1IU9A

Crystal structure of the c-terminal domain of aspartate racemase from pyrococcus horikoshii ot3
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
111
structure length
111
Chain Sequence
MIEETAKKVKELGFKKAGLLATTGTIVSGVYEKEFSKYGVEIMTPTEDEQKDVMRGIYEGVKAGNLKLGRELLLKTAKILEERGAECIIAGCTEVSVVLKQDDLKVPLIDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into gene duplication, gene fusion and domain swapping in the evolution of PLP-independent amino acid racemases
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Isomerase
molecule keywords aspartate racemase
total genus 43
structure length 111
sequence length 111
ec nomenclature ec 5.1.1.13: Aspartate racemase.
pdb deposition date 2002-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iu9A00
2OHVA 3S7ZA 2JFUA 2JFXA 5HQTA 2VVTA 2JFWA 5ELMA 2DWUA 2OHOA 3UHPA 2DX7A 5HRAA 3UHOA 1JFLA 3OJCA 2ZSKA 3ISVA 5HJ7A 2GZMA 2JFNA 1B74A 2EQ5A 3ISTA 3HFRA 3OUTA 2OHGA 2JFZA 2JFOA 2JFQA 1IU9A 2JFVA 5HRCA 4B1FA 1ZUWA 2JFYA 2W4IA 5IJWA 3UHFA 1B73A 5ELLA 3S81A 5EVCA 2DGDA 2JFPA
chains in the Genus database with same CATH superfamily
4C01A 3A0UA 3G2LA 2OQRA 5AK5A 2ORWA 2WKPA 2ERYA 1C2YA 4UM7A 4A27A 2JVJA 3CF6R 4TMTA 5AJVB 2VK1A 1CJTC 3U4QB 4NE2A 1CY0A 1C9KA 1SVOA 3UQZA 4IHJA 2HY7A 3A4NA 1ZGBA 2DERA 3BOSA 1XHEA 2XVZA 2ECPA 3K16A 4P0PB 3SDZA 3OUTA 1WXFA 2AEJA 2HO5A 3BIWA 4GWKA 2WZDA 4UCQA 5JLAA 3WLRA 5JY1A 4AS1A 3PX2A 2XXBA 4KO3S 3PE4A 4W5TA 1C81A 1I9GA 1V5IA 2JLVA 1UH5A 2TYSB 1AKQA 3HBAA 3TTVA 3MIIA 1EDEA 4YALA 1XT6A 3O84A 3HADA 2YCLA 3EZFA 1DBQA 4L07A 4LZLA 1I3CA 1ZM4A 3GU3A 3B89A 4XVRA 4ILKA 4LISA 1OXSC 2BL4A 3L40A 4MJLA 4ADSG 4CIVA 5KQMA 5TVGA 1RWPA 3LQ4A 4MVJA 2YIJA 3M7IA 1URPA 4ITRC 3FWNA 5HFNA 2I2CA 3E9MA 2NYVA 1XTVA 3NBYC 5FTJA 4ALNA 1G9XA 1SNYA 1E64A 1TYCA 4HVTA 2GYUA 3UMGA 4KQMA 1W87A 2XX3A 4DJ5X 1VBFA 3QKRB 2YUTA 3N28A 4WA8A 3BTVA 2Z5FA 4FGLA 1JXQA 1QCCA 1ZIYA 1P31A 1UADA 2F8LA 2OB1A 5FYQA 4CBVA 3UC5A 2GEKA 2C84A 3SS8A 1M2FA 2O0HA 4A10A 2O3TA 2DEUA 2FUEA 4O6VA 4NCHA 2OWEA 4XWKA 2ORYA 1IHYA 1VGRA 1XRSB 2EVWX 1F2UA 2J8ZA 3CR3C 4GWLA 4ER0A 4N65A 2HW8A 3VKHA 1RT9A 2OQIA 2QLBA 3NBAA 5AM4A 3L6OO 3FF1A 3FUXA 1TAHA 3Q0TA 4L78A 2O3RA 4DSZA 5EJ9A 1D07A 1MT0A 2CW5A 4WH0A 1LV8A 5HKLA 1V8BA 2EGHA 4CM6A 3D3WB 5F52A 1R0LA 3ESYA 2CDNA 2CLKB 1CEQA 2ENWA 1QH1A 5JSZB 1SG6A 3B6KA 3K71B 3TEJA 5A1JA 4F45A 4EEXA 1HE3A 1KMIY 2CD9A 3B12A 3V4VB 1XRQA 2BH2A 5ALIA 2X41A 4AJJA 2LIPA 3JRWA 1HV8A 1VKZA 4DAOA 5A4IS 2GN4A 5DCLA 1PQPA 3R5KA 5AESA 4BO6A 1JVSA 3JCZA 2CHUA 1XMIA 4IDNA 5HRCA 5FWXB 2ZRPA 2ZU0C 1I30A 3TTTA 4PSAA 2NVBA 4R05A 3G5UA 2FCAA 2QXUA 3T7TA 3KSMA 4B3BA 3PENA 4DL9A 1E6KA 1TGVA 2ZWVA 1E6UA 3T3DA 1AKYA 5ALHA 4DV2B 3BTUA 3EHEA 3HSYA 3H5WA 1SIBE 2G88A 2K2QB 4RVSA 2HU8A 3U3XA 2DOKA 2JK0A 1OWPA 4YDRA 4NICA 2NQTA 2UKDA 2HB6A 3MWGA 5GWXA 3RQSA 2QW0X 1JHXA 4D6PA 2YMPA 4ZAVA 4BFLA 5IUNC 3UF0A 3WYEA 4CM1A 1RKQA 1J0XO 3HYCA 1MHTA 1DV2A 4V39A 3SR3A 1PF7E 5JXJA 4A0FA 2OO5C 3BERA 4AY3A 2C3YA 5BXQC 1RZRD 3A9RA 4M9SA 2D8MA 2D74A 3BTSA 1BWRA 3CNOA 2A86A 1O03A 2I2BA 3TSZA 3W5JA 2HCTA 3VUEA 5I7AA 5L8VA 4H1WA 4NDZA 1BTOA 5C5CA 4Z3OA 1V2GA 1FRNA 4UAJA 1AK1A 1E2DA 2P6OA 5DI3A 1S8NA 3HKDB 4TYWA 5B3AA 4DMCA 1Q7TA 2KS6A 1HYHA 4H16A 3VI4B 2XNDD 5CURA 5D86A 1N5IA 1NDHA 2HH9A 3FCCA 1PN3A 3HEAA 3WP1B 5I3ZA 5IJ9B 2QUZA 4CEIA 1CUVA 4KXMA 1DIGA 4OK5A 3LPLA 4P4LA 4GXTA 1H2EA 5AI6A 3DZDA 1YDHA 2R97A 2VNKA 5HCNA 2IX3A 2QV7A 2AN3A 2PXCA 3AUJB 3M4XA 1KXJA 1XAGA 2A84A 1Z56C 3H5NA 5C37A 2VBCA 3GRYA 1GUZA 3IOBA 3Q1LA 4GHWA 3UH1A 2AZXA 2PVSA 1PGNA 3RS4A 5ICCA 4OATA 4LTDA 1TAUA 5JXGA 1AQNA 2XNKA 4FTWA 5LQDA 3OSZA 3GHYA 3H1EA 1Z2OX 2P0EA 2QIOA 4C2UA 3QQPA 3FSRA 2QTLA 2IV7A 4RFSB 1R0RE 1V8DA 2FDRA 1QO0D 3NBMA 3WSWA 1MJNA 1WTCA 1XSEA 2GK4A 3IXQA 2CZCA 4KB5A 4QD3A 4E6EA 4CM9D 5FTNA 1DZIA 4IRMA 3U61B 4YJ2B 4PN7A 3EVGA 4R69A 4R1OA 4I55B 1GLGA 3KXDA 4R1SA 1L5NA 4LHZA 2XJ9A 2VRWA 4FOTA 4C05A 2J7PD 1AHIA 3UN1A 2HU2A 3R7NA 1UPBA 3DAOA 3LUDA 3NKFA 4HQFA 3O5AA 3V2HA 4Q4HA 3ZR4B 3WDLA 4D9EA 2FFHA 1ADJA 1OAKA 1XU9A 5F7JA 1G5IA 3MWKA 5DTQA 2PXAA 3VZCA 3NGMA 2IXBA 2IUYA 1MRSA 3MAGA 3PICA 4K2HA 4S2EA 2IP2A 5FYDA 3BAFA 1QVRA 4UHBA 4XYMA 3V7UA 5EGSA 2NQ2C 2VXCA 3I1YA 4HNGA 4K9QA 4L9WA 4WCDA 4BVLA 4LHSA 2FR8A 1T8WA 3B2EA 3QTBA 1CK4A 1WULS 2RHCA 3ICEA 4DJJA 3AEKA 1JT9A 1Q1NA 2XIJA 4LSGA 5AJXA 1IC6A 2DP4E 2GLUA 2ZUBA 3ZWNA 2H1RA 2WZBA 1R66A 1HLFA 2B4AA 1OILA 5AUQA 1PGJA 4JHLA 1P6QA 1Y3BE 3QMWA 1GILA 1PQYA 4JU9A 4OFZA 3UG6A 1J2RA 4CM8B 5L3SB 2VCYA 5EYPA 1DRJA 3EEQA 3IE1A 1M3SA 2LW7A 2XGJA 3ZV4A 3JAWB 4DV4B 3KQUA 5TMEA 4AWBA 4R2IA 4DNOA 4ZIRB 3H2HA 4P84A 4ZI5A 3WFZA 1XXHE 4EEKA 3N39C 2BKEA 3H2KA 4QZVA 3NALA 1M5UA 3HR7A 1K4KA 1THMA 1W35A 1RRCA 3V6LA 2X1MA 5L95A 4LY0A 3F6EX 5L9AA 3OQHA 2JJ2A 5EPOA 4WKNA 1UAAA 3WGUA 1EIWA 1L5FA 3AERA 3PKZA 5T64A 5IP5A 2HUNA 5EFOA 4B5KA 1J20A 2F9FA 1XWFA 2QQFA 3NBFA 5BN3A 1IXZA 3RU7A 2ZK7A 1Y6FA 1EQUA 4PZZA 4RULA 1EUYA 4I5IA 4AJ1A 2HZ7A 5H68A 1LC3A 5JWRA 1MW8X 4QQKA 1E9RA 1C9JA 2V1XA 3C3BA 5TQ2B 2Y1OA 4R1TA 4ZMRA 4PICA 3GRPA 3L02A 2XDWA 4I36A 2QR2A 4GM0A 2P9QA 4U2CA 4L5JA 3ZOZA 3OFSA 4DCTA 3ZXYA 4ARBA 3T3EA 3LPMA 1Z33A 4MPJA 5KHLB 4WX2B 4AG3A 3KX2A 4Z9XA 5I51A 5IJWA 2YMMA 4LZPA 1KOGA 2IHYA 3FVTA 5SZKB 1RAHA 3IR5A 1U2GA 3TTSA 2ZRLA 4LJ6A 1K86A 2HJVA 1WKBA 1A98A 1BDBA 1EP2B 1DU4A 4OMFG 4X0EA 1L5VA 4XLTA 3AF0A 2FDCA 2P91A 4L8VA 2AIRA 1GU0A 1R5NA 4DVGA 1QC5B 3S6JA 5FULA 4MVJM 4K8RB 4UOQA 4F97A 2ZB3A 3DLAA 4RPHA 3WXBA 5IAOA 3RB8A 7REQA 1PJBA 3CJTA 3DEIA 5JSQA 2XCTB 1VMDA 1ZP6A 4H6PA 4CF4A 2BN4A 4P3PA 1QPBA 1TE2A 1R9MA 2W58A 1QFXA 3WWDA 2CLMB 1MOZA 3OURA 2VFAA 2GHQA 2OEPA 1G9SA 3CS3A 1R6VA 3BE6A 3QU4A 5JG7A 3RS5A 4P3NA 4N7RA 3JQRA 1KIFA 4DC1A 3F71A 5C1IA 4BX3A 1VI6A 1SEVA 3P9QA 3E81A 5F2EA 2CJFA 3ZBPA 4X7PA 4ED9A 5CVJA 1VLVA 3KYCB 1XPRA 4HDMB 3GGOA 3GJYA 3BKWA 3EWSA 3G8CA 1C4KA 4TMYA 4YMVA 2PT9A 1C7EA 1A04A 2QTMA 4FEYA 1K8XB 2P3OA 1J9GA 3D1VA 3K1ZA 2YRWA 4FYHA 4LJ9A 2QP9X 5AI5A 2AFRA 3GVIA 4FDLA 4UXJA 4LRTB 2PLAA 1HDRA 4CUKA 5JJBA 1O0BA 2D2XA 4GDFA 2I7TA 3CRNA 1U0FA 4G67A 4IHKA 1QTIA 1G21E 2GK7A 2EJUA 2FX5A 2Q0XA 5KOJB 2WNIA 2Q5OA 1FW6A 1L4FA 2QE6A 3KB8A 1DO0A 4GL4A 1ULZA 1BO6A 4REMA 3ZE0B 1QZTA 4DUGA 1M2VA 1QGED 5KYWA 3KLOA 4NBVA 3MGGA 1A8PA 3EQZA 3I5YA 1CY6A 3CLRC 1W94A 5D6OA 1HYBA 3DLPX 3M83A 3KBBA 2F9LA 3L1IA 1P2TA 5AHXA 1DXYA 4U7WA 3W5CA 4NBWA 1SCIA 5AVVA 4JUAA 4KQGA 2HWUA 1B0ZA 2QJWA 1RYBA 1GR1A 2CLOB 3PZRA 5CNMA 3SXUB 3ILHA 4C06A 4YV0A 2Q3CA 3PDCA 3PDIA 4Y0AA 2BJWA 3EOZA 5ESXA 1I4OA 3ZJ4A 2ZYGA 3Q2KA 3Q7QA 1I6MA 4U02A 1T4DA 4X9XA 5BQPA 2NOAA 5DX8A 2WKQA 2FF5A 4TRNA 3ZDXB 4A8PA 1JWLA 1HSOA 4O1IA 4B87A 1UPFA 1PUIA 1JB9A 3C3YA 1VFNA 4AF7A 1LZKA 1A9ZA 1N9ZA 1I2CA 1YRAA 4NOJA 1L5RA 4P34A 1RVDA 3O90A 5K45A 3L8MA 1Y37A 1ZXLA 1KDTA 5DSXA 4R54A 5CCEA 1V41E 4IUYA 3MQ4A 1IPFA 3UPTA 3GUCA 1RYMA 3DOEA 1BQ3A 3IQZA 4UU7A 5C4IA 1M6YA 2I2XB 2HCFA 1QP0A 1R9JA 4HT3B 3CLUC 4H3KB 4NLLA 4TGLA 1SIUA 5EJEA 5EE5B 5EZYA 1DQPA 2RGBA 1RFGE 3S81A 4JYZA 2B83A 3Q3GE 4G4SP 4QXMA 1AC5A 1XMPA 2R6GA 2H48A 2VPZA 5IZ4A 4N48A 4C21A 1JKJB 3ZNOA 4F56A 2FAXA 1TGYA 3TDNA 3TQIA 5DM60 2O2HA 4EW3A 1KMQA 2O1XA 5C31A 3X44A 4PX3A 1HPLA 2B8WA 4Q1EA 4RHUA 1KAMA 5EUBA 3WWOA 4D8XA 4Q9JA 4FKZA 3CW9A 3IERA 4I4NA 2IYZA 1E0AA 4N7BA 3CVOA 1A4IA 2O2SA 3NEJA 4UPVA 4WWHA 4XPIA 2ZGVA 1RPZA 1IRIA 4WXRA 1IAVA 1CERA 1QZXA 2GZ1A 4LDPA 3QJ5A 4K2AA 3T54A 1FUUA 3WB1A 3ZD7A 1ZL2A 4BKOA 2F8TA 1CJCA 3ZCVA 3CZ9A 2I3ZA 2HCRA 1DBPA 3I8OA 4BNYA 3GPDG 3KXKA 4H6XA 5FAXA 3LYLA 3VKFA 1GAWA 2DQYA 1Z6TA 3KPUA 4ZCSA 3K9FC 2IH4A 3TZCA 4MUGA 2B94A 3OFKA 3U9SA 2Q3FA 1YUBA 4OU4A 3KPYA 1DEAA 2H9YA 2V5UA 3Q87B 1DUVG 1EDBA 2KJQA 4KN8A 2BUAA 4HH4A 4EG6A 5J4VA 4BHTA 5FOTA 3U2QA 5AKKA 3BF8A 5IF9A 4G0ZA 4TV9F 4CKBB 3ZWQA 2DSTA 3VOAA 1F0PA 4DDHA 4CEJA 3D4NA 3LYAA 1PUJA 3QXXA 4TLAA 5AK4A 1AURA 1UDCA 2IU3A 1E7MA 3B9BA 1UJ2A 2WPDD 1FP2A 2ZTVA 4F6RB 1P19A 2IYUA 5DNCA 2CCKA 4BQPA 3DPUA 3KV1A 4W9RA 4C03A 2D3TA 4RF2A 1H1DA 1GPNA 5IAEA 3KXIA 5ALQA 4CFYA 1W36D 3VI3B 4WZAA 1CR4A 2EERA 1ZPDA 3PS9A 2Z6QA 4YRKA 5JHGB 2DMRA 4BRSA 1LTHR 4PWZA 1T9KA 2PJUA 2VDMB 3AF4A 1TCAA 3IO3A 1JFLA 4HCJA 2JHAA 2C2KA 4EPTA 1QOQB 1USGA 3CZCA 4JX9A 4A5OA 1AMNA 3JD4A 3JSAA 5F9MA 2BHRA 2BSXA 3DLBA 1NW4A 5JLJA 3NBQA 3UJ3X 5LD2B 5KDLA 3R23A 3AY6A 2UVDA 2ZUVA 5K7SA 4Y6PA 3U09A 4XDHA 4GPEA 2A0YA 2IU4A 3LX6A 3VZBA 2YDYA 3G2JA 3C70A 3R3VA 4KACA 3RRJA 2HJHA 1SK8A 1HG1A 2FN4A 2WF6A 4HRVA 5K51A 1WXXA 4COOA 4HBGA 4ZHQA 4O2AF 1QIIA 5ADUS 2E5WA 4IBOA 2MDTA 4H35A 3NGLA 4WLEA 1QVVA 1K88A 4EQ6B 2R6DA 3JZFA 3OKPA 4Q02A 4AULA 3SJCA 4KIFA 1PRYA 3D31A 2EZ8A 3GG2A 1OASA 2W9XA 1GDDA 1YV9A 1Z3CA 2QRZA 2EF1A 3H9UA 3KHTA 4B09A 3AL0C 1JAIA 3IL2A 1MC1A 1XZBA 3VVLA 3OSUA 5B1IA 3PHGA 3QUTA 1VCMA 4P98A 3IA7A 4UNQA 3UMYA 1RJEA 3WHKA 1PS9A 2GAFA 3B1YA 4US2R 1JA9A 2C78A 3U16A 3GCXA 2D1YA 3SKVA 4TKUA 3NAMA 1C0EA 3LS2A 5F4ZA 2QAJA 1JB1A 2I6TA 3MXTA 3OUZA 3R4VA 4KPUA 1Q15A 3HPRA 5DEOA 5EZYF 4Z0NA 5I7EA 3QV1A 3RLFA 3P4YA 2IY7A 3NG1A 3LWDA 4TTTS 1YZTA 3S7TA 4F6CA 1GNTA 2AFHE 4XB6B 3RDPA 3KJQA 4IIDA 9GPBA 2Z3VA 2QU8A 2PS1A 1SCNE 2UVPA 4CDMA 4PIPA 5HTKA 2ODWA 3QJYA 4A0SA 2PFGA 5DLQC 5JQGB 4LTNA 2NXWA 2PDAA 4ND6A 3S8MA 4Q9LA 3REFA 3F5QA 4OX9B 1F8XA 3FHJA 2B4QA 3QEJA 4IDBA 3DBVO 1QCZA 4L0CA 2O7NA 3NKLA 1NI3A 2ECFA 3QYJA 2G1UA 4I4TB 1QIHA 1Z68A 3HFSA 3TRFA 2LD4A 2GBGA 1GZSA 1ACJA 4Z8XA 2Q3EA 5B2ZA 1GGVA 1H1LA 1QKJA 1ENOA 1V1JA 1Z2CA 2ZXEA 2RG1A 4D96A 3NHSA 2GKSA 3ICWA 5CVEA 1WG8A 4M8SA 5LU9A 1CUBA 1EP1B 1U9YA 4KJZA 4OVKA 3UB4A 1CJUC 5CFZA 3C7TA 2Q5FA 1GM5A 5EXPA 1L4NA 2C2HA 4LZNA 2AHRA 3EGXA 5B7QA 3IKTA 1PK8A 1YA8A 2P77A 3ESAA 3HB7A 4X94A 5ICFA 3TQSA 4DQ0A 2ZTSA 4J1SA 5H59A 3ADBA 4EHDA 2ZKIA 1V4NA 3TNFA 1Z5OA 4KXQA 4KRFA 3EXIA 2EIXA 4U0KA 1CQIA 5ES4B 1Z0JA 4WFIA 4EGQA 5A4JA 1FU4A 1QFSA 3E3MA 3WP0A 1SEPA 2D00A 1JG1A 2P9TA 3ISJA 3LXRA 3R76A 4YRNA 4U7DA 5CMLA 3WL7A 2PLWA 1R12A 1LVHA 1J5XA 4OH7A 2HSGA 3NRBA 4MITA 1GQSA 3PJDA 2IYVA 3KSUA 3BDIA 5FUXA 3I6YA 3N8DA 1HK7A 3TDMA 2YOGA 1ZD1A 4GF5A 2W0MA 4PLGA 4AL4A 1RQNA 1YVDA 2YN0A 2M6RA 4X1OA 3U5ZB 4XUCA 3VYTB 3G23A 2FPWA 4XYBA 2R00C 4PBTA 1OXVA 1SVWA 3O8CA 3IALA 2C5LA 1ZY2A 1S96A 2XCQA 1ZCZA 1E6MA 2C5HA 2C7GA 1YE8A 3H8VA 4HNHA 5E9WA 1T0HB 4KQIA 5FBHA 3WHIA 3FGNA 4EI7A 1FVFA 3F3YA 3S28A 2DFPA 4XA8A 1ODFA 5FR1A 4ZJYA 2WA1A 1L4KA 1N2IA 5LQCA 5EC8A 3UGQA 2DJ5A 4JLUA 4ZOQI 5JISA 3WB9A 4BV9A 3C3EA 3DFUA 3EARA 5HF9A 1EFRA 3UFXA 5KX5F 3OQ1A 4OGLA 4ECEA 1HO3A 1ORDA 1Q14A 2P68A 4IMRA 2EF0A 1WXQA 1Z8FA 3ABZA 3DO8A 4YT5A 5LN1A 1M1NA 1JDVA 2IVZA 3K1AB 2JBAB 4NZPA 5TQ2A 4ND8B 2ORIA 1PWHA 1VA5A 2W4IA 1UQUA 4BFYA 1KH1A 3CVYA 1F48A 2HNBA 4FGZA 1O97C 3NVKI 4LRSB 3NTRA 4QT4A 5KYGA 8ATCA 2CYCA 3IR6A 3HB9A 2NW6A 3VTKA 2HMYB 1T5HX 4UDNA 3OEHA 4GKAA 5K0FA 2NSJA 1N25A 3DA8A 3FCAA 4H1VA 4HWTA 1ZGGA 4BV2A 1ZK0A 2OCKA 2Z2KA 4RNCA 5BWNA 3OAAA 1M66A 3ENZA 2ZVJA 4HXEB 5LXTA 5TE9A 4Y1RA 2H4FA 1RBYA 1EQ2A 2EOAA 1YR7A 4W5NA 3KU1A 5FNVA 1MBZA 3DEKA 3DBRA 1JQBA 2C7VA 1ST3A 3L7DA 1DS6A 3VDRA 4ZDKA 1U11A 4BX8A 4TS1A 2QRNA 1UFQA 2DLNA 4KQ1A 3RIEA 4ER6A 4AYTA 1RQ7A 4NH4A 1KZGB 5FLKA 5C7IO 4JEIA 3FLAA 4HUJA 1HNXB 4OUDB 1IQ0A 3E9ZA 2HO4A 3OZVA 3QUSA 4P4UA 1W581 4DMHA 3HJNA 1EWVA 3IAAA 2BD0A 3W6UA 1FYEA 4WECA 3H3JA 1YFLA 2REBA 4JLPA 1FP6A 1PFQA 3LLSA 2Q0SA 3EZ7A 4MXDA 5JU6A 4YWJA 3B5EA 3D4LA 3CUUA 4NOMA 3AVTA 1LZLA 4ZKDA 3ESQA 3NXKA 3HI6A 4JJIA 4NFYA 3WLIA 3OQMA 4YREA 3UMCA 2RHWA 1SXJB 3TZKA 3F7OA 1ZJWA 5HGXA 3N0TA 3TPCA 1ZIOA 4Y9SA 4RVFA 5IJZA 4QDUA 1JEDA 4GKBA 3ROPA 3W0LB 3IURA 3PHHA 1JQDA 4HGNA 2ACEA 2FLKA 4IF6A 2WHYA 2HJGA 3KDSE 4XVQA 5K09A 3ITDA 1QG4A 4GVLA 3I6MA 3O8QB 4RTQA 1QYRA 1CV2A 2ZT7A 3G3EA 1AQYA 3AEZA 4ZVKA 3PK0A 3BD6A 3GGSA 1U8TA 3PFWO 4A2CA 1C0PA 3R6TA 3IIIA 4GFDA 4QBKA 2O8CA 4TQGA 4G0XA 4Y2YA 3SYTA 1OLXA 3QVLA 1XTBA 1SO8A 4C0AC 4YIKA 4J2HA 1AKWA 4D45A 1QYDA 2ODPA 3ID6C 3V2UA 3ORFA 1GYQA 2H1OA 4ITVA 4ZOBA 4OFBA 4ALLA 3H86A 3ENVA 3MCZA 4ND7A 1UIMA 1A9PA 1QHXA 3QFRA 4GS5A 4MV5A 4MJXA 4P32A 3GD5A 5IJXA 1A7UA 3TF5A 5J43A 2I78A 3T0GA 1X13A 1X2EA 5BT9A 4DZZA 4MUKA 1DPGA 2X1LA 1RTTA 4NPCA 3HO8A 3KM0A 1ITZA 1GSIA 3ULKA 4AC9A 1OJLA 1E2UA 5I3CA 1XCPA 2QSJA 2RH4A 3MJCA 1KZ6A 1VMEA 2FWBA 4L4YA 2V5AA 3KQYA 2J3HA 5I4KA 2P11A 3I0NA 2DKNA 1G291 2UZ1B 5KJEA 4R0MA 3M6IA 2C97A 1I7DA 1Y8CA 3VR2A 4TL9A 1JJ7A 3DBRB 4KITB 3SM9A 4K6OA 5HNKA 3L8CA 2WIJA 2BFPA 4NV1A 4RD0A 4EY4A 2FZEA 3RSHA 1T5TA 1MO4A 2E49A 1JLLB 2PH5A 2POQX 1Y98A 5CPFA 4B3IA 1NG1A 2I8LA 2CFRA 4Z3KA 3VHQA 3V4RA 1IH8A 4Q4HB 3RVQA 1TFRA 2M32A 3EAFA 4Z53A 1ZMTA 4J8PA 3D7SA 4KDFA 2EBFX 3LSYA 2Z9DA 1YVRA 3NCTA 4KVGA 2B98A 4RV5A 4B71A 2O1EA 1EVYA 2BTQA 4P6VF 2D1QA 4F9EA 5J4YA 4LDQA 4ZAXA 1EEXB 1XDZA 2IY9A 3E1KA 3F5FA 1Q0SA 3OVMA 3NONA 5FB3A 5SY4A 3KWJA 5BOSA 4V0LA 1BKSB 2WSLA 4B44A 3KQMA 4WBSA 4D8TA 1OH7A 1EGHA 3D0KA 3RC3A 4A8JA 1A8HA 5EMJA 1DXHA 1MH9A 2W83A 4I3HA 3QEMB 1BHQ1 1NMEA 1XZLA 9LDTA 3O4GA 4ALKA 3F6SA 3GJ6A 3HLTA 4MQBA 5K4AA 4C4XA 2C42A 5LXTF 5M29A 3ZV5A 2QTAA 3H9EO 3M89A 2CL7X 5HTOA 2GN1A 5MF6A 2YZ7A 3IVGA 1O8BA 4GNRA 3U26A 3TR6A 1CIPA 4I81A 5ALEA 1DCTA 5HEKA 4QECA 1H93A 3TSYA 1LC0A 1WUKS 3LQFA 4EMUA 1NBAA 5CVVA 1BWSA 4A4DA 4D3XA 4L15A 4BO9A 1YULA 2FSIA 2OO3A 3W1VA 2O8CB 1E98A 4GICA 4H15A 1DX9A 1UEXC 1E3WB 2XNHA 1PGPA 4KODA 4PRKA 4W1RA 1I4LD 4ODIA 4XB2A 4Q24A 2ID9A 2FY8A 3OA2A 3RVDA 3E5NA 3KUUA 2XMCA 1BAPA 4PU0A 2QYTA 3PBKA 3THSA 5LMNB 2BTOA 2VA9A 4IQGA 3L7CA 5H5JA 3PKJA 1BX1A 3EUAA 5LM3A 2EHJA 1JXMA 1WV0A 1FTSA 2ZUWA 4LRXA 4ZJZA 3LPNA 5LYJF 1IVYA 1WE2A 2I1WA 3IOMA 3NYRA 2NXJA 3CGWA 2A9OA 2CBZA 2OV1A 3D8HA 3SMVA 4YR7A 4OAQA 2JI9A 3N8GA 2GAIA 2GZHA 3NPAA 4FNAA 3AHIA 4JA2A 3TO5A 2YDXA 3TFOA 1PEDA 1W46A 2ONZA 5HWSA 2YMQA 1MHPA 3NQ41 4G0VA 2EW1A 1DHTA 4MQLA 4JYAB 3ANXA 4WZBB 1ZH8A 1G8KA 2PZLA 5E1BA 3DV0A 3K5IA 1PW5A 2OMKA 3V33A 1NLFA 3LNCA 2D1RA 1K8RA 5KEIA 3QSYA 2ZJ7A 1BA2A 4HDKA 3VJMA 4DN6A 2CNLA 5EJ8A 5CT4A 1KC3A 2DHQA 2V6BA 1KJ9A 3OKAA 2DZDA 2FSFA 1TZKA 2B21A 1TCCA 2ZSIA 4K6FA 1IHDA 5D00A 3FYDA 1JW9B 3F2IA 3Q8WA 1ECCA 1DJMA 2R84A 4QEZA 3L6RA 4PBSA 5DLEA 2OG1A 3M82A 3WIBA 1E3SA 4Y2TA 3L2OB 1PT6A 4MDFA 1TA0A 2NGRA 4N3BA 4Q1BA 4S1WA 4YRLA 4PCLA 5FPQA 1IUPA 3TAUA 4AZ3B 6ABPA 2ID8A 3MJFA 4RVOA 4P5PA 5DF1A 2J0EA 1VPEA 4HO1X 2NIPA 1UPTA 3CX8A 1XOIA 3HP1A 5BWMA 4RL4A 3OCWA 1JEYB 1KC1A 3WRWA 5I7FA 1QGUA 2JA1A 5IMBA 2QM7A 5DP1A 4B4WA 3MT8A 3FUVA 1JILA 4X3OA 4DM7A 4FDVA 3ZLVA 1NF3A 1UDAA 2AC4A 2E0IA 3WLFA 4GT1A 4EECA 1WUTA 5C1PA 1Z62A 3E0QA 2XUJA 2F1HA 2IITA 4CODB 1A5SB 1H4TA 1B76A 2WU1A 4Y3UA 3WSVA 2ZU6A 1GL3A 4CMEC 2B61A 2N9UA 2I7CA 1ZOPA 3N2IA 1MJHA 2HQBA 4LVNA 1CIJA 4U2FA 1FFXA 1NXPA 1AY0A 2YL2A 4KC0A 2H16A 2IC5A 1Y3DE 2OZEA 4IDCA 1CD5A 1GVHA 1NVDA 5D84A 3B6EA 1DRWA 4XUGB 3O2SB 5CT9A 3BA6A 1I1HA 3LUKA 5HUHA 3IJ5A 3EZ6A 1YZUA 3GJTA 4W4TA 2F8MA 2OPHA 4EFKA 4GMKA 1EZ4A 1FQOA 2H65A 2L42A 1ESMA 2I6FA 4FJ1A 5AKEA 3KP1A 3H5VA 1PFUA 5TS3A 1GP2A 1ZAKA 1JDPA 1D4AA 3ZWXA 4HZUA 2ODAA 4G97A 3GJZA 1JRLA 1JA0A 1ML3A 2KLHA 1A2QA 4EY8A 4C0BA 1R5BA 4EARA 5AW3A 4G86A 1RI2A 3RRNA 3QU5A 1UBLS 3WGKA 3O1HB 3GWGA 2AZ4A 5JDCC 3B1WA 3O2JA 3MUFA 4R8RA 4DM4A 5DHUA 5KVCA 1NXVA 4HNUA 3BORA 2H08A 5TQ0A 2WIAA 3N1UA 4B0OA 4C7MA 4DM3A 3DBHA 1IHXA 1MEEA 3JVUA 4K3VA 4CV3A 3L4KA 4IFTA 2QAGA 1IN7A 1KVTA 4NBRA 3G68A 4M6WB 4FD3A 4DLSA 4E2XA 3S8YA 2HYDA 3HYNA 4RH1A 1O95D 3L7YA 3R7AA 2HWKA 1TM4E 2IE0A 3Q3EA 4ZP1A 5INTA 3BS4A 5HDQA 3UGJA 1GT91 2ZIWB 1TZJA 3RS7A 1EWYA 2RFLA 2BGNA 3SBOA 1EKXA 1UAGA 1JQAA 1YHYA 1ZBDA 3TLJA 4JL8A 1NR5A 1WKCA 3C39A 2BEVB 3WVNA 3KQWA 5DX1A 2QD4A 4EUFA 4Y67A 2DWOA 3RHSA 3U7RA 3KR9A 1V5WA 4X6XA 3GEBA 3L6CA 4CN8A 4UQOA 3C1OA 3U44A 2JEOA 3RVPA 4D9KA 4DG5A 1VL2A 2HA6A 5T4HA 1ZN2A 2WJZB 3AHDA 1JBQA 1UJMA 1Z45A 1ATIA 2A1UA 3B6IA 3WB0A 4DLTA 1LPOA 1P17A 1VE6A 1USKA 3OEYA 4CMEA 3BXOA 3FIUA 3UMJA 5JY6A 2CDBA 4OREX 5EHIA 1G4HA 3P4UA 3T7SA 3QMPA 4BRZA 3SOZA 3OMWA 1DZ3A 1HXHA 2BGRA 1TECE 4DWOA 1GXSB 1U2DA 1KDOA 3ROEA 2WYUA 2I2FA 4RJIA 2AE2A 1QH9A 1P2SA 3WICA 3KZ1E 1YASA 2HHLA 3NHRA 2X0FA 3TX2A 1Z2NX 3VOBA 4UNSA 4LEIA 4S0ZA 2CLFB 2FZKA 3HG7A 1RMYA 2NADA 3DFKA 2VK8A 4RTRA 4FB4A 5H1YA 3UKDA 4ZXPA 1ZKDA 2C2ZA 3LVQE 3QTLA 6ADHA 3JAMA 3O1LA 1I2DA 1KP9A 1WP9A 1UODA 1SCKA 1DTSA 1GPH1 2TRSB 3D8NA 3FDJA 2E21A 3KZCA 4JLDA 3RTCA 3VYUB 5DXJA 3AOEA 2CY0A 4HLUA 4EBFA 4EVQA 4DIDA 4YROA 3PX7A 4B3RB 3DBHB 3CFYA 1EK0A 5DLDA 1UC8A 1WRBA 5TQ0B 2GD6A 1L5GB 5BYAA 5I4BA 1VLQA 2JLAA 2DF8A 4ZQFA 1C29B 1B4DA 4FZ3A 2OYSA 5I7VA 1NE7A 4K05A 2RJOA 5COAA 2YR0A 3FROA 4DCGA 2N3ZA 2VSYA 5FORA 4AUKA 3Q3VA 3FVRA 4RHEA 5AOCA 1KY3A 5G02A 5CEFA 5K2MA 5JJ5A 4FEAA 2I9KA 4G0OA 3DB1A 5JATA 1JXAA 4HYTA 1D03A 2FK8A 3F74A 1GTL1 3AWIA 3MERA 3EVZA 1SUPA 4UU1A 4J0KA 4QASA 1Y0BA 4MCHA 4W9NA 4ZK2A 1ORTA 3DPIA 4R83A 4FDAA 1PUXA 1Z25A 5A2GA 3AF1A 1Z6YA 4IDDA 3UAYA 1L9KA 1OZAA 2ISQA 2JKYA 1RIIA 3BCRA 4PLYA 4BYMA 3NM4A 3ZK7A 1WHTA 1E2LA 1FU7A 3ONEA 1I24A 3D7MA 2QK4A 4RQBA 4GYYA 3ROKA 1C1HA 4OGFA 5J47A 2Y0BA 2VHEA 3GLHE 4N49A 4DV0B 5EXDA 1CVLA 4NP6A 2J7PA 4B43A 2IIBA 3IAHA 4P7KA 3BH0A 4F1JA 1EBBA 5K6TA 1B3BA 2PY6A 2V7BA 4TWIA 3K9LA 1TVKB 3F8TA 4F46A 2AJDA 1Z12A 3OD1A 4FFLA 4RD2A 4DYHA 2WINI 3HYRA 2IHNA 2CL5A 2JGDA 3CO5A 3R44A 1WZCA 3P9IA 4H9GA 1QBGA 2WHQA 2WWYA 1C80A 4TT3A 5MGBA 4YCNA 1MPXA 4RGYA 2W98A 5GPBA 4ZO7A 4B6OA 3ESRA 5COQA 1BA3A 1P8JA 1ISFA 4ZCPA 1DBRA 2A0WA 2IHVA 1UP7A 3HUUA 2Z2XA 3SVTA 7GPBA 3B3AA 3MILA 3Q0IA 1LRKA 1SM4A 3H05A 3OE5A 5EZQA 3SHOA 2ADFA 3N05A 1ZZGA 3NC1C 2B1GA 3TUZC 2C2OA 1DBIA 1Q95A 3ZW8A 3GFRA 1UK7A 3PXEA 3BWMA 3L8ZA 3ILSA 4NEHB 3H2ZA 4U6QA 3SP1A 2WW8A 3SY8A 3WK4A 4UVIA 3KZVA 3WKAA 3ANYB 4R1UA 4DCVA 1RYEA 2DULA 3HL0A 2VTDA 4V0QA 3G8BA 5FPTA 2O7QA 4W6ZA 2J9ZB 3QHQA 4XM1A 4RM2A 1D2CA 1PZFA 5JUWA 1WPGA 2QU7A 2W11A 2XF2A 4AFNA 2JGAA 2WF7A 4LHYA 1E2IA 2QMUA 4CMAA 2O20A 2WWHA 1RCTE 2YN2A 1R8JA 4QL3A 4U7TB 4U8GA 4L4ZA 1G20A 2IZZA 3BWXA 4M37A 2WP0A 2ANBA 4I9FA 3G2MA 4FN4A 1H23A 4F12A 1XFDA 4I9GA 1FCJA 1P7PA 4BO7A 1OWOA 1R2QA 4IF4A 5DM2A 1R6TA 4EZBA 5HK9A 3L01A 4P08A 2O2YA 1RYNA 3F6CA 4JL6A 4KVAA 1CY4A 3RHFA 4NK5A 3UA3A 1ZVVA 1GFWA 3KEMA 3PPIA 4L5CA 2FE1A 4OOEA 2JLUA 2OO7A 1XQ9A 2GI4A 2PR2A 2IEIA 2WAYA 4KQFA 1SKYB 4MPRA 3B53X 4A2QA 3GRCA 4GI1A 5CW1A 1X1AA 1NMQA 3SDBA 1N4DA 3TRDA 5LL6P 2IZ1A 2Z83A 1Z13A 2VRCA 4QNMA 3IP3A 4LYGA 5G3ZA 3EXAA 1G6HA 1Y81A 2OV8A 1XP5A 3EVAA 1I13A 3G8YA 4G07A 3ZHZA 4GW3A 1G5RA 1A9TA 5AM0A 5JV5A 1ZU4A 2ZEJA 3SKXA 5A6SB 4A03A 4B76A 3KL2A 3FI9A 3CZAA 2X9LA 2CD7A 4QGBA 3A3KA 4PZEA 4W9NC 1FFYA 1PJ3A 1CRPA 2G67A 2JL1A 4LBZA 3IELA 1M74A 3V4SA 1CQPA 4WN3A 2R8XA 4M7RA 3R7WA 4ZZ0A 1NOIA 1ZR2A 3HCCA 4NONA 1HSZA 2JD0A 4XEHA 3KAKA 1RPNA 3CSUA 3L7KA 3MZ0A 4GKVA 5EINA 3TCXB 3UK2A 5KTOA 2GO7A 4KBFA 1L1QA 3T1TA 2QI9C 2C95A 2Q5CA 3BK7A 4KE9A 4JQZA 3TXYA 1LB1B 2YYZA 4AU1A 3CM0A 4LZOA 1OV4A 3L05A 3GDFA 1R0KA 3L82B 4DEVA 5KTPA 3K6SB 1G16A 1RABA 1M7HA 3VBEA 1A88A 4AX4A 3OZXA 1KEZA 2X4IA 2NNWB 3RUHA 5LQRA 2ZRDA 3E3NA 3GFTA 1N6OA 1WCXA 2QYSA 4RACA 3T8YA 2XWJI 4JT4A 1MO6A 5F1KA 4HJXA 1DC3A 4WTOA 3WGIA 5LP6F 3PFFA 1CR2A 2QN3A 5ECYA 2XUPA 3VR5H 1PKXA 4JI0B 5HOEA 2CFTA 5IHXA 1TQ2A 4N6GA 2NACA 3IE2A 3R1IA 1T9DA 2BRUC 2JI4A 2OCLA 4P80A 5IVKA 4TUYA 4DW8A 5IN4A 1I6WA 1P9WA 3N76A 4XYGA 3P9SA 1OAAA 1TKAA 2CV1A 3BZWA 1IHUA 3HVIA 1KKUA 3W6ZA 2Q29A 3J7TA 1W0CA 3CKYA 3N2NA 4C0XA 2FQWA 1ZRSA 1FRZA 3CX6A 4LJ7A 4BCCA 1Y1KE 3OQIA 3EYAA 3DDOA 5ARDA 3UUGA 1VL1A 5JC8A 5L51A 3IBYA 5E6SA 2DPGA 1R0BA 1RXSA 1HNNA 1V7ZA 1XDSA 2IY8A 1VB5A 3RARA 2IXTA 4ZYLA 3RTEA 4RTKA 4UEOA 4B3GA 5CCBA 5FDFA 5KOHA 2P9ZA 4CV2A 4KQHA 2QL5A 1XK7A 4F5YA 5BSHA 3W5UA 1DFHA 3VH4A 2WK1A 7MDHA 4DLZA 5FUVA 3MW8A 3FMGA 4C5CA 2C0PA 2NZWA 1XD8A 3CRMA 2EGGA 3TWOA 4GI5A 5HJEA 3DOJA 3NO4A 1G9TA 1R4NA 3OWOA 2JLBA 3A3NA 3QPVA 4IXWA 2A3NA 4A6XA 4DTCA 5IZCC 3FWKA 3ZWCA 1BVRA 3O9ZA 4ENUA 1K3FA 5L3ZA 4QNRA 2VPPA 2C5AA 5KYYB 4FFSA 1Y9DA 2X0KA 3H4TA 2COUA 2AOWA 4ICIA 3SIRA 4M7OA 1GGKA 2JGNA 2IYSA 4Y1FA 3UV6A 4BIIA 1A1VA 1FPMA 2AOXA 4G5GA 5EVJA 1RBMA 4ND1A 2XHEA 2N47A 4QU8A 2V6GA 5BUCA 1Z35A 4YRCA 4KH0A 5JNUA 4P0QB 3ZH2A 5CM8B 1J1ZA 3VC3A 1T6XA 4FHDA 2CXPA 4WE3A 1NW9B 1TZCA 1NI4A 1M8JA 1BGVA 1I3KA 3K0SA 4LDRA 1XLWA 4EI9A 3HDJA 2XB4A 1E96A 3EPHA 1BGXT 4ZI2A 3THOA 3DTNA 3EHDA 2O2JA 3FYUA 1D5WA 2PL1A 3GOQA 1ZEMA 4JR1A 3VQTA 4B2IA 2Y1FA 1ZUNB 4KI7A 5AXBA 3MJHA 2FPGB 4UZEA 2W6PA 4BL5A 4REQA 4QBIA 4TTPA 1ID8A 2OFWA 1OFHA 3C5WP 4NBKA 3MRTA 3WGQA 1R8YA 2ZXFA 1RLMA 3GMTA 2GDJA 4AZSA 4CI0B 1YTUA 2R4TA 4ZAGA 3ADKA 5G4LA 4LF7B 1J5PA 1YHNA 2HIAA 3JQAB 3C5CA 3U4CA 1PZMA 2G1PA 3K0FB 3E70C 4D57A 4Q1DA 2R44A 2V4UA 4JJ6A 5GGYA 2I2DA 4D0LB 1W93A 4NHEA 3A04A 1XCLA 4RETA 2WD8A 3N2EA 3QBTA 4JWKA 1WHSA 2C61A 3QELA 4GOMD 3FLBA 2XZPA 2FW9A 5L3QB 2IQ5A 1RHUA 5LBIA 4B3XA 4IDAA 3EODA 2G07A 2Q41A 5GJVC 4CKWB 3ZWOA 4D81A 2GN9A 1J1UA 2VQSA 2FVYA 1I2ZA 1QG2A 4PWYA 3UM9A 1W0KD 2WJHA 4BNTA 4BB5A 2P6PA 4URYR 4DA4A 4JMPA 4Z4EA 1KR5A 2ZBEA 1DUIA 3D4OA 2BBSA 1QSGA 2H2WA 4YEDA 3ZCQA 4MUIA 3ZZNA 2AMLA 3TLGA 4XVUA 5T6MA 5LP6B 2P1ZA 1NXOA 4GZ3A 4B2LA 4HAVA 4XARA 5CDTA 4R1QA 3GEDA 4IGAA 1ADCA 1ZMOA 4EJMA 4DNXA 4MSUA 1RHJA 1NVGA 2J3QA 4MINA 1DRKA 2ONJA 3IB3A 3WSTA 4AZWA 4EY7A 2DY1A 3ECSA 2PUDA 1WUYA 2VPWA 3HCAA 1N75A 3H2YA 2BM1A 2OGZA 2PBFA 2WFZA 4HQ0A 5KKAA 1Q1BA 1W9HA 5GMOA 4EO4A 1WF6A 3RFVA 2X0DA 4EB3A 4BTLA 3IIEA 1O58A 4A8HA 4DEXA 3JASB 3LHIA 4UUBA 3RH0A 5HSGA 2O14A 1O5OA 2EAUA 5B53A 3L4JA 5ECGC 4C0SA 4RC9A 4R7ZA 3OZFA 2XCOA 4TROA 2HLDD 3R9IA 4X8HA 5B6JA 3O2QB 3PDIB 1FS5A 1XQVA 2QSYA 4OI1A 2G08A 2QA5A 2VR1A 1M1ZA 5KDDA 4AZ0A 2HREA 1R1DA 5K8UA 4Q18A 3QW4B 1LDYA 4C14A 3DE5X 4QYSA 2A9KA 3KB1A 3MJDA 3FPEA 2Z6VA 1R9NA 4MRMB 1XDGA 4C0QC 1LW6E 1L7MA 4G09A 1XMVA 2Z58A 4MS1B 5B36A 1PGOA 3P0EA 5H4GA 1CF4A 1SC3A 2KLBA 1Q0TA 1QRSA 3UG7A 2PL5A 4FBLA 4KR3A 3VNSA 4LYEA 4WOPA 2ZDGA 4BFTA 1Y42X 5JEEA 3THYB 1D6JA 3WRXA 4BZXA 3ABQB 2INGX 1MG0A 1U3FA 2ZDQA 1U1EA 4Y9UA 4C1BA 4ZZIA 3TR0A 1OC4A 1YZKA 3IBGA 4NKRA 4B6EA 1YOVB 4MKXA 4DQDA 4QWWA 4EHKA 4MJ7A 1IEXA 2XF8A 1YB2A 1SUAA 5YASA 1BFKA 3N86A 3P5BA 4KYIB 1H05A 2FMKA 1V8OA 1T5OA 3OLWA 5LP1A 4RDHA 4GXNA 1N2EA 2VTEA 1H5QA 1U80A 2BI8A 2BV3A 2HJSA 2QWXA 2VDWB 3H0EA 4I4LA 4R2MA 3VYSB 2OXFA 2Q3MA 2VXOA 1GYPA 3CF2A 3LKVA 3LLUA 1LBEA 2IIPA 3NOQA 1QTRA 1WR8A 3Q10A 5CXXA 1SH7A 3HKEB 4R6XA 2TSYB 4CTOA 3P2YA 3TW0A 2I55A 5L4NA 1DWQA 2QI9F 3AU8A 2OD2A 3EH2A 4M9QA 4EL0A 2JIOA 5KYKA 2F3QA 3IMFA 3KC2A 4WKCA 1M1UA 4CYMA 2H1CA 3U1BA 1G3RA 2CJWB 3FDXA 4R8VA 5HXAA 3S68A 1G5TA 1J8QA 2NU9B 3MJEA 1P18A 3N7AA 3OKFA 3UWOA 3B38A 4CCAA 5CXQA 3M6XA 3GCDA 3DEFA 3AUUA 2UVPB 2CYBA 3FDZA 1NASA 5K3AA 4JDPA 5KYUA 2QRLA 1Y9EA 3DTVD 3EEIA 1KP3A 2QZZA 1PFYA 1OYVA 2MMGA 4P3KA 4EI8A 1U7XA 2HQSA 2MR5A 3ZU5A 2VHVA 1UBFA 2TS1A 3GAAA 4HNRA 2WJWA 2PWZA 3MMPA 1O94A 3UWPA 1FB5A 2GETA 1OLUA 4KUHA 1OD6A 1P2VA 1W4ZA 4MS3B 4Q9AA 4RA6B 1S2IA 5CIQA 3FFAA 1GNLA 1XVVA 1EVIA 1F2TA 1KS9A 1W1IA 2CNNA 2J87A 4JJFA 4XYEA 1N2CA 1B1CA 3T7DA 3CBGA 3SJBA 3NAZA 2XWQA 4C6RA 1U90A 3P0RA 4DSAA 1AN9A 3EDCA 4GGOA 1R8XA 4YHHB 4TMZA 4HYEA 3HDHA 4N03A 1AZTA 5ED4A 3BK2A 4KQKA 4BFZA 2IZOA 5BN5A 4L9AA 4A73A 3UIEA 4TN1A 1F2DA 4P35A 2ZBRA 4EF5A 3DF7A 5CB4F 2GZSA 5JZSA 2G83A 3W2FA 4CT4B 1KJ8A 4YRTA 1M2KA 3U80A 2HJRA 1V9CA 4EYKA 2JGLA 2XRFA 3E5MA 5HFJA 1XALA 2VDQB 3LC2O 2NUPA 2Q7OE 2W6NA 2GJ4A 1KSJA 1UDBA 2QQGA 3ELUA 1LLQA 1JMVA 2E55A 4OGWA 4JT2A 4YAJA 4ZV9A 3H9CA 3SLKA 3ZWBA 3WA7A 2DECA 3L5OA 2Z09A 1WW2A 1KAHA 3DGEC 4ZEOA 3D6UA 3D1JA 5FTLA 2X15A 1NSFA 4Z7NB 1YL5A 1Z7YA 1UJCA 4HUQA 4DXHA 3QVKA 4CCWA 2BSAA 3F90A 3EDYA 1G98A 3VUFA 2Y1WA 5EMMA 5C9ZA 5KYTA 3KEQA 1Y1SA 3Q98A 3ZK9A 3TJRA 5AD1A 1RMQA 4RVHA 3THWB 2O0LA 2OUIA 2Q99A 2HXYA 3HHPA 3SC2B 4RF5A 4MVJF 1G4UR 2H31A 3TQRA 2I8AA 3MWJA 3PT5A 2MJLA 1YK1A 4UUNA 1N0HA 3W5DA 3SNHA 1OREA 1X7ZA 5DIZA 1E4YA 3JPWA 5JVDB 4EKGA 4JJEA 2GPJA 1Q1ZA 3JRNA 1DOAA 1PZHA 3G17A 4CM5A 4FJ2A 4RTOA 2JBWA 3CT6A 1PG2A 3FTQA 2MR6A 4KMOA 5KI6A 2J5QA 4RPJA 3O75A 4NZOA 2R7NA 4JBNA 3OAAD 3UA4A 1TB4A 3GMDA 4HN4B 4KBGA 4BNXA 3V1KA 5EE9A 2QRGA 1C4WA 3MRSA 5K0GA 3GLGE 1E0KA 1SUBA 4GP6A 4ZOCA 3DAFA 3L1UA 3PQ2A 2V65A 1QH8B 4QUIA 3SMQA 1Z8HA 1XVIA 2CJYA 3AYZB 3LTNC 2I1VB 1AUQA 3K0CC 5AI4A 4HS4A 1HZZC 2VJMB 3PHJA 4DR5B 1UXOA 5ECDA 4UTVA 5A5FA 3K70C 3EGOA 3NM6B 3DTVA 1IB6A 3GYBA 2ZYSA 3R6DA 4N3GA 2IWHA 1VYTA 3JYNA 2OSVA 3FY4A 3SVLA 4GOOD 2PGLA 3DVAB 1L4UA 5EJIA 3B1XA 1NBME 2OCIA 1Z36A 2HT1A 3L43A 3F9IA 1TZ2A 2G5CA 2WVAA 4H1UA 1W5BA 4NE7A 2F67A 4UNPA 4TVSA 3JQFA 5JXWA 1Z4QA 3UAWA 4ALMA 4QKQA 1U3CA 1DI0A 3HU3A 5JRZA 1C1DB 3VR4A 4KGDA 3ISVA 2HLHA 2ZIFA 1ACLA 4OBEA 3VISA 5EWMA 1JGTA 2WABA 2WC1A 3PR3A 1P5FA 1JLLA 3I30X 1QANA 3I1FA 1IONA 1ML4A 1PYGA 1VJCA 3FNEA 3QBDA 5AW0A 1GNQA 4P3OA 1M83A 3O9MA 3EISA 4RA9B 4RPCA 2Q3HA 1HFJA 3TW6A 1NURA 4E4TA 3CCCA 2WFLB 3LCCA 4OB8A 4YRFA 4A82A 4PGGA 3R3UA 1OVGA 2F7SA 3A9TA 4MUEA 1EJ6A 1HWYA 3O74A 4RD4A 5IAKA 3DR5A 4HDRB 4IX9A 5EESA 1JN0A 1H5NA 1LW7A 2EBHX 2YNMD 3FB4A 3ITKA 1T24A 3M2PA 3NRCA 3OH8A 2FB9A 3M6MD 4NJOA 2SCUB 4QGGA 1FFHA 1YB7A 3UH0A 3HJFA 5CB4A 3I32A 4EJSB 1PE0A 1V6CA 2V0GA 2G6TA 1N2ZA 2R6HA 3OIGA 5A9SA 3RUFA 2J3DA 4F9FA 3M6WA 1QHGA 1EEHA 3I4LA 1SZJG 4LGYA 1OKKD 2LNDA 2GLXA 3LLMA 4TYYA 3AHFA 2FSPA 5EHXA 4QXQA 3QE0A 1E69A 4N5LA 1C4OA 2G1AA 4WT7A 3I52A 5HRUA 4GMHA 4U6SA 721PA 1E79A 1XTTA 2HK9A 3NH6A 4Z3DA 2ZB4A 2IEGA 3RS9A 5I8PA 2H54A 4F3RA 3IUEA 3KJFA 2P0AA 3OCCA 4M0LA 3T3GA 4DLWA 3KG2A 3DLCA 4B79A 3OZTA 4C3UA 2GM3A 3OF2A 2AG8A 3CLTC 4LF9B 1P5JA 2QYHA 2B0CA 3DMTC 2ATIA 1XQXA 2EBWA 3DE4X 2BT4A 4LYFA 4TXJA 1D8TA 2ZUTA 1BWQA 1KBZA 3KKEA 1IULA 3IT3A 4EYGA 5AUOB 1RC0A 3BMOB 2Y2UA 1U2TA 3EF3A 4RMGA 2G3YA 4MQUA 4WNYA 1GCIA 2V7EA 2ZE7A 1Z4IA 1DT5A 2JFYA 3L7MA 1ISGA 1F2TB 2VIIA 4YMLA 1VJ0A 1N3LA 4UKDA 2HA4A 3NATA 2WJPA 4R9SA 1MNQA 3R5FA 2ES4A 4YCJA 4E5DA 5KOHB 3Q7PA 3ELWA 3EXHA 4EY5A 1JG4A 1RWNA 1XAIA 4BAGA 1QYIA 5FWNA 1JI3A 1NVVQ 2JFWA 3EGEA 3N8KA 4X5OA 3V7YA 3KQKA 1M0EA 2CVOA 2J5BA 3QEKA 4QRHA 1ZRNA 4D43A 2ZSKA 3LQ1A 4Z4GA 3FHLA 2DBQA 3OC6A 4L2IB 4BWFB 3B7PA 4YV7A 1IAQA 4RS3A 3JYOA 1K92A 1KVQA 1K06A 4OM7A 4WZ6A 5KYWB 2PT5A 3GFOA 5LA6A 4ZI7F 1XDUA 1QDEA 3UHAA 3PNOA 1EFVA 1T8UA 4HNSA 1YVUA 4YUVA 4BC0A 1ORWA 4XYLA 3FTDA 5BSMA 1RQLA 1CUAA 2VXBA 4GIBA 2G63A 1T1EA 3FGZA 3JWEA 4QJIA 3U1TA 3UT5A 1ZM3A 4M55A 5BWBA 4GUDA 4P81A 3GLFE 2P90A 1X1CA 3IBTA 4A1FA 3KE8A 4MULA 2LCIA 2P2CA 5DOVA 5T5QA 2PNJA 1Q0HA 2VKTA 1DFIA 5IANA 5J1SB 2XT6A 3JZMA 3KV3O 3L9XA 1W2WB 3R2JA 2ZTMA 4TKZA 5GM1A 1X7YA 4A1OA 5A04A 5J23A 2V1UA 1DEXA 2FYTA 3KYJB 2ABWA 1QX3A 1W76A 2BHTA 1A71A 1CDOA 2CXUA 4MQ5A 1CQWA 5PNTA 3AW8A 1XO1A 4TYPA 4TT3D 1AB5A 4M4SA 3WLQA 2XUOA 1XLVA 4RD6A 3TQFA 5DN6D 3KZKA 4WK2B 4F86A 2R6CA 4TTJA 3DOCA 4YS6A 5ALSA 3RNLA 4YP9A 1U8XX 1NNUA 4YQZA 1G0NA 2EBUA 1CUFA 3SIXA 2H5IA 5CJPA 2TECE 3DMDA 5FUQA 4W99A 1FXSA 1P1FA 2HF9A 3RSZA 2VQFB 3T3MB 4ZT6A 3T1YB 2QRJA 1IY8A 1YRLA 1Z0SA 2ESRA 1KY4A 2IHTA 2LKCA 3EGIA 3LA6A 3U19A 2A1IA 2WM8A 5A6SA 3IXMA 3KELA 1X38A 1CEYA 4DCMA 4UQPA 4WQMA 4EZEA 2GN6A 1BOFA 4FYIA 4M8NE 2H63A 2PZ8A 2ZS7A 4V1CA 3AIMA 3N2YA 3A4VA 4KRYA 4XJSA 1MB3A 3FTPA 1UJ5A 2AEFA 5CVDA 3AF5A 2AUTA 3K8YA 3U62A 4Q4AB 3OCVA 3LCJA 1Z7WA 5HE8A 1PS8A 2X0JA 4MIYA 2QRMA 3IUBA 2PRJA 3U9TA 1MJGM 1UOPA 1XZQA 1CU1A 3GT0A 3ZNQA 1JPJA 3P9NA 3Q8XB 3R3SA 4IVRA 1GO2A 4RADA 4NJEA 2IJGX 4PCUA 4J1QA 3PWTA 3ROXA 2FX2A 2AG6A 4E33A 1YCGA 1W59A 2GZDA 1LXCA 1K7CA 1Q7GA 3HDGA 2G5TA 1A4RA 2Q1UA 4J4HA 4G9EA 4ABYA 1ZOIA 1RRKA 3IMGA 4H18A 5D5PA 1NT2A 4P0TA 4RGQA 3WK5A 4JC4A 3AVVA 5JO9A 5TT0A 3K6KA 5KNBD 5LB4A 3RBXA 1FDTA 3ZYCA 3BD8A 1HE1C 4K40A 1FX1A 2HN9A 2PSDA 4O8ZA 5KNBH 1XMJA 2ARKA 3JARB 3RIGA 3C3MA 2VT3A 3ES9A 4YASA 5G53C 2ZM6B 1XTUA 2OCYC 1E9EA 4BKUA 3QBEA 1VKJA 2WQZA 3FVWA 3D1LA 4KXYA 2WR8A 5FL7D 2ZITA 4WADA 3B13B 4DXDA 1R0WA 4MMZB 1AMUA 3QEBZ 1SHUX 4MNTA 2D7JA 4NZ9A 3TNJA 2R68A 3RIXA 1UWCA 4GBJA 3AM3A 4OBXA 5B58T 2RSLA 4QAQA 1CZKA 2B20A 4RZ3A 3VU8A 3GVHA 1RHKA 4UTRA 3JWPA 3BQNB 4L16A 2J9GA 3ILYA 3WBJA 3GRZA 4JN6B 3A11A 1WMBA 4QHYA 4G36A 1IUKA 3HUTA 5J9FA 2O0MA 3TCNA 4BEJA 4DRYA 4EUNA 3EEOA 2ASVA 2QZ4A 1KEUA 4MS4A 4A92A 4RUKA 4L5BA 5K1ZA 1UOEA 2VCEA 3SYRA 2JJQA 1OXBB 1GTRA 5BPFA 5CD9A 1E3WA 3DEYX 1DOZA 3JD2A 5K3SA 4N5HX 2NXEA 3ILVA 2UYOA 3N6RA 4TV9B 3FPAA 4WDRA 2J08A 5SYMA 2C4KA 2YASA 4UTZA 3RW9A 2AWOA 3K35A 1S5PA 2FK7A 3TK1A 3ZIAA 3PSHA 3EOBI 2PUWA 5DN6A 2YY6A 3UTDA 1TMGE 1VYUA 3EIUA 1NY6A 3H19A 1RAIA 4HZGA 4MVJD 4QQFA 3LY7A 1RTKA 2I6GA 2RGDA 4WERA 3QVXA 2AN4A 1GG2A 2EFEB 2IEDA 3UJ6A 1W25A 4GAEA 3LRXA 3GD7A 3K70B 1G20E 4PVCA 1RWVA 1Y8AA 4J1TA 1FYVA 2HSZA 4FS3A 4Q3LA 2H1LA 5H80A 1EM6A 5JQGF 1UZNA 2MU1A 1Y3HA 1GG9A 1F0KA 2PU7A 2BR5A 2QRUA 3OZIA 3ME5A 4UBIA 1P77A 4AJKA 4I19A 3OECA 4TT8A 4AUNA 5HHTA 3M0EA 2NM0A 1UDWA 1FPQA 1RBQA 3U7IA 4D4HA 2GM5A 1MVNA 3QE3A 1VCIA 2ECOA 3L7BA 1PLLA 3GNQA 5JFTA 2JAUA 3RVNA 2NMVA 2QUAA 4DG8A 5DGDA 3GLFA 4UAUA 1HDXA 3MQ2A 2EX0A 4POOA 2O06A 4HN9A 2RONA 4M1TA 1NZDA 1AS3A 3FF4A 1GRRA 2Z30A 4HADA 4HJRA 4PRZA 1D2GA 4QDJA 4WEQA 1HUQA 2V8OA 3P0FA 4G0QA 1G60A 4XQ0A 4BLWA 1U94A 3LT4A 4CG2A 4D3SA 3P20A 3WYCA 1K66A 3QUAA 2KM1A 2E4WA 2RGCA 3F78A 3KHKA 2XGSA 3PVSA 3WMFA 2G4VA 1GV1A 2YW2A 3ETCA 3RYHB 4BLQA 4X62B 2OO5A 3W2TA 5IM4F 3GZ4A 4C4PA 4BFWA 2TMDA 4ZAYA 2HAEA 3ANSA 1GGEA 2R8BA 5HQJA 1K7FB 4PTZA 1KR2A 1VJTA 3KB2A 1SA0B 4CQLB 1XTIA 3F6BX 1O54A 2VEDA 5AM2A 1R0CA 2WVJA 3ST7A 1USIA 1D7OA 1ILEA 2PNFA 1TA4A 4H0NA 1J0AA 1GZ5A 1SKBA 4MDHA 2V6JA 5AJZA 4WLOA 3FWPA 3KQVA 4GPTA 1AKEA 4G4GA 3N8HA 1VPTA 3PPXA 2PFKA 3ZS8A 2KSQA 3H5AA 3B51X 5AICA 3D3NA 5AI0A 1Q0RA 1JE0A 4RESA 5GOZA 3QXHA 5M3BA 3G85A 3KD2A 2QR3A 4TV8A 1V45E 1UMCA 2ZT5A 3DOOA 1Z82A 3JV7A 1IY0A 3C15C 4J03A 2ZVDA 4LE2A 4JZKA 3A28A 1E3JA 3RG2A 2PZBA 1OFVA 4C0LA 5HRAA 3I6QA 4AS3A 1JHVA 5I9IA 2JGEA 2WTBA 3MB5A 3DUFB 5C8XA 2Q5LA 5KOJA 1ZXXA 1SCAA 3N59A 2QMQA 2Y9PB 3IV9A 3KUXA 4NYIR 4RK7A 3UTCA 4OXYA 4QA9A 4DMLA 2CLSA 5DCYA 2OPBA 1B8UA 2X1VA 3JD3A 5DK6A 4CDRA 4OIFA 1GKKA 4YMTA 1N77A 4QGSA 4AKIA 2IFTA 3ZE9A 5HQ3B 5AKXA 2QRVB 4FHCA 5A9TA 3KOMA 3I6IA 3S8EA 1IXKA 2A94A 3KR0A 1NULA 3INRA 3OP1A 4WZBA 2W70A 1QJ4A 3AUAA 5CLHA 1BE6A 4CLDA 4TYNA 1O6CA 1MN6A 4IKPA 1IG0A 2Q4EA 1QS0A 2QG4A 2RG7A 3MN1A 3PUXA 4NMHA 1AQUA 1ZHHA 2EG9A 4HDRA 5B55A 3U13A 2BSQA 3R0IA 3CA8A 4GRDA 2Q6IA 3ANLA 5L7YA 2FEWB 1EE9A 1KJJA 5KWVA 2PQ2A 1GUFA 2VZLA 3EIFA 3FBGA 3FJOA 4XI9A 5DB4A 5F7ZA 3N7UA 4MGZR 1IN4A 1XD2A 2XQVA 5ICEA 1ZNXA 1KEKA 3NLLA 3OY7A 3GJ3A 4BMYA 4BZWA 3CE6A 3JWIA 1U3DA 2RCYA 2NTYC 4ARCA 3ZGZA 3VZPA 1N6KA 1ZVKA 3N87A 3AR5A 3EPLA 3ICPA 2IGBA 4U7GA 3HDVA 1SCUB 1EE2A 3UBMA 1LDMA 1RMTA 3QLVC 1QPGA 2A8YA 5REQA 3WBKA 1DCKA 2ZXUA 1JTVA 1JG2A 2CXHA 4YLYA 3IAM1 4C22A 2JVIA 4RTNA 2VP2A 5EFZA 2D59A 2C0QA 2CT8A 4IIBA 2ZSJA 5AVYA 2BFBA 3CKLA 3C2QA 2GRAA 2Z3ZA 3N5KA 1R0ZA 5BQXA 2DHRA 3QWFA 2BGKA 4CMBA 3LQKA 1Y5MA 4KFTA 3E5RA 2EZ4A 3DR3A 5F78A 2CSXA 3GFVA 3I53A 3UYKA 4HI0E 3BMOA 4EG8A 3NDBB 1D3AA 3K9WA 3QKSA 2AXPA 1E4OA 2B1QA 3VC7A 3G5TA 1C9EA 3NWEA 1H8EA 3A1UA 2PLRA 5CA1F 4IMIB 3Q7TA 2PV7A 4W7SA 2UUBB 1T2UA 3KT3A 4HQ6A 4LNUA 4EWLA 3U37A 1LPNA 4WPGA 1NLUA 2EWMA 3I64A 3K2BA 3ONWA 2QNIA 1AU9A 4JGGA 4JEHA 3PQ5A 4J0GA 3U7HB 4Q3NA 4C7XA 1VMKA 2OORA 5ECWA 1VXRA 3TQCA 2VJPA 3WGZA 2W6JA 2ID7A 3JARA 5AKGA 2OFPA 4LGCA 4XGKA 5F7XA 1Q21A 3PVZA 1EUCB 4QBGB 3ZXUB 2GEDA 4JP2A 3DZCA 2Y1LA 4FEEA 3H16A 3WGLA 3SZRA 2PGAA 3MJRA 4LJAA 1SXJA 4O4IB 1OFIA 4AKHA 4KMMA 2J6HA 4XPZA 1EVKA 4B81A 4L76A 4UATA 1W5EA 4BNHA 5F21A 5T3UA 1KI8A 2W8BB 3D4BA 4MVCA 4HLQB 6Q21A 4YJDA 1DKMA 2B6HA 3ZXIA 3OHMA 4ZVQA 4RW0A 1IBMB 2JZNA 1T26A 1ZUIA 1C3OB 4BC1A 1HDYA 2FWPA 5CH3A 4KZKA 2WKRA 3PGA1 4NQZA 3OIWA 4BBJA 3EXHB 3CC8A 4WRRA 1OZFA 1DB3A 2IYFA 3I62A 1KQFA 3S1LA 2A9RA 1WBDA 1XLTC 2CCGA 2J0UB 2FUKA 2ZYAA 4UXIA 1OW3B 4D9IA 1U99A 3K9BA 1U1IA 2PX3A 3LT1A 1XKXA 4OI2A 4EYQA 3FTFA 2A1TS 1SOMA 2WM3A 3DKVA 2ZCUA 4J3JA 4QODA 1ZJ4A 3PXGA 1XTZA 1RQGA 2QVYX 4E7OA 3TTWA 4EHAA 4YAUA 1X0VA 3GZNB 1QKIA 1OVMA 3IDFA 5CT8A 5HJ2A 1ZFNA 4JJGA 4BV8A 3BTOA 4N9WA 3CV3A 1A3CA 3K1YA 2H07A 1FNDA 3B1KA 4OHKA 3U39A 5FADA 1A2BA 4UOZA 4ZYWA 3FKQA 3ROGA 5HQTA 4Q3AA 2WQ6A 2QVBA 4IHJF 3DMRA 4DA6A 1H2RS 4D9HA 3D0QA 1YZLA 3DL4A 2QNBA 3QVVA 2P67A 2V3VA 2NZYA 4HZIA 3HE3A 2EG5A 3CLSC 3STXA 5BV2P 2I33A 1G21B 2VRNA 1R15A 3GIDA 5HQ3A 1PKEA 2JHGA 2ZIEA 3B6ZA 3CBQA 3CEAA 4LXIA 3ZIUA 4M89A 2J30A 2FFRA 5KTYA 1AS2A 5AUNB 5AW5A 3UUFA 1LPBB 1XELA 3MXOA 3E1GA 4HDNB 4LNAA 5CEJA 4FYXA 4V0RA 3L4EA 2JFHA 1U8ZA 5EPUA 5IDVA 1RXIA 1DSSG 2NZVG 4RVDA 1N1DA 3KAJA 4G4IA 4RHFA 5FL3A 4UEJA 2BEUB 2JFPA 2YJ6A 4D4IA 4CIWA 3EFOB 2G6BA 1QU2A 3DT9A 4LFBB 2X13A 4A0QA 2AF4C 3WRYA 1F6BA 4MIEA 4AS2A 4C0JA 3M6FA 3LCUA 2WVGA 4FFVA 5BR1A 5C4GB 1QIMA 1T10A 2O8BB 3IT2A 4PHCA 2HKIA 2BUBA 4FHGA 1I4TD 1H2AS 4I5DA 4RPGA 4HGPA 1GA4A 1G55A 2WJIA 3FNIA 4PLFA 5B64A 1Z88A 2PBRA 3HCDA 1Q19A 2N1MA 1E2QA 1QHSA 4MQMA 3TB4A 3JU3A 2JGMA 3RRYA 3UW1A 3OHPA 2OLKA 3FRHA 1EUQA 2ZBQA 1OV6A 4TQ9A 1XCOA 2OOSA 1EFUA 4R0VA 1M2EA 1T3HA 2Z8XA 4TVOA 4XDGA 4RVNA 3IKLA 1HT0A 4HPXB 4WK6A 3JQ9A 2C5BA 2Z5LA 4LA4A 2ZAIA 5CA0B 2C94A 4PIVA 4LF4B 3P94A 2YHIB 1P72A 4YJHB 1RZVA 3BF7A 4GMGA 3B9QA 3J80A 3KR1A 4TRRA 4R9UC 1FYWA 4FOPA 3ZWDA 5BN4B 1KFKB 8ABPA 3HS3A 3BIJA 3QVMA 4RSRA 5ADHA 4AKEA 1WDTA 3GLIA 4OHXA 1EFLA 1QR2A 5H16A 3ZQKA 2BMEA 1AG9A 2VN8A 3DFZA 3OF5A 2GESA 2GN2A 3DJFA 3T61A 4RM3A 4ZU3A 1E2PA 1XWIA 1KQOA 2N42A 3E22B 4MV8A 1FDUA 1M72A 1ODIA 1XXHA 2MSEB 2PMFA 2NT3A 3ER6A 4OHCA 4PG5A 3REQB 5JZBA 1DIBA 4UUOA 1XVTA 4RKWA 4WKBA 1GG5A 4MKHA 3V46A 3ESDA 3ZZUA 4B1FA 4DJTA 3T15A 1AS0A 1DJPA 3V7NA 1JLHA 1JJIA 4G26A 4CU2A 2GPNA 1D09A 3HSSA 2PL9A 2WUGA 4E5UA 3TVYA 4D56A 2B8TA 3K0HA 3KOUA 1F0NA 2GPYA 2PPVA 2VDNB 3E9CA 3KOZA 4FW9A 4O0MA 4O4JB 4KMSA 1O5IA 1M76A 3K1JA 1U7TA 4R81A 4JI7B 3DM9B 3G0OA 4Y30A 2OAEA 1B6SA 1NVKA 2XUDA 2D06A 3IMCA 3ANMA 1HL7A 2ZYTX 3FZEA 4Q4AA 3R6GA 3PFNA 3WMWA 1I01A 4DZTA 3KSBC 3DHVA 3KZNA 1GFZA 1LBTA 4LOHA 2X6QA 3P2KA 4LSWA 5TC4A 1P1KA 1QE0A 2M98A 3X1YA 3ZOKA 1BN7A 1WVIA 4DIKA 1EIZA 4M1MA 2YZ2A 2GEUA 2D1FA 3CLTD 1R5OA 1UP6A 1W75A 3L92A 1OX5A 1GCOA 4JUFA 1KQNA 2PMKA 3HN6A 4XQGA 1AUVA 4OA5A 3DVSX 4YNBA 2WSSA 4MYHA 3IUNA 1TD1A 1KETA 2AI3A 2NZ2A 5GVRA 1M9NA 1QGAA 821PA 3HRKA 3HJAA 1TK2A 1Z08A 2FNAA 3UJNA 1D4FA 1Z4KA 3W2IA 2B82A 4NNJA 4PHTA 5FV7A 4ID3A 4YDHB 3MPUA 4ARZA 2ZSEA 1I9CA 2QMZA 1A9XA 4OJQA 3AH8A 5KUTA 1OWMA 1JZTA 1RPJA 5BSUA 1YDFA 3DYBA 2GJSA 4DT1A 4I1OA 5LKRA 3NNSA 4GX1A 4MTCA 2HEIA 2VJBA 1GZHB 2W2VA 1XDDA 1EBFA 3ASVA 3HBFA 1E0JA 3L77A 3NWOA 1TVEA 1WCYA 2X3FA 3BRQA 1JU9A 1GU7A 2FETA 3IOCA 2VTVA 4ZGBA 3GJ4A 1QKKA 3S2UA 1NHWA 1Q91A 1HDGO 1R37A 3ESBA 5F1OA 5A7GA 2ZE5A 3HY3A 4KAXA 2GDZA 5TDHA 4C4AA 4MW1A 4TVKA 3V3KA 1XLTA 1KGDA 4L4SA 1N9KA 4I8DA 4DY6A 4DWJA 4CKWA 2ODBA 2OHIA 3K6RA 4JASB 3GHHA 4N6OA 5I47A 4MHSA 2J48A 3D2LA 3L04A 4LDJA 3NETA 4O29A 2ZM5A 4M1ZA 5AJWA 2J6CA 3EN0A 1IWOA 5F7OA 4JEMA 4NVRA 3ZVKA 4V3BA 3ZHBA 1ZIXA 5HGJA 2J32A 3ZDZB 4FYMA 4UHJA 2R6JA 1STOA 1BX0A 1MV8A 4MICA 2V9PA 2B4RO 2PX6A 3AR4A 4GP9A 1BS9A 1JT2A 1VSUA 1ZRMA 2HF7A 2P2ZA 3K09C 4OMDA 4K9SA 3GJRA 1QMPA 3RAGA 1WLYA 3SFTA 2BCEA 2X14A 3I73A 4N5DA 1JEQA 1NF2A 5DO9A 3WRVA 3GLGB 3OA0A 3T3PB 3HR8A 2VLBA 4R8KA 4RIEA 3Q2IA 2BMVA 1A5TA 1CYDA 2LV8A 4RIHA 2LZ0A 1BRMA 1IXRC 4YMGA 1JQLB 2Y77A 4FILA 4GBMA 4EHLA 2ZRNA 5BQOA 3NTVA 2ZI6A 3UK0A 4CEJB 1SK9A 3OE1A 4ZD6A 4GD3Q 3BJMA 1DUSA 1G8PA 1AUOA 3HU2A 5ED0A 3GPLA 4LW8A 2CV0A 5IAJA 4R9RA 5JDCA 2WIKA 4N41A 4LBWA 4UNIA 2YYAA 3QBVA 3GLIE 3WZMA 4IAOA 1KERA 3GRRA 4H4DA 3MTDA 4BN5A 1CZRA 4XOUA 1ESEA 1K8YB 1JBEA 2VJDA 3A2NA 1P4RA 1FMFA 2Z08A 3NYQA 5JFGA 1RI1A 3SJUA 1WZNA 3EDQA 2Q6LA 3NHKA 1MENA 4V3CA 3K0KA 2ANCA 1F8UA 3M5DA 5ENVA 3TFWA 2HMUA 121PA 1RYZA 1SVNA 1HURA 1PSWA 2YZKA 3BT7A 1E7YA 2C96A 3NBXX 3PLAE 4O2AB 5KO2A 1N6LA 2BFEA 4PGFA 3HJCA 4U9IS 1B0AA 2V5VA 4A6PA 2XOKA 3FNRA 4LOIA 4ZDIA 3NOVA 5KVQA 3SHVA 4ZOAA 2EKBA 2E7ZA 5DCWA 5IT4A 3FX2A 1U1FA 1XR3A 1T0UA 4PZPA 2ONYA 3WYFA 1YOVA 3EZYA 5AXDA 2R8EA 3C5HA 2G1KA 1ZW6A 1FE8A 1O94D 1TJ3A 2XE6A 3D2BA 3LZCA 4J7CA 4TXHA 5IUJC 4HWPA 3K5PA 5EWJB 1ESNA 2PGIA 1LK7A 3FMFA 4NCXA 4LV5B 3E48A 4DQKA 2YWXA 2V6FA 3FCEA 3L7IA 4G5RA 5HIIA 2PH7A 5A7HA 3SBEA 3HSKA 2C31A 2CXQA 1L9XA 2V7TA 4YJ2F 2BIFA 1BVYF 4IVPA 5NULA 1GAJA 1SUFA 3OFVA 3GRFA 4MRRA 1W4RA 5IT9A 4ZVVA 4O5AA 1TEHA 4U2GA 1JFTA 1CUYA 2GZ2A 1LBIA 2EC5A 3QU2A 4F85A 1W8DA 4ZYVA 4ALIA 2XAAA 1YVEI 3ENWA 4H2DA 4PLCA 3D8SA 2UUPA 3H1GA 3N70A 2UXCB 1KFEB 2FLVA 2IUTA 1WQ1R 3ZEIA 3CZ5A 2Z4SA 3AFHA 1I4EB 4R4JA 1DKLA 1K5GA 4J2TA 2Q1YA 3PEUA 3EVEA 5J2TB 5EHGA 1GKYA 3IJEB 1TOAA 5G0TA 4KQCA 4B3FX 3HDTA 1NUQA 4KGVA 4CQJA 3KAQA 3SQLA 1JKIA 1DJOA 1WA5A 1Z6QA 3WLEA 1J6UA 4RZIA 3K32A 2DAPA 3AUKA 1BYIA 5DNWA 4ZRMA 1S6YA 3ZDFA 5I01A 2WM2A 1EESA 3CUWA 1FBNA 1G3UA 3DKPA 3OY2A 3S4YA 4OBBA 3L41A 3U1VA 2ORVA 2X6TA 1E1MA 1Y89A 4R2WA 1RIFA 4Q1FA 5EKSA 4NDNE 2VPYA 3IBCA 3OZBA 3SS9X 1NOKA 1LDBA 1W5SA 3WIEA 3KHSA 4YAWA 5IVIA 5KTRA 2VDOB 2OV3A 3LBFA 1F0YA 2XD4A 3EF1A 4QULA 3GJ0A 1NYTA 3JVDA 4EMSA 5G4KB 4FMBB 4DBZA 2QPTA 4NAUA 5G1PA 4ENWA 4K9OA 4XDYA 3UB2A 1B6TA 5CFLA 1N33B 2ZCVA 7MHTA 4JX8A 3A1FA 5FUWA 1IHPA 2I67A 2VHJA 4AY5A 2ZI3A 5LPNA 2AJTA 3DDHA 3WWYA 1U9IA 1SURA 1QNLA 4AJ9A 1EYZA 4I50A 1V1RA 5KYXA 1L5SA 4PNEA 4BEWA 1NBHA 3OJWA 1T3GA 2JIRA 1HLDA 2DHDA 3S5UA 4YAEA 2M2IA 2JLQA 3MWDB 3KPVA 1ESZA 1C7JA 2PKWA 2WF9A 4I46A 3UWKA 4IXNA 5BMVF 4RJJA 2JANA 3OLXA 4L8GA 2CVPA 1F51E 2R8RA 3ORYA 5LVAA 4AJ4A 3AVUA 1QZ3A 3BEDA 4JBLA 2KW5A 4LAFA 4NPAA 1C7ZA 1XCBA 4R2XA 3IB6A 3KTAB 5JCJD 3LVRE 3X1MA 2HA3A 1NQOA 3AB8A 1R4AA 1U1DA 2IE8A 2BZ1A 1QIEA 4GPBA 3GLSA 4XTRA 5J5CA 3VZRA 4EHIA 2W6JD 1PJRA 2B30A 1XGKA 2H0AA 1QYVA 3EEFA 4MR8A 5J63A 3RUPA 1ORHA 2AH5A 4G85A 4UUPA 1PX2A 2J6BA 4DCPA 1BEEA 2GARA 3EQ8A 3IP9A 3JQQA 2A4KA 1F14A 3TXAA 1G8MA 4OA8A 2G06A 3QVGA 4JENA 4M60A 4CKZA 2XDQA 1EUZA 4AUEA 2LDXA 3M3PA 4WINA 5AR1A 4YK7A 2HHCA 2IOQA 2PT7A 3I8SA 3TL2A 5K2OA 2IBSA 3H6HA 3MOGA 1G2OA 3FN4A 2CXSA 3JTEA 4MCAA 5AO9A 4ZCMA 4QOGA 2QE7A 1VL0A 1BW9B 4UMVA 4LRYA 3W4JA 1OHHA 2IELA 1JIUA 3CUTA 3W6NA 3ESXA 3A05A 4FQ8A 1N32B 1KWKA 3GY0A 3FOAA 1RHMA 4B6JA 5ALFA 4QM6A 5JT1A 5DNVA 3L6BA 4ABTA 3X3HA 2XE8A 1VQ1A 3E3LA 1K1EA 4UUMA 3SK0A 5KWIA 4LV8B 1J42A 2VK4A 3UENA 1UKEA 2O5VA 4AJIA 2Q4DA 4IQ8A 1TNDA 1QTQA 1XJWA 3TVTA 2NG1A 1MZVA 1UXIA 2I7XA 1OIWA 3VO8A 1T5SA 5AVKA 2Q3DA 5EQDA 4CR6A 2I34A 4QVKA 4LPSA 3G6WA 3K4HA 4PPQA 5CB0A 1Y6JA 1W73A 1T5DX 1SB8A 4XPIB 2AJ8A 3ND6A 4ACBA 1Q74A 3W79A 4M1SA 4CT5A 2ZIZA 4OQZA 2H1WA 5TEWA 1GSAA 1QH8A 4EVRA 5JTUA 3FB1A 4RTJA 4EGSA 2DLDA 5JPDA 1O6FA 1SU7A 2FH5B 2CMKA 2H11A 1V26A 1YJQA 1X2BA 3VYVA 4PY2A 1L2TA 2V55B 1P2UA 4HAZA 1HQDA 1X7WA 5IYZA 1G64A 3E3OA 3R6LA 3W3ZB 2FFAA 1SCBA 4Q34A 5JAHA 3F73A 1G5HA 2QN7A 1WHTB 1W5TA 2ZT8A 2XLBA 3QPWA 4MZXA 3GLUA 1WU7A 3TSCA 4O4HF 2QT0A 1G66A 1LJUA 1EFVB 3B3QA 4MWZA 1DTWA 5CBPA 3TB6A 1J39A 1ZOLA 1D2NA 2DPXA 5CBPB 2ZRBA 5DLYA 3VMFA 4NOLA 1UIRA 3TS1A 4A5SA 3NMUF 2NP6A 3DBOB 3BE4A 2NV6A 3EVTA 1Q20A 2P78A 5FI3A 3GO4A 4MWEA 1RQXA 3D6TB 3I9NA 4K9RA 5GZ3A 5KVAA 5B2EA 2E3JA 2AFIE 1MDBA 1G38A 2NO7A 4HSGA 5GY7A 4RMJA 5ELMA 4BX2A 1V6AA 2CXRA 6PFKA 2V9CA 5K6AA 2NT4A 1Q50A 4N3CA 3OZGA 1CKEA 5E1DA 1PZEA 1WCWA 1SCJA 2RB5A 2RAVA 1MORA 2V7VA 2ZRCA 1E2MA 4TTRA 5BMOA 1EBUA 1GUYA 3HFRA 3AGPA 1N57A 2IHKA 2KI5A 3VPGA 4YJFB 1Z2PX 4C4SA 1PNVA 1P29A 2B8EA 2ZRGA 2DC1A 1UBTS 1HX7A 5CDYA 4S05A 1NQXA 3L7JA 1BHSA 3AVPA 5JD5A 1RQ2A 1S8FA 2X22A 3FUTA 4Q9DA 1KSGA 3WTBA 1JFVA 1F9EA 2CDAA 2HCBA 3CNHA 3TQQA 2J46A 1KIMA 4MKIA 4K0KB 4OQFA 2OCBA 3GQBA 4B73A 2XPCA 1AKVA 1SXHA 4CLXA 5K8JB 4L0MA 2FW7A 1P4AA 1YNOA 5LQAA 3OQNA 1VHQA 2BKAA 3WWPA 1NY5A 5DN9A 2CL6X 3LT0A 2NP7A 1UL1X 3Q15C 4DDWA 3R20A 2GMWA 2X7HA 4AZVA 3AFMA 1ZK1A 3OZSA 4LHVA 2PUVA 3RCBA 1SXPA 4F6RA 2MSCB 4HXGA 2B34A 5CYOA 1V95A 4BTVA 1YF3A 1F2UB 1GRQA 4ZO8A 1HF3A 1XBTA 4UCFA 3A6PC 1ZUHA 1OXKB 3LV8A 3TQHA 1AMOA 2YS6A 2WMYA 5J2TF 1O6ZA 3S2GA 4H77A 1XL0A 1OA1A 4HB0A 4JUCA 2Y71A 3OCUA 5JBQA 2M6LA 4LQDA 2FSVC 5FEUA 4PRLA 3I9V6 2C9DA 4RQAA 4JLOA 4EHJA 4BB6A 1UCFA 3ETNA 3O8OA 5FI5A 3BIXA 4PC3A 1Z0FA 3AR3A 4M54A 1DKUA 2VATA 4UQLA 4FGUA 4X92A 1RKXA 1DXQA 1T3ZA 4L7VA 4Q66C 3T9FA 1WSWA 3IV6A 4Q21A 2AE1A 5T57A 3HGTA 5HS6A 1DDGA 1KVSA 5H81A 1V1MB 1OBOA 5CDFE 3AQIA 3RASA 5SZIA 2VTBA 3PL1A 4U5QA 2NO0A 4M21A 1CUIA 5JC1A 1L4LA 3AUTA 3A4MA 1P7VA 3DZJA 4WNAA 3K9CA 5G2OA 2R8YA 3G0DA 3LG2A 2WSSD 4O63O 5AJTA 3WKDA 3ZY3A 3RTAA 2IKQA 3TGWA 4ZYYA 1EFTA 1K6JA 4HL6A 4TWBA 2QLNA 1JX6A 4CR8A 1P7CA 4PONA 3VPSA 3WLSA 3T5PA 1NQVA 2XMZA 3MINB 1F7UA 1P4SA 4NXMB 2WAMA 3CTMA 4G81A 4RFVA 1AXRA 1ZU5A 3BH6A 1DAHA 3W5AA 3EPKA 4NG5A 5CK4A 2PV0A 2BJVA 3D64A 3GNSA 3FAKA 3X1DA 4DQVA 2XRZA 2QUHA 3T1HB 2NSLA 4C3VA 1SHKA 2P9YA 4G01B 3UUEA 4E70A 1QE5A 2HIMA 2G9ZA 3E9RA 5FTWA 1QV6A 3W4IA 4E14A 3K9HA 1C3LA 1U7DA 3K8OE 1MOQA 3JQBA 4HB4A 4NX2A 4UARA 4L57A 3RSQA 1JTEA 4W5JA 2GTIA 3AF3A 4TVBA 4AKGA 2GEJA 1UDRA 2P2YA 3EBPA 4GM1A 4A23A 5K0BA 3LW7A 3Q11A 3TRJA 4UE6A 2HLPA 2D1TA 2I3GA 2V7QD 3GI1A 1QIJA 3EYWA 3PGKA 4LYJA 5JD3A 1W0JA 1V3UA 3MGCA 4L95C 5EXTA 2XVAA 4YFYA 1H8ED 5CH5A 1JU4A 4TV9A 2II6A 1SU6A 5CU7A 1V3VA 4X1KA 5H8WA 3TOSA 1GKUB 1MVLA 1ZGJA 1NATA