1V9CA

Crystal analysis of precorrin-8x methyl mutase from thermus thermophilus
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
204
structure length
198
Chain Sequence
RAIEEESFRIVDQEAGPHGFSPLEWPVVRRMIHATADFEYKALTRFSQGAVEAGLKAIQAGARILVDARMIACGLNPERLRLFGNEVVELLAHPEVVARTRAEAAVAYAWEKGLLDGAIVGVGNAPTFLLALVEAIRQGARPALVLGMPVGFVNVLEAKRALMEAPVPWIVTEGRKGGSTLVVAALHALIRLAADGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Precorrin-8x Methyl Mutase
publication title Crystal Analysis of Precorrin-8x Methyl Mutase from Thermus Thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Isomerase
total genus 61
structure length 198
sequence length 204
chains with identical sequence B
ec nomenclature ec 5.4.1.2: Transferred entry: 5.4.99.61.
pdb deposition date 2004-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02570 CbiC Precorrin-8X methylmutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 1v9cA00
3E7DA 1F2VA 4AU1A 2AFVA 1V9CA 4FDVA 1I1HA 1OU0A 2AFRA
chains in the Genus database with same CATH superfamily
1GKKA 3GG9A 3ZDAA 1G20E 3EGEA 1UQRA 4NFHA 4TSFD 2AOTA 3T3NA 3E8MA 1B74A 3EC1A 2GI4A 1T5LA 3RS4A 4YQFA 1HEUA 4J1TC 2CXRA 4B8ZA 1MAHA 1OE0A 5B6IA 2BZGA 1QV7A 1U5BA 3IBFA 4I50A 2FSVC 5CJ2A 3SEFA 2W37A 1PR2A 1NP7A 3FJOA 4YUWA 2YJ4A 2OPHA 1DX4A 1W4LA 2JASA 2GZSA 3HXTA 2PZKA 2WTEA 4PFJA 3PDCA 4GPD1 1JR3E 2Z2YA 1WPGA 3DLPX 1DAGA 3H8VA 3VPFA 3M6IA 1WABA 1KEWA 2X0KA 5G40A 1PWXA 1X15A 2PXAA 4NMWA 5DNCA 1S2OA 1Z0ZA 3LO5A 1ZD8A 4HXYA 5BVHA 2BJHA 2P2GA 3IKJA 4DMFA 1EGMB 5IWAB 3I9LA 1U9IA 1EUCA 2XDQA 2AWNA 3A31A 4BVKA 4EPTA 1QLWA 4TS3A 3B9QA 1PP4A 2V7WA 3FSGD 4LXUA 3OLXA 4ZVOA 1C7FA 2G72A 4RQBA 4CZ2A 2C94A 3AGPA 4Z0NA 2P11A 1XTQA 4IXTA 3HXKA 3HKEB 4Q34A 3ITNA 4HWOA 3A27A 4LV6A 1NW3A 1LNSA 1D1PA 3BSSA 3UAZA 1EWVA 1M1YE 1X7GA 2EATA 2PGDA 3M82A 3WLSA 1BFUA 3DMFA 3B13B 3EIOA 3MXOA 3ND9A 4BO4A 1RZ3A 1ZN9A 1AGYA 4O6VA 1A2QA 4E6PA 2ORIA 3JATB 4QL3A 1E4EA 3O9MA 4V2IA 3C4VA 1L5VA 1YC2A 3TRDA 1VL5A 2H7YA 1RVV1 3LQRA 3L7DA 4Q24A 4FYKA 4H3SA 4NBLA 2CKDA 2Q45A 2QAGA 3T5GA 4IRXA 4O4JB 3GZNA 3H6GA 2R6HA 3EVGA 1KDZA 2DXIA 4L7VA 4OU5A 2JGLA 4LJAA 2D59A 1GO2A 2PX6A 1M6VB 4MH0R 2NUPB 2ZQ5A 3PI7A 4OJMX 4D74A 1JJAA 1JPVA 1P0FA 3LHSA 3OIGA 4P0QB 2NSHA 2YUTA 3K0AA 3HN6A 4A10A 2VDVE 1E7MA 1J5EB 4KQ9A 5HTOA 3IJRA 3QOXA 5JXHA 3A10A 4MA0A 4OB6A 1NONA 1KJWA 3I12A 4JJAA 1LK0A 1E6KA 2FW7A 3EFOA 2FPIB 1VE3A 1P1KA 1Q74A 3LFHA 3MBKA 5K0FA 3P1JA 1E0AA 4ZQEA 1IYZA 5IM4A 2DH5A 1KFJB 4HDCA 5B1DA 5ILQA 3CMCO 3HRHA 4YT8A 1XTVA 4MV3A 2I1VB 5IHXA 2C07A 2WTMA 4JNCA 4P08A 3CO0S 4BMVA 5LB4A 3L0CA 1RBMA 1C4KA 4AMZA 2O8FA 2JVJA 1KMNA 5DYYA 1E6WA 1H8HA 2IYWA 1M0SA 1PVDA 1YS7A 2FEMA 3F6CA 3M4JA 3IEIA 3QVJA 1EKXA 4P4SB 1Q1AA 4IDPA 3SQDA 4TUYB 5JPDA 1OTHA 3PEWA 1LC0A 3C15C 2JFFA 2N3ZA 3D31A 1JT9A 3HDQA 3DTNA 4K86A 5J2TB 2O5EA 3SKYA 4V03A 3I9V1 4S1VA 3AUAA 4HFNA 1YA8A 3RIHA 1RTTA 5CFNA 1A98A 5EXDA 1CBUA 4P54A 3D0OA 2PQ0A 3AY0A 4A8JB 4ZKDA 1OB5A 3KX2A 4HLDA 3T7EA 1BEEA 5LP6C 3RNOA 3VKHA 1T2AA 2VBFA 3IIMA 3ILHA 3GCZA 3C8UA 3H04A 1XTSA 1NXOA 16PKA 2FWJA 3FDZA 1XRPA 3LIIA 4Y2GA 3WISA 1EUDB 2D4HA 5E9WA 5A06A 4GM4A 1WJGA 2NPIA 2QD1A 3CRVA 5DHQA 3ELUA 1JDZA 1RRGA 4MQFA 4DILA 5MDHA 2D8MA 2BGMA 2V9PA 1XTUA 2X23A 3B78A 1JIQA 1DJPA 1T9ZA 3EGXA 3C3AA 2ZJ6A 1HDRA 5FWYA 4HS4A 5K03A 2PE5A 4WXMA 4QUKA 5LUAA 2Q46A 4U7GA 4RY2A 3TLGB 3WYGA 1JN0A 2WILA 3N9IA 4KBGA 1TVKB 2IEGA 4JT4A 4LZPA 3ZHQA 4BCDA 5FLKA 1DQZA 3RSQA 2NZUG 2J7KA 3NT5A 3EOAI 4YRNA 1VIYA 2CXUA 1NU6A 3R77A 1F0PA 4Y7DA 1MEOA 4EB6A 4JJGA 2DUJA 3B9BA 2FPRA 3IKLA 4LY3A 4AMUA 1KSHA 1E8DA 2M2IA 3HWRA 4U0KA 2OZLA 2YRWA 1WHSA 4RIFA 4O2BA 3K8YA 1X0VA 4WLEA 2W2XA 2O48X 4L0DA 3ZI4A 3NIFB 3H5LA 2V96A 3NMUF 3OD5A 5JCZA 1ESMA 4YRFA 3BORA 1PAUA 3LQYA 4DF3A 1GQ2A 4OXYA 4CQNA 2PS1A 1I4EB 3C8HA 3VUFA 2AA3A 3LY8A 2KM1A 3OE7A 2ZJBA 4OLHA 4Q9AA 2ZKLA 3NWBA 1ZLYA 1FDTA 3HYLA 1FUEA 4TM7A 5HF9A 2WYVA 3TLCA 3UOWA 4B40A 2QRGA 4DLXA 2X0FA 5KVSA 1AH2A 4EEZA 4P93A 1ZIXA 3LX4A 5FQNA 1Y5NA 5KU7A 1M2FA 3S6JA 4I55F 5FPSA 4QVIA 1LD3A 4MRMB 4DT1B 5CCEA 2GTHA 3R6TA 2O7SA 4B74A 5IT5A 1M10A 2Z8YA 2O6HA 2AE1A 3ZZMA 1JHAA 4HCJA 1SG9A 1GPAA 3HJTA 4EK9A 3E3LA 2XF2A 3L6RA 5EKDA 2R7KA 2AEMA 3GU3A 2H1RA 2OV3A 1E3DA 4I14A 2Q0XA 1KZHA 5F9MA 1K7SN 2NVWA 1XVAA 1Q0SA 3H2KA 5IYZA 4GQIA 3RUHA 3RREA 4BEWA 2PS9A 3O91A 4RDHA 1DOAA 1TM1E 3JQBA 4UEJA 1P7PA 4G0ZA 1ITZA 4L28A 5I7AA 2NM0A 5BW8A 1EXMA 4QUEA 1BU5A 5C37A 4NF2A 2FP3A 1T26A 3O38A 3PWKA 4KR0A 4UM8B 1DTEA 1OXMA 3CT4A 1IOZA 1XTZA 3HMKA 3H3FA 4Q3KA 4DIEA 4OHYA 3OZTA 2YV5A 5AW8A 1SCQA 3UV3A 4KI0A 3W5SA 3KTOA 4RADA 5DU2A 1IOLA 2AKAB 1U2GC 4BFTA 1PFKA 2Q7DA 5CITA 3KKQA 3LQFA 2QUHA 3UGJA 1HT3A 1ZUNB 1RHUA 3Q0EA 3PNOA 4ESHA 3UOGA 4Z3OA 2Q0QA 4U8GA 1G8MA 4F1KA 5IASA 4ZKEA 5LL6P 4Z4GA 1V41E 2R1TA 3K4HA 3L04A 3N0TA 4Y6OA 3T5PA 5P21A 4KKXB 1WU7A 1WTCA 1WL8A 4B35A 5K45A 3DMRA 1I3CA 1WXHA 4M0EA 1Z2DA 3GFFA 1I01A 5LIPA 4UAUA 1GPH1 1RJ9B 3KFXA 2Y0DA 3M6UA 3QF4A 4H4DA 3HJFA 4D3FA 3J7AC 1AN0A 1TPYA 1A71A 5H7XA 3UENA 3V1KA 4BTLA 1SZCA 1VI6A 4MHOA 1PV1A 3D7NA 3IUSA 4S1TA 5FA6A 4EB3A 4XE5A 1DQRA 3FPKA 1UKVY 2QW8A 4MYDA 3PGJA 3SK0A 2MT9A 1BTOA 4YP6A 3WK8A 3ICWA 2YRFA 5AFSA 3PE6A 5A0VA 1T43A 3UGTA 5ABPA 2REXB 4S2EA 2D5AA 3VPBA 3UC5A 3ZD8A 1PV2A 4CLOB 3RUFA 1Y1SA 2Z2IA 2DPXA 1PJBA 1UIRA 4B0OA 3ED1A 3ZH9B 2IWRA 1GG8A 3UB4A 4DLTA 4EPWA 4I6GA 2ZETA 3L4SO 2AZDA 2RB5A 4L8FA 4ER0A 3OCJA 2B61A 2YMLA 2NIPA 2H1VA 3DR3A 4JUCA 4NG5A 3TTXA 2VH2A 5LDGA 5CA1F 1XD2B 2N9UA 3ITDA 2WF6A 5DP1A 3T9EA 4CKEA 2PKXA 2PUHA 2R62A 3NLLA 4DCSA 4OMDA 1EYZA 5DHUA 2RAVA 3HV0A 1V8PA 3O8QA 1UBOS 3SR0A 2Z08A 2ZT8A 4LE1A 1GEEA 2PX3A 5DNEA 4GKAA 2LBPA 3EGVA 4WFIA 3CZRA 3V7NA 1JFFB 1NTRA 2FN9A 1JBKA 2FFJA 3GQVA 4MVWA 2A9OA 4M60A 4O08A 3WJ7A 3BJIC 4ZYVA 2GPYA 3AL0C 1KYYA 2IP4A 4J0DA 1IHUA 4B4UA 3ENWA 1Z75A 3RJ9A 1DRJA 2B37A 2I99A 3F9IA 3SIPA 1XTPA 1VG0B 4DLZA 3C41J 1ZH4A 1FCJA 2J6BA 1XZJA 2C3MA 1GJRA 1RMYA 4LHXA 5MGNA 1ZIPA 2G36A 4BAZA 3O8DA 2HLNA 3DDSA 4N6OA 1JJFA 3PFKA 2RGXA 3E9MA 4EMSA 1E2HA 1T4GA 5DISB 3HRIA 1L4GA 1DEKA 1VXOA 1XKTA 1I0LA 4PBTA 2GK6A 2YWFA 1WSBA 3ZXUB 2VXYA 4UHJA 2YYZA 2FDXA 1YQUA 2M9MA 1BJKA 3LXRA 3VBCA 1W0CA 1DIRA 4RY8A 4BO0A 3KQKA 1NKVA 2PS3A 3K6JA 4ZU3A 3ETCA 3ABIA 4H1VA 4AO6A 2XEXA 4M9QA 4X61A 1P7WA 3I45A 4NCXA 1FXUA 3HYTA 1FFBA 4JQYA 3K0SA 4G1MB 4XR4A 4WCFA 2FSFA 3CNOA 3CRNA 4AN0A 4DV1B 1JVBA 1GDHA 3B1FA 4BLOA 4CMAA 1U2RA 1VSQA 1EK1A 3N8NA 3UJPA 1CEEA 5EE5B 2PNJA 3QLUA 3O2SB 4LBYA 3I76A 3OT5A 2I2XB 5T41A 1DMSA 1KEEB 1NFQA 2JCVA 3JXEA 2ZT5A 4HB0A 3UW1A 1CY2A 4MW5A 2JCBA 4HYTA 4F3KA 3BYZA 3DMPA 4BPRA 3GGSA 4ZOLA 4BN4A 3W5UA 4DIUA 3QSYA 2E7ZA 4ZYUA 4DSZA 4ZODA 1NI3A 1GLVA 1G2IA 5DNDA 2ZWVA 2AJBA 4HRYA 1A9QA 3QH4A 4EMUA 2P9JA 1SBZA 2QPAA 1CNFA 4RTLA 1P4GA 1RCUA 4E7PA 3OPYA 1GGFA 2Z6VA 1YZFA 3AVVA 2JJ1A 1PI3A 2WA2A 4N54A 4XTCS 5T3UA 5JJCA 1AUQA 1J7KA 1W0KA 4K3UA 3OQJA 1ENPA 2XQIA 1JHUA 4KB5A 4YRQA 5SZJA 1E9VA 4B09A 1OYWA 2QRNA 1B0UA 1EVEA 1KL7A 1R00A 4WK0B 3P2YA 1A5TA 1SGWA 3IOMA 4KE8A 4XGRA 1GPNA 1M2OA 3H8JA 5ED0A 2QDKA 5BQPA 3RSGA 3S2SA 4DRXB 2XCTB 4M9UA 3G2KA 1K63A 3CGWA 3ZE2B 4LF8B 1RM3A 3IVGA 3DCYA 2Y1GA 2ZYIA 3H9JA 3FPEA 3E1GA 4K6FA 3LT1A 1IJKA 2IPXA 2WJAA 4AJKA 5CB4B 1FTYA 5MFZA 3NHPA 3MINB 3AWDA 2HHJA 3G7UA 3OE7D 1RWXA 4KUGA 4MSUA 1GZ6A 3FMVA 2I4RA 5F64A 3RUPA 1JJIA 1HLFA 3HB4X 4A3SA 3WJ2A 3QUBA 2VP2A 5L3SB 4KFTA 5AP9A 1G2PA 1ZCFA 5DEIA 3V1LA 4BJ5A 1T3LA 1QZTA 1D4ZA 3MOSA 5M3BA 4X93A 4Y0AA 1YUNA 4J1NA 1U9IC 4ZHQB 5A04A 5LZ9A 3DM5A 3IR7A 1M72A 2NVBA 2ZCVA 2IXEA 2PANA 3K30A 4TMVA 2OT3B 3ZX4A 1FB5A 3B3QA 3WK5A 4EKNB 1NZFA 5F78A 5KYUA 4ETWA 5K8JB 3AC0A 2HWWA 1A9SA 2WSBA 3U17A 4K6KA 2P77A 3I01M 1O94C 5FR1A 5HEKA 1ZSVA 5EMHA 1JT2A 3U4DA 2XECA 1C81A 1KZGB 5J4LA 3DB2A 1QQBA 2QM8A 4EW1A 1UM9B 1LLCA 1Z7BA 3BXGA 4TQGA 4DCMA 2BVNA 2E4ZA 1GUAA 3E9CA 3I52A 1XXLA 1KWGA 3QKIA 2Y76A 3ND8A 3RS2A 3KYBA 3EUFA 1NSTA 3R3VA 3IAAA 1M2GA 4YMHA 1I4TD 4Y2PA 1NRWA 5F52A 3MTEA 3KQNA 3L06A 3D81A 1HL7A 2OCKA 2QAGC 1K66A 3JR3A 3VZSA 4F2DA 3LPLA 3UIEA 4BLSA 5LOVB 3FKSA 3A6KA 1WXEA 1NVMB 4G86A 5B5SA 3WJ1A 5JDCA 5TNXA 1R0WA 1T9GS 2BKLA 2A9QA 2W4IA 3RYHB 3V32A 3DMNA 2BFEA 1O0CA 4G24A 3FVTA 4JU9A 2CYBA 3JWHA 1HEYA 1T5BA 3N2EA 5ALRA 1MEEA 1P0MA 1Z0IA 2ST1A 5JZMA 4HNAA 1QYIA 4GLBA 1W47A 3H84A 3AVUA 3SBXA 4EH1A 1IAVA 2ZIEA 2AXQA 4ZALA 4ARUA 2XMBA 3HP1A 1QIIA 4WNIA 2BEJA 3AIOA 1LSJA 2H7VA 4C3ZA 2CFOA 3LKBA 1VPDA 2EZ4A 5ICGA 1ES9A 1GILA 2QDXA 1BDIA 4ODIA 3F9RA 4OY3A 4YJKA 4PHHA 1W4CA 1CUIA 1L4NA 2RHMA 1U9ZA 4I1VA 4RGVA 4IJQA 3GROA 2ODTX 2XUDA 4L4RA 3S70A 2EJUA 1ORVA 4ZO9A 3IEPA 4O4LF 5HIJA 2VBIA 1FFXA 3LZDA 4B3FX 3R24A 2X7XA 2WICA 4Y2YA 4H0FA 2V7UA 5LZ7A 1TIKA 2XMGA 4RTSA 1LK7A 4XPIA 1NLMA 1F60A 4ZMBA 1PKXA 3I0NA 3UY4A 5IZ4A 2RH5A 1E2KA 5LQRA 5CYPA 3THWB 1D9XA 1QH9A 1KTVA 1SA0B 4YLGA 4JUDX 3TE7A 1IZ9A 1WAMA 3ME5A 4ND6A 4YMWA 4BLRA 4E1AA 1HFEL 2ON6A 3ND7A 1H6CA 2HSWA 1QNFA 2HV9A 2GN8A 2XNDD 4QODA 4UNQA 3W5IA 4UTNA 5JYEA 3PFFA 1G3RA 4MXDA 5AESA 2O2IA 1SXJB 4LYEA 1RE1A 3N2GA 4BNYA 3JAMA 2ESRA 4BJ6A 2HI0A 1L4MA 4KO3S 4JKYA 4WASA 4M0CA 4R1QA 2UUBB 5CX1A 4ZTBA 2I7TA 1PJRA 3I6BA 5K3DA 1SOVA 3EIWA 3G5TA 2XA9A 2FK8A 1W49A 2W2MA 3LNTA 5EC8A 2JLCA 5EGSA 4BQOA 2FUKA 3IP5A 4U2CA 1C1DA 2CDCA 3OOYA 1PUXA 2WFAA 3TRIA 4A92A 2P6MA 4LS3A 1XNHA 2W9XA 4EARA 5EJ8A 3OLCX 3WLHA 4U7WA 4AM8A 5CLJA 1DBVO 2AUMA 1XZQA 3TCXB 3ZE6A 3WTCA 2O06A 2CFTA 3AFIA 5CDSA 4U6SA 1CNEA 5A9RA 3RH0A 1R10A 2Y1DA 3SFZA 3UT5A 3WZLA 4JX8A 1X2EA 4BZQA 4PQYA 4CIVA 3R09A 1UT5A 2ZJ4A 4KMSA 1SUIA 1CIVA 1QF9A 4R1NA 4G85A 3SM3A 1YMUA 1YTLA 1NBAA 3PCXA 3OLVA 4D9KA 2B6HA 1IZ0A 5C7IO 2PJRA 4MRSA 4JLUA 1XRSB 2AFIB 1UQTA 4LDJA 5AOVA 1QFZA 5FFNA 3WIUA 2Q4EA 3A6FA 5M04A 3NDPA 4JBHA 1WLSA 2YVQA 2ZOSA 4OM8A 1HT2E 1MX3A 1X0XA 1YBVA 1X7YA 2C8VA 4QHTA 4G1FA 2QR2A 2IHUA 2IE8A 1CP2A 1QQTA 1W2WB 4W6QA 5EQDA 1GRNA 4BQIA 4QDTA 1DWPA 2YVLA 3P71T 3ZGVA 5JHGB 4QYIB 3WFIA 3PVZA 1Y4UA 4BECA 2XNSA 3S40A 4RD3A 3U19A 2WTUA 1ZM9A 3OTGA 2JPDA 5BWOA 4IMIB 1JEOA 4MW1A 4Z1OA 4FS3A 2PH5A 1JPUA 3B1VA 3C6MA 1O8CA 3BB1A 3BCUA 4Q1FA 3CEPB 1RMQA 3B3AA 1HK7A 1XRQA 1KPIA 2H4YA 2OGTA 2E2WA 2ZUUA 1I13A 4Y2UA 2QT0A 2DWPA 1QYWA 3U5TA 4YJ3F 2GZMA 3R3JA 3R7FA 4A6DA 5EQFA 5IF9A 4ENWA 5JU6A 1IM5A 1IU9A 1U8FO 3H5WA 4JYMA 1S2GA 4OL0A 1A82A 1UJ4A 4QELA 3KXDA 3SQXA 4GKKB 3OCZA 2BMDA 3JQBC 4DNFA 2D2XA 1PEYA 1SQ5A 3AEXA 4DA0A 1RXSA 2OCPA 3EJWA 1XMIA 1UPTA 2AG5A 1QIHA 3E4CA 1P4AA 3F6EX 1O8BA 2G70A 3GJ3A 3TBKA 2XD9A 1YTUA 3RJZA 5JXWA 3BZUA 4DDKA 1Z2OX 3BL6A 1MVLA 1YRQA 2ODPA 3TOZA 8ADHA 2ZSDA 2YINC 3OCWA 5AKGA 2ZJFA 3LIPA 3OT1B 3S1AA 1KJQA 2BWJA 1G5TA 4C0AC 5FOVA 4ID3A 2JJ1D 4WLVA 3OQ1A 1KI7A 1W0KD 1KY4A 4MDFA 4JQOA 2VP9A 4BN0A 3WLKX 2JIZD 2CUKA 4LMPA 3F7NA 5EE0A 3RVNA 2IZ6A 4AZWA 4ZI5A 4JKOA 2IUTA 1KMQA 1Q7EA 1K7EB 3NTVA 5JNTA 1VKJA 4MPPA 1PZEA 2ZI3A 5CVJA 4IEEA 5I7OA 1K27A 5I7RA 4NV1A 5LQAA 2HQ1A 4NBRA 1NYQA 1VI2A 3SY8A 1M1NB 2AVDA 2GCNA 3JATA 1TCBA 1C9DB 1GSOA 2K6GA 2NT4A 4WW0A 3TJRA 1GKUB 2AN3A 3DYBA 3A3PA 1RDFA 3A0RB 4N7JA 1WVMA 2B9VA 2ZVPX 1QORA 3A9VA 3AU8A 4O4JA 5KTTA 1EFAA 2VATA 2GO1A 4N7BA 4BGEA 1NIJA 4B7CA 1QS0A 2IELA 5T4EA 4EI2A 1XWIA 1Z08A 4G0UA 4DM3A 1AIPA 3H2JA 2CCJA 4R2MA 5HF5A 1CTQA 1KDOA 3F47A 5E2BA 4O3MA 5HKLA 1Q92A 1ZA1A 3ABOB 3PB3A 1YSCA 2I55A 4LY6A 3E8XA 1ZZGA 1GUFA 1WCXA 3ZY5A 1QYXA 1JR4A 3HKBA 1ODJA 4L0QA 3HGQA 1V16B 1ZRSA 1G41A 3CU5A 5ENZA 3GDGA 4NBWA 4BLWA 1R0LA 2AQHA 1TJ5A 5ECWA 1JDUA 1GTL1 2IEDA 4TZ6A 1AA9A 2IEBA 3FNIA 4DNOA 4DBZA 2WUWE 1DPFA 2JZOA 4LCBA 1W93A 3DFUA 3ORFA 5ALNA 3WY9A 1Z3IX 3NI2A 1R2QA 3HFRA 4LZNA 3CCBA 3BRSA 4C7BA 5KJ1A 1EHYA 4NDAA 3CTPA 4TUYA 5KWJA 1W48A 5MN4A 1JJBA 1UXIA 2LE0A 3DMGA 4R31A 3HEBA 3RRZA 3CZAA 1A9OA 4OBBA 4FOLA 3DEIA 3WV4A 3G17A 5J2TA 4A73A 4QU8A 1K3FA 4GMGA 1WMDA 5HTKA 3FKSD 3O4RA 3TSOA 3CWQA 1VC2A 1F4PA 1W88B 3H1FA 4EJFA 3U7QA 4A8JA 1BX3A 1HLGA 1Q7CA 3TLZA 3CF6R 4A2WA 4CFYA 1EZ4A 1V47A 1RZRA 1CUWA 3CVVA 1QRUA 2Z3ZA 3ZQ6A 2BLLA 2H1SA 4FYJA 3DBVO 3SG0A 2ZAMA 4ZVTA 2XNHA 3RS3A 1EUZA 3ZVRA 2K7FA 3ZDDA 1EUDA 4D7AA 1VLVA 4KLCA 2VDKB 4I4TF 2IQ5A 2C9OA 2PGIA 2VF2A 2CFRA 1WMFA 2PU7A 2UZIR 3PGKA 4J0FA 4Q1AA 3U49A 2RDMA 2RCNA 1SRQA 5IKEA 3BFVA 3I0ZA 1SVIA 2OB2A 4LGVA 4ML3A 2JRCA 2C7OA 3TLGA 2OG1A 3MZ0A 5CCDA 2PZLA 3HI4A 3HYCA 3HDTA 4IKOA 2FFQA 1Y63A 3IAHA 4IDBA 1M1UA 4BWGA 4C4PA 4DTIA 4EJMA 3T3IA 5KNDA 2NZYA 1VLMA 4UOQA 3F73A 4K9NA 1GR0A 1W36B 5E1BA 4A0SA 1P61B 1C1XB 4BQQA 2O57A 5DASA 3N74A 3PJEA 5CFPA 1Q1NA 3UTDA 5BR1A 4YUAA 3F71A 3LY7A 2J3HA 3EY9A 1WDKA 5BO5A 1KOFA 1T10A 1WKVA 2XKKA 1I4WA 1P1CA 2CHEA 1T1IA 3JQGB 3A2MA 3JQ7B 4L27A 4F5DA 4WCFC 4S0ZA 3P20A 2JFZA 1T9CA 2FZGA 3RFCA 5BSMA 3PF8A 3H5TA 3RS0A 5CYGA 2P62A 3JQ8A 3QLUC 4YY3B 4X00A 3W06A 5IKXA 1DQNA 1NT4A 2O0JA 3CF2A 4R3UC 5EIBC 5B53A 4CM4A 4LOKA 4YPFA 5JJIA 3AY3A 2IYUA 4KN8A 2P2LA 4WX2B 4Q4AB 5E7QA 2WWXA 1QGUB 3QV2A 4UBIA 3WQBA 1VECA 2FOIA 2VDJA 1ULUA 2G1UA 5LZ4A 1LUAA 3IVRA 4DM4A 3UJDA 3W8FA 4J75A 3JAWB 1NI4A 4GI7A 4RFLA 3EZGA 4A1OA 7REQA 2FEXA 1PG2A 4PINA 3ZXIA 5KC8A 3IIJA 4NBSA 4TQAA 3GX1A 2FMFA 2R6ZA 4KBFA 4QU5A 2D6FA 2FWPA 2NOAA 4G0YA 1GVHA 3CFYA 2V5UA 1TE2A 1Y3AA 2V45A 4JYPA 3L1HA 4Y1RB 4RPJA 2GAOA 4FFVA 3TQCA 4LVNA 3WLNA 3OKAA 4NZ9A 3RQIA 1S01A 1H2EA 2YQ4A 4WVFA 2GETA 1G60A 2RCYA 1N1MA 1PL7A 4NAVA 5TV2A 1N6IA 3QKRB 3MJVA 1LXCA 3LCCA 1UBEA 4FYPA 2WZBA 2QD3A 4BV9A 2WHQA 4HX9A 5C46F 4W9RA 1GPJA 4BFCA 4RD0A 4UHEA 2Q41A 5AVKA 3VQTA 1NM5C 1X1DA 3Q7RA 1HOTA 5ICCA 1VDMA 3PUYA 3DW3X 5JS2A 1ZUNA 4XLZA 4GYKA 3ZWMA 4F3YA 3GD7A 3L41A 4AC9A 3ZCVA 1V7ZA 5LUBA 1OI7A 2DQYA 4CM8B 2Z1MA 3UG7A 1QIJA 4G0WA 3SF0A 1WW3A 1VG1A 3JQ9A 1ZK2A 2GT1A 2G28A 3QZUA 2AD5A 3MSCA 1OHHD 3IHLA 1Q7TA 3QVTA 3RUIA 3JAKA 5BSVA 2QSUA 4TKVA 4GSYA 3ER9A 2A35A 1OZ0A 1F0NA 1RJFA 3AJEA 3TE6A 5JRJA 5T8KC 5BNTA 5TXGA 1NVGA 4ZAWA 1Y4DE 1WVGA 3ETGA 3JRXA 3SR3A 4BNDB 2BEVA 5CD9A 5JD3A 3THXB 1EUYA 3FTFA 1HDYA 2FRXA 4NJMB 3ZV7A 4HLNA 1GAEO 4EG8A 2CMHA 2X4DA 4ETIA 3ZNPA 1D2GA 3L7MA 5H9VA 3STWA 1KEPA 1KYZA 1U0OC 4QYWA 2I2WA 5FNZA 4CV0A 3ZPXA 1E0JA 3QFFA 4O4HF 5CA0F 1WZUA 3R5TA 1OAKA 3B70A 1C3VA 2Y05A 2D13A 2ENWA 2Z2JA 3EZ7A 3TYXA 3TTTA 3VYVA 2ONZA 1VHQA 4OQPA 4CLOA 5HCUA 8MHTA 4MAFA 4B9AA 2AH5A 2MSWA 1U7UA 3DTVD 3PWTA 2IDZA 3OZDA 1R5BA 2FZ5A 4C3OB 4JWKA 1Z0SA 2CUTA 1ZUD1 4V0OA 5HJ5A 1XCLA 1JHPA 1ORDA 5JSFA 1LU9A 1U94A 2RHGB 3LDHA 1NVDA 2WG1A 3O21A 3ZJUA 1JKFA 2YHBA 1XTBA 2NLOA 2ZRAA 2W8ZA 3AONB 3NM6B 5KVAA 2ZIFA 4C2TA 5LZ5A 5LYJB 3RLFA 3AOEC 3VJMA 2XGSA 4RYLA 1D7OA 3WIBA 4EHDA 4US2R 5K1ZA 3A58B 1JS1X 3U4MA 1UH5A 3URMA 1LEHA 4DCTA 1OI4A 3K9QO 3MWFA 4OQFA 1AKMA 2WPNA 4TTQA 4U02A 3V4FA 4DRZA 1FZTA 4GBGA 2O8BB 3KRTA 1JFFA 1WPXA 2WNSA 3RF7A 1WBDA 1GNSA 5H81A 3CNNA 4IS3A 4MRVA 4XUEA 2W48A 1VPTA 1MG0A 3KJQA 3EGIA 3OC0A 4BMDA 3IERA 1KXZA 2YY5A 1BWPA 2DZDA 3NW9A 3PYXA 4HH3C 1GTG1 2WJGA 3K8ZA 2Q9AA 4V0NA 4BWVA 4DQKA 1MTOA 3ZWPA 1L8LA 1T5HX 1HDXA 3A25A 4AAYA 3F2IA 3I30X 5A6VA 1QCDA 4D9BA 5H59A 3QQPA 5BRNA 5TT0A 5EZQA 5L95A 1V7QA 4F2HA 3O5AA 3S27A 5B3JC 2Q7XA 3HDHA 2VCHA 4XDYA 3WLIA 1IBLB 2ZJ1A 1S8FA 4E5MA 5CFRA 1SD2A 2FW9A 2LTAA 1NRXA 3WGKA 4BKUA 2HT6A 1CR4A 1QH1A 1UC9A 3BMQB 1MFPA 2X4GA 4IJUA 4AJ9A 4BX2A 4F9FA 4L4SA 3QTTA 3EXG2 1XQYA 2X9GA 3HWX1 3MJHA 2JHCA 2GJSA 3KETA 1E2FA 4Q39A 1QVWA 4O2RA 2R11A 4I4LA 2QLTA 3RHSA 4LYHA 2GWHA 1Y3IA 2DSTA 5EI5A 4FFBB 4HL6A 4B87A 1JEQA 5HKKD 1A2KC 1J07A 4GRDA 1BD4A 1KJZA 3SYKA 1JHYA 1DCFA 3IHWA 1NBHA 4Q4CA 2G7ZA 2G04A 1ZOIA 1P4JA 3DAGA 1PFUA 4O4IF 4QE3A 5C8YF 1VYVA 2Q5IA 3P4UA 4C0HA 1Z3CA 1XUOA 1KEEA 4BNLA 4YCMA 3ZUPA 3FOZA 5JH7A 4Z9AA 3ZZ0A 3KVNA 3ZDXB 4QYMA 5IC4A 4GOOD 3D6JA 2AXEA 1ZPDA 4KH0A 4Y18A 1L8OA 4QSMA 5HZMA 4ZYYA 2FSUA 3IVAA 1BZYA 1IJFA 4CR6A 1LPPA 5B3AA 3NHYA 1C41A 3A9TA 2OCLA 3PXDA 4GWLA 4JB2A 3R2JA 1RJWA 1ECFA 3RSSA 3OY7A 2BM9A 2V7TA 1FMCA 1QYCA 3DP9A 1HZZA 3JS5A 2QGNA 4N4AA 4P32A 5KNDD 1E99A 3ZGZA 1RRFA 3PNBA 2IY7A 3OLQA 3DKVA 1C0KA 1INLA 1GNRA 4G4IA 4RORA 1PUJA 2JFNA 3NANA 2NXWA 4RESA 1M6NA 1CEQA 1TT7A 4DVJA 3MJSA 3FWPA 2YJGA 1WXWA 1SUDA 3WQHA 1JLLB 4DIOA 4DDHA 3EUAA 4RDCA 1T8RA 2IYNA 3GLHB 3EQ6A 3N76A 2VJBA 3RYFA 5ADWA 4R81A 5D86A 1GLGA 4UHFA 4DRXA 3KT3A 1IULA 3KU1A 3OF5A 4PPGA 1P5HA 1EFPA 5B3LA 5DMHA 4B2LA 3KSDO 2B4RO 1R50A 2B3TA 1XX6A 1N25A 2Z57A 2DSNA 1ZOSA 3G2LA 4JZKA 1DXQA 3HZHA 1D6NA 3MINA 4WY2A 5D85A 2GM4A 5E0OA 1BA2A 4G2TA 3KXKA 4GXTA 3T4UA 2BP7A 4FC7A 2V98A 4NE2A 4LWPA 3ZWOA 5KZMB 1ODTC 4K8RB 4B3SB 4K0RA 1SCNE 1ST2A 3RWMB 2QIOA 1J1ZA 1IUPA 4CN8A 3JRWA 3QX3A 3N0RA 1RZUA 2XQKA 3IMGA 4X1KA 4F2PA 1FFHA 1QTIA 4I3GA 1LDGA 3EZFA 2A1TS 4JBNA 4PG5A 3RHZA 3GMSA 3C3EA 4B8YA 4ZHQA 5A3RA 5CX4A 4N0EA 1GA4A 2X0EA 4GI2A 1AC5A 3KUCA 4BDSA 5M34A 4Q4DA 3FZEA 1O97D 2BKUA 5K4GA 3DLCA 2PGLA 1C8VB 4OFZA 4N5HX 4GYWA 2EKPA 2HRCA 4K88A 5KYGA 4KLZA 3FOFC 4TTRA 1NXTA 1T4CA 2QQ0A 4GBJA 3SYTA 2A9FA 5IBCA 4RQTA 2JBHA 4B7XA 1PO7A 1ZWKA 4PF1A 3U61B 4IPTA 3ZN2A 1V6AA 3IIIA 3P5BA 2PU5A 1UPXA 4G67A 3EVCA 1Z8FA 4FGUA 4G1BA 3L5OA 4UMVA 3D4PA 4EA7A 4IG4A 4DCPA 4AP5A 4DTCA 4M8LA 4Z8YA 3MWYW 1T8PA 4FOSA 4YA6A 2Z8XA 3MD9A 3OLYA 4HGRA 5FOUA 5BMVB 1PR3A 2ZRJA 5LOVA 3I0MA 2I6GA 5T5QA 2IF2A 1X80A 1A9TA 3PVSA 1AMNA 3P5SA 1PJ3A 2Q21A 4LOIA 4NAHA 2RGNA 4BBZA 5L7TA 1DV1A 2GVDC 4N82A 3WGJA 3WGQA 1YNOA 1ZXBA 3E9EA 1ZNQO 4DA8A 5DB4A 1FX1A 3F78A 3FNFA 3JQEA 2Q4OA 2O7QA 2YOHA 3D6AA 1EE1A 1NYRA 2WHXA 3PC2A 1W9MA 4XCQA 1RP1A 1FSGA 2V8OA 2WYOA 4M38A 3CF4A 2HT1A 1A9XB 5C81A 1MOPA 1JSCA 1H6BA 1OCEA 4JK3A 5ESDA 3WMWA 4ZZ0A 1K3TA 4RVDA 3GLFE 4H0CA 1MJFA 5DGIA 1YZNA 3D6FA 4D42A 2XSZA 3X2SA 1HH4A 2XVZA 4NCKA 5AI8A 1RRMA 1Y8ZA 1WSDA 2C57A 2Q1UA 1CP3A 2XUQA 3VYWA 4A36A 2XE8A 2C9BA 1M2HA 3KPVA 3BGOS 5EZYF 3WBKA 3L8ZA 5AHKA 1XZPA 4YLEA 2ZT6A 2FPWA 5CDGA 4CTJA 4GI3A 3TWOA 3EMDA 5EMJA 2YJNA 4RSGA 5G4KB 1SHTX 4WFKA 1UWVA 3JVUA 2XMDA 4WESA 1KY3A 1P0CA 2H4HA 5DCUA 4A0FA 5F7JA 2HNBA 2DGDA 5KX5B 5F1YA 1P1HA 2ZUDA 3DKRA 3RADC 1SA0A 4C0QC 1PW5A 1GPMA 3K0EA 2UXBB 2AOUB 1U4OA 1I7QB 3D3JA 5H3LA 3SPXA 4E3WA 1WY5A 4FFDA 4FYMA 5EJGA 5K8UA 3MTAA 3LWZA 1BNCA 3AHHA 3ILYA 3HH8A 3JSXA 3DZHA 3LHKA 4HNSA 4NZYA 3RI3A 4E30A 1XNQB 2O9JA 3DKIA 4UEQA 4TYNA 1CJBA 4B2IA 3MELA 4OPMA 1AK9A 3KYCB 4ENPA 3EAFA 2ZYRA 1B3RA 1DTSA 5C4IA 3WFJA 3PFBA 1CY1A 1OTYA 1TFRA 1W1IA 3I9V6 3BEDA 2CBGA 1CJCA 1E3LA 2H1CA 2MHCA 2C5SA 3I73A 2Q07A 3LCRA 3CNEA 3ZCQA 3OSZA 3L6UA 4D46A 3M6XA 2JGNA 3VC7A 1EFHA 1GQYA 3HB0A 1M74A 2O14A 3ZY6A 4YXFA 5I9NA 3DWGA 4I1SA 1MIHA 1FLNA 4JYAB 5GM1A 3AFGA 1YRHA 2OB1A 1X7ZB 2ZSJA 4L95C 4YUVA 5L3VA 1SG6A 2AKEA 5DHPA 3C48A 1MJGM 3I9JA 4Q4JA 5EJ6A 1CLUA 4Z0HO 3L9WA 1I6WA 1P7ZA 2HBQA 3WYBA 2V55B 1W35A 5I7EA 2AFIA 1Z22A 2POQX 2ECKA 2CXPA 2VF4X 1VE5A 3VRHA 1CUZA 5ICSA 3EXAA 1Y34E 3QHPA 2PLFA 3CLHA 4Q9HA 4TPKA 4OOFA 2YW2A 1IMJA 3CIOA 4ASUA 2NO9A 2QRJA 3MERA 4YCJA 2BMAA 5KB3A 2HA4A 1XAJA 3GAFA 3H0CA 4GDMA 3KTAB 4ZCSA 4QYIA 2ZIZA 3ZE1B 3FCSB 4CKCB 5I3ZA 3P9QA 3IUEA 4HWTA 1EVLA 1NQXA 5J9FA 3AR6A 2XMCA 4JJEA 1HE3A 1Q1GA 2BUAA 1QNLA 1MAUA 3FPCA 1GG5A 5TC4A 1EEXB 3H1PA 2AJDA 2AMLA 4QO7A 1Q1BA 2BW0A 1NW6A 3GGOA 4I4IA 1B6RA 2DLCX 4MRAA 1O97C 4REQB 4CNBA 1U1DA 1Y5MA 2FGKA 3SLKA 4HLCA 4Q21A 5MFPA 2E9SA 2ILVA 2IZZA 2QLLA 5F4ZA 4XOIA 4YQEA 5IRCD 3EEIA 4B7AA 3EFEA 2CXSA 3AX6A 5JAZA 3ZLJA 2JH3A 1Q0LA 2PA0A 5FWXA 3WQQA 1C1YA 3CNBA 2AZTA 1EE2A 4F46A 2V7XA 1OH8A 1DAOA 3NKVA 4B76A 3DE4X 2VBCA 1VQ1A 3MRXA 5H02A 3I72A 2HA7A 4R98A 2QL5A 2YZGA 3WYFA 4L22A 3R8XA 2FPSA 1EJ2A 2WJZB 1DZ3A 2AD1A 3OZCA 5C7OO 1OYOA 5KNCD 3CMMA 2VZ8A 4MUNA 4MDEA 2AJTA 4W1QA 4GIBA 3BE4A 3ETLA 2BGKA 1BS1A 1Y9ZA 4M6WA 4J0IA 1E8NA 2V6GA 3WK7A 1E0DA 3TIGA 3T38A 6AT1A 1FLDA 2BKAA 1II8B 1FP6A 3QPWA 1HRKA 4KSBA 1WD5A 3I8XA 3ZHRA 4ENSA 2EJWA 2QMYA 4QYXA 4ZHSA 4KLRA 3OOHA 2V7QA 5L3RA 5I01A 1XJQA 3T1VA 3C45A 1QF6A 3ZYCA 4M55A 1FBNA 4K9QA 3WRWA 1TZCA 4UE3S 6NULA 2VHYA 2VJPA 3O26A 4NYMR 1THGA 1OJLA 1TL7C 2X22A 2EG5A 1RRVA 1NQ5A 1TIBA 2IHKA 1KI2A 2OBLA 2QUIA 3TGWA 1Y8RA 4RPLA 4EP1A 1S2MA 1L2TA 2BEWA 4RD1A 3SZRA 1FSFA 3COYA 4BQRA 3G3EA 1J8QA 5L7YA 2F4NA 3R7SA 3Q9SA 1IQRA 2XUPA 2V7PA 1CC1S 4II7A 1HG1A 3WGVA 4ENUA 5DOVA 3ZU5A 1OFUX 5JISA 3WWOA 4I55A 1DGQA 1N7IA 3COWA 1HLDA 3NOVA 3JALB 3K70B 1L7VC 2WQ6A 4A16A 1U8EA 3OM0A 1Q3HA 5GJCA 1JZTA 1GNPA 1IAQA 1JP7A 2GCGA 4REMA 1IZ7A 4CMKA 5JNRA 1H3EA 1J21A 4PX5A 2A3NA 5CLHA 2C2BA 1AKQA 2ID4A 4GKBA 5FEUA 3LVRE 5EP4A 2F62A 3N05A 3NHSA 4AQ7A 3IFSA 2FHSA 4JENA 2HRZA 4OGWA 5LWHA 1T3GA 3EG9A 2AF4C 1SBHA 4U2DA 5AVQA 4XB6B 3WRYA 1X1BA 4WADA 4E03A 2ZUFA 3MCUA 5BWNA 1V1JA 2ZB8A 4TQ9A 3EZXA 4B7UA 3K6KA 5HRAA 3UQZA 1K7FB 1N0WA 3R3SA 1UJ2A 1ZH6A 1T1JA 4XH9B 4C6HA 4GS5A 2RGRA 4PG8A 4NS1A 4BE9A 1EDEA 3W79A 1M34A 1AXGA 4P86A 1N2CE 2GCPA 6LDHA 2P78A 4YAJA 2SCUA 3A9WA 4WN3A 1J7JA 1P9LA 1W88A 2BM8A 3R6WA 3MUEA 3WGMA 5KJCA 1IEQA 1JLMA 1WCIB 2HMUA 1YDEA 3U80A 4D9FA 3AY7A 1L4BA 2XMQA 3UWPA 3Q8LA 2P3LA 1R0YA 3STXA 2EJVA 3AI3A 2DJ5A 4BRWA 1G8GA 2Z5GA 2JFOA 1T36B 5D01A 1DG3A 3FYUB 2O1XA 3B3JA 4FLFA 4PLHA 3HZOA 5LNK1 3B6IA 1IZ8A 1ATZA 2I29A 2VAMA 3OBBA 3TPFA 1CW2B 2RHOA 3B1YA 3KNZA 3ONWA 1NNSA 4RM2A 1M1ZA 1J9GA 4R9RA 3RVBA 4RMGA 2GDZA 2Y1XA 4O63O 2OZVA 1G7SA 1XJWA 1NOKA 3CF4G 4LJSA 5KNCA 1DFIA 1IUKA 2ZUCA 1E9AA 1H2ZA 2LKCA 3QOYA 3G0DA 4IZIA 4NE9A 5CK4A 1BFKA 1U2DA 1JHOA 2XSZD 2CNLA 2BEUB 2VYCA 3BA1A 3HCEA 3PT9A 5IKOA 3RSHA 4NH4A 1HDEA 4KOEC 3TJMA 1P1FA 1BC5A 2HNKA 1DIHA 5GP1A 3TL6A 3BH0A 4V0SA 4MA4A 2F3RA 4LI3X 4ZPXA 3GAAA 2BH2A 1WDMA 2OV1A 2Y4NA 5HRUA 4IEIA 2ZI9A 3FUVA 1VJ5A 2G07A 3PNSA 2C31A 1PLJA 5JSHA 3MWGA 4JI7B 1ZA2A 3JQ7A 2XNKA 3JQGA 5EWLB 1DU4A 1COWD 1PWHA 4EECA 4H18A 4XSVA 3A4VA 5A6SA 5CVDA 1OFGA 4RTRA 3HSSA 2J0VA 5F33A 1EM8B 1QXSA 3GJ7A 4QBFA 3LE8A 2BZ1A 2AR9A 1LLUA 1JX6A 2YCLA 2BM1A 4DARA 2BRUC 1NG1A 5BV1A 5DBHX 1L5ZA 3A14A 2QF7A 4H1HA 4HPXB 2P2SA 5HQJA 4DLAA 1I94B 4RS4A 2K5UA 1IUOA 2OXCA 5FXMA 3UUGA 1HYBA 1PU2A 1IOVA 1W5AA 2G40A 1E7SA 1BE8A 1YZ3A 3DPUA 2AK3A 1N2BA 4M37A 1XEWX 4JSRA 1YH3A 3E9RA 3R5FA 3ETNA 4DSOA 4QFBA 4RLSA 4PZLA 1FK8A 1JYFA 1V7CA 3VXKA 3QMVA 1NATA 1QHIA 3O8OA 4A27A 4ITUA 4K87A 3T94A 5DBOA 5JDIA 3RCBA 1MX5A 4IOMA 4A2QA 5J58A 4D9EA 1VLLA 4UARA 1F8GA 4FYHA 4RWEA 3G8BA 3S2ZA 1XL1A 1N5OX 3F5QA 4DCOA 1O5OA 1YJXA 5EXSA 4KPEC 2DY1A 1R4NB 4KG7A 2IPLA 4HZUA 4L57A 9GPBA 3Q1LA 2DFTA 4PBSA 4DZZA 1SUEA 2J4FA 2ZITA 1N5KA 4BZZA 1L7PA 4M8SA 5CB6A 2CV1A 4BKQA 3SS7X 5D5QA 4JLJA 3SJ7A 2JIMA 2W90A 3LCMA 2I5PO 3ZZTA 1BMFA 4JC8A 4ASUD 3GCDA 4KQXA 1OW3B 3BWCA 2QLBA 3L3BA 1AMUA 3A3YA 1ZY2A 1GSHA 1AU9A 1MPTA 3ZTWA 5F98A 3UVEA 3RKRA 2DBRA 2CDAA 2IV7A 1Z56C 4Y6SA 1RXIA 3FVWA 2JLZA 4M76B 1KFEB 1WXGA 1QKKA 1NHWA 1VKHA 3A05A 2GARA 2J32A 2JKVA 1IY9A 2C2XA 3BD6A 3L9XA 4KCGA 3W3ZB 1CQIB 1YQTA 2F1JA 4IJMA 4UTXA 5FFFA 3TIFA 3A4TA 2GAFA 2YR0A 3SSNA 4X60A 1WETA 4X20B 4FZVA 2RBKA 6ADHA 2DTXA 2XGMA 5AMXA 1JWBB 3G1WA 8AT1A 5TQ0A 5G0WA 4CIWA 3FH0A 2B7LA 1W19A 3D3NA 1L5YA 2HHAA 2JBAB 1TQ8A 1PGQA 4YONB 4QTTB 3P96A 4GRAA 4X84A 1QG6A 1J2TA 4ZIRB 2OYCA 1BVHA 3TNYA 3KZMA 5K0SA 4LDZA 2Z98A 1Q0HA 4KVAA 4N12A 1NF2A 3TW8B 5K0CA 3THXA 3E7FA 3PGA1 1RR6A 2JLSA 3CVUA 1ZJWA 2PQMA 3ZEAA 1K92A 1S3IA 4Q48A 3USCS 3KB1A 4TVOA 2UXDB 5LU8A 3DTTA 1TF5A 4S1WA 3C6BA 1LH0A 3OY2A 1JEJA 2ZRPA 3KB8A 4OFXA 1NVXQ 4WECA 2H06A 1V9CA 3GIDA 2Q2WA 1HF3A 3V2UA 1V9SA 4YH1A 5KQLA 4KL8S 2W6MA 5ALEA 3ZLTA 4FS8A 2IDMA 4G0PA 1ZJZA 3TXXA 1U04A 4NU6A 3AHGA 3P2OA 1F12A 2M1XA 2V7QD 1MO2A 2GFQA 2VYFA 3DSRA 4DCJA 4N01A 5ALZA 1C2YA 1JQ5A 1HA3A 2XZDA 2FR0A 1LZLA 2GD0A 2PR2A 3NP7A 4QM7A 4NFSA 2HK7A 2MJLA 5TGZA 4NABA 1MO6A 4A8HA 1ZUHA 4ARAA 5JSZA 1F5NA 1QJCA 2G4CA 2B1IA 3V1UA 3N7AA 4AUKA 2JH8A 2NVOA 3E9NA 2QX7A 5IN5A 4B48A 4DR1B 4W9NC 1LF5A 2GOYA 4ZP1A 4BLVA 1JVNA 1U8AA 3KZKA 2J3DA 4WERA 2EBWA 5F1KA 4Y6GB 2O8BA 1LFAA 2WTAA 1Z68A 4EG4A 2VSXA 2OCGA 3IP7A 1EVKA 1AQIA 5D00A 5T6MA 4C4SA 2RH4A 2QUKA 4YT2A 2M6SA 2P2CA 1SURA 1WOYA 2K87A 2GPNA 2GB4A 3L0YA 3RC9A 4DV3B 1YZVA 1KZ7B 2WF7A 3OCVA 4J6FA 4KSCA 4Z1MD 3U60B 3VGPA 4EO7A 5H4HA 1RXYA 3FCYA 3ZKWA 3SNHA 5KQPA 1FTGA 2AB0A 1R6UA 5JE8A 3Q7SA 2YXBA 4KWEA 4QJ4A 3TVDA 1E5VA 3GELA 3KJGA 4MITA 4MQLA 1RTKA 1YB4A 3GPIA 1AKNA 1QM5A 1KI6A 3UFXB 3NATA 4HDNB 4ZGBA 2A8YA 2H00A 1WMBA 4A6PA 3SZGA 1CJTC 2V0NA 1VJTA 4C78A 3A37A 2Q3DA 4NC9A 3HJAA 5AJTA 5JLAA 4EJ2A 3IPYA 3LPNA 5D3ZA 4DYDA 1Z4MA 2ZB3A 4IMJB 4II3A 4DRYA 1S4QA 3AFOA 4UATA 4EPYA 1UZLA 2HL6A 1TUBB 2Q0SA 3Q3GE 1G4AE 2BZ0A 5CK5A 1OQAA 1OU4A 2NNLD 2Y9MB 5AKKA 9ATCA 2B1JA 2AYYA 3X1KA 3JWIA 2OK8A 5FA8A 1CE8B 3V8VA 2ONYA 2AT1A 2ZJOA 5DIFA 3DOUA 4K5QA 3RVKA 4GEGA 2XTNA 3ZE7A 3BMNB 5GVRA 2VL7A 1XLVA 3M0EA 1G20B 3EXHA 4M1EA 4Y6PA 5A7HA 3V9AA 3NX4A 4TS4A 1ZGHA 1Z62A 3C70A 3DZBA 3QHQA 4M9CA 2X5KO 4KBYA 4FT2A 3ZJ5A 5I7UA 1R0SA 2K4MA 3GEMA 3KUDA 5LXTF 5L8VA 4OCZA 1Q2XA 3E81A 5KNLA 3EWIA 3FOWA 2X2OA 3HVHA 3ESAA 5AXCA 5BPFA 1C50A 2WKRA 1DT3A 4AJPA 1OBFO 2VQ6A 1RPJA 2GHTA 3DEZA 3I4FA 1HMPA 3IRUA 5GOTA 5ALTA 3SEQA 5KWSA 1ZHOA 1HI9A 1JXOA 3OLWA 2O2EA 1KKMA 2WU1A 2Y6UA 4FBMA 3S5UA 1G7RA 2ZWMA 3U4HA 3WGTA 1TVCA 1KVUA 3FZNA 1CERA 4OHFA 2WINI 4BMNA 1IXSB 2CL6X 4MINA 1QFYA 2OV2A 1WUJS 3LUFA 4G63A 1N36B 3F46A 4YPVA 1JLLA 1VRCA 4EGFA 3KUUA 3GJRA 3Q4GA 4I9NA 4FILA 3IGFA 3L92A 1Z38A 3ZQJA 1CR1A 2CVQA 4L6AA 1GQQA 1ST3A 1XZEA 1JWAB 3A1NA 4PZPA 5K8VA 4NK4A 3A2KA 3DV9A 1MW9X 2IA5A 3KKPA 1KH3A 2BMJA 4MGIR 2G08A 4DC9A 3G02A 4F9TA 1IPFA 1B26A 3IB6A 2AX4A 3KR2A 1WLYA 4PYRA 5G4LA 4ZEXA 1KY2A 2IS1A 2XH8A 4HWPA 2G63A 1VCOA 2QD4A 3H1GA 4PLFA 3CINA 3T3MB 2PGJA 2G8NA 4PZUA 5HMMA 5SY9A 5JRZA 5IH7A 3DUFB 4FI3C 4G6ZA 2Q4BA 3AZQA 1XCPA 2HIGA 3C7TA 2AQ8A 1JL3A 3ZWXA 5HUJA 5JXGA 2MYPA 3AERA 1FDVA 2IYOA 1RC0A 3LQ2A 4OIMA 4ARZA 3RG8A 5ITWA 2V9CA 5ITZB 1BROA 4H35A 4L2IA 1I9GA 1ZINA 2MMGA 3GRKA 1GNTA 5JO0A 2BSQA 4QU9A 2FZVA 3CH5A 4QNNA 1XKLA 2BPOA 4E5VA 5L4SA 1TQDA 4BNKA 2ZBUA 3KZ1E 1U3FA 4QQFA 4KGVA 4IV8A 2R7NA 4NR0A 2Z1DA 5HOQA 2ID9A 2D5LA 1SCKA 1TW3A 2C5BA 2BUBA 1EGAA 1L5HB 1U0JA 2PLNA 1QHYA 2Q1WA 2Q6LA 1AM4D 4PFSA 4RHEA 7AT1A 1GZSA 4LYDA 4ZA2A 2OLEA 5ESXA 3AIMA 4NDZA 1M0EA 3E2IA 4U6QA 4B3HA 2YXNA 4NRDA 3H5RA 1X70A 2Y68A 4N8SA 5DHFA 4XIGS 1MW8X 1E3MA 2R4QA 3HQ4O 3WYCA 4MI9A 3V6LA 1BMFD 2HWYA 2UKDA 4LTNA 3MPOA 3RC3A 5BMVA 5CURA 4RCZA 2IFTA 4IG9A 3S55A 5EHIA 5SZKB 5H8WA 1R12A 1TUEA 3HCWA 4ZT6A 2GJAA 3PHCA 1XXHE 3H11A 4AUEA 4GSKA 1C8KA 1WNTA 5DLQC 3U62A 4Z7QB 3Q7EA 5JFGA 2N47A 3AF4A 4P6VF 4ARSA 1WDWB 3WSVA 4UM5A 3ER8A 2DC1A 1FNNA 2RHHA 3GLIA 1VI5A 4BFLA 2RHDA 3K96A 3LYLA 3NHFA 1ZAKA 4OHUA 3ADOA 5JRDS 3FMIA 1IPEA 4RYDA 5IK2A 2HSZA 5IJ9A 3TN7A 9MHTA 1T2FA 3IDQA 3M5WA 4TTAA 3JYLA 3SIXA 5JALA 3WRYC 3DMDA 5KVVA 3A3OA 4ON9A 1KQOA 1R6AA 3C6QA 1BJRE 2ZIAA 1ZK0A 2CW5A 2WPDD 4FFSA 1F0KA 4KFUA 4Q93A 3O8NA 3ET4A 2NPOA 1Q7RA 4R8SA 5TRTA 3H97A 3KKEA 1G64A 1H2WA 2QN6A 1CQJB 1Z13A 3BILA 3NBUA 3JZFA 1MD9A 1HTBA 2WIDA 2GVNA 3DO5A 5G4KA 3VVMA 4XJVA 1V5FA 4QXPA 4E5PA 1Q0QA 1EGHA 2OHVA 5B7NA 5KOJA 4LRXA 2P5SA 4RKYA 2F9FA 3H05A 5DTEA 1GSAA 4NEHB 1JDJA 1N6HA 2ZJ8A 3NRCA 4PFQA 3TW4A 2AOUA 2WWWA 3FLBA 1EK5A 1Z4NA 2O7RA 1JIVA 1PE0A 3HFSA 2BTOA 1EBUA 1TYZA 4LPSA 1EA7A 2ECPA 4KWHA 3BGWA 3VNVA 1XCBA 3GG2A 4K9RA 3DL7A 3ZCTA 2G9ZA 3K8QA 4OX9B 2J5RA 3Q7IA 1H0SA 3KYCA 5BP7A 2C2ZA 3MNFA 3B9PA 3EVBA 3I04A 2VA8A 1E3JA 2JKZA 1T8TA 4URZR 3V55A 4YT4A 1GPLA 2VCEA 1XG5A 4FWBA 3AI2A 2FQ1A 1D04A 2YW9A 2J5KA 3TS1A 3UMVA 4F8YA 5BV7A 3AVXA 1GCAA 3HDGA 3KD2A 3DT8A 4L8LA 4X94A 3RLIA 3SS8A 1UDWA 4PQEA 4M0PA 5LD2C 3K92A 4AROA 4M9SA 4JUFA 4PZAA 4YYZA 1Y6JA 1WCWA 5AH0A 4EW3A 4FOPA 4RH0A 2Y9PB 3VO9A 2JHFA 1IXKA 3DLBA 2C0QA 2ZRCA 1EWQA 4CGZA 1N6NA 1X7ZA 1LWNA 3EDMA 3PQCA 2WMOB 4IINA 1EINA 2VTKA 5E1DA 5EIOA 1VG9B 1KETA 1E2NA 2VWHA 3KG2A 2DHQA 3QEOA 1Z2NX 4DKXA 5DOZA 5B3KA 5EWMB 5KMGB 3R3YA 5AR1A 1BXGB 1W6RA 3Q98A 2QYSA 2QW0X 2WHYA 3GVXA 2AEJA 3TOXA 3CUVA 3CT6A 3V48A 3JQDA 2I54A 4YJHB 3TLJA 5EZ6B 5FNVB 1DC4A 4ZC8A 3HZRA 3C3MA 4KO8A 2CVZA 3KTAA 4CKCA 4XVUA 1TC1A 3BAZA 4L72A 4OK5A 1OF1A 4YJDA 3VHQA 2OXRA 1ENOA 1JHDA 3K2EA 4NV3A 1KKLA 3O93A 5ILOA 4E15A 1ZJJA 2A67A 2ALJA 2ZM6B 1UF9A 1N9GB 3VR3A 1P75A 1XWFA 1Z6XA 1R8SA 3FX2A 4UFOA 3SZMA 3FVVA 3A4LA 4PZZA 4QASA 1WTAA 3OIYA 4C7XA 1AHHA 4JLAA 3RFFA 4ZVNA 3ZJTA 2GEUA 4MW4A 5JDIC 4G4SO 5HDBB 4RTKA 3CHYA 1AKYA 4RE5A 1BU8A 2IX9A 3U1VA 4HEHA 1FXSA 1UMBB 2WIAA 5K0JA 1TEZA 3DF7A 3GR6A 3B1ZA 2BR4A 2LGJA 3QBTA 4BTVA 4CQLB 2ZIWB 1C9NA 2NXEA 2VSFA 3N07A 3OQBA 3L6OO 2YWBA 5FUBA 2A4MA 4ZV9A 5B6PA 2WOJA 1W44A 3BJMA 1NN0A 3OKFA 3SHQA 1F6BA 1UP7A 4M7OA 1ZDMA 2WYHA 4PANA 2P79A 3KQSA 2ERXA 4HGYA 2CWWA 4I19A 4LYYA 1JNYA 4MKXA 2JGJA 5HGJA 3WL8A 1NVEA 3H6HA 5C5IA 1H5UA 1L5MA 4YRIA 1AURA 4KKVA 1T0PA 3L8EA 3ISVA 3OF3A 2W2QA 3QVMA 4W1PA 4YRTA 4EIWA 1EFUA 3QUTA 4P58A 5CIYA 5KYTA 1CRQA 5LBIA 4TWAA 1LV7A 5JPCA 1UFVA 2DH6A 3ZWBA 4EX7A 1A3CA 5CLGA 3EF3A 4ZI7F 2E85A 2ZRKA 4R83A 1TTPB 1N7JA 5D6OA 1KO7A 2A5LA 2JEOA 3FTNA 3LL4A 4I9FA 3O75A 3V7YA 3GFTA 4YB8A 3IMCA 1PWEA 2H5JA 3NHBA 3IUNA 4Z6KA 4C7OB 3PQ7A 4UTRA 4IXNA 5CT5A 3RTBA 5EUBA 4E3ZA 8ATCA 3FVRA 2UVPB 4WOPA 3WB1A 1IEXA 2HZ7A 2WAOA 2CBZA 3EPHA 4JDPA 2W22A 3U3JA 1EB9A 3AU9A 4Q03A 4RPGA 5LZ2A 5JVDB 3L82B 5I7VA 4HUQA 3J80A 4CQJA 3AB7A 2H9YA 1HDCA 4D8XA 4PCLA 5BOVA 4NL4H 2VDNB 5CXUA 2QB5A 2XT6A 1A4IA 3NHMA 1YZKA 3FJ1A 3JALA 4KVGA 4U2EA 2BEKA 4A0GA 1XYVA 1IEVA 3PUKA 5BY2A 1DHRA 1EK0A 4MB0A 3LSYA 4LDQA 5AHWA 3CZMA 1OXVA 1VBFA 4W1RA 4DB4A 4RZIA 4L4XA 1XB2A 2C1XA 3GFBA 3GUYA 4GMXA 1YUBA 3MM4A 1K1EA 4YBRA 5HIKA 1SKBA 3IL2A 1E1NA 3DV0B 1P72A 3HFGA 2NZ2A 3F2VA 4HFMA 4UXHA 5KI6A 1Z6GA 3CJRA 3VU8A 3AVYA 2PL3A 1QB7A 3FLEA 3NYQA 4H3HB 3VR6D 2VHCA 3IDAA 4V3CA 1DBPA 1GCOA 3MT7A 4QVKA 1PFGA 4A6EA 4XOUA 3PQFA 1R6VA 2OFPA 5IDYA 5LPNA 2IP1A 1DC5A 1UXJA 3CZ9A 1TYEB 4TYPA 3NPMA 4UFPA 2RJOA 3VYSB 4KQKA 1IBKB 1UANA 1I32A 1Z88A 2ZE6A 4OIFA 5CGZA 5C2JB 2CEAA 4HB3A 1BOOA 1EFVA 1XRMA 2BC9A 3LPCA 4GI1A 5ITSA 1U02A 4L7QA 4O29A 2A5DA 4NIMA 4IIGA 1APBA 1M6EX 1ANKA 2J0SA 4MWBA 4LF4B 3Q3EA 4J2OA 3IUJA 1LDMA 1UM8A 3PNQA 2J9ZB 2VG8A 5ALGA 2FLKA 1NF9A 1T5IA 2NYUA 2VDWB 3KSZO 3OZSA 2O3QA 4FEAA 1PCXA 2FQWA 4FINA 4Q12A 1BDHA 1P74A 2G82A 1H6DA 4YDRA 1T36A 5L53A 5E6SA 4D0GA 3FPHA 5NULA 4GQBA 2A9PA 4PX9A 2TECE 3W7VA 4EZIA 2EDAA 1YHNA 3NO4A 4LSZA 2PSJA 4PSVA 1VLHA 3O4HA 1YZUA 3T12A 4WL0A 4AIRA 4C22A 4ZREA 5IK2D 2P8JA 2CE7A 2H1HA 3C5CA 4WOJA 5I8WA 1U7ZA 1Z5NA 3QEMB 1Z25A 1RVDA 2DT8A 1SZJG 2NTYC 3H0EA 4PSCA 1Q0UA 2D5IA 2BEUA 4RXUA 5DXFA 3K0FB 4D3SA 5C35A 2I3DA 1NLUA 3EK2A 3KHKA 2R7MA 2VDRB 2OESA 3BD8A 4WUVA 5C8XA 4OH1A 2HSEA 4HAZA 4PO3X 1ZM3A 3FTDA 1JA0A 1CZUA 1J06A 1V5EA 2Y67A 1SC1A 3DHVA 1VE9A 3EA4A 4A8TA 4NULA 3WICA 3P7MA 3OZEA 3G9XA 1LVHA 3TDNA 5JS7A 1SJ9A 3E7PA 1O7JA 2BFNA 2R4TA 4CM3A 5TMPA 1O6BA 1OLSB 1TCCA 3E3MA 4TTTS 4BVHA 3GPDG 2NTJA 1RP7A 4MEJA 2BTEA 3KOWA 3EXHC 3F3MA 3PJRA 4YDQA 1JFRA 1NVTA 3AVQA 1N8TA 1E6CA 4TKUB 1MO3A 4F11A 1IDOA 3F8TA 4CV1A 1O0BA 3T3OA 5DNWA 5HZHA 4WFJA 2WOOA 1AQUA 1C9MA 3G2IA 1HFJA 2QN3A 3HMQA 4I4TA 4B45A 3KO8A 1YB2A 4AB1A 3PXAA 3F7OA 3GJTA 1QCCA 4D79A 4EHAA 2Q5LA 3OIUA 3PFCA 2WYWA 1GNLA 5LMCA 3FUCA 3UJCA 1HV8A 2WUFA 2JGFA 1UKCA 3E15A 3ISJA 1G8FA 2C98A 3VYUB 5AJWA 3BIWA 1DO2A 1Z5PA 2NO7A 1K75A 2UZ3A 1E7RA 3E61A 2DPGA 4H6XA 4IZHA 4JBXA 4JYCA 5EQTA 4CBVA 4EPXA 3KIPA 3ZWNA 1F2TB 1MBZA 1TK2A 2J3MA 4X8LA 3TAXA 5HBGA 4UJ3A 3QVSA 3WWYA 3OCXA 4IHJF 4C7VA 1SC3A 3WMGA 3CX7A 3OOEA 3KLPX 3S81A 1JPJA 1UPBA 2DJIA 1K8YB 4I4NA 2YYAA 3BK1A 2IHBA 3IAM1 1R4NA 3NHLA 1V4NA 4LN1A 3QXXA 3AUKA 2VKQA 2A4KA 2IIPA 3ASVA 3ENQA 3R4VA 4JBIA 5FORA 4Y1EA 5A71A 3NRJA 2HO4A 1HE8B 3NG1A 3T61A 4ALJA 2FDCA 5KNDH 4M1TA 4V0MA 2FUG1 2P90A 4J4BA 3Q10A 4EQZA 4RD6A 2Y1OA 5F5NA 3IUMA 4OBEA 4QOGA 4TMFA 3S2YA 1JRLA 2RGBA 1N2OA 4U7HA 3WBFA 3EBOA 2IK8A 2YNMA 4C06A 3RGGA 2B8WA 5AW1A 3Q8WA 2ZDHA 1VE7A 3GEDA 4Q5IA 4TT3A 2C0CA 4D80A 2O8EA 2PY6A 2QN8A 2ZSKA 2A78A 3Q8XB 4JB0A 2ARKA 4E12A 3Q41A 1C30B 1KZ6A 1X7XA 1WP4A 2Q8QA 3TI9A 5E3HA 3VR3D 2HK9A 4UHHA 2CD7A 4LYAA 3LUAA 4UZFA 2FG5A 3CW2A 5J47A 3BMCA 3EPLA 2Q2OA 2C97A 1PJLA 2HJHA 4ESEA 1EBBA 1YS1X 4MGHA 2VP6A 3RR2A 3H4TA 3TIVA 3KOXA 3KHTA 4O25A 1LNQA 1MC8A 3EVAA 3ZNOA 2FW1A 2W00A 3LFTA 4OQYA 1CZRA 3AW9A 1GLNA 4CF3A 5GIOE 4N9QA 2EFYA 4D0RA 3OO1A 4TSKA 5ELMA 3OWHA 3TUIC 5IVDA 2JHAA 5JASA 4TMTA 4UMEA 3RFUA 2C7QA 5GZ6A 3K9NA 4EW2A 4E2XA 3BVPA 2DKOA 5ER6A 3IQZA 3X44A 1IWBB 2PKEA 2QLNA 2X15A 4RVFA 5JANA 2PMDA 3OH8A 2I91A 3NGXA 4FT4A 3WL5A 5CUQA 3ZY3A 3R7WB 4DBLC 4XB2A 2FQXA 4HEQA 4NOMA 2AG6A 4W7IA 2FEAA 2IH2A 1VKNA 2A5FA 2AW5A 2NT3A 2NX2A 2C92A 1MP0A 2IPAB 2RIPA 2XE4A 3TI7A 5M2QA 4TTJA 3BTSA 1FX0B 4KDRA 3WLTA 5EEGA 1F14A 1R8JA 4C2UA 1G7TA 3GJ8A 2X8LA 1W52X 2DBQA 3ABSB 3C97A 3CLTD 1Z8HA 3MAAC 3NH6A 5B58T 3ONEA 5CT6A 3INGA 3FFXA 3GA5A 4IIUA 4W7SA 5CNMA 3GARA 4IGEA 5CB0A 1LY1A 2D1SA 2EFCB 2VQEB 3HUFA 1E2DA 5J2UB 2PKWA 5IJXA 1U1FA 2DWOA 1ZWLA 3DA8A 4KRYA 1EDBA 4Q4LA 1TYDE 4YJ2B 2ZRLA 3P2IA 4MS3B 3P9YA 4UHBA 4FDTA 3QWIA 4MW9A 1YF3A 3IEXA 3DHYA 3C5WP 4O8CA 5JXIA 2B1GA 1KP9A 4PYLA 1NURA 2GK7A 2I8CA 2RAUA 3K9BA 4M1ZA 4PRKA 1Y33E 4PPNA 3LHIA 3JY6A 4NH0A 5KBYA 1ND6A 1AQ6A 1Z17A 2FQYA 2ZPUA 1TUIA 4KDCA 2VT6A 4P35A 1GL9B 2BFDA 2AL7A 2P1ZA 1BCSB 1Q0ZA 1J0CA 1SQ0A 1ZHHA 5AVWA 2EIXA 1EGVB 2H4ZA 1OH7A 3TW6A 1ZD2P 1LSUA 1V8DA 1VCIA 1YU6A 1ZK1A 2DF8A 3C14C 3FHLA 3G7SA 3GEIA 4FQ8A 3I01A 1E7QA 4UKDA 4QPDA 2EJBA 2J5QA 1IY1A 3EDRA 3IXLA 4J29A 2FF7A 1PJQA 5HP4A 1SVOA 1DCTA 4PFKA 2FXIA 4CDNA 1PR6A 2G5PA 3NUZA 4PHGA 3FDFA 3TRHA 1WO8A 4UVGA 5G0UA 3H9BA 2IWHA 4WBNF 5DW0A 1N0IA 1Z5OA 3W8DA 2AOXA 1M2VA 2EVWX 5LJIA 2G77B 5HZGA 4HAWA 1HDGO 2DR2A 3ADCA 1CE8A 4JVMA 1XL0A 2VQ3A 1IZZA 2GRJA 3RIXA 4UTVA 1PHPA 3PX7A 3VJRA 3GXBA 2J45A 4H7JA 2DP4E 3HACA 3BQNB 4M9RA 5CLQA 4E31A 5EYPA 1RT9A 4HDSA 5DVZA 4CMGA 5HJ7A 3QWFA 4JEUA 1AF4A 1H9BA 1E58A 5ESWA 4LY0A 3H1BA 1F4LA 2BTQB 2VPXA 2XUAA 3PKZA 4ZQFA 2OGWA 4JS0A 1ISSA 3K0BA 3QKUA 3C0KA 3UMMA 3IP9A 2EV9A 4B3CA 4OI2A 1H5NA 1K6EA 2HN9A 1VMIA 1P60A 4JA2A 1DARA 3LK6A 1LPSA 4J4TA 4EB8A 3UK2A 3I2YX 1IN1A 2PMFA 2HOQA 3CX4A 2CSUA 4N5DA 4QDOA 1JR3A 2CZGA 4C0BA 2VNAA 1QAOA 1BW9B 2C2YA 3O3MB 3QXGA 4OXQA 4IFIA 13PKA 2GFIA 2ZXEA 3W4JA 4BMYA 4XUDA 4DJDC 1JFTA 2FW6A 4BO6A 2YWDA 3CRMA 3WVNA 4PYQA 2XI4A 4UUQA 3THYA 4HGZA 4N0MA 1EAYA 3K0CC 3HN2A 4MUFA 3WLOA 3TGPA 4Q18A 1TU0A 3FOAA 5COBA 1VL6A 2BGIA 2FVYA 3DOHA 3WYDA 1F2VA 1WU8A 3CKMA 4BKPA 4ZYZA 4URXR 3TG2A 3AP1A 3RHTA 1Z7EA 2XQFA 3UMYA 4LF5B 1JEYA 3UHJA 5C8YA 2GTIA 4KN5A 5DDIP 4RKRA 2QN1A 2QSZA 2X19A 3KP1A 5FBHA 4DXDA 1M1YA 1J49A 2X9NA 3FJYA 3G7NA 4M9XA 4LQCA 5ULLA 5HJEA 5DCLA 1GTRA 3E82A 2DR0A 4B85A 3VMMA 1U81A 2XZTA 2HJ9A 1KZYC 4QRHA 1UBRS 1JMVA 2HA0A 2G25A 2NP6A 2DHCA 2YWGA 1CUYA 5DI9A 3HJHA 1A27A 3K5HA 5AVRA 4BMXA 4R7TA 4CKXA 1WS6A 3GRCA 4X44A 3RDPA 2AX3A 5DTMA 1EHCA 3E7DA 4UHCA 1ESCA 2CKMA 2Q49A 1N5MA 1LJ8A 3TSYA 4LK2A 4OLJA 3FYTA 1WV0A 2XE6A 1JKJA 2W83A 1J8YF 1KVQA 2FW0A 2XOEA 3T5MA 1H1LA 5AQ1A 3TUZC 4EI8A 1Z37A 4Z9XA 3ZCSA 2GN2A 3ZX5A 1I6LA 1I9CA 3ZCXA 4MPDA 3DDUA 1JLHA 1Z0KA 4L8YA 1L5HA 4EYEA 2ATIA 3FNQA 1NVWQ 2GZDA 1PJ4A 2ZROA 3KWJA 4MP3A 3UNXA 4DUZB 1U7XA 4UVEA 2WU4A 4A0HA 2IYTA 1EDDA 1BWRA 1MX1A 3T5TA 3DOEA 4X1YB 2PZ8A 3GNSA 3ASZA 4G9EA 3F6SA 4MWGA 3MJDA 4QJ3A 3U3OA 2WJ6A 4H7FA 3WWZA 1YFZA 3ICEA 4DW8A 4DBVO 4HV4A 1XDUA 2QTMA 1XF1A 1OXSC 2BE7A 3MYYA 4L02A 5A4JA 1T6ZA 3LC1O 3STTA 2AE2A 5IKMA 2YNMD 1UBHS 4BQPA 3MT0A 1Y1PA 2VSNA 4PS0A 1KR2A 1V8OA 2GN0A 2QTAA 5FPTA 4WDQA 2EP7A 2XTJA 4HPJB 4C0KA 4O1IA 3P26A 3PBKA 1CS4C 3PD0A 2QROA 1Z16A 4CU2A 4B44A 4EOGA 4LISA 2VNKA 1IBCA 4RZQA 3CXUA 2MSEB 2AI1A 5KPJA 3ICQB 2AG8A 1YNSA 1UPAA 3ERCA 1N1GA 3L2OB 5HYVA 1JH9A 3RVMA 1SEVA 2XKAA 1HRDA 1U6JA 3BIXA 3B6KA 4HTFB 2QTTA 3EBLA 2HH9A 3C7KA 2HWXA 1C3XA 4Y6LA 4ALMA 2LIPA 3MTIA 2WMYA 4TVKA 3MCWA 1G3MA 4ZOQI 3IEMA 4BB5A 4JY7A 5JG7A 4F5WA 4RPHA 1KNQA 2PO5A 4DV7B 4PPYA 1W34A 3UK1A 3L0DA 4PPQA 5K9ZA 1T25A 3DBLB 4IH9A 4JBYA 1CQJA 1JR2A 3ZWKA 3EIHA 4Z7OB 2IYLD 1KJ8A 4LHWA 4XFJA 3BX1A 3ZCUA 5LSAA 4KGDA 4OQLA 1B43A 2GPAA 3G0GA 1JTVA 2WYUA 1QOQB 2R00A 2VCYA 2RH8A 4J7XA 2RMKA 4OQXA 3U16A 2JK1A 2O8VA 4DDVA 3LQ1A 5LCXA 4B71A 1RWVA 2ERYA 3VU9B 1R0CA 5EIXA 5DM70 3C2QA 3KJHA 1QG2A 2ZRMA 2WJYA 3BHNA 4V0KA 3WGIA 3I42A 1KEUA 4BBPA 3DEHA 4TRJA 2G1PA 4M0UA 5BQOA 1TZKA 1MMFB 4KQGA 4OEHA 3QSGA 4W8GA 4GRIA 3JVEA 4CR8A 1YV9A 1V11B 2I3ZA 1YCFA 2XB8A 4FOOA 3AXTA 1E9EA 3P2MA 3BTUA 3F3KA 4K6HA 3OVMA 4KX5A 4S3MA 2W2VA 4KZKA 1TYAE 5EZYA 4EYKA 4WNAA 2FFAA 4CEHB 4JLOA 4HX5A 5CCXA 4DV5B 1ZL2A 2AI2A 2JRLA 4JXXA 4AS3A 1FUUA 1HG0A 1U0SY 3NDIA 3UCEA 3IE2A 1CIJA 1J1IA 5E1MA 3ICVA 3PQ3A 3FA2A 4YRZA 4E88A 5LNK6 1PLKA 4MNTA 3SU8A 1KZ1A 2AMJA 3F1LA 5IC5A 3U3MA 4OQZA 4B83A 3WWCA 2RI6A 3C98A 3N2KB 4M1MA 3IEUA 3ND5A 3GLUA 4G25A 5EWMA 2I3BA 3VPCA 2FMHA 5KMGA 1H2RS 3WKBA 1KMMA 3V1MA 5AIBA 1R9GA 1F48A 1UFOA 1KYTA 3EXFB 1RI4A 4MCIA 4QA9A 3RC7A 4NV0A 5FNVA 4PVCA 4IF4A 4I1OA 5K8CA 3MF4A 1MC4A 4YJGB 1ZEMA 4NFLA 3WAKA 4CQMA 1ENYA 3DNFA 1RYMA 3B2EA 2WWFA 3QEJA 4FSHA 3JYHA 4ZV7A 1E9CA 3D2AA 1N9GA 1GFSA 4ND8A 3ZNQA 5JQGB 1ISRA 4YUZA 3JYPA 1QGAA 3KV3O 1A95A 1Y0BA 4LUCA 5COQA 3VOTA 5AIAA 3HBAA 1E2GA 1J9ZA 1Y6QA 4FMCF 5GAJA 3SKXA 4A0RA 1VJDA 3AEQA 4CL0A 1DJOA 3WJAA 1TLLA 3A9UA 2D74A 1SUBA 3ZWAA 1UMBA 2DM6A 2IC5A 4YASA 5JFTA 4CQLA 3BK7A 4Y2RA 1KI9A 4QICA 3IAEA 4B3GA 5EWJA 2DQ4A 1E3WA 2FX3A 4NQRA 3CPSA 2JDID 5JJLA 4KYUA 4BATA 3RIYA 4OH7A 5KC9A 4LJ6A 4WXYB 4IOLA 4FDAA 4I99A 1OR8A 1PS8A 2XWSA 3VBEA 1FYVA 2D2VA 4MW0A 1ZESA 4C1NA 1JR3D 3UV6A 2H63A 4WCVA 3FRIA 5DM4A 1NXVA 1VCHA 2AMFA 2GFHA 3ABZA 3JTEA 3T1OA 2YNMC 2WAMA 2HBYA 3CEMA 3HU5A 5KTRA 3TKAA 3HL0A 1EQUA 1W46A 3VDXA 4HDKA 3SWWA 4N03A 1ZRMA 2OL4A 1GZHB 3GUZA 3HHPA 5K0BA 1PYDA 1FMLA 3RSZA 1U1CA 1P6QA 2E48A 1RI5A 2AJ8A 2Q5HA 4JT9A 4OHOA 3ZGYA 2XUGA 4I1YA 4PRZA 3DCIA 1VL2A 5AK5A 2HLPA 1XZDA 5B2EA 4C7OA 4KPUB 2BM0A 2A84A 4Y0VA 3ZHCA 1RWWA 2IPNA 3T7KA 4EJ0A 2UVPA 1Q77A 1ZU4A 5JPIA 1DIBA 4O2AB 1LB1B 4GP7A 2MSCB 3NEJA 2R66A 4DJEC 1W75A 5JVDA 1XLTC 2J1LA 3B7PA 4POAA 3WZ2A 3CPJB 5ALWA 3ITKA 4B3DA 1ZH2A 3GDFA 4KXVA 1C3EA 3F67A 5ADHA 1N2IA 4Z5XA 2HYDA 1GGMA 4MMYB 3PNVA 2EZUA 3GH1A 5HOEA 1U9CA 2V7VA 3WRVA 3WAJA 1D9ZA 1II9A 1RFGE 3ESRA 1V4BA 4PIMA 3IHKA 1Y82A 2DR3A 1G8SA 1I3NA 3Q6NA 5K8LA 1Y37A 4XQEA 2PFSA 1GR1A 3EVFA 2PLAA 3SEAA 2XYVA 3HA2A 2OCXA 3PNPA 4NYJR 3DV0A 3U7IA 3S8MA 1DFHA 3AKYA 4ZCPA 1L5NA 2DERA 3M6WA 2OYSA 2VS1A 5K8TA 4LQ4A 5I7HA 4HQ6A 4LC9A 4FZRA 2I2CA 1USUA 2IVFA 2OZKA 1GQOA 1QMGA 1AG9A 4R8KA 2H9IA 1JA1A 1CWUA 1SELA 4MQMA 4S2UA 2PCJA 3TLBA 4C6TA 3I9KA 2W2KB 2Y2UA 1DSSG 2EWVA 2VI5A 3FUXA 3JWGA 4RELA 4Y2TA 1N1DA 4P7GA 5DYTA 4AZ3A 2Q27A 5FULA 1KO5A 1DC6A 1VIAA 2A6PA 4RGYA 1E9DA 1W59A 1CULC 4FZ3A 1PD0A 2QTGA 1N4DA 2PKYX 2W43A 2WDPA 3BGSA 3CR8A 3FR8A 4FFRA 1GA6A 1ZC4A 5KOHB 1D03A 4F7DA 3BXFA 1U1GA 3BQMB 4OMUA 2X5OA 2VDWA 2X14A 3E35A 4KUEA 1UBGA 2J41A 3BGDA 4IGAA 3INRA 4NENB 4ZAVA 3HNOA 5MN6A 2IS6A 4CVNA 3K6RA 4WKCA 2BYTA 3IR5A 2V7BA 3QLEA 3LKDA 4OUDB 3G68A 4NP6A 4OAQA 4TYYA 1NBIA 4H17A 2OFXA 1QR6A 4RZHA 2G0AA 3TQIA 3OOJA 4LJKA 3ZLBA 5AW3A 1YASA 5JNSA 2VJMB 5K6AA 4ZVMA 4TMXA 5AI5A 4EQ6B 5BWCA 1NBOA 3PD7A 3KAPA 3I3SR 3VI3B 5KQGA 4FHCA 1G21E 2H31A 1B73A 3I58A 3LAWA 1THTA 5I8ZA 2B25A 5G02A 4BMCA 1JU4A 1P8AA 1UK6A 3USZA 1H94A 4AY2A 2YXLA 3AUTA 4BP1A 5JI2E 2VT3A 3C8MA 3HEAA 2O2SA 1QR2A 1JW9B 1QQ6A 3L0IB 3D0KA 2VJYA 4L5BA 4UCWA 1MQAA 1PN3A 4DA6A 1KHTA 3LG2A 5FUVA 2ETXA 3NC1C 4CF5A 1E5TA 1FNBA 4IFTA 3GCGA 4BCCA 1LQ2A 3AUJB 4FP9A 4PCVA 4DJJA 2WSIA 4TKUA 2W6ZA 4IY1A 4F4CA 4LJ7A 4WZBE 1XMJA 1P91A 3ASYA 4EEXA 2JAUA 2UAGA 4IOKA 3N39C 1P33A 3PEYA 3OECA 4GLFA 2D7JA 2QRHA 1PJSA 4QXRA 3ZIDA 4JB8A 1BRTA 5J43A 3LI2A 4BV8A 2DUNA 3NJ8A 4B33A 1UMDB 3GBSA 1AJEA 2VT7A 3HV2A 3HVJA 1PJCA 5TQ2B 1EP2B 4HF7A 3TEMA 1X7DA 2NUBA 3IAUA 4AVYA 5FPKA 4RVUA 3LWDA 2W2TA 3W4KA 1J8FA 3BS4A 4RMIA 2OXEA 4XD2A 5CFLA 1F2TA 1RLTA 2QTNA 3BK2A 3LECA 4QLAA 3AEKB 4G84A 4ZQHA 4UCFA 4LIPD 4BU1A 5JD5A 3CKYA 5AI4A 1ZOLA 1KR5A 2GBGA 3AM5A 4Y2HA 1ZAYA 2XDYA 4BFWA 4KYIB 1FMFA 2TSYB 4UTOA 4XYGA 5F51A 2AR7A 2O2GA 3DE3X 3IBGA 2BHRA 4Z7JA 1XMPA 3LA6A 1M34E 4IVQA 5BUZA 4AY6A 2CYAA 3R3HA 5BW5A 3M3PA 2BF4A 1DV2A 1SHUX 2LCIA 1P19A 2BD0A 4GT1A 2ID8A 3GYBA 4WGGA 2GEDA 4A2CA 1H4QA 2HBRA 1GTZA 4GD3Q 3LBIA 2QTVA 1OT5A 1QRRA 2H16A 4RIEA 4D3ZA 2WB2A 1R16A 5JJKA 3JASB 5FOTA 4D6PA 2BFOA 3AM4A 2AQIA 1FYWA 1TQ4A 2RGEA 3MN1A 2LPMA 3UUEA 3ZLVA 1G8PA 4CQMD 4JHLA 2PWPA 3AH8A 1B15A 1FU7A 3RQSA 3K6SB 2H0RA 3BCRA 1V95A 3KC2A 4GNRA 4RU1A 2VLIA 4GECA 4YYEA 2KHZA 1C3LA 5EG5A 2HEGA 4QAJA 2HBZA 3ETEA 4D41A 4OSOA 4X8OA 3SAJA 4GI5A 4ND5A 2IT1A 4DLYA 4FKZA 1NE7A 4OHMA 1BIFA 1E2UA 3R5XA 1L5LA 1SQ6A 4S0XA 4HAXA 4M21A 4BUZA 2F1HA 3P9IA 1QWOA 3D6HA 3SXUB 1Q1EA 1Z4OA 2AFHE 3U3KA 2ZEJA 1W8IA 2FI1A 2QGZA 1XA3A 3GFGA 3OSUA 5PNTA 1NW8A 3PGVA 3RRJA 4INJA 2AI3A 1J5XA 2A58A 3HRKA 4QSHA 2UYHA 2PUGA 1O54A 2CE2X 4N0PA 4D4LA 3K73O 4EPRA 3GLFB 3JQPA 5D3QA 4F45A 2JG3A 5FWNA 1NR7A 2VYNA 3GZTB 4MTLA 4MI6A 3D1JA 3AUXA 2W6JA 3U7JA 4J3JA 5F2OA 3MQ2A 3MGCA 4PU0A 5A4AA 4K40A 3DDOA 1TW2A 4U4AA 4JGIA 3EF0A 3V6MA 1FQJA 1PLLA 5HA5A 1FJHA 4TM8A 2ILTA 2OAP1 1FUYB 1WY7A 2X1VA 3PU6A 2IUEA 4XEHA 1B7GO 2H7CA 4HWSA 4W6ZA 3GRRA 3P27A 5H82A 1JZQA 1K7XB 2YN0A 3MTQA 1M66A 3ESDA 1GYPA 4C07A 4C43A 2FK7A 3O3NB 1AVTA 3TUJC 2QAJA 5IVIA 2IUSA 3KXIA 4WE3A 5CJPA 1GL6A 3VHXB 4RIHA 1RLUA 1DAMA 4KPGA 4OGFA 4CMEA 1DAHA 1IK6A 2O1EA 3L4BC 2YV2A 5AVJA 3RUDA 4CG3A 5J2UA