2PZLA

Crystal structure of the bordetella bronchiseptica enzyme wbmg in complex with nad and udp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
310
structure length
310
Chain Sequence
b'SHMRILITGGAGCLGSNLIEHWLPQGHEILVIDNFATGKREVLPPVAGLSVIEGSVTDAGLLERAFDSFKPTHVVHSAAAYKDPDDWAEDAATNVQGSINVAKAASKAGVKRLLNFQTALCYGRPATVPIPIDSPTAPFTSYGISKTAGEAFLMMSDVPVVSLRLANVTGPRLAIGPIPTFYKRLKAGQKCFCSDTVRDFLDMSDFLAIADLSLQEGRPTGVFNVSTGEGHSIKEVFDVVLDYVGATLAEPVPVVAPGADDVPSVVLDPSKTETEFGWKAKVDFKDTITGQLAWYDKYGVTDIFSHLSAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative nucleotide sugar epimerase/ dehydratase
publication title Predicting protein function from structure--the roles of short-chain dehydrogenase/reductase enzymes in Bordetella O-antigen biosynthesis.
pubmed doi rcsb
source organism Bordetella bronchiseptica
molecule tags Sugar binding protein
total genus 107
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pzlA00
2ZB8A 4BNKA 1TLTA 4CMAA 1EK5A 3PK0A 1B8VA 4J4HA 4ZQHA 2Q46A 4J1NA 3C3XA 3GPIA 3PWSA 3EW7A 3HG7A 4EEZA 1Q0HA 1Y6JA 5F21A 3VAZA 4D3DA 2JD2A 4RF4A 1R4NB 3ZU4A 4O0LA 5T8KA 4M49A 1TT5A 4ND3A 2PR2A 3FNEA 5DULA 1A27A 3GDFA 4GL4A 1NBOA 1N7HA 2V65A 1U9JA 4UVDA 3PZRA 4BNWA 3E6AA 1JLLA 1UZLA 1NYTA 3E48A 1LBEA 4QX6A 1KVRA 5CDTA 1U4OA 1ADGA 3TFQA 1NQTA 3F3SA 2X5KO 3ZWWA 1I36A 4KTTE 5JMPA 2Y1GA 5T8KC 3RKUA 3Q11A 4BO9A 4BO7A 1E1MA 2IZ0A 2C59A 2HMVA 3HN7A 3L9WA 3PJDA 3QWIA 1GCOA 4GX2A 3WGIA 3X2FA 3FR7A 3B20A 1PS9A 3PJEA 3E82A 2EKLA 2WTBA 5EESA 1B8PA 1ORRA 2OUIA 3DL2A 2EWMA 1I32A 4I9HA 3N58A 1JKFA 3W8FA 3FPCA 1E7QA 1GPJA 4J0FA 2I3AA 3G0OA 1P0CA 1PZEA 5DN9A 4KDEA 1E3JA 4CM8B 2PNFA 1I30A 3NX4A 4MVJH 5I7VA 2FR0A 3GVPA 3TWOA 1DC5A 1JU9A 1KVSA 3D64A 2X6TA 3TRIA 4DPLA 1YL7A 4LMRA 1PWZA 1S6YA 2C7VA 3HFSA 4AJIA 6LDHA 1KEUA 3NRCA 2BELA 1FDUA 4UEOA 1PJSA 3WS7A 4NI5A 3KHUA 4OOEA 3TL3A 1F14A 1E1NA 3FNHA 4QT0A 2AQKA 4PZEA 2VNSA 4FJ1A 3AUTA 3QVSA 4Y67A 1Z74A 3QHAA 1LDBA 1HSZA 2AQIA 1GEEA 4IDDA 5T6BA 4YRAA 5BSFA 1PJBA 4Z9FA 1KC3A 4WNIA 1OFGA 2EF1A 3L6OO 3C7AA 3KEQA 3ASUA 5IDXA 3VH3A 1SB9A 4MVJA 4J49A 3OIDA 4CV0A 5T64A 5I9NA 4HNGA 3BTUA 4ONEA 3NV9A 3I3OA 4G81A 4J43A 3RUDA 4DIFA 3LT2A 3U9LA 4CR8A 1GD1O 2POQX 3OP4A 5KVCA 1V3UA 3DZIA 3H4VA 4ND2A 4B7UA 2X23A 4E5PA 4BL5A 4GI2A 4D0SA 3L4BC 4L9RA 4JLWA 4II2A 1NQAO 3G49A 3DQPA 2YQ5A 4N18A 2NTVA 3DBRB 3DZJA 3UUWA 2J3IA 3PFFA 3GEGA 3DTYA 5A4DA 5IDYA 4E0BA 4MVJD 1M6WA 2AEJA 4IGEA 2JHFA 4BO4A 3VPSA 1ENYA 4GKVA 2HJSA 3PLNA 5H82A 3HUDA 4UEJA 2RHRA 4CMGA 2B5WA 3JQ8B 3DMTA 4J16A 3D4NA 2J5KA 3S2EA 2E48A 1KETA 2ZTUA 3WNVA 2FZWA 3PGXA 4UEKA 1GR0A 1ZK4A 1KVTA 3OIFA 1SB8A 3DBHA 3NDIA 4AJ1A 3IUPA 1HWYA 2XPCA 4L75A 2AHRA 2Y67A 1ULSA 4B4VA 3DMTC 1HLPA 3N74A 5TX7A 4YRBA 3JQDA 2A35A 5A3JA 3RVDA 1GCUA 1H0KA 1XSEA 3NKLA 1EVIA 2PD3A 1Y5MA 4TRJA 3JQEA 2JCYA 4YAEA 3ZGYA 1YH3A 4R1TA 3WWYA 5HBRA 2F00A 3H65A 4XQ9A 4J1TA 4K1LA 2OP0A 2P91A 4DWVA 2ZTMA 3UGKA 4YXFA 5ICSA 5IZ4A 4BNNA 4C4OA 1NHWA 3WTCA 4EUHA 3PIIA 5JC1A 1S7CA 1CWUA 4LSMA 1VSVA 3ZU2A 4XA8A 1DAPA 3UVEA 3QSGA 4Z0PA 4YT5A 3GN1A 4PG5A 4YB8A 4IINA 1KERA 1EQ2A 1I2BA 4RQUA 3ITKA 2ZIZA 4BS9A 4KUHA 1LC0A 1T4DA 2QYTA 5BR7A 1W8DA 1E6UA 3S1LA 2EJWA 4LVCA 5JPIA 1I3MA 2Y66A 3BXXA 4H15A 4AJPA 3INRA 5G4KA 5FI5A 5DZSA 4MPDA 3JV7A 3DBVO 3D5TA 5I9MA 5L53A 3JD3A 2DBQA 4MIYA 1FJHA 1TEHA 3TZCA 3GHYA 1I3KA 4OHUA 3I6IA 5I7FA 2NU9A 1B26A 2UAGA 3SJUA 4AJEA 1OOEA 2JFHA 1DIRA 1UDAA 1O5IA 2W4QA 3LT0A 4GQAA 1PZHA 1XU7A 3H3FA 1PGQA 5KVQA 1BXGB 4E2WA 4ALIA 1WLYA 1WMAA 1DLJA 3KM0A 1EUCA 3LT4A 5AOVA 1P45A 4FBGA 1KIFA 4TKLA 3P5SA 3DAGA 3INTA 1C1XB 2O3UA 3E5RA 4OGWA 5IJZA 4JBIA 5F1OA 3A14A 3QVWA 3S2IA 2VZ8A 4CMCA 3WICA 3ZNQA 1ONPA 2BI8A 1SBYA 1RM0A 4M54A 5FI3A 4RVGA 4DIBA 5DCWA 1RM5A 4YAIA 1NAHA 1Y7TA 3DFUA 5FEUA 1I0ZA 2PFGA 1DDOA 4ND4A 4MOWA 2PZMA 1ISMA 4IXTA 4JIGA 3BMOB 1FDVA 5JDIA 2FOIA 1DSSG 3GF4A 1HTBA 4GBJA 3AK4A 3E03A 2Q1SA 4CMIA 1BXZA 1B7GO 1N8KA 2FWMX 3KSDO 1YS4A 4D42A 2DT5A 2D5CA 1X14A 4IUYA 2BFOA 3DONA 3MJVA 4AJ2A 3LC1O 3LK7A 3CH6A 4R54A 4J4BA 4HXYA 2ZTVA 2HU2A 4KWHA 3TOXA 1YRLA 4FIZA 1OI7A 4D3SA 5CDSA 4E30A 3CKYA 1BG6A 2JJYA 1MG5A 2IYPA 4TZKA 5B12A 1Q7CA 4R5HA 2EGGA 3WQRA 1H2HA 1QLHA 3FWZA 4ZVVA 4N5NA 5C3MA 2OBNA 4R68A 1NPYA 1GUYA 4JCOA 3OFSA 4CM1A 4XWYA 2XAAA 1NR1A 5JAZA 2QW8A 2GN9A 3TSCA 1QV7A 3HB4X 4GVXA 3DOJA 3BMQA 3Q2IA 1Z73A 4GWKA 1F06A 2A9FA 3G1TA 4NNJA 4J2OA 1DEHA 2VZ0A 1VI2A 4O59O 1DIGA 1KVQA 2Z95A 4H3VA 4A5OA 3PZBA 1QR6A 3PRJA 3TNLA 3KSZO 4RF3A 1AHIA 3A9WA 1E0DA 3ZZNA 4DIOA 2WDZA 4FC7A 5HS4A 3MJSA 1R4NA 1R0LA 4ND5A 4NK4A 5KOIA 3M2PA 5IG2A 5IN5A 4HFJA 4G5HA 5B4TA 2RHCA 1R66A 2PGLA 5JBIA 1UXGA 1CIVA 3IMFA 2G5CA 3UH1A 2EKQA 3R3JA 3WFJA 3I9NA 1NFRA 3COSA 1XA0A 2PZJA 2EKPA 4HFRA 4B7CA 4URFA 3Q2KA 1TB4A 4RQTA 1PS0A 2P4HX 2SCUA 4R16A 2RIRA 4BO3A 1DB3A 1L7DA 4CM4B 5ES3A 4WK6A 3AM3A 1F12A 3FI9A 3JD1A 5L51A 1J0XO 4M87A 2WD7B 3O03A 4NU5A 3T4XA 2NWQA 4RPJA 5JE8A 3W8DA 3PHHA 4E33A 4N54A 4M1QA 3BHMA 4K6FA 4J7UA 2I9PA 2WSBA 5CHEA 5TJHA 2CF6A 4R1SA 1QG6A 4RO0A 4WLVA 5F1PA 4CM8A 3GDOA 3HDQA 1C3VA 1YL6A 2R2GA 2WE7A 5AXDA 1CDOA 3E8XA 4E21A 3OECA 1HYHA 1RPNA 4XIYA 5B37A 4B79A 4PG6A 1K3TA 1NQOA 2ZQZA 4LCEA 1I10A 5A3VA 4L4XA 4J7CA 1I8TA 1H2BA 4DC0A 3W6UA 3FR8A 4CJXA 3GRKA 5EJ2A 4EJ0A 4XR9A 1H94A 1V3TA 2PGJA 3VPHA 2QRKA 1UZMA 3KLMX 4IDBA 5L7WA 1VJTA 3GHHA 2B35A 1ZSVA 4R4JA 5TT0A 1NVMB 2I76A 2JAPA 4XX0A 2B5VA 2X0IA 1E7MA 5U9CA 5BSGA 4L0QA 3P7MA 3ZWNA 3S2FA 2VOEA 5K9ZA 1VPDA 3HNPA 4BB5A 3W4IA 3PIDA 4U7WA 1JWBB 5L3ZA 3U3XA 2AXQA 4J90A 4RZHA 4AFNA 1G0OA 1K6IA 1HT0A 2X0JA 1HE5A 1Q7GA 4UVEA 5JFOA 3Q1LA 4Z0TA 2NQTA 5L95A 1MXHA 4OL9A 3ZWMA 3DZBA 3Q0EA 3JD4A 5G2OA 5GZ1A 1IULA 1H93A 2O3RA 2OMEA 3OQ1A 3E9QA 4AICA 3VH2A 2YHUA 3TZHA 1HL3A 3U4DA 4FJ0A 1PQPA 1MUUA 2VWGA 1SPXA 3HDHA 3DBRA 1VM6A 1ZXBA 2NUAA 2PZLA 4FFMA 4UULA 1AHHA 2VQ3A 3M6IA 2HKIA 4HY3A 3QVXA 5TT1A 2PH5A 2Q1WA 3W6ZA 2X58A 1XCBA 3TZQA 1NNUA 2D2IA 3OEYA 3PI7A 3UCFA 2OHXA 5KJCA 6ADHA 3DXFA 3JQ8A 3PJGA 3KETA 1TT7A 4BO0A 1K89A 3DB2A 4FQ8A 2FN7A 4DBVO 2ZKLA 4KDFA 1WWKA 1IPFA 1YBVA 3PXXA 1LU9A 3S2GA 1N2SA 2GN6A 4CUZA 1C1DB 4NK5A 4J1SA 3JD0A 2FSVA 3RD5A 4DLBA 2IEBA 2LDBA 2C82A 3NGLA 1XYGA 3EK2A 1LA2A 4UUMA 5KVSA 2EJVA 2WWRA 3K2BA 5DCUA 3ZNOA 1SCUA 2PZKA 5HRUA 2HMUA 2IEDA 1FDTA 4YJGB 2OZPA 1NAIA 3UOGA 3LT1A 3WLEA 4IZIA 5JAQA 4BNUA 3MTGA 1LQUA 5JMWA 4IMRA 1EQUA 4JK3A 3ZI0A 4CMHA 1XQ1A 3HADA 5JAMA 5T67A 3ICCA 4CV2A 4S3MA 4FSHA 5GY7A 3UAGA 4JJFA 4LN1A 2TMDA 1I5RA 4Y6RA 5TS3A 2I3GA 4II3A 3C7CB 2I65A 3GY0A 5ILOA 1MFZA 4IJKA 4PLZA 5G0VA 4FCCA 3TOZA 5K0ZA 3Q9NA 5CFZA 4DPMA 2B36A 4RGBA 4BMVA 4YJHB 1PJQA 3FN4A 4PVDA 2YHIB 3JQAB 1KVUA 2E4AA 3TZ6A 3RC1A 2BLLA 2QG4A 1BDMA 2VHWA 1KBZA 2QZZA 1IYZA 2F1KA 4BO6A 1CEQA 3CSDA 2GGSA 2HAEA 3K8ZA 4R1UA 5JDCA 1P1FA 1LLQA 3NDRA 2QYSA 2JHGA 2NTNA 1GYPA 3U0BA 4PLTA 5DBFA 2G17A 2QHXA 3HZZA 2QRJA 4JNKA 3ZWVA 4ALKA 4K26A 2P9EA 1WDKA 1ZFNA 4WPGA 3ZU5A 4BKUA 4D7AA 5ICMA 1B14A 3JQBA 1YKFA 5JDCC 4CLDA 5DNAA 1BXGA 4A27A 1BMDA 3AU9A 3WOHA 1LRLA 1VLLA 2NV6A 4WEQA 1EUZA 4WLFA 5KTKA 2RAFA 3U4HA 1J6UA 3JQ6A 1JQBA 4R51A 1C1XA 5JYEA 5AXAA 4GSKA 3WJ7A 7MDHA 1DPGA 1O95A 2X9NA 3JQBC 1IZ9A 4QFCA 4AJHA 4TZTA 2JKVA 1UP6A 4U8GA 5TIIA 3M2TA 4M89A 3W1VA 2VUSA 4PLWA 3K5PA 3RIHA 4E4YA 2YFQA 2PKQO 2VUTA 4CQLB 3DZHA 3AU8A 3K6JA 3DHEA 2CDBA 1W4ZA 3BMOA 3EZLA 4WGGA 4FB5A 1PR9A 3WSVA 2GD1O 2UYYA 1Z45A 4K28A 3PFWO 4GH5A 4DUPA 4J1QA 4ESOA 1T1SA 4IQGA 4GX0A 1JW9B 1NVTA 2IODA 4RF5A 3CUKA 4WECA 2CSUA 2Q1TA 4I1IA 1ZW1A 4E6PA 4XGKA 5L45A 1LDNA 1ZKMA 3RC2A 1P74A 1FXSA 1ZBQA 4BVAA 1O9BA 3F4BA 1E3LA 2WYVA 4B8WA 1SEPA 4BUCA 2X7HA 5BNIA 4LW8A 4CMEA 2GYYA 4RVDA 2ZYGA 3ITDA 2FR8A 3OJOA 2GZ1A 2ZYDA 3AY3A 4IDGA 2IXAA 2YW9A 3STHA 1NFFA 2NVBA 5DF1A 4ZD6A 1CQJA 4LVUA 4WUVA 4M8SA 1DFHA 2AQHA 4RVHA 5FFFA 4DVJA 3OMLA 1YOVB 4CMEC 1D8AA 1PL8A 3GDGA 5DOVA 1PJ3A 4XQGA 4F45A 1K2WA 3MOIA 1A4IA 3I9JA 4OXKA 2O50A 4IGFA 3GMDA 3K9QO 4W99A 4XRGA 1M76A 1GY8A 4BKQA 1H6CA 3CE6A 2JCVA 2O7SA 3BAZA 4BV8A 1DC6A 1N92A 1X7GA 1YBAA 5L4LA 4JBHA 4EGFA 2D0IA 3MWDB 2J3KA 3KO8A 1UAYA 2QQ5A 3H5AA 1BGVA 4NFYA 4BNYA 3KYCB 2WM3A 2EXXA 1IL0A 3PQDA 4Q3AA 1ML3A 3H9GA 2GERA 2Q2WA 2GCGA 1R4MB 1EFKA 4IDEA 4YTEA 3I4CA 4IJVA 1SZJG 1PWXA 2JCXA 4FW8A 4IDFA 2X22A 2OGUA 3ROQA 3I1JA 4GMGA 1KY5A 4UUNA 4CM4A 3AJRA 1NR7A 3SBOA 5A1TA 2FPGA 1GQQA 2ZCVA 1W73A 2WD7A 5CEJA 4Q39A 4RLHA 4PN3A 1HDGO 2Y0EA 3B70A 3G1UA 4B4OA 2VT3A 2X0RA 4NDNE 5IN4A 3A1NA 5LCXA 4UUOA 1PTJA 3PYLA 1JTVA 3R3SA 3ULKA 5HTOA 4MIOA 3OA0A 4FPXA 4J6FA 1A4UA 2O4UX 2I6TA 4IS3A 1R15A 5DBGA 2LDXA 2VYNA 5L4SA 1WDMA 1J4AA 1HYEA 3FWNA 5IDWA 1X13A 4BIIA 1YBMA 5IAAA 5ADHA 3AI1A 1B0AA 2BKAA 2ZATA 1EDOA 2V6GA 3GG9A 4A7PA 3H9EO 1EBFA 4RVUA 1UXKA 3WMXA 5G4LA 3IOYA 3OF2A 4BGIA 1RYDA 3PEFA 1GYRA 3IAHA 4LISA 1VL8A 2FRDA 4OMUA 3AUUA 5DT9A 2NSDA 1PR3A 1ZVMA 4L4SA 3WLFA 3NEPX 1GUZA 1SOVA 3BMNB 3QWFA 3E18A 3OHSX 1UAGA 3PHGA 2VYND 3EMKA 1LSOA 2UV8A 5DBIA 4E2XA 3EGOA 4BQPA 3OQ6A 2YZ7A 4IZHA 1ADCA 5EINA 4DPKA 3RROA 1NTOA 1G1AA 5CDUA 3E9NA 1IHXA 2TMGA 4BNGA 4WLOA 1WPQA 5GMOA 3WYEA 1R16A 1V6AA 4DTIA 4P4LA 5ITVA 1QMGA 1VKNA 3PYMA 4PRLA 1UP7A 2EEZA 2X86A 3CIFA 3B6ZA 4MVJP 1T4BA 1JA9A 3WR5A 3W4JA 2D8AA 3GZNB 1E1KA 4ZGWA 3U62A 1VJ0A 3RC9A 2GNAA 1EDZA 2OBYA 1P1RA 1C0IA 2UUPA 3E9MA 5JS6A 1TA4A 2RBEA 3RSHA 3ZNPA 4GLLA 1ISIA 5CP8A 4F6CA 1SAYA 1R6DA 2PGDA 3I5MA 3GT0A 3Q6IA 5U1PA 1U8FO 1XHLA 2JFFA 3I9OA 1H6BA 4Q3NA 5BSEA 3FBTA 1C1DA 4E32A 2V6MA 4G2NA 5A02A 4MKXA 3FNGA 4OXYA 1CF2O 4RV9A 4NJMB 5I8ZA 3ANNA 4YCAA 5MDHA 3QIVA 4ID9A 2C2XA 1QP8A 4R41A 1HF3A 3NTQA 4DRYA 4FFNA 4YJGA 3ZW8A 2H1SA 3D4OA 1NPTO 1XLTA 1BW9B 1P1HA 2C7GA 4JQCA 4TQGA 1E3IA 3FD8A 4QO8A 4CPDA 4MKRA 4U6SA 2C07A 1EEHA 3OH8A 5JYDA 1OBFO 1GADO 1X7DA 2X1HA 2XXBA 3WWZA 4JX8A 1DC4A 4AJKA 2VCYA 4OAQA 2Q45A 2VOJA 4GAEA 4YVFA 1XEAA 3CXRA 3U49A 3WJAA 4BV9A 3CZMA 4DGSA 1HDRA 4N5LA 3K96A 3GR6A 1C14A 4ALJA 3RBXA 5JAIA 1MFPA 2D1YA 1F0YA 3F46A 1MG0A 2IRWA 5COQA 3R6DA 3CMCO 4YJHA 4I5EA 1ADFA 1U2DA 2C5EA 2YHIA 3JQAA 3LYLA 4BNMA 2JD0A 4WNCA 4YR9A 1H5QA 4WE3A 4TROA 3WDSA 2DM6A 2A92A 2FMUA 3UN1A 4E12A 1PJ4A 1D4FA 2G0TA 1Y5RA 4BNHA 2X9GA 3WG9A 5JY6A 3H8VA 2DU8A 1GQYA 2CY0A 2AQ8A 3NJ8A 3JD2A 5ITWA 1WAMA 1KS9A 2O48X 4WCDA 1H6AA 2CVOA 4E5NA 3BTVA 1DRVA 1RKXA 1YVEI 2VT2A 1VRWA 3IC5A 3OQBA 4LRTB 4BKOA 1R0SA 4LK3A 4PGFA 2HCTA 4PLYA 2VUUA 3EVTA 1W6UA 5TQVA 3JQAD 1IPEA 1UXIA 5I8WA 3GC6A 5DCYA 1QXSA 2C54A 4JBGA 5C7LO 3DAPA 3JTMA 3GPDG 4NIMA 3QV1A 4AG3A 3NUGA 3DR3A 1E92A 1Q0QA 5EL0A 3DFZA 3NTRA 1B16A 2W90A 2WYUA 1ZZEA 3H5RA 2EERA 4O6VA 3RUAA 3RUEA 3H9QA 4CQLA 4ZRNA 1X7HA 3RUCA 4IIUA 1HDOA 3A06A 4W6ZA 3ASVA 1N9GB 1OC2A 1T2AA 2Q4BA 1E3SA 4IDCA 4J3FA 3M1LA 4QFDA 5I7EA 3PHLA 2Q1UA 2RH8A 2VHYA 4MP3A 4YA6A 1HXHA 4XRRA 3PVZA 4GMFA 2Z1MA 5JDIC 5G0UA 1CQIA 2VHXA 3H3JA 3VZRA 2BD0A 3WB9A 4Q3CA 1O0SA 1YGYA 4IY1A 4NBRA 2JL1A 3I4FA 4YJFB 3MJTA 4RJTA 3VZSA 1AN9A 1HSOA 3JQ7B 4GGPA 2DLDA 4NU6A 4O63O 1D1TA 1RM3A 2WE8A 3PYXA 4IPTA 4PVCA 4YACA 1ZXLA 1KC1A 3JQGB 4WOKA 1QKIA 1EVZA 2Q99A 1GZ3A 1WMBA 2B0JA 3LF2A 4NBWA 3B1JA 4TMFA 3QJ5A 4HBGA 3SLKA 2D4AA 4WLNA 2YV2A 1YOVA 3OEWA 4XKJA 3AUAA 1Z6ZA 5G0WA 5BT9A 2HMSA 1TVEA 4N5MA 2O3JA 2GO1A 4J9UE 5GZ6A 4FOOA 3UXYA 3I9KA 4JN6B 2HSDA 1LQTA 4NG5A 5L9AA 3GGPA 4BB6A 3IUSA 3NYWA 3KTDA 3ENNA 3BHJA 2BGLA 1FMCA 2ILTA 1I3NA 2WJPA 3ZWCA 1QYCA 3GH3A 4EJMA 4FFOA 4BNFA 2AW5A 3KYCA 4YYZA 3G3EA 2Q4EA 2AG8A 1KY4A 4LMPA 2B4TO 3FRJA 1R4MA 2AA3A 3MWEB 4MVJM 2P5UA 4BO1A 1LJ8A 1MGOA 4TRNA 4CM9A 4DYDA 2X8LA 1EFLA 3U4IA 4PLFA 5L40A 4AJ4A 3OJLA 2WD8A 4ALMA 3OETA 2ZJ1A 1A72A 4GWGA 3OM9A 1U5AA 1WW8A 1YB5A 3PPIA 1ZMOA 3JYQA 3W8EA 3UF0A 4BNIA 1ARZA 1EE9A 2G1UA 2Y05A 1DRUA 4P4NA 4RPLA 5A5FA 4D45A 3DHNA 4BNJA 4GVLA 3MTJA 5EQDA 3IDSA 4DYVA 1JAXA 3BHIA 3HE3A 2GR9A 3AI3A 2HMTA 1XU9A 5BNFA 1PGJA 2O4CA 4ZU3A 2BRUA 4R3WA 2DTEA 1PGPA 3UCEA 3EUWA 5ER6A 4B4UA 1U7TA 5TRTA 4HFMA 1T26A 3GVXA 3L0DA 4FFPA 1T1RA 3F1KA 1JN0A 4O1MA 4ZQBA 2NVUB 1HEUA 3ZH2A 1N7GA 5JC8A 2Z5LA 2AEFA 3JQCA 5C5IA 3AI2A 2O2SA 3F5SA 3GAFA 2A4KA 1BSVA 2FZEA 2DPGA 1V35A 4AJNA 1A7KA 1CJCA 4QUKA 2HO5A 3NTOA 1K0UA 3BMNA 5G0TA 5TNXA 4XEHA 1V9LA 1OZAA 2GN8A 3ZW9A 2I67A 3ZWAA 2E82A 4K9DA 3GOHA 4JJIA 2AE1A 3EDMA 4YJDA 3DOOA 4I9UA 3SC6A 4BNTA 2O3TA 2QX7A 5DDIP 4WCFB 4D41A 4WLEA 2C0CA 3WGGA 3H5NA 1DFGA 2HUNA 4ZA2A 3Q9UA 3HDYA 1M75A 1JKIA 3GGGA 2Z1NA 1W0CA 3D5QA 5CDYA 4UUPA 4TRMA 1E7SA 1Z75A 3MJ4A 3NJ4A 2YQ4A 4ZQGA 1DIBA 1NP3A 3GUYA 3GZNA 3M1AA 2HK8A 1K5HA 2BF7A 2B83A 4ITUA 1Q0LA 1KYQA 3DZGA 3AM5A 4Z6KA 3RQSA 5IZCA 1NHGA 1TXGA 2NQ8A 5IXSA 2HRBA 4J2HA 4RLSA 1ZNQO 3GEMA 4BMNA 2PV7A 4WJZA 5JNLA 4CMKA 3IP3A 3V1YA 4X54A 2BHLA 3RFXA 4NFHA 4UVGA 4LGVA 2JD1A 1UZNA 4NZ9A 1KOLA 1BWSA 3UHAA 4A26A 3JYOA 3TPCA 4ALNA 9LDBA 1K6XA 3ZU3A 3RU9A 5JXWA 3LU1A 3V1UA 1FK8A 4WLUA 2DBRA 3HN2A 2Y68A 3E5MA 1A9YA 4ILKA 1OC4A 4MINA 4NJMA 4XCVA 3PJFA 4Y6PA 4ND1A 1ZMTA 3U09A 3PHJA 3QLJA 1LEHA 1ONNA 3OA2A 3SVTA 1PU2A 1XIVA 2CMDA 5KJEA 2V6BA 1V3VA 4D43A 4P22A 1JWAB 3AW9A 1PX0A 2J3JA 4CLEA 4DC1A 1QYDA 2BGKA 1LXCA 4S1VA 4PLCA 1BW9A 1P9LA 3O8QB 3AOEA 4QXMA 2YDXA 4N7RA 4RZIA 2OOSA 3GNTA 1U5CA 1P44A 1LDYA 1CERA 4L8VA 1JKJA 5F5LA 3I6QA 3RUHA 5B4UA 1ZCJA 2DQ4A 1PJ2A 1N5DA 4Q3BA 1I33A 1LI4A 5EERA 4FFRA 4H16A 3IJRA 1EZ4A 3C1TA 2IZZA 5H81A 3FF4A 4IDAA 5T57A 3P2YA 5AXBA 3VVCA 3T4EA 2P68A 5KJ1A 3K30A 4YBZA 4YWJA 3RFTA 1MC5A 3SXPA 2ZCUA 1SO8A 1MA0A 4RPKA 3VKVA 2NU6A 1D3AA 1P33A 2CVZA 3ZWXA 3D0OA 2C5AA 1PIWA 2GRAA 1A71A 2ZQYA 1X0VA 1GAEO 4FGSA 1MC4A 2Y1DA 2FY8A 1GZ4A 4KTVE 5F1KA 4Z3KA 1PS8A 1SC6A 5EIOA 1I24A 2E6UX 2UUOA 2FR1A 3WQQA 3ANMA 2H5LA 2W2LA 4DA9A 4D0RA 1E5LA 1GV1A 3ETEA 1NX6A 1P31A 3R0IA 5TF4A 3ZHXA 4FR5A 1LRJA 2J5QA 2A94A 4I5GA 1I3LA 3KEOA 1ZUD1 5IFLA 3JYNA 4U5QA 1LC3A 5A9SB 1LSSA 3VC7A 1U3VA 2ZB4A 3ZWYA 3RUIA 3O26A 2VWPA 3HJAA 1DRWA 1YQXA 3JQFA 4F6LA 4XYLA 1YB1A 3H9JA 1LDGA 5A06A 2H63A 5B1YA 2W2LD 4QECA 4MVJI 1BXKA 1AXEA 3AFNA 4D46A 5TLSA 4RVFA 4KZPA 1BRMA 2Q49A 4DQUA 5CPBA 1B3BA 3ANLA 3ICPA 4EZBA 1N9GA 2B4QA 2P9CA 3ETGA 3QA9A 2PKQP 1WNTA 3GNSA 4OOFA 3B1KA 1ZK3A 4XR4A 1IE3A 2YJZA 3ONEA 1UR5A 1AGNA 2OO5A 4YQYA 4IQ8A 3TDKA 2XF8A 2CUKA 4W82A 1U8XX 1U7HA 4YJFA 3ZHYA 4EUFA 3A4VA 1CRWG 3JQ7A 3T7CA 4U6QA 1E6EA 4Y6SA 2GF2A 5FWNA 3JQ9A 3DZFA 3JQGA 4MVJF 3OIGA 3RCBA 4DLAA 3K2EA 5KJFA 1ZO8A 2EIHA 1YO6A 3FPLA 3RFVA 3SX2A 4Y8VA 1XELA 4GKBA 4XGIA 1T2DA 3TF5A 1EK6A 4IQ0A 2BI7A 5GZ3A 3KB6A 2VN8A 4E31A 3ZCXA 4TKMA 1LDMA 4UVIA 1J5PA 3V1TC 3C85A 1NXQA 4KUEA 2EV9A 4W4TA 4B8ZA 3RWBA 1QSGA 1E5QA 4OO3A 3ZV4A 3GMSA 2ZYAA 3QVTA 3EVNA 4JJGA 3WXBA 2WYWA 4Z9YA 4CLOB 3WBFA 2G82A 3NGXA 4GPD1 1LSJA 4CL8A 4JP2A 2J3HA 4BO5A 4CMJA 3CTMA 4HX5A 2WEKA 1GQ2A 1LLCA 1MX3A 1Q7BA 4CODB 8ADHA 1DXYA 4XJTA 4YT4A 1O8CA 1MV8A 1WXDA 2Q2QA 1B15A 2QIOA 3FTNA 4MIEA 5TJ9A 1PQUA 4CM5A 4OIMA 2RCYA 4ZHSA 3KZVA 4Y9DA 3W4KA 4GLOA 1AXGA 2AMFA 2GN4A 5ENVA 4BOYA 4HWKA 4DXHA 1VE9A 4L74A 5ENDA 2C2YA 5KVVA 4PLPA 1UP4A 5DP2A 4Q3DA 2H9IA 3AOGA 3NAQA 1HZZA 4R9RA 4RVSA 4HADA 1L1FA 4R9SA 1ONOA 3VDRA 2G76A 2W2KB 1NVGA 4J7XA 1FF9A 3KRTA 1ID1A 1DIAA 3WGHA 3U4CA 2FHSA 2CNBA 3AWDA 3CEAA 3DMYA 3KUXA 3VPXA 2C20A 3BIOA 1XQ6A 2O3SA 2XXJA 1T25A 4NBVA 3AM4A 4U0KA 4E2YA 5L4NA 2VNAA 2EP7A 3LVFO 5AYVA 3O38A 3V2GA 4NJOA 4XIJA 1ISHA 2VTDA 4ZRMA 2GDZA 4MP6A 2NVUA 3PQFA 1GZ6A 1E6WA 3KYDB 5COAA 3GVHA 1FDWA 5K6AA 3VZQA 4AVYA 2HMWA 4PZDA 1SEVA 3IIEA 3VH4A 3A28A 4QTZA 4YDRA 3DO5A 3FBGA 3CINA 3WGOA 3CPSA 4RDIA 4B3IA 5IF3A 2EW2A 3RUFA 1DJNA 4PFJA 5K6AC 2X0NA 4QQRA 1NPDA 4ALLA 5KIAA 4B4WA 4FC6A 3V5NA 5AXCA 3MZ0A 3GVCA 4TSKA 4DMLA 4HP8A 4WCFA 5LDGA 3ZWBA 1LTHR 3OICA 5A05A 2X9VA 1EVJA 2OFPA 1ZJYA 2ZJ0A 2IYOA 1HZJA 2Q50A 4KP7A 3L4BA 1RYEA 3TZKA 4XGNA 1M66A 4KWIA 1GYQA 1E3WB 4KOAA 3ST7A 2ZK7A 1P1JA 3DZKA 4CQMB 5KCZA 1WZIA 3H2SA 1EBUA 3ADPA 1M67A 3KVOA 4WCFC 3MJCA 3SLGA 3ADOA 3VTZA 4L4RA 1A9ZA 1BVUA 1LLUA 3JYLA 3KXDA 3QE3A 3GNQA 3O9ZA 1GFSA 3VDQA 1GUFA 4PIVA 4LSWA 3QW2A 5TGDA 2VYVA 3DC2A 2Y0DA 3IKVA 1Y9AA 5JLAA 5A04A 1FDSA 3DHYA 5JW6A 1VL6A 1DBVO 3L07A 4LCJA 3ON5A 4JROA 4OKNA 4E5MA 4NQZA 3BYZA 3VH1A 1XKQA 2VTEA 1B8UA 3L9XA 3WSWA 4YT2A 5CDGA 1HDYA 1SNYA 1GDHA 3FSRA 3MCVA 2EP5A 3C8MA 4DQXA 4BNVA 4C7JA 4DMMA 4ZJUA 5H83A 2Y1FA 3ZV6A 3Q3CA 3WGZA 1LSUA 2BFPA 2VYVD 3BMCB 2Y99A 3CMMA 3GG2A 2PK3A 2UVDA 4I08A 1O89A 5THKA 4KQWA 1GTMA 2P2SA 2QZ9A 1R12A 4W7IA 3WIEA 5EN4A 4BGEA 1PJTA 3V2UA 4FFLA 1YE3A 2DUUA 3O8QA 3QRWA 1A5ZA 2CZCA 3ORFA 1IY8A 2UDPA 1ENZA 1I01A 2J5RA 3HHPA 1MLDA 2PD6A 3ONDA 4PG7A 3C24A 3WIDA 3F9IA 5C37A 1U3UA 3EAGA 3GQVA 1MB4A 1DHTA 5B4VA 5ER9A 4EEXA 3TL2A 4OKIA 4XYEA 1NM5A 2IXBA 5JCXA 2P4QA 3EZYA 1UH5A 1H6DA 1HDCA 3DOCA 3WGQA 2W8ZA 1LNQA 2NM0A 4BHTA 2HQ1A 2PH3A 2DFVA 1NWCA 4J91A 4BGUA 2Y1CA 4INAA 1EVYA 1UUFA 4YQZA 2PWZA 1Q2XA 3VPFA 1J49A 1Y8QB 3MOGA 2CF5A 4ZQFA 4NHEA 4IJWA 3PLRA 4Z3DA 5C7IO 1N1EA 1AE1A 3VOSA 3KBOA 3GVIA 4IXWA 3WFIA 2D3TA 1PQWA 3K31A 3VHRA 1U2GA 4OM8A 2HJRA 4J9VA 4UREA 3ZNNA 4WKGA 3QWAA 4NMHA 3I23A 7ADHA 5U4QA 2D5AA 1DOHA 2FPIA 4XQEA 3PTZA 3H9UA 1WVGA 4ZQEA 1MXFA 3L77A 4IM7A 4CLRB 3LZ6A 1M2WA 2VRBA 5TSDA 5A9SA 2CDCA 2DKNA 3KSUA 2PA3A 1ZEJA 4FOSA 4OSPA 4CUKA 3QY9A 5L7TA 3CZRA 5AQ1A 1CYDA 1Z7BA 2NNLD 3K73O 1BTOA 1QYWA 3LF1A 2I99A 3GAZA 3MJEA 1Y8RB 4FD3A 4GX1A 1IHYA 4KUGA 1ZEMA 4PLGA 1Z7EA 4HKTA 3G17A 4IS2A 2I66A 3H6KA 3IS3A 4HV4A 1E1LA 2DAPA 4OJNA 1QV6A 3RASA 3INGA 5BQFA 2GZ3A 3ROPA 3U5TA 3R1IA 4A10A 4D3FA 3BA1A 4EYEA 2DBVO 2EW8A 1KEPA 4DQVA 3H7AA 2BH9A 1BDBA 1GV0A 4GX5A 1I2CA 5MGBA 4A73A 1HLDA 4OXNA 3RBZA 3TN7A 3O4RA 3UFXA 4XDYA 2DBZA 2C29D 2HDHA 1JDJA 1RWBA 3I9MA 2DTXA 1YL5A 3ZN2A 2J6IA 1DC3A 4CV1A 3EYWA 4Q3EA 2R00A 2EG9A 1ZSYA 2E37A 3C1OA 3WBBA 5CG1A 1PJLA 4A03A 3RU7A 1Y9EA 4F46A 1VSUA 1XDWA 5THQA 3GUCA 5CEFA 3D3WB 3UICA 1HRDA 3NDJA 4AJJA 1ZK1A 2R00C 1GPDG 4A2CA 2CD9A 4RPGA 3RJ9A 4BO8A 3DBLB 1Y1PA 3IKTA 5A9TA 4YT8A 1NWHA 2E49A 3D1LA 4FN4A 1DJQA 3I83A 3EHEA 3WTBA 1DHRA 1QYXA 4DREA 3GK3A 4JP3A 1HDXA 4CLOA 1PL6A 2X5JO 1RJWA 1HE4A 3V2HA 1PZGA 1TT5B 3NT2A 4J0EA 1YXMA 4XDZA 5L7YA 4PG8A 1HYGA 4OH1A 2BFAA 5BNTA 1EE2A 4W7HA 4BNXA 4IIVA 2YUTA 3ZV5A 4EJ6A 1G6KA 5IXYA 4CLHA 5AVOA 2JAHA 3HQ4O 1YONA 4PLHA 3QVOA 4ROSA 4DBZA 3TQHA 4IMPA 2YFHA 2IZ1A 2Q2VA 4OQZA 1PSDA 3ROMA 2IE0A 3IQDB 2OL4A 3G79A 4G65A 1Q1NA 1YDWA 4H7PA 1YJQA 4MKZA 3L6EA 1AUPA 1HETA 3AFMA 5F5NA 3V8BA 4BMSA 3PP8A 2IDZA 2B69A 2AE2A 1H9BA 3P2OA 2VHVA 2B4RO 2FP4A 1WDLA 1EUDA 4AL4A 2QRLA 1NFQA 1D7OA 2PD4A 4XB1A 2W2KA 5JSFA 1YB4A 3ONFA 4JGBA 4CM9D 3OSUA 1K6JA 2O23A 1PEDA 2X4GA 3WNQA 1F8FA 1X1TA 3KYBA 1C0PA 1E7YA 3C7DB 5CPFA 1ENOA 4OYRA 2GZ2A 3BZUA 3ZHZA 5FYDA 2DFDA 2Y0CA 3FNFA 3FHLA 3ZWOA 4NH4A 2PLAA 1UDCA 3RAJA 1IB6A 3HB5X 5CEEA 3LQFA 3GLQA 3KYDA 4BNLA 1O6ZA 1NQ5A 4R1NA 1V8BA 4LRSB 1X1EA 1PJCA 2HK9A 1XR3A 2H6EA 4TVBA 1P1IA 3HDJA 1H9AA 5T5QA 3VVBA 2DVMA 4EW6A 3QWHA 3F47A 1E3EA 4CLXA 3AY6A 4P38A 1SMKA 5A03A 3ETDA 4UAGA 1ZIDA 1R0KA 3K92A 4Q9NA 3WYCA 4ZN6A 4RL6A 2GUGA 2Y93A 5KNLA 5I9LA 5F3RA 4EI2A 1ZJZA 4R01A 3F6YA 3DDNA 3RBVA 3GRPA 3RJ5A 2FSSA 3AY7A 1ZSNA 3OBBA 3ABIA 1DLIA 3EC7A 2Q3EA 2DC1A 4WASA 5J23A 4P8RA 1XWFA 1Z82A 5EPOA 5HA5A 1XGKA 4YPOA 4NBUA 5BSHA 3LDHA 4XYGA 2AEMA 1HE3A 1HE2A 2OORA 2WMDA 3RI3A 4Y98A 2P5YA 1E3WA 4HUJA 4CQMA 1M6HA 4MO2A 1P0FA 2NVWA 2V6FA 4XJSA 1QLJA 3SEFA 1VL0A 1WP4A 2O2YA 3KOUA 3LC7O 3PDUA 3PWZA 3PWKA 1DFIA 4KQXA 5A9RA 3WQSB 5COBA 4BO2A 4B3JA 2VWQA 1LRKA 1X0XA 3D3EA 4NFSA 4MVJG 2PTGA 2PKRA 1HDZA 4NBTA 3ZDFA 4NR0A 1YQGA 3DEYX 3GA0A 4UVHA 3IJPA 3DTTA 2YV1A 2D59A 3FCOA 4IJUA 4FDAA 2Y1EA 4GGOA 3BTSA 9LDTA 3S8MA 5IZCC 2GASA 4CR7A 3H2ZA 2YYYA 4Z9XA 3WMWA 4K6CA 4AJOA 5I7SA 4CM6A 3PHIA 4CQMD 1WZEA 2FPPA 2GPTA 2BMAA 4BGVA 3DBHB 1QRRA 1IZ0A 3F4LA 3KV3O 4TWRA 4YEDA 3TJRA 1ULUA 2OP1A 3UCXA 5HM8A 2ET6A 4CL3A 4D79A 4YRDA 5KJ6A 2BGMA 3VTFA 5FF9A 4M55A 3SJ7A 1T2EA 1C0KA 1N1GA 1P77A 3N7UA 4P4GA 4WOJA 2J8ZA 4CMBA 4DLLA 3L6DA 4BKRA 1PZFA 4BQRA 3BMCA 1T2CA 4MDHA 3L4SO 3ZV3A 2YDYA 3GN2A 3OJ0A 4CR6A 4A0SA 4MP8A 3LLVA 1E7RA 1KEWA 2AG5A 2YV3A 5HS6A 4E2ZA 2JFGA 3E1KA 2GLXA 3D7LA 2VRCA 4RORA 4RPHA 4J4TA 4XYMA 2CDAA 1YWGO 1LDEA 3FTPA 4L76A 5TC4A 3NT4A 4R5MA 3VKUA 1E7WA 1F17A 4PCVA 3QWBA 4QEDA 3UW3A 2OXIA 1VC2A 3F1LA 4RCVA 4Z0HO 3AOEC 2NTJA 1PGOA 4C7KA 2CFCA 4CV3A 1ISGA 4AJLA 4ZICA 3LSYA 1EMDA 1DAOA 1QYVA 1F8GA 4YAJA 1E77A 3BTOA 1UDBA 4WEOA 4BNZA 2DTDA 1ZK0A 1I2ZA 1D1SA 5KKCA 1ISFA 1U1IA 4I5FA 5KWEA 1VJ1A 1CETA 2ZB3A 3HWRA 4XB2A 4PZCA 5DOZA 2HLPA 4GSLA 3JYPA 2VRCD 3IL2A 4XQCA 5EQFA 1JVSA 4R3NA 2RH4A 1B2LA 3JCZA 4W9NA 1BHSA 3I52A 1P3DA 5G4KB 5JCJA 2O3QA 1Y8QA 1C0LA 3WGYA 4YAKA 5DP1A 4XYBA 3RKRA 5KKAA 5LDHA 1ZH8A 4CM7A 3DWFA 2HK7A 1P1KA 3NT5A 2R6JA 4R69A 4EITA 3GZ4A 1JVBA 2DPHA 2CVQA 1LX6A 4IBOA 4W9NC 4HFNA 5IDQA 2DUWA 4I8XA 4XD2A 3JSAA 1L7EA 1QORA 4I9NA 2NLOA 3EY4A 3PGJA 3LLSA 1UXHA 1ZK2A 4TVOA 1PGNA 1ISJA 3PQEA 2VZ9A 3OJFA 5JCJD 1PL7A 1R37A 1T2FA 4FJ2A 2XOXA 3T7EA 4U0JA 3ZHBA 4CLRA 1NASA 5A5EA 1DO8A 4E3ZA 4MJLA 3GEDA 4EUEA 1OAAA 2NU7A 5HWSA 1OMOA 1U4SA 4NPCA 2BFMA 4F3YA 3VPGA 4JXKA 1Y81A 1X15A 2YY7A 3GFGA 3B1FA 4E13A 1U3WA 1V0JA 3KLPX 1HKUA 2B37A 3QP9A 1GU7A 1VKOA 3ROKA 1B3RA 1XG5A 5EMHA 1T24A 2P9GA 2VHZA 1JAYA 3PDJA 5C7OO 5CG2A 1Y8RA 3C1AA 2PY6A 3ENKA 1TI7A 2Y1OA 4M86A 4TRRA 3JQFC 1YDEA 4O5OA 2HRZA 4OSOA 4PG4A 1IUKA 4FGWA 5JO9A 2V7PA 1GL3A 2W98A 4EBFA 1IOLA 3OJEA 2NU8A 3UKOA 4E5YA 8LDHA 3WGTA 1LLDA 4RDHA 1MP0A 4CUJA 4CMIB 3TFOA 4B3HA 4FS3A 3AUSA 1UJMA 3DAFA 1G0NA 1SOWA 1KEVA 3D4PA 2VWHA 5JY1A 1YJ8A 1DIHA 1ENPA 1RM4A 3F5QA 3I9LA 3SC4A 4BKPA 1BVRA 4PRKA 3GFBA 4HNHA 4RF2A 3MEQA 5ILGA 1U3TA 1ADBA 4XZ3A 2I5PO 3HFGA 5G0SA 4YAGA 2EGHA 3RC7A 2X5OA 4OQYA 3ZWPA 3WX0A 3WYBA 1A7AA 1LUAA 4PLVA 5JO0A 1GEGA 4DL9A 2ZB7A 3P19A 2GSDA 3GGOA 2EHDA 2NACA 4CM3A 3QQPA 4I5DA 4QSMA 4D44A 1U28A 3LC2O 3X2EA 4E5KA 1YQDA 3D3WA 3HSKA 4KMSA 4MVJE 3IP1A 3VZPA 4B7XA 5CAEA 1UXJA 3JQ9C 2O7QA 2NADA 3BMQB 5LC1A 4QO7A 3S55A 2ZTLA 1O94A 4EDFA 3DBLA 4L73A
chains in the Genus database with same CATH superfamily
1E2HA 1X7WA 2ZB8A 4CMAA 1EK5A 3P0RA 4CL2A 2ZVPX 3B9PA 4CF4A 3PK0A 2BUAA 1B8VA 4J4HA 1T2VA 2Q46A 4J1NA 5LQCA 3PWSA 1Y6ZA 3TCNA 4RD2A 2A9PA 3EW7A 5DLYA 3DLPX 4IMJB 1JJFA 1N0UA 3M70A 4KBGA 1YRWA 4TTRA 4QXPA 5F21A 4D3DA 1A88A 4BZWA 3IOMA 3B2NA 3DJFA 4GR4A 4IW3B 2DH5A 2CDRA 4O0LA 1O94C 3K0CC 4RDXA 1D9XA 2H57A 3KZKA 4F60A 4UARA 4QSHA 1NBOA 2ZSBA 1I4OA 1U9JA 2H07A 2JAXA 3G9QA 3O74A 4IRMA 2XVXA 5DK6A 1W30A 3GRFA 4NOMA 3HYLA 4R6XA 1ADGA 2VSNA 3O2SB 1KORA 1O94D 4G0XA 4ZI2A 4KPYA 1X1QA 4J07A 1BDJA 2J67A 2XBMA 1UIMA 3P8ZA 1B42A 1M1NA 3PX2A 4B4DA 5JNWA 2IQIA 4KTTE 3HBMA 3FOFC 3O4JA 3KE8A 3Q11A 4BO9A 1MAWA 4XDHA 2AG0A 2CZQA 2HMVA 3L9WA 4ZAYA 1GCOA 2ORIA 2W83A 2VP2A 3B20A 3E82A 3F6BX 1AO3A 3FKSA 4ETWA 2WTBA 4Y2SA 4PHTA 3UG6A 2R6ZA 4PCLA 2FOLA 5CYFA 1ZD3A 4FBMA 2F17A 2G04A 2VJQA 3KPYA 3N58A 4DB4A 1E7QA 1YT5A 3E22A 1GPJA 4JI1B 1C7JA 4G25A 1Z26A 1H0RA 3G0OA 3ONVA 1GUBA 1SIUA 1GGVA 2OQVA 1JLHA 4UAUA 1VGQA 3CJQA 1HZZC 1JR3A 1G5TA 2Q3JA 3ZOZA 1FFBA 2MR5A 521PA 2PNFA 3FIUA 2ZS9A 1I30A 3AFHA 3FWHA 3NX4A 4C0XA 4C05A 1R0YA 3GVPA 4QQFA 5BN5B 4KRFA 3OE4A 1Z2EA 3D64A 4F71A 3TRIA 5GONB 4GXQA 1QX4A 2HQSA 3FKSD 1F4VA 4EATA 1H2EA 2X4IA 3HZOA 3O94A 4UZEA 1P2VA 1DKUA 2ODQA 2WG0A 1H9CA 3VKFA 4UHCA 1OV4A 3VTKA 1CQXA 1FDUA 1I1QB 1PJSA 4JBWA 5BQ3A 4JD5A 4NI5A 1AZSC 2QSJA 2OMKA 4K6GA 4MQLA 4NV1A 1S0UA 2DP4E 1JR3D 4PZEA 2F55A 3IVMA 4FJ1A 4JJEA 2RMKA 4L9AA 1X1DA 5IBPA 5JQGF 1TMKA 4H7IA 3D6AA 2GF9A 4G01B 2AQIA 4IDDA 4EAAA 5T6BA 2WAYA 1RPTA 1PJBA 2NTEA 1XD9A 2CXPA 4EUNA 4QOEA 3L6OO 4WNIA 1DBRA 1PQYA 3C7AA 1CF4A 3ASUA 3VHLB 3VH3A 3BK2A 1SB9A 3F6PA 3O3CA 3R4CA 3UY4A 3W5VA 5EZQA 5JZBA 4TS9A 1MEEA 2QN6A 3GLTA 2XDAA 4K9RA 4H7EA 2JGAA 3SSMA 3I3OA 4HN2A 5CBKA 1GILA 1IN5A 2F64A 4J43A 4DIFA 2RHBA 4EB3A 2PZ8A 1KQGA 3U9LA 4A6XA 3NHJA 3P0HA 1ZDMA 2WVGA 2C88A 3L7IA 3OEEA 4HDAA 5JXIA 1W25A 4ND2A 1BMTA 1DAFA 3QU5A 3TLBA 3FNIA 4GI2A 3PR1A 3TQSA 1S5PA 3DD5A 4G36A 4JLWA 2ONCA 5CH3A 4FTWA 4AYXA 2CV1A 3DQPA 2J3MA 1YQEA 1Z6QA 3H5TA 3HGMA 4N18A 4WW0A 2J3IA 2VHTA 3W7AA 3GEGA 4EO7A 1BYIA 2J32A 3U7HB 3OZEA 4KO2S 2H5JA 3K4PA 4QTYA 5D8DA 1SU4A 4QC2A 3LNCA 4GKVA 5TXGA 4EB0A 5HNKA 4M1WA 1L7BA 1XJWA 2CUNA 4IP0A 3D43A 3IT3A 3HUDA 1A9SA 5ARBA 1X42A 2HA6A 1GGHA 1EEXB 2B5WA 4J16A 1RDFA 4F72A 3OEED 2E48A 1RR6A 1ZITA 3EVAA 3S2EA 3ZCSA 4M0UA 1E9CA 1JG1A 3I30X 1KETA 4H31A 4CKYA 4L5JA 3WNVA 3NXSA 1BOFA 1GR0A 4RY9A 2HSZA 2V59A 5AM1A 2ZRCA 3LBFA 2QQFA 5CH5A 1P6UA 4GQBA 4I55A 4QJ4A 1DBPA 2CKDA 4E7PA 5CFLA 1YZVA 5F7OA 1CB7A 4WL0A 1Z5WA 4RTJA 5IH7A 3AHEA 4ZCMA 1IXYA 1Y1QA 5JHHB 3MTQA 2Y67A 3H2BA 1ULSA 4B4VA 1XWIA 4R8VA 4R8SA 3PCTA 4ZIRB 3EGDA 3C39A 3URMA 2CJXA 4ITRC 3VMFA 1JB1A 2VP3A 3ES9A 3EBPA 4ZJPA 1SCUB 3RVDA 4E46A 1AQ6A 1H0KA 4XH9B 1XL0A 2OO7A 1VCOA 2PD3A 3FNBA 2APJA 1Y5MA 1E4EB 5CJJA 4GNRA 3JQEA 3WB1A 4QPCA 4B75A 4C7OB 1D2NA 4CGZA 1YS1X 1Q0ZA 1NYQA 2OV1A 1A95A 3LCCA 3N2GB 4GC5A 2F00A 1QBKC 3H65A 1R74A 1KDPA 1BROA 4GDFA 4XQ9A 4AX8A 3C3WA 4J1TA 5CFNA 5FUWA 2OP0A 3LYUA 3LY5A 1YZFA 2PGAA 5KHLB 3KHKA 3SQWA 5IZ4A 3RB8A 1H22A 3FHJA 4BEBA 3AVXA 2EYQA 4EUHA 1BKDR 1PUXA 1QGYA 3CLHA 3U9TA 3QSGA 1S7GA 3L7OA 5LQJA 2H08A 2GAAA 3GN1A 3HMQA 4PG5A 3TX6A 4YB8A 3A32A 4EARA 2DWOA 4D5EA 2X4DA 4IGAA 2I4TA 1Z0FA 2ZIZA 4R1MA 5IH3A 2MU1A 4ACBA 4NFLA 3WQBA 1LC0A 2WOOA 2REQA 3KAJA 3BK1A 3IURA 1H5NA 3DDWA 4KRGA 5FAKA 4DSOA 1I3MA 2Y66A 3BXXA 5K0SA 1QDEA 5TF0A 4AJPA 4EVSA 2DQYA 3INRA 3G5MA 2VG8A 5LBTA 1WY7A 4IDQA 2R8EA 5A4AA 3JV7A 3UJHA 3DBVO 2IK8A 2XCTB 4GMXA 3JD3A 4MIYA 4BVBA 4LE0A 1I3KA 2WKSA 3LX8A 1P5ZB 5I7FA 4H6PA 4FE4A 2X77A 3IR7A 2FPUA 3LZCA 2CFOA 3BFPA 3G8CA 1UDAA 4LYGA 4KMMA 2FWIA 4E2FA 2F43A 1FNBA 2QLBA 3FZEA 3LT0A 3OTQA 3I1YA 3FIJA 2HNAA 3H3FA 4H1VA 4LAFA 2CE2X 3G8YA 4B40A 2F7SA 1PGQA 1U2GC 3T52A 5E1BA 3LLMA 4X1IA 3DE0X 5ALEA 1JDNA 1DLJA 3C45A 1BQ3A 1P45A 4FBGA 1O8BA 2YRFA 5H70A 3P5SA 5T4BA 2H4XA 1UMKA 3IODA 4CT0A 1W36B 3IIJA 4OGWA 4KSCA 3BD9A 4X3CA 4AJ9A 3AG6A 4UM9B 1KJQA 3DW1X 1FW6A 3S2IA 5CDFE 4CMCA 1MIOA 1ONPA 5CLLA 2PUBA 2WJVA 3JWPA 1OWLA 1Q7TA 4M54A 3EYAA 4MVWA 2DHDA 2BFWA 4V3BA 5TQ0B 1DQYA 1Y7TA 4FYIA 4LHEA 4E1BA 5FEUA 2E21A 1G59A 1DDOA 3NV7A 3KFVA 4ND4A 4UJ5A 2IOQA 4RTRA 2PZMA 3U19A 3BFVA 4F85A 3BMOB 4ECEA 2GA9A 4HDKA 5JDIA 4JI3B 3GF4A 3N2ZB 1ZD9A 4QODA 3LP6A 2HPHA 1YZGA 5K8CA 4CKEA 1BXZA 1B7GO 2A84A 2GM4A 3K20A 4RNCA 3HR8A 3KKMA 2FWMX 2XZOA 4Y7CA 3RKSA 4HN4B 2KJQA 1XEWY 4A0HA 4D42A 3N8IA 4D9FA 2DT5A 1FDRA 1MTZA 1ESDA 2R8ZA 2W6QA 3FPJA 3I2YX 4EA6A 3NIBA 5IFKA 3ZK9A 4BKMA 1H4SA 1PT8A 5CRIA 1P91A 3CH6A 1Z6XA 4Q1BA 3ND6A 1DINA 1CLUA 3O1LA 2BGRA 5CDSA 4C7VA 3UM9A 5FBWB 3BH6A 1OU0A 2E1RA 3CKYA 4KNVA 1A0OA 5CNMA 2XY4A 5DB4A 3R76A 2H54A 121PA 1JQJC 2IYPA 3H97A 3U3JA 1JU3A 1CUDA 2OBNA 2P1RA 4ZI7B 2OPHA 2V0CA 1V43A 4CM1A 4D8XA 2XAAA 1NR1A 4BWFB 3P2JA 1AZTA 4RWZA 3FAKA 4EKDA 3VJRA 4GVXA 2ABWA 5DYWA 2H1CA 3D81A 3D7RA 4DM7A 2VF7A 4EFDA 1DBIA 3G1TA 2BPOA 5K8TA 1DEHA 1M1ZA 1EFRA 4O59O 1DIGA 1WD7A 4GOXA 4L5IA 1GGJA 3GBPA 4LK2A 2EQAA 4QRHA 1QR6A 2IXEA 2ENUA 3SXJA 2VXOA 3KSZO 3TNLA 4K0KB 4AZ3A 1Z25A 3A9WA 4O3MA 2HHAA 1E0DA 3AKYA 4YREA 4WN9A 4M7OA 5F2OA 3X1ZA 4DIOA 2WDZA 5I3ZA 3U6BA 2R7LA 3MJSA 1R4NA 4DY4A 4L50A 4ND5A 2J0EA 5I6DA 3D6MA 5IG2A 1K5PA 1QWSA 4HHEA 1TO6A 2GS9A 4HTAA 5B4TA 2GBLC 2XT0A 1R66A 3EZ9A 3PF9A 4AAYA 2BEVB 1OASA 2JFQA 1UOQA 2OHJA 3KEMA 3UH1A 1L5WA 2ZSFA 1AKRA 3WWEA 1EZZA 4FT4A 1NFRA 4HFRA 1EFRD 1XU4A 2AMVA 2JI7A 2PZJA 1W6RA 3T7JA 3IQZA 5DTJA 4ARUA 5J2UA 2ZJYA 3WJ2A 1HPLA 5H4HA 1UBUS 3OO0A 4GGMX 4RKQA 4DOMA 2PL1A 3U1BA 1FSGA 3CKMA 4Q6WA 1IZZA 2HWUA 2PX4A 4R16A 3Q12A 3PC8A 1QFMA 4BO3A 1L7DA 4CM4B 2P9YA 5ES3A 4M83A 3PGLA 4WK6A 3AM3A 1F12A 3UA3A 4PRZA 2HNKA 1UWCA 1GZ5A 3R5SA 3OZFA 1IG0A 1J0XO 4RQAA 5KAPA 4NU5A 3T4XA 5CDFA 3D7SA 3WVNA 5B3AA 2NWQA 3IEIA 3R8XA 4Y2UA 4A1FA 1YK0A 1NYLA 2B3DA 1G66A 3I2FA 3PHHA 4PZYA 2YIDA 1BWQA 1H1DA 5KX5B 4M1QA 4F9FA 6REQB 4J7UA 3UK6A 3V8VA 1NMZA 1UPFA 2VF8A 3PC8C 3FPGA 3R6LA 5F1PA 2Q9CA 1R0BA 1EVKA 4L16A 5HGJA 3IEVA 1UDXA 3O84A 1YRQA 1P17A 2X76A 4G4GA 2R2GA 5FUMA 1CFJA 1F8YA 1X80B 3E8XA 4MUFA 1E59A 5AXDA 1K6EA 3OECA 3K4HA 3UFBA 4E21A 1HYHA 5ITZB 4B79A 1K3TA 2H59A 2ZUUA 4HWRA 1V41E 2PU7A 1M3SA 3G8AA 4QLAA 4RC9A 1JYFA 4HAZA 2IHBA 4M1MA 2AR7A 4L4XA 1XDZA 4MWTA 1EYZA 2Q5HA 3RYCA 1I8TA 1IBKB 5SY6A 4GPBA 3MGAA 2ZYHA 4OX9Y 1FFXB 4CJXA 3L4KA 3BD7A 2D54A 4ZEOA 3LVBA 1H94A 1F7VA 5JPCA 3VPHA 4IVPA 1UMDB 1R6UA 3BWVA 2Q62A 3TB4A 1I7LA 1UZMA 2EZ9A 4IDBA 4PZLA 2Q07A 1RXVA 2GHTA 1T3TA 3QITA 2VC2B 4EYQA 1Z2PX 4NLLA 5TT0A 3WKBA 1MEOA 3HB1A 4GLBA 1KEZA 2ZIXA 4P5EA 3RFUA 1ESZA 1E7MA 1BXRB 2X0IA 3DTVB 1QAMA 4L0QA 5BSGA 1AURA 1GG2A 5CLJA 1P2FA 2VOEA 2G36A 4MGHA 2VPZA 5E95A 1VPDA 2GNOA 2QTTA 3QZUA 4BB5A 4IKPA 1E64A 3DP9A 3KQPA 3G2PA 5J4LA 4UM5A 1ZD5A 2F1OA 1TK3A 4RZHA 1AJEA 4KK4A 2ZVQX 3NAZA 1K6IA 5IYZB 2X0JA 4H1WA 1Q7GA 4UVEA 1GU1A 2BDEA 1QFXA 2BTOA 4G26A 1WVIA 3DZBA 1PT5A 5GZ1A 1AQUA 1IUPA 2O3RA 5D1HA 1E61A 1JP7A 3IA7A 3E9QA 2C03A 3OQ1A 1X38A 3A10A 2QS9A 3OPYB 4O29A 4OHCA 2MSLA 4U7TB 2LGJA 1YF3A 4JAVC 3ZHVA 4FLEA 2DKOA 1JHDA 3QW4B 1NG1A 2C83A 4LXIA 2VWGA 3RO7A 3R2JA 3VZDA 1SPXA 2AH5A 1FS4A 2I1LA 3AEKB 2ZYSA 2IP2A 4YPFA 1EU1A 1NP6A 1VM6A 4AIRA 3PQ8A 3TVTA 4AY5A 1OF1A 3G9TA 5HCIA 5I47A 2VQ3A 1DKRA 3NYIA 5EZ5A 3M1IA 3T99A 1RQRA 3W6ZA 2VDPB 1XCBA 2JS7A 3TZQA 3JQRA 5BUQA 2QE7A 3OTWA 3PI7A 3QEKA 4KOEC 3UCFA 4RZ3A 4DNOA 5KJCA 1YBFA 2YHAA 3JQ8A 3QOWA 6ADHA 3KETA 3AR3A 1I7PA 2R8RA 3W2EA 2FN7A 2X2PA 4P5PA 4DRXA 1T0JB 3HDTA 4BMDA 2AW3A 3L4EA 4F11A 5I48A 1WU8A 3K2QA 5DSTA 1LWOA 5F1YA 2WYHA 3HU5A 4D3YA 3GLGE 4QFMA 1JEOA 1C1DB 4NK5A 4RZUA 3AUYA 4X8MA 3T3PB 1YB6A 4C1BA 4KPUB 1QOQB 4WZZA 3PD1A 3QF4B 4DLBA 5IAEA 1T8UA 3RTDA 4JV5B 2QTAA 4KR6A 3EK2A 4UE6A 4PHCA 4MQ6A 4AYTA 2CVHA 2PN1A 1LA2A 1JPUA 3DCIA 4NC9A 3UMBA 3IVXA 2WWRA 1IXSB 1P3Y1 2EBFX 3CX7A 2C8KA 1J97A 2QE7D 3RVOA 1HEIA 4QUEA 1FDTA 1H1LA 3B53X 3UOGA 1X9GA 3MJDA 1YZNA 3WLEA 1Z13A 3LKDA 4BNUA 4MV8A 5HE8A 1Q11A 2FSHA 3X1DA 3AF4A 4X60A 2GB4A 5FTNA 3BWDD 3P9ZA 2YY5A 3HADA 4QXQA 4R0NA 5T67A 4IVNA 4BLSA 1Y5NA 2VKQA 3QYJA 1RIIA 4FSHA 3UAGA 3SXUA 5GOZA 2ZU0C 1AK9A 1MRZA 2IYLD 2JI9A 3SIPA 4Y6RA 4WTOA 4YRZA 2CJPA 5HRAA 4DLUA 4F5ZA 3L84A 5ILOA 1DT3A 1Z38A 2B0CA 4O2AA 3CLKA 3OFKA 4X6XA 4TYWA 3R4VA 2OXRA 3K9BA 4DILA 1G5IA 2IPXA 2Y71A 4TV9A 3TOZA 5KSYA 2GUWA 2R1VA 4MS1B 3M5CA 2G06A 5HQ3A 2O2GA 4KQMA 2QTNA 2ORYA 3M83A 2O8EA 4IX9A 2C00A 4CTJA 1O87A 4BMVA 1G38A 1MJHA 1MENA 1MW9X 1O7JA 2YVUA 5EIBC 4ZMBA 1QRTA 1E6KA 2YHIB 3JQAB 1KVUA 2Z04A 4GZ6A 3AILA 3BQ9A 1GTL1 2BLLA 5JQGB 3O1JC 1XP5A 2QAJA 5AUPB 4RCYA 3USES 2C78A 3L7MA 2H18A 2VHWA 4BJHB 4B3SB 1IYZA 3GARA 4BO6A 1UFRA 1E3MA 4DLVA 3PQ5A 4UTPA 2GGSA 1TMYA 4P5DA 2XQKA 1S4QA 5JDCA 3HABA 3EARA 4X8LA 4Q21A 2BKXA 2JLCA 2WD9A 3SEZA 1U1FA 2JHGA 2RG7A 3EG5A 4UUBA 5FEMA 4PLTA 4CI9A 4YDQA 2WA2A 5DBFA 1KJJA 5HJ5A 2QHXA 2ZSAA 1BCSB 1IFXA 1D2MA 2QRJA 2VTVA 4URVR 4AQDA 3M3PA 3TUIC 5JAPA 1WDKA 1ZFNA 2NT3A 2IHUA 3CISA 5AKXA 4Z4EA 2X5XA 2VP9A 4CLDA 5JDCC 3ZTYA 2FSUA 2Q6OA 1AMUA 4A27A 4BEVA 2NV6A 2IWRA 1PQ4A 2BT4A 4WLFA 2JHCA 2WWIA 3GL9A 2RAFA 2JBAA 2NGRA 3OZRA 4MAMA 3OQVA 5CNJA 1J6UA 4LIPD 4XUGB 4QD3A 4ZZ2A 1C1XA 1QVVA 2V8BA 2HC9A 5AXAA 4GSKA 7MDHA 3V46A 2D13A 1AA6A 3QJYA 4I4NA 2VCEA 3QM1A 4OBBA 4DKXA 2YC4C 2PAFA 3F6RA 4BX2A 2H2GA 3R9XB 1UP6A 3NHSA 1YQUA 1BS9A 3RIXA 3C5WP 4DV5B 2X2FA 4ZAGA 5TIIA 1XZQA 4BFXA 3PENA 4HXEB 3UATA 4ZTZB 1Y4DE 1KSFX 2PKQO 2IS2A 3Q40A 1S02A 1XHEA 5DV9A 5LNK1 3D59A 4REQA 3UANA 4EL0A 3PGA1 4F4UA 2FZGA 2PKXA 3ZXIA 1MMFB 3WSVA 2QI9F 3GI1A 2FU5C 3I8XA 4JYPA 1FFYA 2DWCA 1NQWA 1TAQA 4IIBA 1NBWB 4GH5A 3TEMA 1T1SA 2CMGA 4GMHA 2R65A 4GX0A 1JW9B 2ZBGA 2B92A 3GRYA 1K9VF 3HCPA 3MILA 2Z43A 3CUKA 1NJGA 5C46F 1TCBA 3I3SR 3MJRA 2ZDHA 2Q1TA 2ZIUB 3H1EA 4UXJA 1ZW1A 4MSUA 3AR8A 2A1UA 3TMKA 1HOTA 2G9RA 4B3CA 2DSNA 2CBXA 5ECWA 4G0YA 1FXSA 1HUQA 1TU0A 3R24A 2GPAA 2HR1A 4C06A 2UVQA 4BVAA 5ALRA 2VBFA 3F4BA 5KAMA 3ZXSA 4BUCA 5IKOA 4ZCRA 4X7MA 1UPAA 3ZX5A 4LW8A 4CMEA 5B7GA 1C9YA 2IYNA 4QATA 3VKWA 1AIPA 1N5RA 1W4CA 1DI0A 3K0KA 4FNGA 4UZSA 4OHXA 2FR8A 3OJOA 4DHEA 2XE4A 2ZYDA 3FYCA 2F67A 2QRHA 4YFVA 1FFAA 1GTVA 4P7FA 5FNVA 4F2DA 2W2XA 4ZD6A 1QHEA 1CQJA 4LVUA 3QX7A 4AMVA 1XQXA 1JSZA 4M8SA 2OXFA 3GCZA 5IVDA 2AQHA 4AKEA 2QK4A 5FFFA 5LFAA 1YOVB 5CR9A 1XROA 2Q9UA 3EDCA 1U28C 3VX3A 4CMEC 1XNQB 2V0GA 1D8AA 2XNKA 2ECOA 2EJUA 2V7XA 3D8HA 1FL9A 3AKCA 4XQGA 3FB4A 5CX1A 1K2WA 1L4BA 3ROGA 3V3TA 4F45A 3OOSA 3A2LA 4E6EA 3GMDA 3K9QO 3R3HA 2FR8C 4HYYA 4W99A 4WBSA 5E6UA 1M76A 1GY8A 5HZMA 1SD5A 3AV0B 2O7SA 3EQ7A 4MQEA 3RVRA 1CQWA 1DC6A 1V4BA 2ZIVB 1N92A 2QVZX 5L4LA 2BJVA 5JJBA 3HBLA 3WKCA 4DLSA 4PGMA 3FOCA 2QWXA 1UAYA 1C41A 1BGVA 1FE8A 3OOWA 5KSWB 2ZR9A 3KYCB 2QW0X 2WM3A 3UHPA 1DBWA 2OCGA 1JJ7A 1MJ5A 3FAZA 1E20A 3CEMA 1EFPB 3HLKA 4I1VA 2GERA 2O2HA 2Q2WA 2Q28A 3AR4A 4NZNA 1XNRB 4L9SA 1CHDA 2PGNA 2G88A 3B51X 1CEXA 3QUSA 2CL5A 3H2KA 2FXIA 2IC5A 2ICAA 2J0SA 1UBFA 4D9JA 4CTNA 4ARZB 4QPDA 4AUNA 2CHGA 2B2CA 1N1MA 3I1JA 3NWOA 4MR7B 4QUHA 1GT6A 1NR7A 1Z4JA 5ANRB 4KAXA 2FPGA 2ZCVA 1OFVA 2NYAA 2QVBA 1XF1A 5LSAA 2HI0A 1E98A 1E62A 2VH2A 3QG1A 4QYTA 5CEJA 4Q39A 1CJBA 5FA5A 5TGTA 2QX9A 3K9FC 1HDGO 1CIJA 4L02A 4OLHA 5AJXA 4B35A 4D8YA 4DLKA 3P9PA 5K4GA 4B4OA 2X0RA 5LB2A 2A3RA 2I71A 5IN4A 1WEKA 1T8RA 1F2UB 1MX9A 3WWCA 1IVNA 3A11A 4YGXB 3ODPA 4FPXA 2FN4A 1BEEA 1A4UA 2AN4A 4J6FA 4LZJA 2Z4SA 5DBGA 1GU0A 5L4SA 3A9UA 1J4AA 5K0TA 1MOQA 3M6UA 1HYEA 5JROA 1X13A 2C5BA 2R68A 1AG9A 1Z2AA 2CD7A 5ADHA 1B0AA 3OC6A 4HWPA 4XUCA 1HO3A 4TWAA 1XB2A 1EDOA 1WXWA 3GG9A 5TARA 4Q1CA 4I4IA 4A8JC 1JMVA 1EBFA 1TFUA 1PR1A 4RVUA 1MN6A 1NXOA 2AK2A 5IVKA 4U63A 4B6RA 5K99A 5G4LA 4BGIA 2GXAA 2JGDA 1QF7A 4B8YA 2BHRA 5JJ5A 1USVA 1GNLA 2JEYA 5J4HA 3ZDDA 5FLKA 3IAHA 1VL8A 2NZXA 3AUUA 3HP4A 5IJXA 2H2HA 1QBGA 3HH8A 4F4DA 1TRHA 1F0KA 3WLNA 5SICE 3WLFA 3HVUA 3UXMA 5HIIA 3KYJB 2ZVDA 2Z8ZA 1UAGA 2QN2A 1J06A 4DANA 4I1RA 4MA5A 3HY3A 2GPBA 3WK8A 2ODAA 3R0QA 2AG1A 3HJNA 1YU9A 2GZAA 1E2FA 2O6LA 2YZ7A 1RS0A 2ZYTX 3OT1A 4IZHA 4MR8A 3FFBA 2H52A 4MUNA 4P83A 1SU6A 2R87A 3G2NA 5AVTA 4HWSA 3AJ8A 4JZYA 1ICEA 1YA4A 4V0SA 1QUFA 3UWMA 1L3BA 1H2YA 1RWOA 1SD1A 1Z6YA 4RY8A 3I32A 2XZLA 1R16A 4DTIA 3NVDA 4HQNA 2PS1A 3HCOA 3RYIA 1QMGA 2QJOA 3PYMA 4PRLA 1V3QE 2O9JA 5FBQB 4A91A 1UP7A 3I04M 1MD9A 1AZWA 3PQ7A 4RJLA 4I81A 2M1ZA 2FUNB 1ST3A 3CIFA 4MVJP 5H68A 4DUYB 3E3AA 3G9UA 3PXUA 4K1XA 5CFMA 4XTRA 2WJAA 1OXUA 2KBEA 2D8AA 5AKLA 5DTMA 1VYHA 2IY7A 4FM9A 2G40A 2YFKA 1R2QA 4URXR 4OFWA 1OWNA 3A4IA 4A5SA 2WIDA 3MW8A 2GNAA 3IPCA 1U0LA 1EHIA 1CY6A 4F2PA 3L8HA 1C0IA 2CBZA 3TE6A 3E9MA 3NHMA 4ENUA 1T9AA 4YP5A 1AY0A 3ND9A 4GLLA 4TLLB 1OFHA 1NXVA 3GQBA 5KTSA 1JG3A 2SKCA 1SAYA 3EMDA 3GP3A 1R6DA 1XEXA 3RRXA 2BI4A 4RE5A 3G0DA 3D6VA 1T0BA 2GXQA 2DJ5A 2H3EA 2ZULA 2AC4A 3CJRA 4PSAA 2JFFA 2E7ZA 1H6BA 3B48A 4F3TA 1W1WA 1WW2A 2FPOA 3N2EA 4ZO6A 3ROXA 1R0CA 1TZ2A 3E1GA 3OX3A 3VR2A 4E32A 1Y9ZA 4IO1A 5KNBH 3M6AA 3R6GA 2FZKA 2WF7A 1IK6A 2BJWA 2I6UA 3ANNA 1G6HA 2PUEA 3H1AA 4R1QA 5H3CA 1X1RA 2C2KA 2PANA 3QFCA 1ETUA 4R41A 3PQ3A 2MINB 1WCIA 3NC4A 4MIKA 5HF9A 3T3GA 4DRYA 4NNPA 2KWIA 3L79A 1RHRA 4KQIA 5FI0B 4GP7A 4BQFA 2IOYA 1QWOA 1XLTA 3D4OA 1C8BA 1BW9B 2UZ0A 5C53B 4LUCA 5A0FA 4QO8A 3FD8A 2H1FA 2G3YA 4CPDA 4DDWA 5HM6A 1MJGA 3HEMA 4GZ5A 5AHWA 1U81A 3VR2D 1GGNA 4ND8A 3V34A 3UGTA 3RRNA 5IC5A 2XXBA 1ZN7A 4B83A 5BSTA 4POOA 4AJKA 4LFAB 1MB9A 1A5TA 1NW9B 4LDNA 2Q3DA 1VECA 2Q45A 4M9QA 4OAQA 2XWJI 5CVTA 1A04A 5JS8A 2PMCA 1F4PA 1FX0A 3CZMA 1E94E 3EAFA 3K96A 4OUDB 4PINA 4URWR 1NVDA 5EEHA 5L3VA 5C2JB 1C14A 5KWVA 3K72B 3SNHA 3TFWA 4PS1A 2BFCA 2GARA 2O8VA 5DT2A 3NRBA 3R6DA 2G4LA 3NTVA 4I5EA 4MLCA 1W5EA 4TL7A 3KPWA 5FTMA 1RLTA 2WJHA 3OZCA 4RADA 4ENVA 2DR2A 2NU6B 4TROA 3U3MA 1SIOA 2QRVB 1EINA 4BMPB 2ZUWA 3LXMA 5J4YA 4BNHA 1YR2A 2HCJB 3KJQA 3WG9A 3IEXA 3GLGB 2WABA 4EKGA 1FVXA 2BTEA 2HH9A 2CY0A 2AQ8A 3NJ8A 1TM4E 5FIUA 5IRCD 3JD2A 2CWWA 2C04A 1Y1TA 3WLHA 3ELUA 4F5DA 3N53A 2O48X 4WCDA 3A0UA 2JFVA 1D9ZA 1RKXA 4YRRA 1FBTA 2ANCA 3BGIA 2VT2A 3CVJA 3LCVB 5IJ9B 1OJLA 4AKIA 5FP0A 2D0DA 4PLYA 5C8VA 1K4YA 3EVTA 2BDTA 1YZTA 5TQVA 3IPXA 4XCXA 4F6RA 1KYVA 1VYVA 3W78A 4CE6A 3H05A 3IDOA 4R2HA 3ELDA 1UC5B 1V26A 2CLMB 3TRKA 4KLNA 4RD6A 2C54A 4Q4CA 5FWAA 2NSJA 4DMRA 4PPNA 2XWSA 3F7NA 3RBAA 3UJCA 1T9BA 2G08A 5DHRA 2QGFA 4D9KA 3DQZA 5FX2A 2YX1A 2W0SA 3IB3A 5JS7A 2XVAA 3JZAA 4NONA 4OGGA 1WUYA 1T6BY 3NUGA 3OJXA 5KHOC 3DR3A 1E92A 2QT0A 5J40A 3LT5A 3ZV7A 1GNRA 1XFAA 3KDPA 3GJZA 1E6MA 3CWZA 2HLHA 2OCXA 3C8HA 4XSGA 3KT6A 5EVCA 3BDIA 1FA9A 3EXFB 3VNSA 5LJIA 3W2TA 3H9QA 4AZ0B 2WBLC 3RUCA 4IIUA 3TAUA 2Z6UA 4CN9A 3R20A 2QVGA 3D2BA 4LSGA 3M1LA 4EHJA 3BCSA 4L72A 3I5YA 1CUSA 2VPTA 3IRVA 4Y9SA 4YA6A 4JYBA 2B3TA 4GMFA 1EGHA 1XJ0A 4BLOA 4BNDA 3SIRA 3H5IA 4UXHA 1QMPA 3H3JA 1F60A 3C6BA 2DFNA 4OP1A 1RRKA 1YIDA 4Q3CA 3UWOA 5C5EA 1KBOA 4FYWA 1ACJA 2OAEA 3I4FA 5KKNB 1FLNA 1SK8A 1SURA 1TZKA 2ETXA 2XCLA 1HSOA 3O3NB 3JQ7B 1KMIY 1P7CA 5EMMA 3UOAB 4O63O 3D4LA 1QDLB 4FNOA 4DSNA 4O5AA 2WE8A 4DCTA 2JFPA 1H0SA 2W11A 4IPTA 2ISCA 1XP8A 2IU4A 4JP5A 4PPFA 4PVCA 1GTJ1 4UTXA 3OZDA 3JQGB 4WOKA 4M0KA 4LYAA 5JQWA 1G2IA 1GZ3A 1RYHA 2AFIA 2J5BA 2W00A 2FWAA 4NBWA 4PAGA 3COWA 3EC1A 1JR4A 3DOUA 4TMFA 5ALPA 3LDAA 3M5DA 3QJ5A 1J99A 1O5TA 2XKAA 2D4AA 1VLJA 4BVGA 4TS4A 2VF2A 3MMPA 2O8BA 3REFA 4D2IA 1PKEA 2RKBA 5D00A 1HC7A 4RAOA 2VDUE 2AUTA 4QT4A 4EHIA 3CS3A 1JWLA 2AC2A 4J9UE 1BWRA 1TM5E 3RRMA 2J4FA 2V58A 4K0RA 4TSFD 3WB0A 3R7NA 3ISJA 3HVKA 3NYWA 3H11A 3NIGB 4WZ6A 3V7UA 2AJTA 3IUQA 3BHJA 2HA7A 3B52X 2ILTA 4KPFC 1JIQA 3CY6A 3ZWCA 2N47A 4H35A 4DLYA 3MWDA 4UDXX 3GH3A 4Q19A 1TC1A 2R6FA 1EHYA 3F5MA 5KYUA 4XUEA 2RGCA 1DDGA 3DUFB 4LMPA 2OQIA 4IGKA 3V42A 2AN5A 3ZVMA 1W9HA 2EX1A 1NIPA 3T7IA 1R4MA 3MWEB 4B2IA 2XEDA 4BO1A 2FUG1 4BN5A 4ZTUB 3JY6A 1LJ8A 1MGOA 2PT6A 1MABA 2ZGVA 3A1WA 3CURA 4G6ZA 4EMTA 4HDCA 4DYDA 2X8LA 1EFLA 2WU4A 1ADJA 4AJ4A 1RTKA 3OJLA 4B3DA 1GSOA 1NOKA 1NW8A 1PDWA 2WD8A 4GWGA 4RABA 1F8UA 1QJ4A 1GARA 5J2TA 3SGLA 1QQ6A 1Z3CA 1ZMOA 4BNIA 3UF0A 2QF7A 1IIBA 2NTYC 5KTTA 1N78A 4Q4AA 3WWDA 4MGIR 3TUZC 1PP4A 3A04A 4N6OA 4P4NA 5AVKA 1VHDA 3OCUA 3BREA 2CHUA 4FOPA 4NPHA 4C6HA 1OTXA 5F4BA 1OZHA 1TTTA 3VMMA 3ZUGA 1Q3KA 1T0UA 4OYYA 4OI1A 2W71A 5LQDA 3RODA 3BHIA 3HE3A 5AKJA 3SC2B 3W9YA 5KNDA 2FDCA 2Q3FA 3HJFA 1XU9A 2J87A 2YJTD 3FETA 4G4IA 2BFDB 2O4CA 2QUIA 1T4CA 4PQYA 5TS2A 3UV3A 2XQIA 1C5KA 4C2UA 1U7TA 3GRRA 1KGDA 2RHWA 1R8JA 3GVXA 4ZOCA 3T95A 1EIZA 3BXHA 5AKZA 3TPZA 2C4NA 1T1RA 2O2DA 4FGUA 1JN0A 4FYKA 2HMYB 4JXXA 4AKGA 1C3XA 1V5FA 2IEIA 4YNBA 5EEGA 1HE1C 5JC8A 3DVAB 3S2YA 4AECA 3USZA 3B36A 4LXHA 3L4JA 2CXHA 3F5SA 3GAFA 4S1WA 4ZV9A 4MYUA 3FROA 3HA2A 4FGJA 1COZA 1CR1A 4ZHQF 4KGDA 4QUKA 5KNDD 3PB3A 2FUEA 2HO5A 1CUEA 1ZGCA 4TUYA 3PV0A 5G0TA 2B30A 3M5WA 4DMUB 3O0TA 1XZCA 5TNXA 4W5RA 4HLDA 3U5ZB 3A7DA 4XEHA 1OI3A 1PO7A 2AZTA 3RU2A 2ZJ4A 3DULA 2I67A 5FPSA 3ZWAA 4ZV7A 3D6HA 3D6FA 4U8HA 3FLBA 3ZY5A 4I9UA 4M6WA 1E8MA 5AO9A 2O3TA 4FEEA 4ZI5A 4I3HA 5I5EA 2RBKA 3HS3A 4RH0A 3STVA 5CVCA 2C0CA 5JJCA 3WGGA 2C3OA 3FHTA 1Q5PA 3H5NA 1L1EA 2HUNA 4J0JA 2BSXA 1NVKA 1IEVA 2JAUA 3GGGA 2O7RA 4DIEA 4L28A 3P2IA 3PDWA 1BZYA 2WMYA 3IV7A 3RV4A 4L4YA 2O2ZA 4BWVA 5BWMA 3ISTA 5SZJA 1BQ4A 4TRMA 4XAQA 4BZQA 1KEKA 4MV9A 1NA5A 2JKYA 4UMDA 2YWXA 1FP1D 4DB2A 3QEMB 1ABFA 1RADA 2HK8A 3KIPA 3BSWA 4G9EA 2FEXA 3LFUA 4AU1A 4TMVA 5LZ2A 3GFOA 1DQRA 4PNPA 4YRQA 1KYQA 5F73A 4LDAA 1GSAA 3AM5A 4R6WA 2GTPA 3ETJA 1NHGA 3NB0A 4B5LA 1TXGA 1YMVA 3ILSA 3EF0A 4QOHA 2H4JA 4DMCA 5IXSA 1J8FA 1EM8A 4BMNA 1KGSA 3WO1A 4AD8A 2IYTA 1UKAA 3DLIA 3QUQA 4UVGA 1J2TA 2JD1A 3KALA 3PFNA 3KQNA 1J24A 3O9MA 3FCUB 1TJ4A 4A26A 3I6MA 1KI6B 2O2JA 2PJDA 3ZHUA 9LDBA 1K6XA 3U16A 5M3BA 1S2GA 5BPFA 2QN8A 3NBKA 2B94A 3C14C 5DWVA 1FK8A 4G9BA 3NC1C 2GT1A 5B64A 2I1WA 1EK0A 1I4TD 3CRMA 2OYRA 4JXZA 4LMAA 4ILKA 4MK4A 4O2BB 3A4NA 3I28A 3PJFA 4NJMA 3W2IA 4ND1A 2E9SA 4JYAB 2CLOB 1YJXA 4X1OA 2R44A 3WK6A 4F12A 4S0ZA 2WWFA 4G4SO 4BBAA 1PU2A 2H1WA 4WBNB 1ODJA 4DZRA 4N5DA 2Q5QA 3DZCA 1NU6A 1KRXA 4DC1A 2J3JA 4DUZB 1XNJA 1U94A 5FL7D 1O97D 4XFDA 2GTIA 1UKCA 2ZSHA 4HLQB 3O8QB 2RSLA 3GRCA 3GCWA 4FVTA 4LOAA 3IJ5A 1F2VA 1VPLA 5F23A 2ZI4A 1Q19A 2V5UA 1LJLA 4JASB 5H0IA 3MCZA 1L7VC 4EJFA 5JS2A 2CBGA 1LDYA 1E5XA 4L8VA 1D4AA 3TNYA 2ZPUA 1EKXA 1I33A 1LI4A 1N6NA 2C98A 3E3MA 1O6GA 4Q93A 4J76A 5DH9A 3IJRA 4YAOA 1OX4A 1PRYA 2QV0A 3OTIA 1ZH0A 5H81A 5T57A 3BOSA 2Y77A 2QDKA 3P2YA 2REOA 5AW7A 4Q16A 3CR8A 4AMBA 1TJYA 2X13A 2HY7A 3VVCA 5DGTA 5LOVA 1FYDA 4U7PB 5C4IA 2JH8A 3K30A 4YBZA 1IOWA 1W93A 1V7PC 3WA6A 4FYYA 3KZCA 4LJ5A 4XCQA 1N5OX 1C9NA 2NAFA 3AF2A 3Q2OA 3G0CA 4P36A 3LUHA 3QYAA 4K87A 5EZYB 3ZPXA 1EM6A 3I5UA 4CDMA 2FRXA 2GRAA 2ZWOA 2ETVA 3E84A 2DFLA 1MDFA 4BDTA 2FE1A 1GAEO 4JS0A 1M8JA 5E6RA 1T6YA 2GH1A 3S2SA 5CNIA 3O8DA 4Z3KA 1PS8A 3W79A 1MVNA 2R4UA 4XX1A 3I62A 5TPWB 4AKSA 5EIOA 5F2EA 2E6UX 2UUOA 4I8IA 2R7MA 9ABPA 1JHVA 3ANMA 3WNZA 3S1SA 5ICGA 2PLWA 2W2LA 1A9QA 4YCLA 3THXA 2QT9A 4X84A 1P31A 3GWZA 4HR7A 2PCLA 5JRDS 3P9YA 1Y0BA 2J5QA 4KN9S 5CVVA 5K1ZA 4YV2A 2BGIA 4ZDJA 2MCFA 1YCHA 4I5GA 5CFQA 1BE0A 3V00A 1ZUD1 1ZD4A 1SGWA 2H3HA 3LBHA 4U5QA 3TVDA 4EFMA 3I8SA 4MCAA 1UZUA 3EDQA 2ZTSA 4U7HA 4JB0A 4LFCB 5K03A 3NATA 2O6HA 2C77A 3ZWYA 1NF9A 1QIJA 2YY6A 2RFLA 4OI2A 3RUIA 3R0JA 2OYSA 2R96A 4QPJC 3H1GA 1JR6A 5A06A 1BGWA 2W2LD 4QECA 1Q14A 4MULA 1XZKA 1IN7A 3ORSA 4MVJI 4RY0A 1AXEA</