1V9CA

Crystal analysis of precorrin-8x methyl mutase from thermus thermophilus
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
204
structure length
198
Chain Sequence
RAIEEESFRIVDQEAGPHGFSPLEWPVVRRMIHATADFEYKALTRFSQGAVEAGLKAIQAGARILVDARMIACGLNPERLRLFGNEVVELLAHPEVVARTRAEAAVAYAWEKGLLDGAIVGVGNAPTFLLALVEAIRQGARPALVLGMPVGFVNVLEAKRALMEAPVPWIVTEGRKGGSTLVVAALHALIRLAADGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Precorrin-8x Methyl Mutase
publication title Crystal Analysis of Precorrin-8x Methyl Mutase from Thermus Thermophilus
rcsb
source organism Thermus thermophilus
total genus 61
structure length 198
sequence length 204
chains with identical sequence B
ec nomenclature ec 5.4.1.2: Transferred entry: 5.4.99.61.
pdb deposition date 2004-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02570 CbiC Precorrin-8X methylmutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 1v9cA00
2AFRA 4AU1A 3E7DA 1V9CA 2AFVA 1OU0A 1I1HA 1F2VA 4FDVA
chains in the Genus database with same CATH superfamily
1RHKA 3HN2A 4TRJA 2UUPA 2J48A 4LRQA 4XFDA 4DYHA 3WC4A 3PJRA 3ZHSA 3DM9B 3WA7A 5CT5A 1AUQA 2FRDA 1H2RS 1XQXA 1J2YA 1SHKA 5KKAA 3QUAA 2JLQA 2P7IA 3U3JA 1B76A 4JL5A 1EXDA 4TKVA 3Q1KA 5JHHB 1GGEA 5AI9A 2R6JA 4KX5A 1OPRA 1V8PA 2GZ2A 4QDUA 4C5AA 4ZZ0A 1AQIA 4MQEA 1DXQA 2Z98A 2ECKA 2PYZA 4DHEA 3EQ7A 4Q9NA 1KOJA 1OA1A 1CULC 1QCYA 1PS9A 4Y1FA 1Y48E 1HRDA 3COSA 3IAM1 4IKOA 4B7UA 4QGSA 3DXFA 5CFZA 1V5EA 1ID8A 5T67A 3GDHA 3M4JA 2AN4A 5FHRA 1US8A 3WKDA 2HHAA 5DWVA 4WI1A 3WBFA 3AVXA 1X80A 5GONA 1W4RA 1QFMA 2Z8ZA 2JLRA 3CRZA 3RUIA 4DADA 5CA0F 2FZLA 4H6PA 4W5NA 5LNK6 2PAAA 4PG4A 5GGYA 3S40A 2WZCA 3Q3EA 1UFQA 1YVUA 4S1PA 4GW3A 5AOBA 3WB2A 2P7HA 3OT4A 3ZW8A 5LQCA 3MBKA 2HV9A 2CFIA 2NYVA 3Q6MA 1EPUA 4LV6A 5JRJA 3DE1X 3BHNA 1R6UA 3GNQA 2J0UA 3IR5A 1SUSA 2HX1A 2PXAA 2V65A 3C3CA 1D1TA 1ZG3A 3UEOA 1L1QA 1NDUA 2ZB8A 1N5LA 1SR8A 3LA6A 1YJ8A 4M9XA 1JAIA 2RHTA 5HE8A 4EY8A 5EIBD 4MS3B 1YKSA 2NXWA 5BPFA 5IAOA 4ZJYA 3RYHA 3R7DA 1C7JA 1X19A 3LL4A 5EIOA 3VX4A 4C30A 3PHIA 1HOTA 1F12A 4KLAA 3D0RA 3DZCA 4TV8B 5E3HA 1L4UA 4PE5B 3GOHA 4TKUA 1I4TD 1Z5VA 1GVHA 3N07A 3HBMA 2DY1A 3D3KA 3GGCA 4FHGA 3KAPA 3QXGA 4W5JA 3RHFA 4RE6A 1DS6A 3QKRB 4DSUA 1V0JA 3QE0A 4G0XA 1NFQA 4RA6B 3CFYA 4TKZA 3R5KA 4HGNA 5CEEA 2HREA 4ZCSA 1RWXA 3W2EA 3HG7A 2IE8A 2IX9A 2QZJA 2V8OA 2J3DA 4WJLA 2CXOA 3DLIA 2IZ6A 1GYQA 4UE3S 5EKSA 3V1YA 1C8KA 3CB4A 3I5UA 5CVUA 4Z3DA 2B2NA 4UHJA 3VVLA 4N82A 4D9BA 1KZ6A 1T13A 2B4RO 3ZCPA 1HRKA 2X0KA 2L2QA 2ZSUA 1QQAA 4LMPA 3VR3D 4PTLA 2Y1FA 5AUQA 1QIGA 1IXYA 4N1AA 2PX0A 3TB6A 1RRFA 4RPGA 3KOMA 2E87A 5BO5A 5TLSA 2M1XA 4DA0A 3FPHA 3OC6A 4IMJB 4Y6GB 4ARIA 1J1UA 2H63A 1RAIA 3P9PA 1GA6A 3JD1A 4RKRA 1O9BA 1TK2A 3N6XA 4RZQA 2GQ0A 1MXHA 2EXXA 3OSUA 5CA0A 4S1WA 1IUNA 5FI0B 4F7WA 1CUAA 4P7JA 3RFFA 3NZEA 1OKKA 5CB0A 2VPQA 1ODJA 1JVSA 2ZRPA 2ATEA 1WB5A 1KHTA 5AM1A 2GZRA 4Y2HA 3BRSA 3W78A 4L8YA 4MV9A 2H00A 3EGDB 1H2HA 5J2UB 4CG1A 3ESQA 1SM4A 4I9NA 4UNNA 4BU0A 1T9KA 4ITVA 4CCYA 1TIKA 1RXVA 3D6MA 1FLDA 3R0VA 3GLHA 1PFGA 2Z4SA 2JLAA 3H05A 1PGJA 3RLFA 3SQXA 3DHWC 1VE1A 1EHIA 3PICA 3VZBA 3X2SA 3HJCA 3N2ZB 5CT4A 5KOHB 5G3ZA 2C7BA 1SD1A 3SJUA 5GWXA 5ED4A 1GYRA 2CL7X 3H86A 2WU8A 4BX2A 5LL6P 3KYIB 4EY4A 4H0CA 5JUWA 1QQBA 4NS1A 4NU8X 1PJZA 2I3ZA 3P4XA 5BT9A 4PN3A 1QCDA 1HDEA 4P0QB 5BYKA 2VL7A 2J33A 5C8DA 1FXWF 1HR0B 1Z13A 2ZI9A 1CTQA 4RE5A 3F46A 4UOQA 4MWTA 4XYMA 4YH1A 5KEIA 1UXOA 4IBOA 1U4NA 4AY3A 1QIEA 2Z2ZA 2VSXA 3GZNB 3S7TA 1IMJA 5KQPA 2C4KA 1JDUA 4G5QA 2CJXA 4A8PA 1JKFA 4DBZA 5U9CA 3QPCA 4JUBA 5TT0A 1ZSVA 2OXTA 1PNQA 3JY6A 1RC0A 1X13A 3NGMA 1QP0A 2ISQA 3ETLA 4QJ4A 2Q6IA 3MWFA 4QUKA 1XZ8A 5FTKA 3QWAA 3NASA 4EA6A 2Q2VA 3AF5A 3D7SA 4MR7A 4F9FA 3AX6A 2JGDB 5D8DA 3AWIA 4KQIA 4E07A 3VMFA 3LNTA 3FHCB 1EXWA 1NM5A 2G25A 1ORIA 3NHBA 2A9KA 5EUBA 2DFTA 3DAOA 4K9NA 3TXAA 3HCEA 3EZFA 4OI2A 5C8YF 5J4HA 1TZCA 1H2EA 2HBQA 4RADA 2G6BA 2WV9A 3PCXA 5I6DA 2AW3A 2VWPA 4M99A 4UNPA 3OMXA 4ZYWA 3PR2B 1WPGA 1OAAA 2QX4A 3NBFA 4NKRA 3NT2A 1X77A 3L01A 2PU5A 3V4OA 3WB1A 5MDHA 2I03A 3CSDA 3ENNA 3JQ9C 3R3ZA 1FNNA 1QG0A 1D2NA 4OK3A 1Z4IA 4M0EA 4AI6A 1Z8NA 4HLUC 4LHVA 4Z6KA 1QS0B 5TR9A 4WBNB 4YDQA 5JROA 2XUJA 3QEJA 4HEQA 4MYUA 1B8VA 3EVCA 3HKDB 4ZI2A 2C57A 1Z7EA 5B6PA 1H85A 2QW8A 4I50F 1EE9A 1YB1A 2J9GA 5IUKC 2QPLA 4GOOD 2QMOA 4MVJH 2GN6A 3VDRA 4B76A 1BEZA 2BLLA 4CV1A 5BV2P 4UBJA 2PG3A 1A4XA 2X3UA 3AUXA 3P9CA 2W4MA 5H16A 4KPFC 2RGGA 3HABA 3K94A 3DB1A 2YTZA 1AMUA 2C0CA 1LDGA 2YV2A 3D2CA 3I73A 4U7GA 3U19A 3Q2IA 5IBPA 2WG1A 3DUFA 3GCWA 3W6ZA 3ROEA 1OREA 4AMBA 4RABA 2LD4A 4UU0A 4AUKA 3VZDA 4B4VA 3DOOA 4HWOA 4WKNA 3MLBA 4LRYA 1U0GA 5E7MA 4BFUA 4ODIA 5F3DA 1PEAA 2L19A 1E9BA 2H4XA 3P9KA 2DT5A 1ZJJA 4OV6B 3J7AC 5EYPB 2ATIA 2JEYA 4QHYA 4NH4A 4CL0A 3AEQB 1JVNA 4QNRA 1ESZA 5HE9A 3KOXA 4CM5A 1Y1RA 3VQTA 1EFRD 1ADFA 3SF8B 1KZHA 3D6JA 2X8AA 1Z8HA 3WAJA 3VX3A 4KE8A 1ZJWA 4YP7A 4KIGA 4OKSA 1B41A 4BNIA 4D4IA 4XJSA 4D9HA 3PS9A 2DAPA 3IAHA 4JBWA 4UBMA 3PUXA 4XIFA 2XKAA 4NOLA 2YY7A 4EPTA 4JKIA 5C1OA 1JHYA 1WSBA 1ZUIA 3EHEA 3RKSA 2BGGA 1YA4A 3QLVC 4PV7A 1GGMA 1ICEA 3BKWA 5U1PA 4FMDF 5ERXA 1ZNWA 5C8YA 1RJ9B 1YAHA 2IH2A 1I9GA 4O0MA 5B1YA 3GT7A 2W2QA 1N3YA 1XTQA 3DEKA 4KGVA 4NAHA 4ON9A 4R5MA 4RDHA 4YX9A 1IBCA 2O7VA 3SSAA 3IUEA 3INYA 2E5WA 2WTBA 2M2IA 2HEGA 3F7OA 3JQ8A 5SY6A 2GM3A 3LY9A 3OF2A 4C3UA 1DIHA 1E96A 4EQ6B 3FGPA 1IAVA 1RQ7A 4P84A 1QOQB 2PH5A 3JQGA 4MLCA 4RTOA 3U37A 2GERA 5JMWA 4LYAA 4CR7A 4KNWA 1ZUNA 1CVRA 1GZSA 1S7CA 1WXQA 4I50A 1T3HA 4WZBA 3WYAA 5LMUB 1Q77A 3VU1A 2ENWA 2JAQA 3QLJA 1I9CA 5L3VA 1KO8A 2BMDA 1O3YA 3NTLA 1CLEA 5EKTA 1BDMA 2IX3A 1KFEB 2B8JA 2J6CA 3KKKA 4W1PA 1W47A 1M67A 3ZWVA 3VGPA 5KNCA 4EX7A 5KHOC 1DX9A 1XAGA 3NHLA 3IPLA 3I1FA 1WY5A 1V4VA 2GETA 1E7YA 1ZJYA 4HH1A 2FW7A 1EWTA 2X4LA 2NQ2C 1XF1A 4OHKA 3FW1A 4RW0A 4MS1A 5B58T 2XQVA 2PT9A 4DN6A 2J59A 3EVAA 2HLHA 2ARKA 2WHRA 3CJTA 1RLUA 4NEQA 1JJBA 4QXOA 3PXDA 1JRLA 3CVJA 3OZXA 4Q01A 3SEQA 1ZMXA 3Q15C 1I2BA 2P2ZA 3THXA 1IG3A 2BMVA 4G5XA 1HGXA 3A1WA 4JLDA 1DEHA 2RH9B 4YO8A 3NTOA 4YI3A 1ZK0A 1E1RD 1TC1A 4DA9A 2IT1A 7AT1A 5KWIA 1FFXA 1YE3A 1Y6RA 1SK8A 3HXMA 3QVLA 4FZVA 1QDUA 1WD5A 4US0R 5D6OA 4BO6A 4GH5A 3L7AA 4GPTA 4KG7A 4EELA 2XGGA 4WK6A 4IH1A 2ILTA 1U0OC 4QTTB 5DJ5A 5HG0A 1M7HA 2X0RA 1E2NA 1GCUA 3LYAA 1F51E 1X38A 3NUZA 3ENWA 3PHJA 3R6TA 2NU9B 2XHZA 4ALKA 4B73A 3QFRA 5TMPA 4MVJI 2AG1A 5CNMA 1BU8A 2P9QA 4Q3OA 4RHTA 1WRBA 5ALIA 4AWBA 4LE1A 2IZZA 1EFVB 1NOIA 3LPMA 4WJKB 2CSUA 3MUNA 1P0PA 3OOSA 3W8FA 1QOZA 4KAJA 5BN4A 1FQWA 5L95A 4AZVA 1T24A 5KB3A 1C1DA 3DDZX 4HWGA 4BYMA 4CEIA 1PO7A 5K0TA 1LQTA 3QVTA 4JJFA 5C32A 3A3KA 5A4DA 2R8PA 1SKUA 3HKEA 1TZKA 3D5QA 1XXHA 5C9ZA 1T5BA 1T2EA 1Z3IX 2G08A 3QVKA 3VVMA 2AJDA 1PWXA 3ZE6A 2NO5A 2YOGA 4BBPA 5ITVA 4CDRA 1E5DA 3O6VA 1WD7A 1K98A 3T54A 2DY0A 4EY3A 2W8ZA 1V11B 3S3TA 2ZBFA 2W6ZA 2P6OA 1L6IA 3TSZA 1FP1D 3BMNA 2RHRA 4I1PA 4RVFA 4F1WA 5HP4A 2O2DA 1GLGA 1XSEA 5KHLB 5EE0A 2B2CA 1CEXA 3GJ6A 4R1PA 1V26A 2H18A 3AR3A 4JA0A 1X8LA 2I78A 3VR6D 4M0DA 2Q9UA 2V59A 4LXGA 3BE6A 2PKQP 3L79A 2D5AA 2FQXA 3AUAA 4JOCA 3SDZA 4ERNA 3GF4A 4Y2UA 4YRPA 3WADA 1G6Q1 3LDGA 3R3JA 4B81A 4OQPA 1JJ7A 2QI9C 2QVBA 3T9AA 2DUJA 3C15C 5IUNC 3U6KA 2C4WA 1PIWA 3AB3A 1GSIA 2Z09A 4ZZ2A 1Z0IA 3EZLA 2NUAA 2Z2JA 1E9CA 2Z3ZA 4P9NA 4EA8A 1JWAB 3H2HA 1N5KA 1KKMA 2NO7A 2V98A 3R6DA 1FC0A 3DV9A 3V8PA 4E2FA 4EHBA 5H5JA 3C7KA 4H17A 3I61A 2Q5FA 2WIGA 1RYNA 2Q0HA 3IUNA 4QYXA 4Q9HA 2PL9A 2O3UA 3NTUA 4K9QA 1OFUX 3A1DA 3EZNA 2DLCX 1NJ8A 1ENOA 2WMYA 4NVRA 5TQ0B 3MOGA 3KXPA 3UCFA 1EINA 1R5JA 1I7PA 3EZ6A 4B45A 1IN5A 1CD5A 3RB8A 3ROPA 2XV1A 4GMHA 4DLZA 1Z6GA 1ZU4A 2Q8PA 2AFHA 3BX1A 3I1JA 4QYIB 3X2EA 4PFKA 1PAUA 2JAXA 1GGVA 2XY4A 3OURA 4QGGA 2FDCA 4B31A 2MSWA 4JI5B 1F1BA 2I2FA 3GU3A 3SQMA 3S27A 4BUZA 4X1YB 4ATNA 3ICWA 1M73E 5HF5A 4RSRA 3U4HA 4PZEA 4ZICA 1UDCA 4P22A 1PR0A 3J81A 2VC2B 4ZO6A 1Q1EA 3KKPA 1QMGA 1X2BA 4BX3A 1TFRA 5DLQC 4G5HA 4ZA2A 3R9XB 3KUDA 4TQUS 4RPCA 1NMXA 5DGDA 4MHTA 2DCMA 2VNHA 1V1JA 3TIXB 3MAAC 2NV2B 1JQKA 3PRJA 1C3OA 5B55A 1VBMA 4Y9DA 1HI9A 2IKQA 3GJ5A 4BXOA 1SOMA 3JCZA 3CU5A 1DPGA 2VDWB 2VH5R 4ETNA 2CYCA 1CQIA 2O3SA 3B78A 2QTWB 4ONEA 4ZD6A 3OJ0A 4GPIB 4M46A 3TLMA 3MYYA 3MWLA 1DRVA 1N6NA 5ER6A 4WESA 1O4VA 1P62B 2MSEB 1GR0A 1T25A 3F9RA 4HNAA 2I2WA 2AOUB 2NZ2A 4ESOA 4QG3A 1QRDA 1E3EA 3LUJA 4WASA 4E0BA 1C30A 3V7WA 2C5EA 2ZYDA 3GEHA 2JBAA 3H75A 4N0PA 2WFLB 4RDCA 5EVJA 5SYMA 4R68A 2ROQA 4HNUA 4Q4AA 1SXJC 3RYFB 3CZRA 4NAVA 1UEIA 3IR6A 4HDQB 3UUGA 3WIBA 2DULA 4QDXA 3W5UA 4RDXA 3CF4A 4BNKA 1IHYA 1UT5A 2CUKA 1WIWA 4PYLA 4ZYUA 1AHIA 1HNNA 4CETA 2PWPA 2WVJA 5KNDH 4UHFA 1LPPA 1YQEA 4JN6B 4JT9A 1CUEA 4ARUA 4BVKA 3UJ8A 5J4LA 2VF8A 4J0QA 5IVKA 2PQ0A 1O0BA 4PYRA 3DNPA 4FSDA 2ZBVA 5KBYA 4YRJA 3DMGA 2Q2NA 2A92A 3AKEA 3GJ8A 1A7AA 2Z3VA 4N12A 5CT9A 2P65A 1CJSA 1QHGA 1EX7A 5E3JA 1EDOA 2XWJI 3VR4H 3ZCRA 1DO2A 4F38A 1J39A 3R3XA 5BMVB 1N2HA 2VXBA 4EBBA 1M1XB 1IXSB 4H7EA 3RHTA 4CV3A 5DEOA 3RTBA 3LGAA 1VZ2A 4RWEA 5JAUA 4XFKA 1JTEA 2Y3IA 3MINA 4NMMA 4PO9A 1H5NA 4HZUB 1IONA 1D4AA 1JDSA 2XNHA 3B36A 3A2NA 3OEEA 4LC0A 4F93B 1PQPA 2QRJA 3NDIA 4FNGA 5J23A 5LVAA 3R5SA 4TTIA 4PGHA 1EP2B 5BW6B 3AWDA 5EKXA 3RVPA 3X44A 4B80A 1XRRA 1K88A 4FFBB 2FFJA 4E11A 4ETIA 2XYGA 3UJDA 3S68A 3VJRA 4DLRA 4BO5A 2NWQA 2FR0A 4UQPA 2QSJA 1R18A 2YWEA 4G81A 5K8TA 1SUBA 2WTEA 1S1CA 3D8NA 1PBNA 4FHZA 3MM4A 3Q40A 1NA5A 2IIBA 1S6YA 2QZPA 4S1NA 5ALNA 3WGOA 5C5DA 1P6XA 4B3HA 3AIOA 1XKTA 1IY2A 2ZE6A 1ZXXA 3HCBA 3DL0A 3AVUA 2QTFA 4ZRDA 2YMPA 4HXFB 3OMLA 4B6QA 5HMMA 2QYTA 1Q50A 1CZUA 2XUOA 2C2XA 1AA9A 1C50A 1PD0A 2VFAA 4F04A 3AUFA 1EVLA 2WV7A 2XCUA 5IANA 2F9LA 3K0EA 4IUCS 2GZHA 3FMVA 1AQLA 2GFQA 2RONA 4I66A 1J99A 2IYLD 4V0SA 1CUBA 1INLA 3DVQX 1U99A 4O1HA 3GC6A 3PDJA 4FCVA 3SR4A 4TKVB 3COJA 4KAAA 1N0UA 1RBMA 1YZFA 1LXCA 1T8RA 2J08A 3ADPA 3RADC 2X2FA 4BFCA 2H59A 2QLJA 1SU8A 4GUDA 1KO7A 4OHZA 5BSFA 1LLQA 1KP9A 2ID8A 1BYUA 2CHUA 3G7SA 3GG2A 2P5UA 3GMTA 2FFRA 3IULA 1MQSA 3F67A 2DHQA 4TV9B 2FMFA 2BFEB 5BRAA 1PK7A 4OXIA 5CNJA 4DDHA 2HU5A 4HNQA 4DUYB 4LYEA 3D7LA 4JX9A 4U5QA 5IPFA 1SBCA 1T1JA 5EMKA 4IIEA 4M0FA 1X80B 3Q9SA 4S2UA 3G2NA 3G1UA 3BICA 5CBKA 2YJ3A 3AFGA 2PT5A 3BIFA 1CWUA 1OWOA 1ULAA 3IP9A 1UBHS 4UTXA 2Q8NA 2WSLA 4CM9A 5K0EA 4LXXA 2A2ZA 1UPFA 1NY6A 2IU4A 2VT2A 2WHPA 2ZI5A 3AC0A 4N5MA 2VHCA 4XRRA 1P7WA 3DPIA 3IKLA 1DC5A 2FQ1A 4HDAA 3I42A 2I67A 3LQRA 4PR0A 5T3YA 1XPJA 2KBFA 1NMSA 1VJRA 2QS9A 1I3KA 2YVAA 3LKZA 4GF5A 1XP5A 2J0UB 4UREA 4YT5A 5AHWA 1UMDB 1OWMA 2I9KA 1COWA 2D2EA 3DM5A 4RGVA 3DXYA 2ZK7A 1UDWA 4B2YA 1MAWA 2A86A 3JWIA 2R85A 5E1OA 4TGLA 3T3IA 5LMNB 4RD1A 2HMVA 3H83A 5TGDA 1N8KA 1ST2A 2UUCB 1QZ3A 4FI3C 4WECA 5HIMA 1F0PA 1DRWA 3TFQA 1F6WA 5T4EA 3ROTA 2IHZA 1M83A 1TQ8A 4P93A 5ALXA 1YA6A 4YTEA 4NZOA 4KE7A 4KPUB 4KIWA 4Z51A 2H1FA 4PXAA 2OKGA 1IPFA 2B1RA 3A1EA 4YECA 5D3MA 1G18A 1TW3A 3TZ6A 3BIWA 1C7IA 1DO8A 4GHWA 2AIRA 1MEJA 2HB6A 1X2EA 4CM7A 1KAMA 1JQEA 3EIFA 3FFXA 1U2DC 1KYQA 1HETA 5DP1A 5IN5A 2HOQA 4D8VA 4XWKA 1G21A 1V2GA 1S8AA 5JYBA 1DDOA 3NH6A 4Q3CA 4PN7A 3P1JA 1BEEA 2DTEA 3GUHA 1UPBA 5AK4A 2AZDA 4MGKR 2HY7A 2H65A 2VJNA 4BP8A 1YE5A 2DBZA 4CU5A 3TOSA 1TQ4A 2XAAA 4HY3A 4JDPA 4NOKA 4F2DA 5BR1A 4EFLA 2OV2A 3KV3O 3N8NA 4OJMX 3GEDA 4PBTA 3QITA 4TROA 2P2YA 1JEAA 3Q8XB 1S2NA 5ICMA 5JWRA 3GT3A 2QQFA 4DCTA 2QRPA 4AF8A 1UP6A 3GRVA 2NN3C 3NXSA 4KQJA 3T3GA 5C52B 1R2QA 5CNKA 5EE9A 3Q9NA 3NV9A 2FPUA 2B1GA 4GR9A 5CA0B 5A9TA 3O5AA 3HJNA 1N9ZA 1U1GA 2YYYA 3Q12A 2P0AA 1PTJA 5EZSA 1WTCA 2AUMA 4YYEA 5CCBA 5UKDA 2RHJA 2UXCB 4HK4A 5FR2A 1ZCZA 4M0UA 5FUWA 4BVBA 1S01A 2V6JA 2WPDA 1RWMA 1V7ZA 3GK3A 2BGJA 4J2TA 5DE3A 2EQAA 4MA4A 5EWJB 1SXIA 4QYMA 4X7PA 5C37A 1QVWA 2GUGA 4PU0A 1S96A 5FFMA 3E27A 3GLHB 3NP9A 2O2GA 4P31A 3PQ5A 1O03A 1PDOA 3G6WA 3LT5A 5HFNA 2WD8A 2BM0A 4DLSA 4ECEA 1G4HA 3UWOA 1VBFA 2NV0A 2EWMA 2DGDA 3HXQA 1RQRA 4GYYA 2DVMA 4NXNB 5GMOA 2QX9A 2VLIA 4WFQA 3T94A 2J5KA 5ADHA 2VZ9A 3TG2A 1FY2A 1GT6A 2CK3D 1SH7A 1Z4KA 2JD0A 3TDMA 3VOBA 2FE1A 3GDGA 1L5SA 1XV5A 2NVWA 4ER3A 5F3WB 3C1OA 2BE9A 3AY6A 4XVHA 5H0IA 2GSWA 5AJXA 2NO0A 1K5PA 1HUQA 1VIAA 4OJTA 4YRLA 1VBNA 3NXKA 1BXKA 3GJQA 4KBYA 4GRIA 5T6BA 4FGWA 4ZCQA 3D7MA 1YS1X 1ZMOA 2ATVA 4E5VA 1XU7A 1A7KA 1OXTA 4MR7B 1WOMA 4F6LA 3ANSA 2Q5IA 1KFJB 4RZXA 3JW8A 3JZIA 5AI8A 5E9QA 3T7TA 4MWDA 2ZBPA 5TMEA 4DDWA 4IO1A 2Q2QA 2P9YA 3O21A 1T6NA 1YR3A 3MELA 4QUGA 3I72A 1C0IA 4FCCA 3IUMA 1VLJA 2BBTA 3C39A 3EY9A 4GZ5A 3TZQA 4DYDA 2HWWA 2YZ2A 2IOHA 3D8UA 4G09A 2XKJE 1Z0KA 2OBYA 3KZVA 3OKFA 4UXJA 4ZQFA 3ANLA 1I0IA 4YGYA 1OA0A 3VPDA 5T41A 2EJUA 3GEEA 1T5DX 4EKGA 5BUZA 1PJLA 2RG7A 4NIMA 1WAMA 3B9QA 1IN6A 4MGHA 2UYQA 2DH6A 2QG4A 4TS9A 1KDTA 2VHWA 4LSGA 1EUDA 4MMZB 4PLZA 5IVIA 2QT9A 1GKIA 1RZ3A 2A57A 4QXAA 4DBLC 4MI3A 1FUYB 1JW9B 4B6FA 4DZTA 1QK3A 1VCNA 1CS4C 4QRDA 2AYXA 3KWMA 3OZCA 1D9ZA 2R1UA 3SJ7A 2P3SA 1YASA 4FFNA 1SULA 5IT9A 2X5OA 1NTOA 1GNSA 2ZAYA 2F1IA 3A9RA 2O7SA 2ZQ5A 4I8XA 3ESCA 3E35A 3JQDA 5EY5B 3W90A 4EH1A 5KPDA 1CUCA 3DUFB 1KFBB 3FKJA 3I3SR 1FLAA 3Q85A 1U3VA 2Z9BA 3LT4A 2BTOA 4LE2A 2F3UA 1W44A 2R6AA 4JLKA 4O29A 1G6KA 4RCVA 3VSEA 2Y77A 2CDCA 3IH5A 3VUFA 3P9YA 3UPTA 3IRUA 2WP8J 1IWOA 1JNYA 4L5AA 3SC3A 4IIDA 4F86A 4OQEA 1ND6A 2D4AA 4PQGA 3PC4A 2GXSA 4LSWA 4PX3A 3ONDA 2J6BA 2RK6A 5KPJA 2QIPA 2JAUA 2XVMA 1U9JA 4PXSA 1N2IA 4XSGA 5HUJA 3ADBA 4QICA 2CUTA 4L15A 1GAXA 1WXFA 2AK3A 2W9XA 5J40A 3O9MA 13PKA 2IFTA 1FX0A 1QYCA 5DHSA 4C07A 4U7FA 4JI4B 5CB4F 3WIOA 3A3NA 1ITZA 4RCYA 5KWVA 3MHTA 1EK5A 1UH5A 3A0RB 3I28A 2VBCA 4AX8A 3ZG6A 3VUEA 1VE3A 3K70D 1P0FA 1U2RA 4N5IX 4RY2A 3PFHA 4BO7A 1E6CA 3DOIA 5D6NA 4JB2A 4HNSA 5DYYA 1NNUA 3Q8WA 1U8AA 2GPYA 1IK6A 3UHPA 3M83A 4MJLA 4UPEA 3OT1B 4A2CA 5C8YB 5EJ6A 4I46A 4F2HA 5BW8A 1Y5MA 4DZZA 2BFNA 4NXMB 1D6SA 1WF6A 1JHAA 1N3LA 2IDMA 4WQMA 4B75A 4ZOBA 3FMOB 1FNCA 5TEVA 1UMBB 1LK0A 1P81A 1R5NA 2P27A 2X13A 4PO3X 5H70A 4Q1EA 4AY4A 1QF7A 2P2NA 1PR2A 1F1JA 1IH8A 3FM9A 4YMHA 5F9HA 1A4IA 1VLVA 1CIVA 3TRDA 2JI4A 2EKZA 3DZ8A 4EVSA 5HZKA 1X1EA 2FRVA 4Y2XA 3OOWA 1JECA 2DPLA 2HF7A 4I50B 3BXZA 1NW4A 5HQTA 1H2FA 4HNGA 2PIDA 3HCPA 3TXXA 2BGNA 4UOEA 1OVGA 2XI4A 3H1EA 4MXDA 5HIJA 4G5GA 5DVZA 1LBHA 4GX1A 4MULA 1J07A 1BFDA 1IWBB 4G85A 4J91A 1EBFA 2HNKA 2QN7A 3GRYA 1XTSA 1EFTA 3C45A 1JFRA 4HBGA 4D3ZA 1PD1A 5EVCA 1MQ8B 1RQXA 2IOFA 4LDRA 4G5FA 2RG1A 1GVNB 2ACWA 3MJCA 2XTJA 2OR3A 4DC1A 2JBHA 2FWPA 4XWOA 2R1TB 1VYTA 1Z6QA 3BB1A 1VG8A 5H1YA 5GV7A 5B4VA 1OFGA 2QL6A 4DJJA 2NVBA 2JATA 1EB9A 1D4FA 3ZU6A 4K26A 1Q3KA 3V7NA 1GN9A 2H0AA 4QFMA 3THXB 4V0ME 1LBEA 5CJJA 3N6RA 1N5DA 5FBQB 2IGBA 1WXIA 2GN8A 2NM0A 5THXA 1N1DA 3BSSA 1WHTA 5B1EA 2IEZA 3ACDA 4OYYA 1YZQA 4AS1A 1DQSA 1BGXT 5ITZA 1RI2A 5EMNA 1PBTA 1P2TA 4P08A 3HQ4O 1F14A 3NRJA 3ICPA 5CM9C 4EVIA 2ZVDA 5IBQA 2NXEA 2VUUA 2Q50A 1H6AA 3PXGA 1UT6A 3IMCA 3DONA 4FMDB 4D96A 3VNBA 1Y82A 3E4CA 1CY4A 4I2NA 1OC4A 5AW0A 1LF5A 1TYAE 3G9UA 3D4IA 4HWTA 4US2R 2Y93A 5HQ3B 4FN4A 3QW2A 3BYZA 2BC9A 3B52X 3GLTA 3FOEC 3SHTA 3BE4A 1FK8A 1X8XA 5KNCD 1Y5RA 4A27A 2ZS9A 2ZYVX 4QG7A 4XVRA 5BNFA 2D0DA 3RRBA 1NJ2A 5B58C 1YIDA 1EE1A 4LXTA 2Z4RA 2ZIAA 3A3YA 3DDWA 4NCKA 3S4YA 5HRCA 1LLDA 5IMBA 2JCVA 1ZBQA 3BK7A 3LP8A 2ZVPX 4N7BA 4TS1A 2YNMC 1ISRA 2SKCA 4J6FA 4OHCA 1UIMA 4XD7A 5ICEA 3RVQA 4EUKA 3G79A 2PBFA 5FI1B 4S1OA 3QOFA 4KB5A 4IIFA 4PTYA 4YQEA 1QRTA 3R76A 2HRCA 1V7QA 2JIQA 3MTEA 3W2HA 5BSKA 5CCEA 2DQKA 3BMNB 3H1AA 1UQRA 3E8XA 3G9QA 3P19A 4AUEA 1NX9A 1FFDA 1HYQA 2H9YA 5F5NA 3FMIA 1PN3A 1V95A 3HYLA 3DL4A 4A91A 2I4OA 3B1VA 2ZLBA 1P4SA 4GMFA 1ZA1A 4ZRMA 2BDEA 1RQ2A 2O2JA 3PNBA 3PQEA 2X4DA 3IX7A 3IVRA 5FWYA 1AV7A 2JIPA 3U3MA 2VQEB 3SKVA 4AZ3A 5DI3A 5ALKA 3NEYA 3I5MA 4LDJA 3ZY4A 4WA8A 4YMSA 3H9UA 3QQPA 3RQIA 1Z0JA 4CJXA 4Z7QB 3N5KA 1O95D 1ZHHA 2B36A 4FYVA 3ZE9A 4BNZA 1T3SA 4TYWA 3O93A 1VXOA 1R8XA 1JQ3A 3O7WA 3TQIA 5KYNA 3WAGA 3IDOA 2ID9A 4N0EA 1PJ3A 1S8NA 4QXPA 1SCJA 4TRMA 2EFDB 4XB2A 5B53A 3IQIX 3T1OA 2G5TA 1QGAA 1HL3A 2WVHA 3FYTA 4N54A 4D26A 3HI4A 3JZFA 1B8PA 4OHWA 2V1XA 3AKCA 3KG2A 3LP5A 4EEXA 1DP4A 1M6VA 4BNDB 2RE8A 1QO7A 2XE7A 3FR7A 3IQEA 1E9RA 4Z0NA 1QFSA 3P26A 2HU8A 3QQ5A 1A77A 2GTPA 3LSYA 4L4YA 2AFHB 3W2TA 1LY1A 2ZVJA 4AJJA 4LOAA 1M8KA 4M7WA 4CG0A 3N53A 2O8VA 1CNEA 3Q5GA 3PE6A 1DHRA 2EAUA 1E98A 3CH4B 1DSSG 3KE8A 3KKMA 3DEZA 3MFYA 2DERA 4DOMA 1Q1NA 4Q6WA 1IIBA 1K8XB 1Z6PA 3ZXIA 4G1EB 4DR2B 3NHWA 2DQZA 4CXMA 4Q05A 3WZ2A 4ECAA 3KSMA 2C2MA 1U9IC 2V7VA 3GFGA 3PV0A 2FWAA 3QVOA 4QVKA 1C3OB 1RMYA 3L8EA 3OJWA 1R10A 3Q72A 4TTQA 3SLGA 2QSUA 4BXOB 1QZUA 1ODTC 1QX3A 3LC2O 4K8OA 4MX8A 4UDNA 5FLXA 3DPUA 4LXYA 4ED9A 2J1LA 3LW7A 3SQOA 5KYGA 4RS3A 5JZBA 3CX6A 4ZVKA 3ZI7A 3JZMA 4IQ0A 4WESB 1N57A 1IQUA 1BRMA 2IXFA 1LTQA 5K4HA 5AI5A 3TDKA 5KCZA 2JFYA 3HJTA 2X2EA 3T06B 4ARCA 1C30B 1L4MA 3ZJYA 3IR7A 2IYWA 4RMGA 2JBAB 1P9WA 3MGKA 1DWPA 3NB0A 3PXUA 4DQVA 1E8MA 1PVOA 3CCFA 1FVXA 3OH8A 4TWBA 1OGJA 1G5RA 1LFDB 2QTVB 3K31A 4MLDA 4YUZA 3ZGYA 4A7PA 1W88B 2IYUA 2XB8A 4KQWA 4LTNA 5CLLA 3T7SA 2GJ4A 2AMJA 4QULA 1USVA 2H7CA 1U8UA 2RMKA 4J0CA 4W9NA 1KGSA 2Q5OA 1OB5A 3KVVA 2N3ZA 1ZR2A 4G89A 2CE7A 2FP4A 4L08A 4AJ1A 3ROMA 5K4AA 1PQWA 2FFBA 3QX9A 1E58A 5CYPA 1GY8A 3X1XA 4D56A 4EUHA 2G1JA 3V5NA 3W7AA 5AYVA 5A5EA 2IA5A 4J0IA 4KDCA 4QNMA 3UAVA 1KC3A 5JNRA 3AJRA 5A5FA 3LX8A 4KXLA 4FFSA 4H08A 1RPNA 3QBEA 3RBZA 4EYGA 1RZRD 2Q3HA 4ZARA 3JATA 3E3LA 2O2EA 3HH8A 5CH5A 5A6SB 3WY9A 5BNTA 1XL0A 1TEZA 3GHYA 2YWCA 1PZGA 2H5IA 3DMDA 4GMGA 3NYQA 2XNJA 3PSAA 2DXIA 3OOEA 5JPIA 1IBLB 3TUJC 2OXIA 1A9OA 4YHBA 3LWNA 3GLKA 3BDAA 3Q41A 3CRVA 1F9EA 4PLCA 3STUA 5JI2E 1Z6XA 4F2PA 1JDVA 5EHQA 5AHOA 4K6HA 1W2HA 3C5WP 2AF4C 2HRRA 1LPMA 1C4XA 4G5SA 4PC7A 2AC7A 3IAFA 3MTQA 4GVLA 1M1UA 4IAOA 4QC2A 4AMGA 4R0MA 5LQJA 3C98A 1ZDMA 4MKXA 1EP3B 5ALWA 1A5AB 3I2IA 2CDNA 3T9EA 1TX4B 3GFTA 3RWBA 4DLNA 1RM5A 3OQVA 4FFLA 5LLSA 2GLTA 3SDSA 3DMFA 2ESRA 2DKOA 3GPLA 3TSYA 4C4ZA 3PC6A 3O8CA 1JPJA 1SGWA 3MILA 3V8NA 2B69A 2HK6A 4ZEXA 3MUFA 1WETA 3KKQA 5SZHB 4XIJA 1CQZA 5HIIA 5LQSA 3HJRA 3FZQA 2G5GX 1D3AA 3BMQA 4JELA 4MAFA 4XPZA 5ALUA 3PLRA 1DWOA 3ZLBA 4ZGWA 4E1BA 2J3LA 2ZKIA 3OLWA 1U0JA 3DFMA 2YZGA 1EXVA 1TM1E 1XZHA 3QVSA 2MR6A 3PWTA 3NHRA 2OC9A 4RXUA 3YASA 1A97A 3AONB 4LCJA 2QJFA 3VR6H 1NW7A 3PCTA 4PZDA 1ECBA 5EZYA 1RABA 4QOJA 3RTAA 5HRAA 1SEVA 4FILA 4F6CA 3VZCA 5FA5A 4UJ3A 4JCOA 2BFMA 2EW8A 4WK0B 3BEOA 2E89A 2GD1O 4G0ZA 1NMZA 1SOAA 1YOVA 4OP3A 4EPXA 4KREA 1Y4DE 2J6IA 1U7OA 2P5SA 2X5KO 4PPYA 4B9AA 2GPTA 4IHKA 4NCHA 4EP1A 1GEGA 1RYFA 2FVXA 3A9SA 3S2SA 3S28A 3E22B 5CIWA 3BREA 3H0EA 1QUEA 4Q48A 3ZBPA 1E9AA 4P54A 3A11A 3LC0A 3LCUA 2E4VA 2C4UA 2PV0A 3HY6A 3CLTD 4RPLA 5AHXA 4BLTA 5LLDA 3TVYA 1G7SA 2OEPA 2YS7A 3A36A 3AHGA 1J6UA 2XNKA 3EPPA 3UIEA 5IDYA 3DOHA 3H13A 3NRCA 3O0TA 4PS1A 4A8HA 3KT6A 4RD2A 4B6GA 2FUG6 2QUJA 2PMKA 2WHPB 4AKGA 1CR2A 2Y99A 4X41A 2QTAA 2V03A 4H6VA 1YDWA 1A8HA 4Q9KA 1KR5A 2XD4A 3R9IA 2W90A 2JEOA 2LDXA 4FW9A 3E9NA 3H4MA 3EBLA 2EP5A 3QKTA 4IJ6A 3RSZA 2UZ1A 3KWJA 5KYVA 1W4AA 1SIUA 2UVPB 3VSAA 2QJTA 2X8LA 2JIBA 5GIOE 4NTZA 1UPCA 3GVHA 5AI0A 5BRNA 3WK8A 4AMYA 4BMYA 2ZIGA 2DSNA 2IP2A 1SXGA 4Q7JB 2CUZA 2BEUB 1MFPA 2PN1A 3PNSA 3B2EA 5I7UA 2I6QA 3KQTA 4GI1A 4JB0A 4BGUA 5F5XA 3K9BA 4AICA 3GGJA 3PFCA 4I1UA 3GV0A 3DBRB 1EUYA 3GVXA 1L5FA 4OQXA 2GBCA 3OJLA 3FNGA 4FHCA 3IIJA 5EJGA 1L7EA 2I6SA 1KP3A 2QSZA 3KFVA 5D3MB 2JAOA 2SICE 4PBRA 3ZCUA 3IVXA 5K03A 1IUPA 1JA9A 4WZAB 1EVQA 3IOMA 4RF3A 4BX8A 1YMUA 1PEDA 3BDIA 1W8DA 3DTNA 2ES4A 4RAOA 1A5SB 1W30A 1F4VA 4C0JA 3RSCA 4JXXA 3TRKA 1UWVA 1G21B 1B14A 4RULA 2H3HA 4IX9A 3NAGA 4DABA 4Z54A 5AVOA 2WAXA 3KDSE 4NOMA 1ZW6A 4EW3A 1D9XA 1FDRA 1MF7A 1OTYA 2I55A 1FVFA 2WWIA 2TMDA 3N7TA 1GRNA 1QE5A 2F90A 3N5CA 3NJ4A 3RJTA 2B37A 2FW8A 4OQQA 1DNPA 1QQTA 3AHCA 1PW7A 3ORQA 4QREA 5ECDA 1DAGA 1QBKC 1QP8A 2PWAA 4P4TA 1KERA 1YSCA 2FN7A 3B3QA 4OQYA 3UJAA 2RJOA 3E9YA 2WLSA 4RQUA 1COWD 2LV8A 2N47A 1Z0SA 2HJVA 2W4QA 2P6MA 3EZ9A 3OI7A 4FS8A 4UPVA 4D3XA 3BE5A 1ZK1A 2BEVA 1B6RA 2ZTVA 4G4SO 1O77A 1CC1S 2WT9A 1VA5A 3KQQA 3OPXA 4WN9B 2OECA 3OCVA 5DFAA 1Z06A 5DX0A 1F7UA 2C61A 5DOVA 2P68A 4C2TA 4RK1A 3OE4A 1AXEA 4N7RA 3STHA 2Z6UA 2ZRIA 2Y6VA 4N7MA 3PNPA 2D7CA 3PJDA 4FVTA 4GG1A 1U98A 4IKEA 3V2GA 1W29A 4FR5A 4ZK6A 5C53B 4OATA 4ANFA 2ZWOA 2XE4A 1ATZA 2NT4A 4H9GA 4K8RB 4DCNA 2BR3A 1XTRA 2X6QA 4ZVPA 1TTTA 3ISVA 5L7WA 2YRFA 4RNDB 1N9KA 1R4ZA 5DISB 4CM6A 1L7PA 1KEEB 1NATA 2FWNA 1P7VA 4R2IA 2FX3A 4TYMA 3VH3A 4TZTA 1XALA 4I4IA 2F4VB 1B0AA 3CKLA 2WPNA 3OJFA 2Y27A 3WTBA 1M1NA 4UTOA 3GNSA 3KB2A 3EQZA 2HDWA 3TW6A 4Q21A 2QBYA 4L3WA 2PLWA 5FPQA 2O8DA 3P9RA 1BXGA 4CKXA 1KQFA 2YHUA 1YB6A 3K0FA 5BXQC 3FSJX 3HO6A 1MRSA 2JA2A 3C1AA 1FOEB 1QB7A 3HJGA 1G20E 4RD0A 2VJMA 2VTBB 3T4XA 5AJYA 3H8WA 3NS7A 4GPBA 4EW2A 1ORTA 4BE7B 1LB1B 4HB2A 3VU9B 3G9XA 2WKRA 1NW3A 1T5OA 1WUJS 1AF4A 2RHHA 4FKBA 4F8EA 3U81A 1ND5A 1ZHFA 3MGCA 3UJPA 3ABSB 4CLDA 4GKVA 4ZJZA 5LB4A 3THWA 4Y2PA 3EUWA 3VPXA 4EZBA 3OZFA 3LX5A 3HHPA 4YRDA 5IVHA 2GA8A 3N9IA 1Z0ZA 4B3BA 3G82C 3K8OE 3S70A 2OCYC 2V7BA 1P74A 1T1GA 5FBKA 2G67A 4IQFA 2Y0EA 1MG5A 3W34A 3JQAA 3AIMA 3PNMA 5ALPA 4CKCA 2OXEA 5MHTA 4WKPA 1NBAA 1YZVA 2H9AA 2LXNA 2HGSA 5AIAA 4CDNA 1YACA 1SC1A 1Z73A 1EX1A 2DYKA 3DD5A 1AKQA 3N70A 4Y1RA 5KO2A 3SSMA 3PCRB 2XMRA 1EUDB 3B51X 1EDDA 4NV1A 4R1QA 2PA3A 2R6HA 2O2CA 5AKXA 4D8XA 3HKCA 3UMRA 2BF4A 1J25A 1PI3A 2FOIA 3OZEA 3N0WA 2Q5LA 1V8OA 1YV9A 2I34A 4MW7A 1CXZA 4DRYA 3ADDA 3VYSB 2ID7A 2FRDC 3DEIA 3DL2A 3GH1A 1UBMS 1DBVO 1WCIA 4UXHA 1XCBA 5FR1A 1USIA 3A6KA 3PUVA 5F35A 4ARBA 1CKEA 4BJ3A 2Q1UA 1EFKA 1P75A 4I55F 2B9VA 1JR3E 3SNHA 4FR0A 2PJZA 1BKYA 1IXKA 1U9YA 2I2CA 4EI2A 1OSNA 3CR7A 1XMQB 4L3VA 2A1UA 4PSAA 4AC9A 4C4OA 5SV2A 3GFSA 1BE6A 5EEHA 3CEPB 5TPZA 3FHOA 2RI1A 1HH4A 3B1XA 3E9RA 1QV6A 4BLPA 3KOUA 4RVUA 5GJCA 5L3QB 1SOVA 3W77A 3WK7A 3PUIA 1E79A 2A14A 3TZEA 1J9ZA 2WWRA 3IDZA 3S7ZA 2DFNA 3WI7A 5DB4A 4N39A 1BS9A 1FX0B 4YN3A 4C4XA 2RKWA 2P4SA 1JWBB 2NU8A 5ICCA 5CJ2A 2QQEA 2E1PA 2QRNA 2MR5A 2PMFA 4PYQA 3E5RA 3G2HA 4WV3A 1CJCA 1E3DA 1YC5A 2VHUA 2ZTUA 2ZR9A 3OZBA 3DTTA 4K1XA 4UNIA 4QQNA 1YJBA 2B9EA 2J5BA 4P58A 5IXSA 3U7HB 3SPXA 4WZAE 3ZZMA 1CF2O 1HXHA 1XG5A 2HPZA 3JVDA 4JP3A 5ALZA 3R0QA 2GM4A 3VKGA 4ZANA 1PGQA 1A3CA 5EZ6B 4ER6A 4W5RA 4QBKA 2AR0A 4RH1A 5G0TA 3R7WA 5EXPA 5JC1A 5IJAA 1A2QA 4CTKA 4LF5B 3UPUA 1HFJA 1NZFA 5IUJC 2OY0A 1TYZA 4XAQA 2JVIA 2YDYA 3NIWA 3NUQA 3WQSB 3T9DA 1XZLA 3SS9X 2J8ZA 2OV8A 1WSWA 4GWGA 5CLJA 3T3OA 4QE3A 2UYCA 2XOXA 1GPH1 4CLOA 1SPXA 2WJVA 5F1YA 3S55A 4JYAB 1E2LA 1EGQA 3ONWA 2AK2A 4WY8A 1V25A 5KHAA 1FRZA 5J63A 3WX0A 1PG5A 1H4VB 4C4SA 2DPHA 2XT6A 5H7XA 4C0BA 2E55A 1TTHA 4G5OA 3ZWDA 1DC4A 2YXDA 3UJBA 4A16A 5AD1A 4EI8A 1HDOA 3BL5A 2WIFA 5IW8A 1XQYA 1PL0A 3IMGA 2VUSA 2AN3A 4I55A 2XIQA 2ZYAA 3WHIA 2YN4A 2BGUA 1AUOA 2FCAA 2CL6X 1U0RA 2ZJ5A 4U8HA 3IUJA 4LJ8A 5BR7A 3BGIA 4IFEA 1YI1A 2FF5A 3ONEA 3E7XA 3TVDA 3SZMA 1WQ1R 1KZ7B 3HYSA 4AS3A 2XYRA 4CF5A 4YAIA 1GFWA 3CYFA 1BWSA 3EW9A 4XX0B 3ZHOA 1E2FA 2DWUA 4DWWA 5LWQA 1PUXA 1NASA 1TA9A 1VL0A 4KMSA 5LYJF 1I5OA 2HJSA 5LZ8A 3ILHA 1SHLA 3GGOA 1GSAA 3GBVA 3U4MA 1ZD3A 3CZ9A 1P0CA 2O3JA 1LX7A 5EAIA 1ZRNA 4I4TF 5CB4B 1A4RA 4G1VA 1NT2A 5ITZB 3GUZA 3ZXUB 4I19A 3FMPB 3P5SA 1BE0A 2NGRA 4Q7LA 1AQUA 3BE8A 4YRFA 4U7TB 3IO5A 2IUEA 3NBXX 1SZCA 3P9ZA 4QBTA 2H29A 3C7DB 5CK5A 4E5MA 1GL7A 2WWYA 4PG8A 2WHXA 4L4UA 1Q20A 5FPYA 3BB3A 1EX6A 1TU3A 5KIAA 4YPVA 1E7WA 1JEDA 3ONVA 4DGSA 2AD1A 2FGKA 1I1NA 3MT9A 3NX4A 1UQTA 1GADO 5JVDF 1ZUD1 3G2JA 3R4VA 4HQ6A 3VTKA 1GQRA 4Y1GA 5IM4A 3RUPA 4JA2A 4Z49A 1FJHA 1JG1A 5HZHA 4LWPA 4Q93A 4XIGS 1VRCA 1R8JA 2POQX 3K9CA 1H8EA 2RGCA 1L4YA 2E2WA 5CTJA 4Z9FA 3KPVA 4DCJA 5CTAA 3E2PA 5IU6A 1V9CA 4UW9A 2C2GA 2VJLA 5JT1A 3K53A 1CYDA 2OBFA 3FWNA 3GLSA 4LJ5A 4QDZA 1WDKA 4E4YA 1DEOA 2AJ8A 3GJ3A 5E6UA 1Y8CA 4NF2A 2ZUCA 4YCBA 3HEMA 3KB6A 3T5AA 3QK7A 3OFJA 3QLUA 4ZI5A 4LTMA 4DB2A 3AUKA 3QOYA 1QIFA 2G9ZA 3UB2A 3A6JA 1KEWA 5KAMA 2AN1A 4GXRA 1P2DA 2IU0A 2O8NA 5DCLA 3T8YA 3OZGA 5BNIA 1JQJC 2II6A 1MH1A 5DI3B 1NM5C 4R1NA 4EYOA 4XUCA 3HA5A 1KHHA 3I53A 3MK31 2KSQA 4OHMA 3ZGVA 4I3FA 4KR0A 4EJSA 4NZPA 3PEVA 3ZZUA 5K0JA 4JV5B 3DO6A 3DOUA 2JCXA 3RS8A 1E4YA 3G59A 1AD2A 1UKBA 1LH0A 3IAUA 1WXWA 3FKSD 5B64A 2X5XA 3E9CA 3NEPX 3W04A 4DV3B 5B7GA 9GPBA 1J56A 2HF2A 1FTWA 3NHYA 1XMSA 2G76A 2Q4RA 1A95A 2D5BA 2SNIE 3CLUC 4I4TA 4IQ8A 4IIJA 2AJBA 1JDNA 4RMJA 1SBHA 2GB4A 2Q62A 3ESAA 3L41A 4RO0A 4FGJA 2A5LA 3X1KA 3IT2A 4XD7D 5IKXA 1VMIA 3K70C 2GR9A 4IJVA 3RS3A 1HDCA 3P5BA 1DTEA 2VHQA 3QRWA 3T5TA 4KW7A 4R69A 1LSOA 2B4TO 5TMBA 3NM4A 3TCNA 1BQ3A 2WP0A 2ZB4A 4FD3A 4JI3B 4G2TA 3ZIUA 2ST1A 3I52A 5ENZA 5AXCA 4PAGA 4BMOB 2XMGA 2YW2A 1CZLA 3JYQA 3TWOA 2WUVA 2PZBA 3DE3X 3EOZA 3MS4A 4D79A 4HQNA 3ZN2A 5K99A 1F4LA 2F3QA 4MR8A 2XZPA 3GR6A 3BZUA 3CBGA 1R0RE 4B34A 3T1VA 5I48A 4HWRA 5EQFA 4QUAA 1S3FA 2X5NA 1FPQA 4JEMA 5LA6F 3TLCA 1X1TA 5JDCA 4UHKA 1MX1A 2R1VA 1OW3B 3RH0A 1VG1A 1AK9A 3GRKA 3NHZA 4UE6A 3DAPA 2YC2C 4GX2A 3K5WA 3TSCA 5HBRA 5DYNA 3G2LA 2IW3A 4GL4A 4S24A 3T7KA 3OSZA 2P2SA 4DCGA 3PFKA 4A1OA 2LNDA 1M0SA 2UZAA 3S44A 3CISA 3L46A 2VSFA 3TTSA 3WRXA 3TR5A 4AX4A 4L0MA 5ER9A 4AY2A 1TIPA 1VSBA 1C9YA 4J9UE 1PJBA 2WJHA 1ZKDA 1I32A 1L5VA 1IY0A 1C3VA 2V4UA 3D8TA 2Y67A 3NALA 4IZOA 4RACA 2PJRA 2CL0X 2HZ7A 1WSAA 2MMGA 1G2IA 1AY0A 4LYHA 1O9GA 1V8DA 1X39A 2C98A 2VHXA 5HILA 2GZ3A 2J3HA 3KVNA 3UXMA 5I7OA 5AVTA 5LOVF 3SX4A 2OCKA 1NOJA 2WTMA 1H0HA 3PT5A 2WU3A 2Q4DA 3L8CA 4BVAA 5WRFA 2GLUA 3WLOA 1VIYA 4DNXA 5HS4A 5HS6A 4N03A 3T15A 1CZHA 1VKHA 3O1LA 2GWHA 3AI7A 1JQAA 4PC6A 3RBAA 3VV2A 4Q1AA 2I29A 5K0BA 2A35A 3CUKA 2NPIA 3H2YA 4HRVA 4ZP1A 2WSSA 3TZLA 2K7FA 4CIYA 5DRTA 4UOZA 5LQUA 4X6YA 2PD6A 2GRJA 1T4GA 5JSQA 2YMLA 3KSUA 1ISPA 1SB9A 3P0HA 3UJCA 2HU2A 1EVEA 1EK0A 2WNHA 5E6RB 4F3CA 4BRZA 3P9XA 1OYWA 3KQVA 3P97A 4BZPA 1OH8A 5IH7A 5EP2A 2JI6A 5KSYA 3ASUA 4IJKA 2CFOA 1YRHA 5FWXA 4EHDA 3REOA 3GPDG 4YUWA 2GAOA 1OPXA 2OGSA 4KDEA 3RCBA 3ZGNA 4YRZA 1LI7A 3VKHA 4L57A 2BBSA 3ESZA 3NFYA 2PMBA 4KQ9A 4N3CA 5EZQA 1KPHA 2G6TA 4Y0AA 1CPYA 4HLQB 4F2GA 5KYYB 2P1ZA 2A0WA 4PGMA 5CFNA 3P4YA 3KYBA 4R8MA 5GJVC 2I8LA 3C3EA 1EZ1A 1PX2A 1XLUA 5DNDA 5KSZA 2ZSFA 4H1WA 1S9HA 4I5EA 4O4HF 2F55A 4RKQA 1JHOA 5BSUA 2QN8A 2H2HA 4RKEA 3KVYA 2FSHA 1W0KA 2W2PA 3WGKA 2HJGA 5IXYA 1Z2OX 2JFQA 3WKBA 2XTMA 2WICA 1QIJA 4GQAA 1JIIA 3BMQB 4DRXA 1XLWA 4JLOA 3ZVKA 3UCEA 1OZ0A 2AGVA 1T1SA 2VNJA 4IY1A 5FBWB 4DMFA 1E63A 5HFJA 4QKQA 3H16A 1C0LA 1M7BA 3ABZA 3O3OB 1EG7A 2I62A 2JFHA 1DKNA 1GKUB 2NSLA 3FRJA 3H9GA 5DHUA 3PEWA 3BRWA 3ZWQA 1TA4A 1DGQA 1BQEA 4XCVA 3WP1B 1C0EA 5AW4A 5EZYB 2OMKA 3U7EB 1CUSA 1QVVA 3SBXA 2WA2A 4FNMA 4G4SP 3WO0A 4AXBA 1YOVB 5GQSA 2WA1A 4PZ9A 5L3SA 2QM0A 2E0IA 4D3SA 2CD9A 1U2GA 3K32A 4HN9A 2BGTA 4N3BA 5SZIA 2LUOA 4LZZA 2QRMA 2GARA 4DTIA 1TVKA 2H08A 2IS4A 3DLHA 4G24A 4JR1A 3JWHA 4K9LA 3K4QA 2GOYA 1JE1A 3A3PA 4PTZA 4FGSA 4MRVA 4G0UA 3VR5A 4KDFA 3B20A 4AP6A 2J3KA 3URKA 1EVIA 2WJWA 1U11A 2EKDA 2K6GA 5C5EA 1MGOA 1Z2PX 1BO6A 1Z6TA 2YS6A 2RH4A 1RQLA 2WAOA 2XXAA 3GW8A 2D13A 5B3KA 1WU8A 2ZPTX 4ZCRA 4ND3A 2CNKA 3I4CA 5LQAA 2C9MA 1CCWA 4GLJA 1T3TA 4BJ5A 3UFXA 2BUBA 4HNVA 2HK7A 5EXSA 3QHPA 4NBTA 4MPPA 1YL7A 1G16A 4EW6A 1EJ0A 4IJUA 2RIRA 1T4MA 3RSHA 1CY2A 3W1EA 3AVTA 1NVGA 2FEPA 3I0NA 3N8HA 4Y1EA 5E6SA 2IQIA 3ZNPA 4B71A 2CXHA 2DFKB 2GA9A 4IYJA 3UHJA 1AKNA 3QF7A 4M9RA 2R44A 3UGTA 1E1NA 1GSHA 4O4HA 4M88A 3IEIA 5BYJA 3VO8A 4CI9A 1E20A 3U3RA 1UKCA 3EWAA 5TE9A 1Z45A 2GF0A 4C03A 1OQAA 4BVFA 5AQ1A 3KLMX 1X7ZB 2WSIA 4IZ6A 2FSVA 4TS4A 4DSZA 3CEHA 1UC9A 3ND5A 2BMAA 1P7PA 2ZT5A 3P2EA 5KQMA 4UAJA 4JI0B 4FDVA 5TY0A 5KSOA 3O8QB 5BPHA 5DLYA 2QR5A 3GAZA 1EVKA 1UWCA 3L0CA 5DYWA 5C3UA 4DPMA 4RCZA 2IIVA 4MUEA 4PICA 3MLEA 1QO9A 1YI8A 1SURA 3O8BA 4M49A 4X7RA 3BQMB 1RWOA 4OSEA 3IPAA 4HAWA 4HEHA 4IDCA 4RKFA 1JPVA 5FA8A 1KMHB 3I2JA 1K63A 1GZDA 1GCAA 1QC5A 4B6EA 4TWIA 4BBJA 4M8NE 2JZOA 2V4ZA 3FDFA 5AKZA 3EUFA 4A2PA 1NAHA 1QKKA 4DR1B 5AXAA 4N5NA 4G1MB 4G41A 2PDAA 3Q7EA 2Q6TA 3AU8A 4FYPA 2QMUA 2XOKD 4U3JA 3UK6A 4M87A 4MGIR 2O1XA 4TMFA 1XWIA 2HSWA 4OHOA 4GVXA 4CM3A 3CLSD 1WY7A 4FTWA 2H1OA 3Q8LA 1KJQA 2W71A 3D8HA 3GQBA 4R3UC 4HP8A 1VLQA 1TAQA 1MIOA 1FSFA 1IHOA 3BMXA 5A05A 2BEVB 1ZYUA 1K2WA 2IPXA 3SLKA 1P1RA 3ASZA 2PYIA 1I5RA 2VKTA 1R6XA 4MUJA 1XZQA 4PFQA 1FUEA 4BJHB 3HGMA 2WNSA 1PR9A 1N3BA 4URVR 3T4EA 2NLOA 2EBHX 1EJBA 3GYGA 4X3OA 2J7PA 3ANTA 1O9HA 4PG5A 4YQYA 3UJ6A 4QLBA 3CSSA 1E1CA 2H1WA 3SX0A 4QUDA 4O5AA 2IS6A 1U2PA 2NACA 2VTDA 1ZIOA 3O2QB 2G07A 5IARA 1ZUWA 1L4EA 4JJKA 4GM4A 2H2FA 4F4JA 3U5TA 2D5LA 3RAFC 2WSMA 3HUEA 1L3CA 3I9OA 3IXLA 3L5OA 2YWFA 4PEVA 2GVZC 4Z9BA 3QKSB 2WG2A 2ONKA 5FJJA 5J5VA 3KJXA 4P92A 2ZJAA 3L7NA 5ETJA 3N1UA 3DFFA 2G40A 4X6XA 2H4WA 1HK7A 4FIZA 4G9EA 4RZ3A 5DBIA 1XWFA 2BT4A 4W6QA 2XUHA 3TIFA 4TLLB 2GAFA 4ZV4A 2QBYB 2Q4EA 3AQ4A 3Q6IA 1SZDA 4N7JA 2DQ4A 4ZHQF 5KTSA 5LZ4A 1H1DA 2AMLA 3VU8A 2AHOA 4XWWA 2FW0A 5DF1A 2G1PA 4BDSA 3A1VA 4KWIA 3ZH9B 3K0FB 4X6LA 1VJ0A 1YBVA 1NR1A 5ITWA 1QO0D 1EKXA 4NCNA 2FZEA 1WP9A 2VJMB 4LZLA 3SY8A 2JHGA 1MVLA 2HYIC 3UOAB 4RSMA 1IPEA 2ZT6A 1T1RA 2H1CA 3GUCA 3Q2KA 4HH3C 1S2DA 2FDRA 2PX4A 1ZMBA 5JAOA 1P0IA 2IS1A 4RJLA 4N6GA 4NK5A 3QYJA 3IBYA 1F0YA 3ER9A 1LSSA 3AP1A 2PX5A 3AKYA 4CUZA 3KEMA 5LNK1 3HB0A 1RXCA 3NW9A 4QECA 3O1JC 3THWB 4XGIA 2P91A 4IZIA 3N2YA 1VGVA 1V39A 1T9ZA 2PUGA 2EKBA 1U1IA 4MI6A 4B7CA 2QD4A 4D4LA 16PKA 3KUUA 1RPZA 2AEJA 1B6GA 4JLWA 5NLLA 4CM8A 3I23A 1OZGA 3TGLA 1PFQA 2JFNA 3KALA 4KLRA 3CLTC 2IYPA 4G36A 5JBIA 2WE8A 4CKCB 2WTUA 2WIBA 4PHGA 5EL0A 1I7SB 1EP9A 2FN3A 1CIPA 1NVAA 1PHPA 1OYVA 2P41A 2VQSA 3E0QA 4JC0A 2BGWA 2D59A 3U4QA 2WABA 5AJTA 5EIEA 4Y2GA 5IASA 2CLIB 2J9YB 1U02A 2BJWA 3ANMA 1ECJA 4FQ8A 3LDUA 5BYBA 4DJFC 4EDHA 1MAHA 1HPLA 2YYAA 1L7OA 2IYNA 3IUSA 4BAZA 1L5YA 2E4XA 1YRYE 2C84A 1WCIB 5ALVA 2BI8A 4OFWA 1V3TA 4YMTA 1D1PA 1IM2A 1JIKA 2QLTA 1ZL0A 3DCYA 1VECA 5DHAA 4ZGGA 2JI8A 1Z75A 2R5NA 3H0KA 4AJ4A 4O08A 3TCXB 3K35A 4FFVA 3RASA 1IJEA 4CIBA 3EMBA 1EUZA 3TINA 3L77A 3L06A 3CIOA 1JZSA 2XDYA 3SM3A 3H99A 3PTLA 4CODB 2CWWA 2A1UB 1Y3BE 3AL2A 3RVRA 1P5JA 3RW9A 4BNGA 3AM1A 2B6HA 1T9HA 2VP4A 4MB6A 3S2GA 3L18A 4JODA 5IYZF 3TEMA 1Q0TA 4WOPA 2MMCA 2C7PA 1ORDA 3JWPA 3K5PA 4NBLA 1FBTA 4YJHA 5F7ZA 1IDOA 2Y1WA 4P98A 4RTNA 1N7HA 1SXHA 2VQFB 2NP7A 3AZQA 3LDHA 3UMVA 2J30A 1L8OA 2XUDA 3M5CA 4HRAA 2ZU6A 5CFQA 5I7WA 3JQAD 3PKJA 2DLNA 3OWHA 1K3FA 1R12A 2RI0A 4PONA 2QD2A 3KZKA 3TAUA 2VXCA 1ZD4A 3G2IA 4TXLA 4FK8A 5FV7A 3JAWA 4FYMA 3LPDA 4QBGB 7MHTA 2PUEA 1NVXQ 4KBGA 1QRRA 4E31A 1AU9A 2PUDA 4AKSA 3NWJA 1R0WA 1Y0BA 4B3CA 1MO5A 4XKJA 4ND6A 2ILVA 4OFZA 1DRJA 1QP4A 3QKWA 2ZUDA 5D51S 4DB4A 4PAQA 2NO4A 3DWFA 1NKSA 3V8MA 3CVWA 1E2GA 1M6NA 4JGGA 1E4EA 5AOAA 5B2ZA 1GU7A 2CDRA 1TD9A 2ODEA 2F8LA 2HSEA 3DDNA 3R7WB 3ZDRA 2O20A 2VYQA 3HJFA 3VZQA 3NETA 3NPMA 3AR8A 4ZOLF 2O3RA 4EO4A 1RQPA 2VHZA 1K9SA 3O38A 1EEXB 3FETA 5E4YA 3SX2A 3ESDA 3TTVA 2BFDB 2I4TA 5I7AA 2O2ZA 2R11A 2EIXA 1ETUA 2VDPB 1ISIA 1MUUA 1KDOA 4HDSA 2JIZA 3CPHA 4EGSA 3I58A 5TPZD 4L0DA 1ZC4A 4CLOB 2P0YA 2GJSA 3O9VA 1G7CA 1RWVA 2H52A 4CLXA 2CXNA 1TM3E 2OZEA 3M1LA 5LSAA 1JL3A 2A5DA 4GX0A 1IEQA 4H7JA 2GZAA 2VP9A 1V3UA 2IIPA 4WFKA 3P9SA 3WBKA 1IY8A 2VT6A 1E79D 2W83A 5CXQA 5CLGA 4DCVA 2XJ9A 2GXQA 2HXGA 3QGMA 4EEKA 4X1KA 4C0HA 4P4SA 5FTLA 3HGTA 4RYLA 5L7TA 4I55B 4MUNA 1ZOPA 2MT9A 1JSXA 4JBNA 3COZA 4GYKA 2Y0PA 2YXEA 4MDFA 3AEKB 4TL6A 2IY9A 1NBWB 4IIYA 1K8ZB 3HL0A 2I6UA 3QZUA 4IWNA 1GQFA 1EA7A 1WZCA 2R65A 1WNFA 4D5EA 3Q10A 4P6VF 2OHFA 5AKYA 1W5AA 1OZFA 3CIFA 3FSRA 3UGKA 5KWEA 1FW8A 4B79A 3SN6A 3JYOA 2NTNA 4EKEA 1WMDA 1RJWA 4Q4HA 3ETCA 4HBZA 4ZC8A 2EP8A 1GSOA 3DHVA 4BCBA 4L9WA 4UM9D 3EUEA 3I6BA 1NSYA 2PO5A 4C14A 3NWPA 4YLYA 2OV1A 3O73A 4F5EA 3WGJA 1PTJC 4H7DA 1PR3A 4FP9A 3R8CA 4U2GA 4B1FA 1F06A 3K2IA 3WYFA 2GH1A 5I51A 2DE0X 4X5OA 3E7PA 6LDHA 2D0OB 3HCCA 4RD4A 5AW1A 1JAZA 3DVSX 1WHSB 4IXMA 1YZUA 3EEBA 1MQ9A 4PQEA 5E9AA 2JHFA 2NO6A 4I1IA 4J03A 4DM3A 2I3DA 1PUIA 5BQOA 1YBFA 1MJGA 1U7ZA 2X0NA 4E51A 4EW1A 3HCRA 1K5HA 4P7BA 2AYZA 3DAFA 1LUAA 3EXG1 4PS0A 4CPDA 3LUBA 5JQWA 1Y9ZA 1SVIA 1WKCA 3LG2A 5DSXA 1E2DA 1FFAA 3DR5A 4E32A 3NWOA 1ID1A 2C5AA 1SOUA 3B6IA 3AR7A 4QSMA 2I66A 4F8YA 2DLDA 3OIFA 3I83A 2CLSA 1L4NA 3DF7A 4G8BA 3SFZA 4A8JB 4CMAA 3I0MA 3LUDA 3TKAA 4R1LA 5KCMA 1WF3A 4MVJM 1L5ZA 5BV8A 4LCEA 1USGA 4NULA 1O6BA 3TJRA 3CQ9A 1OHHA 2DF8A 3S0JA 1AQYA 1LJ8A 4NQRA 5E6UB 4K9PA 4J43A 4UKDA 2HWKA 1C3JA 2WT8A 1SKQA 5CHEA 4XA8A 4OOEA 1CUZA 2W8BA 5CURA 2FHPA 2QAIA 3SLRA 3ZYCA 2PLAA 3H5OA 3WGQA 5SZJA 1IVNA 1KJIA 2AEFA 3EOAI 1QFJA 1L5OA 2C2OA 4W7HA 5KNLA 3IQWA 2Z6QA 1SKYB 4M0KA 4EJSB 4TZ0A 3O90A 1RYEA 4WVLA 3ABOB 2PKWA 2Q99A 4J1NA 4AVYA 4XWGA 1KDVA 1T8WA 4EKNB 4OQMA 4HYYA 2JASA 3HM9A 1P6QA 1M72A 2C77A 2H7YA 4NPHA 4ETWA 3OLVA 3C74A 2ZG6A 1FB5A 5LYJB 4Y98A 1L5GB 4CE6A 1XA4A 1VMDA 3N8DA 1MZPA 3K96A 1C8BA 2GCIA 3IP3A 4DA8A 2PS1A 1M2KA 2EOAA 4I4TB 3TQTA 1YQQA 1OBVA 3AFOA 3GMSA 5TVGA 3VH2A 3G8YA 3FI9A 4K2AA 1DB3A 3OZ7A 4KIFA 2JAPA 4OTZA 3BTVA 3AERA 1TJNA 3MEQA 4PLWA 4D4JA 2HUNA 3CCCA 3AETB 4R0VA 1M2EA 1RKBA 1W6UA 2VF4X 4LHYA 2IH5A 2DETA 1SG0A 1H8ED 3KT3A 3NHSA 1SCBA 1XRNA 3LY5A 3UFBA 1HOXA 1YMQA 3KR1A 4U2FA 1JT2A 5DOZA 1Z34A 2ODPA 2A9OA 3HDVA 2PH1A 4JVOA 2EARA 4YAEA 4LQDA 5LYYA 2YV1A 2WU0A 3RQSA 2YHSA 4Q9IA 4Z2YA 1OI3A 1IATA 1EJ6A 1TCCA 4PC2A 2WJ4A 5JVDB 2AA3A 3SE7A 2PVCA 4GZ6A 1YHNA 3NBUA 3CO5A 1RAHA 4IEEA 1D04A 2A3NA 4CF4A 4UQLA 2IPAB 4JH0A 4F5YA 1E3WA 2AQHA 4YROA 1BDJA 5IJ0A 3EZYA 3H6KA 4EAAA 3DHNA 5BN1A 2NUPA 4DTCA 1Z5WA 1G5FA 2B4KA 3JYHA 1KVTA 5JD4A 3D4OA 3TIVA 1AZTA 3S2ZA 1Z68A 5F9FA 4BMPB 4BUCA 4BNMA 3DMRA 4UAUA 1Z3CA 3OC0A 4LZJA 4NI5A 3HKBB 5KZMB 1C29B 1N5IA 3BQ9A 3H5TA 1L1FA 2HCFA 5DYTA 4E5YA 2C00A 4ZVLA 4OYLA 3M1IA 3WB0A 2OHGA 4V0LA 1OOEA 4M0LA 2QB5A 3E9EA 2R4UA 5DO9A 4EFNA 1KY2A 1QU3A 3VC1A 2DT8A 2XNSA 1Z47A 2X76A 2I6TA 1AGYA 2W6OA 3ZKWA 2QTLA 4X3CA 4XYLA 1RVDA 5IK2A 1GNQA 3J81k 1QXSA 3UOGA 3ONNA 3F6BX 1XMJA 3HVUA 3MWGA 4MVJF 4Z0TA 4CF7A 5CD1A 1Y8QA 3DLPX 3FCXA 4LVOA 2UUAB 4MVJP 4NICA 2VAVA 2XXJA 1LK7A 1XGKA 3L1KA 4M0MA 5T4HA 2EIHA 2ZXEA 3IDSA 5K4GA 1UKAA 3BULA 3O2NA 5DLPA 5H82A 5DM60 1QK5A 3O3NB 5DCYA 2B4QA 3BL6A 1AV6A 4L5IA 2ZJ6A 1LA2A 2NUBA 2XVZA 1ISMA 3AEUA 4LJRA 1RXEA 3MRVA 3NYIA 2HW8A 3HN7A 1USKA 4OSOA 4RAQA 1V9LA 4YUVA 3DNFA 2C9DA 1K7CA 3L7YA 1W85A 3LQ2A 3PUHA 1W59A 1DL5A 1P4JA 3RUFA 1LDBA 2Z8XA 1PV2A 1OZAA 1JHXA 2RH5A 3ENQA 4GOMD 3WWOA 1DQZA 3BIOA 1GPNA 4BLSA 2VJYA 1EE2A 5I7HA 1EFCA 2C82A 2YHIA 5ANRB 5LMZA 3T61A 1SC9A 5FWXB 1AMOA 1A1VA 4XTRA 2D8AA 4BV3A 2P4QA 1GPUA 3GT0A 1N7JA 4PQYA 2ZYWX 5AM0A 3R7BA 4JVMA 3E3MA 3X1YA 2C4TA 3GJYA 3H6GA 3DZDA 3W9YA 4OL9A 4LW8A 3ZWNA 2PR2A 4FEYA 2EHDA 2PZKA 4HJRA 1ZLYA 5DHQA 3DLBA 1BVUA 2Q6KA 4K88A 4DQ0A 4C4YA 3NGXA 2HSDA 3D3WB 4WKCA 3BQNB 2O0HA 4JEHA 1H9AA 2PKYX 5KNBA 4X20A 2FX5A 3PUJA 2G9QA 4BMXA 1M6EX 3A37A 1Q0SA 4ZVTA 5H3CA 3WWYA 1J8FA 3C6MA 4HGPA 1K7YA 5EE3A 1THZA 5CW1A 5JBNA 3ONFA 5JAIA 2UXBB 3DOEA 2GHQA 1BFUA 1WTAA 3VYRB 1NR5A 5JG7A 4C89A 1MEOA 2QNBA 3GCGA 5E2IA 4DRXB 1VSTA 4ZVOA 5GJBA 2FUKA 3OLYA 1W5SA 3GWZA 4RIIA 3SJCA 1ZWLA 2NU7B 3SHWA 2GRAA 1SVSA 4B6RA 4U6SA 2DKFA 1IK4A 1AE1A 3RYIA 2XECA 5H4HA 5LOVB 1EMDA 4FE7A 4PRLA 5EMHA 1JKXA 1ZD9A 3GFPA 3JQBA 3HEAA 1V1MB 4WDQA 3WNQA 3ESYA 5FORA 4DLPA 1A88A 3L1JA 3R5JA 4G1UC 3QBDA 5A3QA 2PLNA 4J3NA 4ALJA 3O95A 5L3SB 1WS6A 2WD7A 2ZREA 5F77A 4BQQA 2Q29A 1P2GA 3AVPA 5KVAA 1CQJA 2FCRA 3A1UA 3LAWA 2Q9CA 4KK3A 2IIQA 2QZ4A 4DUGD 5C8XA 1J21A 2IP4A 3C14C 1PTKA 2WZBA 1TVKB 1P31A 2NUTA 3RV3A 4NZZA 4D9FA 1ZICA 3G8BA 3GP3A 4FFPA 4ZQGA 4CDGA 4DWJA 5A2QA 3WRWA 3L3BA 3HEBA 1W0CA 3L05A 3SXPA 3ZY6A 2VT7A 5GZ3A 3BJRA 2R4QA 2GEJA 2J3QA 3R7SA 1JSZA 2QXYA 4LWZA 4ME6A 3S29A 3ZGXA 5JSFA 3KUKA 2QNIA 5L6LB 1JEYB 1AM4D 1TQHA 1Y8RA 4GICA 4MQUA 2C8JA 2QMQA 4RDIA 3W1VA 1FDVA 4L5JA 2DQYA 3B1KA 1W0KD 3QPDA 1Q0LA 5CJPA 5DBGA 4HVAA 1U0LA 3UV6A 1XPRA 3THYB 4Q18A 3R3HA 3EEOA 4DQKA 5A1JA 2JFXA 4PLGA 4KZKA 1L8XA 2I7TA 3NG1A 1IAQA 2QHXA 4MPTA 4R8SA 5LQMA 5DCUA 4Y7CA 3FUTA 5KOIA 2W42A 4YBZA 4JXJA 2F43B 2KW5A 3A4YA 4HEA6 2BFCA 4JL6A 1ESDA 4M7PA 1UBEA 4O4LA 1NJ1A 1ZNYA 3WL6A 3BJZA 2H2DA 3CJRA 3M6UA 5JSZA 2FVYA 2XZDA 4TMTA 4FDMA 1A9PA 3SGLA 3MJDA 4O4HB 3VPBA 1KIAA 4NL4H 1IBKB 3S1SA 2X2PA 1KJ9A 4IMIB 2JLYA 2O8BA 1Y81A 1J8VA 5LXTF 1EYZA 3F7MA 2VK8A 3KLPX 3L7BA 3QTBA 3OKAA 1Q1ZA 1Z5PA 1YQDA 2P6RA 1EX9A 2PHZA 3HL4A 1Y4SA 1XAHA 2G0NA 4OA8A 4WOJA 2PPVA 5JS1A 5KU1A 3MXOA 3VR5D 2J41A 2IEAA 2PLRA 1U3WA 4GIBA 4DGQA 5HIAA 1J9EA 3CNBA 4KWCA 1G3IA 1NN3A 1Z7WA 5FTNA 4MPDA 1DEXA 3R6GA 3Q9UA 4YJ3A 1T1EA 2XDWA 3UPDA 1RTTA 1ZN9A 1IZ0A 1NVVR 3E53A 3G0DA 3U7FB 3PPWA 2FI1A 2O3TA 1K27A 4IJMA 3EW7A 3R8FA 4GC5A 2AX4A 1DFIA 1BMFD 1KU6A 4J4HA 4U3JB 4CUKA 5AESA 3ZWPA 3F3YA 2O8FA 3FNBA 2V5VA 4BNJA 2VRCA 2GX6A 3PEYA 1NP7A 1EESA 4QL3A 1MMFB 2WZDA 1E1MA 4N9WA 3TXYA 1UBNA 4M1OA 1SIBE 4IJQA 3AT1A 3BAFA 4C7OA 3GELA 3U2QA 2F8MA 2M6SA 4G1CA 4M9QA 3TQSA 2Q0QA 4C5BA 1A04A 3MUOA 4TXHA 1ESNA 2WINI 4KXWA 2NSDA 4YLEA 1VP3A 4ENTA 1PNVA 1ZR4A 4PQRA 1IZ9A 1E2IA 2VHJA 1VMEA 2UUOA 1VZ3A 4GM0A 4HHEA 4RESA 4WZZA 5EWMB 4X6UA 1TUIA 4BMCA 4Z4EA 1E1CB 5TF0A 1MC1A 2PJDA 3HLTA 2OG2A 2BF7A 2FG6C 4V0MA 3V3KA 2VI5A 1G291 2XCRB 8LDHA 3AFNA 3LQKA 4HMPA 4NK4A 4UVDA 5EMMA 2BY4A 4XCQA 3SC6A 2YWBA 3ZLJA 4MIYA 4W9NC 3JQFA 4D41A 5JFOA 2PUHA 3OA2A 3OIWA 5EFZA 3AZOA 4MUXA 3R2JA 1WMAA 1VCHA 1VLLA 4K6CA 1QTRA 5A7FA 1D1SA 3AHHA 1X0VA 4CT0A 1LPBB 2DTXA 2ERYA 1YJAA 2A9PA 3DZKA 4UCFA 1KK0A 3RK0A 3SD7A 4AN4A 4E5DA 4OX9Y 1XNRB 3ZKAA 1QYWA 2H6EA 2NU6B 2XLCA 2YINC 4QOEA 3VJLA 4DMMA 1GRQA 3I2GA 3RIGA 4R8RA 1UM9A 1WWKA 5BORA 2MSLA 4JDUA 2VP0A 3AI3A 1C1HA 3DOCA 1N4AA 5CDTA 1T6ZA 1HA3A 1P60A 2XYPA 3OICA 4OMUA 1PT8A 5ECYA 3EK2A 2CNWA 3NLLA 2R79A 3A6GA 2M6KA 3GAMA 4X7BA 3TBKA 3WSTA 1U4SA 2XQGA 3PNKA 1DQYA 4LRXA 1AK2A 1QSGA 2O2HA 1AUVA 3PQ7A 4QDKA 1J90A 2QEQA 4ZT7A 3W06A 3MJ4A 4C1BA 7ABPA 2C8KA 1W9HA 4HS9A 5FPHA 3GMIA 5F4BA 2NTJA 1PZHA 3A6LA 1PVVA 2DMRA 4MTCA 3LBIA 3WHLA 3B1YA 1XD2A 4C3OB 1JF8A 2OCPA 3H1BA 1FL9A 1GG5A 3ICCA 4GI2A 2P75A 4QU8A 2ZAGA 1ABFA 2PSSA 1VRVA 3BWBA 3NR2A 3PUYA 3QELB 3QVMA 2BIFA 4RSHA 2ZAIA 1RIFA 1TEVA 3K0AA 1Z07A 3V8EA 2Z8YA 3IUBA 2REQA 4V0OA 1Z5ZA 1Z8DA 4IIGA 3VH1A 3RC1A 2ZB7A 1II8A 1RPAA 2C1ZA 4K0RA 1G38A 1H3EA 2D1YA 2EW1A 3OETA 5FWNA 4GNKA 2YV4A 1PGOA 3PJGA 4NARA 1NW6A 3U4QB 4DG9A 5C46F 1FMCA 3PYLA 1KY5A 1QGZA 1TKAA 4BLOA 1L5WA 2H1SA 2QP9X 2C2YA 3RK4A 1XEWY 2UAGA 4DV6B 2FV8A 4CKBA 4D6XA 2GYYA 4TYQA 2C4NA 2QTHA 3WRYA 4D8WA 5BUSA 1U0SY 3N0VA 2HQ1A 3AK4A 4DY4A 5FA6A 4BO4A 3LK6A 4UUOA 4D9IA 3L6OO 5BSVA 4TRNA 4F71A 1YJQA 2FZKA 4RVNA 5MGBA 4IINA 3K8YA 4IOLA 1QZXA 1HE3A 2GM9A 1Y6ZA 5K3CA 4Q7MB 3G0OA 4OHVA 5JASA 1SBZA 1WV0A 3I2KA 1NUPA 1CUUA 1LLFA 1E3LA 1KAQA 2YWJA 4QTZA 4QDJA 4AMUA 3HRIA 4KR7A 3H7IA 2V9ZA 4ZXPA 1G42A 4C06A 5CLFA 1D6MA 4PAWA 5FLKA 3U17A 4E09A 2EWVA 1F6BA 2Q3LA 3W4JA 1YZGA 4PYKA 4UUAA 3KJNA 2HMUA 4F4HA 5AVRA 4HX9A 4I4CA 4MYTA 4BP3A 3EXAA 4EDFA 5A5VA 4WLOA 3JV7A 2I3BA 3JAWB 4E94A 3K6SA 1DT3A 1NVEA 1N4DA 2BRUA 1UPXA 4FX2A 1UF9A 5HF9A 1KO5A 3DDCA 2PKEA 1ZH6A 1P4HA 2CZGA 4WLFA 4B7ZA 4JBLA 4PSUA 1IVSA 2R6R1 3NUGA 1JXMA 1W5BA 3BOSA 4HUQA 3CLSC 4YPFA 3ZU3A 2R96A 4JBIA 5JIBA 3ZVMA 2FPLA 3TD6A 3QYPA 3CR3C 2I33A 4C7BA 5BT8A 2E9SA 2IHTA 3MTBA 4LOKA 3MD0A 6Q21A 5TJ9A 10MHA 4YMGA 4Q1CA 3T95A 3H87A 3C3BA 3IA7A 1E94E 4V0QA 4EYSA 1ORRA 2QAJA 2MSCB 4HG2A 1PJ8A 2ZRFA 3R3SA 2YC4C 1V37A 5BN3B 1PSZA 3WZLA 1XBTA 1SPBS 4TVOA 3WZMA 3EF0A 4QGBA 3P52A 1XZFA 4HDSB 2P9EA 4Y2VA 4QRHA 3F5DA 1JU9A 1NBEA 2YWDA 1PFKA 4P7FA 4RANA 3JPYA 5TT1A 5EQJB 1E8DA 1UWLA 2LRHA 3KT0A 4FOLA 3CMMA 3FPJA 5ALRA 3RARA 5JXWA 2RGYA 4E2XA 4GMXA 4JI1B 1HKUA 3ZV5A 4RZSA 2OUKA 4C4AA 3U4AA 1N5JA 1CETA 1EBBA 1R37A 1UFOA 3JD3A 4W8GA 4X1KB 3OESA 4R71A 1RJGA 2AXPA 4G97A 2TMYA 4AK9A 4D2IA 1DINA 4GI7A 1N2JA 1Y5LA 1V6SA 5KKNB 3MF4A 1Z82A 3J80A 4QFBA 3ZCVA 1GGHA 3HDHA 5IYZB 5KKCA 1Y42X 3HE3A 1I2ZA 2HPVA 1MOPA 5I8PA 2X7JA 3UKJA 4ZMSA 4U2BA 3DXXA 3E1GA 4NCXA 3EDCA 2XZTA 3Q7IA 1PJTA 2ZJYA 5IDXA 2C99A 1B73A 4KN6A 3FB4A 3GPBA 4C4TA 2V3CC 1U0FA 1IZ7A 3NP7A 2R60A 1F2VA 1I80A 2OT3B 4ASUA 1E3SA 1YZ3A 3DEFA 1E0JA 3E48A 2NXJA 3KU4A 4D9KA 3E5HA 1TJPB 4ILEA 4Q1BA 4BGIA 3NVDA 5KDLA 1PWZA 2CLKB 4J9VA 4JBXA 2BH2A 3UW3A 1AGPA 2JIZD 1P17A 5M3BA 3FR8A 2PTHA 1SCNE 2NV6A 4OJKA 2ZRGA 3IBGA 1OE0A 1OXSC 5K1ZA 4BNLA 4MUBA 1HTWA 1XCLA 1ZNQO 1HQCA 2C04A 2EZUA 4GECA 1MU0A 2X9NA 2AN9A 4RF4A 1F5SA 1U7XA 3BWYA 5EG5A 5IDVA 3REQB 4DSTA 5U4XA 5HK9A 1M2GA 2GN0A 1ZY2A 2KMLA 5B1IA 2A0UA 1KQ3A 4WOBA 4ZAVA 4WERA 3N2LA 4ZODA 3ROXA 3GLQA 1DC8A 3MT7A 4AZWA 1E5LA 3RPEA 3U4CA 2BSXA 3PDWA 1K8RA 2H7XA 1RLIA 2QAGA 2QUIA 4LZPA 3U4DA 3A06A 3M3PA 4BV9A 3KQSA 3LC7O 4MW2A 3GN1A 3F98A 1XTUA 1EUCA 1T8YA 2YXPX 4Q9LA 2JLUA 4ZPXA 3M89A 4JVSB 5IFKA 3ZD6A 2P9BA 1K4KA 4QA9A 4KN9S 4RQTA 1K68A 4NZMA 4EHNA 3ILXA 3FXAA 1NMEA 2P1DA 1V45E 2HN9A 1K06A 3HXLA 3L1HA 5E38A 1L4LA 4YVFA 1D6NA 1DDGA 2IYVA 4MVCA 4PWYA 4YA6A 4AJKA 4EYKA 4ZI7F 3G9ZA 4R4JA 2FP3A 3QTLA 4JBHA 2W2LD 3I9KA 4B32A 2W8BB 1M6YA 2WILA 2Y68A 3L49A 4WFIA 5P21A 3SF0A 3BRCA 3SR3A 3ZQUA 5B4UA 2PE5A 1BX3A 1R88A 2VOJA 3CEJA 1ZIDA 4GD3Q 4KYTA 3VDXA 5K5EA 4NV3A 1N7GA 5EI5A 5DNYB 4P34A 3KR2A 2DUUA 5K6RA 1RRKA 1OBCA 2C9ZA 5L3ZA 1N2GA 2EGGA 1CUXA 1IEVA 1FDUA 1V5FA 1WG8A 1ZIXA 2I4NA 3CTMA 3GZTB 4RVOA 5F2KA 1H93A 1VP9A 4INPA 2DBVO 3JQCA 4P7GA 1C7ZA 4C05A 2AYYA 3WK6A 3QU2A 3IV7A 4EHJA 3MGAA 4LOJA 4MQ6A 4DG5A 3X3HA<