2PZLA

Crystal structure of the bordetella bronchiseptica enzyme wbmg in complex with nad and udp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
310
structure length
310
Chain Sequence
SHMRILITGGAGCLGSNLIEHWLPQGHEILVIDNFATGKREVLPPVAGLSVIEGSVTDAGLLERAFDSFKPTHVVHSAAAYKDPDDWAEDAATNVQGSINVAKAASKAGVKRLLNFQTALCYGRPATVPIPIDSPTAPFTSYGISKTAGEAFLMMSDVPVVSLRLANVTGPRLAIGPIPTFYKRLKAGQKCFCSDTVRDFLDMSDFLAIADLSLQEGRPTGVFNVSTGEGHSIKEVFDVVLDYVGATLAEPVPVVAPGADDVPSVVLDPSKTETEFGWKAKVDFKDTITGQLAWYDKYGVTDIFSHLSAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Predicting protein function from structure--the roles of short-chain dehydrogenase/reductase enzymes in Bordetella O-antigen biosynthesis.
pubmed doi rcsb
source organism Bordetella bronchiseptica
molecule tags Sugar binding protein
molecule keywords Putative nucleotide sugar epimerase/ dehydratase
total genus 107
structure length 310
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pzlA00
2RIRA 4FFPA 1SAYA 1YGYA 3LU1A 1JAXA 1UZMA 4LVUA 3UH1A 1HSZA 1Z73A 1ISFA 2DPHA 5JAZA 4WNCA 4D42A 3GG9A 1B26A 4D7AA 5KVCA 3AUTA 3OMLA 2J3KA 4S1VA 4YA6A 1Y1PA 3DMTA 3GN2A 1CYDA 4PLWA 2PKQP 3NTRA 1PJSA 4EUHA 5F1KA 4DYVA 4WKGA 5K6AC 2QG4A 2IYOA 3ZU5A 3W6UA 1KERA 4R01A 1LUAA 1E3SA 3EVTA 1JTVA 2JCVA 4RORA 3S2GA 4GSKA 5JC1A 2YDXA 2GDZA 1VSVA 2GLXA 2VCYA 1CWUA 1F06A 2Q49A 4UUOA 3KBOA 3ZW9A 4EDFA 1EVZA 1X13A 4BUCA 3A1NA 3IP1A 1WNTA 2VWQA 2IXAA 1D4FA 4UULA 1IB6A 4II2A 2FP4A 2PTGA 1WVGA 1CIVA 2C82A 4J91A 3OP4A 2WYVA 4DPKA 1GQQA 3OETA 3ZN2A 1QORA 1ZSYA 3CUKA 5ER6A 5BSHA 3EZLA 5L45A 1HTBA 1I01A 4CM9D 1YVEI 2C2YA 4NBUA 1GQ2A 3NTQA 1SCUA 3FWZA 4UEOA 3OIFA 4NPCA 3WIDA 4FPXA 4YJFA 5GZ3A 1NHWA 4YJHA 1C0LA 4R54A 1LQUA 1P9LA 4GPD1 2OZPA 4CMBA 1E3JA 4BNHA 1M2WA 3ZWCA 2OO5A 3OJEA 4MKXA 1TEHA 4MO2A 3Q0EA 3GEGA 3RQSA 2EGGA 1I2CA 1UP6A 3WS7A 4DQVA 3D0OA 2EJVA 1I36A 5JDIA 2X7HA 1XGKA 2V7PA 3DBLB 3CKYA 4RQUA 1BW9B 2TMGA 1ZZEA 3OIDA 2WMDA 1RJWA 3DO5A 5HWSA 3BMNB 2ZB7A 4KOAA 4BGUA 1K5HA 1VJTA 1M67A 4RPLA 3KYCA 5JDCA 5KCZA 4CLDA 1ENOA 4FIZA 4CM3A 4CM9A 4ALMA 1B2LA 3GVXA 1ISIA 4G81A 3DB2A 5CPFA 5EQFA 1D7OA 3AM5A 4ND2A 4I1IA 4FW8A 4PGFA 3GGOA 3KYDA 1KYQA 4E5PA 1DLJA 2PLAA 4IZHA 1UXGA 1QKIA 1NX6A 1LDEA 5ITWA 3C1OA 2QIOA 3AM3A 4DQXA 1E6EA 2CVOA 3WGHA 5DNAA 1LDBA 4BNYA 2Y67A 2ILTA 5IJZA 4GKVA 3R0IA 1OFGA 1P31A 1YKFA 4BO4A 3CZRA 3FNFA 4P4LA 1H5QA 1A5ZA 1ADCA 2QHXA 1P1KA 3N74A 1QR6A 4HV4A 1DXYA 2WSBA 3GEMA 3ICPA 1LRLA 1C1XA 3MWEB 1MB4A 4ITUA 4J4BA 1PGOA 2NUAA 2YJZA 3D64A 3B70A 4IS2A 2HKIA 1ZK3A 1V8BA 2GGSA 4OXNA 3WGTA 3HB5X 3INTA 1ZFNA 2Z95A 5G2OA 1C1XB 3E5MA 4YB8A 2HMWA 1H6AA 1PEDA 5U9CA 5F1PA 4CV0A 4EEXA 3AUUA 3FNEA 3CXRA 1PJ2A 2JCXA 2W2KB 2XAAA 5JAQA 1A4IA 2GZ1A 2VT2A 1KEUA 2SCUA 3ZWOA 1Y8RA 3C7AA 2ZK7A 2NVBA 1E3IA 1P3DA 4YJDA 3W8DA 1B8UA 1QLHA 4JGBA 4YJHB 1C14A 2YY7A 4TMFA 3TWOA 5B4UA 2FHSA 2P4HX 1P1FA 4AJHA 1Y8QB 3C3XA 3PLNA 5I7EA 4Q3BA 2Y1GA 1C1DA 1QV6A 1VI2A 1QYVA 1YO6A 2NTVA 1T4BA 4B4UA 3ITKA 3DZHA 1QSGA 5CDTA 1B7GO 4J4TA 3SEFA 1J4AA 4DA9A 3GUYA 2IYPA 4XQEA 4D41A 1LBEA 2GF2A 5IN4A 2GN9A 3ABIA 2VTEA 4F45A 1I2BA 4WOJA 4ZJUA 1LDMA 4DUPA 5DT9A 3D3WB 2E4AA 4W9NA 3FCOA 1ORRA 2EERA 4KP7A 1BVUA 2UAGA 3LQFA 4OXYA 5B1YA 4YAKA 4MVJH 4KUGA 4RF2A 4YAIA 1L7EA 3DBRB 2CY0A 4RO0A 2CVZA 3PP8A 2EW2A 1HDGO 1ML3A 2Q45A 1U9JA 4ND4A 4R69A 4EGFA 4R1NA 2H1SA 3ANLA 4L73A 3QVXA 3D5QA 3KSZO 3ZWPA 1Y5MA 5A5EA 4IDCA 3WIEA 1AE1A 3TOXA 5JPIA 4PLVA 4CL8A 2HO5A 1OAAA 2WE8A 1EFKA 2IZ0A 2YQ4A 4NG5A 3FNGA 4U6QA 3GRKA 1WZIA 2HMUA 5FWNA 2Q2QA 3GN1A 3UCEA 4MVJD 5IAAA 3Q9UA 4L4SA 1GD1O 1K6IA 3JD1A 3JYOA 5CHEA 3D7LA 3RJ5A 2DFVA 4WE3A 1VPDA 4JXKA 4QXMA 1DSSG 3GEDA 3ZV6A 1U1IA 2A4KA 3PFWO 5FYDA 3MJVA 4M86A 4MP8A 4CPDA 4JLWA 4D3FA 1YB5A 3VC7A 3HSKA 3WQRA 2HK8A 2PZKA 4WGGA 1BHSA 3V1TC 1JA9A 1PGNA 2D59A 2UDPA 1HT0A 5G4KB 4GX5A 1GQYA 5HS4A 3F46A 3KEQA 4RLHA 3BTVA 4HFRA 1V3UA 3BXXA 4Z9XA 3WBBA 5JLAA 1QG6A 3GNTA 1K0UA 5TGDA 4FQ8A 3W1VA 5HA5A 2OL4A 3I9OA 3L6EA 1PS9A 3WWZA 1U3TA 3HDYA 1RM3A 2B4QA 2VYNA 3JTMA 1AHIA 5EJ2A 3TF5A 4MINA 4OSOA 3WMWA 5CDYA 1QV7A 3HDHA 5GMOA 2J3IA 3DHEA 5L7YA 1FDTA 4RCVA 2NSDA 1NQOA 3B20A 3F1KA 5T67A 3DBLA 4Y8VA 3ZWXA 1KVUA 5EIOA 1N5DA 4CMEA 3UGKA 4BNWA 1TT5B 4OMUA 4FFNA 1UP7A 3IS3A 4IUYA 3IKTA 1O6ZA 5CEJA 1A71A 1CEQA 1WXDA 3OF2A 1FMCA 2O50A 2DUWA 3CE6A 4D0SA 1R15A 4IMRA 4OH1A 2BELA 1EUZA 4L76A 3G1TA 2UVDA 4OAQA 3V2GA 3WGQA 4Y67A 5A02A 1QYXA 2O3SA 1AUPA 3UW3A 4OQYA 1EDZA 3DBVO 4FOOA 2B35A 3GG2A 4IQ8A 3DZBA 4MVJM 2JD2A 5ENVA 4BO1A 4O5OA 2WD7B 4YYZA 3E82A 2VUSA 4GX0A 4IXWA 1LI4A 5BSGA 5IN5A 4R3WA 3CTMA 3RBZA 2VHXA 1E77A 3BHIA 5F5LA 4OIMA 4Y6RA 1E7MA 1BSVA 2X23A 3MJ4A 4TWRA 2Y68A 4XJTA 3RBVA 1T2AA 1X1EA 4DVJA 4BHTA 2CUKA 4A0SA 2DT5A 2NWQA 3JQAA 4TQGA 3RROA 3TZHA 4U6SA 3V2HA 1YE3A 1NAHA 2BRUA 2R6JA 3OEYA 4J7UA 2Z1MA 3HNPA 5DULA 1PX0A 4G5HA 4EBFA 2VOEA 3SBOA 3TFQA 4LN1A 5TT0A 2GN6A 3ONDA 3ZWWA 1GZ6A 1JWBB 1X0XA 1CERA 4MPDA 1A9ZA 3DAGA 4LCEA 1O8CA 3GA0A 3GDOA 3DR3A 3PQEA 5I7SA 3RSHA 1DC3A 3LT4A 3PRJA 3DONA 3L9WA 4DMLA 1WLYA 4NR0A 1U5AA 1E6WA 2ZCVA 4ESOA 5FFFA 2GZ3A 5K9ZA 3MJTA 3AFNA 4RL6A 3C8MA 5DZSA 2GN8A 1AXEA 4CM4A 4F46A 5JDIC 2QX7A 2PWZA 3IAHA 4ND5A 3RAJA 3DAFA 2JD0A 3FSRA 4BNKA 4JQCA 3ZNQA 3K2BA 5IDQA 1YH3A 2AG8A 3FHLA 2X6TA 3PI7A 3E03A 5IDYA 1ZK2A 1GUZA 3WXBA 1C0KA 3ZWYA 3VZPA 3AI1A 4BO7A 1MXHA 5KIAA 1IZ9A 1BXGB 1SB8A 1FDWA 4HY3A 3T7CA 4CMHA 3FR7A 3HFSA 4ZGWA 3PPIA 5GY7A 4OM8A 1LTHR 1ZO8A 2ZQYA 3FD8A 5G0SA 4WASA 3B1JA 4D44A 1HDRA 2HQ1A 4NZ9A 3GFBA 4XKJA 5A9RA 4RVGA 3SC4A 4U0KA 4HWKA 4ZU3A 1H6DA 1TT5A 3AK4A 3RFVA 3S1LA 2QRJA 4RF3A 3ZCXA 2GN4A 3VZRA 5K0ZA 3K31A 4AJ4A 3ICCA 1JKJA 4A26A 1A7KA 3S55A 4RVSA 3K30A 3MTJA 3RC7A 3V2UA 2BI7A 2CF6A 1RM5A 2Q3EA 5DOVA 1LXCA 1B14A 3KYDB 4DBZA 2I66A 3DTTA 1LDGA 4XEHA 3E18A 4FR5A 2PGDA 2X58A 3QIVA 4FC7A 4LMRA 4WUVA 1KC3A 1BRMA 1PJQA 1V9LA 3WG9A 2NADA 4J3FA 4JIGA 2B4RO 4L74A 4OOFA 4TRJA 2YV3A 3ZW8A 3LK7A 4FJ1A 4NDNE 1YOVB 2NTJA 4LSMA 4XYBA 1PGJA 3MTGA 4XGNA 1HXHA 3ULKA 5CFZA 4E31A 3DZIA 1BG6A 1IUKA 4P38A 2ZTUA 3ITDA 1DEHA 2BGKA 3H7AA 4BVAA 4CM4B 3QRWA 4MP3A 1LLQA 1BXZA 3IP3A 3ZDFA 3O8QB 4RPGA 1GDHA 2RBEA 4O6VA 4JCOA 3I83A 3WSVA 3RU7A 3F5QA 3G49A 5IDWA 3ZHBA 3PWSA 3RKUA 3UHAA 3V1UA 3PGXA 4CLEA 3QHAA 4BO8A 3AM4A 2WDZA 3IUPA 4HXYA 1ENPA 2EF1A 5CP8A 4GX1A 5EN4A 4BQRA 4QO8A 1GEEA 2CD9A 3RUEA 2G5CA 1QRRA 4MVJA 1YQXA 3WB9A 3TL2A 1HYGA 1Q0QA 4BNZA 3GOHA 5TLSA 1EZ4A 3CIFA 1LDNA 3M2PA 1C0IA 2HDHA 3JQCA 4NNJA 1I8TA 3JQFA 3I9NA 4XIJA 4YWJA 4ALNA 3O8QA 2CZCA 3VOSA 1VRWA 1CQJA 1UH5A 2ZTVA 3IJPA 2A92A 4FOSA 1KVSA 4UVDA 3TPCA 4LW8A 2TMDA 1P45A 4XJSA 2O7QA 3K96A 1H93A 4ZQEA 3IQDB 3U9LA 4OYRA 5B12A 4J0FA 4XYGA 3GFGA 4XIYA 5A9SB 2FY8A 2I3GA 3OJOA 4J2OA 4RF5A 1BVRA 3PJDA 4EZBA 3DOJA 5BNTA 2AQ8A 3N7UA 4I9NA 3BZUA 1C0PA 3KO8A 1ZMTA 3WLEA 4CLRA 3B1FA 3DOCA 3NTOA 2XOXA 3EC7A 3PHJA 3TZKA 4GVXA 3U4IA 4CM7A 2H63A 3ADPA 2C20A 5T57A 1X7HA 4R41A 1M6HA 3G17A 4XRGA 1SOVA 1FF9A 3PDJA 3VPSA 2HMSA 2UUOA 3Q2KA 5A1TA 4E2XA 2DAPA 2J5KA 4Q3NA 2NVUB 1TXGA 4NU5A 1PL6A 1YBMA 3H3JA 1XSEA 2FR8A 1HSOA 5ER9A 4UUMA 2NQTA 5HM8A 4PLHA 4XDZA 2NU9A 3B6ZA 1EE9A 5JC8A 1PZGA 3QW2A 5F21A 4AL4A 1IHXA 3JQEA 1OC4A 2QYSA 1ZKMA 1ZBQA 3O4RA 3H5AA 4LGVA 4BV8A 4CLRB 4DMMA 4DRYA 2JKVA 4WEQA 1DRWA 2Q2WA 4WCDA 2RHRA 3V1YA 4GL4A 4BO6A 4J43A 3JQGA 3I9KA 4OGWA 3RWBA 1P74A 3SVTA 4TVOA 4KDEA 1GYQA 1E7SA 2NVWA 3U49A 3UN1A 1VJ1A 2ZYGA 4BV9A 2E82A 1DIBA 5BNIA 1MFPA 1O95A 4OKIA 4DIFA 4DLAA 3I5MA 5HBRA 4I5EA 4INAA 3HWRA 4CQMA 1LDYA 3JCZA 1LSSA 1DFHA 1MA0A 1ZJYA 2WYUA 4GBJA 3ONEA 1E3LA 4GGPA 3L4BC 3H2ZA 1U7HA 1E1KA 3DXFA 3TFOA 1Q0HA 4AJNA 2DU8A 2O3UA 4FCCA 5DBFA 1UDAA 2ZKLA 1NFQA 1WDLA 3JQ7B 4B4WA 3KUXA 4KMSA 1GAEO 4S3MA 2Q1TA 2O7SA 3TRIA 1HKUA 3AU8A 3Q11A 1EUDA 1GZ4A 3HN2A 4Z3KA 2P91A 3GT0A 2W4QA 3HDQA 5L51A 3ORFA 2O23A 4YT2A 4RF4A 4GMGA 3FWNA 5IZCC 4PLZA 3GHHA 1YJQA 3BMNA 2PR2A 3LYLA 4D3SA 4Q3AA 5DCYA 3OEWA 4R1TA 3OM9A 2B37A 1K6XA 5JY1A 5EMHA 1OMOA 3GVHA 3PWKA 3RKRA 3LT0A 3K8ZA 2C5AA 4KWIA 3AI2A 1GPDG 3LC2O 4J1NA 2OP1A 2BGLA 4RQTA 4AJPA 4CV2A 2NV6A 5CDSA 5KWEA 4ND3A 3MEQA 1IULA 3JD0A 3GZ4A 4YRBA 2HU2A 1P1JA 5I9NA 9LDTA 4U0JA 5ILGA 5C3MA 3HN7A 2EV9A 1YL6A 1CETA 3DZKA 4MVJP 2OGUA 1DAPA 3EAGA 1DFIA 1E7RA 5I8WA 1ZVMA 1F12A 2VZ0A 4JN6B 3WWYA 4F6CA 3EYWA 3BTOA 1ONNA 3RJ9A 5BT9A 1E5QA 1G0NA 1ONPA 3L6OO 3JV7A 2FSSA 3RC1A 4UUNA 4MJLA 3RI3A 1DHRA 4FFLA 1UP4A 4GAEA 3FTNA 2B0JA 2JCYA 3TZCA 2PA3A 4FJ0A 2C7VA 5JCJD 1Y81A 5C7IO 4EJMA 1NFRA 5LCXA 1FDSA 1TT7A 3VDRA 4BNIA 1MV8A 4M89A 3NGLA 4PLYA 2Q1WA 4D45A 1FDVA 1P1IA 2RAFA 4ROSA 5H83A 5JFOA 4XGIA 1VL0A 4CUJA 1XWFA 2WTBA 3L4BA 4J1QA 3H8VA 4QQRA 1ADGA 1QXSA 3WYEA 2X4GA 4MIEA 3DZGA 1PGQA 1YQGA 5ILOA 1VLLA 3JQBC 3W6ZA 1DC6A 3SC6A 4ALKA 4Z6KA 4ZRMA 1I3KA 4JNKA 4DXHA 5MDHA 1DBVO 4TRRA 4R16A 4BKPA 1IHYA 3CSDA 4LRSB 3RC9A 1ZXBA 3DL2A 4CMIB 1ZMOA 3O26A 4GLLA 4R3NA 4CJXA 1D1TA 4N18A 2EGHA 4TKMA 5DN9A 2G0TA 4NH4A 4XQCA 4ZD6A 3ASVA 5AQ1A 3OJFA 4IS3A 4E3ZA 3PJEA 4WCFC 2CDAA 4JBHA 2BH9A 1IY8A 1XLTA 2XXBA 4QT0A 4IINA 2P68A 4BMSA 4IZIA 1JKIA 5ENDA 2QYTA 2AHRA 1Q7GA 3JYPA 2HCTA 5I9LA 4F6LA 4NU6A 3RD5A 3GR6A 2IRWA 4MIYA 5CG1A 4D43A 5JBIA 3QVTA 4KDFA 2Y99A 4XA8A 4C7JA 3RBXA 3BTSA 4ALIA 3OQ1A 5KKCA 1JU9A 4EW6A 5EL0A 5HS6A 2IEBA 4ZQFA 2FPGA 3ZHZA 3EMKA 1XA0A 3O38A 2HMTA 1VKNA 1DIGA 1XELA 3F4BA 2VT3A 5T6BA 2P9CA 1RKXA 5AOVA 4CMAA 4CQLA 3L9XA 4YJGA 1R4MA 2R00C 1A9YA 4BO0A 1Y6JA 2Y1FA 5JCXA 1MG5A 1N8KA 1NP3A 4BNMA 4YXFA 5IDXA 3IDSA 3F5SA 3TZ6A 1ZXLA 2J5RA 1I33A 4CV3A 2DVMA 2G76A 4QSMA 3WGGA 3JQFC 1KBZA 1E3WB 1FJHA 3UF0A 3VZQA 1MLDA 1F14A 3HADA 3OJ0A 3LLSA 1H9AA 4NQZA 1EE2A 2YHIA 1T1SA 5JAIA 1E3WA 4YVFA 1BTOA 1JN0A 3M2TA 5JO9A 2B4TO 3GMDA 8LDHA 2I9PA 4OOEA 3QWAA 2FN7A 4MVJG 4TZKA 3D1LA 4NFYA 1V6AA 2FZWA 1ZEMA 3FRJA 4B4OA 3NT4A 3RVDA 4GLOA 4NBTA 2UUPA 3GNQA 4Z9FA 4PLTA 1HF3A 3BMCB 3HE3A 3FN4A 2J6IA 3D4NA 5ICMA 1I3LA 1UAYA 3HHPA 3AU9A 1H2HA 1E7QA 1YONA 5L4LA 3ZU3A 2G17A 1VL8A 2JHFA 5L7TA 4XYEA 3I6QA 1ZK1A 4CMCA 3ZWNA 1D8AA 5I7FA 1Y8RB 4Z9YA 3H5NA 3ZWVA 3OA2A 2EJWA 4NJMB 1DHTA 3F47A 4XR4A 3A9WA 1A4UA 4HFNA 1R66A 1Z7BA 3WQQA 4QEDA 4AJEA 1NAIA 1Y8QA 1EK6A 4WCFB 1NWHA 4PG7A 4RPHA 4K9DA 2GR9A 4L9RA 3HG7A 4RJTA 3NT5A 1ISJA 4KZPA 5IZ4A 4RVUA 3RUDA 3W4IA 4I08A 4CR7A 4CUKA 2PGLA 5KJFA 1DPGA 4E30A 3GGPA 1I32A 1NVMB 2OORA 3E9MA 3KV3O 1MXFA 4UREA 4QTZA 3E8XA 3U09A 2AQHA 4QECA 1BGVA 2Y1CA 4R1UA 3BMOA 1YBAA 4Y6PA 4BMVA 4L0QA 4ZRNA 4Z0TA 1ISHA 4YCAA 2VNAA 3ASUA 1GYRA 4EEZA 2DFDA 3QVWA 5A9TA 1SNYA 2O48X 2P5UA 1B15A 1LC3A 4DQUA 1BW9A 2X0JA 1GCOA 1KEWA 1R12A 2VQ3A 4XYLA 2R2GA 1HZZA 4Y9DA 3C7CB 4GWGA 3TQHA 2VUUA 3KB6A 1SC6A 3SLKA 2Q1UA 4BKUA 2D1YA 3K73O 1ZSVA 1BXKA 4D3DA 1JWAB 1U8FO 2VTDA 2ZB4A 1A27A 2O4CA 2W90A 3UUWA 1OZAA 1SZJG 3GNSA 3ZV4A 4L75A 5B4VA 1Q1NA 2W2LD 3QWHA 5LC1A 2IZ1A 1Z7EA 1L7DA 3ROMA 1KIFA 4UVGA 1ENZA 5L40A 3MOIA 4JJIA 3MOGA 4O0LA 2O3JA 5LDHA 4TSKA 4PZCA 4U8GA 2VWHA 5L9AA 4E5YA 2PGJA 2YQ5A 3RFXA 3D3WA 2RHCA 2G1UA 4BO2A 3EUWA 2PKRA 3INGA 4R5MA 3JQ6A 5FEUA 1VJ0A 3P2YA 4YJFB 2B5WA 2P5YA 5J23A 1M76A 5TJHA 4CM5A 2A94A 4MDHA 4CM8B 2VNSA 1I3MA 3L6DA 3FPLA 1LX6A 4W7HA 4DPMA 3EK2A 4BS9A 1EVJA 1U3WA 2YUTA 4YAEA 1O89A 2CF5A 5G0WA 5KKAA 1HE3A 1YJ8A 4BGVA 1CQIA 5T8KA 1MP0A 5AYVA 1GEGA 2W2LA 3PHLA 1V0JA 3X2EA 3S8MA 2Y1EA 3SXPA 4FN4A 1T25A 3EVNA 4TKLA 4HKTA 5IFLA 3SLGA 5COQA 5A05A 2JFFA 5T5QA 1ZCJA 2OP0A 1DIAA 1DFGA 5TC4A 3WYCA 1PIWA 4R5HA 5F5NA 4K1LA 3NT2A 4E2ZA 2Q99A 4CV1A 3QLJA 2AE2A 3EHEA 3AJRA 2OXIA 2YHIB 3I3OA 1IOLA 4BB6A 2ZATA 4PLFA 3K92A 4E32A 2PY6A 4NK5A 3DHNA 3WGYA 3NV9A 4RPKA 1AXGA 4CQMB 2JAPA 2VN8A 3ZWMA 2GNAA 4TROA 4YACA 3C24A 1X0VA 4R9SA 2WJPA 2EP7A 3ZNNA 4BQPA 1LLCA 2OFPA 3ZI0A 1W4ZA 1IZ0A 4ID9A 4CL3A 5BSFA 3OBBA 2LDBA 4DC0A 3A28A 3DZFA 2H6EA 3DWFA 3QSGA 3W8FA 3FR8A 2OUIA 2VYND 3RASA 2VYVA 1XYGA 3S2IA 1UZLA 2PH3A 1GV1A 3RIHA 4ZICA 5TF4A 4WOKA 1W73A 5JS6A 1PWZA 1VSUA 2WM3A 2ZCUA 4FC6A 3GGGA 3ZHYA 3ZH2A 4OL9A 4IJUA 3KYCB 3DEYX 4B4VA 3L77A 3KSUA 2CNBA 4E21A 4E2WA 1HDYA 1VKOA 1XG5A 2GD1O 1E1NA 4CUZA 5C7OO 3PTZA 3E48A 2NU8A 1HDCA 4AJKA 4L8VA 3PZRA 2X9GA 2FWMX 4GKBA 2Q2VA 4HX5A 1GUYA 2JD1A 3VH4A 4CQMD 1HRDA 1LSUA 1M75A 3H9GA 3Q6IA 2UYYA 4KQWA 3IMFA 2I67A 3H65A 1NR1A 2WYWA 3COSA 3LF2A 3RUFA 4B3HA 2ZJ0A 3IC5A 3E9NA 1KETA 2D8AA 4GQAA 1LJ8A 4PFJA 3QWFA 4LISA 2E37A 2Q50A 3C1TA 4LK3A 5TIIA 4DREA 1ZUD1 4IQ0A 1P1HA 5BSEA 4BL5A 3H9JA 2O2YA 2CDBA 1U3UA 1OC2A 2C5EA 3E5RA 5A03A 4CR6A 3VTFA 4I9UA 4JP3A 3OSUA 2EKLA 2D3TA 3VVCA 2VHVA 3MWDB 3G3EA 4WLEA 3Q1LA 1EMDA 5CEEA 3VHRA 4RVDA 4ONEA 4A10A 1B8VA 1KC1A 1T2DA 2GUGA 1NQ5A 1KS9A 2B69A 2P4QA 1DB3A 1FXSA 2JHGA 1EFLA 3D5TA 4B8WA 3F1LA 1H6BA 3L4SO 2V6GA 1I2ZA 4YEDA 5AXAA 3VZSA 2O3RA 3N58A 4NK4A 4WECA 3QWBA 3VTZA 3PXXA 2XPCA 5THKA 4RVHA 1DO8A 2BHLA 3GAFA 2J8ZA 3KEOA 4UVIA 1PTJA 1P0CA 2J3JA 3PYLA 1T24A 1SMKA 7ADHA 1Q2XA 3DMTC 4GWKA 1IYZA 1U4SA 5G0VA 2PK3A 1XHLA 2V6BA 4A03A 5CAEA 1ISGA 3H3FA 2FPPA 1UXJA 3JD2A 1BMDA 1XDWA 1YRLA 5H82A 5KJCA 1U7TA 1LLUA 5I8ZA 1J0XO 3JD3A 3ZGYA 4BGIA 5K6AA 1CF2O 3UAGA 3BA1A 3RUIA 2WD7A 2X0RA 1UUFA 3NGXA 1YB4A 1KVTA 5B37A 2EWMA 4G2NA 4IDBA 2IEDA 2VHYA 3BHMA 4J7CA 5TX7A 3M6IA 1NBOA 4BIIA 1VC2A 4YPOA 5KVSA 1NTOA 3PYMA 4WLNA 1SOWA 1KOLA 5L7WA 1RM4A 4QO7A 3LF1A 1E92A 1PQUA 3WTCA 4XGKA 1DC4A 1WPQA 3GPIA 4J7XA 2FOIA 1QYWA 3S2FA 4BNXA 4ZA2A 1HLPA 1WZEA 4IDGA 3ETGA 1BXGA 2A35A 3BHJA 3FNHA 3I1JA 5ICSA 4A7PA 4ALJA 2BGMA 3ON5A 1UZNA 1H94A 4DLLA 1L1FA 1M66A 1ZK0A 3G0OA 1U8XX 1ULUA 1EEHA 3QA9A 5JY6A 4E33A 3WICA 4IBOA 2NLOA 3D3EA 3GVCA 3T4XA 1UDCA 1DOHA 4Q9NA 4XR9A 1R0SA 4N5NA 4MIOA 2AA3A 5JAMA 1HYEA 4AICA 3H2SA 1OI7A 1DJNA 2BFOA 1Y9AA 2P9EA 4CM1A 4TRMA 2OMEA 1AHHA 3TNLA 2PV7A 1JVBA 3UOGA 4RGBA 5TRTA 1I10A 2DBRA 2I76A 4M54A 3IOYA 4CLOB 5TQVA 1G1AA 4U5QA 1ULSA 3PWZA 1D1SA 1VM6A 3H9QA 3PLRA 4PCVA 2Z5LA 4HBGA 3IJRA 2AQKA 4NBRA 1LSOA 3MCVA 5BQFA 1X15A 1NNUA 2X5JO 3GK3A 5ADHA 2Z1NA 4PIVA 5JDCC 3S2EA 1EK5A 1H9BA 4UVHA 1YQDA 2VOJA 3BMCA 3I4CA 3K6JA 1J6UA 4IJKA 3TJRA 2FRDA 7MDHA 4U7WA 4BB5A 3VH2A 4I5GA 5FF9A 1RYEA 2BFMA 2C0CA 3L0DA 3CMMA 3GHYA 5G4KA 4ZN6A 3W4KA 4DLBA 3CMCO 5KVQA 2FSVA 3NDIA 3PGJA 3QWIA 4H15A 4JP2A 2NTNA 5DF1A 1HDZA 5JXWA 3I9MA 5A9SA 4W82A 3FPCA 5ITVA 3PJGA 4QUKA 2D5AA 3ZZNA 1HZJA 3WTBA 4H7PA 3WFIA 1BDBA 1N1GA 4JX8A 2ZB8A 2Y1DA 3PIDA 1LA2A 1RM0A 2VWGA 2AG5A 2X9NA 1PGPA 2O3QA 2AEFA 3HZZA 3LZ6A 3MJCA 2YW9A 3UXYA 3GF4A 1PSDA 3TDKA 1UDBA 5JMPA 3Q9NA 1X14A 3VAZA 1PJCA 4DIOA 1SEVA 3ETEA 4OKNA 4B7UA 1GUFA 2BF7A 1X7DA 3ZU2A 3T4EA 1F8GA 1E1MA 5DOZA 1PZEA 3TZQA 4FDAA 2VZ9A 3P19A 1HDXA 2VYVD 2E48A 4FGWA 1DLIA 5GZ1A 1RPNA 1Q0LA 5C5IA 4D0RA 4DWVA 3GZNA 4WLVA 4RZIA 4LSWA 5BNFA 5DDIP 5JNLA 3CINA 3GC6A 2HLPA 3BTUA 4BOYA 3JD4A 1JKFA 2DM6A 3OA0A 1SO8A 3R3JA 3KSDO 4XX0A 4PRKA 3E6AA 1WDKA 2ZIZA 1C1DB 1YXMA 4GI2A 2YV2A 2BFPA 1WP4A 1K89A 1P77A 3CH6A 6LDHA 4JBIA 1P33A 3JQAD 1ZH8A 2AXQA 3HUDA 3GAZA 1K6JA 1DRVA 4J1SA 5THQA 2IZZA 4OO3A 4WJZA 2GZ2A 1YS4A 4Q39A 2Y0DA 1XEAA 1ADFA 1JW9B 4CMGA 5EERA 4IJVA 1E5LA 1EQUA 1WMBA 4BNFA 5EQDA 4MVJF 2NVUA 4CMIA 4BNNA 1GADO 5HTOA 1XQ6A 4UAGA 3D4PA 3FTPA 3UCXA 4Y6SA 3WDSA 4E12A 4R4JA 1PZHA 4AJIA 5FI5A 3SX2A 1T4DA 5L4SA 4CODB 1VL6A 2EXXA 1OBFO 2GYYA 3BYZA 4P22A 4XCVA 1YOVA 4Q3DA 3DFUA 1E7YA 1CDOA 1Z45A 3AOGA 3WSWA 2GCGA 4PZDA 4KTVE 4MOWA 2Y1OA 2OHXA 1XU7A 3JQ8B 4HNGA 3IL2A 2C54A 2VRCD 4WK6A 2X0IA 4E5NA 1EDOA 3OHSX 2PZMA 5DCWA 2I6TA 1XCBA 1Z82A 2HSDA 3VH3A 1DAOA 3LC1O 2AW5A 4UEKA 5L53A 4II3A 5KOIA 4DGSA 1PJTA 4AJLA 4C7KA 1PWXA 2GSDA 1GZ3A 2FPIA 4OJNA 5IXYA 2WD8A 3NKLA 1A7AA 3OIGA 1PJ4A 1NVGA 3P2OA 1E3EA 1BWSA 3H9EO 3Q2IA 4B79A 3MJSA 2NACA 1FDUA 1KVQA 2PNFA 1HL3A 2OOSA 1PJBA 1YBVA 3V5NA 2D0IA 3JQ9C 3NAQA 1NM5A 1PS8A 4E6PA 2QRKA 1TB4A 3BAZA 4XB1A 4YDRA 5EINA 4DPLA 1HE5A 3PVZA 2E49A 4K28A 3KHUA 4EJ0A 2NNLD 4J9UE 3AW9A 1B16A 1CJCA 1F17A 3PEFA 5COAA 4IGEA 1JDJA 1O9BA 2J5QA 1U2DA 2PKQO 1R16A 5BR7A 4NFSA 2VRCA 3I9JA 4RPJA 3GDFA 4LMPA 4K6CA 1GCUA 3E9QA 2AMFA 3DQPA 4RV9A 4J2HA 5KNLA 3PJFA 4GSLA 4NBVA 3H6KA 5FI3A 5JYDA 4IIUA 1Q7CA 4NBWA 3DAPA 4OXKA 1YDWA 2DTXA 1KEPA 2RH8A 5A04A 2DBVO 1PR9A 2BKAA 4NIMA 4AJJA 2O2SA 4JK3A 4FB5A 4R51A 5IZCA 4O59O 1AN9A 1JVSA 3GMSA 3DTYA 2NQ8A 2YZ7A 2E6UX 1QLJA 4B3JA 1ZJZA 3RUAA 2EKPA 1T2CA 3M1AA 1N92A 1E1LA 2Y05A 4RZHA 5G4LA 3QV1A 2QZ9A 2DQ4A 1LEHA 2YHUA 1LQTA 1V3TA 4YAJA 4TVBA 2V6FA 2Y66A 3UKOA 3VVBA 4LCJA 1PL7A 1UJMA 4XD2A 3RC2A 5JW6A 1WW8A 2ZTLA 5U1PA 3ROQA 4YT4A 3MJEA 1KY4A 3ETDA 3F6YA 1EBFA 5EPOA 3D4OA 3HDJA 4EUFA 2VHWA 4IM7A 3OICA 4A5OA 3Q3CA 3OQ6A 4W6ZA 5HRUA 3K9QO 5F3RA 4DL9A 2QRLA 4YT8A 3ENKA 1RWBA 4BNUA 3QVSA 3W4JA 3WQSB 4PG5A 3O9ZA 3C85A 3VKUA 3INRA 5KVVA 2PZJA 8ADHA 2FR0A 1Z75A 3JYNA 1PR3A 4MVJE 2QW8A 4WLUA 4K26A 5CDUA 1S6YA 4P4NA 2BD0A 2BFAA 2ZJ1A 1B0AA 3DC2A 4ZQHA 1YL5A 1U5CA 4CLHA 1R4MB 4MP6A 1HETA 5F1OA 1ISMA 1PQWA 1U28A 2DLDA 2HRBA 3ZV3A 1JQBA 3RUCA 2EEZA 2IE0A 5GZ6A 1BDMA 4NJMA 3JQBA 3TL3A 1NPDA 5A5FA 2GERA 4E13A 1GY8A 1WWKA 3NEPX 2CDCA 2AEMA 2DKNA 1I0ZA 3U4CA 3OQBA 1DRUA 4H16A 2B5VA 2DC1A 3GUCA 3E1KA 3DOOA 4Z0HO 4RLSA 1JAYA 4DIBA 5TNXA 2GRAA 3ZNPA 1KY5A 4NI5A 2HMVA 4B8ZA 2FMUA 2ZYDA 4TRNA 4YRAA 2ZYAA 5A3JA 4FFMA 1W6UA 3AY3A 4J1TA 1N7GA 4PZEA 2F00A 1MG0A 1T2EA 3WGIA 3O03A 4KTTE 2EP5A 4YRDA 2D5CA 1TVEA 4J16A 1GL3A 4Q3EA 1LSJA 2OBYA 2JFHA 5KJEA 4DC1A 2NU7A 4J6FA 1QP8A 1PZFA 3GQVA 3LC7O 5MGBA 1NASA 3WJAA 2EIHA 1V35A 3LVFO 4QFCA 4ZQBA 3ST7A 3WJ7A 1IPEA 4BO3A 4AG3A 4HNHA 3H5RA 2FR1A 1K2WA 3IUSA 1G6KA 2Y0EA 1X7GA 4FJ2A 3VDQA 2HUNA 3OJLA 3VPXA 1H6CA 4X54A 1VE9A 4JBGA 2C59A 2X0NA 4KQXA 2IODA 3WGOA 1HYHA 3EGOA 3WR5A 4PLGA 3WX0A 3F4LA 3NJ4A 2BI8A 4YJGB 3U3XA 1Z6ZA 2G82A 4XQ9A 1NYTA 3P5SA 2O4UX 4YT5A 4KUEA 4Y98A 3DBRA 1GU7A 4I5FA 4FD3A 4HP8A 5JE8A 1TA4A 4BNGA 4NFHA 2WWRA 1NR7A 3OH8A 1MFZA 3NRCA 1YL7A 2R00A 1LNQA 4B7XA 3I52A 2JL1A 4GVLA 4E0BA 3HJAA 2X9VA 5C7LO 1ZK4A 3EY4A 1WMAA 2F1KA 1ZSNA 2I5PO 4XRRA 3NX4A 2W2KA 4PLPA 3STHA 1JLLA 1T26A 5IF3A 4J4HA 3JQ9A 2I3AA 3QVOA 4AJOA 3ENNA 5IXSA 1WDMA 5L4NA 3JQ7A 3WLFA 3ANMA 4I5DA 1LU9A 1PJLA 4ILKA 4R9RA 3U5TA 2DBZA 3ZV5A 1N9GA 4EUEA 3BMQB 1B3RA 5AXBA 4CMEC 2ZTMA 3ROKA 1AGNA 4XWYA 1DDOA 4A27A 1O94A 4ZVVA 1M6WA 4JJFA 3ADOA 3KYBA 4CR8A 2CVQA 4GGOA 1Y5RA 3JQ8A 1KVRA 3EZYA 4W4TA 1EVYA 2CSUA 2BMAA 3DBHA 3I6IA 3WBFA 3WOHA 1NQTA 3M1LA 3FI9A 1SB9A 2NM0A 4IDDA 4RDHA 4HUJA 1X1TA 3A14A 3R3SA 3HQ4O 3FBTA 4EI2A 3PHHA 3NDRA 1NWCA 2B83A 3I4FA 4P8RA 2PD3A 5G0TA 2C29D 2VUTA 5A06A 1N1EA 4OQZA 2I99A 3KETA 2JJYA 1NFFA 1QYDA 2ZQZA 4AFNA 3BIOA 3KZVA 1R4NA 2P2SA 2Q1SA 4L4XA 2JAHA 3GPDG 3R1IA 4WLOA 1I30A 3UFXA 4IDAA 1I3NA 4UVEA 4YTEA 3BMOB 4CMKA 4C4OA 1UAGA 9LDBA 5AXCA 3ZNOA 2A9FA 2W8ZA 2J3HA 4J9VA 3ZWAA 3DBHB 3C1AA 3T7EA 1YDEA 2IXBA 2WE7A 4R68A 5KJ1A 1DC5A 1MGOA 4NMHA 1J49A 4URFA 2D2IA 4LVCA 3VH1A 1R37A 4BO9A 1GYPA 1N7HA 5TJ9A 1I24A 3PQFA 1GFSA 3DMYA 4M87A 3WMXA 3NUGA 3WGZA 4M55A 3VPHA 3TSCA 1XU9A 3NYWA 2VWPA 1S7CA 2DPGA 1YB1A 3AFMA 4QFDA 4FS3A 4E4YA 3I23A 3U0BA 2PH5A 5H81A 1GV0A 1UXHA 3HFGA 5I7VA 4RDIA 1ADBA 1O0SA 2GPTA 4HFMA 4CM6A 4ZHSA 3PZBA 1G0OA 4HFJA 3H9UA 1H0KA 2HK9A 2JFGA 3NDJA 1EQ2A 2XF8A 5DP1A 1DIRA 1PL8A 3LLVA 4IGFA 3CZMA 2HRZA 4YBZA 5I9MA 2POQX 3VKVA 3CPSA 3G79A 2X8LA 2Q46A 4Z3DA 4YR9A 4FBGA 3VPFA 2VZ8A 4UEJA 1F8FA 2V65A 3AOEC 4A73A 3L07A 4OSPA 1T1RA 4N54A 2YFHA 3KXDA 1NXQA 3OECA 5AXDA 4BO5A 1MX3A 5JCJA 1NHGA 2Q4BA 1P44A 3PYXA 3QY9A 1ZEJA 2IDZA 2Y93A 3AWDA 4MKZA 2DBQA 2X1HA 4CQLB 2C07A 1W0CA 5T8KC 1O5IA 1RYDA 3LSYA 3H4VA 4IMPA 1D3AA 4DTIA 2GASA 4M1QA 2YYYA 4IDFA 1B8PA 1XQ1A 4E5MA 2X86A 3GZNB 2VHZA 3DZJA 3FF4A 3UCFA 4I8XA 2BLLA 3AUSA 1ONOA 1LRJA 4HADA 3VPGA 4CLOA 1YWGO 4XZ3A 4IJWA 4PVDA 4BKRA 3I9LA 3RCBA 3X2FA 2D4AA 4ND1A 4WEOA 2P9GA 2PD6A 3WNQA 3WNVA 4E5KA 4BNVA 5TSDA 5TT1A 1HE2A 4O63O 3EDMA 1FK8A 5A4DA 3DFZA 1Q7BA 2HJSA 3ONFA 4FFOA 2EW8A 5COBA 1ID1A 4CM8A 4NHEA 4CMJA 5IG2A 2RH4A 3KM0A 4Z0PA 4N5LA 4A2CA 2OBNA 2DTDA 2EKQA 5KTKA 3ZU4A 1Z74A 2EHDA 1EVIA 1H2BA 4NJOA 3GH3A 3GVIA 4PG8A 3JQGB 2AEJA 3KLPX 4L4RA 2PFGA 3K5PA 1B3BA 2CMDA 4J0EA 3UVEA 5U4QA 4WLFA 3V8BA 4EYEA 1R0LA 4K6FA 4EJ6A 2LDXA 3PIIA 3IIEA 3F3SA 3AY7A 4F3YA 3AOEA 3B1KA 4BKQA 5JO0A 2PZLA 2YDYA 4XB2A 5L3ZA 1XR3A 2Y0CA 3TOZA 4YQZA 4ALLA 1NVTA 3ANNA 2Q4EA 1LLDA 1UR5A 3JYLA 3P7MA 3WYBA 1QMGA 4W7IA 4BNTA 2X5KO 3JQDA 3JYQA 1HWYA 5DCUA 3KLMX 1P1RA 1HE4A 4XYMA 2DTEA 1A72A 1DIHA 4AJ2A 5CG2A 4MVJI 3W8EA 3R6DA 3UICA 1P0FA 2ET6A 1GTMA 1GPJA 4IY1A 1F0YA 1NPYA 5CDGA 2CFCA 1DJQA 3U4DA 4D46A 3PQDA 5KJ6A 3DHYA 3GVPA 4DBVO 3HB4X 3NJ8A 1PU2A 5DP2A 6ADHA 1Y7TA 1OOEA 4EITA 5A3VA 2B36A 2GO1A 1HDOA 4DYDA 2WEKA 3AI3A 4WPGA 2ZB3A 1Y9EA 2UV8A 1SPXA 3PFFA 2H9IA 1N9GB 1U4OA 1E6UA 2AQIA 4IXTA 4IQGA 4RVFA 3U4HA 1EUCA 1WAMA 4QX6A 4KWHA 1SEPA 4XDYA 3SJ7A 1U3VA 4H3VA 4PG6A 3ZWBA 4N5MA 1MC4A 3PHGA 4G65A 4FFRA 4PG4A 4M8SA 5AVOA 2HK7A 4ZQGA 3RFTA 2YV1A 4AVYA 4JJGA 2C7GA 3GDGA 4AJ1A 2H5LA 1SBYA 1E0DA 5B4TA 4BNJA 2FZEA 3BMQA 1ENYA 1T2FA 1NQAO 4CLXA 1MUUA 2HAEA 2AE1A 1XKQA 1W8DA 2V6MA 4Q3CA 3LDHA 5EESA 2W98A 5LDGA 2QZZA 1PS0A 4FGSA 3OFSA 4PRLA 1N2SA 3DDNA 3GY0A 4BMNA 5JSFA 1LC0A 2YFQA 3WFJA 1TLTA 4IIVA 4J90A 5C37A 5CPBA 4OHUA 4R1SA 1CRWG 3ZHXA 4J49A 2DUUA 4BNLA 4N7RA 4BKOA 4JROA 3CEAA 4GX2A 1I5RA 1ZW1A 3GLQA 5TS3A 4B3IA 3IKVA 1QYCA 3EW7A 2EG9A 5DBIA 5G0UA 1ZNQO 1PQPA 1V3VA 1TI7A 1MC5A 4B7CA 1HLDA 2PD4A 1R4NB 3TN7A 5JMWA 4I9HA 3KRTA 5ES3A 3AY6A 1J5PA 3PK0A 3QE3A 2XXJA 4PN3A 4FSHA 3C7DB 3K2EA 2VRBA 5DBGA 1K3TA 1NPTO 1ARZA 3QJ5A 1HEUA 3RU9A 4GH5A 4PVCA 2NU6A 5CEFA 2C2XA 4GMFA 1XIVA 3RUHA 4D79A 3JSAA 3PDUA 1LRKA 3ROPA 1IPFA 5L95A 4UUPA 4WCFA 1KEVA 3A06A 4MKRA 1E7WA 2I65A 4KUHA 4LRTB 4W99A 1IL0A 1UXKA 2QQ5A 4WNIA 4PLCA 1PJ3A 3A4VA 4BGEA 1U2GA 3GRPA 3LT2A 3QP9A 4M49A 3KOUA 3PHIA 1UXIA 3AUAA 2X22A 3SJUA 1EBUA 4W9NC 3MZ0A 4YAGA 5T64A 5JYEA 3LT1A 4XQGA 1R0KA 4E2YA 2HJRA 2RCYA 4IPTA 2X5OA 4IDEA 4O1MA 3QQPA 2O3TA 3JQAB 3U62A 4P4GA 3FBGA 1ZIDA 3KVOA 4YQYA 3G1UA 3F9IA 4TZTA 1GR0A 1C3VA 1R6DA 3KTDA 1IE3A
chains in the Genus database with same CATH superfamily
2F2TA 1LW7A 5E9QA 1SAYA 1YGYA 1T5BA 3IVAA 5HZGA 3EXIA 1UZMA 2V97A 1W59A 3UH1A 3I0NA 3F8WA 1HSZA 1Z73A 1ISFA 1MO6A 4RANA 5EKUA 4XH9B 1B26A 3VX4A 4D7AA 3E3NA 1KZ4A 1JQKA 2J3KA 3OMLA 2ZAIA 1FNSA 3F8SA 3PXDA 4GP9A 4U7PB 3UJ6A 1QHIA 1Y7LA 3FYUC 3GN2A 3OZCA 1CYDA 5IK2D 3GLGA 4BCDA 4QEKA 2WJVA 1PJSA 2VUHB 1I1OA 3C6XA 4DYVA 4WKGA 1RFGE 4LJYA 1GT6A 3LP5A 2IYOA 1I7LA 1N25A 3TTTA 1Q1AA 1TM7E 4UTZA 4R01A 3SE0A 3ZXIA 4KXVA 1N75A 5ENZA 1CCWA 1JTVA 2AX4A 4K6HA 1SXJB 4RORA 3WISA 2VL7A 2YDXA 1PEAA 1KU0A 1VSVA 2GLXA 1ONSA 1KZHA 3MAAC 1WZNA 2P6UA 2PX3A 4MRAA 3CBQA 4KLZA 1TZMA 3GWGA 3ZHOA 3ZDQA 2B2NA 1KJQA 3SSMA 3X2SA 1WNTA 3MTBA 2PYIA 2YWHA 4BNDA 4BATA 1HZZC 2QR5A 2BM9A 2Z58A 2C8JA 3HO6A 1WVGA 2W11A 2Z98A 3KAPA 3N0RA 1BMTA 2H4JA 4LZAA 4MAFA 1CIVA 3GLIE 2FWRA 3OP4A 2PZEA 4LHYA 2G9RA 4GRIA 5TE9A 2IPOA 3ZI4A 1S4MA 1DDGA 1X7WA 3ZN2A 2C2WA 1GVHA 1QDEA 3CUKA 1VE7A 2ATCA 2DQKA 4UU7A 5IJWA 1HTBA 5DYTA 3CH7A 1I01A 3AHIA 4CM9D 2C2YA 2QGFA 5JVDF 5JROA 4EKDA 2B3TA 1NLZA 2WTAA 4TSRA 1V5FA 1S89A 3H6HA 5ALTA 5CB6A 2BDUA 5B7NA 4YJFA 3RYFB 4GEGA 5GZ3A 1U0BB 4YJHA 1C0LA 5AW3A 2XUQA 1LQUA 1SKQA 2CFIA 2O14A 1VIVA 1VYHA 1IN1A 4QYWA 4A6PA 2XX3A 1NLUA 2NG1A 3LWBA 5CXXA 1XDSA 3WMFA 4KLAA 2PUDA 3TS1A 4LGCA 3Q0EA 3MD0A 3R23A 2XMQA 3TTUA 4FFSA 3MCAA 1E8MA 2VDWB 1UP6A 3KOYA 4RSRA 4DQVA 1AN0A 1YQ9A 1Z62A 2Q5OA 2R7NA 4TMVA 2V7PA 1WSBA 2ZSIA 1V11B 1W4CA 2CHFA 3LLUA 4TLAA 4ZOLA 4D0NA 4DUZB 4UDOA 1BD4A 1UJ2A 1Y9JA 4EB6A 4CG3A 2O2CA 4HRAA 4GI5A 5LMNB 1O03A 2F9FA 5HKAA 5IAGA 1PSZA 3E2MA 4KPYA 4ZYVA 5KCZA 1GKYA 1NW8A 1U90A 3E7FA 3UFXB 4CM3A 2BFCA 3C7KA 4RQAA 5HKLA 2VDNB 1ISIA 1R8QA 5DMHA 4DIMA 1C8LA 3I34X 4G81A 1HLGA 3SCZA 3DB2A 1FNBA 4IO1A 2OZKA 2V3VA 2WSMA 3E9DA 3FI0A 1E2KA 3HI4A 3Q7RA 4KGZA 5EXEA 4C87A 1H3NA 3W9UA 2R0QC 1DLJA 1E9AA 2PLAA 5AI4A 5ALJA 1UF9A 4YN3A 2ASVA 2QM0A 4JELA 3D3QA 3E22B 3VNVA 2ZJ8A 3VNAA 3GCGA 2D2VA 3VA7A 1RRPA 1IBSA 2QIOA 3IMCA 2MSDB 1XTJA 5HOQA 4FONA 3FJ1A 3CCCA 4C06A 3S8YA 2WHPA 3PFCA 3B5EA 3KZMA 1ZD8A 3FCYA 1E2FA 1YTLA 3SZGA 5JJ5A 1J7JA 4P4LA 3C4JA 1WM1A 2R1TA 2VBCA 2QHXA 3N74A 3SJCA 2ONKA 2B1GA 1OAOA 1JEOA 3BT7A 4V0NA 1PGOA 2L42A 2OM2A 2YJZA 2HKIA 4E2FA 5HUHA 5JXIA 1ZK3A 1JG1A 1IEXA 1V8BA 4WN3A 5IHPA 2FPIB 3LWDA 3SYTA 1F5NA 2XWJI 4F4UA 2GPJA 3KELA 2ODPA 1IZYA 1S8AA 1XZKA 3C8ZA 2HK6A 3IT0A 4PCAA 4PAOA 5IVDA 4LNHA 2Q6KA 4BQFA 4KPGA 4N8EA 1OTHA 4L8FA 4FZVA 4ZPXA 2CNLA 3QU7A 2CLHB 3C3MA 5JCOC 3MQ2A 4KE7A 3L6UA 4YP9A 3CXRA 1JEDA 3GP8A 1CUXA 1OX4A 1M6EX 1X42A 3I4LA 1KZ1A 3K9BA 2OCAA 4NULA 5JAQA 4B5LA 3UPTA 1YA8A 1YU6A 1B41A 4NMWA 4TOIA 2XMCA 3A6DA 3C7AA 4QHYA 4KR9A 1LI5A 2ZK7A 2IDMA 2JDIA 5BQ5A 2NVBA 4YJDA 3W8DA 2Q1YA 3WLAA 1QIKA 3C41J 1B8OA 1QLHA 4KFCA 3VFDA 1C14A 3GA5A 4DARA 2YCBA 2CEKA 1CVIA 1SBTA 1UZUA 3NNDA 4TKZA 1FUUA 1QGUA 2G1AA 1IIBA 3IXQA 3LWZA 1NF9A 1HK7A 1SVUA 1T4BA 2OTCA 4GVPA 1QSGA 1B7GO 1MX9A 1VGRA 3DGFC 4J4TA 4JDUA 1BYUA 4PNPA 5EPEA 3SEFA 3C4VA 2IYPA 2ZB2A 2OHJA 2GF2A 5IN4A 1Q95A 1WMEA 3IPCA 1SD5A 4RPCA 3ZWKA 1XZHA 4AS2A 1DJLA 2QN2A 2Z3VA 3N2NA 1LDMA 2ZU6A 4I19A 5DT9A 3D3WB 3VR3D 2LGJA 1NBIA 3KR9A 1BVUA 5FNVA 3LQFA 4HI0E 2FEOA 2C0PA 4Y0AA 1J1UA 1QZTA 1GLNA 3R09A 1BS2A 4ZCPA 3TTXA 5KNBH 1NLYA 3DBRB 1PK7A 2CY0A 3OLXA 4YMWA 2CVZA 5A0FA 1YSCA 1ML3A 1AKWA 2Q45A 1H22A 2NO5A 3KJEA 4IUDS 2HU5A 4ZI7A 1Y8CA 3RSLA 2F67A 3HKEB 3W1EA 3NYRA 5E6RA 5B53A 3V1KA 5I4KA 3A58B 1R6XA 4OJQA 1XQWA 4YFVA 3SNHA 1W2GA 2BCGY 2Y1WA 4NOKA 4RFVA 3SFTA 4E5VA 5A5EA 3WIEA 2AWOA 1AE1A 4I4TB 1AGYA 4IDNA 5LD2B 1RD4A 3LKBA 1M7BA 4X93A 2CUTA 2IGBA 2IZ0A 3GRCA 3QX9A 2PN1A 3ZUPA 4JBNA 3RT9A 2JK0A 3FNGA 4A23A 3W5CA 3I5YA 1T6XA 4QICA 1WZIA 5FWNA 3UCEA 4LTMA 4PBSA 4U9UA 4C4PA 4L4SA 1WUHS 5KTPA 4QLOA 3JD1A 1C7RA 1D1PA 3FSEA 3U4GA 4A8PA 4UXJA 1ZWKA 4J0HA 2MJLA 3JR7A 5LYJA 3K9WA 1FQJA 3IAM1 3QQ5A 2PMFA 4CRWB 5JVDA 3LLCA 4MW7A 3UOWA 4WRRA 5JYBA 4GYKA 5CB4F 4WFIA 3Q10A 3TQQA 3MJVA 4G36A 2P7IA 3S7TA 2WK1A 1T1IA 2JVIA 4JLWA 1L4EA 1F0KA 4Z4GA 2CCKA 3NVMB 2VCEA 3DMPA 2A86A 3L7JA 2CXPA 2DLCX 1NXPA 1Z3IX 2JLQA 2F8TA 2QE6A 5LQSA 3VC7A 2NXCA 3HSKA 3T5AA 4WGGA 4TN5A 1M10A 1RACA 1H0HA 3AL2A 3SMQA 1PGNA 3VR4H 1Y8AA 2XMSA 3DEHA 5FD8A 4ZDWA 1QUFA 2W70A 3WMGA 2DEUA 1OJ7A 2ECFA 4AKEA 2EFEB 5A0TA 2CNNA 1JEAA 2ZI5A 4QDOA 3KEQA 1U6KA 4PSUA 5IK2A 5LQAA 4HFRA 4QPDA 4IX9A 1E9DA 3GNTA 3QKRA 1K0UA 1YJCA 5EIWA 1U5BA 4QUBA 2MSCB 3U6KA 1G20E 2Y0PA 2DZDA 1B1CA 4L4UA 3AR8A 1WCIA 4WY5A 4AULA 1F8YA 3A3NA 3HDYA 3LRPA 3KEFA 4F3CA 3UT6A 5EJ2A 1IOZA 2YS6A 3JTMA 3N1UA 3OZEA 3TF5A 4OSOA 2Y6UA 1ELOA 2R97A 3QLUA 3HDHA 4KQFA 4MV3A 5CXSA 4KMRA 1XCOA 1FDTA 1GPH1 1U2QA 2NSDA 1G20B 3B20A 3BRWD 3EZNA 2AMYA 2JZOA 3G7UA 3L7CA 4N6OA 2FZLA 1KVUA 2HDOA 2VH1A 3KAJA 4Y8VA 1XN4A 5ALWA 3ICQB 4RE5A 2Z43A 1CRQA 2IXGA 4PYLA 5AM5A 5AT1A 3SYMA 2NT4A 4B2YA 4FYXA 1TX4B 5FL7A 2OLEA 2ZIXB 4PN7A 5CEJA 4HT3B 2VDLB 4PS0A 2GEFA 2JFBA 3E61A 3GV0A 1FMCA 2O50A 2DUWA 5ALMA 4FM9A 3FKSD 1XNGA 3NB0A 2K2WA 1FSSA 5A7HA 3VU1A 1JL3A 7YASA 1V4NA 1CHDA 4TQ9A 5FTKA 1IG3A 2HBYA 3GT7A 2DH6A 3PVSA 4H7DA 4Q0MA 3WGQA 1JU3A 2DWPA 3ENZA 1NXSA 3SHFA 3QFCA 1QCZA 3TOVA 3R3VA 3UW3A 3A36A 3QU5A 4LE0A 4FDTA 9LDBA 3FZEA 1XRLA 5ENVA 1U2ZA 4K46A 1RPTA 2YY6A 5H3HA 5TVKA 1A4XA 2G5TA 3MCZA 3SNKA 2O54A 3LTNC 4HLUC 1KQGA 2BEUB 2P2GA 4RLFA 4Y6RA 3VVMA 3LFUA 1E7MA 1BSVA 3EDYA 4XFDA 1WF6A 3C87A 2PZBA 4LXXA 5EWLB 2CXSA 1UMKA 4AS3A 4EA6A 3RBVA 4BBJA 3LBHA 3ZKWA 2CJWB 2ZI6A 1X1EA 2A88A 2IXEA 4QIHA 5CM2Z 5CM8B 1NQUA 3BKWA 2DT5A 2ZUTA 4E94A 2IYSA 3OEYA 3G8YA 5K3FB 3UC9A 2YZMA 3HNPA 1BFUA 3A6EA 1PX0A 3O4FA 3W5UA 4G5HA 1F3OA 1LPPA 2VOEA 5HK9A 4DBLE 5CB4B 1LKZA 1NKSA 4N0EA 3ZU6A 1JR2A 4TT3D 2DWCA 2QJOA 1ZGAA 2CVPA 3CX8A 3ZWWA 1JWBB 3PR2B 5DV9A 1Y0BA 4EPYA 1SU6A 1VRVA 1VBKA 2JI6A 1TMGE 1A9ZA 1GPKA 3DAGA 3RVLA 4EAAA 1GQFA 3QVUA 3PQEA 2OO3A 3QVLA 1WPXA 3LT4A 3PRJA 4BP3A 1JPNA 3L9WA 5GQSA 3W06A 2PZAA 1GO2A 1ODJA 2AHOA 3KQPA 4MICA 4Q1DA 4S24A 2QZPA 4MTLA 5DI3A 4DEYA 4TXJA 2WF6A 2RGBA 4RL6A 3TINA 1JBQA 1VSQA 3T3EA 1RPZA 1BYIA 2UKDA 1ZUNB 2J5XA 2KBFA 3RAPR 4XM2A 3JVIA 4Z7NB 4JQCA 5E1BA 4ZZIA 5IDQA 4V02A 4XUCA 1H0SA 2QXUA 3PI7A 4M8KA 4B6RA 4DMKA 1ZK2A 2C1ZA 1GUZA 2G7ZA 2Z4SA 4K9LA 2JIBA 3AI1A 3RFCA 2DRIA 2IPNA 3I76A 4BPBA 1JIUA 1FVOA 2HA3A 2YC2C 3I6YA 1X92A 3CNHA 4V24A 4LSZA 5DFAA 5IT0A 2WHPB 3QMPA 4DA7A 4FGJA 3LOUA 2FYTA 3WL8A 1NP7A 1FLAA 2AG6A 1E58A 3NP7A 4ZVOA 2ANCA 4OM8A 1R50A 5FUVA 3SYKA 3TBHA 4G4JA 3RADC 1HDRA 4NZ9A 4D99A 2QN1A 2PRYA 2EQBA 1F38A 4J3NA 1VXOA 2V7XA 1JHMA 4ATNA 3LI2A 1L4LA 2JJMA 1MQ9A 4OXQA 1A7UA 1KJWA 1TADA 4U0KA 4OQEA 2F62A 4HWKA 4ZU3A 4ZOEA 1TT5A 4RESA 3RFVA 5BV8A 5AOBA 3U7JA 1EH5A 2Z3WA 5A7GA 1H05A 1G7RA 5K0ZA 3I8XA 1QZXA 4X95A 1JI3A 2O07A 4MLZA 3LBNA 1N2BA 1KMHB 3B7GA 3LQKA 2J33A 1USGA 2GAOA 3P32A 4ARSA 4WBSA 5IVHA 2Y9PB 1AKNA 4XTRA 1RM5A 3LCMA 4X92A 5K6RA 4OX9Y 3CO0S 1E3MA 3KYDB 4OQDA 4J07A 1HTWA 1G21B 5FNVF 2XBLA 4EKNB 4FC7A 1KJ8A 4H08A 2Q6IA 3CF4A 3ZLTA 3GWZA 3WRYA 5FJIA 5DX0A 1D09A 2B4RO 2HPZA 4V0MA 4TRJA 1E2EA 3PNMA 5GGYA 3R20A 1T43A 3LK7A 4E6EA 1YOVB 3F7TA 4JVLA 3MTGA 5CX1B 1QPGA 1VKZA 2ZT5A 1HXHA 1L5OA 4PXAA 3RVMA 5CFZA 1BG6A 2JJ1A 1GG8A 1YBFA 2DULA 1TZJA 2IP2A 3H7AA 4LYJA 1U9IC 2B8WA 2ZAYA 3QRWA 4JUCA 1JTFA 1LLQA 3IP3A 1CUGA 2E4XA 3BXZA 3ZGZA 4OBWA 5K3FA 5JNUA 3IV6A 4O6VA 1E5TA 3M6UA 4ZP1A 1IAQA 4X66B 4F71A 3Q7SA 3RU7A 3T0FA 1ORHA 2WHYA 3LJKA 5FWAA 4EWLA 3RKUA 1UFOA 5CTAA 3MINA 2V7VA 2WQ6A 4I4CA 4BO8A 3ZX5A 1AQNA 1IY2A 3DKIA 3ND7A 3OCUA 1MHPA 1XRNA 2F3SA 4JL8A 4X41A 4EUNA 1WXQA 1XVUA 2QUHA 3PA6A 4FKBA 1KFBB 3DUWA 5EJ9A 3FG9A 4WN9B 5CP8A 4GX1A 5EN4A 4QO8A 1M5TA 2CD9A 4LYFA 2G5CA 1C3LA 4IL5A 2RGAA 5CR9A 1N8SA 3R5SA 1HYGA 3N2EA 1UMBB 4V0OA 4XX0B 5K0LA 4BNZA 3RU3A 2EARA 1H8EA 3NRJA 4XGRA 2ZRIA 4WESB 2PS9A 2XXAA 1I8TA 4WACA 4EUKA 1KP9A 3A8TA 2P4EA 3BULA 3JQFA 3MWDA 4XIJA 3O8QA 4PANA 3UGTA 1R27A 4Z54A 1CQJA 1ML4A 3WRXA 3KAKA 3RAFC 3P1JA 1Q16A 4HSGA 2O7QA 4HYTA 3TLGA 1H93A 3TEFA 3ORYA 1YAHA 1RPAA 4NMMA 3AHJA 5K4HA 2ZJ6A 3UXHA 3H2JA 5T3YA 1XJCA 3WB2A 4QXOA 4MV5A 4YCSA 5DNYB 4JKOA 3FCXA 3ZYCA 2FY8A 4IUBS 3OJOA 1L4UA 1ODSA 5CJPA 1V8FA 2DGDA 3BJMA 4TL8A 3VV3A 3D8UA 3E5NA 2J59A 1KJ9A 3GIDA 4GU5A 5HEKA 2AQ8A 3N7UA 3OG9A 4UBJA 3GLIB 3KO8A 5JD5A 4BN5A 1ZMTA 3KPWA 3O8OB 3B1FA 3NTOA 3EODA 2CXRA 3PHJA 4UZSA 4GVXA 3U4IA 3ADPA 5CNMA 1I6MA 2VP6A 3NKVA 2HFKA 1JKJB 2CNKA 4DLSA 2V9ZA 4YUXA 4UTVA 3KWJA 4Q4HA 4MW2A 5BRAA 4DSNA 5GVSA 2BI4A 2LBPA 2TRSB 5EXPA 2IZ7A 2WJIA 4ZAVA 4V38A 1SXJE 1O6BA 3LT5A 2B9VA 1ZCZA 2OZEA 3K0AB 3EFOA 5EZ5A 3H3JA 1ULBA 1SFRA 1XSEA 2FR8A 2E0IA 2XKBA 4JQSA 4M53A 4XXHA 4D56A 1YU9A 2EFJA 4Q4JB 1AQJA 4V0LA 2QNBA 4E11A 2ZWOA 3PD7A 2NU9A 4GZ5A 3ROTA 3DE0X 1Q0ZA 5JC8A 1HGXA 1XTUA 3QW2A 4EFLA 2XUDA 3SBXA 4AL4A 2R7KA 3JQEA 4ND8B 4BV8A 3AVOA 3TE6A 4ETWA 10MHA 5L8VA 2J3DA 5IW8A 1WXEA 4WCDA 1QMPA 3GJ4A 1YJAA 4BO6A 3FKSA 2IVFA 1F7UA 3CKMA 3JQGA 4OGWA 5CT8A 1QRUA 1GZSA 3RWBA 3SVTA 2B6HA 5DASA 3RQIA 3VR6H 3TCKA 4KDEA 2RK6A 1H9CA 1X9GA 4C0WA 1XP5A 1GYQA 1K6MA 5BN5A 5FLXA 2HXYA 3JW8A 1E7SA 5E6SA 2XAUA 5PGMA 3UMMA 1WETA 1M1UA 2XE4A 2BCEA 4BEWA 1DIBA 3MRSA 3S68A 5DLQC 3WGMA 2CHGA 5MFZA 5EIBC 2ENUA 2O2GA 2VDRB 4FN5A 4Q4AA 4QXRA 4UBOA 3SG0A 1T15A 4DIFA 3I5AA 3ISTA 3I5MA 1BJRE 4U00A 3V8PA 4UCXA 4JI3B 2V7BA 5KQPA 4EGSA 5AI9A 1MKYA 5K0SA 2AK2A 5TDHA 5H5JA 5CA0F 4GGPA 1E3LA 4CCYB 2QR2A 4RMGA 4UW9A 1PVDA 4Q1BA 4M7RA 1EXDA 1RBZA 1KAQA 4D81A 4J8PA 1C3XA 3GXBA 2AH5A 4IP0A 4B87A 1TQ8A 1X7ZA 5KX5B 3W90A 3IMKA 2DU8A 2O3UA 4FCCA 5DBFA 5DM1A 2ZKLA 4EG3A 1NI4B 5AVYA 4XFJA 3UIEA 1FU7A 5HQTA 2BE9A 1JG7A 1JJAA 1KRHA 2P67A 3B5JA 3JQ7B 1T9AA 4KMSA 2XDQA 1E20A 2MSEB 2E5WA 2P5SA 3V4LA 1CFZA 1EDEA 3EFHA 3DF9A 2GLTA 3FBWA 3P71T 4JLDA 3LL4A 4H3HB 4LZNA 4F96A 4PU0A 3HBFA 3MCWA 3TRIA 4ZOCA 1QTNA 2ZS8A 4LRWA 3FZGA 1FBTA 4I4TA 3UMFA 5E4YA 4H35A 3W8RA 4CEHA 1NW6A 2P91A 1GCGA 4YDHB 5JSQA 4KREA 1L4BA 5L51A 3EFBA 3UG6A 4H9GA 1T4MA 4JLUA 2K87A 1TC2A 4R1LA 4PLZA 5LQRA 1TU4A 4L16A 3KOZA 4ZDIA 1EX7A 3BMNA 1N8NA 1CEXA 1YTUA 1S3IA 4F4HA 4D9IA 1RADA 1JZTA 3VJMA 3IT1A 4JL6A 3BL5A 5DT2A 1NVEA 1Q57A 4G5OA 3GVHA 4FQ7A 4NLLA 1L4HA 4P0TA 1Y4UA 3AI2A 3LC2O 3RK1A 2OP1A 4RQTA 1ZCFA 3BE4A 1WVMA 1MAHA 4AQDA 2Q28A 1IULA 1UQTA 1Q12A 4BFLA 3GZ4A 4MVCA 4X85A 3KHSA 1P1JA 5I9NA 9LDTA 1T34A 2YMLA 4U0JA 4W8HA 5ILGA 2QD4A 3HN7A 2QRHA 4R2XA 5C3MA 1CKEA 3IBSA 5LJLA 4XD7A 2GN0A 2V58A 3MYYA 4RHYA 1O94D 2OQ2A 3D2LA 3DZKA 4OBBA 2BZ1A 2Q3HA 4MVJP 3HVJA 2M32A 2OGUA 4MRVA 3RVSA 3UWSA 2GCPA 1SXPA 2Q0QA 4DRZA 3LGAA 1LVUA 5I8WA 5LWHA 4QYXA 4MQEA 2IV2X 3H1TA 4RJ2A 1E2GA 1Y9DA 4CETA 1QP4A 1KS2A 4LC9A 2PEYA 5BT9A 4WX2B 1E5DA 3FGPA 4MQMA 2J07A 1PR4A 3BMXA 1NMXA 3JV7A 3IH5A 4PHHA 3TKAA 4MJLA 2TMKA 4IOKA 4YP6A 2HT1A 3NBXX 5JQWA 2I1WA 1JG4A 1Z4JA 3TZCA 3E9ZA 1JFRA 2BIFA 2IZOA 1WZCA 2IYQA 2AVNA 2XIQA 3LQ1A 4LPKA 5ITSA 5HR5A 4JFAA 1JXMA 3TKYA 1MJ5A 1NFRA 5CHYA 5D5HA 4EJMA 1VDMA 4QE3A 2QD3A 3OZ7A 3P94A 2I0FA 1FDSA 4JJKA 4Q48A 2CFSA 3IBGA 3VDRA 4DZTA 2VAPA 2P2NA 4C0SA 1GGKA 3GGSA 2CCGA 1K86A 1QHSA 2Q1WA 3I5XA 1P1IA 3GQBB 4RU1A 2GVDC 1T6NA 4XGIA 2FZCA 2WTBA 3L4BA 2BKXA 3KVYA 3H8VA 3L4KA 1JXOA 1ADGA 3ESYA 4YLEA 3H17A 1U0RA 1PGQA 4LWZA 1T2UA 4FK8A 3JQBC 4R81A 1HUQA 1QYRA 2C3PA 4IYJA 4J03A 3W6ZA 3SC6A 4Z6KA 1PJZA 3CHYA 2OT3B 1I3KA 3HO8A 1Y98A 3AR4A 1SQFA 3BORA 1ZICA 3K6RA 4CTMA 5MDHA 4DNFA 4GL2A 3KBBA 1PYGA 2CXTA 4LRSB 3OIVA 3RC9A 3ZHTA 5ELXA 2IL1A 3U3ZA 5IJXA 1YVPA 3G2IA 3FMFA 4I8DA 3O26A 3JWHA 4HQ6A 5A4AA 1XTZA 3KUUA 1D1TA 1RWMA 1YS6A 4CJXA 5J58A 2HF9A 3R6LA 4FIDA 1USWA 2IUYA 3SY8A 5EHZA 1HG1A 2NOAA 3BGIA 4AMZA 5LYJF 2G0TA 5FBHA 5AQ1A 1SIOA 1XYYA 1BHO1 3OJFA 1HORA 4NBNA 3PJEA 3FSGD 4KC0A 1SVMA 3ZTTA 1FNDA 3CX3A 4ZV7A 3V7YA 4QT0A 4IINA 4ZWNA 3NUQA 4OQQA 5BNZA 1EVKA 1S2NA 2QU8A 2YL2A 1TJNA 2HCTA 1S2MA 4WAUA 4KNVA 4NU6A 2GCOA 2QMZA 4OH7A 2EYQA 5JBIA 1DX4A 1GZHB 3QVTA 2W2OA 2QQEA 4C7JA 3ZDYB 2VA9A 3AUKA 4RD1A 2P3SA 3PUJA 3BTSA 1JLSA 2LKDA 3HA2A 4MRPA 4TLBA 4W63A 3HEAA 2RC5A 4DANA 4MI9A 4HVTA 2GN2A 1BE1A 1XZBA 3N5CA 2ABWA 3RANA 2J9RA 4EY7A 4W9RA 3HCWA 1D7AA 3SZMA 2FPGA 4LWQA 4BKRA 1SU7A 2H2FA 2RJOA 4UCFA 1E9BA 2IE8A 2R8ZA 3EMKA 1XA0A 3IDOA 1YIOA 2QZJA 3ZGNA 1UMCA 3KL4A 2BN4A 3AKZA 4DSOA 1K98A 1R4MA 2QD5A 2Y1LA 1XJQA 2R00C 3ABRB 5JSHA 2Y1FA 3AC0A 1NP3A 2ZEJA 4BNMA 1YFZA 3MQ4A 3IDSA 3OY2A 1EX1A 3QEMA 4YH1A 3SXJA 1E2BA 2Q5CA 4M9ZA 1S1CA 3CN9A 3P96A 4RK0A 5SY9A 5LQNA 3A9RA 1KBZA 1Y7HA 3UF0A 2PUVA 1V1RB 1BEUB 1MLDA 1ORIA 4DW8A 2YR0A 3B9PA 1K7SN 2FW9A 4LHXA 1ZVKA 3A3PA 4ZVMA 4UOZA 5BPFA 2UXBB 1GUAA 4ES6A 4RKEA 4NQZA 1RYNA 1TUEA 2XCLA 4W6QA 1RZUA 1NIJA 3VYVA 4YVFA 4K6OA 1N2CE 1IQRA 5C1DA 3R7WA 3M2TA 1UJ4A 2VDMB 4YECA 5JO9A 3GMDA 8LDHA 4NHOA 2P6MA 4OOEA 4F5EA 4ZFNA 1XL1A 1Z0ZA 3R8XA 3SXUB 4EHDA 3PTAA 2H4XA 4KG7A 1EM8B 1RWWA 2HLDA 1Z28A 2FZWA 3BWMA 4YAOA 4YLGA 1ZEMA 1ZL2A 4F21A 4QU0A 3IB6A 3O8LA 4MJ7A 2UUPA 2AN9A 1BQEA 1KY3A 3H2KA 2I2FA 1QFSA 3DM9B 1ZM4A 1GN9A 3IQWA 1S02A 1E1QD 2EFYA 1L5QA 1QH9A 2AFRA 1I3LA 3EGXA 5ICMA 1O95D 1KH3A 1UAYA 1Z8FA 3HBAA 5T3UA 1E7QA 4COKA 5L4LA 1GG2A 2FW6A 5FEMA 4JYMA 2H1WA 4PTLA 4UPEA 2MHCA 1VXRA 4Z2AA 4XYEA 2JVJA 2W48A 3IOMA 1E4EB 1UPBA 2A0WA 3OZAA 1D8AA 3O8NA 1FDOA 1TVMA 3HCEA 2NZYA 3PC8C 1T2NA 3EIEA 4B83A 3ILXA 1XXHB 4FNAA 1FW8A 3F47A 1GTG1 3UMVA 4EO7A 1NYLA 3T5MA 1PSWA 3KE8A 4QEDA 3WQQA 3DF7A 1F8UA 3HJGA 4WCFB 3DDCA 1FJ2A 4DJEC 3KCNA 4GOMD 2HSJA 4TWZA 5IUNC 2GBIA 4RPHA 4K9DA 4DM7A 1IRIA 1X1AA 1YQTA 3A6PC 2SCUB 2XHZA 5IZ4A 4RVUA 2H4HA 4N9WA 4I08A 2R6AA 1TTQB 4CU5A 2IDKA 3C39A 1EAMA 1V8ZA 1SG9A 2PGLA 5CFMA 4ZU1X 5KJFA 1DPGA 2WWWA 4PGMA 3WY9A 2FW7A 3S1SA 1MXFA 2QVCA 4HDNA 4QTZA 2H65A 3O92A 3U09A 2IEGA 3UC5A 4OJYA 1BGVA 3DL0A 2G9NA 3NI2A 2DFTA 2R5WA 2IPMA 2QBYA 4ON9A 1G66A 1OIVA 3Q7TA 1YBAA 5DKFA 1EU1A 2C61A 3CF0A 3NPAA 4GI7A 5EUQB 1NN5A 1ISHA 4YCAA 2C2BA 1GM5A 4EEZA 3QVWA 3K15A 1ODIA 2O48X 2P5UA 3ESDA 2WSIA 4H27A 3VBCA 3M5WA 1LC3A 4U5XA 3L0YA 1BW9A 1OX4B 3KQSA 2Z9BA 3LK6A 4E51A 1UC8A 1Y5NA 4Z4QA 2B82A 3BUSA 5CYOA 4Y9DA 3C7CB 3E05A 1TTPB 3O4HA 1RRCA 4CKCA 2FJUA 4BKUA 4ZYXA 4ZAZA 4GT1A 4DIEA 3K73O 1IHUA 1TVCA 3A6LA 1YZYA 1U8FO 2WAYA 2WYOA 3INNA 5AO9A 2GYWA 3ER9A 3R9XB 2WU3A 3SKXA 1VG0B 4GPTA 3C45A 2V4UA 2COEA 2FWJA 4P4SA 3ZV4A 1TDJA 3MHPA 3QWHA 3K72B 2I4MA 1Z7EA 3T4PA 4AJ9A 1B8NA 1KIFA 4CF7A 3A7DA 3RRZA 2HIGA 3MOIA 2C8KA 1P62B 4TSKA 3FOEC 2FZGA 2VWHA 1Q2UA 5IAJA 1C30B 2JVKA 2YQ5A 1UFRA 3TNDA 3D3WA 1GQOA 3MS2A 1VP9A 2E9SA 4AF8A 2Q3BA 2WZCA 4EF4A 1WZ2A 4W5TA 1EYZA 2RAUA 2XE6A 4BO2A 1CUAA 4AECA 1LBTA 3JQ6A 4LXYA 1H8HD 1VJ0A 1WCYA 2FRVA 3P2YA 2B5WA 2P9TA 5CLGA 5FEUA 1AKMA 5J23A 3LBFA 5TJHA 1MVOA 2A94A 2V8OA 521PA 4BCCA 4U2CA 5MGNA 3L6DA 1LX6A 1R6VA 1U3WA 2V98A 4WNAA 1VBFA 4BGVA 1R9MA 3QFFA 2XDYA 4Q4HB 1O5OA 1MP0A 2ZKIA 1V6SA 3BFJA 3PE3A 5AYVA 4JENA 1YB6A 4IFIA 3GJ8A 2OUKA 2W2LA 3W5AA 1WY5A 4NICA 1V0JA 4EQ6A 3ZDBA 3MBIA 1RMYA 1GTRA 2Y1EA 3G9UA 4RZSA 3R5TA 3VO9A 2H1RA 4C1BA 1JECA 3PUKA 1EFRA 1P7YA 2ZR7A 2WSLA 2YRFA 3EOAI 3ORSA 4B74A 4ESVA 3OPYI 4JODA 1PK9A 3VU9B 3JALB 5IFLA 5A5VA 3MWYW 3KEGA 5K0FA 3SLGA 1M2NA 2YBDA 1I9CA 3AEKB 2JFFA 1VG1A 3OU7A 4JFRA 3IE0A 1DFGA 3OQVA 1Z16A 4ZT3A 4R5HA 4E2ZA 4OHVA 3IFSA 2WOJA 2DUNA 2Q99A 4U7HA 2ZT7A 3V8NA 3QLJA 3N76A 4QYTA 3EHEA 1IMOA 2HRDA 1E1RD 1MAUA 3A2KA 4AG6A 1T36A 3N8HA 3EARA 4ISBA 1WQ4A 2XYVA 2XKJE 3C70A 3I73A 3ZBQA 3HBNA 2FEAA 3COZA 4TLEA 2ZATA 3T5BA 1FVFA 4E32A 1Z0FA 1YK0A 2X1VA 3B9QA 3NV9A 4JVOA 1VHWA 3PC4A 4TKVB 4OVKA 1U99A 3IRUA 1GTZA 2GNAA 4YACA 2P35A 2EU8A 1T6ZA 4WXRA 2WJPA 5YASA 3PNVA 2EFDB 4L22A 1UT5A 4BQPA 3ADCA 4P7JA 3G2HA 4WWHA 5AUNB 1G8YA 2F43B 3MUNA 1PFVA 2VVTA 4Y0VA 1XWIA 3K0BA 3HR7A 2PIDA 4GW3A 3DZFA 3D6AA 1HFWA 3IAXA 2ZZMA 5GINE 2B7CA 1CS4C 2IYZA 2LPMA 4RZ3A 3RASA 2DR2A 3NHFA 1XYGA 3S2IA 1UDWA 3RIHA 4ZICA 1V9SA 4B2LA 3NHRA 5JS6A 1J9GA 1PWZA 2X5XA 1TKBA 2ZCUA 5K2OA 1EFCA 2O2XA 4WDRA 1FNCA 3CW8X 3H5TA 3ZC3A 2ZSFA 4IR7A 2I7DA 1XMVA 3A26A 4FW9A 1BVYF 4H7JA 2RCNA 4MRSA 3ZH2A 5ESXA 3VR6A 2Z5VA 2ZE7A 1KR5A 3NHWA 1M1NA 3W9SA 4B4VA 6REQB 3I3SR 4H1HA 3NANA 4NV3A 3CVWA 3E58A 4LA4A 2FFQA 5K0BA 1A0OA 3K1ZA 3K1JA 1XNHA 2GD1O 2PUJA 1HA3A 4EG6A 5EXSA 3PTZA 3WL4A 2XQGA 2ZRDA 1HDCA 2GPYA 5FOQA 1GWNA 4C7BA 5LNK1 3Q8LA 4NABA 2DH5A 4Y2QA 2FWMX 5DHUA 2Q2VA 4I46A 8OHMA 1OZHA 1GUYA 1Z22A 2JD1A 1ZUHA 4PYMA 4CQMD 3MT9A 5BYKA 4YFYA 5ALYA 2QV7A 2UYYA 4KQWA 2XQIA 4LDNA 2I67A 1UBHS 1KE1A 2WYWA 3LF2A 3Q6NA 3SXUA 4TM7A 4EIWA 3B8EA 4B3HA 3IC5A 3EW9A 2NU9B 4ZGGA 4CXMA 3E9NA 1KETA 3RNOA 3H8JA 5BVHA 3V55A 5LYYA 2VDPB 1LJ8A 1QX3A 3EIXA 3UMJA 4WBXC 3WGUA 3SICE 1E62A 1K8ZB 4F2WA 2YJ4A 4L28A 5KX5F 3WHLA 3C3PA 2PGIA 2RB4A 3NWEA 1ZH0A 1Z12A 5TIIA 3ROXA 4JXXA 2FG6C 2WHRA 4QDTA 3IEXA 2ZYTX 5CIQA 5C31A 2Q0HA 1G9XA 2C2MA 3OCVA 4II7A 3EC2A 2IHNA 4RWZA 5ALXA 2FE4A 4JYZA 2C5EA 4RTRA 2ZQ5A 3GGJA 1WX1A 2G7MC 1IOWA 1CDDA 4NATA 4QUEA 2HY7A 4I9UA 4JKIA 4JP3A 2ZJZA 2E1PA 3HYNA 5AMXA 4B76A 2DBYA 2VHVA 1QO0D 4BLRA 1RI1A 3G3EA 1JQ5A 3R2JA 3AFHA 1EMDA 2F1RA 3RAEC 3A6KA 4ONEA 3E7XA 4A10A 1LH0A 1B8VA 2HTFA 1UEXC 3L4EA 3PKZA 4LX8A 4PZAA 4R7TA 4Z4HA 1R7RA 4ND7A 2UUAB 3FX2A 5JV5A 2Z1DA 2B69A 1GNSA 3IR7A 2VLBA 2Z5FA 1DB3A 2WNHA 2OK7A 5C18A 3CWCA 4AD8A 3HB9A 4LY9A 1HEYA 3AL3A 1CZLA 3K0FB 4NVRA 1H6BA 3L4SO 3FMGA 3M70A 3WHIA 4ENQA 4YEDA 2PL5A 2W6OA 3IMEA 2GJ8A 4NK4A 4WZBB 3PXXA 4YI3A 3X1JA 1WXHA 1LJLA 3P9RA 4UBLA 1YUNA 2FMKA 5DWQA 2IX3A 1ZVJA 4HLUA 4O3MA 2HW8A 5FWXA 2UYGA 1RZRD 4XJVA 4O33A 4RTSA 1WIWA 1QIIA 3DMTC 3CJQA 4IIBA 3NM4A 2WA2A 4MUXA 1U4SA 4PPQA 2PK3A 1Z4KA 4TQAA 4AO8A 5CAEA 1TJYA 2PCJA 2FPPA 3OE5A 4K81B 1XDWA 4B43A 3WO0A 1NJ2A 4TYPA 4FBLA 4YUVA 3AJDA 3BA1A 3RUIA 4B4KA 5LM3A 1IQUA 4R9VA 3DPIA 1DPFA 4IF4A 4MR7B 4Z7JA 3BHMA 3DXXA 1NBOA 1TE2A 1TFRA 1SR8A 3WGKA 4BIIA 5DN6A 3I09A 1ST2A 3ZHUA 5BQPA 1DOAA 1F0NA 3RB8A 4CE6A 3RHTA 1JH8A 1KOLA 1DOZA 3CCFA 2XA2A 5TEVA 1Z6YA 4QO7A 4MZXA 4MEBA 5JHHB 3RJZA 1KYXA 1DC4A 2GF0A 4LECA 5FBZA 2J7PD 3G2PA 3GRZA 1DTEA 5BUZA 5KWJA 3HXMA 4OREX 2YHBA 2E4UA 2QTHA 5CFQA 4J0JA 4ZIRA 1TMKA 1WZEA 3NIWA 4KQCA 5IANA 4UNRA 3NTLA 5ICSA 2O2IA 3OLWA 4IDQA 1W48A 3G8DA 1BKSB 4YP0A 1V16A 1FRFS 1L5FA 3LY7A 3I42A 1ACJA 5D86A 1SXJD 2Q0XA 1NNI1 2BFEA 3L02A 2X8JB 1R4AA 1YMQA 1GZDA 3LWNA 3PNPA 3TQCA 1ZOSA 3QA9A 4D4KA 5HHTA 3GRUA 1EX6A 2NLOA 3I6ZA 3BXFA 2ZVJA 3JASA 1JUDA 3ONWA 4ARCA 2UZ1A 2X0KA 3AR9A 3THYB 2WFLA 3T4XA 1H2WA 1KSJA 2PANA 2VFAA 2Q9CA 3BF8A 3CS3A 1CY7A 2AA3A 1GRRA 4KAAA 4MIOA 4N5NA 5JAMA 5CT6A 4I50A 2P9EA 2BFOA 1MPXA 3EGCA 2OMEA 1E4OA 1FPMA 1N3YA 1T8PA 2PV7A 3HJUA 1TO6A 4JASB 1E4VA 2I6XA 2AG1A 1EGVB 2BBWA 5E0KB 4DNXA 4XWWA 1FVXA 2E5FA 3IKLA 2I76A 5TRTA 4B82A 4N3NA 2R2AA 3IOYA 4R2IA 1AK9A 5L3QB 1QQBA 3KOWA 5KZMB 2P6RA 1E3TA 5SV2A 2V54A 3PLRA 2I1VB 1OX5A 2Z6UA 5E2AA 1FSGA 4CKXA 1LSOA 3GRRA 3MCVA 1X15A 3GJ5A 1NNUA 2DJIA 2G88A 3BERA 4FTWA 5AW7A 1N5JA 3RIYA 1Z7YA 4MEAA 1YHYA 5JDCC 1SQ0A 3S2EA 4DHWA 1YQDA 4GXRA 3I4CA 4IJKA 7REQB 3QPUA 1CX9B 4LI3X 7MDHA 1TTHA 2GK4A 2JBAB 1XWWA 1CP2A 1B76A 3FOAA 4NDZA 5B36A 3ELDA 2PZ8A 3LUPA 1EK0A 1RYEA 1KGSA 2C0CA 4HPJB 3DO8A 1EK2A 4ZO9A 4LRQA 3GPLA 3CMCO 1BCRB 4EY3A 4GC5A 3NDIA 5TQ0A 5DM70 3VAYA 1K6EA 4LHZA 4NZYA 1U8YA 2LCFA 2NTNA 3NZEA 5DF1A 5DW0A 2AR7A 3L7LA 1LK5A 3AL0C 4L7QA 2IS2A 1DEAA 4FDMA 1SUDA 1QG0A 3ZZNA 2A7QA 3IHWA 3WFIA 2W4IA 4CDGA 2FMIA 2X19A 2Y1DA 2XNJA 3IAS6 1LA2A 3RVQA 3UZUA 4YCLA 5ES4B 1MJGA 5JI2E 2YWRA 3NIBA 1T3ZA 2DOKA 2XB6A 2A59A 3HZZA 3LZ6A 3UXYA 2YW9A 3KSBC 4LDJA