1V2HE

Crystal structure of human pnp complexed with guanine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
288
structure length
288
Chain Sequence
ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Crystal structure of human PNP complexed with guanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1v2hE00
3UAWA 4GKAA 1PK7A 5CCEA 1C3XA 1JE0A 3ONVA 1PR1A 1Z34A 4QATA 1TD1A 4BMYA 5F77A 4D8VA 1OVGA 4D8YA 3OF3A 2OC4A 3OCCA 3O6VA 3PHCA 4GLJA 1FXUA 1I80A 2XRFA 4OY3A 5C80A 1OTYA 1V2HE 1PR6A 5F7JA 3EUEA 4LNHA 1VHWA 1Z5NA 4R2WA 3E9RA 1M73E 2H8GA 5F78A 5CYGA 4E1VA 2HN9A 2QTTA 3NBQA 3UT6A 4G89A 3OPVA 1VFNA 4RJ2A 1JDSA 3GGSA 3U40A 4DA8A 1Y6RA 3C74A 1G2OA 2IQ5A 4F3KA 1PF7E 1JE1A 1ULBA 3UAXA 1U1GA 1Z38A 5F76A 4L5YA 3IOMA 2HRDA 3LGSA 1PK9A 4F2PA 1ULAA 3OZEA 1Y1TA 1YRYE 2A0WA 1QE5A 4OGLA 3P0EA 4DANA 2GUWA 1YBFA 4TXMA 3K8QA 4D9HA 1LX7A 4JWTA 3NM6B 3T94A 3OOEA 1JP7A 3DP9A 3FUCA 4NS1A 3DJFA 1YQQA 1RXSA 3ODGA 1JDZA 4OF4A 1ZL2A 5F73A 3OOHA 3BSFA 4L5CA 5F7XA 1CG6A 4LDNA 4BN0A 4WKBA 2A0XA 3KVYA 1RXCA 4TXJA 4UC0A 1RYZA 3NM4A 1U1CA 4TS3A 2A8YA 2OC9A 3E9ZA 4I2VA 4D8XA 1Y1QA 1U1DA 1T0UA 1V3QE 1PW7A 5K1ZA 1LVUA 1OU4A 2QSUA 2QDKA 1ODIA 4D98A 5B7GA 4GMHA 3KVRA 4PNPA 3BL6A 4G8JA 4BMZA 4DABA 2OXFA 1SD1A 1RXUA 1OUMA 3QPBA 1N3IA 3NM5A 3OZCA 4YO8A 3UAZA 3GB9A 1PR5A 3OZBA 1PR2A 4MARA 3FNQA 5FAKA 4YNBA 3BGSA 1JDTA 5IFKA 4EB8A 3E0QA 5B7NA 1ODLA 4M7WA 1VMKA 1Z33A 1TCUA 2AI1A 1V48A 4FFSA 5CXQA 2P4SA 4WKPA 1T8RA 1ODJA 1VHJA 5B7PA 1TCVA 4H1TA 4QAQA 1K9SA 3F8WA 1XE3A 4QASA 1A9OA 1T8YA 3KUKA 2Q7OE 1JDVA 4LZWA 1JDUA 2BSXA 4KN5A 1B8OA 1PR4A 1Z39A 4L5AA 2ON6A 4QEZA 4QFBA 4L0MA 3MB8A 1Q1GA 1RCTE 1Z5PA 1CB0A 4WKOA 1WTAA 5EUBA 2B94A 4NSNA 3FOWA 3UAVA 3MMSA 1RFGE 5EPUA 4DAOA 4DAEA 3DF9A 2AI2A 3PNPA 1PKEA 3TL6A 1YQUA 3EEIA 4TYMA 4JOSA 1U1FA 1ODKA 4WKCA 4M3NA 5ETJA 3KHSA 2HSWA 1SD2A 4LKRA 5F7OA 1OTXA 3DDOA 3LBAA 3INYA 1Y1SA 1RR6A 4TTAA 3KU4A 2RJ3A 1A9SA 3IEXA 3FWPA 5B7QA 1V45E 4MCIA 4YJKA 1RSZA 2PGAA 4LNAA 1T8WA 3FAZA 5JPCA 2A0YA 2AC7A 4X24A 1NW4A 1PR0A 1ECPA 5CYFA 1NC1A 5IU6A 2ISCA 2I8AA 1Z5OA 4TXHA 4GLFA 4F3CA 1Y6QA 4TS9A 3PNSA 4DARA 2OECA 3D1VA 3ENZA 5KB3A 1A9QA 4TTJA 4TTIA 3FB1A 1YR3A 2QPLA 1Z36A 3DPSA 5F7ZA 4YMLA 4WKNA 1V41E 1K27A 1RXYA 4OJTA 4U2KA 1Z37A 4MCHA 4ECEA 3KVVA 1Y1RA 4PR3A 1K3FA 2AI3A 3EUFA 1V4NA 1JYSA 1OV6A 4DA7A 4DA0A 4QARA 1NC3A 4L6IA 4BMXA 1TGYA 4TXNA 3UAYA 4F2WA 5CCDA 1A9RA 3OZDA 5EFOA 1PBNA 1A69A 1SQ6A 2I4TA 1JPVA 1T8SA 4NY1A 4OGKA 3LA8A 4P54A 4R31A 5I3CA 1ZOSA 4R2XA 4DA6A 4EARA 1LV8A 1Z35A 4F1WA 1B8NA 1A9PA 3K8OE 4TXLA 2QTGA 1TGVA 4IP0A 5CXSA 1PWYE 3SCZA 3P0FA 1U1EA 4OEHA 4K6OA 5DK6A 1SJ9A 4G41A 1RT9A 4M1EA 3EMVA 1A9TA 2HWUA 3PHBE 3O4VA 3BJEA 4JP5A
chains in the Genus database with same CATH superfamily
4UU1A 4BLSA 2WUVA 3A0RB 3SZUA 4C4YA 5KQLA 2V59A 1FPMA 3DDUA 3FNRA 4MZDA 1ZCBA 2IU4A 1M6YA 1GTZA 1MO3A 3D2BA 3R3YA 1NLYA 4JLVA 5T67A 5AVXA 5GOZA 4INOA 2C3MA 2RHCA 3ZWYA 4JBWA 1PIWA 4CV2A 5I7WA 2C92A 4EUSA 1W44A 4ZDIA 2RH4A 1Z8NA 3C8UA 2W6CX 2CK3A 3UJCA 2ZQZA 2ZSUA 4RTKA 4MWGA 1C0KA 2QM3A 3SPXA 2A78A 1FCJA 2X4IA 3EXIB 4N0DA 3SYNA 3HBFA 3DD1A 3VV2A 4BJ5A 4EBBA 4N82A 4QDZA 5EIWA 3PHCA 5BV0A 3ZH2A 4LZLA 4RK4A 4RKFA 1LU9A 2EJCA 2Q21A 3A9SA 1R9JA 2RGBA 1X7WB 3VR4A 2E9SA 4B3IA 1WMEA 4B79A 5AJXA 1NUHA 3OLYA 4HEA6 4JUAA 1E1LA 2IX3A 3NHJA 4AS3A 5L3QB 2ZZNA 2VRCD 1D4OA 4WEQA 3O9ZA 4DM4A 2E85A 2F9LA 1FNBA 4XCXA 4RLHA 5IANA 4G4IA 1W0CA 2Q4EA 4HXEB 3N28A 2PRJA 3T1NA 2HN9A 4QQKA 2V7UA 4WCVA 1ZH2A 1KVUA 5CUQA 2NV6A 1H4SA 2I9PA 4JNCA 3TRHA 1E20A 4AG3A 2O20A 1TQHA 3KJEA 1OWMA 3RSHA 1GU0A 4TT8A 1FYXA 4R9SA 3ZE8A 4QELA 3DHYA 4TQGA 2WKQA 1U0GA 3ROGA 5J2UF 4N3CA 2WG0A 3WNVA 2Y2UA 3DV0B 1L4MA 1VE1A 3BWXA 4MK4A 4MHSA 3R7SA 3P2EA 4F71A 4D0SA 1PQUA 3TM4A 4YLEA 2QRVA 1VYHA 2DWCA 2FFBA 3HR8A 3EZ6A 1MDFA 5IW8A 2G9NA 1YA4A 5FO0A 2VSNA 2YWEA 2QMUA 2NSLA 4ARAA 3AESB 2NP6A 2MSKA 3E48A 4KKVA 4WLUA 3UMVA 3CBGA 2CJYA 1KQ3A 2PMFA 3A4LA 3OOJA 1XWIA 3IOMA 3RYTC 4XWAA 3H84A 3L0CA 3IEPA 4DIMA 1OFUX 1PHRA 4YK7A 1R8QA 5BN3A 1PJSA 1PK9A 3GAZA 2W22A 2ZWPA 1GCGA 1DCTA 1Z5UA 4YJHB 4B4OA 1NVTA 3BVPA 1QE5A 3ONWA 1V35A 4LZAA 4OGLA 3VBEA 3W8FA 4RTQA 4L28A 5IK2D 1P1RA 3I61A 2PUGA 3NIWA 4XB6B 1UDWA 3ZQ4A 1QHSA 4UKDA 2RKOA 1SB8A 4LQCA 3AIMA 3I53A 4ZT6A 1E7SA 3HDTA 3OTOB 2SICE 3SE0A 1Y8AA 3C97A 3NM6B 3U80A 1JKJB 1VB5A 4K9QA 1ZLXA 3KC2A 4LYGA 3SSOA 4BKQA 1T36B 3LLMA 3L7OA 5AIBA 5K4HA 4EKEA 3MCUA 2OHGA 5FPQA 3RAFC 1S3SA 5F9MA 1TC2A 2IHTA 2X0FA 1EFKA 4OHRA 1GG5A 3H13A 1KAQA 3KSUA 2Q4TA 2CNWA 3IP9A 1OAKA 1TLLA 2GDZA 2QRKA 4WNIA 1MVNA 3BRWA 3DE3X 4J2HA 1GEEA 4UEJA 3LKZA 2DE0X 3QX9A 3CB4A 1Q0LA 3CZAA 3GEBA 4GW3A 4CLXA 3PEWA 2L18A 1HE4A 1FUIA 3IJRA 4YGXB 3SU8A 4ECAA 1O77A 4II3A 1Z7YA 1ZHHA 5JYBA 4RZ3A 1ADYA 3NBUA 2G67A 1EVIA 5ERYA 2VC2B 5CFPA 1V8OA 1NL3A 5D3QA 4W9MC 3DCJA 3IBFA 1YRWA 3KKOA 1DKQA 2ZTLA 4RA9B 3BH0A 3WFIA 5G0WA 2NTEA 2Y1DA 3AF0A 2B1JA 2GFQA 3JQCA 4L9WA 2WSYB 1GQYA 4JEMA 4PO8A 4UAGA 4UD2A 3R7WB 3TSCA 4KQWA 1OV4A 1WXGA 3SSNA 4Q15A 2P4EA 3P9YA 4I4TB 4YWHA 1GZVA 1S7GA 3DT6A 3JQAA 4Y7CA 1IH8A 2HA2A 4JLJA 4P58A 2O7SA 5BVHB 2FUCA 2B8TA 3TBFA 3BAFA 1IXKA 3PXDA 1J24A 3KP1A 1L8OA 3PVSA 4HLQB 1ZVQA 3MINB 5L95A 2PUTA 3FRHA 2FPRA 2B2CA 1R4ZA 1IY2A 4Y8VA 4OFBA 5J1TB 2FLWA 4AIIA 2AE2A 1VBMA 1JAZA 1LFAA 3EXFB 3RC1A 2JLVA 2I91A 3FROA 3ONDA 3CBQA 4F84A 2GESA 2GDJA 5CB4A 2PWPA 4HXYA 5FORA 4DCCA 4EKDA 2VI5A 2EJUA 2BR4A 2GHRA 2IZ7A 3R2JA 4GPEA 4U0KA 2C0PA 4KIFA 1NVXQ 1XZFA 2Q5CA 1ECJA 1RC1A 4C03A 5KWJA 3L0ZA 1K0FA 2IYXA 3CZ4A 4H17A 3UCXA 4UTNA 5CA1A 5EHXA 1E5DA 3LFUA 5JWRA 1NVGA 1TL7C 3MSXA 5IZCC 4QQFA 4XDHA 1SCUB 1WXEA 2J0SA 5HJEA 3HO6A 4YP7A 1OH5A 4N76A 4Q3LA 4W7HA 1GTG1 4I81A 2WC1A 3QEJA 4Z7QB 2BKXA 4OBBA 1P5FA 4W82A 1OAOC 2RIRA 3SYMA 4O8CA 3VDXA 2AE1A 3WG9A 2KHZA 2XSZD 4FYPA 4WDQA 1D6MA 1I3MA 1EJBA 4R7TA 4W1SA 4WPGA 4XARA 4DKXA 1BROA 4KJXA 1R6DA 2BGJA 2V03A 4D97A 5GV8A 3B38A 3ZZUA 4J16C 2CL5A 2EG9A 1IK6A 2WIBA 2EFHB 5JO9A 2BHTA 2OGWA 4YUWA 2GKOA 3OIWA 4E2FA 4BQPA 3NOOA 4LIPD 1QONA 5KNCH 1MKYA 4KNWA 2G5CA 3CLTC 1BH6A 3OJEA 4PLTA 3DFMA 1UEXC 2XUHA 4RCYA 3SJCA 3ITNA 5B55A 3RC8A 1DAPA 3IUYA 2J30A 5A4FS 3JQFC 4AUNA 2XV1A 4QSHA 1H1LB 1FSGA 4XVRA 4EHKA 3T3PB 3K8YA 3FYUC 4WFIA 1RC0A 3SEFA 3L4JA 2UZAA 1JRLA 3UK2A 2G4LA 2I99A 3OWOA 1P31A 4C6TA 4AMVA 3X1WA 4ZVOA 4DCTA 3WSWA 1FYFA 1EDBA 3V8MA 1DOZA 4K6CA 1RJEA 1UBUS 1C3VA 2HBRA 3I4FA 1YQXA 1ANKA 2QZ9A 2ZI3A 3OIDA 1PWXA 3GZNA 3IPAA 4Q7EA 4ZQHA 4ZOQI 5KC8A 5A9TA 1SQFA 5JZSA 1U2DC 5LQKA 2PZKA 5HOEA 3AZOA 2UZ1A 3PVZA 5THXA 3THYA 1S1CA 3WJ2A 4BMPB 3YASA 1M1YE 2WE8A 3N8DA 4MUBA 3UJHA 3CNOA 2LD4A 5EJAA 1MRSA 2HL6A 2A30A 2PKCA 4PWZA 1NM5C 1V5WA 4J1QA 4CTOA 2VP6A 4JDPA 1HC7A 1K5PA 4YDSA 4YALA 5JANA 2X1MA 1P5HA 4FYYA 3IXLA 2PS3A 4RD3A 4RPGA 5IP5A 4B6PA 4ZMBA 5BV1A 2RHJA 2R8BA 1U3CA 1EH5A 2QKYA 1US8A 4L6AA 4NP6A 4BJ3A 2WTBA 1T6YA 3S1SA 4ESEA 1EIWA 3SGLA 1CIPA 4EHLA 2B1GA 3IIEA 1L5HA 1LWNA 1JQAA 4MEJA 4HGNA 4MW9A 3WR5A 3ZD7A 1M66A 2J45A 6PFKA 2ATVA 1O97D 4H6WA 1B15A 3H9BA 2XUPA 3ZOZA 5ER6A 5AVUA 1T9CA 4NS4A 1UBLS 3PPVA 5ALEA 2WWGA 3AKZA 2W83A 4D0GA 2P2YA 1P9OA 2HT6A 3C6ZA 3HCNA 1SHTX 2JFHA 5EKSA 4PLYA 4GD3Q 2BONA 4MULA 1GGJA 5CFMA 2NP7A 5TQ0B 2W6NA 2A1UB 2BOVA 1P33A 1KJWA 4OQLA 3DWGA 5EXEA 3I9NA 3SSMA 3KR1A 5T64A 4JB3A 2D54A 3TLZA 1FNMA 4MUKA 3WMXA 4B34A 3KEMA 1JEQB 1IHPA 2BGKA 3P27A 4C89A 1UBTS 1K0UA 1WTAA 3FDFA 3WLPA 2B92A 2AZXA 1HYEA 2FEKA 4B7CA 2I67A 2EYQA 2IVZA 3DDSA 3GDHA 5HK9A 1U63A 2W6ID 3PA8A 3WDKA 4B43A 2ONJA 1A7JA 1A8HA 2FPLA 2J9XB 2R8YA 1QWOA 1XZ8A 3PZRA 1JI3A 4NYMQ 2BP7A 1SC1A 5DN9A 2FUG1 5LMCA 3PD1A 1YSCA 2Z30A 1S5PA 2JGIA 1AGNA 4YYZA 1VRVA 3ZVRA 1DQRA 1DQYA 1G5PA 4Q4LA 1YFZA 5AW2A 5JS6A 2H29A 3EW7A 2WW8A 4WY2A 1NBMA 5AKJA 4NNPA 1UXHA 3AG5A 4J1NA 3GRVA 4JQCA 4J4TA 4KUHA 4BE7B 3PJRA 3LCJA 4WESA 4BFZA 1F4LA 1T9GR 2IITA 2OAEA 2WU3A 2PGDA 4AZ0B 1MTOA 3N3AC 4CQMB 1ZCAA 4I1OA 4BV2A 4D9KA 1P80A 1KI6A 4HZIA 4C6HA 4OQQA 4PSAA 5AW3A 4PYQA 1XF1A 1EHYA 1R15A 4HRYA 5TARA 1T1GA 2IDZA 1LPSA 5JFTA 2PUEA 1JJ7A 2FEWB 1DVRA 3Q98A 4K9NA 4HXGA 3ZUPA 5DASA 4B82A 1D0VA 4E94A 4OP1A 4CEIB 3M2PA 3RS4A 3ZQKA 1QB8A 1LVHA 3ORFA 2IP1A 2X9GA 3AB3A 2AJDA 4HQ0A 3V80A 4H7FA 2O5EA 3MXTA 1S0UA 1POWA 5G02A 1GLVA 4YP6A 4R2JA 1DHRA 1X6VA 4PC2A 2BPOA 5CM8B 2B3TA 2CHEA 4JT9A 4L4ZA 1NPDA 1E61A 2OENG 1RM5A 3N7TA 4MCIA 3M6LA 3RBVA 1R9NA 3DHEA 4M21A 2BH2A 3BFXA 1RDFA 3DZDA 2AZDA 2ZYHA 4PCUA 1M0TA 2BMVA 3FE2A 3MUFA 2A0YA 5ADWA 1Z2OX 2AMFA 2I7XA 2GCOB 4H08A 4DLTA 2C7QA 5F52A 1G2QA 3A4TA 1I14A 3K0CC 2IF2A 1MCZA 2FUEA 3HKDA 1R0SA 4TL9A 2V9CA 3UW3A 1VG1A 5I4KA 3T4XA 3A6ZA 1BHO1 3MT7A 4L27A 2W2LA 4B80A 4LWOA 4C7XA 4F3CA 4WJLA 1JLMA 2IDKA 2CDNA 4E3ZA 5C8YF 3D3NA 2ZXUA 4LRUA 2EKLA 1DKNA 3IE1A 3BXFA 2IZ6A 2O2JA 3NVKI 1M7HA 5LM3A 1IOWA 4AJ1A 2OCDA 2PGXA 2G0AA 3E23A 2QQEA 3I32A 3S1AA 3UK0A 3VR6D 3VU9A 2D1SA 1UK9A 1JG4A 2NUTA 3ZJ4A 4D9JA 4JI0B 4TV8F 2HK7A 1N6HA 4QTTB 5WRFA 4KOEC 1KOFA 1NF3A 2ZRJA 3K71B 1EX7A 4D2IA 2ZE7A 4IZIA 1SPBS 2BSAA 3HRIA 5EE9A 3K70D 3KL4A 3UMMA 5LL6P 4TTVA 5DWVA 2VJMA 1Q20A 3EC7A 2GM3A 3I12A 5B4VA 4FYVA 3FIJA 1Z29A 4HZUB 2ZJ6A 2YV5A 1JHMA 3PQ7A 1QG4A 1MFZA 1RIIA 3T5AA 2ADFA 4EFNA 4U2KA 4U9IS 3I2HA 1SVWA 3QFTA 4OXYA 1HSOA 4MSUA 2VXBA 1JYEA 4LXTA 2EX0A 4M1ZA 5ERGB 2JGJA 5HMMA 3IIMA 3UJPA 5IRCD 1WUKS 2JGDA 1LB1B 5T8KC 2BUAA 3BMNB 4XI9A 2CFIA 1YR8A 4GSYA 1N2ZA 1V3UA 2F7SA 4HYQA 4X1YA 1TU4A 4B3BA 3T9CA 2Q9AA 1WABA 2JIDA 3L84A 5KNBA 2QIPA 5EXSA 3U4GA 5ICSA 4DDWA 2PXHA 3OM1A 3QKRA 3OKAA 3IDOA 3ZG6A 4UNNA 4FT4A 4J1TC 3LDUA 3DZJA 4RZIA 4MPTA 4X8MA 3RC7A 3REQA 2F64A 4P0QB 3EGOA 4WVFA 3P1JA 2Q1WA 3HYSA 2PS1A 4FHGA 3BK1A 1Y82A 4UU7A 2WJWA 3C3AA 3OZDA 4BVKA 1KYXA 1SK8A 2PANA 4HWTA 4INZA 1L5ZA 1Y3BE 2P75A 2X3FA 3ZTWA 2QPTA 4Z4EA 4Z1MA 4COOA 4ZDWA 5LBIA 3HUEA 1YS9A 4KRFA 1SKYB 2QXTA 4R8RA 2QUAA 3IUBA 5T7BA 1A9YA 1YBMA 3TLBA 4K0KB 1KTVA 4LRQA 1C41A 4HH4A 4U6SA 4O33A 5AI6A 2WIKA 3N8NA 1VKNA 4URFA 5GJCA 1G6HA 1SC6A 4BKUA 5ED4A 1FUUA 4TV9B 1BRTA 2BRUA 9LDBA 3W3AH 3QF4B 1JIXA 3F46A 1L6RA 2MYNA 4KC0A 2YRXA 5EJ8A 4DT1B 1E7YA 2PUWA 1L3BA 4MYUA 3C6XA 4PRZA 1W5FA 2Q0QA 3CTMA 4LG1A 4PZAA 4RDHA 5IDXA 3ZHBA 4TYYA 3ZGXA 1UKBA 4LYAA 5I8WA 1UZLA 2G4CA 3A25A 4XM2A 1PUXA 3KAJA 2DOKA 4OX9B 2PRSA 3IPCA 4B4WA 3PFHA 3AF1A 2GA9A 3KXDA 2WF9A 2VXCA 3TIVA 3WRWA 4ZIRB 4IP0A 2VAVA 1S2LA 3LJKA 2B83A 2Y67A 4YBZA 4DBZA 1Z6PA 2AQKA 3T3DA 3TS1A 3CUWA 4R83A 2O8CB 4W8GA 1UDCA 3RVQA 1EVYA 2ECPA 3LVRE 3VH2A 4AZSA 5JXHA 2FPPA 2WFMA 2WU4A 1OLSB 2O3SA 4Q19A 3G3EA 5FRDA 1PWHA 4P4UA 3GGCA 3MYRA 2PJUA 2HGSA 1JFVA 2VF5X 2VNKA 2OLJA 5AFSA 1A4IA 1DTEA 3KPWA 4CM9D 2XYHA 1C0LA 2HA0A 3KM0A 4R05A 4BU0A 1GKYA 1YZNA 3G23A 2W0MA 3C5EA 2UUPA 4HLUA 3K4HA 3DO6A 5K0NA 3U3XA 4EQ6B 2AFIB 3G8AA 5JCJA 3I42A 4P86A 4J7AA 1RW4A 3B2QA 5IVPA 2ADMA 2QNIA 1KSJA 3THWA 1PTKA 3G5UA 4DDVA 1HEUA 1OB2A 1SXGA 2J3MA 2ZIXB 4JLBA 4LW8A 4W4TA 1XU4A 5F51A 1FFSA 2JC3A 2R86A 5CA0A 3O6VA 4A4DA 5BMVB 3DSRA 5IYZB 2C9OA 1NVDA 4ICIA 4YRZA 2QM8A 4EWLA 5L3ZA 1FJGB 1YNSA 3QVWA 4YCCA 5KNDD 3L7DA 1PR6A 5DH9A 1QHFA 3OIGA 2XZLA 2AJTA 1H5UA 2XTZA 5JH7B 1CV2A 1NQUA 1Z5NA 4JKOA 3NHYA 4XWTA 5LB4A 1SBCA 3E9RA 1M73E 3I8SA 3M5CA 2H8GA 2YQZA 4LGCA 1I13A 3N5CA 4LYEA 5E6UA 3REOA 2JFBA 2O0MA 1YTUA 4EPVA 2X9NA 4JVLA 1IUPA 2XLCA 4IDCA 4JSRA 4V0LA 1XEXA 3VZDA 2YHSA 2XBMA 1Z0ZA 3OLXA 2DH5A 2OKCA 2PO7A 5EVCA 4NKRA 1UMKA 3Q41A 3GH3A 1TM3E 1V11B 1OXXK 3QTLA 1XAHA 1NP7A 1EUDB 3G1WA 5I8ZA 2ZANA 2G06A 3R7BA 4C1NA 4DMKA 4RKYA 5DM0A 5LP6C 4JVNA 1T9AA 1O0CA 4I1SA 4MVXA 2JJMA 2XTMA 4ZO7A 3BG5A 3SLRA 3WFJA 4B5KA 1QIFA 3E7PA 4KP7A 5A05A 2J5KA 1NXXA 1QCZA 2C5BA 4HAZA 4ER6A 1FFXB 2A9QA 3ADKA 3WRYC 3K8ZA 4BQQA 4PZPA 3GJ7A 1JDNA 1FYWA 4LXIA 1SVNA 4R2MA 5COQA 1QWSA 1DAEA 4MKXA 3FOZA 3OQIB 1PF7E 2GB4A 2ZVPX 4PRKA 5A5VA 3HV2A 1V1MB 2W8ZA 3SQMA 1L0BA 1Z9BA 3Q7PA 5ELMA 1MQ9A 3HN7A 3WGUA 2BTQB 2GLUA 2K87A 3AGPA 5C81A 4OL9A 3M83A 1H5NA 2BF7A 3LVFO 2EHJA 3ZY3A 3WZMA 3CJRA 1IE3A 1N6KA 1QE0A 2ANBA 2GPAA 4JC4A 3U4MA 4M36A 2X0KA 4LK3A 2H7VA 1DIAA 5E4FA 1SGWA 4AMUA 4NYJQ 2VHYA 3FMVA 4N0QA 4PICA 1DX9A 3ILVA 4I8DA 1E0DA 2G70A 3ZE6A 4UHHA 4UHCA 3LPLA 1XRRA 5A06A 1UC8A 3HXTA 4LN1A 4Y67A 1R0KA 2NT3A 1V5FA 1Z25A 4NFSA 2ZTUA 1TM7E 5CITA 3WK9A 1KRWA 3NWOA 3OCWA 5H7XA 3EK2A 3FPLA 4YI3A 4OI1A 3GFGA 3FYTA 1A88A 3EVTA 1XRPA 3EJ6A 3QLTA 2FR1A 3P2IA 1N6RA 4WT7A 5D7NA 3WNBA 1X1AA 1N0HA 3X1YA 4AL4A 2A33A 4BNDB 2H3EA 1RABA 3M82A 4GI7A 2DTEA 4FLMA 5DBFA 5B1SA 2XD4A 4YJ3A 3HB4X 4CMJA 2HA4A 1HT2E 1XCOA 4P5EA 3P52A 5FL3A 4NBRA 4UDOA 3ZHYA 5EWMB 2OLEA 1AHIA 3ZWQA 3QXJA 2TMKA 4BVLA 1C8BA 2QHXA 1U3VA 621PA 1ZMTA 3ASYA 3IP3A 3D6HA 3OKFA 3QWAA 2E4ZA 2QD2A 3V7UA 1FS4A 3MJVA 4AS1A 1N78A 4WKBA 1CY8A 1T6XA 4GFDA 4JS0A 1J2JA 1JIKA 3TFOA 3GLIE 2OV6A 4TXJA 4EOGA 4YLGA 5CD9A 4XB1A 2J0EA 4JOCA 4KIJA 4LJ9A 4LJYA 4RFVA 3SC2A 3C1OA 1IHDA 3N05A 1EFPA 1CQJA 1N7HA 1KETA 4LJLA 4LQLA 1SD5A 3L6BA 1AB6A 4MGZR 3H9GA 2A8YA 3AR6A 3CUYA 1AZTA 3P9KA 1C8LA 2EFCB 4O2AA 2KI5A 1Y1QA 3W1WA 1M1ZA 2X5OA 3HACA 4Y2VA 4ZXPA 2OQVA 5HGJA 2Y1WA 5AK5A 4OCZA 3U4QB 1QU2A 4Y18A 1ZN2A 1GEGA 3FYSA 4MI6A 2HR1A 3GAAA 1GM5A 1KS2A 1WB6A 3JXEA 1NN3A 4G5RA 5DCWA 5JQWA 2DXIA 4FFOA 2IYLD 3T3HA 1ZCZA 3GUZA 1WM1A 5E7IA 5I7AA 4RK7A 1LTQA 4P9NA 3MIZA 1O4VA 2VDWB 2YASA 2AN9A 1IY0A 2MIIA 3ZD8A 4TQ9A 4F38A 2J5BA 3GG2A 1L1FA 1UPXA 2NZ2A 3TVYA 4I5IA 2CXHA 3O75A 3LI2A 1THGA 2XCRB 3A9RA 2Y0BA 3NFRA 5AK0A 5C18A 1HQYE 1QYWA 1Z2CA 2K4MA 2KSQA 5I5GA 2BFOA 3ZIDA 3KWFA 2CBGA 3AZQA 3AX6A 3VU0A 5J47A 2XAAA 5LA6B 2HHLA 3TLEA 2XDYA 1OUMA 2ZI6A 1JWAB 2OV8A 4FINA 5EJGA 1FA9A 3NM5A 3QU4A 2Q5OA 4QULA 1USKA 4KREA 1FFCA 4GP6A 3RRMA 2CNKA 3ZYZA 1A77A 1OGJA 4OP3A 3V4RA 4RVHA 1JXOA 4LVCA 3MD9A 1ATIA 1T4CA 3TE6A 2L19A 5HKKA 5FTLA 1D2RA 1UF9A 3I73A 2CZQA 3KJFA 2YC2C 3KYDB 3UBTA 1QB7A 1C3OA 4QUBA 3BORA 4XD7A 4Q18A 2JAUA 3D7RA 4YY3B 1NNUA 1B7GO 3U13A 2J3LA 3KO8A 2ABWA 2G25A 3ICQB 4YNBA 2VNIA 1TZMA 1QKJA 2O5RA 3GMIA 3FGOA 3HRHA 4M1TA 3EFEA 4EAAA 2YW9A 3HSKA 5AVQA 2CMDA 3TR6A 3WO0A 1ZI6A 5LJIA 3BSWA 1U28A 3M3PA 3OLZA 1PZXA 4QFCA 2AW5A 1H2YA 3DZFA 2ZIVB 4Y6OA 2X86A 4KXNA 2XTNA 3I9JA 1ZN7A 1EZ4A 2EZTA 3QEMA 4KO4S 2O4UX 4MWCA 1J49A 3TQFA 2XE6A 3VDQA 3KX2A 3OFSA 1XJWA 3IQIX 4KH0A 4KR6A 3OBBA 2C99A 1U9JA 3NUQA 4ZU3A 4MR8B 5CH5A 1QO7A 1KRHA 2P79A 2VP3A 3I2YX 5FIUA 3W8NA 2G88A 1XWWA 2OWEA 4ND4A 4DRXB 4DMLA 4LNUB 1N5JA 1M2NA 2XMQA 2VZ8A 3RAGA 1PJQA 3CUVA 4JEIA 3RHZA 2OO5A 2ADOA 2DFPA 2NAFA 3BREA 2JI4A 5MGNA 2ODEA 1QLHA 4IOMA 2GNAA 1XE3A 1PN3A 1I10A 3U16A 5EXDA 3QU5A 4D4IA 4J0QA 1U0NA 2ZIAA 1T8YA 4R1MA 1ZBDA 1EM8A 4QJ4A 4BZPA 4QD3A 3DKKA 4RTMA 1JEEA 3RUHA 3FBWA 2SCUA 1WMDA 1Q95A 5C1BA 4YA6A 3IEKA 4LHXA 4F1KA 1UFOA 1DPFA 7REQA 4OXKA 4DMUB 3D6TB 4NZ9A 1R4MB 1Z2NX 2OGSA 5TMEA 4M37A 3R3XA 4C78A 1VP3A 4FZ3A 5L7WA 4CQMD 1QYDA 3INTA 4MWEA 4P3OA 4BAZA 3WL3A 2X9LA 4KMMA 4EGSA 1PR3A 4XGRA 1MH9A 2A5LA 4DB2A 1G4UR 3IAEA 1OZ0A 3EQ2A 4OMFG 5BUSA 1S3GA 3VPDA 2J48A 3D6AA 1NKTA 4NMWA 4RS4A 1Z5PA 4C0KA 3VSEA 5DI3A 2FWRA 5CJJA 2P2CA 2WLSA 4X1KA 3ICEA 2Z58A 2OG1A 1CUYA 2P2ZA 2Q3LA 2F8TA 1VL5A 2CD7A 4EG1A 3E70C 3KTAA 2Y1XA 4HNAB 4EZBA 4C0JA 4MYDA 4YAEA 3LCVB 5G0TA 3UJDA 4F9EA 2DFDA 4C7KA 2F59A 1Z06A 5CVDA 3RSFA 4GZLA 1E59A 4YUVA 5IWAB 2HNKA 2P4HX 4DV6B 3U7RA 2IEGA 4MB0A 4GPIB 3B6IA 5LOVF 2XA1A 2XVXA 3I37X 4ALIA 2YWJA 2ZK7A 1DT3A 1HYQA 2WLTA 2H5LA 3K1ZA 5HTKA 4DAEA 4DS3A 1ORWA 2IEDA 1K08A 2NZVG 2LKDA 3EXEB 5KQGA 5FBQB 4ZVQA 3LY5A 4QU0A 1I4OA 2DT8A 3GC6A 4OUDB 2VUHB 1H2WA 4OIFA 4ZRDA 4B74A 4CMIA 5JBIA 3IVMA 2DB3A 3H11A 2CJWB 4V02A 3HMKA 4DJ5X 4DV3B 2H1OA 4R98A 1G63A 2H16A 4DR4B 1XD8A 3ETCA 3L7AA 4MV8A 1I1HA 3VKWA 1RACA 4EYKA 1HK7A 3DJYA 3DMTA 3OI7A 4RZSA 1P4SA 3GT4A 4C7OB 3TE7A 1Z22A 4QGAA 2Y3IA 5TGZA 3HP7A 3ZGZA 3EZXA 1LTHR 2EL9A 4C04A 3AVWA 1N7JA 1Z4PX 3GBSA 3ZWVA 1J7JA 4I9NA 3LQ2A 3A6HA 2A59A 3K96A 4NOMA 2BE7A 1LD3A 3ODPA 2BHLA 3QE3A 1HE2A 1VIMA 2P1DA 4P08A 1A5SB 1W2HA 4MS4A 3O74A 5DXFA 3ZUGA 3HKEA 3HM2A 4P3KA 4B1FA 2R79A 4I9FA 4QWWA 5LBTA 1ZONA 2X2PA 1S3FA 4YO7A 3TMAA 4B71A 1X1BA 4HJXA 4JMLA 1PT8A 3N9IA 2J8ZA 4LC9A 4A0HA 1C4XA 4DSTA 2UUCB 5BW5A 4Y9DA 4EKGA 1W52X 1M8PA 2BTEA 2HK6A 5H02A 1Z0DA 3Q7QA 5BSFA 4BY9E 2HAEA 1I51A 2XCTB 4UNRA 2H7CA 2PUAA 3KQHA 2QMEA 2JFQA 2BCEA 2V7TA 1ABEA 4BGEA 3TZHA 2DCMA 2QDXA 4O4HB 1KEZA 2GBIA 1Q84A 4IBOA 1XDWA 4DE5A 5BWCA 3G88A 1M7BA 3SJUA 1BCRB 1E2GA 1Y6QA 4PLZA 1B43A 3FR7A 4GT1A 1MIOB 1XZMA 1L4GA 1TMYA 4BNZA 3DC7A 2D7CA 2GEKA 2D5AA 3AM3A 1NI4A 3JARB 2GEVA 4KVZA 3Q2OA 1DUSA 1Q50A 1R5NA 1ST3A 1PFQA 1T24A 2IF0A 1REQA 4OYLA 4TVBA 4LHZA 3EF1A 1ZS9A 1X14A 4JBHA 4Q9LA 2BUBA 4MQ4A 3SKVA 2QLMA 2BYTA 2F8MA 3JQ8A 4W9NA 1GKUB 3X0DA 3AWDA 1FNCA 2QPLA 1Z36A 2ZCUA 3ZD6A 4WA8A 1EXMA 2H1VA 3QLUA 4MVJG 1QRRA 1KI7A 3SDSA 4GUDA 4LECA 4ZQFA 3ZU5A 4JKIA 3AETB 4EG8A 2BISA 2QM0A 2XOXA 1HE3A 4LVNA 2ERCA 4UOQA 5BQOA 4FB4A 2Q3HA 1CS4C 1JXAA 3H2GA 4LFCB 2XZPA 3TKLA 3OD5A 1HDRA 3W3ZB 1OX6A 2Z98A 2HBYA 4RDCA 3EIOA 1IJFA 2XNHA 3WWCA 1JFSA 1V96A 1LBHA 4TLBA 2BJVA 2ZKLA 3H2BA 1ZJWA 3EH2A 1DI0A 1L7EA 4HLDA 4QGBA 1ONSA 4X7BA 2JG3A 4R8MA 1SIOA 3KV1A 4JP8A 5GGXA 3U3DA 5CBKA 4G07A 2R96A 1KTIA 3TYXA 3OA2A 2WG1A 1P7YA 4ZV7A 4TYWA 3DAOA 4PFJA 2ZCVA 3HO8A 1DAOA 4FE3A 2I6TA 2W37A 2QAGA 4E33A 3DBHA 2GHTA 3O38A 4J49A 2OZLA 3H2KA 3FGNA 4RQUA 4BWGA 4O2BB 3WQSB 1MX1A 1W73A 5DGTA 1E2FA 1Y4AE 3R6DA 1PJ4A 4MKRA 2W70A 3O94A 3KZVA 3F9RA 1GD1O 1WXFA 1KWKA 1KYIA 2DR0A 2QOEA 4IMJB 1UZUA 2CUTA 3QBEA 4A73A 5TT1A 3RVNA 2X4GA 1EUCB 1P60A 2LR0A 1LNZA 1UJ6A 4HN4B 4EB6B 5DBEX 1ODSA 2Q2QA 4BP9A 5DN6D 2ZIZA 3VKFA 4J9UE 2ORVA 2F3QA 1RRGA 3C15C 2PEZA 4N48A 4NY1A 3D5QA 3I6MA 3G2OA 1DXQA 1QH8A 1ID1A 3TUIC 3IAM6 3C3CA 5EXTA 1UPTA 4UEWA 2ZAOA 3KSDO 4L16A 4P3NA 4UHDA 4G65A 2CE7A 3MTQA 3PGLA 2WIJA 5B3LA 3KQLA 1NDQA 1OXBB 3LLVA 5T4BA 1MT3A 3TRIA 1NJGA 2OHHA 1WOYA 2PH3A 3HEAA 3IAAA 3WYEA 4OGGA 4EO7A 4PYNA 2CDCA 4IYRA 3ESQA 1Y7TA 3QUCA 2NU8A 4QG3A 1VE6A 2E4UA 2XIQA 1A5ZA 1ZIYA 2R1ZA 2WSBA 1WY7A 4KL8S 2QRNA 3K9WA 2FWBA 4E22A 1WIWA 1YUBA 1C1DA 4QXOA 3V8QA 5JZ9A 2C5FA 2Z5LA 5IAKA 5DK6A 3UKJA 4BFSA 2Y68A 2QGFA 4ZPXA 5FI3A 1B0ZA 4YAGA 2HTFA 1ODTC 1PG5A 2GBLC 3ORRA 5ALLA 2GPSA 3K0FA 1A9TA 2IPOA 3GHYA 3TKAA 4M4SA 5KJEA 4F5WA 1TX4B 4KR0A 5KNBH 4EY7A 1YL6A 3KKEA 1FP1D 1XVAA 2C42A 2K6GA 2HMTA 3GFPA 3VNSA 5ALVA 5ITWA 1P44A 1IN1A 3E0XA 1S2OA 3AUSA 1A1SA 4FBGA 2NACA 2R1TA 3DOUA 1T3LA 3KKZA 1ZM2A 4LDPA 4Z53A 1Z0FA 1UC5B 3KCQA 3IC5A 4NH0A 4OQFA 5KYVA 3PWKA 4RD4A 3UJ8A 5ALIA 5L8VA 1HDOA 3ELDA 4XYEA 1ML3A 4FMDF 3SSAA 4B8ZA 1JIJA 3KSZO 4M0PA 1SKAA 3OX1A 4RV4A 4FYWA 2WDPA 3DEHA 8AT1A 5L45A 3NBKA 4NOJA 2R1UA 3PQ8A 5ALPA 3PE6A 2I3ZA 4RTSA 3WGVA 1G20B 2YTZA 3R6WA 4F9FA 1SXJA 3C5CA 3DBLA 3FCAA 4BKMA 4ARUA 4OQNA 3H75A 1D04A 1M34B 1NKVA 4HNSA 2P0AA 4DQXA 5BR4A 1N6IA 4PSDA 1E99A 2JCXA 2HIGA 2NVUA 4A0QA 3EXG1 3TIXB 4BNXA 4HQKA 4PX5A 4H7JA 4J94A 4OH1A 4IO1A 1DINA 4HMOA 3VRHA 4F6CA 4LPKA 4GR5A 4WZAE 4HFRA 1Y34E 3PTLA 3VZRA 5JJKA 4RCZA 4YX9A 5CX1B 3RQIA 3EXHA 1N1DA 3KIPA 1AXRA 2Z43A 2PX5A 4CGZA 5TF0A 4EUEA 3VR2A 4ALLA 1QRDA 4D9NA 3AI1A 4ERNA 3PGKA 2AYZA 3H8VA 4B7XA 1G0OA 2I2XB 3N86A 4YC7A 3S2UA 2XD9A 3R74A 1KC1A 3LD9A 4MPDA 4GOND 4XYBA 1IJBA 3PC3A 3ZY6A 4BNVA 3NJRA 3G5LA 3WP1B 3FHOA 4OM7A 3KEGA 4MB2A 2XQVA 4KR3A 3ZH9B 4DCGA 4AG6A 2O1XA 1Y9AA 1AKTA 1P4HA 2G72A 2OV2A 3LUPA 1JJAA 1J09A 3N2KB 1VZ2A 3AR3A 3EIQA 1MRZA 4JLPA 3AHDA 3MS4A 1W85B 2GCGA 2CUNA 1G8FA 3H9QA 4KH1A 1QIIA 4IJVA 4DXDA 3MTJA 2JPDA 4K3VA 3EDRA 5EYPB 3V1NA 4NV1A 3E5NA 4WMLA 1IZ8A 4N39A 5GONB 4C76A 5A4KA 1GQFA 1TUBB 3TIIA 1TQ4A 1HR0B 1W36C 3ZTTA 5C8VA 3SQOA 3WYDA 4C0XA 2QG9A 3SC4A 1POXA 3DL4A 4WW0A 5F1KA 4M87A 1YRYE 1YS2X 2PNJA 1XLVA 3TW8B 4BX0A 5HTOA 3TTTA 2JIOA 1E1CA 3JVVA 4ESHA 5B1DA 5KQRA 1U9YA 3OPYA 4PIVA 4UUPA 2AJCA 1KZ6A 4OXXA 2QP9X 1HG1A 4XPIB 1XZKA 1X94A 3OHPA 2J3IA 3LE8A 1IIBA 3OJXA 1FDRA 4CQNA 2JI7A 2YZ2A 2C3YA 1AVTA 3IYLW 1M74A 4M9CA 2ZRQA 4QWMA 3G59A 2G6TA 4NI5A 4U0JA 3FTEA 2NTVA 3DOFA 1IEWA 2FPIA 5HKBA 1JWBB 1AG9A 3RDPA 5CLGA 1W5TA 4L7VA 2P27A 3H8JA 3LBYA 4GBGA 3HJRA 1PVDA 3C14C 3F7TA 3M34A 1QHIA 4EHDA 3MS7A 2CUZA 3H9CA 5DDIP 3FYUB 2Y0EA 2P6MA 3TSWA 1ZL2A 2JL1A 3K2BA 4QLAA 3OLCX 4KXUA 3TR0A 2WYOA 1Z68A 1EU1A 3IMFA 4RF5A 1TT5A 1E4YA 1TO6A 4B3CA 1Q77A 4D41A 3A4NA 3ECCA 3ADDA 3GXBA 3HH8A 3KKKA 4DBLE 4EFDA 3GFOA 3OECA 1GGFA 2OCXA 1Q1ZA 5JD3A 3WZLA 5BUCA 1W25A 2G5PA 1R6TA 3T9EA 4S0ZA 4C30A 1QH9A 2ENUA 3V4FA 1O7JA 1COWA 5DM2A 3O1LA 3V1UA 4JP2A 4QUAA 1RAAA 3A9CA 2XXBA 4TS3A 2J5RA 5JRJA 4LQDA 3ND7A 3AOGA 1V9LA 2OC9A 2VAXA 3E9ZA 4K7JA 1G5RA 2QLLA 2VPYA 5H5JA 5LP1A 3EASA 1F6DA 2GVDC 1M0EA 3BKXA 2EC5A 3PRKE 3ZVLA 2HW8A 5BSGA 4PG6A 1LPOA 5MN6A 4GOXA 1QPGA 1V8DA 3JQGB 3V4OA 3WA7A 4EHAA 1IL0A 2XB2A 3T54A 1DKPA 5C7IO 3OKPA 1QIGA 4P32A 5CH8A 5DWQA 3FXAA 3BSSA 5TEVA 4DNPA 1TM2A 4I36A 1NF8A 3WK8A 4JLUA 4JI8B 5DW3A 3T1HB 3PNOA 5L7TA 1J8VA 3BL5A 3Q0IA 5IULC 5DTEA 1GPMA 2QRPA 2UUAB 5KTRA 1ODIA 2V5AA 2XVAA 5DTMA 1SUBA 2C0CA 3ROQA 3AY0A 5LR6A 4X7PA 4ND2A 4NJEA 4Z4GA 3WLKX 2C2WA 4I6EA 2C57A 4UPDA 1SU6A 2UZ0A 1Y80A 4XE5A 1F48A 2H1CA 3WGKA 3UC5A 1ZP6A 2C9YA 3B53X 4ZJZA 1MQ8B 5DBHX 1UBMS 1UKVY 5A1TA 2SBTA 4YRNA 1ZK4A 3A26A 3IHKA 1ZO8A 4NG5A 2BBSA 4P8RA 4Z4HA 4BNIA 4IDQA 4UNIA 4DRZA 4EA8A 5A3JA 3UAZA 5G0VA 4NNOA 2C00A 4N7BA 4QICA 3F9IA 5JG7A 3I92A 4ZICA 2C03A 2HYDA 3HUFA 2O2ZA 3KD3A 3NJ8A 4MR9B 4XVQA 4WBNF 1EGHA 1UBNA 3P19A 3CLVA 5ILQA 1XP5A 4WCFA 5EZYF 5GM1A 1XZNA 4NENA 3GARA 3LYHA 4FUQA 1MO5A 5G3ZA 8GPBA 1JG7A 2I6XA 3GLUA 4KRXA 4ENTA 5C4GB 2FR8A 2GN4A 3NHRA 5KCMA 3WKAA 4Q9DA 5ALGA 3VMMA 1QZTA 3ZW8A 5C51B 2I7DA 4I3HA 3ZHOA 5KTNA 3SFTA 5LUAA 2X8WA 2YMQA 1VLZA 3C3MA 3GU3A 2R8EA 3BB1A 4JCOA 1LPNA 2JFZA 3H86A 4JB8A 2I80A 1UL1X 3CEMA 5EIBD 4DYVA 5JADA 1UBSB 1R9MA 3MAGA 3KQTA 4BNUA 1BS2A 3DUFB 3E5MA 3OM9A 1XQ9A 2W8BB 5ECYA 4QAQA 2FMFA 2R6FA 3E9YA 3RWMB 1F06A 3JASA 4PZYA 3TXYA 4CM8A 5M34A 5HRUA 1ORTA 3RR2A 5FFNA 3P2OA 2GVZC 2J5QA 4LWPA 4Y98A 3FWNA 3KWMA 1ZOOA 3UC9A 1SOUA 1KDZA 2EG5A 2BF4A 1G19A 1XXHB 2DYKA 2J6IA 3CC8A 5JE8A 5B57C 5KOHB 2A9VA 2FSSA 4CLOB 1GAXA 4YTEA 1E6CA 2YNMC 4I1YA 2GAAA 4ZYYA 1M54A 1MJGA 1PS0A 2V9ZA 3INGA 4I5FA 4OO3A 3ND8A 4DCOA 4EA6A 4BVFA 4XGQA 4GZMA 3TZQA 3I28A 4LZWA 3I9FA 1X92A 3EZLA 2Y1CA 2AR9A 4MEAA 3GCZA 4TTTS 4A82A 3EZNA 9MHTA 2OYCA 4RVOA 3WLIA 1Z39A 3ZV5A 2NO0A 1KIAA 1CEXA 1Q0HA 4A7PA 1WL8A 3DVAA 4JLMA 2LWIA 3C3PA 1U8YA 1MB0A 2NXEA 3IVAA 1GPAA 2D8MA 3LVQE 3NRJA 4M9RA 4KE6A 4Y2YA 3H2YA 4NU0A 1ZUHA 1HE5A 1V3TA 4JUDX 3JVDA 3W2FA 4TYNA 2PPVA 4JBXA 1NN1A 2FQWA 3EPPA 1L1QA 2X0IA 1GAQA 2P68A 3BHMA 3C5HA 5FUBA 5HIAA 2VJPA 1K97A 4CM3A 5JSFA 2JCVA 4RPCA 1YE8A 2VDRB 5HG0A 1JSLA 1CXZA 2EWWA 4NE2A 5AKLA 3W0LB 4Q4DA 3NOVA 5E2BA 1Q1EA 2O05A 1GTVA 1ZGAA 1D3AA 1FDIA 3GQBB 4AU1A 4NCIA 4PU0A 1FP7A 4TSKA 1Y0BA 1QF9A 1ZMBA 1KP2A 2A7QA 3MMSA 5KWSA 2QMOA 5KWIA 4DV0B 1IIRA 1KDOA 4WXYB 4JITA 5FL7D 1ONOA 5DX8A 3S5UA 2C2HA 1I4WA 4BNYA 2FMXA 3RYCB 5E6RA 1PJAA 4GWLA 3H4VA 2P2NA 4AJHA 2ZYUX 4QUEA 5HQJA 3W4JA 2PLNA 4WOBA 3KEOA 4TYMA 2PN1A 1ZGGA 4YJ2B 5B7NA 5KX5F 1T2CA 2XNCA 2E21A 1TUEA 4Q7MB 2HXGA 1WSDA 2R00A 4DTIA 5GQSA 4D4MA 1QS0B 2HSWA 2B7CA 4OHKA 1G21B 5A5GA 1XTBA 5JRZA 2IOFA 1Q1QA 3GPBA 1PJZA 3WMEA 2J9YB 3OMWA 2VH1A 5AQ1A 1ENOA 2WIAA 5LDGA 4EF4A 3TZEA 1ULSA 2PMWB 4TTPA 1I1QB 3Q5DA 1Y1SA 1RR6A 5SZJA 3BD9A 4AB1A 3NMUF 4WSOA 1U0JA 2XT6A 1GPUA 1PHPA 1NR7A 2OFPA 2Y2VA 3CWZA 3IEXA 2NV0A 4CKCA 3G1UA 4K5QA 3WLTA 3SHVA 3RTGA 1O03A 2VBCA 1RLJA 3D7MA 3CX4A 4Q37A 4W8HA 3W5VA 1WOMA 3HJGA 3OTGA 3H97A 4HVLA 2Q29A 4FK8A 1WHSB 4P7KA 3GJ8A 3LQ1A 1I9CA 4IM7A 3ZGOA 1QVWA 3M6XA 2OZEA 3WNCA 4I1PA 4ER3A 3O2JA 1ZCFA 2E0IA 3DOHA 4OSPA 4BNHA 4ENRA 3HL4A 5JW6A 5DNWA 3OT1A 3V6LA 3ANTA 2OB2A 3WGTA 2UVPB 4M7OA 2ZRGA 2FPSA 1T8TA 3GAFA 3T4PA 1NC1A 3A70A 2IYFA 2M98A 1KOJA 3EA4A 1JIVA 4YREA 1NMZA 1ISPA 1IWPB 5J2UA 1QTQA 3OEED 4LGMA 1JFLA 3THOA 2JD0A 4I50F 3VPCA 3ZHZA 4DZZA 1EA7A 1CRPA 4FR0A 3VR0A 2ZB8A 4EHJA 1LW7A 2EXXA 3QBVA 2PXXA 4ZDKA 4TTJA 4F86A 2VNHA 2FWNA 1N8NA 1QAOA 3FB1A 2ZT6A 1G9TA 1Z0JA 5L51A 3O8CA 1Y3CE 1SNYA 4FBLA 2GS9A 3KQVA 3RG8A 4A9AA 4XX0B 2IA5A 4G56A 1CWUA 1F60A 1W88A 4G97A 3P2KA 4UMEA 4MS1B 4DLKA 4YMLA 2WJYA 4P98A 3ROMA 4D57A 2Q28A 5LYJB 2J67A 1J39A 3JYLA 2HBZA 4UE3S 1R8XA 2XDQB 2HKIA 2AFHB 4R1QA 2HI0A 1YUMA 1NPYA 2R2AA 1D2MA 5LUBA 1MO4A 4L72A 1IBMB 4OJTA 3W34A 2C88A 2V0GA 1MOZA 3GYGA 2O2XA 1VIAA 3UT5B 3AZPA 4D8TA 4HKTA 3TOVA 5REQA 1ZISA 2HTEA 721PA 2V7QA 5CFNA 4IIJF 1WETA 1K4YA 1F8FA 1WMFA 1X42A 1ISGA 1D6JA 1G8MA 4Z9XA 5FD8A 3JZDA 3PLRA 4QSMA 4V1CB 1M0SA 5ADVA 1C4KA 1P9RA 4HUQA 2IEZA 3EUFA 3W6OA 4C29A 1TVMA 1J99A 3QVXA 1SXPA 3IE2A 4AJ9A 3PIDA 3AI2A 1T2NA 4ZRMA 3R7FA 3G8YA 2HCTA 4BQEA 1TMOA 1T2FA 2P6RA 4H3KB 5JISA 1MJNA 4LXGA 3FDIA 3NAZA 3B1FA 3PLNA 1AS3A 4CCAA 2XB9A 1K4KA 5EFZA 4P93A 4TXNA 5KAMA 4FFBA 4GC9A 5IM5A 2XWBF 3FFTA 4GC5A 4WHMA 4F11A 2B36A 2JFFA 3PGMA 4OV6B 1E8MA 5DTIA 3ECSA 3L2OB 3ZV7A 4XWKA 1BN6A 2QRVB 4CIDA 1L7QA 1TZCA 1PT5A 3U3JA 4OHUA 4FSDA 3QVTA 4I55B 3UH0A 5LP6B 2J59A 1Q7TA 4P5PA 1RHKA 1DELA 4K88A 5CLJA 3H5AA 4MO9A 1G3MA 1MJGM 1YQEA 4R3NA 2R6ZA 4OGKA 4AP9A 3BE4A 1CR1A 5BVGA 1PFVA 1T25A 4MS3A 3W04A 2QX4A 2M1ZA 4WA7A 2WM2A 2J87A 3WMRA 4ZMRA 5BN3B 1C50A 2I71A 5J2TB 4Y9UA 1PSWA 3HHEA 4PXYA 4Q24A 4QPPA 1QKKA 4PE5B 5E8RA 5D84A 4B76A 1AUPA 5ALOA 3CUKA 3RVDA 2CE2X 5KVQA 3FNEA 3PEUA 1NIJA 1JSRA 3RAPR 4DMHA 5IKOA 2AC4A 3UFXA 3ZWAA 3QYJA 4FTWA 2HRRA 3SNKA 1HTBA 3WWZA 3CH4B 2I54A 1MABB 3D4OA 3K09C 2B35A 3G9TA 1XRNA 3LZDA 1HA3A 3IT1A 1WUHS 4KAAA 5TMBA 3ROPA 1V26A 2COEA 2WD7B 1M2EA 3OZVA 4XGIA 3G1TA 3DYVA 2QVZX 3IAS1 3O1JC 4XW2A 2BEJA 1RD4A 2NUPB 3PEVA 5EZ6B 4DEYA 5TXGA 5LQUA 5CG1A 4G86A 4BLOA 2PUDA 2GEUA 1CR0A 2QP4A 4KGVA 2FPWA 3E9NA 4U5QA 1NV9A 4BRWA 4Z6KA 1NTRA 2PRZA 1WZ2A 2J4DA 4WGGA 1R74A 1MQAA 1GHTA 3WTCA 1H0HA 4YP5A 3HCFA 1HLGA 2PH1A 4L7QA 1SKUA 3A1TA 1C9EA 3IOEA 5IC4A 5JAOA 2CNNA 4IHJB 4R54A 4IINA 3PXAA 5DX0A 3HUUA 1KZGB 4RTPA 5FAXA 1VFPA 2QW8A 3QFHA 4L4YA 4JQSA 5CNKA 4TWZA 2IU0A 5J4VA 4M0LA 5F77A 3L46A 4FR5A 1K7YA 3F2VA 3EDOA 1NUAA 3BFJA 3OF3A 4MLCA 4NOKA 3CISA 3KQPA 3O82A 4OQZA 1M76A 3JQ9C 4H4EA 4NK4A 3UANA 3AUYA 1FXUA 3HEMA 3HLTA 2WP8J 1USWA 2GSDA 4IYJA 4JXJA 2JVJA 2QZSA 4OQDA 3OP4A 1NF2A 2BEWA 2ONYA 3CPSA 1E62A 2GQ0A 4OHXA 5BV2P 2KLHA 3M4XA 4ARZB 5IZ4A 1NULA 3G68A 4RFSB 3JTMA 5HZMA 2GZSA 1NVVQ 3MRSA 4ZAYA 4R2WA 4CM6A 1IFXA 3H5IA 2QD3A 2BZGA 2JZOA 4QNNA 2YS7A 1EDDA 2ZDHA 3P9PA 4L08A 2QK4A 3SXUA 4NIMA 4MAFA 2Y4OA 3EF3A 4V0ME 3S8MA 4KXVA 5CIQA 1PNRA 2Z8YA 3TTXA 3V1LA 1QDEA 2VP2A 1BC5A 1YA8A 3DUWA 4N3AA 4R8KA 2X40A 4RESA 3BJZA 4AJJA 3QE0A 4TT3D 2FOXA 3CLTD 6CHYA 1XLTA 1DZ3A 3FTFA 2WU8A 2I5PO 3C6BA 3G2HA 3HNRA 1HQCA 4PPFA 1Z12A 4QPJC 3V3KA 3WBFA 4CM4A 1E96A 4G0MA 4IDOA 3REGA 3EW9A 5F2KA 3KOUA 2VDPB 2IXTA 3IHLA 4B6GA 4F3NA 4RSHA 4UDNA 4ZJPA 1E69A 3C6YA 2A5YB 5DCLA 1MMFB 4Q7LA 4HK4A 3THSA 2XYRA 3B1VA 4M46A 3GY0A 2QL7A 1Y89A 4UW9A 3T7DA 4CU2A 2PTGA 1N9KA 4R9UC 1JMKC 4F3KA 1JN0A 2LCIA 4BZWA 1A5TA 4IOKA 4U2CA 1GLGA 1GFIA 2RC6A 1FBTA 4O6VA 2D2FA 4IGIA 1E2JA 1HTTA 5J63A 1TVKA 3DMPA 16PKA 3JWHA 2VPXA 5CT5A 5H16A 3L8FA 3AW8A 4D92A 3BDAA 1D5WA 3FKSD 4HDOB 4D3SA 1SKMA 3QP9A 4WFQA 1Z75A 1M3SA 1W46A 1EE9A 4KAJA 4RENA 4K9OA 2OCGA 2DM6A 4QODA 3AK4A 3QWIA 4UD6A 2CXTA 5I9LA 3MWDA 2ZTVA 4D3XA 1JQKA 5J9FA 1WZCA 3R7LA 2HWWA 4EECA 4PPGA 3NHUA 3VKVA 4HNGA 2ZUEA 4EL5A 1KBZA 1P17A 3MRTA 1GRQA 2OMKA 5JVDB 2VDVE 2EW2A 2QZ4A 3D0KA 3OQMA 1W4BA 3OOEA 3NETA 5A1JA 4TKUB 2AC2A 4AP6A 3PFIA 3MOGA 1NDUA 4GF5A 4ZXFA 4NS1A 1M1YA 1VPDA 3GJ0A 2FFQA 2Y93A 3FNIA 4QAJA 1O89A 5FXMA 2V96A 4MMXB 3GRZA 4NX2A 3UJ6A 4BUCA 1YJCA 1CR6A 1Z2PX 1R16A 3IGFA 1TK2A 1EX9A 3IB3A 2A4KA 4GYWA 4ZT4A 1SPXA 3I6YA 3I52A 5IS2A 2H54A 1U0FA 4KV7A 2YQ5A 1YXMA 4DUZB 4DCUA 4XA8A 5K8TA 4KFSA 4Z4FA 1ZQ9A 3BTUA 1JR6A 3HJBA 2DLCX 2VQSA 3RYIB 2CV2A 1AX9A 1NBIA 1RAIA 2G1AA 1CQZA 2FMTA 1G7TA 3BCHA 4JYCA 2A0XA 3GJ4A 1G4AE 1MORA 1XLWA 3JAWB 3SOZA 4GQIA 1J33A 1US8B 3SFZA 4QQNA 3H17A 2EF1A 4LXUA 4ATNA 5CDGA 3A2NA 4C4ZA 2RCNA 4EHNA 3GLFE 6ABPA 1A82A 3ABQB 1L5HB 2IEIA 2Q6VA 1SFRA 3MTEA 5EGNA 1GA4A 4HPXB 1EG7A 4YT5A 3VKHA 4EJ0A 1YFLA 3E7DA 3QKSB 2P62A 3COVA 4F6RB 3ESAA 1JG2A 2BEUB 4LMPA 1W5EA 2J7PA 5K05A 1Y8QB 2VHVA 3GFFA 1EFLA 1XT6A 3FB4A 4JWKA 1UXIA 3IEMA 3ESRA 3K72B 1RE0A 2JS7A 3Q9UA 4Q1AA 3W6PA 1IBRA 5FPTA 4LF6B 3VO2A 5EINA 2PCLA 5BV7A 2QGZA 4DV5B 2QX8A 2BFFB 1U04A 3AFOA 5JAHA 4I99A 2HU7A 2IXFA 1LDYA 1TW2A 2AN1A 4DTCA 1LXCA 1QFSA 1X7XB 4YWJA 4JI3B 3IKLA 1NXPA 3DQQA 4AWBA 5EKXA 4UOZA 1K7XB 2LTAA 5B7GA 2FRDC 5E2IA 3WHIA 1DCMA 3LXRA 4MKHA 3AUFA 4D9FA 1W4RA 1AC5A 1SUWA 2I55A 4L0QA 3G7NA 4D7AA 1VC2A 2YRWA 4IHKA 1U94A 3V1YA 4YIHA 2C54A 4CQLA 4DSOA 3KTFA 3PKIA 3P71T 3C3JA 4LOHA 2E4AA 1BRMA 4MWSA 5KNLA 2FHSA 1DRVA 3TLCA 5DOZA 3N6VA 5C8YA 4JLWA 1GQOA 1RQXA 4E7OA 4HTFA 4M98A 1LSJA 2E4XA 2GK6A 3ICVA 1W7AA 3O8BA 2Q49A 3TZKA 1O6ZA 2F6RA 3OZBA 4QFDA 2G8LA 1ATZA 3R77A 2J9FA 2IHUA 3LAWA 3C8HA 3COWA 4MQ6A 2CLLB 3VX4A 1S2MA 2EAUA 4G0XA 4TMYA 4TV8A 1RYEA 1F17A 5IX8A 4M6WA 2QTVA 4X3PA 2VSXA 3IE0A 5KYUA 3ZK9A 4IKEA 1KGDA 2H31A 2PM8A 3ND6A 3PSAA 1SY7A 3ZNNA 3KE9A 4Z0NA 1VJDA 3IX7A 4PY2A 1SU4A 2IYNA 4PX9A 1SUAA 2QZPA 2V5VA 3GGPA 1Z88A 4UHEA 2XR1A 2C2MA 2PX3A 1TQ8A 5K8VA 2WJ6A 5FI5A 1TOAA 1TCUA 3CH6A 4LTDA 3ADCA 1PX2A 1JS1X 4ZAXA 1XMQB 3AF2A 5CXXA 4MX8A 4EB0A 3SEAA 4CM7A 3S44A 4NMLA 2HFKA 3NWPA 2LRHA 4MLPA 3A4MA 4H1TA 4KWEA 4AP5A 1FJHA 4NE9A 1VXOA 2AHOA 2XUIA 4KQIA 5LQDA 4PINA 4WOPA 5LSAA 1BU8A 3LT2A 4GOJA 3Q85A 1KMMA 1U9CA 3FPFA 4NDNE 2MSNA 2OESA 1L7AA 1HDCA 1TYDE 5EP2A 1JGTA 4XLZA 3OX2A 5EMLA 3HKDB 2QAJA 4O02B 3C7DB 5P21A 2GGSA 4G1FA 4HDKB 2B37A 1YF3A 1E60A 1FP6A 3NRCA 4BNLA 2WM8A 2DFTA 5G1NA 4UASA 5IJAA 5A5DA 2KBEA 4FJ2A 4ER7A 1U0SY 4N4AA 1H2EA 3D54D 3CY6A 5HDBB 2AQHA 2VCHA 1VLQA 1B0UA 3DGFC 5H70A 4ZODA 2PCJA 5I9NA 2UUOA 3IA7A 4Y7DA 1BXZA 3M6FA 3CZ5A 2F55A 1WDMA 2GBCA 3KK0A 4PAQA 1RCUA 4QEZA 4E07A 1E92A 3WGOA 1AKEA 2IY8A 2YC4C 4O4JB 4B7AA 3JZMA 1RXIA 2H6EA 2Z04A 2CFRA 3BFVA 5DW0A 5A9SA 3RYFA 3BGOS 3M49A 1QHGA 2CL0X 2E5WA 3PE3A 1NNLA 1WKBA 3ST7A 1FQJA 1UQRA 5F3DA 1Q1GA 2ECQA 4HDSB 4RVUA 2NPFA 4FDMA 5E8JA 3VZPA 4F7DA 4BB9A 1E9DA 3HXLA 2EBFX 4GQAA 4LJ5A 4PZUA 4P1ZA 4JC8A 2JJ1D 4RH0A 4F7WA 3RSLA 2H2GA 1KS9A 5AK3A 2CNLA 2OA0A 1M1XB 3A06A 2C82A 2QMHA 1QGUB 1L4HA 4YCJA 4GECA 1QAMA 3S2FA 1VKOA 1VYVA 2CLHB 2HIMA 2W0SA 3CT6A 3LHFA 2QP3A 4OU4A 1PLLA 4R8SA 5D86A 1U80A 2JGDB 3DH0A 3TOCA 2Z6QA 4D4KA 4U2EA 1EGMB 3KLNA 3R5JA 1JT2A 2IJGX 2AG5A 3K2IA 5AUQA 3MT0A 1U8XX 1GPH1 4PN7A 4FT2A 1TQ2A 4PLCA 3B7GA 2OORC 2R8OA 4JL5A 4NWIA 2YMPA 3QKRB 5CTJA 4AJ4A 1CT9A 4GOOD 3MCTA 3F4BA 5DNUA 1WU8A 2XQFA 1KAHA 1WMSA 2Y1OA 3NBZC 5HYVA 5C5DA 5JWOA 1NASA 4F1JA 2P0YA 4LXHA 3QKIA 5CDHA 2WAXA 4NNJA 3BSYA 4WNAB 5JDIA 5FV4A 4YJGA 5AR1A 3QFSA 2XHEA 3E7WA 4G0ZA 1SD2A 1NXTA 4GRDA 5KDDA 4DKJA 4B6SA 1R50A 2X42A 1WPGA 1I4EB 4N18A 3F9CA 3DLPX 3DDOA 5HFJA 3TRJA 5HF9A 3MEQA 2Q3MA 1SA0A 3KB6A 2EBHX 1CY1A 5FV7A 1JB1A 2GD2A 2RJNA 4WKOA 1P6QA 1TVEA 4KVGA 1BEUB 2XADA 1WZEA 1CHDA 3FVTA 3ROXA 4UVDA 1GNRA 1PL6A 5JXJA 1ZX1A 1RLTA 3FZNA 4TOIA 3L18A 3MFYA 1Z8FA 1UPBA 2YY5A 4G4GA 4ED9A 5AD1A 3FCEA 1DV2A 4IDNA 4XCVA 4AKEA 3UWMA 3HYRA 2EGUA 1QIJA 4J29A 2GPTA 3LUHA 2M32A 4EMBA 2ZREA 4MKGA 3EOZA 4DY6A 2C58A 1RAEA 2M6KA 6YASA 1ZNZA 5K6AA 5A5FA 1YB6A 3GJRA 1WKCA 3QVKA 4O4LB 5FJJA 1PR0A 3QX8A 4PCAA 1L7DA 1JHPA 4TYQA 3IQWA 5JQGF 1FY2A 4CKYA 1EI9A 1H05A 2FVXA 7GPBA 2CVFA 4P4GA 1NVEA 3HSYA 4O0MA 4OA5A 1KDTA 3L04A 2ATEA 3RROA 2PNFA 3RSSA 5G1OA 3SF8A 4R0NA 4UJ3A 1XA4A 2WHQA 3V1MA 4EHBA 5KYKA 1A1VA 3BF7A 4Q4HB 4KVFA 1EVQA 5ENZA 4JHLA 2CD9A 4H16A 2JLYA 2JCYA 2W2TA 4NESA 3X1XA 4F92B 3D8TA 1QOQB 1YR3A 4BB5A 2ID7A 3N8IA 3QG1A 1I3LA 2QVBA 2G7ZA 2PGNA 2CLSA 3C43A 3EZYA 5MFPA 1JX6A 1SHZA 3LQ4A 1E3IA 2PT6A 3HI4A 2AZ4A 3EYAA 2MR5A 1U4OA 4JI4B 4C0HA 4CKBA 1AHNA 1RXYA 2QTLA 2XI4A 2G76A 3IVXA 1X1EA 2R7NA 2I4LA 3KVOA 3LC1O 3Q7RA 1JKFA 3B1ZA 4RLSA 2PX6A 3K7EA 4O63O 3T3IA 1SXIA 1G3UA 1SB9A 2Y1KA 4AO8A 4CF4A 1FZTA 3CSDA 1UMDB 3O3NB 3KOMA 5FCDA 1FK8A 2B8JA 2DC1A 4YBRA 4OTZA 2EZ8A 2IC5A 4TZKA 1JILA 5DWDA 5EJ2A 3AERA 5E4TA 3U3ZA 2IUSA 3E27A 4PEVA 2AN3A 3U26A 4GSKA 5BN4A 2VUIB 1R27A 1JR3E 4LGYA 4DWJA 4D25A 3BXPA 1HZZA 1HGXA 3H1FA 2JLWA 3E53A 5KAPA 3IMGA 3LKVA 3P9CA 5J5AA 4D56A 2DT5A 2B9VA 3LDHA 4EHHA 1YONA 3SIPA 5ICCA 2JZCA 4H2DA 4CYMA 1RTKA 1NC3A 1ZIDA 2FY8A 5U4QA 2D5IA 3QKTA 3UV7A 4AX4A 5CLIA 3L7YA 3WXBA 3K05A 4OJNA 1M2OB 4ZC1A 5FF9A 3GGOA 1Z4LA 1NSTA 5BNTA 1ZGBA 3FLAA 1F5NA 4IG9A 3C1AA 4HWKA 4FKMA 3RUDA 1KWGA 1XHEA 2P5UA 1BIFA 3QHQA 5FBHA 4IS2A 3ASVA 1G3IA 1SVSA 3NTOA 2VJLA 4KUGA 1YB7A 1JH9A 3LC7O 1YR6A 1N2EA 3KB2A 5FA6A 4O2RA 4DUPA 2P2SA 5A02A 5E0KB 1P6UA 4TM8A 4FPXA 3H5OA 3OTIA 2CXPA 4DREA 2QVXX 1PJCA 1ZOSA 2RGGA 3KHUA 4DOMA 5I3CA 3LUDA 1NW3A 1P3JA 1KEEB 4PHTA 4RMIA 1F3OA 4L9AA 2W6JA 4RU1A 4ZO6A 5TX7A 2EP7A 1QDUA 3RNOA 4C22A 4ZT3A 5EZQA 5AKHA 3TCNA 4RIIA 3NCHA 4GPD1 3GEHA 3NANA 2B1IA 3RUPA 1JBEA 3SBDA 3SCZA 2R48A 4DQLA 4QDTA 4NICA 2FE4A 2DP4E 4WJZA 4P4SB 5AXCA 3UMJA 5DKFA 1Y5IA 1PD0A 4BC1A 3SOPA 2CWWA 1QIDA 1V5GA 1RRKA 2GZHA 5IM4A 1C7IA 2V7EA 3HZZA 1AH2A 1N1EA 5CNJA 5DPMA 5C52B 2W2OA 2GF9A 2I7VA 3L4BA 2W6OA 1XJQA 1I0ZA 5H0IA 2BI7A 1E0AA 1K63A 3VU3A 1GN8A 2VNSA 4QDJA 1ETHA 3M6AA 4RD2A 5GZ6A 1DEKA 2Z2IA 3O92A 4HCJA 2K7FA 2HZBA 2JANA 3WLAA 5BQ5A 4C5BA 4EP1A 2PYDA 2J7KA 4E31A 1JPJA 1ZD9A 3VA7A 5CCEA 3QLJA 4ZVRA 1KQPA 1T5DX 1GUBA 2B9EA 4N65A 4OBWA 3GLIA 1JE0A 1QF6A 1R9GA 2KWIA 4HWPA 1MN6A 1I33A 2P41A 4MVYA 4YP1A 4CDNA 1VI2A 1DC7A 1C29B 5FLEX 2OQ2A 1HF3A 1Q6YA 5LJLA 4JV5B 4D8VA 3LOUA 3NGLA 1HDZA 4R1NA 3JRNA 2WWIA 4Q9NA 3LWNA 4AMYA 2HREA 3VYUB 5M5BA 3SC2B 1OXKB 1WDLA 3WQRA 4PG7A 2VTBB 1YS4A 2R8XA 1EFPB 2ZBUA 2EATA 3D8NA 1R4NA 5HZGA 1GSAA 1MAWA 4NBTA 3ENKA 1N3YA 1YCHA 3W79A 1DWOA 4FI3C 4NAUA 3NOQA 2DBYA 1XKQA 2VJDA 3B3GA 2IYPA 3OE7D 2IV2X 1EK6A 1HETA 1QSGA 2GM9A 1F2TA 5CYGA 4HB0A 5TRTA 1P2BA 3IURA 3TVDA 3FPHA 2VTVA 4L74A 2BGUA 10MHA 2ZIGA 2X4LA 1KK2A 4GNKA 4XKJA 4R41A 4PTLA 3NV7A 4EZIA 2B1RA 4U7JA 3PX2A 4O3FA 4A6XA 2BFDB 3PCRB 1XFDA 1VFNA 4J1SA 3VPHA 1OOEA 4IKOA 5LN1A 2RHOA 4H7PA 5BQXA 1R10A 4W8OA 3FWKA 4X00A 1JDBC 3GVHA 3ROFA 4ZZ2A 1E1QA 2ZBPA 4URWR 1T5TA 1RPAA 3FF4A 4ZEMA 4DA8A 4IH4A 4RD1A 4JI5B 1L4UA 3UHFA 4ENVA 2HHJA 2JGLA 3F78A 5AKGA 5DOVA 3R8XA 4CT4B 2IE0A 3LQFA 1EFCA 3J80A 1Q17A 5EA2A 4TL7A 1T3SA 3CF0A 1KVRA 4IVRA 2XW6A 4TZ6A 3GGJA 2JEYA 5LXTB 3NBAA 3SBEA 3ISVA 3IR6A 3BXEA 4NK5A 4TWIA 5KQPA 2GYWA 1I3CA 1W581 4A6DA 5JS7A 1U5CA 4IV8A 3FJOA 4U39A 5AHRA 4OLBA 4PANA 2JLBA 2P69A 1MU0A 3MGAA 3MW8A 1UINA 3AT1A 1KNXA 2H48A 3C3YA 3E7FA 3PNBA 4UCQA 1NZFA 2I7CA 3H4IA 1Z0KA 3Q9SA 1FNDA 1E32A 3K6JA 3OP1A 1QZZA 3NKFA 3DE0X 4PVDA 4YRCA 4ZMSA 5KSZA 4KXXA 1E3EA 4OAOA 3E4CA 3HCCA 2ZSFA 3FLEA 6NULA 3ZV3A 2XLBA 3UB2A 5LDHA 2ZYIA 2GHQA 4QXPA 5I4CA 1XCBA 3DYIA 3DLHA 3N2GA 1BXGA 4XIIA 4RK6A 5B2ZA 3SJ7A 3BRSA 5ALYA 1DG3A 2YZ7A 2V8OA 3N1UA 3IUEA 5EWLB 4R6WA 3F73A 5TLSA 5AVKA 4QT0A 5BPHA 2OZVA 5BW4A 3EMKA 2F9FA 5JMWA 4R1OA 1DDIA 2O8BB 4G9EA 4WINA 1ONPA 3WYNA 2HM7A 3BB4A 5LOVA 1MEEA 4W5TA 3IQDB 1WNFA 1XPJA 1CCWA 4JU9A 4Q5IA 3AO0B 3AEKA 4CN9A 1QIEA 1FDVA 5HBRA 4LAFA 4MXDA 2PZEA 1FX1A 1DQNA 5ICFA 3CHYA 3OZRA 3ADBA 5HEKA 1M6NA 3CNQS 2AV6A 4WK4B 2J3HA 5E7JA 5EJFA 2AD5A 1XMSA 5AWFC 2FKNA 4TKVB 1KI2A 1KFBB 4BN0A 3H5RA 1H8HA 2BKVA 1XVLA 3E6AA 4OB7A 2D2VA 3CGWA 3WWOA 3PXEA 1KVSA 1JJBA 1RPJA 3UOGA 1M6VB 2ZUDA 4GP7A 2PKWA 1SBHA 1HMYA 1RYZA 2ZSAA 4FNGA 5KYWB 1L4BA 2N0SA 3B82A 4L1KA 4CKXA 5BR1A 2FH5B 4Q21A 1A5BB 2I2FA 5CEEA 2PUBA 4TSFA 3BRCA 4F4CA 1JLKA 1O08A 2LUOA 3U4AA 1NVBA 3RREA 2GN9A 3RHFA 1GG2A 4A15A 1KKUA 3EDQA 2H65A 5J43A 3QTBA 4TPKA 3GWZA 3GWGA 3LPDA 3P97A 4MMZB 1QFZA 1Z7EA 2EKPA 2WZBA 4J7XA 1U7OA 4OQXA 5FNVB 1MX9A 4L8YA 1ZQ1A 4XQ9A 2JFVA 4MWZA 2Y66A 3ZE2B 3B8HA 3WVNA 1UC4B 4YRMA 2BFCB 2GCPA 2VDNB 2J6CA 3LX8A 1VSVA 4UREA 3UBMA 2PL5A 2X5JO 4ZT5A 1CUBA 4R40A 3DDWA 2X5NA 1IBLB 3DDZX 1Z2DA 3K9GA 4PZEA 4B81A 1WY5A 1PTJA 1JBQA 1OT5A 1PJRA 2AG0A 2FF7A 3MBOA 3ZHQA 2DVMA 3RH0A 1IY1A 1LWOA 2XNKA 4UU8A 5A2GA 5E4YA 3DAHA 4MV4A 1ZK3A 5T57A 2OXFA 5JIBA 3K4PA 3AU9A 4MVWA 3VDRA 1OIWA 1I36A 2DPHA 4K2HA 3TUZC 2R0QC 3HCPA 3QWBA 5GJBA 3VAAA 2O0KA 3BIXA 4L95C 4MI9A 4E5UA 1EZ1A 4I4NA 3EZ7A 3FYCA 4E4TA 4Z54A 1XELA 5IJ0A 1PNTA 1G59A 1GV0A 3Q3VA 4V0OA 1U7XA 2EZ9A 4M0KA 2QW1A 2N47A 1JB9A 3ILSA 3EVCA 1YKGA 5D5QA 2R97A 5NLLA 3SJZA 4GVXA 3V4VB 3W2HA 1C7ZA 1PR5A 3LBFA 2OHFA 3V8PA 1YZLA 4IUCS 4JP1A 5ARCA 4WZ6A 4JQYA 2XZOA 3WV4A 2PUCA 3PPWA 4MARA 3TR5A 5BRNA 5CM9C 4EB3A 2QROA 3QITA 4PO1A 5CA1F 5FAKA 3ABSB 1CIJA 3K3PA 1E2MA 1G5FA 3IDSA 3S2YA 2CXQA 2P3LA 2WPDA 2FEMA 3ZXYA 5CFZA 5K8LA 1UJ5A 3CZCA 3RVOA 4RJIA 4EG5A 4P34A 1DXYA 2G28A 5AK6A 1Z6GA 3KKMA 2SHKA 2A5GA 2G04A 2Y1FA 3PIIA 2NGRA 4QOIA 1VMKA 2OM6A 4GPZA 3JTEA 2IOQA 4DZTA 4OIMA 1FLAA 3SVZA 5T6BA 3W4KA 5F4ZA 3UJ7A 5GVSA 1B6TA 4J8PA 1TIBA 3PNVA 1UEIA 1CUCA 3DFIA 4HQNA 2P4SA 4WKPA 5HF8A 1YD7A 4LMAA 2PG3A 5DK4A 3CMMA 4CTNA 1TCVA 3OU7A 4Z1MD 3DXZA 4FLFA 4Y1FA 1RKQA 1J2YA 1JBKA 1D07A 4H27A 3AYZB 4KIUA 3QG5A 2GJAA 4DDHA 4QUDA 4DR6B 3OFND 4D82A 2D2EA 3ZCRA 4C0AC 2B69A 3KUKA 1I2DA 2UZ3A 3Q7SA 4QRIA 4X3OA 1W8IA 2HPHA 4Y9TA 5DLEA 1G5TA 2QU7A 2RHHA 2NU6A 2Q1XA 4B4VA 2H17A 3IL2A 2NMVA 2WJGA 4AULA 1BW9B 1J8MF 1ENPA 2DFLA 2XYQA 3DZBA 3L8GA 3B9QA 3ZU6A 2C7PA 5JPIA 1X9IA 3B9PA 4YXWA 2NN3C 1T4BA 3JX9A 4F5YA 5JJCA 1NMXA 2BGNA 2JGMA 2QX7A 5KJ6A 3FR8A 4EI9A 2E5LB 1RHQA 1WAMA 4P80A 5DT9A 4Z3DA 2VHJA 1JFFB 1GWNA 3C70A 2XKJE 4FUTA 3WK5A 1Y9ZA 2PGIA 5AVTA 2A6PA 3TDMA 2NO5A 1R0WA 2QVLA 5KDOA 1MEOA 4KK4A 1PGPA 1RZVA 1IPFA 4XSGA 4JUIA 1QYCA 2P8JA 4G9GA 3II6X 4DSAA 1BXRB 4Z3KA 3PGA1 3SS7X 3TOXA 3D4IA 3D7SA 3KJGA 2HCBA 3IDFA 1R8JA 1YVRA 3PL1A 1NQOA 2OK7A 3NWEA 1GXSB 1NBME 1CVLA 4JFAA 1P1JA 5J4LA 2G0TA 2VPIA 5EUBA 3WB1A 1WCYA 3R09A 2G9VA 4K26A 4GL2A 2OSBA 2H7XA 5AICA 3PBKA 4L3WA 3L8HA 2CLFB 3H3FA 3O1HB 4RSRA 5G41A 1UBOS 3PTAA 2C3OA 2HGZA 1XNGA 2C5SA 3GNLA 3CUSA 2ZSIA 3VKUA 1T3TA 4JL8A 1PKEA 3K09A 2IWRA 2CLCX 3SKYA 4Y6QA 3BMQA 5CU7A 2FXVA 2G36A 1HL3A 3GEMA 2C2YA 4PS1A 2XUDA 4NZZA 4Q02A 4LS3A 1R0BA 4CM1A 1IZZA 2SKCA 1ZUNA 3OOSA 4JOSA 4JVSB 3SG0A 4E5NA 4G0VA 1GA1A 1GLNA 5H59A 3RRXA 2VPZA 4INAA 1S8OA 3KAKA 5HF6A 5U1PA 5DX1A 3GFQA 4KWIA 3FBGA 3B20A 1CZHA 1GQRA 1FP4A 3IIIA 4BV3A 1KI8A 1OTXA 1KR5A 4OI2A 2VFAA 1V16B 4QNMA 4IGKA 4UBNA 4EPXA 2JNWA 4IS3A 3NW9A 1IUNA 1Z45A 2BDTA 2AUNA 1UR5A 3CR3C 3E3MA 3H1AA 1VL1A 3INYA 4EITA 5ER9A 1NU6A 2WF8A 3R8CA 3AY6A 4QTZA 5L4SA 3PICA 1HYHA 1NR5A 3U6KA 5DHRA 3VHXB 5JO0A 1XRLA 1OY1A 3IAFA 4ESOA 4DIKA 1D2EA 3KXLA 3DG9A 5GGYA 3D6JA 2GJSA 3O83A 4V0SA 1Z4IA 1Q21A 1GTJ1 1A4RA 1KYVA 1B2RA 1S3IA 1TM4E 1IJEA 1SKYE 1JEOA 2FP4A 4J90A 4JLNA 1DAIA 2V7PA 1BD4A 2GM5A 2ODNA 4M1QA 1HOTA 4RK5A 2DHRA 3T1QA 1CYDA 4X95A 3EWAA 2VK4A 3G2KA 3ZCVA 4EG4A 3H6KA 3FTNA 2FW9A 3P0RA 1ECPA 1ZWLA 4Q47A 1JYFA 1A8SA 1TZJA 5CYFA 4YAUA 2WWRA 3F71A 2I1QA 2I33A 3A14A 3WE7A 4ZI7B 3G7UA 3SEZA 4CEHA 4IRMA 1M2VA 2C4TA 2GPWA 2IELA 2WVHA 3G2JA 4TXHA 5CEJA 2A88A 2W2NA 2R87A 4FGJA 2Q1TA 1IHXA 3K5IA 3KT0A 4V3CA 4YAOA 5EEGA 1UK6A 3RB8A 3V8RA 3OE5A 4REQA 1B8VA 3ZW9A 5B3JC 1W6RA 2AMJA 2FEAA 1EK2A 3U7FB 5KVSA 1BWPA 4JGGA 3D1VA 1XCLA 4NBWA 3TJMA 3U56A 3K1TA 1A9QA 4K87A 2CFOA 1E77A 1V3VA 3R3ZA 4G4JA 3NNDA 4QJ5A 3TTUA 4D4GA 2JFXA 4DIBA 2XAUA 3EIHA 2EKDA 1V7QA 2C5LA 4TL6A 3X2EA 5F7ZA 2PPLA 2XGGA 4FHEA 2A92A 5A4DA 3X1DA 1R1DA 1OT3A 1ZC4A 2UYYA 3IQXA 4UZEA 4AKIA 5AM0A 2GRUA 1UXKA 2YZNA 3GUHA 1BCSB 1W1WA 3H4TA 4PQFA 5KYTA 2ZSJA 2BBWA 2CYAA 3I9V1 4CMHA 2VT7A 4WZAA 3DOOA 4MCHA 2CZGA 3I8OA 3N2LA 1WVMA 5K51A 1T9ZA 1W0JD 3ZDRA 5AW7A 2VXYA 3UJ3X 1Y1RA 4X0EA 4K8RB 4RV5A 1JQDA 1RBMA 2X41A 5TQ2A 2WTUA 2UVDA 4TV9F 4QIHA 3DXYA 1WXIA 1ZMXA 2EEZA 3F49S 3OJWA 1OV6A 4H31A 4D02A 5EXXA 3VI4B 3G2NA 4CKZA 3K6SA 5EHZA 4BRSA 3HDVA 3MWFA 3QTTA 5EWJB 2XUJA 1IM8A 4NH4A 2ETVA 1A71A 3G49A 3HBAA 4PAOA 2MMCA 4EY4A 3CLHA 4INPA 4RIHA 2XGOA 3AHGA 2JEZA 3UAYA 3T9DA 9LDTA 1R18A 3BWDD 3K9CA 1RXEA 1N36B 2RH9B 4GPAA 2I1LA 4XTCS 4KAFA 3AUTA 1KDRA 3K9QO 2PWYA 3N75A 4MLZA 4XGKA 1RQLA 2QF7A 3IRVA 4J7UA 1L7VC 2VL7A 4XQEA 4RL4A 2N75A 4KX5A 1KO1A 2H4YA 2DKNA 3O31A 2QL6A 1SC9A 1MTZA 1KL7A 3NDJA 4YJDA 3H8SA 1UOEA 5K0LA 3V6MA 1Q2UA 4U63A 1J2EA 1IQRA 1E3QA 2V4UA 3G9UA 3K32A 1EP9A 1DADA 5K20A 3PHHA 5KREA 1QM5A 1L9KA 2PMKA 3OTQA 2DCUA 4P84A 4DLSA 4Y0VA 2PT5A 5KYXB 2RGWA 1R12A 2KX7A 1CY0A 3CMCO 3LT1A 4KE9A 1L2TA 2I22A 4BO8A 5BYJA 1SXQA 3FY4A 1H9AA 4AQYB 1X2BA 4N8EA 3LF2A 1E89A 1KO7A 3N5KA 4DSNA 1CS0B 2ZT5A 3IHWA 3LY9A 4LKOA 4XFDA 2DPYA 3NDRA 4UBOA 1ESEA 2HRBA 2Q2WA 3ILHA 5IXYA 5JNLA 1Z4OA 2JFNA 5IYZF 2Q6OA 2YJZA 5CW2A 3ZJYA 1H42A 3TINA 4KIWA 3EVAA 1FVOA 4ZFNA 1JI0A 3I83A 4X20B 1CRWG 3DA8A