2PZLA

Crystal structure of the bordetella bronchiseptica enzyme wbmg in complex with nad and udp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
310
structure length
310
Chain Sequence
SHMRILITGGAGCLGSNLIEHWLPQGHEILVIDNFATGKREVLPPVAGLSVIEGSVTDAGLLERAFDSFKPTHVVHSAAAYKDPDDWAEDAATNVQGSINVAKAASKAGVKRLLNFQTALCYGRPATVPIPIDSPTAPFTSYGISKTAGEAFLMMSDVPVVSLRLANVTGPRLAIGPIPTFYKRLKAGQKCFCSDTVRDFLDMSDFLAIADLSLQEGRPTGVFNVSTGEGHSIKEVFDVVLDYVGATLAEPVPVVAPGADDVPSVVLDPSKTETEFGWKAKVDFKDTITGQLAWYDKYGVTDIFSHLSAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Putative nucleotide sugar epimerase/ dehydratase
publication title Predicting protein function from structure--the roles of short-chain dehydrogenase/reductase enzymes in Bordetella O-antigen biosynthesis.
pubmed doi rcsb
source organism Bordetella bronchiseptica
total genus 107
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pzlA00
2CMDA 2Y0CA 2YHIB 3UN1A 5L40A 2AQKA 2Q46A 2EIHA 4CLOA 4CLXA 4PG7A 3OBBA 4UEKA 5A3JA 3GVCA 4H15A 7ADHA 2H6EA 1HF3A 1U3VA 4D0RA 5KVCA 4E5YA 3KRTA 3AFMA 4E21A 1VM6A 5HM8A 1C0LA 1DIRA 1ZW1A 4N54A 1XEAA 1JAYA 5TRTA 5ICSA 4B3JA 3PLRA 3TFOA 1JWBB 4XDYA 2HLPA 2IE0A 1T1RA 1XSEA 3U0BA 3GG2A 4DMLA 3IMFA 4F46A 4ZICA 1LC3A 5H83A 3VPHA 4E30A 2YV1A 1TI7A 2BI7A 2X9GA 2GRAA 1IYZA 3OSUA 3WDSA 2UDPA 4PG4A 2QRKA 3HJAA 1T2DA 3GHHA 5ENVA 4KTVE 1EQ2A 4XDZA 4IDDA 4HX5A 1P31A 3RASA 4IXWA 3PQEA 5F1KA 3TRIA 5DF1A 3GT0A 1E92A 2HO5A 3IKVA 3FRJA 4XKJA 3G3EA 1V35A 3LC7O 2FPGA 4G5HA 3VH4A 1E5LA 4OOEA 1DIBA 3FD8A 3U3XA 1MC4A 1P74A 1X13A 4EW6A 3WMXA 4FOSA 4GX0A 3NX4A 3PYLA 4BNNA 4Z0PA 4LSMA 4BIIA 1JA9A 3DBLB 1KEWA 5HS4A 2ET6A 3FR8A 1DC6A 1WW8A 1XU7A 3OP4A 1YXMA 3WR5A 5C7LO 1Q2XA 3VZPA 4YYZA 2HMTA 4C7JA 2PA3A 4MVJP 4OGWA 5DBGA 5TF4A 4YPOA 3D0OA 3H5AA 5KWEA 1BXGA 2VRCA 4CV0A 3KSDO 2DU8A 3RWBA 1GYRA 4IJWA 1E7WA 1K6XA 2OHXA 2C2YA 5F5LA 2W98A 4IBOA 2ZQZA 3K2EA 3PK0A 3H2ZA 1WDMA 5DT9A 5IDQA 2J3JA 1ZEMA 3QWAA 4TKLA 1QYDA 1U28A 1H94A 2I99A 2ZTUA 5T64A 1TT5B 4IIVA 3SX2A 1MXFA 3AU9A 1JVSA 3K92A 3WGZA 3OQ6A 3LK7A 2VTDA 1KEUA 2IZZA 2EP7A 1UR5A 1NM5A 3R3JA 4RJTA 2JCXA 4YJFB 3JQFA 4EEXA 3I9OA 4K26A 2X6TA 3ZW8A 3PQFA 1PR3A 4J7XA 3TFQA 4B3IA 3HFSA 3ZHBA 4U6SA 1EUZA 4OQZA 1A4IA 3W6ZA 1WAMA 2B36A 2HMUA 4IMRA 4MIOA 4UULA 5IN4A 4BS9A 9LDTA 5EQFA 3UUWA 1PJTA 3ZU4A 1I36A 2OO5A 2O3TA 3L6EA 4NH4A 5U9CA 2AEFA 1NQTA 1FMCA 2PKQO 3ETGA 1LXCA 5I8WA 3TZCA 1DHRA 4BNHA 1CETA 5BSFA 1EVJA 4E5PA 3K6JA 1VL8A 3NT4A 3KZVA 3CINA 4RVGA 4QEDA 3O9ZA 3RI3A 1LDEA 3UCFA 4ZGWA 2Y99A 4EUHA 3U9LA 4CQMA 2RCYA 3E18A 5JSFA 1SOWA 1ARZA 4LCEA 1PTJA 1YRLA 3KLMX 1ULUA 3FN4A 3HN2A 3QQPA 3JQBA 5JLAA 2WMDA 3STHA 4MKRA 3GEGA 1G6KA 3AOEC 2VZ9A 3PWSA 4XA8A 2DBZA 2A35A 1N7GA 4UVDA 4XCVA 2EGGA 3MOGA 2GN4A 5A05A 3KVOA 2FMUA 4KP7A 2OMEA 4G65A 2HKIA 1A7KA 3DTYA 5EMHA 1E6WA 3BHJA 1UXIA 1ONNA 2NVUA 2DTEA 3L9XA 4DQUA 1VE9A 4M54A 1P0FA 4JJFA 3RC7A 3SJUA 4R01A 4LSWA 4FFNA 3EZYA 1CIVA 3AI1A 3WOHA 5G0SA 3M6IA 2CUKA 1EMDA 2HAEA 5B4TA 5I7FA 3GK3A 4OSPA 3BMNA 2DPHA 3NRCA 3E9MA 1HDXA 3JSAA 3QSGA 2PGJA 3UFXA 3BHIA 1HSZA 3FBGA 1E3WB 3SVTA 2EJWA 3H9UA 4NK4A 2YY7A 4Q3DA 1PZHA 3DZBA 1B15A 3TQHA 3JQBC 1OMOA 4R9RA 4CODB 2P9CA 2VOEA 1YE3A 1J5PA 1Q1NA 1R6DA 2VN8A 2NSDA 2D8AA 3PHHA 3LC2O 4GWKA 4JJGA 4KQWA 5G2OA 4K28A 3PGJA 3LU1A 4I8XA 3JYLA 3HFGA 1VJTA 1NWCA 4J43A 4M1QA 5JYDA 1YKFA 1C0KA 4BUCA 2PD6A 1UDCA 2EKLA 1DB3A 1N5DA 3ASUA 4CM5A 5A5FA 5L51A 3AY7A 4DLLA 5F3RA 1PWXA 2VYNA 3G49A 1V8BA 5L7TA 5KVSA 1Q7CA 2UVDA 2O7SA 2X0RA 4B4WA 5FFFA 1N1GA 4IQ8A 3T4EA 2EXXA 4IGEA 4PZDA 1Q0HA 4Y6RA 3FWNA 4DRYA 4EJ0A 5L3ZA 4LK3A 1O8CA 3AM5A 1UJMA 3D7LA 1NPDA 2IODA 1R0KA 1DIHA 5B4VA 1Z82A 4ND2A 3TDKA 3BMCA 3UCXA 1NPYA 3ZU5A 2PLAA 3DAPA 4MOWA 4CR6A 1O0SA 1C1DB 1WZIA 4R54A 1NASA 3I5MA 2I66A 3VPFA 3JQ8A 3ZU2A 1Y81A 3DMYA 1CEQA 1HE2A 3M2TA 5THQA 5LDGA 1FDVA 4D43A 1RYDA 3BAZA 5CPFA 4AJHA 1DJQA 2BI8A 3OEWA 4IDFA 1YB1A 4WOKA 1PL6A 1X0XA 4KUEA 4CLDA 1FDWA 4NBRA 4BMSA 2O2SA 2P9EA 1MG0A 3JV7A 3KEOA 1HYEA 4FCCA 3GAZA 3BYZA 4RO0A 4HKTA 5BSGA 5EN4A 3GFBA 4A10A 4ND1A 2HQ1A 4CMIA 5B12A 3CEAA 5KKAA 4P38A 4ALNA 5JMWA 3Q11A 1M75A 1LDBA 1ZXBA 1ZMOA 5KJEA 5LDHA 4J1QA 1LTHR 3BMQB 5JW6A 4TVOA 2FSSA 3R6DA 4YDRA 3I6QA 2X22A 2F1KA 4A5OA 3K2BA 3PI7A 4E2XA 1PL7A 3E1KA 3DZKA 1PGPA 2CSUA 5G4KB 3TL2A 3QWFA 3H6KA 1H0KA 2BLLA 5TT1A 2HMVA 1C0PA 1JWAB 2VHXA 4CJXA 1QV6A 1SPXA 3MJCA 1PIWA 3GUYA 4J9UE 3PDUA 1PJLA 3WWYA 1RM4A 4X54A 1IPFA 3A4VA 1PSDA 1S7CA 3C7CB 2AXQA 2O50A 4NZ9A 1B3BA 2HU2A 5FYDA 4YCAA 3KLPX 2EERA 3DBVO 3LQFA 5GZ1A 3VH1A 2PH3A 4XYGA 2IDZA 1Y1PA 2X0NA 3K5PA 3ZWBA 5JBIA 4AJKA 3T7EA 2DUUA 4I5GA 4WNCA 3PWZA 4J1NA 3DMTC 3L07A 4U6QA 4INAA 2Q4EA 1LSUA 2O3RA 3LT1A 1C0IA 1DPGA 1GZ6A 3PTZA 4FIZA 4WE3A 1KERA 4NFHA 2C7GA 4AL4A 2PR2A 3ZWYA 1JKJA 2Q99A 4LCJA 3GQVA 5KJ6A 3VPSA 2GD1O 4NK5A 3INTA 2A94A 4B7CA 4PVCA 4YEDA 1BXZA 3P2YA 2QHXA 4J4TA 4R5HA 4D0SA 3CIFA 1ISMA 4UVIA 2D2IA 2ZB7A 4JIGA 2CD9A 5AVOA 1U3TA 4ID9A 4JNKA 1LEHA 4FFOA 4BKRA 3PJEA 1EVIA 2FP4A 4ZQBA 3I4FA 5A9SB 5BNIA 3GVIA 1T25A 4OL9A 1AE1A 4ND3A 1JN0A 2GN9A 3ADPA 4UUPA 4CL8A 1OZAA 2EW2A 1I24A 1B0AA 1PZGA 3E48A 4P4NA 3WGOA 4I9UA 1HE3A 5IDWA 3PHIA 5F1PA 2VTEA 4AJJA 1K6IA 3NTOA 4BHTA 6LDHA 5IFLA 1FDUA 1OAAA 1B7GO 1IHXA 1OC2A 4WNIA 4RPGA 4ZVVA 4BKPA 2C54A 2GN6A 2DT5A 3A28A 2HSDA 4L8VA 4RVDA 3GG9A 3QIVA 4BGUA 2I3AA 1ZZEA 3UXYA 2D4AA 2X4GA 4CM8A 2A4KA 1VPDA 2POQX 1P9LA 1U8FO 3AUUA 4U5QA 2PV7A 2FN7A 3KBOA 4BNJA 3JYPA 4O59O 4JLWA 4NBUA 5EL0A 2V6FA 3I83A 2J8ZA 1Q7GA 2NQTA 2IXBA 3PJDA 1BXGB 1J4AA 2C59A 1BGVA 1AUPA 4EEZA 1E6UA 1PJ2A 4GLLA 1E7SA 4PLTA 3WJAA 3N7UA 2DPGA 2HK7A 1X14A 1LA2A 4YJDA 1KS9A 2DTXA 2YFHA 2VWPA 3I4CA 1V0JA 3NDIA 4Z9FA 3WJ7A 5TQVA 1UZNA 4XGKA 1LJ8A 3VC7A 4ROSA 3IP3A 1RYEA 1Y8QB 5JCJA 4DYDA 3B1JA 4ZRMA 2C2XA 1LQTA 2HUNA 4LVCA 5KIAA 1K5HA 1WMAA 5A1TA 1R0LA 4KOAA 3ENKA 4K6CA 2EV9A 3FPCA 4ALMA 5ENDA 1AHIA 2UUPA 4GVLA 4N5NA 4ILKA 3IIEA 2P68A 3D5QA 3HB5X 4EUEA 1N1EA 4CM9A 3I9LA 4BKOA 4Q3NA 3FHLA 1P77A 4RF5A 1VRWA 1XDWA 4CM3A 2ZYDA 3JTMA 4IDAA 3QA9A 1RWBA 3WXBA 2FOIA 1GZ3A 1G1AA 4CQLB 3M1LA 1HYHA 2FPPA 1ZEJA 4TRNA 3VTZA 4EUFA 1E1MA 1DOHA 4CMHA 4AVYA 2OZPA 2VOJA 2E4AA 4PG5A 4YJHA 2ILTA 3PLNA 1NNUA 2Q3EA 3L6DA 4PLZA 1AHHA 4PLYA 5L4SA 3H9EO 3U49A 2VT2A 1XCBA 4XIYA 1JQBA 1XU9A 3ANNA 4D46A 3GRPA 3NGXA 1A7AA 3A14A 4UAGA 3B1FA 4PG8A 2VUUA 3W8FA 4A03A 4M87A 5IZCC 2FZEA 3D3WA 1SC6A 1XKQA 2WTBA 4BL5A 1YQGA 3JQEA 4M86A 5C37A 1DAOA 4R68A 1UXKA 1E5QA 3DZGA 1SO8A 4QFDA 3WBBA 1SZJG 4PIVA 1HDCA 4LRSB 5T8KC 4XYMA 5JFOA 4GQAA 1EDOA 1XA0A 3L0DA 5TJ9A 2W2KB 1P3DA 4U8GA 1Z73A 4WCFC 4DUPA 5K6AA 1HE4A 1RKXA 5JAQA 3ZWPA 1ZUD1 2X7HA 3GOHA 3KOUA 4JJIA 1OC4A 4L73A 3E6AA 3KV3O 1VL6A 3RSHA 2E6UX 4KUGA 2DUWA 4ZD6A 4Z6KA 3CH6A 1B16A 1YBMA 2D5AA 1EEHA 4RDHA 4YQZA 4CQMD 4NIMA 4DLAA 2OBNA 3Q9UA 5TX7A 1ZJYA 4XRGA 1AXEA 1BW9A 4K6FA 2DBVO 4GKVA 1IHYA 5KKCA 1EVZA 1QRRA 1PU2A 1EQUA 3AUTA 1GPJA 5HA5A 2CNBA 5T67A 1GFSA 4MIYA 3S1LA 1ENPA 4JBHA 3WWZA 3WTBA 3L4BA 1F12A 4BKQA 1SB8A 5KJFA 4AJ2A 2OGUA 2X23A 5A03A 4GVXA 4CUKA 3AOGA 3A9WA 1NPTO 1C1XA 3JQCA 4Y8VA 2QYSA 3AY3A 2AQ8A 3KHUA 4CLRA 2VZ0A 3OM9A 1I2CA 4IQ0A 2VHZA 3JD1A 1PX0A 2PGLA 4IXTA 1ZK4A 3WX0A 1GADO 1ZSYA 1GY8A 3G1UA 4RCVA 1YONA 3FBTA 4BO2A 4FSHA 3C8MA 2VCYA 1FJHA 3H9QA 4I1IA 4NBWA 3WQSB 5JDIC 3GMDA 4XYBA 5IF3A 1LRKA 3H5RA 4FBGA 4PGFA 2EG9A 4CLEA 4Z0TA 4MINA 1UXGA 2VWHA 3EVNA 4HADA 1HWYA 3D64A 1HXHA 2DKNA 2PZLA 3SXPA 1I3LA 1UXJA 3PJGA 1YDWA 2FSVA 2RH8A 3B20A 4QO7A 4E31A 2H63A 4QT0A 4WCDA 3ZHXA 3VH3A 4RPJA 3LT2A 4N7RA 2ZKLA 4J4HA 1PQPA 3LF2A 4XQCA 3S2GA 2C82A 2VT3A 2Y1GA 3X2EA 1E6EA 2P2SA 1LI4A 5CPBA 3FCOA 3LLVA 1PJQA 3BMOA 3QWIA 4HNHA 1QYCA 3IJRA 4CMBA 3ROPA 3NT2A 4MJLA 1IE3A 4FD3A 3MJ4A 3NTRA 3ZWOA 1I01A 3DTTA 4GX2A 4D44A 4TZTA 2VYND 2IXAA 4GGPA 1Y7TA 1RPNA 3WSVA 3E5MA 1DC4A 3HDHA 3BTUA 4LGVA 3MJSA 1P1JA 3DB2A 4CV2A 5EQDA 1VSVA 3MJEA 4CMEA 1XIVA 5H81A 3W4JA 1A72A 2X1HA 3ZH2A 4RORA 3WFIA 4CMIB 2J3IA 4RL6A 4WLFA 1P45A 3HDYA 4MP8A 3WIEA 2EHDA 4ALLA 1MV8A 3ZN2A 1P1RA 3JQGA 3RC9A 4OAQA 1EBFA 1NHGA 4J4BA 1NQ5A 2EW8A 3ITKA 3ZWCA 1LDNA 2RH4A 5CEEA 3SJ7A 3RBXA 1EFLA 1QYVA 2WYUA 3RUDA 1ZSVA 3K9QO 2GPTA 2TMDA 4CUJA 4IZHA 1PR9A 2VHYA 3PFFA 4TWRA 4BKUA 1C3VA 3O4RA 4O1MA 3IDSA 3O8QA 2P5YA 1WMBA 2AQIA 3OECA 1H5QA 3I9JA 1SEPA 3QJ5A 2B35A 5A9TA 4OIMA 1GV0A 1Z45A 2HRZA 1WDLA 4YT5A 1SCUA 1LDYA 3HNPA 1ULSA 1XQ6A 3E8XA 3K96A 5H82A 1EDZA 1E7YA 5ES3A 3NDJA 5ILOA 2QG4A 1GQYA 2XXJA 1M6HA 8LDHA 4J2OA 2Q50A 4RLSA 1ZXLA 1NFQA 2GZ2A 4EJMA 1A5ZA 1KYQA 4K1LA 2C0CA 4XB1A 4E6PA 3GNTA 5EESA 2Y67A 1SEVA 3KM0A 3HWRA 3AUAA 1ZNQO 3PYMA 1QMGA 2QIOA 4D41A 1PQWA 1DJNA 2AQHA 2ZK7A 3GGPA 3H5NA 3TF5A 2OORA 1UAGA 5B1YA 2DFDA 4G2NA 1LC0A 5IDXA 4M49A 3C7DB 4GH5A 2NVWA 2ZQYA 5G0VA 4HFJA 3ANLA 5DBFA 1T26A 3EGOA 4D3SA 1QG6A 4WLNA 5JC8A 4NU5A 2BH9A 4Y6PA 4II2A 4BO4A 1D7OA 1JDJA 4R1UA 1W73A 2ZATA 4TSKA 1U5AA 3TN7A 4CM4A 4JQCA 1H9BA 1KEPA 3QRWA 1DEHA 5DP1A 2E48A 2BF7A 5JCXA 2AMFA 2O4UX 2W8ZA 3C3XA 3CUKA 3FI9A 4XGNA 1MGOA 1U1IA 2A92A 1KEVA 4MP3A 4YAKA 4HY3A 1I3KA 5AXCA 4W7HA 1QP8A 2J5QA 3GNQA 2V6GA 4MVJE 4CM8B 1ZKMA 3WYCA 1KVUA 4D79A 5L4LA 5TJHA 1J0XO 4DIFA 2V6BA 5FI3A 2X9VA 1YWGO 1SBYA 1LNQA 3AY6A 4KWIA 4DQVA 1EFKA 1KC1A 1ZK3A 2AEJA 1E3JA 3R0IA 1HDZA 1MC5A 4GMFA 4C7KA 1Y9EA 4PLCA 4F6CA 3NV9A 4Z3DA 5K0ZA 1BTOA 4OMUA 1GR0A 3GEDA 4CMAA 2UUOA 4D3DA 3EK2A 3OIGA 3LF1A 1PS8A 1KVRA 3RFXA 3CTMA 3F5QA 3NT5A 4CMKA 2JAHA 4LW8A 3S2IA 2CVQA 3WTCA 1C14A 2AE2A 4N18A 2CDAA 2I65A 2X8LA 5A06A 1DFHA 4PZCA 1ADGA 5KOIA 5U1PA 4YAGA 2Y05A 4KWHA 2I9PA 4PVDA 4XIJA 5T5QA 1UP7A 5I7VA 2G82A 1F8GA 3LT4A 2EWMA 3CKYA 3X2FA 1LLCA 1LX6A 3PZBA 1X7DA 4BO1A 3ICPA 3RQSA 1Y8RA 5ER9A 2RIRA 2PNFA 2Z1NA 4WCFB 5CAEA 5COAA 3QWHA 3E82A 2JD1A 2PKQP 2NVBA 3AU8A 1NFRA 4EYEA 1VLLA 3EDMA 1PZFA 1JU9A 2Q2VA 4YACA 3GHYA 5BR7A 4NJMB 2CFCA 2Q2QA 4IJVA 3JQFC 1BVUA 1KY5A 5TNXA 3WGGA 3WYEA 3BXXA 2JFGA 1OI7A 4YJHB 1IPEA 1K89A 3Q0EA 4OOFA 5JCJD 3JQ6A 3PPIA 1VL0A 1UAYA 5I9NA 3KYDB 2ZJ0A 4EDFA 1LU9A 3DOJA 4OKNA 5I7SA 2ZIZA 1DRWA 5MGBA 1IZ0A 3DL2A 3DC2A 1K6JA 1BDMA 3D3WB 4N5LA 1YB4A 3Q9NA 1TB4A 3VZRA 1YOVA 5KNLA 1ENYA 3H8VA 3TSCA 1ZK0A 2RBEA 5KCZA 5CP8A 1E77A 4CM9D 1BVRA 1XG5A 2D3TA 4GL4A 4YB8A 1N8KA 3F5SA 2OUIA 3WGIA 1MUUA 2ZCVA 3GVXA 3PVZA 2NADA 3ONFA 3ZW9A 4CM6A 3PWKA 4RVSA 2GCGA 2BRUA 2G17A 3OJFA 3WICA 3R1IA 4W82A 5JDCA 1N9GA 2QZ9A 5TC4A 1IY8A 1R66A 1VKNA 1GAEO 3ZDFA 3RU9A 4AJEA 2NQ8A 2CY0A 5C5IA 2GF2A 4XQGA 1DDOA 3LZ6A 1UXHA 1NP3A 2BFPA 3OA0A 3V2UA 4A73A 2NUAA 4R9SA 4H7PA 4DQXA 3KYBA 3ZWMA 1T24A 1MX3A 5B4UA 1I32A 3DOOA 3S2EA 1Q0LA 5A02A 1E3EA 1ZFNA 4J7UA 4I5EA 4IQGA 4PN3A 1I3NA 4QQRA 1BDBA 3OJLA 2UAGA 5JPIA 3RUFA 3LSYA 2AEMA 3VZQA 1PJ4A 3TZQA 1CRWG 1JW9B 1CQIA 1Q7BA 2HJRA 5KVQA 4ZJUA 1F06A 3H7AA 1P1FA 1R4NA 2GZ3A 4HFRA 1NFFA 3DBRB 3U09A 1NQAO 1YJQA 3NEPX 4CR8A 2I67A 3OA2A 1W6UA 4CLRB 2NU7A 5CEJA 4NJOA 2UYYA 3UOGA 3G1TA 3ORFA 1U2GA 2BHLA 3ANMA 1VC2A 2ZTLA 2AW5A 1QYXA 5DBIA 2G0TA 1B8PA 2JAPA 1R37A 3DO5A 4YQYA 4M55A 4P4LA 1GUFA 1R16A 3GY0A 3SC6A 3VPGA 2BELA 1NX6A 4P4GA 5JXWA 3C1AA 1H6BA 1P44A 2WE8A 3KO8A 3NJ4A 1AN9A 4RV9A 2DFVA 5DNAA 1ZBQA 5FI5A 4QXMA 3K31A 1QLJA 2V7PA 4BOYA 4XGIA 2DM6A 1MFZA 3HDJA 3JYOA 4YJGA 5JS6A 1EE2A 4RPLA 3RUCA 3GH3A 1NVMB 3E9QA 2O3UA 1YL6A 4ITUA 3UH1A 3K30A 5CDYA 1FDSA 5IDYA 4RVHA 3RBVA 3MJVA 4B79A 1ZVMA 3EUWA 4WASA 4ZQEA 3U62A 4B4OA 3ITDA 3P5SA 1MP0A 3TJRA 3HADA 3GF4A 2WD7A 3ZWVA 3VDRA 2XAAA 4EZBA 2ZB8A 4R1NA 4XR9A 1WPQA 3FNEA 3JQAA 4ALIA 2I76A 3ZGYA 4ALKA 4GBJA 3RUAA 2BFMA 3D1LA 1FXSA 2JFHA 1E0DA 4UREA 3RBZA 1KVTA 3RJ9A 4BV9A 1U3UA 1E3SA 3RCBA 2YHIA 4DC0A 1YVEI 3EY4A 3U4IA 4S3MA 3WIDA 3JQGB 2BKAA 4HV4A 4FFRA 3PJFA 5DOZA 5IG2A 4WUVA 2PK3A 2YJZA 5C7OO 2D1YA 3AM4A 4JP2A 4CLOB 3GR6A 2ZYGA 5DDIP 4E5KA 2ZYAA 4A2CA 4PG6A 1GEGA 1UZLA 1EUDA 3E5RA 1T2AA 4MIEA 3S55A 1GD1O 4OM8A 4E2ZA 1HE5A 3WYBA 2Z1MA 4ALJA 3W4KA 1YO6A 3DBHA 1E3LA 1DC5A 4OXYA 1Y5RA 3JD2A 1Z6ZA 1EZ4A 3KSZO 3PYXA 4K9DA 1D8AA 1X1EA 1HZJA 1GUZA 1R12A 4O0LA 1EE9A 4QFCA 2XPCA 2O48X 4GKBA 4TZKA 4YWJA 3Q6IA 5AXBA 4AJNA 1LLQA 2VYVA 1XYGA 4IDGA 4FR5A 1LSJA 1LUAA 1HYGA 3DDNA 4R5MA 1NR7A 3GDFA 1PGOA 2NU9A 3KB6A 4BNZA 1WDKA 2NTNA 4JBIA 3OIDA 3PEFA 2JD0A 3ZWAA 5G4LA 4XB2A 3ZWNA 2R2GA 2IZ0A 3CE6A 2GASA 3ZNQA 1KETA 3TZKA 1X0VA 4IY1A 4JXKA 3UF0A 2J5RA 3WS7A 1NTOA 1I2BA 1MFPA 1ZH8A 1ADCA 4BMNA 1M66A 2JHFA 2PY6A 2UV8A 4Y98A 1KVQA 1WVGA 4WPGA 4HBGA 4WLOA 1O6ZA 3JQ9A 1LSOA 4Q3CA 4JX8A 3DBLA 1PJ3A 5DULA 5B37A 3KEQA 4DMMA 5F5NA 1HEUA 4PLPA 1TLTA 4NFSA 1PS9A 5JY1A 2EJVA 4S1VA 1JKIA 3GZNA 5I7EA 3O03A 4AJ4A 2W2LA 5IXYA 3DFZA 3F9IA 2ZB3A 4TVBA 3WSWA 4CM4B 2B5WA 5JMPA 3DZJA 1PGJA 4PLFA 3OFSA 5KJ1A 2DQ4A 1K0UA 1TVEA 4WKGA 1W0CA 3UCEA 4YAIA 1DSSG 2VUSA 3WQRA 4AJ1A 4BO5A 2O4CA 3D3EA 4IDBA 2NACA 1TT5A 2RHCA 2J6IA 3GN2A 3F47A 4DTIA 1V3TA 1PS0A 5G0WA 5BQFA 5IXSA 5C7IO 1HL3A 5ICMA 2B83A 4YJFA 4U0KA 3OJEA 3RC1A 4D45A 4UUOA 1B2LA 2QX7A 5L45A 1TT7A 1CERA 2W4QA 3JQ9C 4IMPA 1MB4A 1ZK2A 4QECA 3VOSA 2R00A 4A27A 4ZQFA 3FPLA 4TRMA 1M2WA 2D59A 3I1JA 2JJYA 3C1TA 4RQUA 5EERA 4FDAA 4U7WA 4L75A 2GDZA 4RF4A 4ZQGA 3DAGA 4BNVA 1ZO8A 4C4OA 3ZWXA 1U3WA 4YRAA 7MDHA 3B6ZA 1E7QA 3QLJA 4MKZA 4YAEA 4CV1A 2BMAA 3ETDA 4FFMA 3ULKA 2B5VA 3ZU3A 2HK9A 3P7MA 4FJ1A 3MEQA 1R4MA 5A04A 3FWZA 1DBVO 2B0JA 2JCYA 2YQ4A 4BMVA 4R4JA 4F45A 1WP4A 1E1NA 3GMSA 2CF5A 3F1LA 3EYWA 4CQMB 2VNSA 3FTPA 5HRUA 2C07A 3VVBA 2FY8A 1I33A 1DRUA 3V8BA 2NV6A 3WGHA 2IZ1A 1XR3A 5A5EA 4FJ2A 3QE3A 4CM1A 4R1SA 4XYLA 2GUGA 3RFVA 3BA1A 4I5DA 4O63O 3PHJA 1DXYA 1I2ZA 3R3SA 1IULA 2CZCA 1H2HA 3ETEA 1ISGA 5JAZA 3FSRA 1PEDA 2Y0DA 3PHLA 3GPDG 1LRJA 2BD0A 5JAMA 3K73O 3IQDB 3ZCXA 3ZZNA 3RUEA 1HDGO 1M67A 1AGNA 2VRBA 1RJWA 1YBVA 3NDRA 5COQA 1MA0A 3NYWA 3L77A 3EC7A 2NVUB 4Q3BA 4NG5A 1X7GA 4F3YA 3EVTA 2CVOA 2VWQA 1YOVB 3K8ZA 2Y68A 3ICCA 4BO3A 3E9NA 2QRJA 2E82A 4NDNE 2DC1A 5FEUA 2QYTA 3RFTA 3PXXA 3LDHA 1X15A 3BMNB 2NLOA 1GQ2A 4GPD1 5K9ZA 3TL3A 1E3WA 3V5NA 4TRRA 3BHMA 5F1OA 5ILGA 3V2HA 4B8ZA 4BO7A 5CDSA 3OQ1A 1UDAA 4J1SA 2PFGA 2ZB4A 2HK8A 1GV1A 1Y5MA 2WDZA 2XXBA 5A4DA 4D42A 1P1KA 3BTOA 1SB9A 5ER6A 2BGLA 1EK6A 1E7MA 2OBYA 2CF6A 3SEFA 3H2SA 1A9ZA 3WGTA 1E3IA 5GMOA 3F3SA 4BO8A 5GY7A 3DZHA 1LBEA 2HCTA 4LVUA 5F21A 5K6AC 3IKTA 2FR1A 4OQYA 4HNGA 3WNVA 3B70A 4PZEA 3NTQA 3F4BA 4MKXA 1T2FA 2ZCUA 4XYEA 3RAJA 1U8XX 1BHSA 1UZMA 3UW3A 3FNHA 3UKOA 4BNFA 1AXGA 2EP5A 3ROQA 4A26A 1N2SA 4N5MA 4ND4A 3DHEA 4F6LA 2GR9A 3KYCA 2B4TO 4DYVA 4MVJA 3NUGA 4TRJA 3SLKA 3EHEA 2OOSA 1X1TA 2H9IA 3AUSA 1DAPA 1GUYA 3BMCB 4RDIA 4W6ZA 3RUHA 1ONPA 3L4BC 4DIOA 3ZV4A 1ENZA 1XWFA 5T6BA 1VSUA 4O6VA 1G0OA 4IPTA 3JQ8B 4AJOA 4R51A 1T4DA 4Y9DA 4KUHA 5DN9A 4BNTA 2C5AA 2OXIA 4EITA 4DIBA 3CZRA 1QORA 1JAXA 2FZWA 4XWYA 1GTMA 2PD3A 3GNSA 2P9GA 2PZJA 3C85A 3KSUA 4NNJA 3VTFA 4RVUA 2Y0EA 4QO8A 3VKUA 3ZNNA 1YBAA 2H1SA 2O3JA 1I5RA 3JCZA 2Q1TA 1FK8A 1GDHA 3P19A 5CG1A 5LC1A 2IYOA 3JD3A 2H5LA 4WLVA 2GYYA 1H2BA 1CJCA 1ADBA 1B8UA 3P2OA 3BMQA 4IGFA 1JKFA 3ST7A 3A1NA 3CZMA 1YS4A 3TOXA 3UICA 2JL1A 1BRMA 2E49A 1ORRA 5G4KA 3GVPA 4GLOA 5HBRA 2O3SA 4Q3EA 1H93A 5CEFA 1DLIA 2WD7B 2BFAA 3JQDA 2GSDA 3QY9A 4GGOA 4NFYA 1UDBA 4L4RA 1Z74A 4IUYA 3GFGA 2YV2A 1VKOA 3ADOA 3EW7A 4O5OA 3GDOA 3PP8A 5I8ZA 1VJ1A 1T1SA 4MVJM 4HWKA 1GYQA 1CWUA 1T2EA 5JAIA 4W9NA 2HRBA 1LRLA 5AXDA 3QVXA 3VPXA 1W8DA 3W1VA 3FTNA 2P4QA 1PJBA 4CMEC 4DA9A 4XEHA 4R69A 2GLXA 2VUTA 3Q2IA 5AQ1A 1HETA 1V3UA 1HZZA 1YL5A 1NVTA 3RKUA 2TMGA 4IJKA 4QTZA 1D1SA 3C24A 5JC1A 4NBVA 1S6YA 4TKMA 2VHWA 3IJPA 3DBHB 3GLQA 4PFJA 1H6AA 5EJ2A 3NJ8A 3TOZA 1I8TA 4TMFA 4KZPA 1B8VA 3VDQA 3RKRA 3UGKA 1OFGA 1YGYA 5G0UA 1SNYA 3JQAD 2IEBA 3N74A 4NHEA 4Z3KA 5AYVA 4J0EA 5CDUA 1W4ZA 4GX1A 4HP8A 3GDGA 3KTDA 3BTVA 3OF2A 4B7XA 4WGGA 4OH1A 1ADFA 3TZHA 4AFNA 5A9SA 5GZ3A 2JHGA 2VHVA 1GYPA 3AWDA 4BNXA 3JYNA 4JN6B 3WBFA 3ZV5A 5IJZA 6ADHA 4W9NC 4UVHA 2C20A 5GZ6A 1NR1A 3GAFA 3SC4A 1QXSA 3U4CA 4OSOA 4I5FA 4MO2A 5DCWA 4W4TA 1D3AA 2WWRA 4CR7A 1ISIA 2PKRA 1TXGA 4UUNA 1F0YA 4J49A 3ON5A 4XQEA 4EBFA 2EKPA 3TNLA 1LDGA 3DONA 4RZIA 1ZJZA 1ID1A 3OH8A 5C3MA 1P1HA 1B26A 2VYVD 4B8WA 2ZTVA 3WGQA 1X7HA 4NI5A 1V3VA 4IM7A 4UUMA 3Q2KA 1NYTA 4L4SA 4DWVA 4ZQHA 1GEEA 3GZNB 4M8SA 3Q1LA 4PRKA 3DWFA 5I9LA 1WXDA 4FJ0A 3SBOA 2LDXA 5HWSA 2QRLA 3CXRA 4BNLA 1EVYA 3V1TC 3W8EA 2FWMX 2Q4BA 4XJSA 3IL2A 1Y8QA 4Q3AA 3RROA 2B69A 2VQ3A 4JP3A 4OJNA 1P33A 1BMDA 1G0NA 3DZFA 4KQXA 4YA6A 2FR0A 4OO3A 3N58A 5IAAA 4IINA 1F14A 3M1AA 3ASVA 4BO0A 3QVSA 4BNIA 1I0ZA 1NAIA 1L1FA 1ZMTA 3HQ4O 4FGSA 4NQZA 2YDYA 3AOEA 2WM3A 1QR6A 1CQJA 2OP0A 3M2PA 4J16A 4NMHA 4U0JA 1L7EA 2YDXA 1I3MA 3OEYA 2Y1DA 4KDEA 4Y67A 2GN8A 5FF9A 5AXAA 4BO6A 5L7YA 5BNTA 3S8MA 3VVCA 4A7PA 2RHRA 3C7AA 4BGVA 2PGDA 2W90A 5LCXA 4J9VA 3WLEA 5L95A 4BO9A 1U4OA 2BGKA 2W2LD 2JFFA 4AJIA 1ZCJA 4UVEA 4A0SA 2AHRA 1J6UA 4CQLA 3QHAA 2Q1UA 3PFWO 2DBRA 4UEJA 2X5OA 4MP6A 4PLVA 2FR8A 4E0BA 2WYWA 4GI2A 2EKQA 2HMWA 1R4MB 3TWOA 5AOVA 4Z9YA 1DLJA 1E7RA 1V6AA 1N7HA 1SMKA 1YH3A 1Z7BA 2X9NA 1LDMA 3IP1A 3V1YA 4DL9A 3F4LA 5TGDA 2DVMA 5T57A 3AI2A 3H65A 2RAFA 4NPCA 2AA3A 2DTDA 3W8DA 4E4YA 3COSA 5L53A 2PZMA 4R1TA 1YDEA 1BG6A 3NAQA 2P91A 1U5CA 3D4OA 3NKLA 1EK5A 1KC3A 5JO9A 1BWSA 1A4UA 2W2KA 2PWZA 1L7DA 1GQQA 3MZ0A 4XX0A 4KMSA 4UVGA 4J7CA 1F8FA 2AE1A 2FPIA 4CUZA 2HDHA 3HSKA 3IAHA 2V65A 3AK4A 4DBVO 1O5IA 3GRKA 4AG3A 5L4NA 1HT0A 2VWGA 2NM0A 1O95A 3I9KA 3MWDB 3KETA 3I9MA 2A9FA 2NWQA 3ZHZA 2IRWA 5JY6A 2FRDA 4FQ8A 2P5UA 3D4PA 1XHLA 3FNGA 3GN1A 4CMJA 4L0QA 4R16A 3ZNOA 1U9JA 3INRA 4OKIA 5EINA 4RQTA 1T2CA 3Q3CA 1NQOA 2CDBA 1BW9B 2O2YA 2B4QA 4FFLA 3GGOA 3JQ7A 4IDCA 5JE8A 4DPMA 3INGA 5KVVA 5HTOA 3ONEA 3LYLA 3OHSX 3KXDA 3AM3A 3U5TA 1GZ4A 2J3HA 4JGBA 1H6DA 5A3VA 3H4VA 2IYPA 4YTEA 2I3GA 1ISJA 3HZZA 1DHTA 5KTKA 3CMMA 3QVWA 3QWBA 1C1XB 3H9GA 4UEOA 3VAZA 2JCVA 4JBGA 4YT8A 1IL0A 3WNQA 1R0SA 3HB4X 5JDCC 5L7WA 4XRRA 3SLGA 3FR7A 4GMGA 4L74A 2QW8A 1O94A 4MDHA 2G1UA 4RVFA 3PRJA 4GSLA 4Q39A 2OFPA 5G0TA 1UP4A 3DOCA 4IIUA 1DFGA 5I9MA 3KYCB 3DQPA 4RPKA 2EEZA 2GNAA 4RPHA 2Z5LA 2Q1WA 4ONEA 1SAYA 4YRBA 4BNWA 2X58A 3CPSA 3I3OA 5DCUA 4WK6A 3BZUA 4MVJG 3GUCA 3GGGA 4YT4A 3BMOB 1Y6JA 4P22A 4IS3A 3AJRA 3DXFA 4FFPA 1HDYA 1KBZA 3VH2A 2GO1A 4QX6A 4E13A 3QVTA 3WFJA 5A9RA 2J5KA 3U4DA 4BNKA 4AJPA 4H16A 3MWEB 4PLHA 1DO8A 5BSEA 4YRDA 3ENNA 3HE3A 3DMTA 4BGIA 4MVJI 1QV7A 2YYYA 3ROKA 1IOLA 2OL4A 4KDFA 4D7AA 1GU7A 2D5CA 1PGNA 2PH5A 3G0OA 4RLHA 1ISHA 5KJCA 3OETA 4NU6A 3WQQA 4MVJD 1U2DA 3QV1A 2NU6A 3VHRA 1D1TA 3GZ4A 1HDRA 5IZ4A 4ZA2A 2O23A 3DHNA 3G17A 3T7CA 3I9NA 1RM3A 2Y93A 3OICA 2R6JA 3GC6A 4NR0A 1DFIA 4XR4A 3RUIA 4YR9A 2OP1A 2QQ5A 4B7UA 1DRVA 1YB5A 2X5KO 5J23A 4KTTE 1CDOA 3O8QB 3CSDA 4L9RA 2CDCA 1KIFA 2Y1EA 1GCOA 3BIOA 5TLSA 4R41A 1R15A 5TIIA 4E33A 4P8RA 5CDTA 3FNFA 1IZ9A 1QKIA 4MVJF 2WYVA 5CHEA 3F1KA 1H9AA 3IC5A 3LC1O 2Y66A 2DBQA 3IUSA 4XD2A 4BB5A 1Q0QA 4CPDA 2XOXA 1NAHA 4QUKA 1VJ0A 3L9WA 3GPIA 3RVDA 5JNLA 4GAEA 1HSOA 2PZKA 3A06A 1PL8A 4PLWA 1EUCA 3O38A 5BNFA 4L76A 2Q2WA 3HN7A 4BQPA 4LN1A 4WLUA 3WGYA 1FDTA 3PZRA 4WLEA 5EIOA 4WECA 4M89A 2YHUA 3MTGA 4BGEA 1B3RA 1ONOA 4WJZA 1HLPA 3I23A 1YL7A 4I9HA 4R3WA 1NHWA 1M6WA 1TA4A 4EJ6A 4DC1A 1QSGA 1D4FA 1GL3A 4XZ3A 4HFNA 2VZ8A 3ZNPA 1Y9AA 2C29D 2Y1OA 3DHYA 4H3VA 4TQGA 2Q1SA 3OJOA 4DPLA 1UP6A 3ONDA 3I6IA 1NVGA 2JKVA 2SCUA 8ADHA 4L4XA 3VKVA 4YAJA 2Q45A 4E2WA 1I30A 4CM7A 3CMCO 4I08A 3MJTA 1U7HA 4FOOA 1QLHA 3PHGA 3OJ0A 1IUKA 2PTGA 3WG9A 1NWHA 1O9BA 3LT0A 1GPDG 1PWZA 4ZRNA 3ZV3A 4YXFA 2IEDA 5THKA 4XJTA 1NBOA 1XGKA 3UAGA 1PJCA 1HTBA 1WZEA 3OIFA 3E03A 3GA0A 4FN4A 3QP9A 4OXKA 4RGBA 3RD5A 3PIDA 4MPDA 3MCVA 4CV3A 3OQBA 3B1KA 3DAFA 4JROA 1M76A 5EPOA 1ENOA 1WLYA 2I5PO 3HHPA 1SOVA 3HUDA 1K3TA 1B14A 3ZI0A 4BNMA 2GGSA 2DAPA 4R3NA 4B4UA 4GSKA 1DIGA 3RJ5A 4J0FA 1F17A 5DCYA 4W99A 3D4NA 4ZU3A 3V2GA 5BT9A 3UVEA 3PDJA 4B4VA 4DBZA 4E3ZA 4DPKA 4E2YA 2DLDA 5IZCA 4HUJA 1PGQA 3JD4A 1QYWA 4PRLA 3AFNA 3H9JA 3T4XA 4RF3A 5HS6A 4LRTB 3AI3A 5IN5A 3U4HA 5TSDA 2EGHA 5T8KA 3IS3A 4JCOA 5ITVA 1HRDA 3S2FA 2C5EA 4II3A 3H3FA 2BGMA 1ZK1A 1UH5A 4J6FA 4CMGA 2V6MA 2X86A 4GWGA 4Z9XA 4WCFA 2C7VA 1FF9A 3QW2A 2VRCD 5L9AA 3HDQA 3BTSA 1XQ1A 4E12A 1Y8RB 4IZIA 4ZHSA 2AG8A 1LLDA 2D0IA 4CL3A 4NJMA 4FB5A 2O3QA 2Y1CA 2WEKA 4J2HA 4DLBA 3RU7A 1JLLA 2YZ7A 2R00C 4BV8A 1EBUA 2PD4A 2X5JO 1U4SA 1E1LA 4IS2A 1HDOA 1OOEA 3ABIA 3DEYX 3KYDA 4J91A 3EMKA 5CG2A 1ISFA 1BXKA 3GVHA 4FGWA 1VI2A 1ZIDA 1LSSA 2I6TA 3HG7A 2LDBA 4LMRA 2WJPA 4E5MA 1YQDA 4BVAA 2CVZA 4J1TA 1RM0A 4LMPA 4RF2A 5FWNA 4YBZA 2VNAA 4HXYA 3TZ6A 3IOYA 2YQ5A 3EZLA 2NU8A 3WLFA 2B4RO 1XELA 3ZWWA 4AICA 1U7TA 4WEQA 1PQUA 1MG5A 3OMLA 4BNGA 1I10A 4WOJA 1A27A 3JYQA 4BNYA 4CMCA 4JK3A 3RC2A 3WB9A 1KOLA 2NTJA 2X0JA 2YW9A 4MVJH 5U4QA 4HFMA 4QSMA 4IDEA 1N92A 2HMSA 1DIAA 4OXNA 1N9GB 4ND5A 2WE7A 5JDIA 2BFOA 4YVFA 4BQRA 3V1UA 1KY4A 3G79A 1ML3A 3C1OA 4IJUA 1YJ8A 4J3FA 2P4HX 1HKUA 1O89A 4EI2A 2GERA 1CYDA 2Y1FA 2ZTMA 1J49A 2F00A 4NBTA 3GEMA 4PCVA 5TT0A 3JD0A 3PIIA 5DP2A 2Z95A 1Z7EA 2YV3A 4D3FA 3JQ7B 4DGSA 4Q9NA 2X0IA 4J90A 5JYEA 4ESOA 1H6CA 3F46A 4WEOA 3L4SO 2B37A 2FHSA 3W6UA 1CF2O 3DBRA 4I9NA 1DC3A 3VZSA 1R4NB 3RIHA 3MTJA 1UUFA 4Z0HO 4E5NA 2EF1A 3I52A 1MXHA 3F6YA 9LDBA 1P1IA 1YQXA 4GX5A 1PJSA 1LLUA 4PLGA 1MLDA 4XQ9A 4BB6A 3FF4A 4Y6SA 1A9YA 2J3KA 3DFUA 4TROA 3W4IA 4RZHA 1PZEA 1NXQA 1C1DA 1JTVA 2ZJ1A 5TS3A 4DXHA 1KVSA 1E1KA 1Z75A 1RM5A 3D5TA 3ROMA 4B3HA 2JD2A 3ZV6A 3O26A 5MDHA 2NTVA 1OBFO 5CFZA 4CLHA 1A71A 3TPCA 1TEHA 1WWKA 5JO0A 1GCUA 2E37A 1IB6A 2GZ1A 1JVBA 1K2WA 5COBA 3PGXA 3IUPA 1BSVA 4URFA 1HLDA 5ITWA 4DREA 3WMWA 4EGFA 2G76A 3AW9A 1WNTA 4FPXA 3DR3A 3LLSA 5DZSA 3L6OO 4YJGB 1LQUA 3EAGA 5DOVA 1T4BA 2NNLD 3UHAA 3KUXA 4FW8A 1ZSNA 3DZIA 3LVFO 4OHUA 3PQDA 5ADHA 4LISA 4G81A 3H3JA 2HJSA 3QVOA 2WSBA 4FC7A 4FC6A 4FS3A 1XLTA 3MOIA 5CDGA 1P0CA 4DVJA 4ZN6A 2G5CA 2Q49A 2QZZA 4BNUA 4E32A 2YFQA 3ZHYA 2YUTA 3JQAB 4W7IA 3NGLA 2XF8A 2O7QA 4OYRA 2WD8A 5BSHA 4AJLA 2AG5A 4YT2A 1V9LA
chains in the Genus database with same CATH superfamily
3I32A 4OH7A 3UN1A 4A2WA 2D2XA 2AQKA 2XUQA 1QV9A 2EIHA 1SQSA 3K0FB 3C5CA 4N03A 4CLXA 4UEKA 4AYWA 3HO1A 1P81A 3IAEA 5A3JA 3HTXA 4XPIA 2H6EA 3AJAA 2FUEA 3LK6A 2O2GA 1D9XA 1WBDA 2HL6A 4D0RA 3H5OA 4IJ5A 1PWEA 1RAIA 2H85A 5L40A 4LDPA 2C3MA 2Q9UA 4OPMA 3VYTB 2CJYA 3R7AA 4D8WA 3RYTC 3ESBA 2BGRA 2YIMA 4WX2B 4E21A 3OQPA 1FLVA 1XTRA 4J0HA 3M6XA 3PXBA 1UMDB 3DLAA 2ZG6A 3A3OA 3LQ1A 5JRDS 1XEAA 5CCDA 2G07A 4QUGA 4DIDA 4ZHQA 5I47A 4QNNA 2RG1A 3VPAA 3SXUB 3VOBA 1QGOA 1B8NA 1T1RA 4GZ3A 4RK7A 1AS0A 3C97A 1X94A 5J1TB 1YS6A 2X3FA 3SG0A 3VC1A 2GZMA 3LCJA 3KTAA 3QLUC 1CJTC 4E30A 3ELUA 2X40A 3BSYA 1CY1A 4TLDA 3V8RA 3OF3A 3OSUA 3CW2A 4Q03A 4GKKB 1OX5A 3S6JA 1DBRA 4MWSA 2AX3A 2I55A 2OHFA 4IXMA 3BGDA 2VZLA 1GPWB 1ZGHA 4OUDA 4WNAA 4M8KA 5ENVA 4ENPA 5AM2A 1WZCA 4KFTA 4CKCA 3AY0A 3HR8A 1QQ5A 1KDVA 2QTAA 3LUKA 3TRIA 2Q6KA 2ZSKA 1E92A 2HO5A 3IKVA 4JJ7A 3S1SA 2FW9A 2WVJA 3UUEA 3FMPB 5HZMA 1RZRA 1YRQA 3GEEA 4Y2SA 1V35A 2FPGA 1QDLB 1HZZC 3AXTA 5JVDB 2XE4A 5CA1A 4O4JB 1JQEA 5T41A 4EW6A 4ICIA 3NX4A 3PYLA 4LNUB 1QVRA 4OD0A 4Z0PA 5CDHA 1Z5GA 7GPBA 2ALJA 5HS4A 2ET6A 2LD4A 3FR8A 4BYMA 2Q1YA 1HFKA 3FOBA 3MIIA 3TPFA 1EJ0A 1YXMA 1SXJE 1Q2XA 1FFSA 3V7YA 5E6SB 1YQEA 4LY9A 3MCAA 1BZYA 3GXBA 4OGWA 1MH9A 1KZHA 1W47A 2Q5QA 3H5AA 3KQTA 1ECLA 5LBTA 4CKZA 4AUEA 5EZQA 1GYRA 4IJWA 1S1CA 2D0DA 3I76A 3JR3A 1VJ5A 2I4LA 2SBTA 3KU4A 4X91A 3SDSA 3K70C 2W2NA 2W98A 3JATA 5A3QA 2C77A 1JFVA 4IBOA 5EYPA 3PK0A 1JKMA 4OYYA 1HO3A 5BQ3A 2VP6A 1QYDA 3LFHA 1I6LA 1W5EA 2I99A 3H1FA 3KWJA 5J43A 1GZUA 1KK0A 1OFUX 3EXHA 1VG0B 3SR3A 1TT5B 4ZCRA 1RSZA 4IIVA 3AU9A 4BFWA 1JVSA 3K92A 3P4YA 1DBPA 1Q19A 4LJLA 3UH0A 4LJ6A 1WEKA 2IZZA 1KYYA 3C3YA 4GLJA 4KFSA 1PEKE 4YPFA 3KJHA 3L4JA 1C9KA 2AZXA 3JRNA 1TPZA 2AD1A 3AVXA 5KSYA 4PCAA 3LPLA 4EEXA 3ZKWA 1RI5A 3L7OA 4P4SB 3W2IA 5I3ZA 5LUAA 1NKTA 2X8AA 1DX4A 3P32A 4WK4B 4LY3A 3WA7A 3UXMA 2X8JA 3W6ZA 2B36A 2HMUA 3CLSD 4GRDA 4DRXB 1NW7A 4UULA 5IN4A 2I87A 9LDTA 1LVUA 3UUWA 3FIUA 1XVLA 3ZU4A 2Z9CA 4YIHA 3KQPA 4NH4A 4NMHA 3S2SA 4PHGA 2VK2A 5U9CA 5KNBA 1PQ4A 1J2YA 1VKJA 4RJKA 1NZDA 2IYRA 3DE1X 2Z04A 4TS9A 3TZCA 1TVCA 1XAIA 2IEIA 2Z4RA 3CE9A 4CFZA 4Z5XA 1FFHA 3RSSA 1VL8A 5CHYA 4RD3A 4JB3A 1ZGAA 3IV9A 3PHBE 2IUEA 3I2YX 4IUBS 3RI3A 5JNRA 4MDYA 3DBIA 4Z86A 3I5UA 4EUHA 4PZ0A 3WYFA 1KA9H 1UT6A 3E18A 4YK7A 3WK8A 1XOIA 2O52A 3VZBA 5JSFA 121PA 3P96A 2QJWA 1SOWA 4I50A 4ZWNA 3A1UA 2BFFA 3DZCA 3KB8A 1FSZA 2OXTA 1SVKA 1YRLA 2Z2JA 3L2OB 1KEKA 1T8TA 3OIVA 4L8WB 4DLYA 4GM0A 3OZAA 5KOJA 3STHA 3CVOA 1G6KA 2J3DA 2JDID 3PWSA 4FDVA 4WVFA 4ZO8A 4YASA 4CKEA 2ENWA 1JH9A 1UC9A 1X42A 1Z6QA 2YXLA 4REMA 3FPGA 1AOXA 1BJKA 3IT0A 4R98A 1EWQA 1HT1E 1YACA 3MOGA 4HUQA 2HJGA 5LP6C 2EOAA 2GN4A 3KVOA 1MF7A 4JI0B 4M8IA 3FDJA 4MV4A 3KQUA 3O21A 3P9CA 4G65A 2OO5C 3NIBA 3DTYA 1FTWA 4KX3A 1E6WA 3BHJA 3O8RA 4GG1A 1TNDA 3PUHA 3EOBI 1KK1A 3ADDA 4F9EA 2C5FA 3NM6B 3L9XA 3G0CA 4QPNA 3WWDA 4M54A 5JBNA 2VDRB 3U19A 4MPPA 3VPBA 1K86A 1SRRA 2XCQA 3FRHA 1G19A 7YASA 3KL2A 3AI1A 2HAEA 4GZMA 3VVLA 2A14A 4RLQA 3EXEA 5B4TA 2ZBQA 1ZCAA 3FOEC 4MKIA 2DPHA 1CF4A 4UNRA 1TGYA 1HDXA 1R0XA 1KARA 3LY9A 1KZ9A 3ZDQA 3BHIA 4S1PA 3RLFA 2P7IA 1E3WB 1P6XA 1W34A 4RFLA 4NK4A 1YZFA 2YY7A 2PRJA 4OP3A 4IG4A 4D3XA 2C8JA 3F74A 3EA4A 3MT7A 1GDTA 1VKHA 3JQBC 1UAAA 5EZSA 5K3FB 1NF8A 5G53C 3V6LA 3TTTA 1SHKA 3BE6A 1Q1NA 2O1XA 2A33A 2VN8A 3PT5A 2NSDA 1E59A 1MAAA 1CEYA 4KQWA 5JTUA 3M6AA 3LU1A 3NHBA 2V5AA 1EM8A 1V8PA 2J9FB 4J43A 4TV9A 1FLNA 2INGX 3A10A 1YKFA 1C0KA 1CJMA 4QQNA 2EKLA 2UXDB 3E2IA 3EVAA 3AL2A 3INNA 5F98A 3Q3GE 2WJYA 4NMLA 4KQ9A 3RGGA 3OOEA 3AY7A 5EIBD 4P3XA 2VI5A 2M1ZA 3ETHA 3H7IA 3BE4A 2AEEA 4YDQA 5BUSA 2DUJA 1M2GA 1YI1A 2FRDC 5KEIA 5FFFA 3DLIA 4KODA 4WT7A 2C04A 4FNAA 1PBTA 4O33A 1LNZA 5IEJA 1NMYA 3FWNA 2DULA 5FEMA 3ZGLA 3AR4A 3PXDA 2GH1A 3NBZC 3AEKA 1O8CA 3D7LA 2PGNA 1RTTA 3A1SA 2BGIA 3D7KA 4KQ1A 5C3UA 5DNUA 5C51B 3IP5A 5B4VA 4XEUA 5LMNB 1Z82A 4UTXA 3BMCA 3UCXA 1LQ2A 1TYEB 5CH3A 5J47A 4YP5A 2GPBA 4MOWA 3LHKA 2PSJA 4B2IA 1O0SA 1C1DB 1PQYA 1WZIA 1NASA 1E1CB 4R6WA 1Q91A 1RYMA 1Y81A 3M2TA 2I6GA 5FOUA 1KI7A 1AKQA 2IP4A 5LDGA 4BN5A 4RESA 5E8JA 2NIPA 3PNSA 3BSFA 4WXMA 4LCBA 1GU0A 2XE8A 4C07A 3L84A 2PN1A 1WCIB 2H16A 4RD6A 3UGTA 3OEWA 2CHFA 4IDFA 1QAQA 5HUJA 2I2BA 4NEHB 5HTKA 3ZUGA 2XNHA 2D5LA 3IXMA 4KYTA 1QC5B 3GLGB 4R2WA 2ZJ8A 1DKLA 4CLDA 5THXA 4LWPA 3K0AB 4NBRA 4ZT7A 3WB2A 1ZPDA 4F4UA 4FCCA 3E1GA 5C35A 3VDNB 3BYZA 4X66B 3IBTA 2HWYA 5BSGA 4G85A 1NMZA 5JR3A 2KS6A 2GZDA 2ZFUA 3LQRA 4CMIA 1PK7A 5KKAA 4ALNA 4J75A 5CNKA 4JDUA 3IPCA 2FUG1 2OFWA 5DHAA 2C2MA 5JMWA 3Q11A 1SXJD 3B1YA 1ZXBA 2HLDA 4LJ8A 3TINA 1ZVVA 2YVKA 3DCJA 4OHVA 5LQKA 1LTHR 5JW6A 3H75A 3I6QA 1PO7A 2F1KA 3BWCA 4A5OA 4E2XA 1FW6A 3MXTA 4L3WA 4C7BA 1MCZA 3E1KA 3RK0A 4EHHA 2IK8A 1WR8A 5KHOC 2V5UA 3K53A 1DS6A 1EFCA 1A96A 3H6KA 4UFNA 4C4YA 3NEJA 3T54A 2WTMA 3U60B 4IGAA 1OBOA 4LG1A 1EXMA 4LZPA 2R8YA 2AFVA 1PJLA 3FOCA 1SUEA 2UYCA 1GAWA 2AOTA 4FHCA 1G64A 4NZ9A 4K46A 10MHA 1OBHA 3N2GA 3OEHA 4YCAA 2VATA 1VLJA 2Z58A 2E5FA 3DBVO 3DMRA 3TEFA 1UQRA 2PH3A 1B93A 3TZLA 4A1OA 4B44A 4BZXA 3K5PA 3D3KA 1OGYA 4YI3A 4K9LA 2YMMA 5FV7A 4J76A 1M8PA 5AJUA 3F2IA 3O4GA 4MO9A 3HBNA 4CEIA 2CLLB 3ICOA 5TARA 3TLXA 1N6RA 1G9SA 3IAS1 3WB0A 3D4LA 2D7CA 1GKUB 2XB8A 3K9BA 1KERA 4HLCA 4NFHA 4QUHA 2JFXA 1RI1A 4AL4A 3DZ8A 2PR2A 1JKJA 1IIRA 2OV2A 1AZSC 4WBNF 1J07A 2GBIA 4YMUA 5DTQA 1JFLA 3UMVA 2HCRA 3O91A 3I61A 3GQVA 3NWBA 5DB4A 1D6NA 4Q9AA 2VP5A 3E81A 3MWLA 2XCSB 2J0QA 3INTA 2ZUDA 1JV2B 4B7CA 4FHDA 4YEDA 1BXZA 1SU6A 3F0TA 5LLTA 3NVAA 1XKTA 2HSGA 4U02A 1TM4E 4RMNA 3MELA 3RSOA 3GFOA 2P75A 1ISMA 3PQ6A 1X7ZB 3HU2A 4FE3A 1TL7C 2ZB7A 4UBIA 2PKEA 5FPPA 4CT4B 3CRRA 3ESDA 4ID9A 4TYYA 1GPLA 1G21A 1RQ2A 2XA1A 4MCAA 4JWKA 1UBTS 2B78A 1RVV1 4QQKA 2KLBA 2FXIA 5J5CA 4EO4A 5TF0A 1NY5A 4TV8B 2GN9A 4OHMA 5AOAA 1KH1A 1W85B 2GJAA 4DV2B 3E48A 4O4HA 1Z0IA 4P4NA 1HMPA 1QF9A 2A88A 4YJKA 3WGOA 2XJ4A 4ETMA 3PHIA 4YCBA 3UV7A 4E2YA 3I58A 2PX4A 4K9QA 1K6IA 1SQFA 4KPYA 1D1PA 5K1ZA 2QRVB 4WNIA 1W25A 1CUVA 4XD7A 1IOZA 1KJNA 2OTCA 3CONA 5ERYA 4ZVVA 4H7DA 4XTCS 5NLLA 1REQB 4BKPA 5IC5A 2ATXA 5DI9A 4NPAA 5KCMA 1D8TA 3QIVA 4GMDA 4LECA 4BGUA 3AQIA 3IE1A 3HCEA 4B6QA 2A4KA 2TSYB 1KE2A 4WERA 2XH8A 3KDAA 4HPWA 3VR4A 3CQ9A 4NXMB 3GELA 4D56A 2OV4A 2XNSA 3JYPA 4AX4A 4DNQA 3CS3A 4RH0A 1PUJA 5EL0A 4N47A 1J09A 3CLKA 3QUAA 2ZIXA 2J8ZA 3JZDA 2IXBA 2VJLA 1BXGB 2PTHA 4HXGA 4PC2A 3BIXA 1S2MA 2AMVA 2RG7A 1PJ2A 3FA2A 2P6OA 4EEZA 2PZGA 5B57C 4UM8B 4FFVA 2QLBA 3ZE2B 2HK7A 3KZCA 2VH1A 3IYLW 5I9BA 2DTXA 1KQ3A 4MJXA 4C2AA 3I4CA 1RJGA 4CRWB 3E7XA 2C7PA 2CCGA 4GZ6A 1TCVA 1P4JA 4K40A 5TQVA 3TB4A 4B1FA 4BWFB 2HT6A 1BDIA 2Z56A 1Z5VA 1CEEA 3CLSC 2H65A 2E18A 1AQ6A 5AMXA 3TQTA 3GP5A 4MB2A 3EZ9A 2IOQA 3L7IA 1K5HA 3ACBA 3KFLA 4KOAA 4RFSB 1KP9A 2Q2OA 4ZI3A 2PL3A 3LBYA 5K6RA 3GFQA 1S4MA 3IKJA 1HOXA 2ODQA 3EF1A 3O3MB 5K0EA 1AHIA 1J97A 3B9PA 2XUOA 3I04A 5FLXA 1RRCA 4IEIA 4RU1A 3FMGA 3IIEA 1IJKA 4Q4AA 3HB5X 1J8FA 1I14A 2GVNA 2ZR8A 3GCDA 2A1UA 4JT2A 7REQA 3A4LA 2QGZA 2E55A 2IIBA 2L42A 4FDTA 4V0LA 2JLXA 3JX9A 1GXSA 1AV7A 1U04A 2ZYDA 2LCIA 4E11A 3JTMA 3D7MA 4U4AA 4MVXA 1Y8AA 1JG4A 2WBLC 1T8WA 2FOIA 4BV2A 1G1AA 2FPUA 2M9MA 5JG7A 4YXWA 1I7QB 4PG5A 3G5UA 1R8SA 3PLNA 4XUEA 1FFXB 3DDSA 3FCAA 1KY3A 3OCWA 1AHHA 1SKMA 2ONZA 3A7DA 4PLYA 1Q3TA 3H9EO 5F7ZA 5CA1F 4MK4A 2XMZA 2COKA 3B1XA 4XIYA 3TIVA 3ANNA 2W4MA 3GRPA 1NUHA 1R9MA 2KPOA 4MI1A 4LZAA 1POWA 4UAGA 3DE4X 1Z6GA 3BG5A 5F4ZA 5PNTA 2IWRA 4Q21A 3WY9A 4JYMA 1OH8A 1YRBA 1BRTA 3DMGA 4C30A 2HB6A 2XTJA 5CFLA 1MOZA 2GTPA 3D3WA 3QTBA 1XKQA 3NALA 4OAPA 3O7WA 4BL5A 4EG1A 2QYOA 2BCGY 2WWHA 1YASA 4IHJB 1OT3A 4KSCA 2NT4A 3QXSA 2VPIA 4GLBA 4R68A 1E5QA 5DHTA 4QFDA 1E58A 5G02A 1HDCA 5FADA 5JFOA 2GBLC 4C1NA 2E4ZA 2GHQA 4FEEA 4TWJA 4ZOEA 3KXLA 2OPBA 1G5HA 3BK7A 3DDCA 3R3HA 5ALWA 3U16A 4B34A 4DAEA 5K45A 4NNPA 3FPEA 2FPIB 4ZXPA 3V33A 4K6HA 3RYHB 1RKXA 4F0JA 3W0LB 3UMCA 2HSJA 3I39X 4LF5B 2X7HA 3GOHA 3KOUA 1IVYA 4JJIA 4DARA 2GJSA 1BXRA 3VKHA 3KV3O 1JHRA 2C5LA 1FA9A 1E4OA 1IXSB 2IF2A 2VBIA 5LYJA 2A6PA 1YZTA 1XD2B 2FFBA 1YBMA 1P4RA 1RQLA 3CH6A 3OKCA 3OC0A 2DP4E 3RUPA 1Z5WA 2EL7A 2J3LA 3Q9UA 3V2IA 1T3SA 4QGGA 2D1SA 4G0NA 2NYRA 1VJGA 2FX3A 1AXEA 4K6FA 3QKWA 3R5HA 4IX9A 4D4LA 5AK3A 1QG4A 5IJAA 1JSZA 4JX9A 5KKCA 2V5VA 3V1KA 1Z8FA 4TXLA 4GUAA 5HA5A 1RP7A 4A8JB 3S1LA 1GFSA 4DT1B 2OXRA 1HV8A 2W71A 1U8ZA 4K0RA 1ENPA 4IIJB 1JT9A 2CUZA 3C39A 4JBHA 4MV1A 3SJZA 3UT5A 2CNDA 4J1TC 3U37A 3WTBA 1TZMA 5EIBC 1C2TA 3F97A 4E1VA 2ATEA 1CU1A 1FSSA 3BM5A 3Q10A 4AJ2A 4BFUA 1NW8A 3KVNA 4ZT5A 1GFIA 2FZCA 3JQQA 1NPTO 2CUTA 4Q19A 3N8DA 1VP3A 2QYSA 4GPZA 1II8B 4A0GA 5D51S 4D99A 4CLRA 4XFDA 2Y1KA 2AZ4A 4IQ0A 2PGXA 1Y4SA 3JD1A 1PX0A 2V7EA 2XCIA 4B48A 1JLHA 2AVDA 1H2EA 2PGLA 3BGSA 1GADO 3G1UA 1GY8A 4GR4A 4REOA 1YONA 2XWJI 3C8MA 3I5XA 2IYVA 3PD7A 4I1IA 4MGYR 2BE9A 4HWOA 5JDIC 4LC0A 4XYBA 3AHGA 1HBJA 4LQ4A 4BFVA 4I50F 5KMGA 1RQPA 2J33A 1CDEA 2FUG6 2HWXA 2XUPA 1XPRA 4PPYA 4MINA 1UXGA 3KQHA 4N3GA 1JZQA 3R40A 4JKIA 4UBKA 3W77A 2HHHB 4LQLA 1HXHA 2DKNA 1W4LA 2CHGA 4HNRA 4KI0A 5C1BA 3L01A 4K7JA 2I9KA 3X1WA 1UXJA 4GMKA 1HI9A 2JGFA 3B20A 1D5WA 4KQ2A 4WCDA 3GFTA 1N3YA 4N3CA 3ZHXA 4RPJA 4CHGA 1J42A 4J4HA 5C8YA 1PQPA 5C52B 1IB0A 4MYSA 2BFDA 2C4TA 2C9OA 1NN5A 4UEQA 5CPBA 3L79A 4LJKA 4OA5A 2GEKA 1S3GA 2VKQA 3KJGA 5FPSA 3FNRA 1G17A 1WM1A 4IWYA 1WTCA 4NV0A 3IJRA 4RY8A 1Y4UA 4LTMA 3N0VA 3SDZA 1Y9JA 4QJ4A 1HFEL 1K8ZB 2IIQA 2QN6A 3EH2A 2J7PA 2JCSA 2OAGA 3DTTA 3K72B 4ENWA 1ZM9A 4RS3A 1SXJC 1Z2AA 4BVEA 2IXAA 5TMDA 3R8CA 4TL8A 3K20A 1RPNA 1WQ3A 4UJ5A 3G88A 3MWEA 4N76A 3E5MA 3BTUA 1TE2A 1OIWA 3W5VA 3LDUA 2W6CX 1P1JA 1I4DD 2X15A 1DELA 5AKZA 5EQDA 5JFGA 1NW4A 1UPUA 1XIVA 3W4JA 5P21A 4Y1RB 2C88A 1FPMA 3REQA 1GG2A 2J9ZB 2BUAA 2R6CA 3IDQA 4EB8A 2JASA 3HDYA 4Y2QA 3FW1A 4MP8A 1YKGA 2CYCA 4YRCA 1MV8A 4IDPA 4EJ2A 5IJ9B 4KPUA 5AQEA 3G2QA 1DRJA 3EGEA 2XNJA 1XRPA 2JI6A 3PLAE 4TV9F 1YR1A 5FOWA 1T0BA 1GWNA 1FVXA 5CEEA 1YJ5A 2JIPA 3B82A 4OEHA 4Q4CA 3EIEA 1QTRA 1GAXA 2ZWMA 4JUIA 3RUDA 2CCJA 4JSYA 1ZSVA 2QT1A 5EMLA 2O5CA 1MQAA 1JG2A 3DH0A 3KXKA 3PFFA 2VHYA 2ZEJA 4BKUA 3DOIA 2IT1A 4O1MA 2FXVA 2GJ4A 4BU0A 2P5YA 3BD7A 5JQGA 3LY8A 4A8HA 4AQDA 4FKMA 2CSXA 2EKZA 2Y9MB 3HXKA 3QJ5A 4HAZA 3AETB 1J1UA 3UXHA 1QH9A 1GV0A 3CW9A 4YT5A 3SHVA 2IYLD 3F3YA 3E8XA 3FOAA 3PIRA 4NE9A 5ES3A 4M0MA 4D1YA 2XRYA 3WIVA 4KOEC 4NCJA 5IXJA 1T91A 3AG6A 3UC9A 5LD2B 1ODSA 1VMDA 4TSRA 1WOMA 4YUWA 4C5BA 1NFQA 1NMEA 1NZFA 1CJKC 1A5ZA 2GZ2A 1J24A 2ORWA 5FAXA 3PRYA 2DJ5A 2PV0A 2RBKA 1NU8A 3KM0A 4AKEA 2R4UA 3TLYA 4YLEA 5AESA 1MOPA 3A27A 4WKCA 4Z9AA 1B6SA 4OYHA 4C04A 1IU9A 1K4YA 2XGMA 1XFDA 2Z08A 1PQWA 3OLZA 1GZ5A 4UD2A 4Q48A 2VDQB 3NKVA 4D8XA 4RM3A 2QENA 3SR4A 2ZK7A 4YRNA 1V1RA 3GGPA 3BULA 2QZSA 4FVTA 1QKKA 2OORA 3TF5A 4B3SB 4MCHA 3BFKA 1PZMA 2DFDA 5CIYA 2BEUA 2H06A 5I5EA 4FONA 4HLQB 2EBWA 2ZBGA 1NMQA 2HREA 3HNOA 3WAJA 1QGAA 2ZQYA 1NJGA 1J21A 4B87A 4K9SA 4TZ6A 5JCZA 4LMAA 3A6FA 1XN1A 3KUDA 2KMLA 3SHWA 3VO9A 1NI4B 3HV2A 1ZD4A 2DY0A 2ZBEA 3Q9SA 4GRIA 5JC8A 1A98A 4L4ZA 1RXSA 4NU5A 3OU7A 2DSTA 3QPUA 1W76A 3HYCA 4IOKA 4II2A 2YRFA 4PE5B 4Y6PA 4B2PA 1LS6A 3C6QA 3ZS9A 1RQ7A 4X94A 4CG2A 4TSKA 2BFWA 4GNKA 5DW3A 3TN7A 2OE2A 3OAAD 1H9BA 2IYFA 2YN4A 2P2CA 2E48A 4OF4A 3FVTA 2AMFA 4XGNA 3C3XA 3CUKA 3FI9A 4EUNA 2AUNA 3A6JA 4ZYTA 2FEWB 3FPKA 1IK4A 1KEVA 4IZOA 3JR7A 3JVEA 4YAKA 3ZOZA 3FGNA 5K8CA 2FSIA 2XQFA 1ZKMA 2A1TS 5E7MA 3WYCA 2WNIA 3T1TA 5TJHA 1EUYA 1K7XB 4YDSA 3IPYA 3MWJA 1XEXA 1YWGO 1LNQA 2RI0A 2BP7B 3AP2A 3RG2A 3VR6H 2BM8A 1ZNZA 4Q05A 3P8ZA 4DQVA 4OI4A 3CV3A 1ZK3A 4XW2A 1HNZB 4UFPA 4RTJA 1HQKA 1SBNE 4ZEXA 5DTEA 1CUZA 1FB5A 3NOXA 4GMFA 4CT5A 3GLGE 4G5RA 4D8TA 2PMKA 4R71A 2P11A 5BN5A 3IA7A 5TQ0A 4NU8X 5IP5A 5K0ZA 3SEQA 4Q1FA 2RGEA 4F1KA 1J22A 2Q41A 3LF1A 4MZDA 5FULA 4LOJA 2QRZA 5FPTA 2WUFA 4CMKA 4AMGA 3F5QA 2BMWA 4JLUA 4XARA 5DM60 2DHEA 3WTCA 3AHHA 5GOTA 5LQCA 1C14A 1WCV1 2B7CA 1NV8A 3TQRA 4ACBA 4EB6A 2X8LA 5AKEA 2IDJA 4KQKA 2VDLB 3FVRA 4PXAA 3VHLB 4UAJA 2ZSFA 2Y05A 1EQAA 2I9PA 3OQNA 1U7DA 3PA6A 4NCKA 1BU8A 4XIJA 2O2ZA 4PSCA 3T6KA 2G82A 5ADUS 3AKZA 2BMEA 3G2KA 1NE7A 3LP8A 4JFAA 3QKRA 4FYPA 3RQSA 2IYZA 1Y8RA 4FGKA 2BZ1A 3FCCA 1AHNA 3E82A 5DI3B 3VXKA 1Y4AE 2BM9A 3AU8A 4PYLA 1LF0A 4OP1A 1LKZA 5DXFA 1PZFA 2HBYA 2QP9X 3HYLA 1M1YB 3PICA 4YACA 3ZGZA 3ND5A 4O4HF 4NJMB 1GAQA 3LWNA 3T3DA 2Q2QA 4QULA 1PAUA 1ZN9A 1JR3A 1KY5A 2FPPB 1BKDR 2JGLA 4K9OA 1L5HA 1DUIA 1J8QA 2EQAA 3TW0A 1VE1A 3WYEA 2JFGA 4HNVA 8OHMA 3DEIA 1RWPA 4YJHB 1KI1A 1IPEA 2RGYA 4I6GA 4ZODA 3JS5A 5JCJD 2WSMA 1JEYA 5DX1A 1CX9B 3HVIA 3HVRA 3T9CA 1ETUA 3KYDB 4BXOA 1YQWA 1U8UA 5BMOA 2QT9A 3MYYA 2ZIZA 3TUZC 4PZZA 4OQ4A 3NO4A 5IKPA 3HWSA 1Q74A 3E9ZA 1QWOA 1K6JA 1XP5A 3C6BA 3PSHA 4N5LA 1N5LA 1YB4A 2RFLA 2ZYUX 2XKKA 3UT6A 2YTZA 3LH5A 1YI8A 4AWAA 4E5UA 3QPWA 3AX6A 2R47A 3HV0A 1D2RA 5CP8A 3TLKA 5KCZA 3TEJA 2XGGA 4CM9D 1BVRA 3LQ4A 2LCQA 2D3TA 3PQ2A 4GL4A 1N8KA 3F5SA 4ZOQI 4ZAYA 5EMNA 4ZVKA 4RHTA 5AW6A 3LFUA 4UHJA 5LSAA 3K4PA 2NADA 2JFNA 1ZD3A 3G0BA 2CC2A 1XCLA 3TTUA 2H4JA 3IA2A 3IUQA 3OJFA 3IULA 4EHIA 2VAXA 4IMIB 1N9GA 2QZ9A 3DMDA 1IY8A 1R66A 3OOHA 2WAYA 3E7PA 3DUFA 1W49A 4JKYA 3H1GA 1T9HA 3LKBA 1Z0ZA 4PYMA 4IV8A 4UUAA 5IWCA 4XQGA 1DDOA 5JWRA 4WZAB 1KP3A 1OILA 2NUAA 3QEKA 3EX7C 1QBKC 4UW9A 2A8YA 3ZWMA 1K7EB 4QPCA 1NBEA 1I32A 4D0LB 4UTRA 5B4UA 3CVXA 2ANCA 5HCUA 1ZFNA 4I5EA 2CE7A 3L7BA 4XLZA 3OE5A 2QTMA 4QQ8A 1F4VA 5CLHA 3I1YA 3OBIA 3CO5A 2AEMA 1PJ4A 1CRWG 4F6RB 4A9AA 1EFPA 4CF5A 3AVOA 1GVHA 1F06A 3JTEA 3PGKA 4S0ZA 3QFSA 4GP9A 4UFOA 4K03A 3KIPA 4X93A 5DM1A 2BEKA 3SVZA 2GX6A 2IGBA 1HOTA 1NFFA 4RNCA 4JOCA 4R8MA 5FP0A 3RKSA 2RGXA 2HC9A 3MMSA 4DSTA 1FP2A 5CUQA 1NQAO 1CUEA 1JJAA 3V4OA 3KELA 2F62A 1DADA 4KFCA 3QU4A 3WVNA 2D7JA 2GFHA 4DG9A 5D6NA 3MT8A 3UXEA 4HYQA 1U2TA 2QLFA 5JHHB 4M3NA 4ZAXA 2D06A 3BK1A 2WTEA 3MTQA 4NJOA 3H1EA 5CB4A 1T5LA 4LUCA 4BGDA 3CH7A 4QOJA 1DEXA 3WV4A 1RBMA 1UPAA 2XB6A 2A5DA 1VC2A 3BBLA 1KWGA 2NSLA 2AW5A 1QYXA 2XZTA 3BWYA 3L7DA 1H4VB 3AERB 4MICA 3T3IA 4E07A 2BIFA 1TMYA 3BCSA 3H1TA 2FW0A 4N0DA 1FSGA 4YQYA 5J2UB 1KWKA 2QG9A 4JB2A 5B7PA 3CRNA 1JIIA 1UCFA 2OGWA 3CM0A 1O0BA 3ASYA 3GY0A 4DDUA 3SC6A 3VPGA 1KZ7B 2NO1A 3CPHA 2QD5A 1L6IA 4X85A 2X2PA 3KO8A 1UK6A 3HKCB 3H2YA 2YUIA 3BWXA 2MDTA 4GXQA 2AV6A 3B5EA 4YI5A 1MC1A 3RANA 2B82A 4BC0A 1SELA 3ZQUA 3HA2A 3H2IA 1BYUA 4BOYA 3L93A 4XGIA 3EDYA 3NHLA 3NM4A 3NBQA 4AF8A 3WADA 1Z5ZA 3NWOA 4R8SA 3HNRA 4YJGA 4RPLA 2BFNA 5K4AA 2I2WA 4S1TA 3RUCA 2Y4NA 5JS6A 4W9MC 5AHOA 2O3UA 4ZYXA 4K9MA 2K2QB 2J5BA 2R8XA 2PMEA 3K30A 3QFTA 4ZALA 4RVHA 3T1QA 2VTBB 4ZYZA 1D7AA 4RMJA 1DQZA 5IULC 4MAAA 3DHWC 3N8KA 1ZVMA 3DMFA 3EUWA 3IUYA 1TJNA 4ZQEA 3V7WA 3DP7A 4WKOA 1HQDA 3W3AD 3QE2A 4L07A 3ITDA 4MQ4A 4KH0A 1YSCA 3H86A 3Q7SA 2C2WA 3II6X 1I94B 3FDFA 1DEAA 2QAGC 4HDRA 1GQFA 4MV8A 2YBDA 1SBHA 2WD7A 3DE6X 3MGAA 3RH0A 2W42A 3PEYA 2BJWA 4DJTA 1B0PA 2MR6A 2ZB8A 3SZUA 4ALIA 4BLSA 2P1DA 4FX2A 1S2LA 1E62A 5DO9A 3U6KA 4X7PA 3RUAA 1LBIA 3RJ9A 1MBZA 2IUTA 4UREA 2R8BA 2B2CA 1KVTA 1V5IA 1Z2EA 2GHTA 3BKXA 4A6XA 5J2TA 3RCBA 1AA6A 1K5GA 2YHIA 4KQIA 4S3MA 2DQYA 3EIXA 3WIDA 3JQGB 4EPXA 4RTPA 4IFIA 2PUDA 4HQKA 4JY7A 3X1JA 1V47A 5IG2A 4WUVA 2AXNA 3UJ8A 5BWCA 1P2FA 2D1YA 1YUBA 3AM4A 3P9KA 4CLOB 1THMA 1YA6A 2RJOA 3N2LA 2YX1A 1X3SA 3GT7A 4U2CA 4DM4A 1IN4A 1UZAA 2ZYAA 4A2CA 4XPIB 2JH8A 1UZLA 4L6IA 1EUDA 4M83A 4RX1A 2WU3A 1DAIA 1R5BA 3DHVA 1BDJA 3VGJA 4CLOA 3CVJA 3AHEA 1B41A 1FTQA 2JJ1A 2Z1MA 4BQOA 4WVLA 3DBHA 3W4KA 5JRJA 2GN2A 1JFSA 4PAGA 4H0NA 3JD2A 3AW8A 2ZUTA 2OMKA 4A1FA 1U2RA 1XP8A 4JQOA 1U98A 1E6LA 1X1EA 1XZLA 2N1MA 1GUZA 3O73A 4QFCA 4ZHQB 1E9AA 1XZKA 2A7XA 2O48X 2XPCA 3C6YA 4TYMA 4YWJA 4JB0A 4YV0A 5AXBA 3TG8A 1QPZA 4FLMA 1LLQA 1E0JA 3NW9A 4G5OA 1P8JA 4X7RA 1XRMA 3TTWA 1LSJA 2WJIA 4NCBA 1LUAA 1NC1A 2R79A 2RARA 2YZNA 3KTAB 4PSKA 3LCRA 3NEYA 3GXOA 3UK2A 5C8YF 3GDFA 1XZJA 1PGOA 3KB6A 4QXRA 3L18A 3VYRB 3E7DA 3SVLA 4M22A 5HE9A 5HHTA 5G4LA 4XB2A 4TMYA 3ZWNA 4WNAB 1J00A 3GBSA 5CLJA 3ZQ6A 1DARA 4OUDB 1T36A 1JBEA 2W6QA 4IDOA 2CJPA 3OCCA 3ZNQA 5B3JA 4AIRA 2XDQA 4IY1A 3GRAA 3C70A 4B3TB 3IBSA 1JAIA 2ZT6A 3OHPA 4HG2A 1ADYA 4LV8B 1B6RA 2JLBA 2BEWB 3H16A 4C4SA 5ELLA 1RKUA 3MVEA 4PZAA 1I3OA 3WK5A 3EPPA 5KWIA 2CXSA 2JIRA 4RULA 1CKEA 2Y6UA 1FXUA 3I1FA 4MLCA 3OZRA 5DM70 4JX8A 3OPVA 5DULA 4YN3A 4DJJA 3KEQA 4Q9DA 3G9UA 1KRXA 1VFNA 1M1ZA 4MW5A 5A5VA 1HEUA 1KFKB 2PGAA 1RP1A 2I4IA 3R5SA 3WYNA 4ER7A 3NCTA 5CK5A 4Q7QA 5IBQA 1PS9A 1A1SA 3MW8A 4S1VA 1C30A 3NB0A 1QGUA 1V41E 4PSVA 1ORWA 3SYNA 5BT8A 2LIPA 3OPYA 1Q22A 2C9MA 3DE2X 3MMZA 4LDZA 2HLHA 3LX6A 2B5WA 5JMPA 5DNYB 4PLFA 1Q1QA 4URZR 1JH8A 1K0UA 1NXOA 1TVEA 2ZYIA 1JS1X 1H65A 1W0CA 3AR9A 3IUNA 3JATB 2C00A 4L4UA 4QICA 5EYPB 3P97A 3AJEA 1CVIA 5IVDA 5H02A 4DG5A 3G9XA 5D7BA 3PNMA 3HY3A 4Z4QA 4IDBA 3FPHA 3L1IA 4Q9JA 2R0QC 3F47A 4DTIA 5JQGF 4LE1A 2B94A 4QJIA 1GRCA 5CTJA 5LQMA 1MB0A 3M9WA 5A71A 4G4GA 4LHWA 4QUIA 5I9TA 4ZT2A 1SU8A 3BD9A 4GI5A 1XT6A 4AK9A 4IQFA 1Y48E 4R1PA 1ZNWA 3DEFA 5E3HA 2HWUA 1OWPA 2ACEA 1CERA 3JQ9C 4QECA 3UTDA 1MA3A 1ZK2A 3ZKWB 1EWRA 4C43A 4COKA 4IOLA 3LKVA 4LMBA 3DCYA 3I1JA 4DLUA 4KXMA 2JJYA 2OV3A 1W35A 3C1TA 2Z8YA 3EQ6A 4YCDA 3SIRA 4FDAA 1ECFA 2B8JA 2X8JB 2LZ0A 3LO8A 4C03A 1QO0A 1AXRA 1RHUA 4L75A 5B1SA 1QH1A 1UJCA 3GDHA 4ZQGA 4EG0A 2HA7A 2Q5CA 2QX8A 3G7SA 1XO1A 1ZO8A 2ZJOA 4JEHA 5SZJA 2JBHA 1W5SA 3RQIA 4YRAA 2VUIB 5D01A 1DWPA 1E7QA 3TLGA 3V7FA 1AN0A 1H4TA 4F5EA 5KNCA 3VGPA 4Q1EA 2AN5A 3BB1A 3OZ7A 4TN1A 5CNJA 4B6GA 4DN6A 3HUFA 1A1VA 3RABA 2HK9A 3P7MA 4FJ1A 3MEQA 2MJLA 3P26A 3U80A 1QO9A 2C3YA 1QF6A 5L3QA 1F0KA 4XH9B 3FWZA 5ALQA 2B0JA 2JCYA 2YQ4A 2OCAA 4BMVA 4R4JA 4AAYA 1W48A 2D3WA 4ZFNA 4CIYA 2CF5A 4Q7EA 2C83A 2V7WA 4I4NA 3T5TA 5BW5A 3SQDA 4YJ2A 5HNKA 3PG5A 4OATA 2H8GA 1I33A 1NOIA 3WGHA 1UKCA 2I8AA 3DR5A 2BFFB 2NPFA 5HKBA 2J0EA 3QE3A 2FLKA 3RC3A 4C2UA 2ONJA 1HDIA 4CIWA 1TQ6A 4OI2A 5KOJB 4I5DA 3X43A 3FROA 4TT3D 2CBGA 3F6CA 1IULA 1NBME 5EIAA 4CKEB 1FLAA 3V1MA 3R6TA 4F4JA 5KVAA 1G3RA 2ESRA 3BFPA 4HUQB 3A3NA 4MCJA 5JAMA 4D74A 5FX2A 3BCHA 2V0GA 5C32A 2OQ2A 1O9GA 3GRCA 4M0CA 3ZZNA 3ZIDA 2IF0A 3PFNA 3RUEA 1FQOA 1YBVA 2VRBA 2P62A 4WFJA 3GOQA 4GU5A 3L77A 3TTVA 2FCRA 2ZR9A 4PPNA 1CS4C 2RAUA 3AHJA 3AFGA 3DLCA 4DKJA 3NXSA 3BS4A 3ICCA 1IUOA 1HK7A 3G2IA 1VRCA 3E9NA 3GP3A 5IHXA 4NDNE 3VFDA 2O8EA 5FEUA 4EJSA 1NBAA 2DX7A 5EIHA 2PLRA 3AIMA 3PXXA 3EXEB 4H0FA 3WDLA 2H5IA 1I9GA 2B6NA 2K4MA 3F49S 3DFIA 3PF8A 1CHNA 3TL3A 1E9SA 1K0FA 3V5NA 4V1CB 3KWMA 3DL0A 5KAMA 2P5SA 1KH2A 2RAVA 3LMKA 5TGTA 2PE5A 3T7RA 2WB2A 4LF7B 4H7KA 3TCKA 2W6IA 2ZB4A 2GXQA 1BS1A 1Y6GA 2XXBA 5AVZA 4OQEA 1QH8A 1JL3A 3HBAA 4D42A 1FDRA 2C57A 2BGLA 1Y7PA 3GQBA 3AFOA 4RANA 5L6LB 4PGHA 2C2HA 1Z2NX 2WJ4A 1MABA 4HGQA 3H2SA 1A9ZA 3AEYA 4AQ7A 4ZAGA 3ENVA 2GPWA 4MULA 1EM8B 4TV9B 5GY7A 4LVUA 3VM6A 4C5CA 2PXHA 3IKTA 3U3JA 2FR1A 3QY0A 4OQYA 3WNVA 5HX7A 1V16B 3B70A 4FKZA 2VHUA 3B6JA 3DMHA 5K2OA 1T2FA 4XYEA 1T9ZA 4NZMA 4BFYA 1NOKA 2QRPA 5C9ZA 2G9UA 1N9KA 2QROA 4C6SA 4J0CA 3QM1A 1YB6A 1IZ8A 4ZT6A 3I9V1 1E8NA 5MF6A 5HFJA 1M34A 4G26A 2EP5A 1P5ZB 3SHQA 1N2SA 1TAUA 4N5MA 3B13B 3DHEA 2GR9A 2JJMA 5DX0A 5LLSA 2BDEA 1EVLA 2PPLA 3K9HA 3OM8A 4DYVA 3QVJA 4MVJA 1MB9A 4MQMA 1R0YA 2CHUA 4D81A 3B3QA 1NQVA 2L18A 4WACA 2OOSA 1P18A 1YR6A 2H9IA 3BMCB 4NCNA 4TT8A 2QAIA 3RUHA 1MIOA 4HB4A 5HQ3A 1Z12A 2H8KA 4MW2A 2XJ9A 4ENUA 1UKYA 2EG5A 2HHCA 5FTNA 5GQSA 1BVYF 1HNWB 1VIDA 4AMYA 1T8Y