1IU9A

Crystal structure of the c-terminal domain of aspartate racemase from pyrococcus horikoshii ot3
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
111
structure length
111
Chain Sequence
MIEETAKKVKELGFKKAGLLATTGTIVSGVYEKEFSKYGVEIMTPTEDEQKDVMRGIYEGVKAGNLKLGRELLLKTAKILEERGAECIIAGCTEVSVVLKQDDLKVPLIDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords aspartate racemase
publication title Structural insight into gene duplication, gene fusion and domain swapping in the evolution of PLP-independent amino acid racemases
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 43
structure length 111
sequence length 111
ec nomenclature ec 5.1.1.13: Aspartate racemase.
pdb deposition date 2002-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iu9A00
2JFUA 2JFWA 1JFLA 2ZSKA 2JFPA 1B74A 1B73A 2OHOA 2JFZA 3UHFA 5HRCA 3HFRA 4B1FA 2JFNA 2OHVA 2OHGA 3S81A 5ELLA 1ZUWA 2VVTA 2GZMA 2JFOA 2JFXA 2W4IA 3OUTA 5HRAA 2EQ5A 3UHPA 2JFVA 3ISTA 2DGDA 2JFYA 2DWUA 3ISVA 3UHOA 3S7ZA 5EVCA 2DX7A 5IJWA 1IU9A 3OJCA 5HJ7A 5ELMA 2JFQA 5HQTA
chains in the Genus database with same CATH superfamily
3SOZA 3TEJA 2MSNA 2UYOA 1XZHA 3E1GA 4V3CA 3LU1A 4OY3A 1FFDA 2WU4A 4HRYA 3K6SA 2EDAA 3O0TA 1U2QA 5LDHA 5AIAA 4IDAA 2OBBA 5A5VA 2IUYA 2O5CA 4MKRA 2OFPA 3S81A 5LDDC 4URFA 4OX9Y 4TZ0A 3TSYA 2JCYA 3NDJA 4E5VA 4X20B 2A5LA 2VPWA 1ATIA 2VK1A 4EOGA 3KSUA 4OL9A 5SY4A 1E3MA 2BGUA 5H02A 1DAHA 2Q4DA 5JS8A 1PI3A 3D3QA 2X5KO 3C3XA 3HFJA 3RYFB 4DVGA 2PUBA 5T67A 4KIFA 3SNKA 4AVYA 4QOJA 2IOFK 3GHYA 4K6FA 4MR7A 2FOLA 3G68A 1T2VA 5D5HA 5EUQB 3W9BA 3WB9A 4EB6A 3W78A 1AMUA 4ARCA 1H1LB 1NAIA 1Z0UA 5CW1A 3RUDA 3WLRA 3FHCB 2FP4B 1QPBA 2XR1A 3HBLA 2X19A 3IEIA 1AS0A 1TFUA 2TMDA 5IT9A 3COSA 3PXXA 1GV0A 2JS7A 4N5MA 2R2AA 2W8BB 3T3OA 4NAUA 2KYRA 2ISQA 4G07A 3LWBA 4G9GA 4V02A 5JI3E 3TLAA 1Y7LA 1JR3E 2IS1A 2JAXA 3DHWC 3QNWA 3UJ3X 5A3JA 3T5PA 1EFTA 1KZYC 4FCTA 1VL0A 3QX8A 3X1JA 1E9CA 2JGAA 2CXXA 1ZINA 4DZTA 4C7MA 2QE7D 4TXLA 2LE0A 2PZEA 3ZGNA 3ZLBA 4QUAA 1LW6E 1CB7A 3K0SA 2QT9A 3K16A 4HXEB 5CHEA 1TTHA 4YH1A 5DXAA 4ZARA 1ZJWA 1DRVA 1MJHA 3K92A 3MJCA 5CDTA 1EGQA 3T7CA 2F9MA 2QD4A 2G5TA 1EUZA 1BEUB 1FFSA 1LA2A 2LZ0A 4MW4A 5DRTA 4W7HA 5KYUA 3ZWYA 1XZLA 2ZI7A 4I4TB 3GT7A 4RKFA 3TSZA 1DLJA 1MW9X 3BHMA 1P6XA 4R2MA 2DULA 4A10A 4A1OA 4UU0A 1K92A 4D9NA 1C0IA 3D5QA 4FIZA 5K4AA 3UGJA 1QIJA 2FZEA 4WESB 5KYXA 2R0QC 4WOBA 3WDSA 1GA4A 2HFJA 4DA0A 3NUGA 3S1AA 5C4MA 1NY5A 1YBFA 3CZ9A 3F5MA 3NKLA 4HLUA 2WHQA 2Z9DA 4UBKA 5EQFA 1W4AA 4YRFA 5HDBB 3QWFA 3TRDA 3MJDA 4R1MA 5FTKA 3HYCA 3C3MA 3TLYA 4N7BA 4G1VA 2CFTA 1P1KA 3UB3A 4UMDA 3L7MA 3E9MA 3ACCA 5EVJA 4Y9UA 4IWXA 3KXPA 1XCGB 4QQNA 1E66A 1G8MA 1VZ2A 2AYXA 1E9AA 4UM8B 1CJTC 3I73A 1WQ3A 1V71A 1H8ED 5EMKA 5KJFA 1E2JA 4UFOA 1GZVA 4MI9A 2XEDA 2WUVA 4WVFA 2PYDA 2Q5QA 3V1MA 3W90A 1HQYE 3BPSA 4DR4B 2PMDA 1KO5A 2CLMB 1BGXT 5JSQA 4RZUA 1EINA 4FCWA 5DTRA 2OR3A 3W2GA 4CHTA 1P0CA 4JT2A 5COAA 1TVMA 2Q41A 1U0HC 2Q0QA 2YUTA 3I01M 3CNHA 4L9WA 1CDEA 3WE7A 4JBGA 1A0OA 1EK0A 1II8A 2ZW9A 2RB5A 2VN8A 3I0NA 5DZSA 1XKTA 4HUJA 2DBQA 4YRPA 1SG9A 2VNIA 3IQFA 4Q3CA 1FP4B 4CL0A 1HYGA 3HM9A 2QRVA 2CD9A 2GTHA 2VSYA 3E7PA 3A4VA 3GCDA 4X41A 4OHZA 4ARAA 3NUZA 1R9MA 2QRHA 4MLDA 1RBQA 4YV0A 3ISTA 3WL4A 9ATCA 5C8DA 4BNUA 3OKAA 4D9JA 3FPJA 1JR4A 3R5JA 2AW5A 2B6NA 4Z2YA 3LUAA 1JQAA 3E82A 3TLMA 4NSNA 4E0BA 2FFJA 3IDFA 1DBQA 4GM4A 3FNHA 1PR4A 5CIYA 1LK0A 1R8SA 3A2KA 4PNEA 3GXOA 4L50A 1L7QA 4PO3X 1AA6A 2A58A 5T3YA 5K0SA 4D97A 1TQ6A 2QZPA 1NE7A 2ZB3A 4NRDA 3C8UA 5AI8A 2FVYA 2PS9A 3G8YA 6GPBA 1LF0A 4PGHA 4MR8B 3U4AA 1BX0A 4KR9A 1L4NA 3S1SA 1PNRA 4I8DA 1U6JA 1Z6AA 3EW9A 1UP6A 4IHJF 3CKYA 3TQFA 3ILVA 2OGSA 1ODCA 1TZBA 2OV6A 3QE9Y 4RXMA 3DDWA 2R48A 3KBOA 3FSGA 2KLHA 5EIAA 2XGJA 1G5TA 4ZU1X 2OB1A 4OXQA 1WLSA 4XFKA 1RBYA 1I0ZA 1EE2A 1Z4JA 3PKZA 3KDSE 4QPPA 2GK6A 5CBPA 3GRFA 2GJ9A 2OHIA 1GUYA 2PA3A 2WSSA 3B85A 3K5PA 3P9PA 4GP7A 1KOLA 3SIXA 4AN4A 2YICA 1QFYA 2ZSEA 3TM4A 2FVXA 5LIPA 5DYIA 2B25A 3N7TA 3OEHD 3QBEA 3OPYI 3BL6A 5E4YA 1U90A 2NLOA 4BQQA 3IRUA 4V3BA 3RIHA 4UJ3A 4EYKA 10MHA 5CTJA 4HL6A 2ACVA 4IINA 1SZDA 5HG0A 1JTEA 1CUBA 2BFFA 5JLAA 1IHDA 1ZBQA 3IP3A 2B7LA 3E7DA 1QBKC 5ANRB 3UV6A 4PS0A 3FCOA 5FR2A 3PEWA 2QORA 4LHZA 1F8UA 3KOMA 4MVWA 3CS3A 3V7UA 4D9CA 5E4TA 3SIWA 3P5BA 2OYRA 2QTHA 3C3DA 4LYDA 1T8YA 4QUHA 1W36B 4E4YA 3V3TA 4E5UA 2UXBB 4NIMA 1NUPA 4N5DA 4L3VA 1GZ7A 3VHXA 2ACWA 3F4BA 4ZYXA 4Q4HA 1WU8A 1Y8ZA 4URYR 2YHAA 1TYEB 1EE9A 1E94E 3H11A 1E2PA 2QLNA 3P9SA 1P2VA 4IJ5A 2PXAA 3ADKA 2GA8A 1H22A 4Y2QA 4TUYB 1YRLA 3QVOA 1DTWB 2I03A 3D9QX 3MCUA 4ZO8A 4IIJA 2I29A 3DWFA 3JQGA 2X0NA 5LQDA 1ZJJA 5BRAA 1DX6A 3DBHB 3MUFA 3R20A 3JQRA 3W2HA 2NZJA 1OE0A 3FF4A 4MDYA 4B6JA 2WLSA 1R0LA 1P77A 2CCJA 2QVZX 2VZ8A 3OH8A 1GTG1 3OZUA 4HATA 4I6EA 1K7YA 2D3WA 5ICGA 4V2UA 1EUCB 3EMKA 3LKZA 1A9YA 1Q77A 3TG2A 3ZWXA 1CJSA 5LM3A 3BJRA 3BIXA 2I4RA 3FIUA 1NLFA 4COKA 3WKBA 3A1VA 1V43A 3G5UA 4MNTA 1NY6A 3C15C 3S44A 1I01A 4IO0A 1OI7A 5KNBA 3R6GA 3U7IA 1XZKA 4JLAA 5KOJA 1MP0A 2AH5A 3MYYA 1G5QA 5C5IA 4FS8A 3PCTA 2YX1A 3PDIB 3ZQJA 5AW9A 4CQLA 4F6CA 3ZWVA 5E1MA 1WG8A 2ZBPA 1NC3A 4MVJA 1S9HA 2ZJ0A 1GXSA 4LRSB 1UANA 2YXEA 1P2UA 3EGIA 4EZBA 3M4NA 3MIIA 1HDCA 4QTUB 1KKMA 1PNQA 4M1SA 3ZGYA 4B9EA 1ZL2A 2O2SA 1ONPA 4I4IA 5AI9A 4L2IA 4AG6A 3VSDA 4DRXA 4XASA 1TF5A 1VJTA 3EVTA 2BLLA 3QXHA 5HIIA 1P1CA 4RGQA 2PUAA 1N33B 3HJUA 3TSCA 2CYAA 1ISFA 2JLCA 1GPUA 4Y1RB 4F2PA 3TE7A 1J99A 3B1KA 1ECLA 1CW2B 1H2ZA 1P73A 3BORA 4MROA 4BMNA 1KVUA 2F1OA 3UMGA 4XYBA 4AO6A 1FDTA 2IYXA 4MEJA 1VLZA 1P7WA 3GV0A 3TLJA 1FBNA 4XDZA 3AW9A 1E9FA 5B5SA 2XD4A 4JCCA 3VNQA 3D1LA 5BXYA 2JGMA 2E4YA 4OYRA 4RYDA 1PG2A 2XBUA 4HZUA 3F9IA 2WHPA 5AKJA 4XSGA 4LJRA 1Y6RA 4DYHA 5BSHA 3VMFA 1TTPB 1MA3A 3CLKA 1G21E 1JDBB 3HJRA 4KAJA 4KODA 4LBZA 1M7GA 2IUFA 1TVCA 4M87A 4OJNA 1JU4A 5KDLA 1OBOA 1CR4A 4LC9A 1YU6A 1J25A 3NGMA 4TPKA 4CMEC 2GM5A 2FG7C 4EL0A 3QNMA 4CMIB 4BASA 4IIUA 3BC1A 4YVFA 5F1PA 1WZEA 3JQFC 4R7GA 1MX5A 3NWOA 4DDKA 3DZHA 1Z12A 4MOWA 2IOYA 2V7GA 3CLRC 2ANCA 2IXTA 1TZ2A 5B3JA 4BCDA 5JSFA 1ORHA 4FYVA 1A5AB 4XW2A 4XJSA 3O4GA 1BIFA 1A9RA 3L6OO 2VP3A 3ZQ6A 5CK5A 3WGNA 5CX1B 1VLVA 1M7HA 1E3IA 1PTJA 3FNEA 3DTYA 4CGZA 3WB2A 3G2MA 2CMFA 3C3EA 1GARA 3D4LA 1FRVA 1XZGA 3GL9A 1NULA 3GO4A 2X1HA 3LXRA 4LJLA 4OKIA 1Q1BA 5GZ3A 2DWOA 2CMGA 3ZHBA 5HKKA 1K8RA 2GCOA 1N92A 2GVZC 2WMNB 3I64A 4LI3X 4AZ0B 3A7EA 1YFKA 4GEKA 1Q1GA 1X7XA 3E8SA 1E89A 2GHRA 1M2VB 3QLEA 2D1YA 5IEJA 2NYVA 3ZGXA 1ST3A 5LZ4A 4JBWA 3SOPA 4G5OA 3ZDCA 4J9VA 1C9NA 4MMXB 4RETA 3H0EA 3FOBA 3PPXA 5HZGA 2AJDA 4KQ1A 4GX0A 1EFPB 4TWAA 2NQTA 2KPOA 1FTYA 4YCNA 1FXUA 3IEVA 1GZUA 1VJ5A 2PMCA 4LS3A 1SN7A 3B1XA 3GJQA 3CNQS 3HBFA 4KO3S 1NSYA 4KDCA 4RCYA 5LQUA 1P81A 1E1RD 3JQCA 3URMA 4Y2YA 5M29A 3W05A 2Z9BA 2WFLA 3PGA1 4DY4A 3LL4A 1T4MA 1W5SA 3Q0IA 7YASA 2CFRA 4LJ9A 1PR6A 1WUHS 1B8VA 3JYNA 3KPVA 2WE8A 2RCYA 4FYXA 1D1QA 5JI2E 1MAAA 3DT9A 5EJ6A 2BL4A 2O7VA 3EXFB 3IVCA 2BP7B 1MKYA 2OAEA 1PAUA 1FX0A 1TUIA 2GKGA 5TEVA 1XJCA 3BTVA 1XRPA 3FSEA 3LP8A 1MO5A 1UWLA 2OLKA 2YWRA 1IBCA 1HF3A 1P8AA 3IEKA 5ALUA 5EJ9A 4QTYA 3JQ7B 3ZHTA 1XZMA 4JI6B 2QENA 2KLBA 3QRWA 4MRAA 2YNMD 5BR8B 5TXGA 5KTYA 2VA9A 1C2YA 4DQXA 1T6NA 2O54A 4GC9A 3REQB 4LJ7A 4DLSA 3IEPA 3QKIA 1XZPA 2NU9B 1ETHA 3K15A 3KKNA 5BYAA 2V7XA 1M8PA 5HGJA 4WV3A 4Z3DA 1ELOA 2YJZA 2CF5A 3ZHSA 1RQ2A 5C7YA 4EJSB 1FYXA 1JR2A 4E5MA 1H2EA 5B6PA 1D9XA 2Z5VA 5F1KA 4TMFA 4JI1B 2ZIEA 4L8WB 1DPFA 4DB2A 3ANYB 5DNAA 1S02A 4MITA 4CL2A 1V3QE 3LNCA 3I92A 3N87A 3T3MB 1Z34A 3QBDA 1QOPB 1O6GA 1JNYA 1R0CA 2A8YA 3B53X 2C2ZA 3HL4A 3PHCA 3BD8A 3Q15C 4MH0R 3TQTA 9MHTA 2QPTA 1V11B 2E7ZA 3F74A 4KDFA 3WSVA 3V8PA 3VZRA 1G9XA 3AUFA 1EDDA 1Y3HA 2QNIA 2QTTA 5A1JA 2H4YA 1ULAA 3GLKA 2D2EA 1QYDA 1Z2AA 5B3AA 4XGQA 1Z15A 5H83A 3WLJA 4DSUA 1XZQA 5TC4A 4YCJA 5FTNA 5J2TA 3ZC3A 1P2GA 2J45A 2YZ2A 4OHVA 4OO3A 5ADUS 3ANXA 3FZYA 3WGVA 4ZI7A 4ZYWA 1AY0A 3ZU3A 2F64A 1EUYA 5HUHA 2B37A 3DTVB 4M1YA 4LBYA 4NZNA 3BWDD 4E5YA 4Q93A 4DWVA 1ZOPA 1W29A 1RWPA 5JSHA 3ZLJA 3OZXA 3ANNA 2LDBA 2I6SA 3GK3A 2A0FA 1J8DA 3IHWA 3KDAA 4RZIA 4BTVA 1J97A 1T9AA 3LFUA 4C9BA 1XLTA 5DMXA 1G8SA 4EAAA 5IJZA 4CI0B 3ILSA 1FE8A 4O1IA 2ONJA 5FLXA 3I0ZA 4N0MA 3O75A 2NTEA 5HEKA 2OYCA 3WMGA 1BW9A 1KY5A 2B78A 3JWIA 3T94A 4ZMSA 1GVHA 4PNPA 5DV9A 5FBRB 5DX1A 2HYDA 5EUBA 3HEMA 2XX3A 4P35A 4OFBA 3VC2A 1U5BB 2DU8A 3WZMA 2PKQP 1HQDA 3CF4A 2ZBVA 2BOVA 1IN8A 1UFKA 3ZNPA 2VHUA 2WYHA 1YUBA 4PXYA 3TK1A 2HQOA 1IXYA 1NVVQ 4JBHA 2YRFA 3ZWMA 1LI7A 4CW7A 2FPKA 3OURA 1P0PA 4XM1A 5BSTA 1BCRB 4ZOQI 4YAUA 4YY3B 2VUUA 2VO1A 4NU8X 5I5EA 2GT1A 5L9AA 3VPCA 3O6VA 1N1MA 2BR5A 4NAHA 3PNLA 3DAGA 4AKGA 3PFKA 1A8SA 5DXFA 2DKNA 3GH3A 4Z6KA 3GDOA 5BN3A 4EJ6A 4ZYTA 1XU4A 1GADO 2G76A 2XGSA 4YDRA 1Q1ZA 3F7TA 4KPYA 4TKZA 1KAOA 3ZGVA 1H8HA 2YJ6A 4E2XA 1YBMA 3L93A 5F5LA 1T1IA 2IOFA 1G7TA 4PAOA 4WJLA 3VO9A 2IPNA 3Q1KA 4FMCB 3ABQB 4IOLA 5FH9A 3OKPA 3BJIC 1P3JA 1PSWA 1LSUA 4YT2A 3MN1A 5DTMA 4O2BB 1ICEA 1VG9B 2BBTA 3KYDA 1RXUA 4LYHA 1SH7A 3O21A 1RKUA 3O31A 1V4VA 4LBVA 3UUFA 2J3QA 1LBSA 3D4NA 5EHGA 2XVYA 3DPSA 1SOMA 5C8YA 4DQKA 1QK5A 3T95A 2VJOA 1J09A 5CA1A 2NIPA 4MQEA 1CUXA 2DBZA 4Q4CA 2Q2VA 1K1EA 4PSCA 3HXMA 3WLFA 1SHLA 4LRUA 4GOJA 1A9QA 1NVBA 2QMYA 4Q3LA 4DHWA 2X8WA 1QQBA 4KLRA 1Q15A 1H6BA 4AP6A 3WYCA 2NQ8A 2PKXA 1CZLA 3C2QA 2RGBA 4HEHA 4IXTA 3A1TA 1IK6A 3AL3A 2Q9CA 3ICOA 4WZBB 1T2CA 4CMCA 2R8PA 1U5AA 3K94A 1M66A 3VKVA 4DTCA 1HMPA 3OY7A 4D3SA 2WTEA 2QTVB 3IHKA 3B5JA 5ER9A 3N2ZB 3ESXA 4CM8B 5J4KA 2YCBA 1B0AA 3QY0A 2P62A 4TTAA 5K8UA 1REQA 3R9KA 2E21A 2X9NA 5BRJA 5CXUA 2IK8A 1XQ6A 3CTPA 5FHQA 4NENB 3GQBB 1UADA 4YMVA 1MT3A 1WB9A 4EI9A 5I6DA 1JTFA 2Q21A 3GMIA 2HN9A 4M1QA 4YJKA 3DOUA 1NM5C 4ZAVA 3WK8A 2FUEA 3DAPA 4BX0A 5KNLA 1DCTA 2AYYA 4XWGA 2FX3A 2OM2A 1CUSA 3T4XA 4G2TA 5DNUA 3SHQA 1NJ8A 1KMMA 3F78A 3HFGA 1XG5A 2WP8J 3EVZA 4WUVA 2QX8A 2GNOA 1SQGA 5E2AA 3DR3A 1WL8A 3HZZA 3SDSA 4AY4A 1X1TA 1MO6A 2OORC 2XDAA 1GQQA 1NASA 3COPA 3DEAA 4XZ3A 3P0IA 4DCVA 1WXIA 2PWZA 1Q0RA 2I1VB 4P4SA 4JEUA 4ZCMA 2M1ZA 4O4JA 4FM9A 1E18A 1CULC 4Z4IA 2HNKA 5A9RA 3RKSA 1NNEA 2JGFA 1QTIA 4KJXA 4P5PA 2GZAA 3PKJA 2IELA 3CFYA 5H59A 4RGYA 1RPAA 2HF8A 3DYIA 3M6LA 4NOLA 4Y9RA 3VKFA 3WISA 4TTPA 1K8YB 1XNHA 3GJSA 4JENA 3UMSA 5BR4A 1BHO1 4I6JA 2IZ1A 1OXTA 4ZK6A 2KS6A 4BVHA 2BJVA 4OK6A 4S24A 3DPIA 2IKQA 4DV6B 4KIWA 4FZRA 1JR6A 4XWOA 4QQKA 1ECCA 1LPPA 4FE3A 1DWUA 5JMWA 3SC2A 3M6MD 3IQWA 3KUXA 3IP5A 3MWFA 1RI5A 1KI6B 1U5CA 4HWOA 4QBGB 4ZALA 4Z0TA 3SKVA 2BC9A 1P5HA 1USVA 2QP3A 1LDYA 4Q7MB 5ITZB 5DCLA 1GOTA 1KJ8A 4RVNA 5DX8A 2IC5A 3T5AA 1SCNE 3K09A 1FX1A 1PX2A 4PEVA 4BQOA 2ATCA 3PICA 4GXNA 4D6YA 4IUCS 5TPWB 3H9CA 5F9HA 3CURA 1D04A 2FDRA 3DE6X 3JD4A 3WSTA 1A96A 1B1AA 1R6VA 2PDAA 3D2CA 4J4HA 2RG1A 2V5AA 3HKCA 3MJFA 4IIBA 4MUIA 4BFTA 3GLFE 3PWTA 4C3VA 3HU1A 1ZM2A 1H9BA 1A1SA 3BG5A 3UYLA 2AHOA 2E4ZA 1JAIA 1DAKA 1AK2A 5JNTA 5KVCA 4DV2B 1TYBE 3R9WA 1U7XA 3MINA 4DV4B 3HEBA 2I9PA 1CK4A 3NX4A 1D6JA 2W4IA 4M1EA 1V9CA 4DG9A 3LBYA 2QRMA 1Y98A 2JFVA 3G2JA 4HBGA 1AH2A 1YDWA 1X7ZB 3DQQA 5KVQA 1PR1A 2BYTA 3AFGA 3LXMA 2X4IA 4CKYA 1IN5A 1U9IC 2FZLA 2WPNA 4IQ4A 4XVQA 3PSAA 2BEUA 4N6GA 3IX7A 3QTTA 4PRZA 2ZRMA 3TVTA 5T8KC 2IH2A 2OO5A 3QLJA 2ID8A 1NVFA 1Z29A 3LZDA 1V8BA 1VDMA 3NIDB 1A8QA 1IQUA 1URPA 1Z4OA 2I4NA 1JFFB 3OD1A 1IC6A 4FC6A 2P6NA 3TS1A 4EGFA 3C4VA 5JZ9A 4RDCA 4IDPA 1LSOA 1LQ2A 4TN1A 2C3OA 1P44A 4UD2A 4Y7DA 4DPLA 4L8YA 2AQHA 1C1XA 3EPJA 1YASA 3DMFA 1P61B 1KO8A 3NYIA 3G49A 4HLNA 5B37A 2JI7A 4I50F 3ZBPA 2V59A 4K05A 3TBKA 5AJTA 1IDOA 4N6NA 4EZEA 2B4QA 4TQ9A 4I5GA 3M1AA 3VPSA 3RYIA 4FZJA 4F4FA 4LWOA 1OFUX 5FWDA 5KU7A 1LTHR 5FBWB 4LCEA 4KN9S 4POOA 5AJUA 1E2EA 1RMQA 1IY2A 3U31A 4JITA 1G8HA 4R7ZA 4DTIA 4TV9F 4XVUA 1QG6A 2ATIA 4H1UA 1RZRD 2I1WA 3FVRA 3ONVA 1QLHA 1CS0A 2GPYA 2BFMA 5A06A 4HAZA 2GTPA 4LHEA 1SXJD 1H0KA 1AT1A 3AY0A 1EFVB 2WAYA 3FSJX 2FEKA 1HLPA 3CKLA 3C3AA 2IGBA 5DOZA 4ARBA 2DFKB 4QUJA 3WNBA 2G04A 4HWKA 5I9SA 4BP3A 4ZAGA 4NZOA 4B3HA 2BE9A 1Z5VA 3FKSA 2X9VA 2CVQA 4FSDA 3WJ1A 2GYYA 3K1TA 4N4AA 1VI6A 5EIFA 2ZZNA 5BUQA 7REQB 1T9DA 5K9ZA 3IB6A 4NAVA 4A73A 2J8ZA 3JYLA 1G7SA 3WNDA 2ZR9A 3LFTA 2Z8YA 1FP1D 2P2ZA 3MHPA 4DLUA 4KXUA 4QGSA 4LSMA 5KSWB 1ZM3A 3LKBA 2QN7A 4HDAA 5IAEA 1CF4A 1JVSA 1UC9A 2QX9A 3BVPA 1WXDA 4ZCSA 4YCMA 1G20E 4W5NA 2Q0SA 4CTJA 1Z0JA 1XJWA 1RJ9A 4ALKA 2ZM5A 2QRLA 1OBCA 3NFYA 3DE5X 1KAGA 3IEXA 3NEYA 5KOYA 1QRUA 1L1EA 2YOGA 3WJ2A 4BN4A 3OIFA 3U6KA 1ZMOA 1ECBA 2YDXA 1QIDA 2GN4A 2GD2A 4IDGA 3I5XA 2Y77A 2XLCA 1P72A 1PSZA 1UEXC 2R79A 2HDNB 2YZMA 3CKMA 3ZTYA 5I47A 1EZ1A 4JI7B 3BKWA 4UTRA 3U3DA 1T8UA 1O95C 1N7HA 4DAEA 4DLRA 1NATA 4RK1A 1SOAA 3A6DA 4U7JA 4D82A 3TRHA 3ORQA 2Y6VA 1GDDA 3DBOB 4NI5A 3TLGA 3LZ6A 3QSGA 3SJ7A 3SS8A 3ZE0B 1SIWA 1WRBA 4WEOA 1KJJA 4L08A 4PSDA 3J7AC 4LOHA 3W6NA 4X1KA 3Q8LA 3H6HA 1H2WA 3AV0B 1AE1A 3G6KA 2JIBA 2GN0A 2HT1A 5F12A 2D1QA 4L5CA 1RXCA 2PH7A 3D8NA 3I5MA 1HPLA 4GXQA 5G3YA 2VHQA 4B6EA 1YZLA 4NBSA 1ZR4A 1VG1A 2WOOA 1ISMA 4JEIA 3TE6A 3D8UA 1RIFA 3I5YA 1QO7A 3RHSA 4AZ3B 8ABPA 1U2RA 4IDFA 4PG7A 1ZIYA 2GO7A 2HWKA 1E3DA 4WJKB 2Z2ZA 4B8ZA 1OJLA 2CVOA 3JQBC 1S7CA 1THTA 3AB3A 3CLRD 4GVLA 4FGSA 4Q3OA 2VK8A 1DQPA 3CUKA 1UK8A 4J7XA 4J29A 2QL7A 4ZCRA 1FS5A 1DT5A 2CXHA 1RU3A 2QXYA 2RHJA 3TL6A 2IDJA 4HLUC 2DY0A 2HRBA 1F3LA 2PYZA 3AR8A 2X0JA 4ARZB 4GI7A 1I94B 1QKIA 1OB5A 1XL0A 2W7TA 3MF4A 5JWOA 3OOHA 1HG1A 5A62A 2CV1A 3C48A 1JE0A 4EENA 1XROA 4HBZA 3TDMA 2F7SA 3WGZA 4U7DA 4F85A 5TLSA 4NABA 3OF5A 4EHBA 1X77A 1R5NA 1YIDA 2A1UB 2DTDA 2GPJA 3RC7A 1EESA 1A8PA 4A8HA 4U5XA 4ARSA 1IJBA 2V5UA 1MAHA 1NXSA 3V4FA 1VTKA 3WGUA 2FK8A 3RS2A 1RYFA 4K2HA 5T4HA 2ECFA 2C9DA 3A1SA 3CZQA 3H4MA 4RY0A 5JAZA 4JT9A 3B3JA 4WD3A 3U7FB 4FFPA 4G4IA 1QYVA 2EYUA 3F98A 3Q5DA 4X3CA 4NNOA 1D2EA 3IV9A 4NX2A 2DPLA 3DSRA 4ISCA 4PRYA 1Z2PX 5F5NA 3RLFA 2QZSA 1ACJA 1OI2A 5BWCA 1KS2A 3HO8A 4A92A 1M5RA 3ZCSA 1N3IA 4D99A 3EWSA 2NGRA 5KVSA 2J7KA 4CN8A 4P0PB 3P45A 5LZ2A 1BKSB 4LDQA 1ZS9A 3OM9A 3QOXA 4RWEA 4ZOCA 4RPHA 3NBAA 4MKGA 4UVHA 1NSTA 1NVWQ 2GN6A 2C5EA 3ZNQA 5JXWA 1PNVA 3QPUA 5LXTB 2VZEA 5FB3A 2QVXX 2X5XA 4FI3C 4M9QA 2W2QA 5JTUA 2Q5JA 2GRJA 5ES4B 3OOSA 1ARZA 2IW3A 2O0LA 3UK1A 4REQA 2GSDA 1C7ZA 1F0YA 3DV9A 3OBBA 4J3FA 4A6XA 3R6WA 3MG9A 4AN1A 5I7FA 3H6KA 3ETDA 3L5KA 5HS4A 2OV3A 3BMOB 1JG1A 4UEQA 5CNKA 1DXQA 2H5JA 1GN8A 4MA0A 3UA3A 2OVFA 4N0DA 1BVRA 3TGLA 1YONA 4CEIB 4AKIA 5LMNB 4MVJM 2NQ2C 4C29A 2OQIA 1FB5A 2E82A 5IVKA 3R7AA 2NW6A 1M74A 2IHTA 2ZUCA 4O59O 4ZHSA 3A9UA 3F3YA 5BNIA 1GY8A 3LDAA 4XJVA 4C4SA 3RCBA 2D54A 4YAWA 1X1SA 2YHIB 5ULLA 3TLXA 5CRIA 1UBSB 1C7QA 3LC0A 5TMBA 5CDSA 4KNWA 1TM5E 1KDZA 5F3RA 3RUPA 2L42A 3DVQX 2HMAA 5K3AA 1XEFA 5JMTA 4JLVA 5EVCA 4IR7A 3IP9A 5KKNB 5H9WA 4PINA 1LJLA 5FADA 4XLTA 4GUAA 2FN8A 3H3JA 1FDSA 1USWA 1JECA 3RSQA 5HZMA 3O1HB 3FRJA 2R97A 4TMVA 3KKPA 2EP5A 4DR6B 1FMLA 2FW8A 1K2WA 1FFGA 1SXJA 3C4QA 3OPYB 2HLPA 1G19A 4LI0A 4W6QA 1H85A 1XTVA 3CEPB 1MCZA 1O5TA 2PJDA 3MMSA 1XKXA 2XUDA 1E63A 3PHBE 4FSHA 4V0RA 4EB6B 1PG0A 2V98A 2NU7A 5TMPA 1DC3A 1QVRA 2H65A 2ZRPA 3FZQA 3HC7A 1C3JA 4KZKA 4UUNA 4X1OA 2Q2QA 3KQPA 3UB2A 2P90A 4C43A 1Y0BA 3FDFA 5JRZA 3OPQA 4ZT7A 3QX3A 5ALHA 4GOMD 2NZ8A 2NSHA 3GN1A 1S2NA 1Q7EA 4UHJA 4R9VA 1I3CA 1ISPA 3ICPA 3K73O 3UAGA 3I3SR 4F96A 5I48A 1GPKA 4FNGA 4H1TA 2B4AA 4FHFA 3K2IA 4BQEA 1PDOA 2XTMA 5EJMA 1IY8A 2G5GX 4DYDA 4ZDJA 2XB6A 3COJA 2FMTA 1DVRA 4O2LA 2XY4A 2XNSA 3BL5A 5JD6A 4C4RA 2FLVA 3BMXA 1CQZA 1CEEA 4OLAA 4DR7B 1P75A 1X7GA 2PNJA 2OMEA 3V8MA 4Z3KA 1D2RA 1LCIA 4D43A 4YUZA 4RZ3A 4OB6A 5AVOA 2DFLA 3RS9A 3QJGA 2J9RA 2ZT6A 3NW9A 4JOCA 1WKVA 4LE1A 5DHFA 5THKA 3W06A 5A4AA 3IEMA 3UBTA 3FYSA 4QU5A 4F06A 2IY7A 3FTNA 1DAOA 2FRDC 4R16A 3L1UA 4IJVA 3FKJA 4DARA 4KIGA 1EP3B 3TYXA 3QE4A 1N9ZA 4LHVA 2VYQA 4BNZA 2JVJA 5KYUB 4EW3A 4G0NA 4CIYA 2XI4A 4JJ7A 1Y1RA 4DPMA 4FYIA 1WMBA 2CK3D 3LUHA 4L0CA 4XR9A 3I9V1 3X1WA 2Z6QA 5FFNA 2EJTA 3GBVA 3TI9A 5EHIA 3VTZA 1GZ3A 1YHNA 3ZHZA 5KYXB 1QB8A 5K8TA 1E4EB 4NG5A 4CLRA 3X2FA 2X77A 2VJKA 1Z5GA 1Q20A 4RMHA 1ZN8A 3S1AB 4LZNA 4ZYLA 4UVIA 2R6DA 2VC2B 3PC7A 2CL5A 1U8ZA 4PRKA 3ZPXA 2EZ9A 5CFNA 2HCBA 4UW9A 1NDQA 2IEIA 2PAFA 3IBSA 1AHNA 3LLSA 4JK3A 4JIMA 2W6IA 4HLQB 1GPAA 3JYPA 2IWRA 3VFDA 2IVZA 1IVYA 1P0FA 2C1EA 3TDKA 3OE7D 3LJKA 4DMMA 1KFCB 2H4ZA 1T5HX 1Z2DA 2ZB8A 4KN5A 5J4LA 1PCXA 2O14A 4P0QB 2Z8XA 5CVVA 5K01A 3AI3A 3LHKA 3O4RA 1GZ6A 3U4GA 2ZJ1A 4CM5A 4LZOA 4TMYA 1ZN9A 3W6OA 2F00A 5I45A 5G0SA 4FN5A 4CU5A 2PR7A 1PD1A 1U8CB 5DU2A 3LQFA 1G8AA 1UIRA 2ZUSA 3KEQA 4ZQGA 5FTWA 2GN1A 3CX8A 5FJJA 5FP0A 1LLUA 1R0WA 4MUFA 3FDJA 3DBVO 2ZR7A 3DP7A 1II8B 1PEAA 3O82A 4HAYA 1DBSA 5AI6A 4RULA 3RSZA 1VCNA 2ZRKA 5K0ZA 1BVHA 1BS9A 2P9GA 4L28A 3HCDA 4QARA 1NMXA 3FWNA 2QRVB 5DI3B 9GPBA 1JR3A 3A11A 2DQYA 3H19A 4W4TA 4CKEB 4TKLA 4RM2A 3D6AA 3P9CA 1PBNA 2Y1WA 4KR0A 4Q39A 4R2WA 4BVBA 5GTDA 2XQJA 1IB6A 4P3YA 4XPZA 1XCPA 3IMGA 1D7OA 2WLTA 2FE4A 4CQMB 1V7CA 3PI7A 3WAGA 3B3GA 2WF7A 4MV3A 3VDMA 3B2EA 4OXKA 1HLGA 3I8XA 4JVSB 4XIIA 5E9AA 4H7PA 3BZWA 2F8MA 3PJRA 3M3DA 4P7JA 3ZHQA 3GQVA 4L5JA 3I6IA 4R31A 3SIPA 4P3KA 4ABYA 3ROTA 4AL4A 1YB6A 3S8EA 1YQGA 6AT1A 3NXKA 3F8SA 1MDFA 1Z36A 4LKOA 3T7KA 2AMYA 5AVUA 3WG9A 3ESCA 1XAIA 3ZQUA 2EX1A 3KM0A 1U8UA 2V5VA 3K8YA 5B4TA 3R7WA 1W8IA 4TMXA 4J0JA 1KYWA 1FQJA 5K6AC 4CT4B 4OXXA 3RIYA 3T7DA 4IF4A 5FPTA 1PBTA 1XC7A 2YN4A 1E3EA 3L4BA 3TNDA 4N8SA 1A2KC 1U31A 3AP2A 5DM4A 2XB8A 5EMLA 5CBPB 3CVXA 4QZVA 2FPSA 1ZZEA 2XE6A 3HADA 1OTYA 4EAQA 4KW7A 1MORA 2Q5CA 3L8FA 2FQQA 1SHTX 1VMAA 3BSWA 2QIOA 3FTQA 4RLHA 5AM3A 5EIOA 2JJ1A 1U0RA 3O8QA 3UTCA 1XPRA 1Z5OA 4F38A 3KQHA 2P9EA 2LTAA 3A36A 2P2CA 1PWHA 2HO5A 2FWAA 1YBVA 4LK2A 1FXSA 4DDUA 3N0XA 4B6GA 2BFFB 4PCUA 1WHSA 5IVIA 1PEDA 4YP9A 3T9DA 4C22A 4F12A 4GT1A 1YMUA 2ZREA 3MLAA 5EUMA 4OH1A 3I53A 4U2GA 1SUEA 5CA0A 3H2YA 1JF8A 3ADCA 2DPMA 4KR2A 1Z22A 2R44A 3B1ZA 1I30A 4URWR 2PWBA 3LQRA 4BGDA 4NYJQ 2RHBA 3VHXB 1Z3IX 3LOQA 1D2HA 2C83A 4JKYA 3AVPA 4Q4HB 2F55A 3DB1A 1WXHA 2FZ4A 3QMPA 3H11B 4HN9A 2VOJA 3VHRA 2B83A 4M9CA 4DT1A 1Z8HA 2X8BA 4NJEA 3V34A 3KOUA 1RVDA 1KZ7B 3IS3A 1XJ0A 2ISCA 1OD6A 2QL6A 4IIJB 1SBHA 1HYQA 8ADHA 1PVOA 3BMQB 3I30X 4JASB 2P9YA 4KH1A 1L8AA 4FB4A 1KMIY 4XRRA 1CZOA 3LKDA 1X1AA 2ZSKA 3LCMA 3ZHOA 5KTKA 1VFNA 2G80A 4M8LA 4C4YA 3AHCA 1E9DA 5AVYA 1L7OA 3KR1A 4E30A 2FW1A 3PENA 3VU8A 4CIDA 1OFIA 3Q4GA 2QUAA 3N86A 3BTOA 3CR8A 1GEGA 1UZMA 1VB3A 3OZRA 2IX3A 4KX5A 1FDWA 1XP8A 1RI4A 2KBFA 5ALGA 5FO1A 3VGJA 3PKIA 1Y7TA 3LY9A 4G0YA 3NS7A 4CQLB 5I8WA 2MSCB 1XI2A 1BEZA 3NT4A 1XQVA 5IKOA 1GXSB 3CUEF 2WJ6A 4GX2A 2J31A 1Y81A 4HXFB 4TV8A 5HKBA 4JI8B 1E9EA 1T1GA 4R68A 4EG5A 5LBTA 4F92B 3LW7A 3STXA 4Z1MA 5IWCA 4OQYA 3KAKA 1G9TA 2XQVA 4WNIA 3MQFA 2Z30A 3ORHA 4DRXB 1LVGA 2QDXA 2NWQA 3G7SA 3NIWA 4J91A 1G1AA 1AO3A 1J39A 4A5SA 4ZRNA 4D3DA 2IU0A 2I2DA 4BRSA 1TYZA 4F21A 1XLTC 1DV2A 2I3ZA 1H3EA 2ZSHA 3Q2OA 4A6PA 4CHGA 4ZPXA 1Z39A 1Z38A 4ESVA 1RM5A 3GGGA 3VR2A 4IV5A 3ZLTA 621PA 3RVDA 2PH5A 4IX1A 4G65A 4KWEA 1D6SA 1RJGA 3A26A 1BU8A 5FTMA 221PA 3TQQA 1Y80A 3M5CA 2PZBA 4HMQA 2WHPB 4FEAA 3PNYA 4L73A 3FWPA 2YINC 4E15A 2ZWOA 3NT2A 4LXIA 4RMJA 1CVIA 4NC9A 1ZK2A 3RSCA 3THWB 4FZ3A 4MYHA 5K3EA 2WUWE 2ZANA 3GLHE 3ME5A 2A1IA 1AV7A 2FWRA 3A6ZA 2Y9PB 3RT1A 4P83A 2AEMA 4MS4B 3U5ZB 2G82A 3W9UA 5J63A 5LBIA 5K8IA 1T9HA 3OZFA 4L95C 3OAAA 1O08A 3TMKA 2Q29A 3GRCA 1LBHA 2NUBA 3L7JA 4L5AA 2CB0A 4O0LA 5CFPA 1NVAA 3ZVNA 3NCHA 1Y1PA 2JA2A 1ZUHA 3BOSA 4D4HA 1CRLA 4M0FA 2Q45A 2CHQA 2VP5A 2CMHA 4IJKA 1BJKA 3ZKWA 1N2OA 1L1RA 4O4IB 2PG3A 4RFSA 2BV3A 1XZEA 2OP0A 3L3BA 1XVVA 4WNYA 4OHOA 1LGYA 1OAOA 3E15A 4JBXA 3VI3B 3WLQA 3KHSA 4MW2A 2I7DA 1U7DA 2HWXA 3G0OA 4BO0A 2ZJ6A 2R7NA 2Q5IA 4GL4A 4HYQA 5HMLA 1HFWA 1U11A 3VNAA 2BKXA 2WYUA 3D8SA 2EQ5A 1PFGA 2OZPA 4M1TA 1QCZA 1QV7A 1PLLA 3NTQA 5FAKA 4EA7A 4YT4A 2DCUA 1LEHA 1DRWA 4KMOA 1E3JA 2J3MA 1IXSB 1L5FA 4QUIA 4GBJA 4OFZA 4E4TA 3JV7A 5U9CA 1ESZA 5DM70 1XRQA 3Q6MA 4WCFA 1GAXA 5JD5A 3KYCB 4UNSA 1QH1A 4U02A 4G8BA 4C88A 3FNRA 3V42A 4M0CA 2OT3B 4UFNA 2AEEA 2PD4A 4GZ5A 4U8GA 1U1IA 4XWWA 3V1LA 1PIWA 1C14A 3VVMA 2CXRA 3LNTA 4M98A 3STTA 5CH8A 3IQXA 3GA7A 1KZHA 3UWDA 4EO9A 2C4MA 4F45A 5ITSA 4NE9A 2PFSA 4FGJA 4ICIA 1JAXA 1S7GA 4G3XA 4QYMA 5LYYA 1YI1A 4J2OA 3UT5A 2P65A 2WFMA 5DE3A 5KX5F 3TECE 1ZJ5A 5G4LA 1XXLA 1FX0B 3N3BC 1K27A 3PUWA 4YGXB 2PL9A 1FRFS 1SUFA 1FEZA 1LI4A 3CF0A 3NHZA 2C9YA 3WYBA 4BLPA 1FFEA 1FQWA 4KVAA 2XRMA 3KUDA 4UD6A 5LR6A 2C2KA 1C30A 2HWUA 5DM1A 1KKLA 4HO1X 2GUWA 2WIAA 4MEAA 5E7IA 2XT9A 1G2PA 1NZJA 3R3XA 1SUIA 2A0WA 2ZP1A 1U0OC 2A86A 4Q18A 2EVWX 3VPDA 2QI9C 1FTNA 1K98A 4PPNA 3DW3X 2HGSA 4YAIA 2XVMA 2IS4A 2FUKA 2EQBA 3ZWAA 3A4TA 3OLWA 1SPBS 1NJ1A 4MS3A 3KR0A 2VJCA 1TA0A 1YZ3A 2CGEA 4H27A 3MWLA 4L85A 1R6BX 1DIRA 3QEAZ 1N25A 1NWHA 3DE3X 2I1QA 4GQBA 3QFCA 3CSSA 3DMTA 3E2PA 4KQGA 3K8QA 5JTTA 1U1CA 4ANFA 3Q7TA 4DFDA 4J75A 2ECQA 1NN5A 2AJCA 3GWZA 5LC1A 2IDMA 3UCEA 1PGQA 4P9NA 5JNVA 1ADGA 3QVMA 2XUAA 4BNDB 2PLAA 3AYXB 4LOKA 2WIGA 3VTFA 2YYYA 4M0MA 1JSXA 1R9GA 1LWOA 1YTLA 2R85A 3BWBA 4TXMA 3FG9A 1GP2A 3UAOA 1DEXA 1Z75A 4CDMA 2Z8YM 3BCUA 2CVPA 3AG6A 3DVAB 3O73A 3KIPA 3QUBA 2WWHA 1NW4A 5DTQA 4BO6A 4BMOB 3GP8A 3EX7C 1TKCA 4L1KA 3SJCA 1OV6A 1GL6A 2P11A 1VHTA 2R6R1 3K09C 4QUEA 3TZQA 4C4AA 3BDVA 3RWMB 1LPNA 1W59A 2W2MA 4QPCA 1H5NA 3ZGZA 1T5TA 3J7TA 5DBIA 3HXOA 2BONA 2Y1KA 4YX9A 7ADHA 4DUYB 3MMZA 1V4BA 2XQGA 3GB9A 5LOVA 2ZRNA 1Z17A 4LYFA 2VWPA 1QIFA 3EAQA 3QVSA 2EF0A 1DC4A 2PXXA 4M38A 3QU9A 4NZ9A 4BX2A 3PIDA 4BZPA 2EHDA 2O19A 1OKKD 2GS9A 2DG2A 2IU4A 4AJ2A 3VHLB 2Q7XA 1JPJA 1PL7A 4HF7A 2MT9A 4QBHA 4XB1A 5HFAA 2RHHA 1YZQA 3TCKA 1QGAA 1PFUA 3WWDA 5FDFA 1QFJA 5HM6A 4RPCA 3EDMA 1TQ2A 1MB0A 3EEIA 1T5SA 3B7WA 2CFCA 2AMLA 3P9KA 1ZD9A 2RHLA 3M6IA 4RVGA 3JZAA 1BW9B 2A59A 1BE8A 1X19A 4WGFA 5D3QA 5BV8A 2BHNA 3S7TA 1ETUA 3GCWA 1YVEI 2P77A 3CW9A 3R24A 4KVGA 5DBOA 1LLDA 5BW4A 5LIRA 3PCXA 2WIJA 1LSJA 4TLLB 4MKXA 5E9QA 1M5UA 4FE4A 1N2SA 3E5RA 4Q1CA 3FH0A 2X0EA 1N9GB 2JJ8A 3CUYA 4PZLA 3RRNA 4I8XA 4JN6B 1N7GA 1DKPA 4JUCA 4GSKA 3QX7A 1EQ2A 4WK6A 3FGNA 2OK7A 2ZGVA 2R00C 2KE5A 1QP8A 2DPGA 4ITRC 5BR7A 1F0NA 4RSGA 3ZV6A 3SEAA 2IHJA 3L8HA 2HIAA 2MR5A 2V7QA 1WIWA 1WULS 2R96A 1M1UA 1Y3CE 2VJBA 2XOKD 1VIDA 3C97A 1PJ4A 3EVCA 3GRPA 2HFKA 3KE9A 4JZKA 4NEQA 4F8EA 2H5LA 4PGFA 3EXHB 3MAAC 1Z4QA 3GPCA 4ER3A 4ZTUB 5BN3B 3SS7X 4CG1A 1I2DA 3WA6A 4TVSA 2QVBA 4IZOA 4RVDA 2FG5A 1PV2A 1U7OA 2GYUA 1B0UA 4BE7B 3BH7A 4IVPA 2QD5A 4H0FA 1TUBA 3SF8A 4ADSG 1QTNA 5A5GA 5HQTA 1NYRA 5FULA 4UQOA 1XWWA 1LBEA 1ZIDA 2B1QA 1C50A 4RPKA 4HH1A 1FTGA 2VSOA 5BV2P 5ABPA 3HSSA 3OU2A 4RZQA 2HNBA 3BJMA 3KYDB 1FDVA 3BKXA 2AT1A 3N6XA 5H16A 3RBVA 3W3AA 5ARDA 1KMQA 3W6UA 1U0GA 2BWJA 3H5TA 3L49A 4L0MA 4N18A 1ZVJA 3DVRX 2W48A 4MYCA 3ANTA 3A1EA 3FUTA 3Q7SA 1UUFA 5KPDA 2I78A 1NIJA 1NYTA 5K2MA 1FS4A 5D8DA 1PZMA 2XMSA 3B8EA 3T38A 4N01A 3EQ8A 2GD1O 1VHLA 5JH7F 3F6RA 1OIWA 2CXPA 1N6KA 1HOXA 4YR7A 2LV8A 5DX0A 3T34A 5I3CA 4BL5A 1IOWA 4K9SA 3CX7A 4W8HA 3GRRA 1GQRA 3LAWA 3PNPA 2HU7A 4H7JA 3PQFA 1A4IA 4TXNA 3V32A 1RR6A 2C5SA 4IJQA 4R2JA 4YV1A 4RTLA 1QPZA 3ZXXA 1QYRA 5EWMA 5C3UA 2BFWA 4C76A 4ZVTA 3EC7A 4WPGA 2VAWA 1F12A 4LNUA 1DE0A 1DKOA 2E85A 1J9GA 2MU1A 6ABPA 4J0GA 3NAQA 3PJGA 1FLNA 3ZVLA 5DLYA 1REQB 2JJQA 1N4AA 2HA0A 4F5YA 3EW7A 4HSEA 2Y71A 2GCNA 2EJWA 2H4JA 4PQGA 4KQMA 2DAPA 2JAOA 3GG2A 3UXEA 4LFCB 5YASA 4F46A 5T4BA 2QW0X 4CMGA 2QYHA 4CTNA 2GXUA 3BAZA 3ZY6A 1E7MA 1CRWG 3B51X 4E3WA 2WWYA 5BPHA 5K0GA 4HVTA 4B8WA 4KRGA 3CWQA 4HV4A 1JMKC 1VJDA 5AM2A 4FT2A 2F8SA 4R05A 1KK1A 3KT8A 1BN6A 3STUA 3RYCB 2FPGA 4R2XA 4XWAA 2ETXA 3O4JA 3P2JA 2YIDA 5I9MA 1IN6A 3IVGA 2QJOA 2C9CA 3JYOA 3QUCA 1L5ZA 2XMQA 1NT4A 1P60A 4UCXA 5FPQA 4OBEA 4Q16A 2O8FB 4P4SB 3UPUA 4PPQA 2KMLA 3MWEB 4ZVOA 2DBVO 2ORYA 3OMLA 1XCBA 2OBNA 4P4LA 4OAOA 3PPWA 2VYNA 1WZIA 5IZCA 1QP7A 4PW0A 3EBLA 1NP3A 2GXSA 2Q1TA 4LHYA 3U3ZA 3R3UA 2CDAA 3LDFA 3N53A 1R6TA 3WRYA 5IS2A 1JA0A 5LUBA 1Y82A 2A9FA 3Q9UA 1EAYA 4MQ4A 1C2TA 1GUZA 3LRTA 4F3YA 2PZMA 2WF5A 4DJFC 5E2BA 4U0JA 4B3FX 1DCFA 2X7JA 4ZQFA 1NLUA 2BGRA 3SC2B 4DIKA 4TYYA 2UXDB 4N54A 1N5OX 1OVMA 5FLKA 3Q40A 1G6OA 1QHFA 4RTKA 2P5SA 1B73A 4GAEA 2C8KA 2QXTA 4WL0A 4HNAA 3CF6R 4Z53A 3ADPA 1G5HA 2VK2A 1KQGA 4M3NA 2WSIA 1IJKA 2JZCA 1CUZA 2ODTX 1IIRA 1VKJA 4BLOA 3NT5A 4AYWA 3S27A 4TWJA 1N57A 4LV5B 1I0LA 3PR3A 1OR8A 1DC7A 2BR3A 2QQFA 3OZAA 4G89A 1Y7HA 3A37A 2QUBA 1VHJA 4UUMA 1PT8A 2HD4A 3IYLW 5AM5A 4N0PA 3UENA 3MJRA 5CYGA 1X1DA 5FI1B 3MINB 4MQ6A 1THZA 3EEBA 1JXQA 4YMLA 2ZWMA 1Z7GA 4BX9A 4MW7A 4OAQA 4EGCB 4EPWA 3K0KA 3KQTA 1TA9A 4Y2TA 5D6OA 2ZXUA 1U0BB 4HGPA 1ZEJA 5HSGA 2FMUA 2OCBA 3ZW8A 5DI9A 2BEUB 4EUNA 1TPYA 1DC8A 3KKLA 4ZK2A 1N2CE 1SCQA 1KJYA 2FQWA 4KQIA 4RH0A 2FPPB 2YJGA 2C82A 3RVOA 3AVXA 2DYKA 3ND9A 5JXHA 1RPJA 3KV1A 1DP4A 5IM5A 1XAGA 2IYVA 3UOGA 1NT2A 4X00A 1ORRA 4IJUA 4L8LA 1ZGGA 1U94A 4NE7A 4QE3A 3TZHA 3DMGA 1C1XB 3IIIA 1RACA 2P7HA 3C7KA 1R16A 1UPBA 3EZXA 5EQJB 1JSCA 3WDKA 4GS5A 4H31A 2VHWA 3UAZA 1E7YA 2J5BA 4KRYA 4P4UA 2F4NA 2JIQA 3BIWA 2WY2D 3HN6A 1W25A 3WMRA 3BJZA 4HZGA 1TQ4A 1T4CA 4JYPA 4CIAA 3FM9A 1O9BA 2WNSA 5GP1A 1UPAA 1AUPA 4ZHQF 3B1WA 3RYTC 5BYKA 3LT5A 1UZLA 1P62B 5FYDA 5KTRA 4WHMA 4YC7A 3RS8A 4C0XA 4YUAA 1LPAB 2B6HA 3OM8A 3TTYA 1CYEA 1CS0B 4GPTA 1BZYA 2ILVA 1YA4A 1XV5A 3T9BA 1IEXA 2H4HA 1UZNA 1W76A 2P3LA 5EXTA 1VE6A 3DCIA 2JPDA 4OGWA 5DBHX 3T35A 4YUYA 1KJNA 2P7IA 4BLVA 4Q34A 4E1BA 5JCXA 5EINA 2PRIA 4YJ2A 5A4JA 3GGOA 3Q3JB 1NP7A 1L5MA 3E18A 3DEJA 3AKZA 5IC5A 1X8KA 3L9WA 1X74A 4NATA 2OXRA 1WDLA 3AESA 3VPBA 3NHJA 1U0JA 4GPZA 5JW6A 2BZ0A 3K9HA 4DR2B 3H3XA 5FUWA 3V48A 5K0TA 4ALJA 4YQYA 1RAAA 3A27A 2GM3A 3W5IA 4EG4A 2P2GA 2ZBUA 2WK1A 3UHFA 5I8ZA 4BFWA 4F71A 2O2YA 4YP1A 4AO7A 2UAGA 3I76A 4NZMA 3HP1A 4B48A 4FFLA 16PKA 1VLMA 4GI2A 1ND5A 1P2TA 4Q9LA 5KSZA 2CJWA 4PN7A 3BWVA 2YXLA 1KBZA 1HL3A 1QBGA 2P1DA 5C32A 3E4CA 3E8MA 3MTGA 3WR5A 4QFMA 3MTQA 4G0QA 4FOLA 4K87A 2HRRA 1IG0A 5LP6B 3VR4H 3KJNA 4IM7A 3DKVA 2ILTA 4KE9A 1E98A 1FZQA 1R0YA 1TJNA 3OE4A 4UHBA 5D6NA 3E5MA 2MWMA 3FNIA 3LX4A 4NV0A 3S2FA 3AI7A 4BKPA 3DMRA 4R2HA 4EHAA 5CVTA 5JNWA 1JG4A 4NECA 1IJEA 3FSRA 4HD8A 2MSDB 1UT5A 4REOA 3RVQA 4RF2A 4RF4A 4GF5A 4QXRA 4UCFA 1EM8A 1AV6A 1GGMA 4TL9A 1YS1X 4B81A 4X1KB 3RVKA 5MGNA 2EWWA 2XQFA 2ZJ8A 3SN6A 3B9QA 2V9CA 3EGEA 3R3JA 1LX7A 3PIIA 2ZK7A 1Z5PA 3VMMA 5JQWA 2EDCA 5SZJA 5G41A 2B2CA 3DO8A 2O05A 2QF7A 2O2JA 2XDQB 1UODA 9LDBA 4W5OA 1TKRA 3GVPA 3ZNOA 2EHJA 1QANA 3GFGA 5EWJA 1PEYA 3B7PA 3H1BA 3PXDA 3GEIA 4KMMA 1FNMA 2H3EA 1YJ5A 3AHDA 4RZ2A 1WV0A 2H1VA 4GVXA 3KQYA 4RTPA 1YAHA 3L1IA 1FJXA 3I12A 3GUYA 5TIIA 1HZZA 1L7VC 3KOWA 3PGVA 1U04A 5A9SB 1U1DA 4IUDS 3UOWA 3SEQA 1UBUS 4M86A 1H93A 1CUVA 4NBRA 1MEEA 1WEKA 2ERCA 2C61A 4J3JA 4PAGA 2CUTA 5C4GB 3SSNA 3W6ZA 1E0AA 1YA8A 2AK3A 4Y6QA 4KNVA 2B94A 4MP6A 3FYUA 1J5PA 3L4KA 3GGSA 3ROGA 1KU0A 2X3YA 3STVA 1KVRA 1YV9A 3UVEA 4ZAYA 5FUQA 2PLFA 2IS6A 2X0DA 2P27A 1TJ5A 3MFYA 3WLHA 5AW1A 4OX9B 1ML3A 3ON5A 5K5EA 4GL2A 1G20A 1Z6TA 5B1SA 2I6XA 5M7EA 5IF9A 3UJAA 2XE8A 3UMRA 3KE8A 3WKEA 4DNOA 4EEXA 2Z57A 3DH0A 3JR3A 3CEJA 4EELA 4TSFD 4M9RA 4FILA 1USGA 2WR8A 2VDOB 1P3Y1 4M4SA 5HBRA 3S2YA 4PX2A 2J09A 4M9ZA 3QU2A 4XD2A 5CT4A 3JQPA 3MC1A 3FGOA 3W3ZB 5DCYA 3IUBA 1W30A 5TPZD 3KV3O 4IO1A 2CE2X 3BZUA 5FOQA 1AUXA 5KYNA 4JB3A 1NBEA 4TROA 4KHPB 3K0FA 1YIOA 5FOSA 2X0IA 2VBGA 2GPBA 1DQNA 4HXGA 2FEXA 4G84A 4GSYA 3WWPA 1YKFA 3I34X 3KJHA 2I71A 4ZQBA 1A2BA 1GRVA 1RZUA 1JLHA 2VDMB 3TOZA 3TDNA 3I1JA 2IQ5A 1O87A 4F60A 1VPVA 3SHWA 1SKBA 3ZX4A 4M1WA 3K9BA 3LUCA 1B41A 1KK2A 4B5LA 2F43B 4RKQA 4P53A 1Y4SA 1IJFA 2AE1A 4MW1A 4REQB 5KOIA 4JLOA 3BXPA 2Q9BA 2IXEA 1YZKA 5H80A 3PPYA 3L0YA 5AUOB 5LSAA 2IUEA 2V9PA 4IY1A 1VE9A 5CX4A 2XTNA 4MQFB 3R5FA 5B1IA 4HDSB 1RJWA 1IXRC 3AJRA 4ZDWA 4XTCS 1E96A 1MV8A 4QX6A 3TTWA 4KR6A 4CF3A 5CLHA 4I19A 3VR5H 5F7XA 2AOTA 4D46A 4LF8B 1UMDA 3WL7A 5HKOA 4YAEA 3KB8A 4KUHA 3DM5A 3INYA 4IVRA 2G6BA 4AJKA 4RU1A 1WW3A 4NZZA 4O4HA 3SC3A 4KL8S 2DR3A 2HRZA 3HR8A 4BNMA 4F84A 1A88A 2UV8A 1NE2A 4C6RA 1UP4A 2ET6A 3ZJYA 3C3PA 3OTQA 3L6DA 1J0BA 3MTIA 2CZGA 4QO8A 4W7IA 1J24A 5DULA 3SSAA 2LGJA 2AZDA 1K4MA 1EK1A 3ZDEA 4Q4AA 4HFNA 3DBRB 2A5GA 4D9EA 2ZJOA 2JFFA 1WXEA 1KVSA 3KQVA 4I9NA 4DS3A 2BY4A 1BNCA 3OO1A 3QKRA 4NH4A 4QNNA 4AJLA 3NB0A 3RRXA 2B4TO 2FMFA 3ENKA 5ELXA 2Z4RA 3TEFA 1SXJB 1EAMA 2J32A 2LNDA 4GZMA 5DB4A 2B8JA 3JWGA 4E32A 1KI9A 2V4UA 2ZYUX 1ZR2A 4QSMA 1ZW6A 3OU7A 1BWRA 5K2OA 5BSVA 4UREA 4BV3A 3ZWBA 3R5SA 3IFSA 2VQEB 1YD7A 2PJZA 2ZVDA 3OQ1A 3GRAA 3KL4A 4CGYA 2IYZA 2PY6A 3RAFC 3EEFA 4NNPA 1JLMA 1L6IA 2H7XA 2HEGA 2JFZA 3QHPA 1MJFA 1BEEA 4KB5A 4MUGA 5IDQA 1OYVA 1U7UA 3U3OA 1ZM4A 6Q21A 2OZKA 2PGOA 4TS3A 2DVMA 3VKWA 4INZA 4AF6A 1DHTA 1V5FA 3KS9A 1KQOA 1XF1A 2Q9AA 2V03A 4XSVA 4C0HA 3ZG6A 2QW1A 1ZCBA 2YXPX 3IVRA 1G5FA 4UC0A 2IHUA 5IKXA 1IOVA 2DT8A 2PO7A 4YXFA 4DCCA 4YRZA 2I54A 4MRSA 1CNMA 5D1NA 2V6IA 5DGXA 1P2BA 1LLQA 2HMUA 4H0CA 4YPOA 2I8CA 1EA5A 3AYZB 3B13B 3WKCA 5K05A 2NV0A 3RREA 1JPUA 3NDBB 2L19A 2FH5B 1CUJA 2PWYA 2WC1A 4TYMA 4UDYX 3UJ6A 4EJMA 4OOFA 4NULA 4ARUA 4OEHA 1DC6A 3EQ2A 3JQAD 3NHUA 1XMVA 2VPQA 2AOVA 2ZI6A 3DZDA 5JMOA 3D3KA 3EZ6A 3RV4A 2AN5A 3G88A 5BMVA 2XV1A 4XIYA 5ADHA 3SFZA 3L2OB 4BFVA 5EYPA 3AUKA 4IWYA 5H82A 5IH7A 1Q3TA 2BFDA 4RMNA 1WEHA 2PMBA 3QYAA 1IOLA 3R09A 1TB4A 3S5JA 1OW3B 2B0CA 3C6QA 4MUBA 3L8YA 3TL2A 4CLRB 5AW0A 3SQXA 3WZ2A 1M0EA 3D2LA 1TE2A 1I7LA 3OJCA 2OCIA 2ZSAA 1Y6GA 1YR3A 2FUCA 2DJIA 2ZR0A 3OTHA 3GW8A 4NYIR 2V6JA 3R40A 4R01A 1XPOA 3NBXX 2NO4A 4RK5A 1VMEA 4ENRA 1ZAKA 4N8DA 4WBSA 4D9IA 4DJTA 5K99A 3FR7A 1R8JA 1SURA 4MRRA 2ZKIA 2YJTD 4FFRA 1Y1SA 2IY9A 2OLEA 2H17A 3NBFA 3UKOA 4KYUA 2C2XA 1AXEA 1PP4A 2ZIAA 3EDCA 4UNIA 5NULA 2PQ6A 3VNSA 5FPKA 4UNNA 3AIIA 2W6JD 4CM9D 1UEIA 1WABA 4IWNA 2EQAA 3Q3IA 3K3PA 4L6AA 6REQB 2BKLA 4CUKA 1SO8A 2XXAA 3GPIA 1CUFA 3FIJA 4IOMA 5JXIA 2FEAA 1DOHA 1XKLA 2QN6A 3FNBA 2JFWA 1AURA 4IDDA 1T2NA 3B6KA 3EASA 4WACA 4DNFA 4JH0A 3KTFA 5BQ3A 2PPLA 4KXWA 5GGXA 4EI7A 4D3ZA 2UYHA 2A1TR 4OXNA 4CWAA 1P7PA 1I5EA 1JL3A 1Q84A 2CJXA 2ZTMA 2OWDA 2I8LA 4DLXA 1JRLA 5A5EA 1HORA 1OYWA 4OSPA 4XTRA 4K9NA 5ARCA 5TS2A 4LFAB 2DHRA 1IBRA 5B53A 3MAJA 4NWIA 1M2GA 2O57A 1N34B 2HHJA 2IJGX 1IPFA 3G2KA 4Y1FA 2Y0PA 4WK2B 1BO6A 5CIWA 3DAHA 3I9FA 4UHDA 5TPZA 3SX0A 4G0VA 4Y2HA 3GN2A 3LH5A 1XR3A 3NWJA 1RRKA 3TCXB 3LXUX 3TVYA 3WYFA 4D3XA 2RGCA 3MQ4A 4XYLA 4YTEA 4K9MA 4P31A 2H1FA 2KX7A 5JG7A 3VR0A 1UMCA 3GRVA 3P4UA 5JATA 5BURA 3W5SA 4ZVNA 2TMKA 3QKSA 4RMIA 3S3TA 4CEJA 1AJEA 3EJWA 4L9AA 2IA5A 4KREA 3R7WB 4RFVA 5G1PA 2C00A 3MTDA 1S2GA 4I3FA 3T12A 4D42A 5K0BA 3DV0A 1E6CA 5B64A 3H5AA 3IAM1 1U1EA 3DMDA 3SJUA 1X9GA 2W71A 2Y1EA 2GD6A 2GJ8A 2R8OA 2A5JA 5LB4A 1V1RA 2GJSA 3M9XA 4A15A 2AZXA 4HS4A 4JB2A 4PHHA 2VJMB 1ZWLA 2JIMA 2WF8A 3LT4A 3RC1A 5DNEA 3HCEA 4EPTA 3IJPA 2QRNA 1L3IA 4K1LA 3QELA 4PE5B 3D6NB 2QLTA 3KEFA 3O8QB 1YA6A 2WUGA 5C53B 2PUDA 1FVFA 3GNLA 4HGQA 1VL1A 3VOBA 4JU8A 1ZJYA 3SZLA 4B4DA 1LS1A 3W7AA 1YGYA 3ZH9B 4C2BA 5JDCA 4I0WB 5KJ1A 3C87A 3AKDA 1FF9A 5KHAA 3NMUF 2RBEA 2OHGA 3NONA 4YASA 1TM1E 1MVOA 3ACBA 3K6KA 4IGEA 4QU0A 3BBPA 3LM8A 1E2MA 1PDWA 2XCRB 1H5UA 121PA 2W2OA 2AZMA 4L3WA 3ZJVA 1TUGA 4JS0A 2GM9A 2RC6A 4ATNA 1HDEA 1G64A 3O8OA 4HP8A 4JEMA 3KFVA 2YW9A 3KUUA 4P7FA 3IJ5A 2B0JA 1L5NA 1V2HE 3AR9A 2BM8A 5GVSA 1WU7A 1Y8RA 1NURA 2EGGA 4RTRA 1QH0A 2DE0X 3IUYA 1G8GA 3LBFA 1XNGA 1VPEA 2VH1A 3CB2A 1AQUA 1GVNB 3P0RA 2PE5A 4HQNA 5AHWA 2FDCA 3THRA 4NCIA 1SD1A 1RQLA 4N41A 2V45A 3BIJA 1DUSA 4ENSA 3QOWA 5A4IS 1P5RA 3H2HA 5I7RA 1A50B 4AKTA 2XUIA 4FXOA 1YBHA 5TR9A 5LL6P 2C9MA 2L2QA 1XPUA 2E5FA 2BFPA 2VS1A 1N2IA 1DDOA 1QRDA 1U02A 1WZUA 2FUG6 2YTZA 1U2EA 2C7QA 3NAZA 3ZWPA 3T5MA 3UEOA 2CDRA 1Q57A 3CO0S 2XCUA 4QNRA 1VI5A 3K9NA 3GEHA 2BSAA 1U8TA 5KCMA 4DLTA 2REXB 5JAPA 2C7VA 3QE2A 4TVBA 4F4JA 4W9MC 2H1SA 3PV0A 1YI8A 4FD3A 5A1TA 3NJRA 2Q6VA 4I55F 3F96A 4ZI5A 1KSGA 3RU7A 1QIMA 5F76A 2X2OA 2XGGA 3PRYA 5KNDH 4HPWA 2PT9A 5ADWA 2AVNA 2VJYA 1D0IA 2WAOA 3LQ1A 3O2NA 3EWIA 3PQ2A 4H3HB 4PYKA 1EB8A 3FMPB 5SICE 1DC5A 2PA0A 5H3HA 1VC2A 5IVHA 1IBSA 2GQ0A 3U4IA 4DMCA 1NW7A 4XJTA 2JFXA 1H66A 3MZ0A 3RD5A 4AP5A 4EB3A 1AK9A 3HY6A 4NXNB 2I4TA 3K53A 4GHWA 3FBWA 2EW2A 3BS4A 3V80A 4M0KA 3MELA 1VGVA 2YJ3A 1DBRA 4FW8A 4RTNA 3T5CA 4PYIA 1YVUA 1Z9BA 3KEOA 1DXOA 4FKMA 1NBMD 3AF5A 3OG9A 5JNLA 1PV4A 5HJ7A 5JPCA 1K6XA 3DLCA 2AFHE 4J0DA 5HCUA 4OLJA 3OTGA 4L0DA 5AVWA 2YASA 2GKOA 4LNHA 1NLYA 1L5WA 3BRWA 1RTKA 4CKBA 2IP2A 1J42A 2J4CA 2O6HA 7AT1A 5JSZA 3EXIA 3BE5A 3ZYCA 1TMGE 4CDNA 2VP9A 1F2DA 3QFFA 2Z5FA 2C8VA 2ZQYA 1VYVA 2PKRA 3YASA 1RHRA 2BEWB 5DTEA 3SX2A 4CV2A 1WBBA 1OX4A 3FCYA 2PJRA 2EL9A 1QWSA 3LT1A 2FK7A 4MJXA 2D00A 3QJ5A 2ZQZA 4NL4H 4TYQA 5ICSA 1LDNA 2HK6A 5IK2D 3GA0A 3PRJA 2GESA 2QAGC 2X58A 3V1TC 4F3NA 1K8ZB 1PZFA 3PL5A 3JAMA 1E6EA 1M0TA 1E2BA 5MFPA 1NWCA 1E7QA 5AHKA 2IPOA 4B47A 1G59A 4L6CA 4AC9A 3B60A 1OWLA 1ZMRA 3GFPA 2ZI9A 5B1DA 3WYDA 2ZE6A 3OQ6A 2HADA 2ICAA 2YWFA 3IKLA 3KXKA 5CM8B 3ECSA 5CT8A 3RANA 4XQ0A 1V41E 2IUTA 3ST7A 1GPH1 1IVSA 2XIJA 2QT0A 1DIGA 2FRVA 4R8KA 3EK2A 2VSQA 1PJZA 3ETHA 3QPWA 4A2QA 1HRDA 1V1MA 3ZKWB 1D4FA 1A5BB 1TMOA 3Q11A 1XNJA 2QN2A 3ELDA 1M73E 1O4WA 2JBAA 3EUWA 4Q19A 3T0FA 4RDXA 3ZK8A 3SVTA 1CQPA 1ZI9A 3P4XA 1SK9A 4AZVA 1D09A 4KQJA 1CY4A 3DZJA 3CLUC 3AP3A 2WAAA 4RK7A 2JGLA 2NUTA 1I3OA 4EVRA 2EG5A 1X9IA 2H29A 1X0VA 1C5KA 2Q1UA 2Y1GA 3AFMA 3DFFA 1CUIA 3G5MA 3NALA 4E5DA 4EFKA 1CEXA 3DF7A 3ROMA 4XQ9A 2Z83A 3L06A 1Q16A 1GU7A 1UZAA 3U7EB 2UUOA 1ZD8A 4PLCA 5SV2A 2VDQB 3RSHA 1VRCA 2P79A 4OHPA 2PVPA 2HXGA 3R6LA 4WCFB 3ZOKA 2IEYA 3AOEC 3GUUA 3NO4A 2AUMA 3PGJA 1IAVA 1BGWA 2VTKA 4JR2A 5IC4A 4UDOA 4UHHA 3HDJA 2X1MA 4LXTA 2VNKA 2HJVA 5TT1A 2BKAA 4JQYA 5M34A 1EJ6A 3VYVA 4BMPB 2G7ZA 2GGSA 5E38A 3L07A 2R1ZA 2JJMA 4CKWA 4CV1A 1EWQA 1JBKA 1DIAA 1SCJA 4ZKEA 1A5TA 3IUSA 4QC2A 1EXNA 2H48A 4L5YA 3GUZA 3RUCA 3OQIB 1DAEA 4XM0A 4F2GA 3UT5B 2Y76A 2HI0A 3QW4B 4OQMA 4R2KA 4WZBE 1L5GB 3TM5A 2JBWA 5CGQB 3R5HA 1SOUA 1KRWA 1G21B 2MSKA 4B3CA 2VHEA 3ZOZA 3JRNA 4URVR 3GLHA 1EGMB 3DWEX 1GL9B 1C30B 1UT6A 4UBMA 4IIEA 4EI2A 2VIIA 3O47A 4UHKA 4IMRA 3PC4A 4LQLA 1AZWA 1BVUA 2IGTA 1O94A 2Y2UA 3QUTA 1QCDA 1VJGA 1L8XA 1O5IA 1PFKA 3AR6A 1ZQ9A 3CR7A 2W5UA 4KLAA 5KU1A 1OUMA 2IHZA 4PF1A 5T6MA 4UULA 1JQDA 4N65A 4ZV4A 1X1RA 3H8WA 3I2FA 1QHNA 1GGFA 5EJ4A 4G5QA 3UAVA 1GYRA 4G6ZA 3ZIAD 4I5FA 3WWZA 4D79A 5IYZF 1PWXA 4Q6WA 5AUQA 1XP5A 1OIXA 2H18A 3A28A 4E2ZA 3H5WA 5JAUA 1ZRMA 1RI3A 2RI1A 3DT8A 5EOVA 4MW5A 5J1TB 1G60A 3PJDA 3D6UA 3E9YA 4HAUA 2WJGA 1BCSA 4LQCA 1CSEE 1N2GA 3KJIA 3R5KA 2J0VA 2Q27A 4D8YA 3QE0A 1EUQA 1PRYA 3W4IA 4FYHA 4EHJA 3VH4A 5JADA 3OEYA 3NYRA 2VA8A 5LOVB 2DR2A 3KQQA 3QK7A 1MAWA 4BLWA 4I1UA 4RE6A 3D7SA 3LPMA 3MS2A 4G2NA 4YI3A 4WSOA 2C4KA 2ZBGA 1WB4A 4A1FA 1DXYA 5IXSA 1LRJA 4Y2GA 2F8TA 3GGCA 4WXRA 3HJBA 2PKWA 1LJUA 3ORFA 4X1YB 1YHZA 4QEKA 4I2VA 2DWPA 4AG5A 3CJRA 1GFWA 2O1XA 3BB3A 4URHA 1XYGA 1EK2A 3PFHA 2O0HA 1HE4A 2IYRA 1C8LA 1N2EA 3E9QA 3GT3A 1GYPA 1XHEA 4NMMA 3VOAA 1KYQA 2O23A 4YMHA 2AKEA 1BFDA 5P8WA 3H05A 3TGWA 1S2OA 4A16A 2VXCA 3KWMA 4UBLA 2IUUA 5LLDA 1ULHA 5D51S 3RG2A 3G2OA 4IKPA 4TMWA 3DKIA 4EL5A 3IIMA 5DKFA 1U3VA 4R1UA 5K0FA 1GPMA 1Y3DE 1IZ8A 2IXAA 2NN3C 1J23A 2VAVA 3VR1A 5CVEA 4AB1A 4HDKA 1YCGA 3FCSB 4P22A 2Y2VA 2AIRA 3TL3A 3GLTA 5E9JA 3ADOA 4B3DA 1NKTA 3WLIA 1FMTA 2FSSA 2Q4RA 3ZY5A 4UEOA 4CFYA 1Q7GA 1IEQA 2AJBA 3BCHA 3ZVKA 2JD0A 4CFZA 1HLFA 1R4NB 1TI7A 4BFYA 2ZBRA 3WVNA 1PQYA 3OLYA 2XE4A 2BPOA 3VZCA 2H2AA 1NR5A 5HRUA 2BAGA 1CERA 4X7PA 2XT0A 1H94A 4ENUA 2H7YA 3A6LA 1OBHA 4JBLA 3NPAA 3PU6A 5B7QA 1MA0A 2PT6A 5AK5A 3LCCA 3DC7A 3HJAA 3SF8B 1TUBB 4JBYA 2XKKA 3EH2A 1QO9A 1S9DA 1H4VB 2EX0A 2H1WA 4UU1A 4AICA 1MXFA 3VR5A 1K63A 3CH7A 4OI2A 1HE5A 1GSOA 1NDUA 1KORA 3H04A 5IAJA 3ZN2A 4BUJA 1F8YA 3DQPA 1ND6A 3T6KA 1TLFA 2AG0A 2FJ0A 4KK4A 2P3QA 2FN9A 2ECKA 5E1DA 3DZGA 2HC9A 3EISA 5CDHA 1U9JA 4IXMA 5IJAA 2WG1A 3VYWA 4TGLA 1C1DA 5DYTA 2D7DA 5THQA 3GEDA 1BXRA 3IMKA 3QFHA 3NYWA 4EQ6B 1EBUA 1SWWA 3NR2A 2ZI4A 1GCAA 2OL4A 2RGDA 1GUAA 2Z6AA 3H1PA 4FNOA 2X1VA 3LUDA 4BRUA 3FPFA 3DEHA 1XXHA 5LQCA 3AZPA 4HGZA 5EWMB 5ALNA 3RFTA 2D74A 2HPAA 4LNUB 3CSUA 1JDSA 5F7OA 4PYQA 3AVVA 3NTRA 4DF3A 2R8YA 3CVJA 2WE7A 1Q7BA 2DQZA 4YJ2F 2AEJA 2IBMA 4EBFA 1WHTB 4XIJA 3CZRA 1AKVA 3AF2A 1PL6A 4ZPJA 5ESWA 2NSYA 3V2HA 2QRGA 3KJGA 1EBBA 4IILA 3R23A 5FFFA 3PHIA 2QGNA 2B98A 2QGFA 3I1YA 2QK4A 3PVZA 1RLIA 2JLSA 4MAMA 1COWD 1XOIA 3ZU2A 4W1QA 4EPXA 1MC4A 1N3LA 4TKUA 1DRJA 2FJPA 5FRDA 1V45E 3V00A 3ZBUA 1ZESA 1TCUA 5IJ0A 1JG7A 2CDCA 3DCNA 4KIUA 1XDGA 2XOEA 3FWYA 4K6HA 3ZV3A 1P4AA 4DA6A 4G24A 8LDHA 3CVWA 1IHYA 3NWPA 4E6PA 3SZUA 3TRIA 1S1CA 4IG4A 5AKIA 2CY0A 2H0QA 4ZODA 2XUKA 3H5OA 5E6RB 2YCLA 3C8MA 4MWEA 3RHTA 4D02A 1U4NA 2I5PO 2Q1SA 1X7YB 2AJ8A 1IATA 2Q8PA 3C14C 3N39C 3P9QA 4JC0A 4QOHA 2RI6A 4D8WA 3L0BA 4CM7A 3PDJA 2K4MA 2VYVA 4YYEA 3VSBA 2YV4A 4PLWA 4TRRA 4HEA1 2HKIA 1NJGA 3WICA 2NZVG 4DJDC 3OX2A 1Y5NA 2ZYWX 4JLPA 4M7OA 3I6ZA 2CUNA 4LDPA 4CM3A 2BT4A 4MVCA 4J16C 3U7QA 3PYMA 3ZWOA 4QKQA 5IARA 4HNAB 1JEYA 1ODKA 5CLIA 5CH5A 1Y5LA 1KEKA 1G3QA 1JHOA 1T29A 3LWZA 4ZVQA 3W5CA 4Y1EA 3KSZO 2EKBA 3UA4A 1TKAA 3F47A 2CFSA 2VK4A 2W93A 3O8BA 2XW6A 3GU3A 4EUSA 4P3NA 1TJ4A 1S8NA 4OREX 1V5EA 4ZVLA 1VBNA 4XGNA 5DW0A 2DUWA 4CG2A 3R2JA 4X9XA 4EFMA 4I6GA 4DBLC 2WWGA 1JDVA 2GXAA 3T3NA 2B82A 3IHTA 3HUDA 3LBAA 3G8CA 4LK3A 3RVMA 4YCLA 4NMHA 4Q4JA 5FWXB 1RWXA 4PC3A 2IF0A 4DM3A 8AT1A 3RRYA 5HF8A 1NW6A 1M6VB 3NXSA 5DGIA 2IYNA 1JIJA 4OMFG 3U0BA 3J81A 5A0TA 5M5BA 1JT9A 2ZCJA 1A82A 4UUBA 3WC4A 1T35A 2QU7A 1RMYA 2WSLA 4FDTA 1KQNA 3F73A 3N28A 4AULA 4KDRA 1HSZA 1SA0A 1U2SA 2HXYA 1FP2A 4QNMA 4YO7A 5MGBA 4NBKA 4F2HA 4TT3D 2UZ1A 3BE4A 2NXWA 1ZRNA 4RQTA 1K88A 1O6CA 3A0RB 1Z73A 3P0EA 1W4RA 3PC2A 1XFDA 4XKJA 3FVQA 3KB2A 4OHYA 1Z88A 2JLYA 1RJEA 4FXPA 2MYPA 2QP9X 2V96A 4TYPA 2XH8A 1DT3A 5AWFC 4YHBA 1U7HA 2COUA 5E3HA 1I2BA 1LU9A 1MB9A 1XRLA 3GPLA 1MOZA 1N6PA 4C0WA 2CV2A 1L6RA 2WDPA 3RM3A 3Q8KA 1NZFA 2G77B 3LWDA 1DAIA 4U2EA 3FWKA 3KQWA 3I39X 3WYGA 4BMSA 2MMCA 2Q5EA 5LJIA 5AJWA 4ALNA 3QOFA 4UTNA 1SEPA 1I4LD 2FMXA 2ZG6A 5A9TA 1FJHA 1JVBA 2YH2A 3S2IA 1T26A 2OPHA 2QJWA 3I6QA 3D8RA 4MUMA 1Y9DA 2M98A 4MUJA 3RSOA 3F0TA 4CIVA 3G9ZA 3K9WA 3JTMA 1PJQA 1WTAA 1XDWA 3NORA 3BRQA 3ORSA 3T5GA 3WYEA 1W88A 3Q9LA 4WKBA 3WK4A 1GUFA 1QMPA 3KLMX 2F6RA 3AESB 1U0EA 3IAEA 5E8JA 5GVRA 2EERA 2ZYHA 3NIGB 4RXUA 3NIFB 5AHOA 3Q3VA 3I09A 4EA6A 3AHGA 5CU7A 2OV1A 3SQLA 3I2IA 2Q2NA 1C3VA 1R74A 1QH9A 2IYTA 3GLFB 1OHHD 2IYWA 3C5HA 2H11A 4MRNA 2XRYA 3EE6A 2ZRAA 4FFBB 1DMRA 4YMIA 4U7GA 1E20A 2XCSB 3HB4X 4CR7A 2YZGA 3O9ZA 4ILEA 2VWGA 1NHGA 2PGJA 1X80A 1IOZA 1L1QA 1P5FA 3GJ3A 3I4CA 1RJDA 3ZIUA 2PEYA 3MCAA 3STYA 4V0ME 5MFZA 2IHNA 3EVDA 4E51A 1N2CA 1TW3A 1AS3A 2IL1A 4IGIA 4C0QC 4YJHA 3ABIA 1U4SA 2BGIA 3NNDA 1PS0A 5E1OA 5EAIA 4DCNA 3HABA 2C84A 2R2GA 4K6MA 4RVUA 3FCEA 3N8HA 4IIGA 1I36A 1M6WA 2ZAMA 3H16A 4BNGA 4IMIB 1FP6A 4R69A 3OCZA 1P17A 1X15A 3LPCA 1TUEA 3LWNA 4HQFA 1QK3A 1RLUA 4NONA 3LI2A 5GAJA 3UCFA 1T9CA 3I23A 1R66A 3S2GA 2AC2A 4NFSA 2R6FA 1TM3E 2NTJA 4RXTA 2R60A 2WD8A 2PS0A 4W5QA 4NV3A 1DKNA 1ULZA 4IIFA 4HJXA 1MXHA 1I4DD 2PJUA 3Q8XB 3U1VA 1RADA 1LH0A 3SBEA 2NSJA 1QWOA 5ETJA 1ZX1A 1MB3A 5B3KA 3F6CA 2RGUA 4AWXA 5JNSA 3OA2A 5BSWA 3VYTB 3NYQA 4RQUA 3OFND 4BKUA 1QG2A 3B89A 1Q17A 4DREA 1V39A 3T9EA 4D26A 2QNBA 3ABOB 4BMXA 1VCOA 3LPAA 3CC8A 1A7KA 1TZCA 4ND7A 4NU5A 1FDOA 3C45A 1L0BA 3HLYA 3T7RA 4D8XA 3LTNC 1SKUA 1WBJB 3WL8A 4QU8A 3WQBA 4FX5A 3FYUB 4JJEA 4PCAA 5CCDA 2O0KA 1BH6A 3CLUD 1RYDA 1P29A 3EQ9A 3FZNA 1M1NA 4WERA 5EPEA 4C21A 2E4WA 2DTXA 4G23A 2OD9A 3WLPA 1LK5A 4OQQA 4ZD6A 3MRXA 4X20A 1CJCA 4UPEA 3O3CA 3TAUA 3JZDA 1YRHA 1NXOA 2FEWB 3LC2O 4LF5B 3G1UA 1HXHA 1ONBA 1PJLA 3FR8A 3RTCA 2ZYVX 4KQCA 1F60A 1XN1A 3BWYA 5FNVF 3OC0A 3AJDA 4P33A 4LGYA 2I7XA 2PGAA 1EA7A 3IXQA 4TZTA 4E14A 1B23P 5FX2A 1YE5A 1AF7A 2BUAA 4CYMA 5L6MB 2OQVA 1YJ8A 4F9GA 2YC4C 2ZAOA 2HHLA 1X38A 2W2LA 3HBMA 3WNCA 1ZH8A 1Z0DA 1ZMBA 1PFWA 3G13A 3KYJB 4KQKA 4N1AA 4NQZA 1GJRA 4F5WA 1UBCA 2WJAA 1MOPA 4AXXA 1EBFA 3HCPA 2G3YA 2LW7A 3KPUA 1WZ2A 5HZKA 3ASYA 1E3QA 1BKYA 1SC4A 1F51E 2C4TA 2IVFA 4KE8A 1CHDA 1UPFA 2HX1A 2K5UA 2OY0A 3K0FB 4KXMA 2OAGA 3JCZA 4BDSA 4JEHA 1JG3A 2PKQO 1XZNA 4WNAB 1FSGA 3HCAA 1XALA 2B4KA 3WWEA 4MQBA 5JISA 4K81B 1V7PC 1OASA 3H87A 1DLIA 1QAOA 1UC5B 1WDKA 2P9JA 1E6MA 2QROA 3KYBA 4OJYA 3T4PA 4EABA 2EF1A 3F9RA 3E9DA 4M83A 1ZPDA 1TRHA 2D62A 4RYLA 5KO2A 4X63A 2AZ4A 3BXFA 4B84A 1A5SB 1DUVG 1QG4A 2AG1A 2OKGA 2QLJA 3VDRA 4H4EA 1Q0QA 1M1XB 3OSZA 3WY9A 2O5RA 3V7WA 1HT0A 1C7JA 1YDHA 3ENWA 1TZMA 3N2KA 4YGYA 1CJMA 2D0IA 1YH3A 3L8MA 4I4TA 5DEOA 4I1IA 1JSZA 1QH8B 3QV2A 3VPHA 4W8GA 3WHKA 1GTRA 2BTEA 3KZXA 4Q03A 3SLGA 1U0TA 1VBKA 2AFIE 3OTWA 4C89A 3VNRA 1P5ZB 1WR8A 1OOEA 2R751 4G85A 5HA5A 3ZH2A 3WMEA 4AN0A 1YQEA 4KXXA 4Q7KA 1A4UA 3LQ2A 4WESA 1JMYA 3NOOA 1ZD4A 3HJTA 4IV8A 4O4HB 4M53A 3RABA 2FPIA 4W82A 3W7VA 1L4YA 4JUDX 5HIMA 4YEDA 4B0OA 1XZDA 3DKPA 1K66A 4EHHA 1J2TA 3RAEC 1F3OA 1YOVB 1HM5A 2IDKA 4ER6A 1GLVA 3HVJA 3GH1A 4Q4AB 2SHKA 4NMXB 2IX9A 2GPSA 2FZKA 2A6PA 2VPXA 4KH0A 4YJFA 5FUBA 4EKNB 1SU6A 2WD9A 3BICA 3HR4A 3CH4B 4WKNA 5ALWA 3H5LA 2CXQA 3KQSA 4D5EA 4XQGA 2ZIUB 2PGIA 2G36A 2RGYA 2ZUBA 2PX5A 1A9ZA 2HRQA 4AO8A 3CE9A 1T9ZA 4BAUA 2YIVX 4U2CA 2CSUA 1US8B 4Y6GB 1VSBA 4DC1A 1XMJA 1D6NA 1OYOA 2AZTA