1V9CA

Crystal analysis of precorrin-8x methyl mutase from thermus thermophilus
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
204
structure length
198
Chain Sequence
RAIEEESFRIVDQEAGPHGFSPLEWPVVRRMIHATADFEYKALTRFSQGAVEAGLKAIQAGARILVDARMIACGLNPERLRLFGNEVVELLAHPEVVARTRAEAAVAYAWEKGLLDGAIVGVGNAPTFLLALVEAIRQGARPALVLGMPVGFVNVLEAKRALMEAPVPWIVTEGRKGGSTLVVAALHALIRLAADGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Analysis of Precorrin-8x Methyl Mutase from Thermus Thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Isomerase
molecule keywords Precorrin-8x Methyl Mutase
total genus 61
structure length 198
sequence length 204
chains with identical sequence B
ec nomenclature ec 5.4.1.2: Transferred entry: 5.4.99.61.
pdb deposition date 2004-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02570 CbiC Precorrin-8X methylmutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 1v9cA00
1I1HA 1F2VA 2AFVA 4FDVA 3E7DA 2AFRA 1V9CA 4AU1A 1OU0A
chains in the Genus database with same CATH superfamily
3E1GA 4K0RA 3RVSA 1NXQA 3OKAA 1RKQA 4PYRA 4HDKA 4W82A 3L7CA 5KNCD 1EBBA 1N1DA 1PR9A 1WMEA 2AR9A 2CDAA 2PL5A 3JQAD 4YPFA 3TNLA 1OROA 3VHXB 4WHMA 4BNLA 4CL8A 3IERA 4TKLA 3O1IC 5E9AA 2XLCA 4DTIA 1CD5A 3IAAA 3B1YA 1AS3A 3O1LA 4TUYB 1A9YA 5FHQA 1AKUA 2HU7A 3KYDB 1ZSYA 4LWOA 1JP7A 1VBFA 1SD2A 1E3IA 1ZCFA 3ZY2A 1GM5A 2PUBA 2XUPA 3OPMA 1BDIA 1RLUA 2D06A 2AQ8A 4CLOB 1PT8A 2FSVC 2D00A 2J7PA 4G5OA 3F2IA 4DHWA 3WLOA 3MLEA 2D7DA 1O57A 2VJMB 4IJMA 1V5GA 1WCV1 2A5DA 2F4NA 1MXHA 3AESB 4YP0A 1JMVA 3OVMA 2HV9A 2XA1A 3PQ3A 4K3VA 1UBJS 1JT9A 2GPSA 3N0XA 2H8KA 3LY5A 3CJQA 1FU4A 1ADGA 2EWVA 1VLLA 1X94A 4G36A 3IAUA 1OGJA 3CMCO 4TZTA 3ZHQA 3EPPA 4G0ZA 3IHLA 4LV8B 1Z82A 3ROKA 3SKVA 2PA3A 2XTMA 4DJAA 3VNRA 3DPUA 3OO1A 2P5UA 5EL0A 3EFOB 4DVJA 3BZBA 4Y2QA 1YACA 2AFIA 4UU7A 3KNZA 4CIDA 4NCJA 3ELDA 4HD8A 4R1SA 2WD9A 2PWZA 4IQ4A 3ZZUA 3OFSA 2O1WA 1E9SA 2UYQA 1B0ZA 3M9WA 4MQUA 4A91A 4ENRA 4MJ7A 5G0TA 5JAMA 4ALJA 2D3WA 5E0KB 3WIUA 2ZROA 1QVVA 2OHXA 2ZB7A 1U0GA 1V16B 1XTVA 4C6TB 1J9GA 1WPGA 5I9SA 5A4FS 2KX7A 5FWDA 1S7CA 3CINA 1E2HA 1X6VA 2ADMA 2ZI4A 3H4TA 3VUFA 4F3KA 4B3SB 2AG5A 2GS9A 5ALHA 4V2IA 1N0UA 3EZNA 3H5AA 2PSEA 1S3FA 3KB6A 1ECPA 2BP7A 4ID9A 2M6KA 1JT2A 4MHTA 1H22A 1ML4A 3CH6A 2Q6TA 3M1IA 4Q1CA 4IDEA 4A8JA 2C5SA 4Q9JA 1KIAA 1FMCA 1OX4B 1V2GA 3LGXA 4B17A 3DZBA 3RUEA 2GVNA 3P0HA 2JFHA 1GL6A 2C29D 4H27A 3VV3A 1DOAA 3S81A 1JR3E 4Q4HA 1W25A 3VVLA 4P22A 2P9TA 1HNZB 1U3VA 4BLWA 1BRTA 4MLDA 3RWOA 4CBVA 5IABA 1U9CA 2QTVA 2X1VA 3MUOA 4UHBA 3WNZA 2JBAB 4BFCA 4ND8A 3IP7A 4WZAE 1DQSA 3Q7SA 4FMBB 4A7PA 2XHEA 2MU1A 3R0IA 2G72A 2X4GA 3K5HA 2ZUWA 3R7SA 3GLFE 3ZJTA 5C32A 5IXYA 1H9BA 1X7ZB 4KO1S 2H4WA 3IR6A 1AKWA 3KPVA 3ZW9A 1OU4A 2VDMB 2X8JB 1QVWA 1ZOOA 3BH6A 2MDTA 2ST1A 3H9UA 3KTFA 4IGFA 5A9TA 4LVUA 2BUAA 2JH9A 5ICEA 4HDSA 5KNDH 1X86B 4NMHA 1UR5A 3H9GA 4KTVE 3DFKA 1J2TA 4DCGA 5DXAA 2XTNA 3D6NB 4IDDA 3VO9A 4HUTA 3GGPA 1J2JA 1E6MA 1XVIA 3FKSA 3C6KA 3EG9B 3DMGA 1OYOA 4GOND 5GONB 3ETNA 4JZYA 2F3RA 3L0IB 3FPCA 4YMHA 4Q7MB 3K3PA 2A5FA 2JGKA 5L3RA 1RAFA 3UMVA 3ZEAA 3IEXA 4ZFNA 3ORYA 4CV3A 4UVIA 3T6KA 5AIAA 1K6EA 3H1AA 3DAOA 5SYMA 2VFAA 4DLVA 1K86A 2C00A 3DC7A 4MKHA 1QHHB 4WN3A 4H6VA 2ZTMA 1CT9A 2QE7D 2QRLA 3TINA 4JXXA 2VP5A 2E4XA 4GKBA 3HJUA 2OHOA 1OFTA 2QPAA 1JJIA 3HG7A 3PC8A 3WL6A 4WXRA 3B9QA 3PUWA 4YY3B 1FFCA 4BNGA 1N0VC 2VWGA 2Z9DA 2ZRMA 4O6VA 4IWYA 4ESOA 1MJNA 5GPBA 5CLQA 1GPWB 1ZI8A 2IGBA 2M1XA 4BV9A 1TF2A 3LTEA 2G8NA 2N1BA 2R6FA 3X1ZA 2REXB 3HWRA 3USCS 1T5HX 2VPYA 2YFQA 3HCOA 2R48A 2IOHA 2XRYA 5L4LA 5BV0A 1ZAYA 2P9GA 4UNIA 2UVQA 4MMYB 1GTL1 3S2EA 1K3TA 3T7AA 1RHUA 3AP2A 2IUFA 1IM8A 2PJZA 4DQ0A 1V3UA 5HA5A 5A9RA 2V03A 5CGZA 3FNEA 4L0MA 4GBGA 1H0RA 1TMYA 1EJ0A 1YMVA 2ZSDA 1JALA 1XJQA 4UTOA 5FTKA 3TLMA 4AMBA 5BOSB 1WXFA 1KF0A 5BSFA 2LCIA 2FF7A 1S1CA 4UQOA 1JG7A 1S8AA 1VKNA 4P3OA 5BQPA 2ZRIA 4QGHA 1XVLA 1IBCA 2AFRA 1BCRB 1KI8A 5KYGA 2EDCA 3CUKA 1XQXA 4IX9A 2ZIZA 3WQQA 4KNWA 5AT1A 4FGJA 5KVVA 1QHXA 3FZYA 3HGMA 3FRHA 2O3JA 1X2BA 3EVGA 3IUQA 3K9GA 4LI0A 3BFXA 1MJ5A 2G1KA 2CXSA 4JJ6A 3T9FA 2YASA 1L5HA 3D6UA 3NO4A 3SS7X 2JFFA 3VAZA 3LZCA 3LWDA 2W2LA 3AUYA 2EJTA 2RE8A 3JARB 2A9QA 2WD7A 2IHTA 3N59A 3VV2A 2X8WA 1AE1A 3D6TB 4WIAA 4EG6A 3O82A 3JD3A 1KI4A 4FZ5A 3RYTC 1Z12A 5BUCA 3BMQB 5F2NA 1SC1A 3ESCA 3COVA 5BSWA 3CN9A 5BQOA 2BISA 1OH5A 5H3CA 2J08A 2VNJA 4JCOA 4EUSA 2XUAA 3Q5GA 2HM7A 3CRQA 4P5PA 1RCUA 1W85B 5AHKA 1E96A 3UGQA 4DCNA 1J0CA 2WICA 1Z8NA 4KQCA 1DHTA 1T15A 2BM0A 2CEKA 2R00A 5EQDA 5E4YA 3W0LB 4KX3A 3DCNA 4NZOA 2VUHB 3D43A 4XJVA 1GNLA 5DEOA 4E32A 1WXDA 5AW1A 3HY4A 1A5ZA 2B4TO 5DNWA 1DTWA 3GLFB 1EVLA 2B2NA 4NZ9A 5HXAA 4IWXA 3OC6A 2JCYA 1P7YA 1XKLA 1VMKA 2BF4A 3OLQA 1F20A 1QH1B 1U2RA 4V38A 1UBGA 3UTCA 4AO8A 4PCVA 1DO8A 4FSDA 1QTQA 4W5HA 4EG5A 4BB9A 3IJEB 5C51B 4IVQA 4AUNA 3QBDA 5B3AA 1PZHA 1QVZA 3IVCA 3K5PA 2HY7A 3TL2A 2QJTA 2XNKA 5KJFA 3RYCA 1UINA 3VH3A 1NG1A 3EUWA 4PG5A 5ICFA 3O8NA 1EEXB 3AG5A 3CUEF 4MQEB 1NMXA 2YVLA 4K9KA 4A5OA 3CW2A 1MQSA 4AVYA 4C6SA 3CPJB 4J0QA 3L7OA 4P3KA 2JLXA 5EVCA 1GRQA 1O6BA 3G17A 1YRQA 3I58A 3HA7A 1BVYF 3K9WA 1K7YA 2DZDA 1XWWA 2O2XA 2FI1A 4R4JA 3UMGA 4EB6B 2WSIA 1XQ6A 1PW7A 2DUMA 2P35A 2KS6A 1I51A 2XUKA 3B3QA 1VSVA 3QQ5A 4WX2B 3U31A 1UAGA 3BTOA 2X7XA 2WWHA 4EO9A 1QP0A 4X1YA 1EUCA 2QUHA 5K3EA 1J8DA 3U4QB 4UBIA 3AVOA 1XNJA 1WXIA 5DBGA 5C9ZA 1GPBA 3GGDA 1JQ3A 2EP5A 3H4MA 3OPYI 3HL4A 4UW9A 2OOSA 4MS4A 1NVVQ 1ZONA 2HA3A 2J46A 4U9IS 5EHNA 1Q17A 2QKYA 1N2CB 3RUFA 3WICA 2BFCB 1D5CA 1Z6XA 3NIGB 4EYEA 1ZVVA 3USZA 4C07A 4D4MA 4F93B 3G0IA 4GSYA 3KB1A 4S1TA 2X3UA 2H4FA 2HSWA 1NYRA 4LEIA 2REQB 3LE8A 3RTDA 2LGJA 4D8YA 2ERXA 1JDBC 1YD7A 3HMKA 3Q0TA 1LRLA 1E3DA 1I6WA 2AFIE 4FU0A 221PA 3C2QA 2CJWB 4UVHA 3E48A 3TFWA 5MF6A 1CY6A 2CNWA 5EXTA 3RRZA 1MC8A 3WLKX 1E9CA 3FTFA 3N8IA 4PSKA 3FRIA 4QFCA 5L7YA 2H9AA 3NIDB 1U1GA 3V3KA 4PYQA 2G5TA 5ICMA 2P91A 3IAEA 4CTNA 3WIDA 5BSTA 3FGNA 4ZAWA 5L7WA 4Q5IA 4J1TC 4NYMR 2ATXA 2VNIA 4KRXA 1P39A 4QDZA 2ZJ0A 3COZA 3E3NA 5CEEA 2PRZA 3TXXA 5IZCC 3OZUA 2W5UA 3LD9A 3H6KA 4JQCA 3VZRA 2FWNA 3OFKA 2CKDA 2DFTA 4GMDA 4LHEA 4WPGA 3GDGA 5REQB 1XMOB 4MQ6A 2CDBA 2O8CB 1V8ZA 3D8HA 5CCEA 4W5JA 4RPCA 2JKVA 1BEUB 2B1JA 2P11A 4XYBA 1C1XB 1SD1A 4G1UC 4MSUA 3U80A 2HPVA 5JS8A 4XDHA 2ZRFA 1G4HA 1YC2A 2CBGA 2E1RA 2W43A 4AZTA 3WAJA 1OI2A 4PLVA 2J5RA 2JI9A 4D57A 2O20A 2JLCA 4FT4A 4N54A 2Q3CA 2GTIA 4MI3A 5EWMA 3T35A 4HG2A 5KOHA 1NV8A 1CR6A 1I0IA 2HQSA 3L79A 2QQFA 4HMOA 3I01A 1ICEA 1E2UA 1P9LA 2JATA 1E3WA 4I1SA 4MR7A 1WA5A 3WLQA 1L6IA 3ZLUA 1W48A 4G97A 3JQ8B 1YVDA 2RI6A 5FBKA 2OILA 1Y5NA 1LBHA 2W37A 3BSYA 4MRVA 1OZAA 1JYFA 2X5OA 1CETA 1SRQA 4M60A 4NNOA 4OBWA 2AHRA 4WUTA 1CE8B 1W88B 1XP8A 3INRA 3K09A 3T41A 4LDRA 4H7HA 4DUZB 2GAOA 4L5YA 4CG1A 1VJRA 2RGYA 1OXKB 4Q3OA 3P27A 4RYDA 1WDWB 5DW3A 1ZJYA 4GMXA 3D3KA 5BUQA 3CONA 2R6AA 3W06A 5DNCA 4QOIA 2CXTA 4RCVA 3IUEA 4RDCA 1C0KA 4RELA 2J0UB 1QYIA 4KO8A 3WFZA 1L7XA 1RP7A 2Y0BA 4LMBA 4NECA 3UATA 2WUDA 3K72B 3NAGA 4C0QC 5E6RB 4GAEA 8MHTA 4ENWA 3T7CA 1Z6ZA 3CW9A 1PSWA 3UXYA 4YJ3F 1Z4IA 2FZ5A 3GR6A 4QYMA 1JKXA 1T43A 2R5WA 3EZLA 2R0QC 1HDIA 2Y1GA 4L0CA 5TQ2B 3T3NA 2OCGA 3QA9A 5JNSA 4HRYA 3OEWA 2Q4OA 3IOCA 2LUOA 1LD3A 1I33A 3DKRA 5M2QA 5JAQA 4Z6KA 1MD9A 3O7WA 1TCUA 2ODAA 4K9SA 1GPNA 3MSXA 1HUQA 1KYIA 1Z8DA 3H7AA 1G5RA 3HNPA 2I7VA 4YCDA 4ND7A 1DBPA 3K09C 2PE5A 4BO7A 4CV1A 2PUHA 1JEYA 2Q0HA 3N2YA 5JMPA 3G9QA 2J30A 4II7A 3SG0A 2Z98A 1PYOA 3E61A 3W79A 3ZY5A 1V7PC 3MN1A 3PA6A 3R3JA 4EDHA 3HI4A 5TS2A 1Q1QA 4BYMA 3SX2A 4L3WA 3FFTA 1MEOA 2OQ2A 3ZY3A 1ZMXA 3TR6A 4X91A 2VTVA 4ZQCB 2B98A 3K0KA 4PCLA 4O33A 3DT8A 1GRRA 1Z0UA 1LW7A 3IDFA 2AXPA 2HMTA 4INOA 2JJ2A 4EHLA 1KGSA 3HJTA 3AOEC 4G6ZA 2BGNA 4YLEA 5B4TA 6PFKA 2B7CA 1QR6A 1XDGA 1N6RA 1S02A 2XECA 4MWGA 2FEOA 2OGSA 4J0KA 5DZSA 5FWXA 4DQLA 4F9EA 4ZAZA 3BWXA 4PYKA 2VC2B 2EKZA 5DNYB 4BMPB 1MG5A 1F1JA 1RKXA 3CNNA 2CE2X 3K6SB 2NO9A 4Z8YA 1MABA 1QVAA 3FB4A 3VKWA 1WDMA 1ZGCA 4BO9A 1D1QA 4U3JB 1EI9A 2PZFA 3BMXA 1U0RA 3EH2A 4AECA 1BU5A 1DC6A 3QEMB 3T4UA 1GU1A 3MB5A 3L7YA 3A4IA 4NBLA 3HFJA 4IFTA 4NX2A 3WO0A 4GSKA 1NMQA 1YRHA 5LM3A 2R4TA 3QVKA 4LXXA 3BMOA 2Z95A 4ME6A 2YYSA 3LT2A 4UQPA 4EO4A 2C7PA 3FTEA 3ZJYA 1AQIA 2FPUA 3S55A 2DH6A 1WZNA 3R7LA 3W3AD 5IEJA 3AXSA 4EVRA 1K06A 3PB3A 3UO8B 2VPWA 4UTPA 3EJWA 1M0WA 3GQBB 1M8PA 2GBLA 1WHTA 4G0YA 3UNXA 2AFHA 4JP5A 2JK0A 2NSLA 3DKIA 3PFIA 1PWYE 5BNIA 3GBSA 1XKXA 3RIMA 4DEYA 2H08A 1VYHA 4OHMA 4BMCA 3FCUB 2NPOA 3EBPA 13PKA 2I9PA 3E27A 4MWEA 3L02A 4UAUA 1DXOA 3MYYA 1K4YA 2N47A 1JDPA 2IPOA 4OA8A 4X8MA 3RF6A 1BXRA 3BS4A 2E4WA 4FFBB 2YZ2A 4YJ2A 2ZWMA 1LLFA 1IN6A 1L8AA 1B42A 1C9JA 1SIUA 1X1BA 2CXPA 1GARA 1CUIA 3D3NA 3MCZA 2DY1A 1C80A 2BZGA 3OE7A 3G82C 5JCXA 4XD2A 1HH4A 1MUUA 3NXSA 2AV6A 3C70A 3C8DA 2RSLA 3BDIA 5TNXA 1AU9A 1YVRA 1IVYA 2NYVA 3WGHA 5MFPA 2IX3A 5FNVA 4DA9A 2UZ1A 4KRGA 3MT9A 4MUGA 1C4KA 1WE2A 2DTDA 3SVLA 4Z7OB 3OD5A 4I81A 1SBHA 1EFDN 5TPWA 1RACA 4C01A 3T8YA 1RAHA 4NHEA 3DE3X 3IOEA 1Y3AA 1KI6B 2NSHA 2Q0SA 1BH6A 2PBRA 5DULA 2NT4A 2OO5A 5BQFA 3U44A 4KO3S 1CQIB 2XDQB 4LJLA 1KI2A 3T99A 3VNSA 3A0RB 2RGEA 3QU9A 3ACDA 4G23A 3A9VA 3UYLA 2I66A 2ACKA 2W2VA 2AJCA 3TW0A 3VHLB 3UK2A 3M1AA 4NK5A 2H0RA 1EX9A 1TTHA 3KM0A 4WEQA 4LV5B 3LS2A 4GRAA 1Q14A 4LSGA 3ZY6A 2FOXA 5K6RA 1RC1A 1AKVA 1TCBA 2F1JA 4LJ6A 3TZ6A 1U31A 1YGPA 2VQDA 4ZU1X 3A6KA 3STWA 3ZE2B 4N5LA 2Q6IA 2AX4A 4ZYTA 1NVTA 4WK4B 1Z73A 3DYIA 1G63A 3C74A 2WHXA 1ZNYA 2OT3B 2C0QA 1AXEA 1L5LA 2XB2A 3AEYA 4YQEA 4IMRA 5DI3B 4F4IA 2XV1A 4K8OA 4CNBA 3EEBA 3WIVA 4CCAA 4B44A 4AD8A 1OI7A 2ZP1A 2X2PA 3H13A 5KREA 5CLLA 2ZZMA 5AI5A 4QG7A 2C4KA 4BFTA 1XSEA 4UC0A 5ILQA 4GEGA 5AW5A 2GSWA 5FI3A 3SN6A 4D9KA 5FUQA 4OGLA 1WMSA 4RC9A 1KR5A 2HRRA 2OLJA 3JQBA 3SBEA 3TUJC 4AXXA 1R4MA 2X41A 5KTTA 3HVRA 1FIUA 4NQZA 2ZGVA 5CAEB 1ID1A 4RWZA 5FNVF 3FUCA 2O57A 2WNIA 4JXJA 3TLYA 1KYTA 2I33A 2O3QA 4IJ6A 4ZRNA 3S8EA 2AMVA 5K6TA 1QIKA 3SC2A 2GESA 4PU0A 3TB6A 1RYDA 1DEKA 4WXEA 4EA8A 4G0VA 3A1EA 5BWLA 5D7BA 3DE5X 1QZZA 4OO3A 2C4HA 1G21B 4J4TA 3ZNQA 3D3WA 1GYQA 5H83A 5F12A 5AVZA 4GI2A 1A2OA 4HWGA 1P9OA 2QLTA 4PO9A 4BUCA 3RT9A 3ZX5A 4TKUB 2C99A 5MN6A 5K8LA 3I04A 1XZQA 1HYGA 3M83A 2C9MA 2KW5A 3D3JA 4P9NA 1YHZA 4PBRA 2I3GA 1EGMB 3C3WA 3CJRA 4G86A 2OFXA 2XUZA 3LK6A 1YR6A 2LIPA 3M70A 4FI3C 3ZE0B 4F6CA 1KAEA 3DBLB 4RPJA 4W9NC 3TGPA 4I8XA 1GSAA 2F90A 5HF6A 3TF5A 3T9EA 5DU2A 2ZS8A 2RHBA 1ZEMA 3QWHA 3L7JA 1QHFA 2FB9A 3M5DA 1SZDA 4K6OA 3RSGA 3L1IA 3WK8A 1U7PA 4BP3A 4BGEA 3DOFA 4RV5A 1XLUA 3U9LA 1S96A 3FG9A 1EFAA 4NBWA 2XZPA 3ELWA 4KNVA 5F1KA 3WQRA 2M32A 4S1OA 2GJAA 4NG4A 2P9ZA 4KRFA 2DU8A 3F46A 4JQOA 3JY6A 5F1OA 4DCTA 3F6EX 3SVTA 3VKHA 2I99A 3KJQA 2X5JO 4E08A 2HJ9A 2ZJYA 5M34A 5HJ7A 1KJIA 2NZUG 5JTUA 3ID6C 2R1VB 3A58B 1DMRA 3N3BC 5EE0A 5IK2D 4KIFA 2WSMA 2EX0A 1CYDA 2FOLA 3A2LA 3PYMA 2HXGA 4R5MA 1GTZA 5B3KA 4G25A 3HYSA 2XTJA 2GFIA 2FLKA 1JX6A 3UAZA 2L19A 5FRDA 2ZOSA 3RYFA 5KO2A 1NI4B 2A35A 2A57A 3PWTA 2NGRA 1YVPA 1V1JA 3W2EA 3DF9A 3RRBA 4RJ2A 4DIEA 3D2BA 1TZMA 3DBHB 3UF0A 4B2LA 1LZLA 1FLVA 1Z4LA 3I04M 4JHXA 1YZFA 1OHHA 5FBLB 4RZHA 3C6MA 4NYMQ 4EOGA 3G0HA 3IOMA 2PHZA 2VP9A 4M2LA 1QF9A 3CEAA 2NYAA 4MAMA 4YYZA 1QLWA 2V1XA 1DDIA 1NT2A 3C5EA 4C7XA 3MELA 1AGRA 3K2EA 1G16A 1OYYA 3RIGA 2DKFA 1R6DA 1Q0QA 1YBFA 2HWWA 3D1VA 2V7UA 3Q11A 3QXHA 3VOSA 4BEBA 1DC8A 3TJMA 2NSJA 1IB0A 1PWEA 5EMLA 1JHDA 3GCDA 3KOMA 4QGFA 3LHSA 4BQRA 2WB4A 3B7GA 1QU2A 1TLLA 3TOVA 4YQZA 1CUBA 1XCOA 1T2CA 2WINI 3G8DA 4S0XA 1O3YA 2OZLB 4JP1A 1QP4A 1YBHA 3NM6B 2ID8A 4WOCA 3R8CA 1NSYA 1E20A 3PS9A 1D0VA 5G0WA 4BV8A 1W2HA 3MBKA 3NDJA 4R3UC 2WK1A 3FOWA 3VOBA 3AVWA 2V6GA 4FZRA 1UM9B 5D5PA 2WU1A 5CXSA 3FGPA 1MAWA 4KL8S 4BXOA 3A3PA 4BRWA 4ZVOA 4RF4A 4C03A 3H9JA 2OB2A 3GNSA 3L6UA 1JWBB 4PGGA 4F5ZA 4ZI2A 1M0EA 1Y8RA 3OMWA 1MJGA 1RWOA 4MCHA 3S8MA 2IW1A 5EWJA 4EABA 3PNBA 3VRHA 4BE4A 2WTXA 1GLVA 1JSXA 2FQQA 2V5VA 4MUJA 4GZ5A 3A4NA 3LW7A 1KY2A 3BC1A 4PHGA 1G3RA 4BLSA 2X15A 3B3GA 2ANBA 4PQEA 2W6CX 1DT3A 2GK7A 1DT5A 3GLRA 4D56A 4WINA 2PMBA 3KQOA 5FX2A 3OTWA 4UARA 1UXGA 5ALXA 3CN7A 5DYGA 5B2FA 1GUAA 1E89A 1Q1BA 3IP1A 4R2LA 1MOPA 1CJBA 2O06A 5DNEA 5EXXA 5G4KA 2MINA 4BO0A 5K9ZA 3CUYA 1I3OA 4URFA 5AVUA 1ESNA 2EFJA 5ALWA 1L3BA 2PYZA 3AF3A 4HNGA 2YL2A 1H5UA 1GJRA 3OTQA 5FBQB 2RJ3A 4EK9A 2PSSA 2QMYA 2ZJ6A 5HKAA 3MA0A 5D3MB 3FPEA 4EHHA 2YY5A 2AN4A 1Z7WA 5EC8A 3SYLA 1AKNA 5KMGB 2I1QA 7REQA 4ERNA 4C3ZA 2QRJA 1QRTA 5IU6A 1RYYA 2KQUA 2QRQA 2FUKA 3P2MA 3QEKA 5JIBA 4FPXA 2O8BB 3R9IA 1H8EA 3N07A 1YQGA 3EZ7A 1M6WA 2G6BA 2GOYA 2P6UA 4YJKA 4DARA 1MHPA 4IH9A 5CVUA 3UAVA 3JTEA 1GV1A 4XWOA 1ML3A 4QZVA 4DNFA 2JIRA 1XZGA 4DY6A 1U6JA 2PGNA 5TEVA 3G8AA 1NAIA 1YVEI 1UOQA 2BW0A 2H1VA 3GLHA 4RDHA 4C0AC 1GYRA 2ATVA 2FPLA 2VP3A 3NBMA 2LV8A 2IEGA 3Q2KA 1VE6A 5AUNB 1R8QA 3P4YA 1EK2A 4OQYA 4DIMA 1EDOA 5IMBA 1SEVA 4BLVA 4UHKA 1BIFA 4Y0AA 2C97A 1JPJA 2WABA 3IBFA 5HKLA 4B2YA 5BR4A 1SHLA 4CTKA 2ZWVA 3SOZA 3O8LA 3CLRC 1PUJA 5KB3A 1M6YA 2Q2VA 1N2IA 1TUIA 1U4OA 1D8AA 2I03A 2DFVA 2J48A 2QWXA 2VJLA 3EQ7A 1DUIA 3OSZA 3R6TA 4F3TA 3V1MA 5AP9A 2D6FA 3D3EA 2VZ9A 2VDUE 3MTGA 4KMMA 4RHXA 4JA2A 3GLUA 2WSBA 1Z2OX 1A9RA 2ACEA 3DCYA 5T67A 4B7CA 3IA2A 1GVNB 3A1TA 3LT4A 3A6PC 1A1SA 2E82A 1YE5A 1L6RA 3OEED 1A8PA 4WSOA 3UQZA 3SZUA 1C7RA 1DAIA 4HZUB 4CF6A 4Z1OA 4B81A 2FR0A 1HURA 2COKA 4GFDA 1WR8A 1AXRA 3EGCA 2I6FA 1Y7TA 4TWBA 4AF6A 2J4CA 4OHBA 4H7KA 3AWDA 2CFOA 5AW3A 3KHSA 1M8KA 3ODPA 1GTRA 1TZBA 1XDWA 3I1IA 3HU3A 3GNTA 3ORRA 1T9HA 2I29A 1ZH0A 3RBAA 2A3RA 3RKSA 5HKOA 1ULUA 3W5DA 5DO9A 1ID8A 3OTGA 2AR0A 3HBAA 4GP7A 5F9FA 4YRZA 1R18A 4FGLA 4IDBA 3M6WA 2RH9B 2PLWA 4FHGA 1KHHA 2C9BA 2V55B 4N5DA 1MFPA 1T4BA 4TQGA 1A4RA 1PZFA 1TRHA 4D9EA 1CCWA 1SOWA 1ULTA 3QXGA 4Z4HA 2DFLA 3GI1A 3ZCSA 4D8UA 4PXSA 4JITA 5DCLA 2A0FA 2HU8A 2HCJB 2XMZA 4RTOA 3CNHA 2X14A 4O4LB 2AKEA 1GQQA 1S2GA 721PA 4TXLA 4NCNA 3O2QB 2NYRA 2CHFA 3CRMA 2QN2A 1GCGA 2HGZA 5JWOA 4UBJA 2IEIA 1I1OA 1N0IA 4Y7DA 1AUPA 4EYQA 3NGLA 4ENUA 3U26A 3AV0B 1QCDA 4QTZA 2WT9A 5DH9A 2WV9A 3E6AA 4Z4FA 4ZT7A 4EUFA 2CNKA 3G5AA 3IP5A 5K3DA 3FUVA 2CN1A 1UP7A 2WFLB 2EGUA 1SKAA 2SKCA 1FQJA 3QKSB 4CKZA 5KTNA 4JI2B 1OGYA 3O4JA 1M2GA 1M1YA 1SVKA 4RTRA 1E9FA 1BCSB 2A0KA 4WGGA 4Y2RA 4OHYA 2PIAA 3TNJA 2Q1TA 2PGDA 1RI1A 3HDQA 4CLEA 1JAHA 1TA0A 1PT9A 3I9V6 1EGQA 1Y1KE 3OAAD 4P98A 2FR1A 4TTAA 3ZCQA 1U0EA 2CLOB 3I39X 2Z9BA 5HIIA 2XQVA 3SKXA 1Y7LA 2P79A 4QQNA 3PHBE 3G68A 2ZKIA 4NV1A 1WMFA 3EOBI 1G8FA 3G2PA 3QLEA 5IT5A 2P78A 2WM8A 2F8MA 3GV0A 1U90A 2AJBA 2EW2A 4BNKA 3KYDA 4CWAA 3K70C 2VRWA 3BE5A 3DDUA 3UHOA 1L8LA 2JIZA 3GJYA 2H31A 3DM9B 2REBA 3OEHA 4P3XA 4TT8A 1QB8A 4AZ3B 4RETA 2IWRA 3HZHA 5JE8A 2HSDA 3M81A 1A9PA 1M74A 5KX5F 4DJ5X 4X92A 1NW3A 2ORYA 3R5JA 4B6SA 1T3TA 2WRZA 2XMCA 3EIFA 1NVUQ 3SSNA 1Z2CA 2GZRA 3CH4B 1G7SA 3TX6A 1ZH4A 1WUJS 4R6XA 1UC5B 3TGLA 3V2UA 1STOA 4GI3A 2W2QA 4R2WA 3KBOA 1YR8A 4H08A 4PG4A 4RZ2A 3EVBA 3Q6NA 4Q12A 5ECYA 3AR5A 3W4KA 4E46A 5A3RA 2V3CC 1XZHA 2QX7A 4NEGA 2HEGA 2IZ7A 3GH1A 4HL6A 1YFKA 4HQLA 1XYGA 3ZDBA 2QTNA 2Q1YA 4F21A 3RDPA 3W8FA 3IIJA 3GEBA 2PQ6A 2ZR0A 3KZ1E 3R0XA 4WBSA 1BO6A 2R85A 4MDYA 4POAA 2NUTB 2H65A 4KVZA 2FW7A 3DDNA 3LZ6A 2GAIA 5F7XA 1VB3A 4LYFA 3MRVA 1MB9A 1OXBB 2G9VA 3WLPA 1ZHFA 4M89A 4LGYA 1GUDA 1PWZA 3DLHA 1P4SA 1AUVA 4C3OB 1ZR2A 5CK4A 1SQSA 5DCWA 1KP9A 4QTXA 5I4IA 3ED5A 2EAUA 2UDPA 2Y76A 1OCEA 2PAAA 3KXPA 1E2LA 1NBEA 3PUKA 2FQWA 4ZXFA 2D5AA 4H7FA 4LYHA 2BP7B 3GFBA 4V03A 2EL7A 2Q9AA 4WV3A 4LJ4A 5CM8B 3GF4A 3U3RA 4Z53A 4A8JB 4NLLA 5KQLA 3JVUA 5ECGC 2WWYA 1AZSC 3WGTA 3V1LA 3G2QA 1TYAE 3QPVA 1E5DA 4QHYA 1D1TA 1BFKA 4XQEA 3FPAA 3QH4A 1XLVA 3PCXA 4Z3DA 2BD0A 3PF8A 4GKAA 4LY6A 1AGPA 5THKA 4CKBA 1RQRA 2VHQA 3A8TA 5CDTA 1U8UA 3BJMA 3DXFA 5K5EA 2LWIA 2QR2A 4B3XA 1FU7A 2WC1A 3BKXA 4ND8B 5I8WA 2WSSD 1IRIA 4J76A 3NVMB 5JFGA 1HY3A 5BV8A 1OAAA 1YOVA 1HFEL 3PZBA 4L85A 2M6SA 3EARA 2Y77A 4OK5A 4L02A 2IXTA 3S1LA 2UUCB 1T9CA 1Z18A 2JJ2D 4RACA 1JVNA 2RI1A 4TUYA 1E79A 2FRVA 2XYQA 4Q4LA 4FFPA 1M8FA 2CMGA 2OLEA 1HE1C 4RADA 1ZMTA 3K0AA 4ZTBA 1WBJB 3DKVA 4EECA 1Z63A 2PK3A 1DZIA 1G41A 1UBOS 2ZTHA 2WWGA 2CW5A 3GLQA 3D0RA 3ZDEA 4O1IA 2I76A 1QPZA 4OMCA 3OIDA 5GONA 1U1CA 2IA5A 1ZIPA 3B82A 1T9ZA 3A6GA 4QASA 3EZGA 5CG1A 5LJLA 3T7DA 3SCZA 4J07A 2WYIA 4EG3A 3ZS9A 4QPPA 2I4OA 2RHOA 3EXAA 1ISFA 2FV8A 4OEHA 1YUBA 5LCXA 1N4AA 4M9SA 1E7MA 4FUQA 2GDZA 1F8GA 3OCJA 1WQ4A 1D6MA 4FFSA 5F3RA 3UK6A 3KZXA 3KT6A 1QHIA 1MA3A 2RI0A 2AFIB 4Y1RA 4F04A 2HQBA 5FOUA 3SAJA 3N5CA 1SUAA 1K0FA 4D43A 4DLSA 5C5DA 2HK7A 2ZRBA 4JBYA 5BY2A 2WU3A 1GGNA 3S68A 4LF6B 1D7AA 2AN3A 2Y1WA 4EZBA 5LWQA 3EDOA 3T7KA 2J3DA 4HO1X 2YV2A 2D8MA 5HK9A 1NW5A 1Y1PA 2YRFA 2G80A 3FNBA 1R3UA 2OV3A 3IIMA 5K6AC 4IJKA 4JJ4A 2AHOA 5JWHA 1SBCA 4EI7A 2QD5A 5JAOA 2P5YA 3RPEA 4NPAA 1Z0DA 5C7YA 3OBIA 5BOVA 3ZHVA 3Q12A 3BGSA 1JU9A 4PSDA 2FK8A 2QTFA 1D4ZA 3AP1A 4PYLA 3PT5A 4K6FA 3CCCA 3MTIA 4I4LA 2HK9A 1X9GA 1NHGA 1DLJA 1P0CA 4LZOA 4UE6A 4UBMA 1L4NA 3K4HA 2XA9A 1OTYA 4HDNB 4YTEA 3QE4A 1EWKA 1UKAA 1P5HA 4NSNA 4DE5A 2P2YA 3IDOA 2YHIB 1ADYA 4RTQA 1WMAA 4IUBS 2LKCA 1TI7A 1TL7C 2VWPA 1VHTA 3D7KA 1I7PA 1Q74A 3IQHX 1ADBA 1X7HA 1RYMA 3FZEA 1HQYE 1XZEA 5IF3A 1B43A 4CKWB 5BYBA 5CB6A 1KBZA 4R3WA 1A8SA 3JQBC 4XGRA 2RH4A 3CWZA 4DIFA 3HXTA 3QMVA 3JARA 4D8XA 5A5VA 1YZQA 3UJCA 4JKOA 5KWIA 4LC1A 3ZDYB 4CG2A 3G0OA 2GJ9A 5AOCA 5I7OA 2XOKA 4OATA 4A8PA 2GASA 4E12A 1B76A 1KJQA 1ZR4A 1Z06A 4NS1A 2VPXA 1WSWA 2XYPA 2GBFA 4UAGA 4CL2A 1U2GC 2V7EA 3P45A 4B3FX 4YRAA 1I3MA 4ZI3A 2P9FA 1GN8A 4BQNA 1V95A 2YQ5A 1LFDB 5T8KA 3PE3A 1EVEA 1PDVA 3AK4A 4CQMA 1J33A 3ESQA 3Q3GE 4TTRA 1UOOA 2Q6LA 3K35A 5H16A 5JO9A 4B3BA 1KOLA 4BQOA 5C5CA 1FPMA 3QPDA 4G0QA 3ABRB 2RHCA 1ZCBA 2I1LA 5IANA 3D4PA 1ZKMA 4XYMA 1YA8A 3MOIA 2B1RA 4JLNA 1PR4A 2IYZA 5L3QB 2CCKA 3DV9A 3PEUA 4XIGS 1TK2A 5BMVF 2H07A 4INJA 5EN4A 3A37A 4P80A 4S05A 5BRJA 2R6R1 2QG6A 4YMSA 4AYXA 3HDGA 3ZWPA 2VNKA 3GCXA 3VUEA 1H2XA 3LVRE 5LN1A 4IH1A 1FVXA 3BB3A 3ZW7A 2IYEA 2VHWA 4B3DA 5AI6A 4UNQA 1E2GA 2ZJ1A 1SRRA 3MWYW 3DULA 1JXMA 3KVVA 2AZ4A 2G4VA 2GSDA 4PIVA 2H7VA 2Q6KA 1C7ZA 3FKSD 4UEOA 3OU2A 5H5JA 3UB4A 4HGQA 3DO8A 4RA9A 5SY9A 3F49S 3N5KA 1SU7A 2O23A 4O3FA 2RH5A 3K53A 4EJSB 2G9ZA 2SCUA 4E5YA 2BFBA 1P3Y1 4ZOCA 4NEHB 3G79A 4PG8A 1HRKA 1NP6A 4RVSA 2EQAA 1CQZA 1C9NA 4RHCA 1AHPA 4HUQA 3MTEA 4EB6A 3GB9A 3LYHA 3F9IA 4P8RA 2V6IA 3ZWMA 5AK6A 4F92B 4L4ZA 3VO8A 3H2BA 1A7KA 2ZSAA 3A9CA 1E6LA 4XA8A 2FGJA 1CULC 3AUAA 4FYVA 4I4TF 2Q1XA 3TRKA 5BOSA 2WKPA 2GRUA 5ELXA 5BSVA 5AVQA 2YMQA 2G67A 4I2NA 1K92A 2YIDA 1BCRA 1MFZA 1TCCA 1C4OA 1ZJ5A 2RB4A 3HDHA 2V0NA 1KDYA 1DEAA 2QROA 1L8OA 3CJTA 4KPEC 1N2CA 4Q00A 4L95C 1Z62A 4HQRA 4LXGA 4RE6A 5DLEA 3L7KA 3NBUA 3S1AB 4D6XA 3MVEA 3UAYA 5ERGB 4DJTA 2P9YA 3I01M 5A4DA 5CVTA 2REQA 1I0ZA 2P0EA 1JJFA 1IUNA 2PAFA 1QYDA 4EHAA 4OJYA 2Z8ZA 3GLSA 4AJLA 3D0QA 1RRFA 1W5AA 3GT7A 3KUUA 4WT7A 3RS8A 3T3MB 1P0IA 4L1KA 4EPWA 4MQMA 1E63A 4PE5B 3TG8A 2BGKA 2AMLA 3V55A 2IITA 3BMQA 3BL8A 3LPAA 4N01A 2PMKA 3K96A 4D3FA 3ASVA 1GTSA 3F3SA 1N2HA 3P9SA 2VYVD 2LE0A 1YQ9A 3VHRA 4EY3A 1J25A 4J2HA 1FBNA 1ZNZA 2C5FA 2P2SA 3H0CA 1W85A 1TAHA 1ACMA 1PZXA 1MAVA 2R44A 4WFKA 4EZEA 1S0UA 2ACWA 3PX7A 4JBGA 3RSLA 1FBTA 1AK9A 4JEHA 4DUGD 1H05A 1Q1EA 2OQRA 3VXKA 4HEJA 1G3QA 2QLFA 3D6HA 4KREA 2O8CA 1NPYA 4BMOB 2WUEA 1GPUA 3KELA 4RVCA 1EFRA 2VEDA 1QFJA 1Z7YA 1Z2NX 4F1JA 3GU3A 4X63A 3TTVA 3QVGB 3NPMA 1O94D 4DJJA 1X7XB 1M34A 4IRUB 2BM8A 1Q0HA 3E70C 1VSBA 1VA5A 3MTDA 4PX9A 4W6ZA 4CMBA 3PC7A 1QTNA 2DQSA 3G2MA 4M0CA 2ECQA 1VLQA 4CCYB 5EUBA 1QIMA 3KHTA 4Z2YA 4PYJA 4Q7LA 1K2WA 3FYUC 2MMCA 2ORVA 4JX9A 1G98A 2CK3D 4QDTA 4DSZA 4MHOA 4GMHA 5LMZA 3O74A 2ZUEA 1MC4A 3GCZA 1Z33A 1EFHA 2DPXA 1UCFA 4YLYA 1BS9A 4MUEA 2QPTA 4G4SO 4DV6B 1BVRA 1RZVA 1KMIY 5FR2A 1LW6E 2C4UA 2ZRAA 3QWFA 4AC9A 2DRIA 3QTLA 2ISQA 4FR5A 1SNYA 2O7VA 1RHRA 3VPBA 1K0UA 4JGGA 2OC4A 2C5AA 3C3KA 2ZTVA 5J2TF 2G0NA 2GZSA 1GZVA 3P2KA 1M2NA 4JI3B 2J9RA 4A0SA 4DCPA 1JMYA 1G2PA 3AL3A 3R8XA 1S2OA 3TN7A 3SYNA 1N57A 1AG9A 4Q9DA 5DHAA 3VR5A 1ZU5A 5KOIA 1E7YA 1XO1A 4KSYA 2JZNA 3HABA 4H17A 1YO6A 1PNVA 3T95A 2ZYHA 3THYB 3LLUA 5KQPA 2JZCA 1EVYA 3BF8A 1JECA 1RZUA 2Q46A 4TSFD 3L0CA 4GHWA 4I1IA 2BFCA 2ON6A 2FWPA 3I9JA 2CXUA 3WL3A 4BPRA 1SC4A 4U5QA 4B45A 4AJJA 3CB2A 2VPPA 5CNJA 5LLSA 1E99A 2ECPA 2P2CA 2QYTA 2G6TA 1EGAA 3BIFA 4XJXA 4ZCMA 4XWKA 4JV5B 3ZCRA 3ORHA 2VZLA 3L49A 4TV9B 4TRRA 5C8YA 2BBSA 3LC0A 1L7MA 3N2NA 4GU5A 4OG2A 4Y9UA 2SICE 4KWHA 4BNNA 5JDIC 2X58A 3RREA 1JG1A 2CT8A 1NX9A 3DJYA 3LFHA 4RQUA 3GJTA 3FJ1A 1R5NA 3CIOA 2WD8A 3AYZB 3WGYA 3DT6A 2XXJA 1DSSG 3LVQE 1GPYA 1XCPA 2AZDA 3EBOA 3NHRA 3QG1A 2PEZA 4A0GA 1Z5PA 2W0SA 3ZD6A 4GKVA 4FGWA 2QM8A 3COPA 3DVAA 3NCTA 5EQTA 3TQHA 1R3DA 4OOFA 5SYNA 4J0HA 3ZHCA 4UQLA 1EIZA 2PSDA 2DT8A 1QMGA 4OI4A 2PL3A 3D54D 4RVFA 1CXZA 3V32A 2XB4A 3AM4A 4AQYB 3EFBA 3DUFB 3QWBA 4OI1A 2OO7A 3PGXA 4JJEA 2VSXA 3WLJA 1BDMA 4MKGA 2BR3A 5E7QA 5HIJA 2AQHA 4D3SA 1DPGA 5FTLA 4MCIA 2X9NA 1NW4A 3B48A 2GI4A 1J0BA 2GZ3A 2DBZA 2AG6A 3FIJA 3JPWA 5FOTA 1FTQA 5SV2A 2GQ0A 2DPMA 5KOHB 1MEJA 1W29A 5CBPA 4WZBE 1SCKA 1GNVA 1UF9A 2YWFA 3DZDA 1XF1A 4JT9A 2ZJ5A 2OPHA 5A6SA 4KVFA 4A5SA 3PQ4A 2AF3C 2G0AA 2MWMA 5NLLA 5JS7A 2D4HA 4W1RA 3O75A 5JH7B 1Q19A 1B8UA 1CZLA 1W36C 4YIKA 2GEUA 2JVKA 4AAYA 2M9MA 4F56A 3GIWA 4IMPA 4XUDA 5IWAB 1MABB 3P32A 4RXMA 3AVUA 3I6YA 4Y2HA 3MMXA 4OQFA 4U3JA 4IY1A 1EVZA 1HE4A 1SUSA 3S2GA 3H5VA 3LWZA 4ANFA 4MJ3A 1SQ0A 5C1OA 2GZAA 4CETA 3PYXA 3CVUA 2PS0A 1RQGA 4F97A 5CB0A 4XIIA 4BQIA 3L2OB 4XEUA 2CZGA 4K9NA 1HDXA 3V8QA 3R2JA 4GM4A 1HE8B 3D9QX 4RM3A 1U2GA 2YBEA 3C6XA 2FG7C 3H1EA 1BMFD 1FP4B 4TYPA 3YASA 1W4ZA 1SOUA 3OZWA 4D81A 3MJRA 1YZTA 4O2BF 4OQZA 5DYYA 4ENQA 4JI7B 1H2HA 1RXSA 4YV7A 1MO2A 1RPNA 1I14A 2AKAB 1SHUX 2HF8A 3AB3A 3N76A 4FJ2A 4HGOA 4Y1EA 5C80A 5FA5A 3R1IA 3KOZA 3QZUA 1KQGA 3D6AA 5DB4A 2HA5A 2D2VA 4OXKA 4ZOAA 3UA3A 6NULA 4HS9A 1U5AA 2XNJA 4FYJA 4BO5A 3QKIA 4KQ1A 1RYFA 1XQ1A 2X1MA 1TD9A 5I9LA 4KACA 4GPBA 4IHAA 1EP3B 4AY4A 5BQ5A 1YMQA 1NM5A 2INGX 2VTKA 3MMNA 3SIXA 5CA0F 1BVUA 3NS7A 1N1EA 1ZA2A 4KV9A 4PLPA 1JF8A 2BMAA 2EIXA 4YAGA 4KU4A 1KP2A 1CJKC 2BGUA 4WXPA 3T9BA 2PCLA 2COEA 2IIQA 2HA2A 3SD7A 1BS1A 4A8JC 1ZHOA 1VYVA 5LL6P 4OQMA 1G20E 4HXYA 3WHKA 3C1TA 3WGUA 4KZKA 1PJCA 5JYBA 1M66A 1WHSA 4NENB 4Z0HO 1GEEA 2NVUA 3GT4A 3DS8A 1G20A 3QM1A 4XR4A 3RW9A 1Q95A 5DM60 5CFQA 1RZ3A 3V1TC 2COUA 3FDIA 2HRZA 4NMWA 1KI6A 3QI2A 2ADFA 4DWVA 4L5AA 4K03A 1K5GA 1PL0A 3UCFA 1YCFA 5H1YA 1NJ2A 1OZ0A 3OPYA 3F1LA 3L8YA 1G8JA 4LVNA 5FJJA 4DNQA 3ANNA 4WZZA 5GIOE 3O8DA 2RK4A 1LS1A 2GARA 8AT1A 2ILTA 2NAPA 4UUMA 3MAGA 3CRVA 3O0DA 4IZIA 1CERA 2QZ9A 4LSWA 5I9TA 4U7PB 5J1SB 4HXGA 3LAWA 3T7RA 2FJ0A 3DNMA 1MAHA 2P1RA 1QO7A 1R6TA 5PGMA 3IBCA 2NSDA 3EW9A 3V7NA 2IPAB 1SQFA 3E2MA 5FYQA 1DVRA 3AF5A 5GQSA 1SUFA 1SVUA 2AG1A 1U2ZA 3EODA 4C87A 4CNQA 4YCJA 3PFWO 2K4MA 2M98A 3WIBA 1R66A 1THTA 3I8OA 2HLHA 2IBSA 2QUJA 3HP1A 3SC6A 1DC3A 4RK7A 1Y9DA 2J3IA 1GGHA 1KFBB 1P72A 2CB0A 2J32A 4QUAA 1VPTA 4OLFA 3UMBA 3OEHD 1FFDA 4HXEB 2IUSA 1MVOA 4PGMA 3U3JA 3MMSA 3UM9A 4FILA 4F45A 2HBQA 1R9GA 1RPAA 1XTQA 4DG8A 2PMFA 3CA8A 2LDXA 1MPTA 5AM2A 3T7JA 5JD5A 4HYQA 1YTUA 2YVQA 4K9LA 1IOWA 4ZTUB 2G4CA 1JIQA 4ZCSA 3JQGA 3QYAA 2LCQA 2NQTA 5DGTA 3P52A 3NAMA 1KI1A 1Z0IA 2QN9A 2AMJA 3CSSA 3UV3A 3ZWXA 2VK4A 4X5OA 1E62A 4WADA 4TZ0A 1VQ1A 1R0ZA 4TVKA 1J2UA 2XITA 2DPYA 2JVJA 3TGWA 3WS7A 1M8JA 1KXZA 2QTLA 3BJRA 4O8CA 2P3OA 1V5IA 2RGDA 4NOKA 4RF3A 1RWKA 5CITA 3HPRA 4R1TA 4FW9A 3U7RA 2FWBA 2F1RA 1I01A 2H1HA 4MP6A 3TWOA 3IX7A 2PXXA 1UQTA 2O4CA 3KUDA 4FXPA 2JF0A 2P0YA 1UOEA 5TXGA 1BE8A 2JHCA 1QBGA 4M1QA 3UB2A 1GAQA 1USUA 1JHMA 2AQKA 3DBLA 1W30A 3OLWA 3K1YA 4LDQA 1XVTA 5GVSA 3KQSA 1EYZA 1CIVA 4IM7A 4NZZA 1YZUA 2JAWA 1PDOA 4X62B 3G88A 1NVGA 1W36B 4P5EA 2HN9A 4ECEA 1LPSA 1WV1A 4IHQA 4U2FA 4Y2JA 5K4HA 4UU8A 2OBMA 3TI9A 5CCBA 2B92A 2XDQA 2EL9A 4GR5A 2A6PA 4UOQA 4AURA 4G9GA 2Y1FA 4TV9F 3GO4A 4IGIA 4J75A 4F85A 3MSCA 3JQRA 5DYTA 2QF7A 2GM3A 1Y3FE 3SK0A 3LK7A 3SM3A 3UUGA 3WQHA 4ZI7F 1S2LA 1FZTA 4NJEB 3GEIA 3HCAA 3MJCA 1GFIA 3ER8A 2A9FA 2BEKA 5T4HA 1A71A 1I3CA 2I2FA 3GDOA 4UZSA 4R81A 2FFRA 3WWZA 5C5EA 3ETEA 5LDGA 1Y7PA 2P6RA 2O0LA 2NXNA 2XUOA 4WNIA 3I6MA 5AHWA 5EE1A 3ET5A 4A6PA 2NPFA 1YB1A 2O5VA 3T3OA 3LUDA 1MQ8B 4OXIA 2J3MA 5DIFA 4Z5XA 2VAWA 5BN1A 3RV4A 4KE6A 1QRUA 4XLZA 4P53A 3BMNA 1DIBA 5DGIA 4F3NA 2HWYA 3I9OA 4RSHA 5I9IA 5AJXA 3WRVA 3N3AC 4OUDB 2ZI9A 5HUQA 3PNMA 3B5EA 2IOYA 1CB7A 1KVQA 4FDLA 5DHFA 4NOJA 4KXYA 4CE6A 3W1WA 4FJ1A 1U2TA 4TMTA 1DKQA 1KA9H 4RSGA 1FUIA 1FMTA 4RNDB 4G84A 2I3BA 1FF9A 3NHFA 2YBDA 4ISBA 3W2TA 4A03A 4F5YA 3SC2B 5MGNA 4PPFA 5AVXA 2ZSUA 1X1TA 1NQUA 5C7IO 1QKIA 5F35A 2WJZB 4AICA 1J5EB 1RJ9B 5ABPA 3MBOA 4WDRA 3QE9Y 2HRQA 1II8A 2PT7A 3E0QA 4J2OA 4CL0A 1G21A 4ZV7A 3D3WB 2J07A 2WV7A 3E9EA 3AFNA 1VJDA 1EJ2A 4URZR 5TF0A 4C7MA 1DG3A 2IUEA 3GFTA 4OHKA 3HADA 2QNRA 4QIHA 2V7XA 2RIRA 3FNQA 1RVV1 1J06A 2PBFA 3G7SA 2QT0A 4M0KA 2GWRA 1YASA 5T3UA 2QPOA 5EZYA 2JFNA 5I4CA 3VR0A 4O2BA 4D6PA 1UJBA 1UM9A 4RV9A 1DNPA 3IAFA 1NJGA 5HTKA 3ZV5A 1JG2A 5K6AA 4S2EA 2V74B 4RD4A 4JI4B 2R7AA 2GAAA 2E2WA 4ZWNA 3EH1A 3JAWB 4P83A 4UM7A 1N92A 4XIFA 4UNSA 3UJBA 5JMWA 1Z4NA 4FWTA 1HKHA 2ZR9A 4LUCA 4ZCLA 1HEIA 5FOQA 3HZZA 1C3OB 1L0BA 1YAJA 4U7FA 2AOWA 3GRPA 3IMGA 1RYHA 4IDFA 4K1LA 1C2YA 1JIJA 1G5HA 3V4PB 3TMKA 3FUUA 3R3HA 4E4TA 4MTLA 4ML3A 1JB9A 1XTRA 1T36A 4QELA 1QQ5A 3O7MA 4DL9A 4R84A 1W4BA 2YN2A 3G5TA 3IQWA 4PLZA 3RVQA 5BXYA 4B3GA 1YJXA 4MLZA 1HDEA 2FEWB 4M3NA 2OFPA 1RTTA 4AS1A 3D6MA 3LP8A 4QARA 5IZ4A 2II6A 4M0LA 4O1HA 4JD5A 5DN9A 3ZLTA 2O3RA 1PGOA 1N1GA 4GL4A 4Y0NA 1NPTO 5J63A 4HAYA 4HNRA 5JJLA 1JKJA 1EGVB 3DZFA 1QB7A 1KMNA 2FEPA 3D5QA 2FWIA 3HUUA 4ZYYA 3KKKA 2MR5A 3OCZA 1VXRA 5G4LA 1W36D 2YXNA 4GWLA 1FUEA 4HRVA 4YVFA 4DIDA 1QJ4A 3WWPA 4KLNA 3OJOA 1S5PA 4KKVA 3T06B 2WHYA 1E0JA 1RM3A 2WHPB 1NM5C 4XUEA 1RNLA 4Q1VA 4BX8A 2O8BA 2FSHA 2V4UA 3GRAA 2JNWA 3HFGA 4NCAA 3BICA 4PQFA 4BKMA 1XN1A 2UAGA 1HE2A 1WXXA 2YNMA 2IHKA 2XCSB 4GS5A 4NG5A 2Y4OA 3UJPA 3F90A 1R10A 3ESBA 5B58T 1S3SA 3HEMA 1NJ1A 4F8EA 4ZEMA 3F5FA 5IK2A 4CEHB 2PGIA 3I42A 3OU7A 4RLQA 2O2GA 2WWXA 2Z56A 1X8JA 4MROA 4V2UA 4MV6A 1U9IA 1B26A 2C1XA 4F11A 2DFKB 3MD9A 2R1ZA 4EHNA 4BLRA 2XXAA 3GBVA 3IP8A 2EYQA 2WJVA 4U7GA 2WBLC 4XVCA 3TVTA 3V2HA 1B4DA 2C8LA 4IUYA 4KAAA 1U2QA 1EMDA 4P92A 4ZCQA 5G41A 3I2IA 3K1TA 4YGXB 3SGLA 4BJ1A 4BBZA 3ANLA 4ENTA 4IGKA 1W35A 3UWMA 2PH3A 4W1PA 1BA2A 3V1UA 1Z6YA 2PZBA 1M0TA 1QFZA 3GJRA 3MAJA 1AA9A 3SWWA 3FTNA 1OSNA 3TDMA 1U7XA 2WA2A 4ARIA 2FAXA 1JHRA 4OHXA 1Q0UA 2JRLA 1J22A 2VAMA 2D5BA 3S8YA 3GLTA 3FPLA 2YN4A 5DLPA 2HUNA 3S99A 3O8OA 5CEJA 4IW3B 5LQSA 3ZWYA 4ZDIA 2C2MA 4FOPA 1UZAA 4JOQA 1VJTA 2BFOA 1ISGA 4LDPA 2C2HA 1WOMA 1CUYA 1T5LA 1BDBA 2WW8A 3DWIA 1VI5A 3I9MA 1YNSA 1KO4A 1FK8A 3LOQA 4LX8A 1JHUA 1H2YA 2G40A 3DZGA 2Z08A 4GVLA 3RYIA 4CF4A 1X74A 2C84A 2D54A 1VLZA 5FOVA 3CZAA 4JS0A 1MMFB 4W5WA 4V1CA 2DTEA 2ATIA 1CZKA 2V6JA 3IT1A 4QDJA 2L18A 5T4FA 1U5BA 2VJAA 1CX9B 3P9ZA 3U3MA 2FFBA 2GA9A 2MINB 4JMPA 1WD5A 4WA8A 3VO2A 1SXPA 1QYXA 3V34A 5JBIA 3E8SA 3WSWA 1Z7BA 2FVXA 4X6YA 4ZAXA 3D8SA 1TMKA 3BWYA 4ODIA 3IHWA 2DEUA 4NCKA 2CSUA 4MB6A 1QOZA 1ODJA 2GWHA 3GJ3A 4D99A 3PHCA 2JC3A 5J59A 5KCZA 4ZVSA 1NBIA 1Z4OA 3V33A 1E0KA 2VT6A 1OFUX 4C88A 5FAXA 2CYCA 4A16A 5EHZA 4LA4A 3KZCA 2VRNA 1E1CB 5E2IA 3X2EA 2ZRJA 2I4LA 4WLOA 4GOXA 4B43A 5JZ9A 1D09A 5CCXA 4FXOA 5KSPA 5AKXA 5JRJA 3RM3A 1MC1A 1T5SA 4ND5A 1C8KA 3FMOB 2IYPA 3MJFA 1VSUA 2WFZA 3CGGA 3KAJA 3VPDA 4MWBA 2ZSKA 3Q40A 5JZSA 2O7NA 5TT1A 2HNAA 2RHDA 3GLHB 2P62A 3QKSA 1UMDA 5BVGA 2P40A 1FX1A 3IUYA 4CIWA 3MGCA 1NUPA 4BKOA 5L6LB 4N5MA 3IAHA 5CVEA 4XYGA 2FE1A 4MI6A 1YV9A 4D3ZA 3EQ6A 5I45A 2JJQA 1CDEA 3BFVA 4Z9AA 3EAGA 5AYVA 4ZQGA 4UHEA 2H2GA 3PPYA 1NONA 2Z9CA 2DR0A 3ZCXA 1W7AA 4C7OA 3KT8A 1N4DA 1H6DA 2B2CA 4MVJA 3AY6A 2VZ8A 3P0JA 3FZQA 4R40A 2E4AA 3FNFA 4M55A 3REOA 1P9NA 4QAJA 4CI9A 4TQUS 2QRVA 3T1OA 4YR9A 1DIHA 2GCOB 2VJKA 1EAYA 2CLIB 2AVNA 3LY7A 3RJ5A 3FJOA 3VPGA 5HS4A 4IXDA 1PU2A 3ESAA 4KFRA 4L5IA 4YHBA 5T41A 4OL0A 4QFMA 2QJOA 1SHTX 4I5IA 1OAOA 1SVOA 5I51A 4C4OA 4HZUA 2RHGB 3CSUA 1FDSA 4YRQA 3GVIA 3ZD8A 5KYNA 4BVBA 5K8UA 2V96A 2ILVA 5DMXA 2IIPA 2IXGA 3A11A 4LW8A 4RZXA 5DN6D 3ER9A 3EEYA 4CUJA 4CPDA 1G19A 3O3CA 2W71A 2HIAA 4NYIR 4YXFA 5ADUS 3CS3A 3DCJA 5FO0A 4KKXB 1T5IA 2PANA 1C7JA 3PIDA 4KMRA 1QIHA 3O4IA 1CP3A 2JH3A 1RXUA 4ONEA 1OB2A 1VBMA 4J7CA 3RHFA 2G1PA 2FEAA 2E1PA 2Y0EA 4L8FA 1PS0A 4JU8A 5K0JA 4KB5A 5ALFA 4ZA2A 4XW2A 2QP9X 4FQ5A 1P7CA 3BD7A 1Z2AA 3K0SA 1ZJZA 3M82A 3QWAA 4PRZA 3ZVKA 3DFIA 3KP1A 2Q7XA 5F9HA 5JLJA 1JR6A 4N47A 3P9RA 2R8EA 3LH5A 4O4LA 4ETNA 3FB1A 4RTSA 3ZV4A 1B6SA 2ISCA 4PF1A 4J0JA 1C50A 1GY8A 2HL6A 3EGXA 3TECE 2FSPA 1ZOSA 4RJKA 1EE1A 4WASA 3SF8A 1APBA 1E0SA 2JAQA 3QMWA 3S2ZA 4CF3A 5LD2C 1D04A 2X4IA 2Y9MB 2IRWA 4PPYA 4BX0A 4QUKA 5FF9A 4AX8A 3P97A 5HILA 3B6IA 1A82A 4PY2A 5LSAA 3K1JA 1T3GA 2WAOA 3RGGA 3SI7A 2WG2A 3GRKA 2XVYA 1N8NA 1E64A 2P1DA 3CHYA 4J16C 4JH0A 4ALLA 1KTIA 1PUIA 4GKJB 3VSEA 4QT4A 1HT3A 2IPXA 3C8UA 1R5BA 4WL0A 2QW0X 3L7NA 3JPYA 5CIWA 3ZE1B 3ZE6A 5JC1A 1PEKE 1ST2A 2YJNA 4QUIA 1VB5A 1Y1TA 2YQZA 1T8UA 5IVIA 1I4OA 1M2KA 1MGOA 2Q3DA 3KZKA 5CFZA 3LUKA 3ZHYA 3W6ZA 5EP4A 1VFNA 1KKUA 2W2LD 2V7PA 5CDUA 4PM4A 5CT9A 3QFHA 4J0CA 4O2AF 1UBKS 1F2UA 2F3UA 2Q5CA 4XPZA 3SZGA 3ZV6A 4AJKA 4FC6A 2H4HA 1I2CA 5GWXA 2HHCA 4J6FA 1E6UA 2O5RA 1C1HA 2BCGY 2OY0A 3ENNA 2H4YA 4OXXA 3RS0A 5EZSA 3O8RA 3L0OA 2J9ZB 1I36A 1U0OC 1TK3A 1V7QA 1U0TA 3QKRA 3DW1X 1UXIA 4KXVA 1PN3A 5DBIA 1JEAA 1GZ3A 3LFUA 2CJFA 5L3VA 1PBTA 1KQFA 3WVNA 1JVSA 1DCMA 2ZRGA 3CZ4A 4QGSA 2DCUA 1I24A 1JYEA 4BQSA 1PJAA 5KSOA 2E48A 1EK5A 1JJBA 3CF6R 1NMYA 1U2EA 1A9QA 3AU8A 4MRRA 3HC7A 2WQ6A 5MN5A 1AQLA 2JFUA 1UANA 4G24A 2X6QA 1UADA 1VI2A 1IY8A 2DR3A 4DY4A 1FFHA 2GFQA 3MWLA 4P1ZA 2D1QA 3RVRA 2J0EA 2WAMA 1LWOA 3ME5A 3O38A 4OQ4A 4YFYA 5ALJA 3TSCA 4AZWA 4DYDA 1HNNA 4XEHA 5EZYF 5JJ5A 2DULA 3EGVA 1FQOA 2Y8EA 3SZLA 5CBKA 4CG0A 4TLAA 2WPDD 3VU0A 2AYYA 4GOJA 3I8XA 2IZ0A 3MCUA 2XZOA 3G2LA 5LXTA 5A4IS 3C14C 3ICQB 4UE3S 4FFWA 1R2QA 2ZW9A 2GBIA 3JAKA 3K9BA 4CIVA 2WZQA 2VHJA 1G6Q1 3I2FA 1R7RA 1XZMA 4IWNA 1FFSA 2CFCA 3W8NA 1DTEA 3CT4A 3ZU3A 4YJHA 2JLZA 3LUFA 5ALSA 2VSOA 3A9RA 1GLGA 3HVJA 5JVDB 2CUNA 1P2BA 4BZWA 4XGKA 3DDHA 1IHPA 4JSYA 5TX7A 5I7FA 1IAVA 1PEAA 2FW8A 4CIXA 4AY6A 1N2CE 1MO5A 4BY9E 1M10A 1SQ5A 2X2FA 4P86A 2GN2A 2GYYA 3VFDA 1N3IA 4QJ4A 2E85A 4D4KA 5K8JB 2RGNA 2IT1A 1TKCA 3JQ9C 1EX7A 2WQ7A 4X1KA 3OZ7A 1KR2A 5CLJA 2C77A 2I6QA 3EN0A 1VCOA 1LKZA 2H4XA 3EDCA 3R20A 4R9RA 2IOFA 5AVOA 2HYDA 3ZXXA 4MO2A 4P81A 1G4UR 3NM5A 3PQ6A 3NBKA 2ZAMA 1WUIS 2JFQA 2DM6A 2X0EA 1GHTA 4FCTA 4XE5A 5IJAA 1I4WA 2PL9A 4RFSB 1HEYA 3N2IA 4PRKA 2JBWA 3DTVA 5JISA 4B83A 1AHHA 1X8LA 2VSYA 5K8IA 2O2ZA 2P3SA 1JI0A 2V8OA 1VPDA 2RAPA 3MHPA 4MGIR 3FPSA 3KZNA 1ZSVA 4M0UA 4XPIA 1UBRS 1YOBA 2B2XA 4WOKA 5EXSA 1O8BA 3D2AA 1SWWA 1K63A 2WHEA 3NANA 4YBZA 1JEQB 3OJFA 3QSGA 2JLUA 5JT1A 4K46A 1U8EA 1TMOA 4M8KA 2QTHA 1Z88A 5TVGA 2WYWA 2YZNA 3RFCA 5IYZF 1JIKA 3OX3A 3NAQA 4GC9A 3OQPA 3PQ5A 1T0UA 4PFKA 1FFYA 3L7AA 1DIGA 2D5CA 4CF7A 4MHSA 1IZ9A 5EYPA 1W1IA 1RZRA 1QDUA 2X0KA 3R76A 4F4FA 1JR3D 1Q7GA 3G3EA 5F98A 1KAOA 1USVA 2J3QA 4GP6A 4MGHA 4ZU3A 4TZKA 5JVDF 4BRZA 1NBME 3BRSA 2PWBA 2Q4DA 4FFRA 2YHUA 3IE2A 1NG9A 3KD3A 4CMJA 4ID3A 4EP1A 1JDUA 1Q5PA 1QWOA 4RA9B 3RF7A 3UG7A 2PKQO 2YJ5A 3ZPXA 3LPMA 3A6FA 1VZ3A 2SCUB 3CPEA 2ZWIA 1L1EA 3A2NA 4UCFA 1O03A 1E94E 3FHOA 4IIHA 3OOWA 5T7BA 1C30A 3NFYA 2HA4A 5KYXA 4WERA 1MQ9A 4QXAA 4TRJA 3Q8KA 3C98A 1SUBA 2OV4A 5AI8A 4HDCA 4HDNA 4KXQA 3RSQA 3V42A 3EPLA 3LA6A 1H9AA 4I46A 4HNVA 3J81A 4YWHA 4IOKA 3VZQA 3B51X 4KOAA 5H9WA 2XE4A 2ZIXA 4BCCA 3QK7A 4PW0A 2VL7A 4ZYUA 3DDZX 3KQTA 3QW2A 3NHSA 4ZMSA 1LI7A 2QLJA 3FYUA 3U1TA 3DMHA 3CR3C 4EG0A 4TXMA 4XZ3A 3E9DA 3OCCA 3HV2A 4URHA 3HGQA 1V11B 3QW4B 4L8GA 4CKWA 3S1SA 4JBNA 3BB1A 1FTNA 4FTWA 2W2KB 3CNLA 1DDGA 1QHGA 2BJHA 4E7PA 2A78A 3GEEA 2AOXA 4XSGA 4COOA 1E1QD 1H0HA 2H06A 3DEYX 1V25A 5BMOA 3HKBA 1LNZA 1P1JA 4LHVA 4V24A 5BVHB 2VRBA 1K6IA 5GGXA 4N76A 3TMYA 3ZOKA 2UXBB 3NATA 1YJCA 3UJHA 1XKQA 3FLMA 1RE1A 4IKOA 5JSQA 4MWDA 1D1SA 1OLXA 3PDUA 1U6KA 1SCDA 1CY8A 3QKTA 3MQFA 4FHZA 3RVMA 4Q1BA 4BCDA 1ABBA 1FP1D 3I3OA 2GYUA 5HX7A 1NW8A 5LP6A 1I5RA 2X1LA 3FYTA 4IJ5A 4IEEA 4U2KA 3OZFA 1XEWY 2DOKA 1PR0A 2NXCA 1N2BA 4F2DA 2Q3BA 3QNMA 1LPAB 5D1NA 4FWIB 4UM9B 2LVBA 3HSKA 4PHCA 1ENOA 4INAA 4M86A 5D8DA 3QFSA 4OHOA 7ADHA 4POOA 3DXXA 3U5TA 5IEBA 3IH5A 1CQXA 5C5IA 1M34B 3CNBA 3DV0A 4H6XA 3AHFA 4U7HA 3RADC 1ZM7A 5KYWA 1IWPB 4U6SA 1E1KA 1NBWB 1RFLA 1IM5A 2AOTB 5JAUA 3HKCB 3STUA 1DMSA 1OXXK 2PD4A 3LCCA 3VKFA 2H1IA 3HDYA 1V8OA 4DC9A 1GCOA 1CR4A 3NW9A 4G4GA 2PMCA 4ZICA 4DCSA 5E4JA 5K4AA 1WDKA 1QHEA 3LF1A 4FW8A 5AKYA 3COWA 5K7SA 3E2IA 4S1PA 4F2WA 3KLBA 3NKFA 5IJZA 3OT5A 4FWBA 3OUTA 4HX2A 3C24A 5BSUA 1U8FO 1VMIA 5EWLA 1YJQA 3LC7O 1VJCA 4A9AA 1WABA 1VL2A 2OFOA 2AX3A 4NZPA 2UXDB 1S4MA 3M4ZA 1CUDA 4ZVQA 3VR4A 4N7JA 5H80A 3WLNA 1PX2A 1COZA 5KYVA 1DBWA 1PAUA 3CZ5A 1CY0A 1HZZC 3L8GA 2I22A 4C2UA 2ZE8A 5F2EA 3WGKA 2ZCJA 1SUIA 3NORA 4G65A 5FLKA 2ZS9A 4CMIA 2VO1A 2BI7A 3DDCA 3ORSA 4R1LA 1J4AA 5DSXA 3KETA 3FDFA 4YRPA 4IS3A 4NY1A 3S1AA 4D9HA 5KNBH 2HF7A 2Q3HA 5TQVA 621PA 1IOLA 5E2BA 1Z29A 3HB7A 3N6RA 4D4HA 3HYRA 1YS4A 3I09A 2BGTA 1QO9A 4EQ6A 5IVHA 1LTKA 3E7DA 1SVWA 3GGJA 3EYAA 3ICWA 3LOPA 2CJYA 1XDDA 4JEMA 5HGXA 1SUDA 1HYEA 1JFSA 3IAM6 2C5LA 4ZYLA 2F8LA 1QGAA 4GE0A 5FTMA 1XNGA 3EIUA 5EXEA 1IONA 3TK1A 4RVDA 1Z35A 1GAEO 2PQMA 1PR1A 2ZE6A 4YR7A 1CZOA 5I5EA 5ISMA 4F5WA 5J5CA 5AM4A 5AUQA 2JFWA 4P36A 4BKRA 1UJCA 3SLKA 1AK2A 4MUBA 1ZD9A 2X8BA 3GPLA 1R8SA 4JP8A 5HBRA 2XWSA 1E9AA 3B89A 4FOOA 2ZJ8A 4I50B 5IBQA 2JI8A 4D9MA 1FJ2A 4NBRA 4F9TA 3R8FA 2VDJA 4LJAA 3FWHA 3M4NA 1EWTA 3L7BA 4DCCA 4LMAA 1NQ5A 2I4MA 1BZYA 2IF2A 1TYEB 3E15A 4QSMA 5JMOA 4GECA 4P84A 3W7AA 2NXEA 4E33A 3OKCA 1VGRA 2ZBRA 3DB2A 3LBAA 3QE0A 1JQEA 5JVDA 1ETHA 3QVGA 4Q4AA 3ADCA 1HQDA 4XWGA 2CF5A 1IYZA 1GT91 2GLUA 2PXHA 5H81A 1L4UA 1C9DB 1CP2A 2ZTUA 3CVOA 4RS4A 2AD1A 4QEDA 4DA0A 3B1KA 3LXMA 3JWGA 2F4VB 4GVXA 2FFAA 2CV2A 1G3UA 2ZG6A 5KSWB 3HFSA 1EVJA 4LQCA 4B3MB 3OJWA 4Q3DA 3TLAA 3E9YA 4XM1A 5FB3A 1H94A 4MUKA 2PUFA 2JLWA 4OP1A 3MWEA 2LP4Y 3KVRA 3TZKA 3IE0A 4JAVC 1QVRA 3R3SA 3H1BA 1W0KD 3CF2A 4ZAGA 3QELA 4BZZA 4CM8B 4R0VA 3ENQA 4Q66C 3E5HA 3R4VA 2QZPA 2HTFA 3PXAA 3W8RA 1EWQA 4QBTA 3PC2A 4MYUA 4QDOA 4NZMA 3OCXA 1M34E 2QUKA 3TE7A 3V7FA 1U3CA 3DZCA 4G5FA 3I1YA 1Q0ZA 2ZJZA 5BWOA 1EE9A 4JB8A 4KFSA 4AZSA 4HSEA 4J7XA 4LE1A 1FP4A 4L4RA 2OAGA 3K2IA 1KKLA 1XQYA 2J3JA 1DOZA 2QD3A 4IDAA 3WDSA 3ZJ5A 1L4HA 5HRCA 5JUWA 2AC2A 2W6NA 1JXOA 1L4BA 5KYUB 3IKVA 2GPAA 5E2AA 4G4IA 4JLJA 3DAHA 2WIFA 4IZHA 5HZGA 5A0TA 4KFCA 1G59A 3EIWA 4O2AB 4OMDA 2POQX 4HI0E 4RFLA 4UCWA 5DSTA 2C2ZA 1W59A 3O9MA 3LKDA 1F8FA 2ZFUA 1T6BY 1V6AA 3WWCA 2FOIA 3UWSA 4C6TA 4PBSA 1LDMA 5LKRA 2QX8A 3V4OA 3IIEA 5IH7A 1LGYA 4Q3NA 3RUCA 3GG2A 3INTA 4ZJUA 2GR9A 5JWRA 4IG9A 2D0PB 1DXHA 3ZHBA 2JS7A 5JYCA 5DXFA 3FPKA 2PVCA 1QK3A 2A1TS 2OORA 2Q5HA 3B1JA 1FX0B 4LI3X 3ZD9A 4GEKA 1KEZA 3WKCA 1FQWA 1WHSB 2P7IA 3GJ7A 4C0KA 2MTBA 3UBMA 4DV4B 3R3YA 1NRXA 4HNAB 1EP9A 3AJEA 4IIBA 2Q29A 1ONSA 3EA5A 3FWZA 2VS1A 4KIJA 4Y6OA 5T64A 3WYCA 1EXDA 4QA9A 1WU7A 3CZPA 3KUCA 5A62A 3O8QA 1EUDA 3DC2A 5CT6A 5IJ0A 3CVWA 1JA0A 3E1SA 4DDKA 1T1GA 8LDHA 2A14A 3AKCA 2RDMA 4ED9A 3E7PA 3L92A 4EY7A 3OJ0A 4AKEA 8GPBA 4GOOD 1CNMA 4EYOA 2BYTA 1EVIA 4C0XA 1A98A 3KEMA 2JGIA 3U1VA 3A2MA 5LZ2A 2EG9A 3CLUD 3Q8WA 4BIIA 3C41J 4KGDA 3S3TA 3U4HA 1YZVA 1RXWA 4R9VA 4LJRA 4ZPJA 3ZTTA 1U1FA 1NHWA 3AF0A 4NOLA 4V0MA 1FDTA 4QO8A 3WSVA 2KE5A 2P7HA 5CX1A 1IJEA 3A9UA 5FBWB 4HDSB 1Z2DA 5EHIA 2IU0A 3VISA 5JH7A 1U0LA 1ZY2A 2CFTA 4JXKA 1Z25A 3C1UA 1PS8A 2AE1A 1W1WA 4UXJA 1V43A 3JD0A 3QEJA 5I7EA 2IYXA 5JECA 1KJ8A 5LIPA 3RVNA 2FZWA 4YRKA 2YIJA 2IELA 2R66A 3IPCA 2ZSEA 4FS8A 5AK3A 4PSUA 4DSOA 1SIBE 2LNDA 1MGPA 3NH6A 4FKZA 5CLGA 4P0TA 4LE2A 3UIEA 1ZFNA 1V4BA 2DBRA 1D2HA 1OILA 3DEIA 5AXCA 4KN6A 4EHJA 4TMZA 5JI3E 1AGNA 2BKVA 2ORWA 5EJGA 1W6UA 4B5KA 5IXJA 2XT0A 1TQ2A 2DMRA 2IHYA 1Z83A 1F6DA 4NZNA 4Y6RA 3GZJA 4AZ0A 3OWHA 4CV0A 3HXOA 2SKDA 2D2EA 4BGVA 3AJ9A 3G2KA 3LO5A 4JNCA 4KH1A 1GP2A 3CUVA 3IUJA 1DBVO 4QWMA 1E5XA 3AB8A 4UD2A 5C7LO 3M1YA 4ZVTA 5BO5A 3NWOA 4YRBA 1CJUC 5JSHA 3U16A 3ANMA 2EARA 2I3DA 4LOJA 1R0SA 2D4AA 1OY1A 1XK6A 1NBHA 2J5KA 1J9ZA 3STXA 4E6PA 3ZJVA 3BT7A 3BIWA 1IFXA 3HCNA 2LW7A 1RC0A 5FKJA 5K0NA 4B4DA 1X3LA 5HFNA 3KQLA 3PXGA 3OOYA 3CRZA 4XB1A 3Q5DA 3JZIA 3MMPA 5HOQA 1QGDA 9ATCA 4PIMA 1CPYA 1UMBA 4II2A 3EWNA 2RGCA 1HZZA 1UDRA 2DHEA 4LFAB 4BVHA 2ONCA 4KLRA 4WUVA 1NZJA 3TW4A 2GNOA 2QUAA 5ADHA 1RM5A 2QENA 5BWBA 1S7GA 5DHRA 1X92A 3TZLA 4RFVA 1C7EA 4CM3A 1GL3A 2WYUA 1HETA 1C2TA 1CQPA 4EAAA 2RHLA 3TBKA 1JW9B 1UPAA 4JT2A 2J85A 1U99A 4N18A 1RJDA 3I2JA 2HRBA 1J1ZA 1AD2A 1O9HA 1FDRA 2BMDA 4MVJH 4OXNA 2C42A 4R98A 1W4AA 5I7VA 3SYMA 3X1YA 1L5HB 1EAMA 1DP4A 1IWOA 1XWFA 3N6VA 4MV9A 3AHGA 5TQJA 1G18A 1ORHA 2WD7B 5CIYA 2OSBA 1UEIA 1AZLA 4XVRA 2QAIA 3WX0A 3B3JA 5DBHX 5ALVA 2HJVA 3QXXA 3V4ZA 4BO1A 3LBNA 4HYEA 3TLBA 1MA0A 1QH8B 4YDSA 2JIZD 5DBFA 1UXOA 1V35A 4ZD6A 1E3MA 1J8VA 4XGIA 1KEEB 1G60A 3QVJA 3TBFA 2JD2A 4ND6A 1XPUA 4UTXA 1K8ZB 4UEKA 5TEWA 4AUKA 1FYXA 4EHBA 1Q1ZA 3JQQA 4I50F 1WKCA 1N5DA 2PH7A 3CLKA 4H16A 4NTZA 3LL4A 4PGFA 3WYFA 3O9VA 1J2RA 3PDJA 2FZLA 1US8A 4IEFB 5BWCA 4YUWA 1NU6A 2IOFK 1N1MA 3B1ZA 3P9XA 1YE3A 4QHTA 3TKAA 5A0VA 4AKGA 2VKTA 3BMNB 4E5DA 2RC5A 3I5AA 1N34B 4FBLA 3IV6A 2C04A 3DR3A 4OUDA 1N6LA 3U56A 1Z47A 3MPOA 4EW6A 2AUNA 3D6JA 2E4UA 3BHJA 2RCYA 5K99A 1ZUIA 1KARA 1T8RA 3D2LA 2VDWA 1QH1A 1RKVA 3FAKA 4G56A 4XCQA 3RSFA 1VPLA 1K1EA 4I1YA 1NV9A 1WW2A 3MILA 3ZX4A 1O6GA 4JLBA 1PR2A 3ZGOA 2B20A 1V3TA 5G1PA 3WGJA 5GINE 4D8TA 3VR3D 3X1DA 1R64A 1JRLA 4V39A 1THZA 2BRUA 3GZ4A 3E4DA 3IAM1 1E1YA 3W3AA 2JCVA 4UBNA 2D1TA 4YCBA 4DMGA 1OYVA 2WWVD 3LU1A 3RYCB 1DLIA 3EDMA 5CFRA 2WLSA 1G7TA 2GPNA 5G02A 3KSBC 2I4NA 1BYIA 3IVXA 4IJWA 4V0SA 1DEOA 2OKGA 1A5SB 1B00A 1TT7A 2C9YA 5EUQB 4JHLA 5AXBA 1XAGA 4BQFA 4LQLA 2QN8A 5DM1A 2ZETA 4OVKA 3DUWA 5L9AA 5CH3A 4WTOA 1MDBA 1OBVA 2C5GA 1TM1E 3JTMA 4JEUA 3ZV7A 3Q7PA 4X1YB 4ZQHA 2QVGA 4QLBA 4Z7QB 3A6DA 1NWCA 3FMVA 3TFQA 1FXWF 2IE0A 2ZIUB 1KDTA 3NHAA 3L4EA 1UJ5A 4KUEA 2O1XA 1U9IC 2M1ZA 3DD1A 3SOPA 1CJCA 2JGNA 4BEJA 5IS2A 4U00A 2WJ4A 4QYWA 4QFDA 3LLSA 1FUUA 4PRLA 2G04A 3MXOA 5DBOA 5H7XA 1JE0A 3KDAA 2VAVA 3QFCA 1Z0AA 3B9PA 3EISA 5ER9A 2C83A 4NJEA 4YWJA 3HR7A 5B2ZA 3LYAA 3FGZA 4URWR 1BQ3A 1E3QA 5AKZA 1TYCA 2QJFA 4MW2A 4RTKA 2QX6A 5DF1A 5JBNA 3F7OA 2NQ2C 2YY6A 4KK4A 1E7WA 3WLTA 1T29A 4WXMA 2H2FA 4KR3A 4FIZA 4HOYA 4URVR 3OKPA 1TKAA 3VTAA 1JKJB 1R0WA 3Q8XB 1DAOA 2FF5A 3ENKA 2FHPA 1QIJA 3PNKA 3TTSA 5LZ5A 2RGUA 3PHHA 4EPTA 1DO0A 3MC1A 2JW5A 3D64A 1FTGA 1YKFA 1GNRA 1VCIA 3I9V1 3OCUA 4XLTA 1AO0A 2HV8A 2Z04A 1K98A 1XMQB 1NRIA 3B1WA 3IELA 3HEBA 3RS3A 1UJ4A 2DQZA 2HTEA 2XODA 3W3ZB 1YAHA 1AKEA 1HYQA 3G49A 4JLWA 2BHTA 4AY5A 3DWFA 1P81A 2QI9C 4FP9A 4K2HA 1G8MA 2ZIVB 3EXEA 5JNTA 1DKLA 2IL1A 3BMCA 3GJZA 1QORA 4YJ3B 3DE2X 5AH0A 3VR6A 2DWPA 2DHQA 2NO7A 3LHDA 3BTVA 4YV0A 1QHSA 1TFUA 3L77A 4MO9A 3I92A 2DXIA 5L3SA 1QIGA 2DFDA 4FQ7A 4MVJP 2VYNA 3VU8A 2XXAB 1UBTS 2P9BA 4YV2A 2QGZA 2CXOA 2H5LA 2W4QA 1MW9X 2CLSA 2OA0A 4HNTA 1I1QB 1J70A 1O96B 4R31A 2FKAA 4ZOLA 5CLIA 4EX7A 4HKTA 3SHTA 3F4LA 3W5IA 4NV0A 4WKPA 5DMHA 2EV9A 4HNSA 3V6MA 3N2KB 1QGYA 3HU5A 1F2TA 3QG5A 4I9GA 4RPGA 1NJ8A 3ZC3A 1XMSA 3O95A 3RLIA 1W581 3H6HA 4B6FA 5EZYB 3QYJA 3P0EA 1TYDE 2W6ID 1OLUB 4G0MA 5EE9A 2UYGA 3REFA 2BONA 1D8TA 4PHFA 5H0IA 2XPCA 4K86A 4MUHA 1R16A 4F4HA 3T1YB 2WG1A 4EGFA 4DV0B 2R1TA 4BFWA 1CZUA 1PJRA 2AZMA 2I2DA 4QTYA 2EW1A 4R51A 4IRXA 4JYPA 5H02A 2CLMB 2Q5QA 1C3OA 4XLLA 1CS0A 4DR6B 1M3SA 3H16A 4DLUA 3RYIB 1YZNA 5JASA 2PZAA 1IXRC 1YXMA 1K66A 4FFNA 4O5AA 4U7TB 3I2HA 3HZRA 2JI7A 4RF2A 2YX1A 2GXUA 4KQEA 4Z0NA 5FPSA 1JTFA 4AF8A 5KQMA 4DMCA 1NNUA 4EHKA 4EKEA 5K01A 3LOUA 1CZNA 1SY7A 2BMFA 3EMDA 3LP5A 5CH8A 1U5BB 1N5OX 1SKQA 3IS3A 3WK5A 2ZTSA 4IIYA 5TJHA 4FKBA 2EZUA 4BNZA 1UKZA 4G5RA 5J9FA 3QOFA 4PAOA 3CC8A 4MINA 3VZCA 4ZT3A 1CF2O 1N6OA 1OF1A 2EEZA 3H0KA 3HB0A 5GZ6A 4ZV4A 5JHHB 2ETVA 3B9BA 3DH0A 3GW8A 4Y0VA 3R7FA 4IOLA 3UWKA 3FMGA 1O8CA 4EELA 4X7BA 2TRSB 3JVDA 3AQ4A 1I8TA 2OYRA 1J1IA 4GPTA 2IS1A 2R7KA 4WFQA 4AM8A 1E1CA 3QJGA 4IOMA 4UULA 5T57A 3SIRA 1FVFA 2YXPX 3EIHA 1BWQA 1DDOA 2CJPA 3KB8A 3LSYA 2XJ4A 3LVBA 4C0JA 3BHMA 3N0VA 4ZZIA 3W5AA 3BGWA 4PNPA 4OB6A 3AINA 4UM9D 1NUUA 4RK0A 1C1DA 1EQUA 4U9UA 3PUJA 5F73A 4ZYWA 5BT9A 1RXIA 1Q57A 4WKGA 2JJYA 3AR2A 1UFKA 1HWYA 3UPDA 5TGTA 3VNUA 2VOEA 3N75A 2YWRA 3F8WA 5C31A 2JHAA 1WUTA 4Z86A 3EPJA 1WTAA 4QUDA 1UMDB 5GOTA 1H8HD 2XZDA 3BRWD 3OZCA 2VH1A 4E5SA 3CQ9A 3GVXA 3IQFA 3LNCA 3QBVA 4KBGA 3NHUA 4Q24A 4ZVNA 3DXZA 1VP3A 4YACA 4D97A 1CLEA 2VDVE 2WM3A 4MKIA 1PZMA 3HK2A 1V37A 1P1CA 4MPTA 3SQLA 4FYYA 3NP7A 1W8DA 1T2UA 3DE4X 4KQKA 3CG0A 2XUQA 4RQBA 1LPPA 1U3GA 2QUZA 2QDXA 3BSWA 3ND9A 4YALA 4EVSA 4YUZA 1I4EB 3IEIA 4RX1A 4BNXA 3GN1A 3BX1A 3HHPA 3LHKA 3NR2A 1PI3A 1NUAA 2C9OA 1KHTA 3A14A 4YPOA 2C98A 1Z36A 4HEA1 2FP3A 1YDMA 5A3SA 2GCOA 2C94A 1AXGA 5CU7A 1DB3A 2Y2UA 4GG1A 4IBOA 4DNOA 1VBKA 2QI9F 4DUPA 1D9ZA 2AI3A 1KOFA 2EG5A 5EJFA 3RUAA 4B6PA 5L4NA 1MZPA 3DLIA 3NZEA 1UZMA 4PCUA 4L74A 4B4KA 3ILXA 3JQ9A 3DBVO 3L8CA 3O03A 3OKFA 4QX6A 4L50A 4R1OA 1PLKA 2GN6A