 4IFEA 2VPTA 5HJ2A 2H5JA 4OA5A 3L4KA 2GM4A 4QC2A 4J0CA 3LKZA 2ZBPA 3G5UA 2DBQA 3JQBC 2EP8A 1OLUA 3HUEA 1O1YA 1VGQA 3N8NA 3QFSA 4EZBA 3ZIAD 7REQA 2EJVA 6GPBA 2IE8A 4B6OA 3HVKA 5LQNA 2CXQA 4D0SA 1JT2A 3JQAD 4KZKA 2IS4A 1LBSA 1MRSA 3PI7A 5TSDA 1OH6A 1NZJA 4LOIA 3W0LB 3ZDDA 1JPNA 1KXJA 1RVV1 1IZZA 1DBSA 2B61A 2EP7A 2J4DA 5EZQA 4ZCQA 4PRKA 1PFWA 3GDOA 5BSRA 2W2TA 3W5AA 2O2DA 1PK9A 4Q0MA 3WMFA 3N2GA 4QNNA 2R7KA 5F1YA 2HRBA 2P9CA 1U0GA 5CNJA 5B53A 5ESDA 3UW1A 1O5TA 2QRLA 1VBNA 4MQMA 4MWEA 4HPJB 1X1BA 2QRGA 5C8VA 4G89A 1SQFA 3J7AC 2YWRA 1ABEA 3V7YA 4KTTE 1SQ5A 4N49A 4YRQA 4NV3A 1CWUA 2OORA 2GGSA 2OLKA 2W0SA 1UWLA 3FCAA 4LRWA 4QUHA 5DN6A 1G63A 4Z0PA 3IPYA 1AG9A 3KV1A 4Y6QA 1KE1A 4E32A 2XE4A 4DIMA 2VZ9A 4AB1A 2Z0MA 2VYFA 3NC4A 4HYYA 1FU4A 2BGIA 1NUQA 1MBZA 1Y63A 3N1UA 3M6IA 4HDOB 5JNVA 1TD1A 1K6MA 1QGDA 3SWWA 2J7PA 3PD0A 1OXUA 1E63A 2NU7B 4B6PA 3DXYA 4K86A 1US8B 4J91A 1TAHA 5DBEX 5BSFA 3ILSA 2QZZA 4AMUA 3RVSA 2WG1A 1BHJA 5A1TA 4P98A 5CJPA 1LH0A 1MOPA 1RYBA 2O1EA 2D5BA 1VPVA 3L18A 3R75A 4YXFA 1U4OA 2IZ1A 2YY5A 3L6DA 3PX3A 3REOA 2MINA 1E6KA 4UAJA 3LDFA 2WJ4A 1WZ2A 2D1QA 1WX1A 2X0JA 1G20E 4IAOA 2PANA 1IN6A 3C3WA 4TWJA 1I9CA 4JI4B 5JLJA 3D7KA 3JVUA 3M33A 5CFQA 3U1TA 1U81A 3TZCA 4A73A 1B8OA 1DOAA 4CTOA 1SQGA 3KK0A 2BDTA 3L1KA 5DM4A 5JBIA 3OP4A 5BRNA 2NT3A 4LRUA 2A92A 4HDRB 2QT1A 1WB4A 3GLHE 4XXHA 5FL7A 4E2ZA 1S3FA 2YWJA 5I7VA 2OENG 1X7YB 1YS4A 1PWEA 5ER6A 2Z5FA 4MRSA 2O0LA 3EZ7A 5ALKA 3WL8A 4Z4QA 2GCNA 1KO1A 2LP4Y 2NLOA 3P96A 1WRBA 2YJZA 4CCAA 1QFZA 1XZFA 3NQ41 2GMWA 4XQCA 2GZ3A 3GXOA 4YRGA 4OXYA 1M66A 3VJRA 2NAFA 4MVXA 3WYAA 4Q3NA 1ZK4A 3WKDA 3FNQA 4GMDA 2P6RA 4E1BA 2XGSA 4R81A 5JSUA 4M98A 1RRFA 1TYAE 5AM5A 4QZVA 3CVVA 2FOXA 2FFHA 2Q21A 1QHNA 1JDNA 1T10A 2VK8A 1O95C 3RARA 2RGEA 5C8DA 1P2TA 3TGLA 3T1OA 4W7SA 3WWPA 4DCOA 1OB5A 3UMRA 1NN5A 2OOKA 3EEYA 1OSNA 5BV2P 2H18A 3PNQA 2PMDA 3EZFA 2X1MA 3LT4A 3R2JA 4LQ4A 3LOQA 4N3CA 1TM7E 2FUKA 5E6UA 1ZI6A 1CDZA 2W37A 1E6CA 4D4KA 5H9VA 4QXOA 4Q03A 4O2BB 3QFTA 1YJ8A 3EVEA 5L9AA 2DH6A 3OC6A 5MN5A 1F8GA 3ESRA 4K9LA 2WB2A 1QTQA 2CKMA 4WEQA 5LYJA 5AWFC 1UWCA 1EG7A 1BN6A 1LGYA 2GCOA 5FL3A 1NY5A 1RWMA 3G0CA 4MUXA 3EISA 4P2GA 3HCEA 4BZXA 4EPVA 2Q0QA 3KHTA 3I72A 5EMLA 3VHRA 4BGUA 4UUBA 3AJ9A 2R6HA 4FZRA 1EK0A 1W96A 3JW8A 4TTPA 1OT3A 3KJFA 4HH3C 4G8JA 4YACA 2HLNA 1E2HA 2PBFA 3EVZA 3QHAA 1VGVA 2EFYA 3DMNA 4ALMA 3OHPA 1C7RA 3GLUA 2C3UA 1AXEA 4OQLA 4N40A 1J06A 2NQTA 4RABA 1NUUA 1WMDA 3IUEA 2EOAA 3O4FA 4S2UA 1F38A 1ADBA 3G82C 2VSYA 3LSTA 4LE2A 4BVAA 3DM5A 4ZT2A 3W2TA 4AUKA 4X1OA 4ES6A 3RGGA 3CCBA 5HGJA 4LFAB 4AKIA 1NU6A 2WD7A 1KI7A 2HGSA 3DDHA 5ITZA 4HLDA 3OF2A 4KRYA 3BM5A 1NNLA 1O2DA 4O4LA 2VUIB 2WE8A 3DVRX 4J6EA 4QUEA 1JXQA 2OY0A 3MVEA 4N5HX 5CAEA 5DASA 1NP6A 4YJ3A 5FPTA 1T3TA 5LYYA 3M6FA 4TL8A 1LPBB 2X22A 2ZPTX 3Q9LA 3HKDB 1BDBA 1RCFA 3GUYA 4X1KA 2GNPA 3JQFC 2MIIA 3LMKA 1OFVA 3CX7A 3T5MA 4XVCA 3CBGA 3PA8A 3WX0A 1T2UA 1D2RA 2I1LA 4JYBA 1NI5A 4C3UA 4F2HA 2QV7A 1V7QA 2W7TA 2P3QA 4LK3A 4IVRA 3S1SA 3JZFA 4J16A 4B7XA 3A9WA 5K8LA 4TSFD 2HA3A 4KVGA 4QQFA 2IBTA 4WD3A 3H6GA 3BTOA 5FULA 4A8PA 3AFOA 4HTFA 5EIBD 1MVNA 3RQSA 1A96A 1Q21A 5EHNA 4LJKA 3DHNA 3OPVA 1T6NA 1I5EA 1T8WA 4JUDX 1JHYA 1F0KA 2QI9C 4BX8A 1KMQA 1BS2A 3O8OA 2FFBA 5BNWA 3QVGB 1N8SA 3V33A 2PMBA 4MCHA 2IYLD 2XTJA 2OESA 2YOHA 3EZXA 3BSSA 3GJ7A 3MTDA 3SM3A 1WOMA 4M83A 1XJWA 2J6IA 2YH2A 2ZUSA 2CLMB 3HVHA 4ETNA 2ASVA 1XPRA 4D81A 4IVQA 4JI2B 2O0KA 3HB7A 4QHTA 1RKUA 3O8BA 1T36A 5F35A 3S2YA 1PV4A 2Z4TA 2ZBEA 3RVQA 4EJSB 1R4MB 1F3OA 2VYVD 3DBLB 2DUMA 3WHLA 1K6EA 1L3CA 3ZIUA 4S0ZA 4IQGA 1EEHA 3IPRA 4RSRA 4MCJA 4S2EA 5ALNA 3H99A 1ETHA 5KI6A 3VYUB 2E4VA 1XTPA 5BQFA 2WTAA 3GCDA 2MYTA 4WNCA 2XMCA 2EZ4A 5KMGB 1V5IA 1OWOA 1SVNA 4JY7A 1CDOA 1K5PA 4HGZA 5GV8A 3OMXA 4BO6A 2R6FA 1FTSA 4W8OA 1P5RA 1Y9JA 3NHBA 4G36A 5HMMA 2P2ZA 4OHZA 3VGPA 4BUJA 3AEUB 1R6DA 4DJEC 4XYLA 4LX8A 3OPYA 3GA5A 1KAEA 2JHPA 2Q1TA 3G2MA 3PV0A 3HYLA 4H4EA 4IV0A 2YHBA 3N87A 1RQ7A 5L6LB 4P5DA 1HQDA 1ZUD1 2FEXA 1QTRA 2FX2A 4DQLA 2NV6A 1AH2A 5JU6A 3EMKA 1ACMA 2YFYA 1EXNA 3IEKA 3BSWA 3NHZA 5TVGA 1ZGCA 2I2XB 4JC8A 4WXMA 5EINA 4BFCA 4NJMB 1YHNA 2TS1A 3FWYA 4P0QB 5K0EA 2J9YB 1YE5A 1Z34A 1BCSA 1SUWA 2C95A 2QA5A 3D8SA 3SM9A 3BVPA 1Q19A 2W71A 4B6SA 1DG9A 1ONBA 1OWPA 5T41A 1RRCA 1GA6A 1NXVA 1MOSA 3CHYA 2BGUA 2QX4A 2JEOA 4Q4DA 3I9FA 4JUFA 3IEXA 3LPDA 2ZS9A 4XUGB 1M6NA 3UJAA 2UXDB 5JQWA 4Z4EA 3R6LA 3EZGA 4JLKA 5LA6A 1ID8A 3K8OE 4KRXA 1S2NA 5TX7A 421PA 5JZ9A 2GK6A 3N3BC 2ASEA 4QVIA 3EOAI 2NO9A 2RK4A 3CLRC 3TRKA 4ARBA 3QBJA 4XDYA 2EW8A 4PX9A 1QYRA 4R1LA 1BYIA 4MGKR 4AS2A 4BWFB 3SBOA 2VP5A 5CB6A 3DZBA 1U1DA 1UBJS 2EKPA 2C2GA 2HREA 4HX2A 5ECWA 3CF2A 2W11A 2WFLA 4JEUA 4RIHA 4CM8A 1GTZA 1ULAA 4F5EA 2EFCB 3G0IA 4OQPA 3G7NA 4ZYVA 4JVNA 3W4IA 3QKUA 4K9OA 1K4YA 4F4DA 3N9IA 4YAEA 1J25A 1QZ3A 2EEZA 3ETCA 1DC6A 1U3UA 1VPLA 1GLGA 2VEOA 3FPAA 4ON9A 1H2EA 3MCTA 4HDNA 5J4VA 4OMFG 2C8VA 4EF4A 3SKXA 1SCKA 2BP7B 1M2GA 1Q77A 3VSDA 5FDFA 2ZXFA 1TPZA 3ISJA 4EFKA 4LJAA 2VPWA 4H0FA 4UTNA 5TIIA 4PSUA 2WIAA 3BRCA 2D1SA 3KWMA 3MMSA 3PXBA 4B35A 4EL5A 1Z0JA 3FG9A 4FC7A 1HKHA 2GFQA 1RCTE 1YKGA 2BGLA 3D81A 3LBYA 4PYMA 5FA8A 4L3OA 3JAWB 2VKTA 1T3GA 1LUAA 2WNHA 3DYIA 3G2NA 3SQWA 3VSCA 3OESA 4ZO6A 3QLVC 2D2VA 3B6JA 1JKJB 2D1RA 4JLAA 1O4VA 4G0PA 4ZI7B 3J81A 5JANA 2V7PA 1H66A 5AHKA 4RO0A 4DJAA 3ZTWA 2XJ4A 5EHZA 2WAYA 1NQTA 2Y2VA 5FWYB 2FX5A 2P35A 3KXKA 5JSZB 3ED5A 1WD5A 3R7AA 5D01A 1R0KA 3TD6A 1GJRA 5HQ3A 4RJJA 4GMGA 2MSDB 4OM7A 4KH1A 1ODKA 4RHCA 4INPA 1EZZA 2H4JA 3NRJA 4LDQA 4EGFA 4BEVA 3IJPA 1ZBDA 2H7XA 4UM9D 4UJ5A 2H2GA 2GJSA 2BEWB 2JLQA 4C88A 3HP4A 2WK1A 3HLYA 5AW2A 5HP4A 2QPOA 4LHVA 2WF8A 2Z6VA 1JDVA 4Y9SA 4OI4A 4ZVMA 1USKA 1DTWB 1SCNE 2CB9A 2QSYA 3HEMA 4Q3DA 3B85A 2J30A 4OY3A 1UFKA 3OO1A 2RJOA 4QEDA 5EZYA 5K45A 4FFLA 5DTMA 1JMYA 1H2RS 2PMWB 1QG0A 3ER6A 4JNKA 1QO9A 3H2IA 3DOFA 4CVNA 1Z4KA 3PQEA 4B1FA 3ZPXA 1NXSA 1WHTA 2PUVA 2WWIA 3IBSA 1KAHA 1W4ZA 3CV3A 1IQ0A 3FF1A 5DNYB 2X40A 4DY6A 4UNQA 5CLLA 4H6PA 2JI9A 1DO0A 2QP3A 3GROA 2LE0A 3HVJA 4OJNA 4RU1A 4CMCA 1ZM9A 2PZFA 3TS1A 3PC8A 1GVHA 2D06A 3BMNB 4A9AA 4IGAA 3WDMA 4EYOA 2H3EA 1UXGA 4YYEA 4JSTA 3WC4A 3KL4A 3DZGA 5AK3A 3VR6D 1DCTA 4OX9Y 4I9HA 1FZTA 1FW8A 3ZV5A 1FDVA 5B4VA 3WLEA 1SOMA 5ESXA 4RFSB 1V8BA 1Y98A 1F6WA 1P2GA 2LCQA 4TS3A 4QQ8A 1TZCA 3C6XA 4I81A 2OORC 5E7MA 3KXLA 2N46A 3ZI7A 3RR2A 4EA8A 7MDHA 2F1RA 3H16A 4HNRA 3U5TA 3H11B 1PLKA 3PC2A 4R1UA 3TBKA 5I7UA 2C2XA 4KFUA 2IGBA 3KP1A 1OIXA 1P2DA 1VFNA 3C7KA 1B0ZA 2DLDA 2OR3A 2YWFA 4K6MA 1M6WA 1QHXA 1K97A 1BCRA 2IY8A 3NLLA 4MHOA 4TL6A 4A5OA 1NUTA 4MYDA 4UMDA 4LCEA 3N0XA 1Z7BA 4LHZA 4EBFA 1TOAA 3SVLA 2QNIA 2WJIA 2XD4A 2ECQA 1W2GA 1GDHA 1NX6A 2NO5A 1JEQA 2JGIA 3IE2A 3RREA 4NPHA 1RJEA 3TKYA 1QHHB 4CEJB 4CXMA 2WAAA 4LHYA 4KOEC 4EY5A 1L5SA 1F7UA 3JARB 2IOFK 1DAGA 1QCDA 3AP3A 4PGFA 1NV9A 4FCWA 1CRWG 1YZUA 2VTKA 4OQQA 1ESCA 1L5QA 4BCDA 4OLBA 1TFUA 2C96A 3R9WA 1XZ8A 1VHTA 1F0YA 1Z7WA 2XCIA 2DXIA 4Y0VA 3TYXA 3ELUA 2ZDQA 1H2ZA 4GX5A 3VC1A 3LC2O 4EHLA 4YJ2B 2C1ZA 4EYKA 5A4AA 1M2KA 1HTWA 1MZVA 2EHDA 1OXBB 3DEFA 4EG8A 2V5VA 1TA9A 1OTYA 5FTKA 3SYKA 1A1VA 1Z6AA 3DAGA 2I76A 2ZJ6A 3FNBA 3JQ8B 2VJKA 4EH1A 3N86A 2NZUG 1WXWA 4EP1A 2DYKA 2W5UA 3IOMA 1BDJA 1TZMA 1XCBA 1SVLA 1UCFA 4ZVRA 5FNVA 3B7WA 3AFIA 3ZGVA 3G1UA 5C4GB 3EOZA 4RQUA 5CTJA 2GJ8A 3G9ZA 3MYRA 3ENKA 1KH2A 1XFAA 5DNUA 4WBNB 2ID8A 3SQXA 1K8RA 1ZISA 5L4LA 1KO5A 3BKXA 4TUYB 5AI5A 3AVVA 2NPIA 1CQIB 1H8HD 1VIAA 1EDDA 1WLSA 4PZUA 4ZAXA 2BR4A 3MJEA 4M7RA 3V8QA 1GGMA 4K6KA 3NHKA 5I9LA 1V5GA 4Y2QA 2O8BB 4EM6A 4KR0A 1RABA 1BKSB 4V03A 1I7NA 4J0QA 2R44A 2WSSA 3GCWA 3I2HA 5DMXA 3R9XB 1N2IA 1O95D 2HDOA 5K05A 3K71B 3U2QA 2VBFA 2DBVO 1K3TA 3K05A 4GGPA 3OQVA 4IS2A 1TVKB 2HBRA 4QQRA 4S1VA 1IXSB 5I5GA 1GUFA 5I7OA 4Q3KA 1CLUA 5AVWA 1NI3A 2PMEA 1E2EA 3UK7A 3ROTA 1DU4A 1LPOA 1I30A 1MP0A 3JWIA 3RANA 1IN8A 4Q1VA 3VXKA 1S1MA 5IYZA 1I14A 3IUPA 1O5OA 3NIDB 1HG1A 2V4ZA 1ZQ1A 4R2JA 1NRIA 2NUPB 1SOUA 4LC9A 3D1VA 3BGIA 4WVFA 1GA1A 2A0UA 1UC5B 1DV1A 2VEDA 2WU4A 2YWGA 1MIHA 2P6PA 5F21A 3L6RA 4KMOA 4EMTA 4C7MA 3NM4A 5K4HA 2JAQA 3ZWAA 3AI7A 4RV5A 1BW9B 2OC9A 3I28A 4M76B 4QOJA 3FCCA 2EFHB 5LMZA 2VF2A 4TRMA 3C3KA 3NXKA 4KBFA 1U0LA 4ZDKA 4XGNA 1OZFA 3IKJA 1FS6A 4EEKA 1IB0A 1UK9A 2NUTA 4L8VA 2QZJA 1YGYA 3U13A 1UBOS 2HNKA 3C5EA 1A9QA 3L7KA 2IC5A 3FYDA 3OSUA 6LDHA 3F0TA 9ATCA 2PAAA 1CNEA 1LB1B 2JA1A 2O05A 3NHMA 1QTIA 1OLSA 2H4XA 4MJ3A 2Y1LA 1MRZA 2Q5QA 3R6WA 3U4MA 1K5HA 4RTJA 5F5LA 4QLOA 1Z3CA 2G36A 3QRWA 3I9V1 4IHQA 3AOEC 3OQNA 2VHUA 1X7ZA 1LWNA 4K8RB 3VRHA 2O8EA 4MTLA 2FH5B 3CZMA 1RWNA 2P90A 4TYQA 1X3LA 1X39A 3QBDA 4YRNA 5KO2A 1G8FA 3AKEA 1RE0A 3VR5A 1WCXA 3EDOA 3WIEA 2SECE 1P2SA 3P2YA 3HHEA 4RKQA 3LA6A 2O3UA 3KT0A 4XRRA 2CT8A 3QE0A 4DBZA 2JIZD 1V1MA 3KSMA 3ZKWA 1LNZA 1MV5A 2AF4C 4J16C 4B17A 4REQA 3FNRA 4HN2A 4R3NA 5EMKA 1TK3A 2E21A 2VT3A 4B8WA 1WY5A 1QQ6A 4PY2A 4K9DA 5COAA 3ECSA 3H1EA 3L0IB 4JT2A 4TVBA 3CH4B 3MEQA 1E4YA 2SCUA 3VFDA 4R3UC 4B75A 3A4LA 2XKKA 1E9RA 2Z4SA 1P2FA 3EW9A 2CFRA 1CYDA 3NWJA 5AI0A 3B12A 3MT9A 1HFJA 4K7JA 4DSUA 2Y93A 1HNWB 2C5FA 2ISSD 4TRJA 5COQA 4GWGA 5TQ2A 2UUCB 4EARA 3ELWA 2WT9A 1XNHA 1KSHA 1BN7A 3EC2A 5HE9A 5CFZA 2BONA 2VOEA 3PFNA 2WTMA 4MIEA 3GLKA 2NUAB 1ARZA 1B73A 3KFVA 1CUJA 5IP5A 4HQFA 6CHYA 1IN5A 4DB4A 3OWHA 2EGHA 4NZNA 1EJBA 2G67A 3CWCA 4BLQA 3KEFA 1G5RA 1OAAA 3HCFA 1IOLA 3MQFA 1QJCA 1WCIA 2VDNB 1YKSA 3IUBA 1S96A 1I4LD 4JHXA 4KRGA 3O74A 2DBZA 4YMIA 4D82A 3A6JA 3JRWA 5AHRA 1W5BA 3O91A 1LPMA 2B4RO 3IR6A 5FT9A 5BRJA 3HYSA 4FGUA 3IODA 1C1DB 4FJ0A 3IV9A 3O1LA 1NLMA 3ILVA 3KQWA 2A14A 4RIEA 2C9YA 1T0IA 3T9BA 3U7JA 4ECEA 2Q9BA 3TTYA 3K5IA 1KJWA 3UGQA 1SM4A 2OZLB 1FQJA 1TJYA 2J3IA 3RSHA 4F92B 1JHQA 1CUSA 4FN5A 1BRMA 3IEPA 3AWDA 4BRZA 4CQMD 1HDZA 4M1SA 5CU7A 5CLGA 2N75A 3AF0A 2B34A 3PUZA 2RK6A 4G41A 3DUFB 1AKWA 3C6MA 1QQ7A 2I62A 2EXXA 4KMRA 1A95A 4D3DA 3EODA 3B5EA 2HH9A 1MORA 3GFOA 4ZHQF 1A50B 5ICEA 2YVQA 4LV8B 1TIBA 3MINB 1J0AA 1C4XA 3SBEA 2D5CA 3E3LA 2EX4A 3P52A 1VCOA 4KXNA 2FMXA 2HPZA 4F1JA 1HT2E 4F1WA 3L8CA 2F1HA 2YUIA 3LDHA 4Q66C 4XUEA 3S7TA 2XWBF 1XP8A 1FPQA 1H2BA 1J0EA 3DYBA 3F5QA 3GMTA 2FW9A 2XITA 5FPSA 2Y2UA 4O4IB 4P3YA 1N8NA 1WCV1 2QDXA 5J59A 3NEYA 5FOSA 4UCWA 1RXUA 1KO8A 4JYMA 3IA7A 1NTRA 1XMOB 1HOTA 1GKUB 3RYHA 4DUGA 2RGBA 1RP1A 4J43A 3EF1A 4HCJA 4LN1A 1L1EA 4NAHA 3ZW7A 2EFEB 4H3KB 4HUTA 3OE7A 1SU8A 3P2IA 4X3CA 5KVQA 2IS1A 3MC1A 5BVGB 1Q92A 1GSHA 4IRXA 1FUKA 2IIPA 1KOFA 4AF6A 1JF8A 2XSZD 3O0DA 1ZNWA 3CF4G 1NJ1A 1L1QA 4Z6KA 1BWSA 5JATA 1DGQA 4WLUA 4B4WA 2CFCA 3PLNA 1KS2A 1RLUA 2BI7A 4Q4JA 1RD4A 3V1NA 1HSOA 3MIZA 4WMLA 3PC3A 3IBCA 5C3UA 1OGJA 3KBOA 4MI1A 1N6OA 3ZBTA 3GFTA 2BC9A 4TV8F 1T24A 4MKZA 5G0TA 2BM1A 3AJAA 3EVGA 5TS3A 2H1VA 1FQOA 1QKIA 4DYDA 2NVUA 1ZA1A 3DEJA 1K8QA 3NETA 1LDMA 1U1GA 1XWWA 3OJWA 1NLYA 4DR7B 2C2OA 3C1TA 2EWWA 4M6WA 1QX4A 2H51A 4X1YB 5A7GA 3TGWA 4WLNA 4RLFA 2FEWB 3CURA 1C9NA 4IDAA 1X80B 3LBIA 4BMPB 2VCHA 4QTUB 1KYTA 2B3DA 3HO6A 3DS8A 3B1VA 4AZ3A 3GX1A 2PTGA 5HOEA 3TZ6A 2PVSA 3T9FA 5GVSA 2ZT5A 5LB2A 3OAAD 4ZVOA 4TX1A 4ZQFA 3OJOA 4YRBA 4BCCA 3WMGA 1JE1A 1NJ2A 4TOIA 5L51A 3DQZA 3L4EA 4ID3A 5IKXA 1RQXA 3BK2A 3ITKA 3NMUF 1E1QA 1LJ8A 2VHQA 1CY6A 5JLAA 4ZGWA 1J0DA 5TQJA 4YQYA 2LRHA 2VA9A 4U7WA 3K8QA 4GPAA 3PR3A 3LLUA 4TM7A 2I91A 5HG0A 3CKMA 1NJ6A 1MRNA 4JOBA 1Z0AA 3B6KA 3DMHA 4ZDWA 3RIYA 1XAGA 4ROSA 4DR4B 1AZTA 1ZRMA 2EJCA 4J7UA 4WOBA 1S4MA 2O9JA 3AV0B 4TKUA 3QIAA 4DYHA 1RC0A 3VQTA 4G1VA 1BQEA 2C0QA 5GMOA 4M3NA 3SDBA 5C7LO 1T1RA 3COSA 1QRSA 5THQA 3HFRA 1J2RA 1P2VA 4LNUA 2I65A 4KQ6A 1QIFA 4IINA 4RKFA 2NYRA 5DNVA 1F0PA 2OXIA 4IQ0A 2CVPA 2IV2X 1G59A 4KACA 2E82A 4O59O 3WL3A 5BYAA 1IMOA 3Q0IA 1PJLA 1STOA 1XMJA 2KI5A 3PQ2A 2HY7A 4PYJA 1KARA 2ZZNA 3HGQA 3A4NA 3PC8C 4G0QA 4DAOA 3GYBA 5T8KA 2HJSA 3WRYC 3ZCXA 2PS1A 3DV0A 2VJPA 2MSLA 2PR2A 1Q3HA 3VR3A 3DH0A 1OBOA 1P7VA 4JBGA 3KB8A 1PV2A 5KNLA 2GTPA 1NBMA 4X64B 2IKSA 2XR1A 3TINA 1ORIA 4FTWA 4G25A 4BBPA 4IEIA 4B79A 3JATA 5GJCA 3ZWCA 5DN6D 2CWDA 1OR8A 4ZO4A 3RRBA 4JKOA 3COWA 3QELB 1NATA 3PZBA 4Y1GA 2A9QA 2ZUDA 4RW0A 4JI8B 2OQ2A 9ABPA 2OCAA 4OGLA 4JEMA 3QKWA 5AVQA 5JXJA 1HT3A 5AKZA 1R0SA 3T3MB 1H42A 3UFBA 2GWHA 1XEFA 1U1IA 5EQFA 5D5HA 2J7PD 5DBHX 2RIRA 4W9RA 1WXHA 2POCA 5DSXA 4I1IA 3TTSA