1IU9A

Crystal structure of the c-terminal domain of aspartate racemase from pyrococcus horikoshii ot3
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
111
structure length
111
Chain Sequence
b'MIEETAKKVKELGFKKAGLLATTGTIVSGVYEKEFSKYGVEIMTPTEDEQKDVMRGIYEGVKAGNLKLGRELLLKTAKILEERGAECIIAGCTEVSVVLKQDDLKVPLIDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aspartate racemase
publication title Structural insight into gene duplication, gene fusion and domain swapping in the evolution of PLP-independent amino acid racemases
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Isomerase
total genus 43
structure length 111
sequence length 111
ec nomenclature ec 5.1.1.13: Aspartate racemase.
pdb deposition date 2002-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iu9A00
1JFLA 2OHOA 3HFRA 3ISVA 3S7ZA 5ELLA 2OHGA 3UHPA 5HJ7A 2EQ5A 2JFNA 3OJCA 3OUTA 3UHOA 2JFYA 1B74A 4B1FA 2GZMA 5IJWA 2JFPA 2DX7A 2OHVA 5HRCA 2JFVA 3UHFA 2DWUA 2JFQA 2JFZA 5HRAA 5ELMA 1B73A 2W4IA 3ISTA 3S81A 2JFOA 2DGDA 2VVTA 5EVCA 2JFWA 5HQTA 1IU9A 2ZSKA 2JFXA 1ZUWA 2JFUA
chains in the Genus database with same CATH superfamily
2AIRA 4P7KA 4KFTA 4Q1FA 4RK1A 2GA8A 2IXEA 3KSAC 2UXDB 4HGOA 1KDPA 3BIFA 3ZV3A 3INTA 4YRNA 3VMFA 1N5IA 3SYLA 5FYDA 5H8WA 3SS7X 3HDVA 1J8YF 1DKNA 3OM9A 3LVFO 4RGBA 3KLPX 1ESCA 1NG1A 1BWRA 4FEEA 4PX9A 2RI6A 3D64A 2IQ5A 3M83A 2HSZA 3AJRA 4UUBA 5M2QA 3HL4A 3HRKA 5ALRA 4A8TA 4LE0A 2YIJA 5IXYA 1QP4A 1JH9A 1Z17A 2C4NA 4OUDB 2GZAA 4XH9B 5I9NA 1R8XA 3OM1A 5L3SB 1AS0A 1X9IA 1A71A 1CKEA 1J8MF 4HDQB 2MR5A 3GUVA 3N0VA 4PX3A 1OBVA 4ZCTA 1ESDA 3WWOA 4DWJA 1O54A 2H1IA 1Y4SA 1U8CB 3L49A 1RBYA 3VZCA 2VCYA 1PJBA 1X14A 1V26A 2ZWPA 1PQYA 2RHCA 2QMEA 3D5TA 1DX6A 4J7AA 2Y68A 4ZDWA 1OC2A 1Z82A 1CX9B 3PDUA 2NV2B 1DEXA 3BXFA 1W52X 3EN0A 4RHCA 2K5UA 2PSDA 1FB5A 2PLRA 4RK7A 4XA8A 4YWJA 3RHZA 4EG6A 1DINA 2Q9BA 5KOHB 2F64A 3C6XA 1N7JA 2P1RA 1ZJ5A 3ONVA 3MWKA 4C01A 1K0FA 2QTFA 1TC1A 3CF2A 2GKGA 3CW9A 3RABA 2OXRA 4G5YA 2Q3HA 4WRRA 2O0LA 3EAQA 5CLGA 1QZTA 4YAJA 2Q7DA 3RVLA 2GPBA 2AMYA 2PKEA 3MT0A 4I55A 3ZE7A 4DLSA 3NWJA 2OVFA 2J4CA 3GOQA 1ENYA 2W0SA 1E77A 1SD2A 2C84A 1GPAA 2AQHA 2CLCX 3STTA 1TK3A 2ODEA 2QF7A 3BIJA 4LYAA 1AJEA 3OJLA 2VBGA 4YHBA 1XCJA 1D4FA 4EHNA 1IYZA 3OOHA 3P97A 2JZOA 1R6AA 2FN4A 2AK2A 1FNDA 1XTIA 3T3PB 2A84A 3R40A 2TMGA 4MRPA 4AJ1A 4BFTA 3VJMA 3HK2A 2XHZA 2PVCA 1P9WA 2O4CA 4G4SO 4D80A 1O0BA 2HCFA 3L4BC 5EIOA 5LMUB 4G85A 2OZLA 4FDAA 3Q88A 3VPAA 2B78A 1A9XB 1NNEA 4EYEA 1BXGA 1I4OA 2H59A 4WLUA 3RT1A 1GADO 3GMIA 3ZK8A 4F97A 3VA7A 4RWEA 1XPRA 5FB3A 2H57A 3KLNA 1G21B 3G5MA 1XT6A 3I34X 4R41A 5EIBD 2F9MA 2V6FA 4HRVA 1OCEA 4PVDA 2CHVA 1M2HA 3ZEIA 3OMXA 5DTEA 5J9FA 3HJFA 2NNLD 1Y8QB 2UYCA 5L3ZA 4A16A 4EJSC 4V1CA 3B5JA 4JXKA 3FNEA 4R84A 4A27A 3PDIB 1IPHA 4E2ZA 1ZMOA 3BFPA 1FFWA 3ILHA 3KTFA 2QG9A 1BEZA 5HRUA 3ROXA 4H7DA 1KH2A 4Y9SA 4A8PA 2QUKA 4ZHQA 5FOTA 3KYIB 3SBDA 2CUZA 4DJAA 1XD2A 1Q7GA 3SQOA 4TQ9A 2NT3A 3KSDO 2MWMA 2NADA 1Q0TA 4X44A 3IEVA 2C0CA 4N9WA 3VR5D 2FP4A 2PPLA 1RYHA 4HYTA 1E20A 1ZSVA 4N8SA 4PIPA 5TE9A 1YDEA 2VH2A 4KK4A 2XQVA 3DV0A 2UYGA 4W5OA 3ICWA 5DRYA 1JDZA 1RJGA 2BZ0A 4PSUA 4R8MA 4V0QA 5I7UA 2DETA 4KR2A 3V8MA 5CITA 3M89A 1QZUA 1G6OA 1UMCB 1WCV1 2J9ZB 4M6WB 4OBEA 2ORED 3OO1A 2PWYA 4TS1A 5DM0A 3T5BA 1SKYB 5FPKA 1PFGA 1KO4A 1N1MA 1DXYA 1PN3A 2CJWB 1KVQA 4HH1A 2GZ3A 1GPKA 2IJGX 4PV7A 1I2AA 3RIGA 3EXFA 2W2LA 1IIBA 4I8DA 3VZPA 2B99A 2QAIA 3DZBA 3QEMA 4NBNA 3U3OA 5AKYA 4ZRNA 1PR4A 1K68A 4JT8A 4DG9A 2CFTA 2WSIA 2EW1A 5JJBA 3D3NA 1TJYA 1XZBA 2FX2A 5G1OA 1DO0A 1XCMA 2FEKA 3QSGA 4MGHA 2VPTA 5J4KA 4NYMR 4QUKA 4QQRA 2WKRA 3PLNA 1W34A 1A04A 1G3RA 1O7JA 4D0LB 4Q9IA 3AIIA 2RBGA 1KQGA 1RAAA 5FPTA 2A4KA 4G5RA 3AOEC 1YT5A 4YASA 3W2EA 4DMMA 4CKXA 3PTZA 2XB8A 4V2IA 5T6MA 2JFPA 3MPOA 5GVSA 2XT9A 2X0NA 2O54A 1ATZA 1SHLA 1E0JA 3ZBUA 4DCCA 5BN3B 3PI7A 4NFYA 5DLQC 4B6PA 4KKXB 2WU1A 2YHAA 4BAUA 4Q4DA 1ZHOA 3A1NA 3RUAA 1FF9A 2FN7A 2VNAA 1JEQA 4OY3A 4YDRA 3L84A 4B81A 1PSZA 1DRWA 3F7OA 5HGXA 1IONA 2WU4A 3I01A 4UTNA 1V3VA 1R5JA 2YHIB 3U48A 5KQSA 3NHWA 2Z2IA 4G89A 3SVZA 1GTRA 1Q1ZA 1YB4A 2AZTA 2CXNA 4LRYA 1XZMA 2G1PA 4I2VA 3A6JA 4Z4CA 3FA2A 1J0AA 4M1OA 2EU8A 3HUTA 3GT4A 2IDZA 4O25A 4FDMA 1Y37A 4HX2A 5T67A 2C5AA 1U0SY 2V5AA 3EJWA 4JU8A 3R5JA 4O4JB 1QRDA 1T1IA 2HT6A 4KO8A 3OPMA 2X4DA 2VCEA 3K0AB 5A9TA 1N6PA 1M0EA 3IBYA 4FHGA 2XB9A 2H16A 2YXBA 2RGCA 2BGRA 1W7AA 4QREA 4TUYA 5EJMA 3BJZA 2LE0A 4KO4S 3ZWWA 4NU0A 3JASA 2XLBA 2RHWA 2WF6A 4ER0A 3BF7A 4DDVA 3EIXA 4BNGA 1T2EA 4FOLA 1FTGA 1KVSA 3FCYA 3H3JA 4PAWA 2IH5A 3X1KA 1XEWX 1Y7IA 1YAHA 2ZJ2A 5FPQA 3AZQA 1ZIDA 3DZDA 2VDJA 4N3GA 1W5EA 3KJXA 2XITA 2JLZA 3KRTA 2R6GA 3IBSA 5FL3A 4FB4A 1YJAA 2DPLA 1A1SA 1WSDA 3VU9B 4YQZA 4ND8A 1Z33A 3JQGA 2C88A 4P53A 5REQA 3E18A 2FSUA 3MS4A 2AXNA 2PEZA 2HIAA 2B1IA 3WDKA 3EC1A 3C1OA 1K2WA 1KH3A 5BN5A 2ZRCA 4KBFA 1XZKA 2OM6A 3BULA 4RL4A 5DIFA 2HA3A 3I37X 4YTEA 1PW7A 4F85A 5CJPA 2F48A 3GUYA 2DVMA 1JVSA 2LV8A 5TQ2B 1OFIA 1X19A 4U6SA 4QAQA 5H70A 5BY2A 2NOAA 1PF7E 1S96A 5CD1A 3EEOA 4GOJA 3PNSA 1QCDA 4OHZA 1EGHA 1WW2A 4LCEA 1YC2A 4WN9B 3L7BA 2HL6A 3HR8A 4ZDJA 4B3GA 4KVZA 4KQ9A 5HKKD 5LYJF 4XUEA 3ZU2A 2ZYUX 3P4XA 5MGBA 2BBWA 1EWKA 2JFBA 3F1LA 3DTYA 4YP1A 4XSVA 4YLEA 3EVDA 3LJKA 721PA 4K0RA 1E4VA 2J46A 2NO7A 3IHKA 1V8OA 4KPUB 4W99A 1ZUWA 2M6KA 3IJ5A 2RGXA 4BLVA 2CJFA 1T5IA 4P08A 5BSUA 3RV4A 4DGSA 2AOTA 2NM0A 2G4CA 2R9VA 2P6MA 4YJGB 3R0JA 2C8KA 2AFIA 1WSBA 4WVLA 1FP2A 2QI9C 4P4NA 4U2EA 2AOVA 4EZIA 1R8JA 3QZUA 3FE2A 2XT6A 1UM8A 1XJ5A 5K99A 4MR9B 2GDZA 4PO3X 1T2VA 3PPYA 1P2TA 4EY5A 2OO5C 2R6HA 2MIIA 1JB1A 2V7UA 2Y6VA 1INLA 4L8FA 2VXCA 3U3JA 4BNZA 4CU2A 5KVAA 2REXB 2O8DB 1F20A 1FFSA 1P2DA 3K09A 3M4YA 5ENVA 2ZTHA 4JX9A 3QXJA 3NT4A 4AK9A 4QLAA 4BBPA 3HLKA 3PYMA 2PTGA 3FF4A 4LRXA 1UK9A 3NHSA 2YJ3A 3FHLA 5CFLA 1FS5A 4TL6A 2QLJA 1MCZA 4FN5A 1N5KA 1AVTA 2VDPB 2ZSJA 5AP9A 4J1NA 4ECAA 1ADGA 4DXDA 1DAHA 3I45A 3U81A 1RRKA 3GFGA 1KOLA 5E8RA 4W5TA 1SOVA 3UKJA 1C3EA 4QDXA 2FR8A 4DLZA 3WNZA 3OX1A 4FOOA 5F23A 3CCFA 4XZ3A 2VNKA 2X9GA 4KRXA 4MEBA 4XVRA 1BN6A 1Y6QA 5FUBA 2F7SA 1YL6A 3AEUA 3DHEA 2J3HA 1NVBA 2XYQA 5FNVF 3RRZA 2WWGA 2H2DA 4Q4AA 5THXA 1CDOA 1X9GA 3UGKA 1H0KA 3VSEA 4BO7A 2ZPUA 4D81A 2ICAA 1EX7A 1ZHHA 3T0IA 1E6EA 2GN4A 5L95A 1NJ8A 4FW9A 3A6KA 4CM4A 2FPRA 3KX2A 3UFXB 3WSWA 4J4BA 5H59A 2I33A 4AY2A 1FP7A 3PNKA 2ANBA 3C41J 3QPVA 4AM8A 3WIBA 5BV8A 4HDRA 3GW8A 1X2EA 1YA4A 2AHOA 3IEIA 3L0PA 4EJ0A 5I3CA 4C76A 1G64A 4DSZA 1NQWA 1RHRA 2B5VA 3CV3A 4EF5A 1J0BA 1AIPA 2QE7A 3JQ8A 2QZ9A 1OXVA 2JJYA 5JNUA 1KI7A 3PITA 4ZVOA 4BP3A 1O3YA 1EPUA 2JZNA 2FPIB 3B7GA 3KUUA 3VBCA 4RGQA 5ARBA 1C1XA 3MWDA 3RYCB 3DCNA 3MFQA 4H3VA 2GK4A 1BH6A 3T99A 1Q19A 3NBAA 1NDUA 1W85A 1K4KA 2WT8A 4RPIA 4A6DA 1F7UA 1UQRA 2BOVA 5AI8A 3RC2A 1JQDA 3QITA 3ZLBA 1XZ8A 5IX8A 4YRTA 3WXMA 1AA6A 4YJ2A 4UULA 1XRPA 4EI9A 1YA8A 3HSSA 5GINE 1QDEA 2X0EA 2FG6C 2B3DA 3VC2A 1SPXA 1UXKA 2H48A 4G81A 2HV9A 4XDYA 5J1SB 2OKCA 3V7YA 1BD4A 1U2DC 4MVJA 1LPBB 2JFHA 1JJBA 4K28A 4KXMA 4LX8A 1TVMA 1H2RS 5HDQA 3B2EA 1V7CA 1SB8A 1GGJA 3HUEA 3SU8A 4GI1A 1J5XA 1XCPA 1DBPA 4F38A 4IJQA 4YR9A 1Y6ZA 1YSCA 3VU9A 4L9RA 3ZXSA 1YKGA 2G28A 4QYSA 4PZYA 1UQTA 2X6RA 3GG9A 1RC1A 4UBOA 1SRQA 3LW7A 2A0YA 5DGXA 4QM7A 4UU0A 1JBKA 3PFIA 4P4SA 1NRIA 3W7VA 1CETA 1RADA 2ODPA 4FK8A 1VKHA 2GOYA 2QRNA 4PZCA 4PHGA 4B3DA 2QQ0A 4EHIA 3G8BA 1EZ1A 3LX5A 3G68A 1SUSA 1NXOA 4QD3A 2X1VA 3NONA 4Z8YA 5EEGA 1NOIA 2O0MA 5IARA 2WHXA 2Z2ZA 3LYHA 4PQFA 5TS3A 2X4GA 2R11A 3RSCA 5IMSA 3PVCA 4NZYA 5MN5A 3TXAA 1R50A 4OV6B 3OEEA 4MULA 1DAGA 1M1YE 3PE4A 4TV8B 3ZU6A 1NLZA 4LBWA 4EKNB 1T10A 3O4FA 1ZA2A 3D81A 3DKVA 3ML1A 1S3FA 2QV0A 4NPHA 4TMFA 4PLCA 4U0JA 4CLHA 4EHJA 1H6DA 1SCDA 2J0VA 2Q2VA 3IE2A 4IV5A 4RD1A 2QLFA 1JV2B 1Z83A 4QSHA 4WK0B 4KW7A 2QTRA 4FR5A 3C15C 3RVSA 1KAQA 5EJ2A 3R9XA 4OOFA 1YI0A 3IFSA 3Q12A 3FHCB 1N2BA 3BEDA 3C48A 2Q21A 3G88A 1IY1A 3WDLA 2QVXX 2I2XB 4A5SA 4L4SA 4OLFA 2QMUA 1BA3A 1DWUA 1M7GA 2FEXA 4IHQA 5EE1A 3EFOB 2IV7A 4ENVA 3VR3D 3AF4A 2CBZA 4LV6A 4CUZA 3TLYA 3S2FA 1A2BA 1DAFA 1GVHA 3NC4A 3MWGA 4HDSB 2W2VA 4IF6A 4MS1B 3PVSA 2NZ8A 3ENQA 3N8GA 4MR8A 2Q5OA 4K87A 4OIFA 4YAIA 3TIVA 2H9YA 2ID8A 5DJ5A 1C9DB 1B0AA 1NVEA 3ZD8A 2NAFA 2P4EA 4URZR 1XWWA 4X1YA 5DGIA 5ALKA 2EWVA 4IX9A 1MT0A 1D7AA 3AM4A 5DYYA 1GZ3A 2VFAA 4EA6A 5AKEA 3REQA 4A2PA 1MORA 4BO0A 4NY1A 2X6TA 4H7EA 5LA6A 1WHSB 3QF7A 2HMWA 4L85A 4CN9A 1ZIPA 3NMUF 1I51A 1B6GA 4MHTA 4RHFA 3DM9B 1MVLA 5IDYA 4BRSA 3DL2A 3GEHA 4BMPB 4LJKA 1H1DA 3QKSB 2OAP1 1IPFA 2Q3DA 3TZEA 1KIFA 4G0VA 1S02A 3JQFA 2NSYA 1TOAA 1E0SA 3EYAA 4PR0A 3SR3A 3ITKA 2XXJA 3L8HA 4YCNA 3FOEC 1GRCA 2QNIA 1UWKA 1C7QA 3O1JC 2RBKA 4YCAA 1EGAA 2IYWA 1E2DA 2XKAA 4GLOA 4QDZA 4O2RA 5K0SA 4I81A 1G7CA 2CYBA 4GMGA 4UOZA 1UODA 1O8CA 3Q8MA 2FH5B 4W1SA 5E3IA 3V55A 1U2GA 3LH5A 1QFZA 4D4IA 2AN1A 1BJKA 2Z5VA 1DO2A 1COWD 2NT4A 2G83A 3HLYA 3UJCA 4KOEC 5BWNA 2Q1UA 1Z4PX 4TROA 1R0BA 3H8WA 4KR6A 1N5RA 2GI4A 1MJGM 4O59O 1KS2A 4MRVA 3EZ2A 1YZYA 4CNBA 4MOWA 1B14A 5CA1B 3Q3EA 2Y4NA 2OQVA 4AFNA 3WBBA 4DQDA 4B8ZA 2FP3A 1DXHA 1UBGA 2VC2B 3IT0A 2ODNA 2IEGA 2ORIA 3WAJA 3LLVA 2WINI 3KUXA 4PIMA 4XVHA 4L51A 2DRIA 2QYSA 4MUXA 3IIJA 4A92A 3EQ2A 4JGGA 1R2QA 1S7CA 3NHYA 4EIWA 4TLAA 5EIWA 3GRKA 3PGVA 1O77A 2QPAA 2NP7A 5TT1A 3HA3A 1WCIB 1A9SA 2JJ1D 3RAJA 3VDQA 1V16A 1IRIA 3KTOA 3N74A 1C9NA 4QVGA 4EAAA 3ET4A 3CF6R 2JDID 2KX7A 3G17A 2QIOA 2JGIA 4OGFA 5CVEA 2GZ1A 1R12A 5EOVA 3LC1O 2NZUG 2VPYA 1JKFA 2B1RA 2BEJA 4OP1A 4YRCA 2XADA 2O07A 3KZXA 4GYJA 4BFUA 2O3QA 4LWOA 1RQPA 5A4JA 3U4AA 4CMBA 3WQSB 3F3YA 4CMAA 1O89A 4KGZA 2CN1A 3P9XA 4YP5A 3S7TA 4IJUA 3L7NA 5B1SA 4QBHA 1B0UA 1TLLA 3LS2A 3RARA 2DR2A 3VKUA 1N2XA 1R7RA 3CPSA 3HUFA 2LUOA 2FA9A 1ZCZA 4PWZA 3IDQA 1E0AA 5HS6A 3ND6A 4AF6A 1NT2A 4XLLA 3G0HA 4QOGA 5BYAA 1GIAA 1J2RA 3LY5A 4KI0A 5I9SA 3RRYA 3HJCA 1N7HA 2OK8A 3TOSA 1CUDA 3OKPA 4HUQA 2P2LA 5EP3A 1PU2A 2OV1A 3GJ0A 1AZWA 1E9AA 1RVDA 2VOJA 1E8DA 2RKBA 5P21A 3ZS9A 5IAGA 4PNPA 1I0IA 1VPEA 2ZROA 1YZTA 1UBLS 2PKQO 2VJMA 3FHJA 1A9PA 1YTLA 3LVQE 3BL6A 4GLJA 4H0CA 4JL8A 5ERYA 1MUUA 2ENWA 3VAZA 4CFYA 1SA0B 4CDMA 1DG1G 4KE6A 5SICE 4TS3A 4QZVA 5GTDA 3N28A 3WHPA 4JP3A 4Q7EA 3EPHA 1O5IA 1J2EA 1Y3DE 3IPCA 3QYJA 2PAAA 4G1FA 2IU0A 3TO5A 1QE5A 4DHWA 2QA5A 2FWMX 3RYHA 4G5QA 3PX3A 4KGXA 1Q57A 2Z04A 5GIPE 2QU8A 1T5LA 2IWRA 3I1IA 1UM9B 4JYCA 1EUCB 2SKEA 2GCIA 1DRUA 3IMGA 2GAOA 3KU4A 4AZTA 2G08A 1CHDA 1XP5A 2LKCA 3FJOA 3PDJA 3EMDA 3JTMA 4M83A 4UPDA 5HE8A 3GJTA 3ZDEA 4FYWA 2HGZA 1WM1A 4GVLA 3W77A 1KFEB 2EZTA 1GTJ1 2PMBA 3AKDA 2WZBA 3CJTA 5JNWA 2BFMA 3EGXA 3WQRA 3D54D 3UICA 3UGJA 2AUMA 4YJHB 2ZUUA 4FEAA 1J9EA 2ZRBA 4ZOAA 5G40A 1V39A 3WL6A 1FZQA 4EHDA 3WNBA 1A72A 2PAFA 4NG4A 4U2CA 1WV1A 1TW3A 2C9YA 3F7MA 3LGAA 1YACA 1CEYA 4BJ3A 1QE3A 1RWVA 2YNMD 1JAXA 3NHJA 4DQLA 1RTKA 1WUTA 3A9UA 5FYQA 5DEIA 3VNSA 1YS4A 3I0ZA 1K5HA 3FUCA 4O08A 5DW3A 3CRQA 1E4EB 2KYRA 4WW0A 2A1IA 3B2QA 3W2FA 3RHTA 4KN8A 5B7QA 5AKKA 3QBDA 1AH2A 1FNCA 1GGHA 1VXOA 4G4SP 1OBCA 4NH4A 1UWCA 4Z9AA 2AG5A 1R8QA 2YH2A 2OBLA 1S3IA 2ILTA 4BZWA 5KNCH 2Z5GA 2A33A 2FSGA 3CVOA 3TI9A 1H1TA 1OKKA 3OD1A 4MQEB 4ETWA 5C5CA 1X80B 3JYNA 3MQ4A 2CC2A 3GPDG 4JLDA 1WVGA 5AI6A 4CV2A 2DG2A 2WSYB 2YRXA 3OJWA 3QOXA 4XCQA 3RVPA 2HNBA 2NQ2C 1WXWA 2VHEA 2W9XA 1MOQA 3PS9A 1SUBA 3E9NA 4XOUA 1CQWA 4FEGA 1ZGBA 4XLZA 4ZAXA 4EY4A 1E98A 2V6IA 1KK1A 2FDRA 2M9MA 3PUIA 4B2PA 1P33A 3RADC 3PXGA 1D6NA 3TSOA 4DJJA 1XZJA 3E9QA 1NI4A 2ZRLA 1LNSA 3IAXA 1SEVA 1ZVQA 2IYNA 3DE7X 2RHTA 3WK4A 4DHEA 2Q3FA 1K5GA 1LVUA 2AFHB 1NBHA 1GNPA 2QX6A 4OHMA 4QL3A 1SCJA 2RONA 4TTQA 4RV4A 4KXNA 5AM2A 2G76A 2HPVA 3RS8A 2OCKA 2HU8A 3Q41A 4OQNA 4CQJA 1QQ5A 5B3LA 1EFAA 2ZDGA 1VIMA 3BRWA 4BMOB 3PRHA 4DCNA 2A9JA 3TTVA 1QAOA 2JIPA 4AG5A 2IW1A 3K1TA 3O8QB 1DKLA 1E2LA 1M74A 2DTDA 2OZVA 3K6RA 4QRIA 5FWYB 3EXEB 3NM6B 5IJAA 421PA 5BORA 2HHAA 2R6R1 4Q24A 3ZDFA 4MVCA 3K96A 3ETEA 2D2EA 2OXFA 3BIWA 3H5OA 4CIAA 5FH9A 3OEWA 1T6BY 4J7CA 1J25A 1COZA 1QK5A 2A9OA 3ETCA 3Q3IA 1BWQA 2KMLA 2VRCD 3PWKA 4IXWA 3VR2A 3AJ9A 3E2MA 1GG5A 1W87A 3G0GA 3IT1A 2ZQYA 3PHJA 4ERXA 3E3LA 2B5OA 4CEHA 1RAEA 1P9LA 1U1EA 1K6XA 4NEHB 4B8WA 1QC5A 3O4IA 2FAXA 3E22A 4RCZA 5AHOA 2XKBA 1RYDA 2BFBB 4DIDA 5LP6B 2EFEB 4CFZA 3QE4A 2B61A 4I4CA 3SLKA 3BRCA 3OE7A 3ZUPA 2V7EA 3IO5A 1PDWA 1QQ7A 2VIIA 2D1FA 3H11B 2VO1A 3G8AA 1D04A 4PYKA 5FPHA 2FF5A 2IYTA 2FUKA 3CW2A 2VHZA 2PH1A 3T7SA 4NCXA 4LKOA 2D3TA 3VHQA 5ECDA 3IQZA 1I6KA 3F3SA 2Z3VA 1Y3FE 1YZLA 2G9QA 1DEKA 1OI2A 2BE9A 2GPYA 2X19A 3AO0B 2NUTA 3RKRA 2PZFA 1W5FA 3L92A 3WP1B 4NQZA 2IX3A 4AMYA 3W3AA 5FOVA 2JLXA 2CNLA 4BNXA 2UYYA 3CMCO 1LNQA 1JEJA 1ECBA 4Q1DA 3IKVA 5HTOA 3AFMA 4RPHA 3ED5A 3L41A 1VJRA 3OPXA 3PX2A 3ITNA 4IILA 2CFOA 1E3QA 4UU8A 3U4DA 1AQLA 4G0PA 4L0QA 4DQKA 3SC4A 3Q2KA 4ETNA 4DBVO 2FV8A 1I2MA 3NJ4A 3NV9A 4DRXA 1US8B 5LD2B 5CBPA 1A1VA 2F90A 1KL7A 1CZKA 1F0PA 1YKFA 5K3CA 4RNDB 3GP5A 1X92A 3HBLA 3N6VA 1E1YA 2Y0BA 3FI0A 4LWQA 4PLFA 4P4LA 4DCPA 4G0WA 5B6JA 2VP4A 4H9GA 4LE1A 3C70A 4CR6A 4F4UA 3FM9A 3C6YA 2F8MA 1E7SA 3DXZA 4US1R 1D8AA 2G0TA 3R0QA 1E1DA 2HRBA 3NHBA 4OH7A 2WJGA 1G8KA 4YJ3B 1VMKA 1J33A 1UH5A 2AMJA 2GERA 2H31A 2D4AA 3OTGA 2C2ZA 1I1OA 1KE2A 4AXXA 4ARUA 4BKUA 3CZ5A 2H11A 5T4BA 3QY9A 3GROA 3AQIA 3RH0A 3NHRA 2XMCA 3MB8A 3FCSB 4C2BA 2IUUA 4QULA 4UXJA 5AIAA 3PUKA 5ITSA 2FHPA 4UAGA 1C3XA 3KT3A 4Q3AA 3ZE6A 4LNUB 3K9BA 4LZZA 2ZIEA 3RSHA 3B7WA 3EULA 1X9HA 2Z4TA 2WWRA 3EVTA 5CB4F 4QPJC 3VNAA 2IRWA 4C4SA 4CIDA 4DLVA 4DREA 1EFRA 4M1EA 1Z6AA 2RIRA 2I66A 4NYJQ 1SIBE 4N03A 5DNWA 1EXWA 3MPUA 1MIOA 3H5IA 3PQ4A 4IFBA 1RABA 3ZWQA 3ZK7A 1JHRA 1GKUB 1HE5A 3MJSA 4LRWA 4ZEXA 3ZHOA 1A7UA 1P9OA 1ZW6A 3I5YA 1QBGA 1SAYA 5JAOA 3RQSA 1FYFA 1KEZA 3MGAA 1V37A 1CB0A 1G7SA 5EXTA 4J3FA 4WK4B 3KETA 1OBFO 1YF3A 5CCXA 2IP4A 4H08A 4PNZA 1RS0A 5E9WA 4QBTA 4RD0A 2C5FA 4Q1EA 4X8OA 1E66A 2B36A 3FXAA 1V8DA 3VV3A 3E2PA 3FZNA 2PN1A 4IQFA 3OEHD 3E4DA 1W19A 2P6OA 1VL2A 1NSTA 2E0IA 1DRVA 2FKAA 3DYIA 1XP8A 2IP1A 4AO6A 4HI0E 5C8YF 4Q9JA 2JGKA 4FFRA 5J2UB 1OB5A 1DFIA 2PMEA 2ZJ5A 5F1KA 5CDUA 4KIUA 5IZ4A 2XNDA 3NH6A 4OO3A 2AF4C 3Q7PA 4UFPA 2R85A 1KO7A 2AF3C 2PX8A 3EIOA 1IN7A 5EHZA 1CW2B 3PHLA 3KQPA 4MYDA 2PUAA 4LEIA 5EKSA 3AR7A 3RVNA 1ST2A 2EG9A 5DGDA 4YRZA 4HWRA 4HV4A 2ZAMA 4PO8A 2BRUA 4LKRA 4PZAA 3LKBA 1DT5A 2CFCA 3UK2A 3LM8A 1IB0A 3EG9B 1QXSA 4N82A 3V8BA 1IBSA 3HR4A 4ZQGA 4BB0A 3HS3A 1GR0A 1VMIA 4GI3A 3R1IA 4KR0A 3ZWNA 1CNEA 1WMFA 1PL0A 3LT0A 4FSDA 4UBIA 3UOAB 4F4JA 1P74A 2ZG6A 1VKJA 1G21A 1FX1A 1Z73A 2A5FA 4NBRA 3AR9A 3HJBA 3CISA 4KOAA 5FWXA 5A1JA 4HLNA 5EMMA 3OIWA 4K6FA 4KLZA 3LQFA 1M2VB 1YVRA 4OSEA 1Y8QA 3E5MA 4NCHA 2O5VA 3NM4A 1CTQA 1KAGA 1JXOA 4BB6A 2W6MA 3PDIA 4JSTA 4NYIQ 4P3KA 4PQYA 4Q02A 3WL5A 3WLSA 3N2KA 5SYAA 4PWYA 1CUYA 2VDNB 3VR6H 2DKFA 4KR3A 1GAEO 2ZU0C 3E0XA 1EG2A 2D54A 1L1EA 1NMXA 3F6BX 5LNK1 1CULC 3ILSA 3MN1A 4YRPA 1AY0A 1QTNA 5HIKA 4U63A 3FOFC 4RTOA 1NOKA 5K6AC 1Z8DA 2OG1A 4YVFA 3JD1A 3F5QA 3UJ7A 3VNBA 2PUCA 1U1DA 4PN7A 4C22A 4WZBA 5KYXA 2JIBA 3I6ZA 3R24A 4B45A 3SS8A 1YHNA 2W71A 3KBBA 4ZI7B 1QB8A 2PKRA 3FG9A 4O2LA 2IPNA 2DERA 3E70C 4JLAA 4NBVA 1VL8A 2BISA 2NV0A 3QUCA 4BKRA 1CCWA 1UMCA 1J09A 1H9AA 3IPYA 2HRDA 2NTYC 3IH5A 5HQ3B 13PKA 3WKCA 3OQMA 3FUTA 1T4DA 1G6KA 4ZI3A 3BH6A 4L5JA 2WHPB 1Z4KA 3DZJA 1PJLA 1SQSA 4Q47A 4F3YA 1UC4B 2RCNA 4JOCA 5A5GA 2PJRA 2G5TA 2ZOSA 3LUHA 3E5NA 3UJ6A 3SF8B 1T4BA 1W73A 3GJ8A 1GCUA 4QC2A 2C5SA 5I8ZA 4MS4B 5JBIA 1QOQB 3KYBA 1HTBA 3PQ8A 5G4KA 3S2GA 3IYLW 3CVUA 5CG1A 2QVBA 2IYPA 1KQPA 3LYUA 4B76A 3SQWA 2W6ZA 1Z5OA 2W2TA 2UVPB 1DX9A 4TGLA 1IQ0A 1OGJA 1ZBQA 3G0DA 4FNGA 1I36A 4AZ3A 4PO9A 3UJ9A 1D9XA 2KJQA 2PS9A 2OHVA 5C7OO 4L4UA 1JFTA 3L8DA 3H5LA 2CVPA 1S9DA 5BV2P 4TQAA 1CE8A 1TUEA 1TK9A 1E2GA 2QX8A 2YS7A 4KXQA 4RF2A 4D43A 4DBLE 2PUJA 1CQJA 3K6JA 5BSTA 1XFAA 4KE7A 2VPPA 2CZGA 2IDKA 3D2CA 3WRYC 4EWLA 4WOJA 4CEJA 3TB4A 1N6LA 3FD8A 3KNZA 3O4JA 3VV2A 1MX3A 4TTIA 1U90A 1PEDA 1XRQA 3DQQA 3N58A 2QSUA 1MTOA 4WXRA 5CAEA 2HJHA 2V7TA 3JU3A 1WETA 1YQEA 3BIXA 1IZ0A 1EP1B 5U4XA 2I2BA 3V6LA 1KWKA 3U5TA 2EX1A 1PQWA 3EZFA 3O74A 4QHTA 4KQCA 4OU5A 3TOZA 4HUJA 3PXEA 1FW6A 5CTAA 4O3FA 3AVOA 3OY2A 3QVVA 3RC3A 3OZXA 4P6VF 1Z2PX 7ABPA 1NVVR 1NXVA 2HK9A 1LRJA 3IHLA 4FNOA 4Q5IA 1U31A 3TVYA 3DVLA 1E3LA 2H1WA 4CKBB 3SEQA 4AKTA 1YJBA 4N3BA 4X20B 4PX2A 2J9GA 4M9XA 1JHVA 4TYPA 4CEIB 5CNKA 1O95C 2IYFA 4NJEA 4QXMA 3QVSA 3ORRA 4DY6A 4DBLC 5LPNA 3UJNA 2FW0A 2WB2A 5K4AA 3L1JA 1ZHFA 3EDQA 2RGAA 4KXFB 5ALWA 1YJXA 4WKGA 3WMWA 5LZ2A 2XUQA 4HDMB 3MHPA 4G6ZA 2OSBA 5F2KA 2UXBB 4OQLA 5DHTA 4LZPA 4MUJA 1EQAA 2WIBA 3ROQA 5AXCA 4EQZA 3TIIA 1P3DA 3NTVA 3IAS1 4PNEA 1PK8A 2PX2A 1PTJC 3R3JA 4J43A 4ITVA 1YI1A 3HABA 4QPCA 1Z75A 5EG5A 2TRSB 3FIUA 3GEMA 2FWIA 3BB4A 4X7RA 5GIOE 1GDTA 2I65A 3GNTA 3VUEA 3FOZA 2PUVA 4GX0A 3UMBA 1T9HA 4ZREA 4JXXA 3ECSA 4TWAA 4P0PB 5HCUA 2WU8A 4J2TA 1YL7A 2JBWA 2O7SA 3WQHA 3CE6A 3UJAA 1N6NA 4JI4B 4ITRC 4UM9B 4C6TB 1II8A 1SCNE 4GXRA 3ZGZA 4AQ7A 4GT1A 4JA0A 2GEUA 3ZE8A 4XEHA 2FFQA 4FJ2A 1Z38A 1NI3A 2V03A 5HJ5A 3ILVA 3OIUA 2BI4A 3CZQA 3Q11A 3RO7A 5EJ4A 2X23A 3RVJA 2HQRA 1XEXA 1CY6A 4H1WA 5K0CA 1G3MA 1R6DA 2WVHA 4UDYX 2PK3A 5D5PA 4C4ZA 3PU6A 4LF6B 5DX8A 1LX6A 3GLRA 2ZJBA 3JQCA 3GLIA 3I3SR 4U9IS 4E5UA 1M83A 1NC3A 3EBPA 2ZYVX 2HRCA 3FZQA 3G7NA 3R41A 4P58A 1CYDA 4S2UA 3WL7A 2WEKA 3VPFA 5IM5A 2ZYTX 3KXLA 4ZYVA 3H2BA 5JIBA 5GJCA 2C94A 4TSFD 1G6Q1 2XSZA 1V3QE 1YRHA 4Q05A 5K3BA 3FJYA 1FFEA 2O8EB 1A5BB 1FXWA 1AX9A 3QQPA 4MR9A 2P9TA 2Q4RA 1T0BA 3CNQS 1MOSA 7MHTA 3PHIA 2R1TA 2WFLB 3FWNA 4TXHA 5FOWA 4DG8A 1RKXA 4TTAA 3QEKA 3N86A 2F1RA 2CUNA 4G4JA 4MPPA 1JZQA 4EI7A 4WUVA 1YQWA 1V4BA 2R8PA 3PR2B 5DDIP 1QHXA 5AJYA 1WP9A 4PBRA 2I8CA 5DTQA 5IAKA 5LJIA 1WBJB 3U56A 2QX4A 2RG1A 1DTWA 3BQNB 1BOFA 1V1MB 2CHFA 2ZI9A 3AESA 3EVCA 1U0OC 2QR3A 3NDRA 5F4ZA 5CXQA 1PFKA 3L77A 1GNRA 2P77A 3NHZA 5KIAA 2GJSA 3NRCA 1HDZA 5A0FA 3T7TA 3WNCA 1ZD4A 2C8LA 4FS8A 1HDEA 2V45A 3AFGA 3L1UA 1SKBA 4RY9A 1E0DA 1T4GA 2XDYA 3FHTA 1LW7A 2ZUSA 5CLHA 2YYZA 3K20A 2WJ4A 4FUTA 3KLMX 1DLJA 4RO0A 4TM7A 8AT1A 2OL4A 2JK1A 1WXDA 1RAIA 3A4MA 1ZK4A 3CUEF 2HD4A 3AR4A 2XV1A 1PV1A 4XYEA 3RU7A 4DV1B 5ELXA 5F3WB 3LVBA 1JKJB 4QDOA 4RKEA 4JCCA 5HK9A 2VPWA 3DCYA 3L9XA 1E9CA 2OC9A 3JARB 4XR4A 4URVR 1E5DA 3H2YA 2GHRA 1Y5NA 1K4MA 1A88A 1NQXA 4Y2SA 1N9GA 1P4RA 1RC0A 8LDHA 1NRXA 1PKEA 1X1DA 5CDTA 2FFRA 2C61A 2I99A 4I6EA 5MF6A 1MAVA 3HDJA 1T1GA 1TAGA 2B6NA 2LXNA 1QRAA 3JD0A 3UJBA 1HQYE 3U9LA 4BN4A 1MABB 4MS3B 1USKA 1W49A 1BHQ1 5DK4A 2E87A 4BBZA 3QPUA 2NNWB 5E7MA 3DXFA 4B31A 4IYJA 2QAGC 2SICE 4R3WA 2BR3A 2PKQP 4LGCA 4W9NC 3NHAA 2ZWOA 3GDWA 1QO0D 2VDUE 5IN5A 4ND2A 3P0RA 4IKEA 2CVFA 1T5TA 2NXJA 1YI8A 4YC7A 5U4QA 4EB0A 1JILA 3PA6A 5KQLA 2ONKA 1N0HA 4PM4A 1UJ5A 5H83A 1IOWA 1PJZA 3GI1A 1CVIA 5IJWA 2QI9F 2VJYA 1QIGA 2C29D 3N0TA 5JCOC 2Y1KA 4HRXA 4CIVA 3M34A 1OHHA 1XZGA 2HM7A 2NO9A 3QVOA 1EFKA 4NFSA 5T5QA 1X1RA 1HLGA 2AYYA 5EJ6A 4HN9A 1JNYA 1T8UA 1FVFA 2QTTA 1KJ8A 3F3KA 3HV2A 3I12A 4WERA 2UYQA 3Q15C 1RFLA 3TD9A 2PKXA 2QTVA 5EWLB 4HAWA 4OQDA 3G2QA 3ZGOA 4DIFA 1FSZA 3L1IA 4NXNB 1XALA 3H4MA 4FMCF 4OXKA 1X13A 1X6VA 4RANA 3UAZA 5IFLA 1H3EA 3NBFA 2DQKA 1WTAA 1JA1A 4PZDA 2R8YA 4ZT6A 5KC8A 4BFVA 4MARA 1C8VB 1D3AA 2Q8PA 3CXUA 3W34A 1NFQA 2GARA 3RQIA 1NF9A 1O94C 4Q9KA 1SVMA 2QK4A 3DFFA 1XZLA 4XB2A 3N87A 3GGOA 3BE8A 4ZEVA 3DLHA 3ZZNA 1EH5A 2GYWA 5HDBB 1CSEE 5BUZA 4EP1A 2A9PA 4TMKA 1YQ9A 2FE4A 5JYEA 3JR3A 1FS4A 5M5BA 3STHA 3DV2A 1LF0A 3ZJUA 4CM7A 1SU6A 1YJ8A 2VYQA 4S1OA 4ZOCA 4QU8A 5K8TA 1Q3TA 3BWCA 2QZ4A 2ZJ1A 2DBQA 3OZTA 2JGRA 4PVCA 4GWKA 1GZ6A 1SZDA 2ZM5A 2RGGA 1K08A 2HI0A 2XQIA 3HXTA 2NGRA 1JFFA 2IEZA 4RXMA 5AVSA 3BMXA 3FYUC 4QFCA 5JJKA 2GF0A 4UNPA 3RRMA 1W0KA 3TB6A 3O0DA 1Q1AA 1AGYA 2PYIA 1C9EA 3AJAA 3AJDA 1KWGA 3HUDA 2DKOA 4X85A 5PNTA 1NDHA 3NC0C 2WJIA 4Q3OA 1OZAA 2R751 5CX1B 4J3NA 3SEFA 5K05A 1E3MA 2Z6VA 4LISA 4B6QA 1BFDA 1ZYUA 4BRZA 2H3EA 3HI4A 4TTVA 3L05A 3U13A 5H0IA 1NAHA 2WG2A 2WAOA 1Q6ZA 4BCCA 2WIGA 4L5AA 2P2YA 8ADHA 4K8RB 4PG7A 1EFCA 1QG6A 2WPDD 1VJTA 4YH1A 1SHJA 1WHSA 4A23A 1U5BA 5KUTA 2O5CA 3B1VA 3FCOA 5BUCA 2WTEA 1HSOA 3IAHA 4Y6RA 1Q83A 1O0SA 4WBXC 1MKYA 5BMVB 1GUBA 1PR0A 3LRTA 4EX7A 4PCUA 2PT5A 3IEKA 1PX2A 4DUYB 1EXDA 2QRQA 1QIKA 3DMTA 3DBLB 4JVSB 1EXNA 1TJ5A 1HKHA 5DK6A 4EUHA 2ZWMA 3DEZA 3IUYA 2H65A 1T5BA 2IYYA 2GBLC 3PGMA 2WWXA 1UPTA 2C2WA 4AECA 5KNDD 3U4MA 1G42A 2MMGA 1RQ7A 3LDGA 3VR4D 1B3BA 5BURA 3TAHA 1O97C 5FNVB 4YIHA 3ZJTA 1QLJA 3SNHA 1PQ4A 4Y0VA 2O3JA 1S7GA 4D9NA 3DD5A 4C2UA 4QO8A 2NXEA 5UKDA 2Q1TA 2IDJA 2RHMA 4Q3BA 3EEQA 1E7YA 1VIAA 3B5EA 1X1QA 4S2EA 4KN9S 1TZJA 1H22A 2GAFA 3FSGA 4K7JA 2AJBA 2HCJB 5AW2A 2RD2A 2WJPA 4CPDA 2AMLA 3M6XA 3A06A 4C7VA 4OG2A 5H9WA 10MHA 1ECLA 3O2SB 4OM8A 3GMSA 2X3UA 2VDKB 1BQ3A 4C4PA 4QJ3A 2P68A 2HO5A 1U8AA 3D4LA 4PQEA 2AQKA 3A9WA 3T9CA 3VR5A 1E5QA 3G2LA 4HWSA 3SLGA 1OX5A 1SUPA 1DWPA 1L1FA 1WCIA 5JSUA 3MTEA 3SLRA 4L02A 1QANA 1AUXA 4GWGA 3CLSD 5CT6A 3L0DA 5JVDF 2A94A 2FJUA 1OOEA 2X9QA 4QIHA 3J81k 1JYSA 1YFLA 4UAJA 4BO5A 1KORA 1T2UA 2GBFA 3F6RA 4XQEA 1CNMA 4UCQA 1M75A 3FPKA 3TG8A 1WD5A 1A2KC 1ZUHA 5GM2A 3S2SA 1OBOA 3T1OA 4R4JA 2WU3A 3S29A 2EAUA 2HNKA 3KTAA 3CRRA 1UPUA 1IBKB 2HN9A 1QM5A 3DC7A 1OLUA 3AG5A 3F4KA 4AQDA 2B5WA 1VBFA 2HSGA 2L17A 4MKFA 3TQCA 3MCVA 1HE3A 1KZ9A 2CY0A 1G19A 1ZPDA 1XZNA 3CLUD 3LRXA 4GI5A 2FSSA 3Q9LA 5FEUA 1X70A 2FPMA 3O9ZA 3H87A 3U6BA 1GYRA 3SKYA 2ETVA 2H4ZA 2Q0XA 3GJRA 3F9IA 4I1SA 4JBWA 5D00A 1BQ4A 2P91A 3S2YA 3ZHQA 4E5PA 3LCUA 4H3HB 4Q19A 3HEBA 2J45A 3HUUA 4TLCA 1CFJA 4QTZA 1KSGA 3LLCA 1HG1A 1JJVA 1KAHA 4HGQA 1WCYA 1HC7A 1P29A 3G2JA 4IHJF 3UWMA 4QA9A 1EDDA 2VQ3A 1RM3A 1EX6A 1N6IA 1Z0DA 2JI7A 2BFOA 2FMXA 3NT2A 1VXRA 5DNCA 1P5RA 1VI2A 4AWXA 4B48A 4DPLA 1MX1A 4OH1A 2BP7B 4JT2A 2FN3A 1GTL1 1AN9A 1P7PA 2Q29A 5KNBD 3FUVA 1Z6TA 4P5EA 2AOWA 2EF0A 2FPLA 1DJNA 1OPXA 2A1UA 2YX1A 1N2CE 3CH4B 4P84A 4BC1A 2NLOA 1Z06A 1WY5A 4U3JB 1UM9A 4EG4A 1WUKS 4Z7OB 4EMUA 3GH3A 2OMEA 1OYWA 3HNRA 1L5RA 3A6GA 4RK5A 3AUYA 5HX7A 1KTIA 1CR4A 4HSGA 1SJ9A 2CCKA 1FFXB 3C6QA 3OPYB 3DKPA 1M6VB 4ZVKA 4NNJA 5TR9A 2NU8A 4BU1A 1NW6A 2FG5A 2VH5R 1R0SA 4D45A 1RJWA 3RV3A 4ZTZB 3LKVA 4RVGA 4UCFA 1GU7A 2P5TB 3QTTA 1ISGA 2XAUA 4LXTA 5CNIA 1BVYF 3MAGA 4INZA 3BGOS 4YJHA 1Q7RA 1L8QA 2QLNA 4OHPA 5BSGA 4QYTA 2E49A 1JZSA 9ABPA 1E7WA 3R77A 5AW6A 2V8OA 4BQEA 2O8CB 2M6SA 3TIGA 3TRJA 2RCYA 1T43A 1IHXA 1SKUA 1N2ZA 3M6LA 4TN5A 4CI9A 4X3OA 3RG8A 2WIFA 4RM3A 3CEMA 4JJKA 4YV1A 4PG4A 4ZHSA 4J4TA 4MW4A 4B0PA 5JSZA 4K9MA 4OBXA 3ZKWB 1EJ2A 2C2XA 2FOIA 2ZTMA 4RV5A 4PGMA 1NVUQ 1ILWA 1HTTA 5KOIA 3EX7C 2FUCA 4CF3A 1ONOA 1Y8RA 5F2OA 2G70A 3V7UA 4ZO9A 4D4HA 5K09A 3D7MA 1M2KA 4IUYA 5CK4A 2PD4A 4LJ5A 2W6QA 3QI2A 2LD4A 2YZ7A 3ZIDA 3KCQA 3UTCA 2QQFA 4DARA 3C97A 1JQLB 1X1EA 5IAOA 1CS0A 4E0BA 1A5TA 1D0VA 1C7ZA 3IC5A 2AC7A 3ITDA 3V34A 1BW9A 1J20A 5EPEA 1Q3KA 1I4EB 3D4PA 2WYWA 4OQZA 3WIVA 1DRKA 4FDUA 1KY3A 1C2TA 4I5EA 3TQSA 3BE6A 2F3PA 3KWJA 5B4VA 3DFKA 1JHQA 4KHZA 5KTPA 2PH7A 2GBCA 4JWTA 3JR7A 4WDRA 1CP3A 5LU8A 2REBA 1I3OA 2JKZA 3JQQA 1CUUA 5EJ7A 2CFIA 1IN1A 1I5EA 2XA2A 1NLYA 3DWEX 3IKMB 2AG8A 2AFHA 4KRYA 5HKKA 3KSMA 4RJ2A 3TH5A 1RQLA 2FFBA 3DDSA 2I78A 1UJ6A 3UUGA 3WL4A 4FT4A 1PSDA 5ELLA 3UHPA 4OQPA 1SBHA 4P33A 4PZUA 3R8XA 2RHLA 4KQEA 3GVHA 1R0RE 3GFQA 3S1LA 4BZPA 1VHLA 4N65A 5FKJA 4HYEA 1G9SA 2D13A 5B57C 3K6SA 4Z49A 4AYWA 3A04A 4TYYA 4GPEA 3HDTA 4FSXA 2DZDA 2J67A 1XL0A 2VLBA 2BONA 1RAHA 2ZBQA 5E9QA 4ZEMA 3NHLA 4S1WA 2DWCA 1GPDG 5D7BA 3RS4A 4CLDA 1S1CA 3SJUA 4DEXA 1V41E 2XBLA 2J0QA 1G60A 4A1OA 2QP3A 4KTVE 3VQTA 4HDKB 1OFHA 3NP7A 5BSWA 3RGWS 1NBOA 3U1TA 1OVMA 3ODGA 3S7ZA 3C85A 3ZGNA 1M3SA 4D99A 1H0SA 1XQ6A 1W30A 2PGOA 2ODBA 3M3PA 1JU3A 3BHJA 4FGZA 3J80A 4ZCRA 3IEXA 1ZJJA 2X58A 4R9SA 2V97A 4MYRA 4U7DA 5A4IS 3NOQA 1U2ZA 3ESCA 4PHTA 2CKDA 1CZUA 1KSFX 5TX7A 5AW8A 2HJWA 2OGSA 4XD7D 4H18A 3U6KA 4AP6A 4XFKA 2C0PA 4Y6LA 1W6RA 4HJRA 4ZJZA 1IWPB 4CVNA 2OFOA 4I4TA 2FMHA 2YXNA 1IJBA 2DEUA 4JYAB 1IQPA 3SM3A 3AR6A 5JYCA 4B8YA 4QYMA 2CHEA 2QD1A 3A05A 3IKJA 4M99A 3Q2IA 1I2BA 1UDWA 5AUOB 2ONZA 2RE8A 3MMZA 2W2KA 4M89A 3EGCA 3GLFA 1OE0A 1YQTA 1F0KA 1K8RA 4LTNA 4M88A 3ZY6A 1SY7A 2BC9A 1ITZA 3LUJA 5K0GA 5JDIA 2VTBA 5ALUA 4RPLA 2B8WA 3IOYA 4YO8A 1RYNA 4FHCA 3RASA 2ZE8A 3HH8A 4LDAA 1RHUA 5DISB 1O6BA 1E2NA 3MINA 3EGOA 1G8YA 4MUAA 3A2LA 4PAGA 5M7EA 4V0OA 2P5YA 3PKIA 1G21E 3QVGB 1ESNA 3L82B 1NR1A 3FGNA 3WRWA 2JGEA 1IM2A 3WISA 3RS0A 4P2BA 5AOCA 1DVRA 1L3BA 4FMBB 4UTPA 5MFPA 2GFHA 2V65A 2O0JA 3ADOA 2IV2X 2Y4OA 3T3NA 2P40A 2IKSA 4QOIA 5DCWA 2O2EA 3AKEA 3EA0A 5JWOA 1PYOA 3F2VA 3PC8A 5CDFA 3VH2A 3W06A 5FNZA 2VP5A 2ZJ7A 1WHTB 1QYCA 5JI2E 1R4MB 3NBMA 5DF1A 3BRQA 1PQUA 3H05A 3OF2A 4LZNA 5B58C 4L6AA 3CZCA 4GC9A 4NTZA 1Z6ZA 3O8NA 2O1WA 2C2KA 1ZGZA 3G82C 5FBKA 4F93B 4JGIA 3AUKA 3OJXA 4FBMA 5K3DA 1A4UA 3EAFA 1HORA 3KC2A 4MB6A 2ATXA 4W6ZA 3RNLA 2I7TA 5B3JC 5LNK6 5D1NA 1MF7A 1K9SA 1W88B 5DI9A 4OP2A 3F6YA 4I19A 3F73A 4WBNA 2AKAB 1H2XA 3WDSA 5IAAA 2GCNA 2V3CC 1ZH0A 4LHWA 1SKYE 2J0UA 4KSYA 3BCSA 3LY8A 1AK1A 3L7YA 2VHWA 2NVUB 5EZYB 2XZPA 1DC4A 1UKAA 2A5GA 3RKUA 1BKDR 1EEHA 2EW2A 2UZ1B 7GPBA 1NW5A 4I9HA 4BFWA 2C3MA 3V33A 4WGGA 4H4CA 4C1NA 2PNFA 1G17A 3ANYB 3ZTYA 2O2YA 4TYQA 1DQNA 1XAHA 4N5NA 3W8NA 4ZZ3A 3M8KA 5M29A 1LUAA 2ZBRA 1DKUA 1A8QA 1EFVA 3LGSA 3QJ5A 4L3OA 4XDGA 3WQBA 5IT0A 3WZ2A 1AE1A 3G9UA 2D1QA 3W3ZB 3SZUA 3ZDYB 3ZJYA 2IZ1A 4IG9A 4DV3B 1Y34E 3DZKA 4DLUA 3IVXA 1O4WA 4URYR 3ZWMA 5ICEA 3SIWA 1WXIA 1KPGA 2BTEA 3OG9A 1V11B 4D79A 2E5LB 3I8SA 2XE7A 3E23A 3T12A 1L4BA 3JPWA 2H1VA 4HMQA 4GOLD 5F3RA 4MQ5A 2G5PA 1T0PA 3A7DA 3MA0A 3M5PA 3ROEA 5J2UA 3NDBB 3ZXIA 1U8ZA 4JWKA 2BMEA 3ZCQA 4OI0A 3AVUA 5FT9A 4KUGA 5JMWA 1WJGA 1H93A 1A7AA 3C3YA 4RY0A 4B46A 3CUSA 3L4EA 2QL6A 1Z35A 1RYMA 2XY4A 3AF6A 2MYNA 2GMWA 2G40A 3I28A 4ZVPA 1K63A 3ZZUA 5K0BA 5ALIA 2YCLA 4AYXA 2EZ9A 4LDJA 1PJTA 4JCOA 5EUQB 4DANA 2H06A 2FR1A 3Q6IA 2ATIA 1C7JA 3PG5A 4RKYA 4X1IB 1N3IA 3EA4A 5EP1A 4HY3A 3PFCA 1VCHA 5CEEA 1FOEB 1LV8A 4RHUA 3GPLA 4O4LF 1A9OA 1WBBA 1UKVY 2I2CA 2XNHA 2X77A 4UU1A 1QIJA 1H5UA 2FKNA 3F9RA 2C7BA 5LBTA 3GBVA 3NTXA 2XXAA 4WEQA 3RJZA 1Z25A 3RF6A 1QGDA 3PQCA 5IF9A 2YXPX 4JLNA 2O23A 3GARA 3SS9X 1M2VA 2MSDB 2DBZA 4JJZA 3NEAA 5FAKA 1AO0A 3KSRA 5BPHA 1E79D 1U7XA 4TS4A 2BN4A 1P73A 2OHFA 4MV8A 1JLMA 3EGWA 3NS7A 1GAQA 4E2WA 1SKQA 2YY5A 5JAQA 4U39A 5FHQA 4ZYXA 4S35A 4YRBA 1U7TA 5CW1A 3B6KA 1X3SA 4P36A 2DUUA 1N1DA 4TXNA 3QFCA 3TX6A 2R68A 1Z0FA 5ALSA 5DHSA 4H6XA 1Y9EA 4E88A 1AQYA 3HDGA 1HZJA 2OCIA 2EKBA 4UUNA 1HSZA 2FPPA 1Z74A 3I9MA 3OWHA 4MHSA 5TV2A 4RIIA 4RVOA 4MRSA 4OD0A 2P4HX 1Z5VA 1YJ5A 1F0NA 4G36A 1PWXA 1MMFB 5KVQA 1PR2A 1IIRA 2Q3MA 3UTDA 1CZNA 2C4HA 1XDSA 2QTMA 3LMKA 3OLVA 4C78A 3GAAA 5H7XA 1LBTA 1Q22A 2AEFA 2G4LA 3HCPA 3IJPA 2XDQA 3IXMA 6REQA 5CIYA 3NBUA 1ULSA 1UT6A 2CE2X 2JANA 1U3CA 1ML4A 2I03A 1XTBA 1EI9A 4GQBA 3TG2A 3QVTA 2DBVO 3AETB 4XUCA 4GECA 4EX6A 1SD1A 3ENZA 5BWOA 2PH5A 3QLVA 5CK5A 1VSTA 5IAEA 4FWTA 4ZP1A 3VBEA 2ZP1A 3EHDA 3NCHA 4RVHA 1AZLA 5KTKA 3JALB 3OZBA 4XFDA 1LLCA 1VRVA 2JJ1A 5HTKA 2CE7A 5L7YA 3C14C 4HDNB 1BAPA 5BSKA 3D02A 4LX0A 3STWA 3HYSA 2JDIA 3GLIE 1GCIA 2WFAA 3HR7A 4TTRA 1TM3E 3P4YA 5EGNA 5JY6A 3G13A 3D5EA 4HBZA 1TGYA 1X1CA 1NBEA 3TZQA 4NBUA 1VIVA 2EP5A 3INYA 1TKAA 4I36A 2W2MA 5HFJA 4PRKA 1M5RA 1AM4D 1WLYA 3IBTA 4WESA 5CDGA 3HJTA 5BQPA 4E5MA 5BWLA 4B3MB 4EO7A 4Q3KA 2JH3A 4O29A 1RRGA 2CMHA 3FDXA 4ALJA 5CB4B 3OLCX 1IL0A 1Z2AA 4BO6A 3G8YA 4ZN6A 3PRJA 3KEGA 1L7NA 2O0KA 3EZ9A 1UAYA 4HFJA 1T5OA 1O87A 1J49A 5EMJA 5IDXA 1FE8A 1LDBA 1PRYA 2O1EA 3MIZA 5TLSA 1UZUA 1T9GS 3H0EA 1UMBB 5AI5A 2R60A 2ZRNA 1P8AA 1TF7A 4F9TA 4HLDA 2QMOA 3MK31 3LP8A 4HZUB 3FNIA 2JJMA 4J16C 1CJCA 1XD9A 1FP4B 1TE2A 2CZCA 4N3AA 3TBKA 1CEXA 4HFNA 5CB8A 3KPYA 2BUBA 3THWB 2O8FB 4MP6A 5A02A 3KYCA 3BMOA 2D2IA 4KE8A 2IBSA 3KT6A 4G3XA 3AZPA 3KB1A 1RQNA 2VJCA 1UZAA 1XL1A 3P9RA 4G0UA 1TT5A 4F2PA 3FRJA 3DHVA 4X93A 3LCJA 4J0DA 2H1LA 2I22A 4FOSA 4GAEA 2JCYA 1Z4QA 3CH5A 4MZXA 5T8KC 5C8YB 4M0FA 2ZE7A 3NANA 1SXHA 3INNA 5BQXA 4IIVA 1NIJA 2YCBA 2EP8A 4YFYA 2PR7A 1DOAA 2EFJA 3PR1A 4YV0A 3E0QA 5LQJA 4HDMA 3SC2A 1ZNYA 3N07A 2I76A 2XMDA 3CZPA 4P9NA 2O7VA 3RD5A 1T1EA 2PBFA 4CMGA 5C35A 3FY4A 3P9NA 5BVHA 4CUKA 2AK3A 4YMTA 1YQXA 3ADBA 1CIVA 2IPOA 1WG8A 3M1LA 4M3NA 2CK3A 1DLIA 4C5AA 3ZVKA 2I6XA 4FFWA 3IHTA 3TI7A 3SQXA 3JQDA 1KF0A 1NBME 2PBZA 3THSA 1AOXA 4XVCA 821PA 1EESA 1PUXA 2Y8EA 5I4IA 2Y0DA 1KVUA 3MBIA 3MT8A 4IKPA 3EFHA 3FLAA 1W4LA 2A9KA 2G1AA 2RHBA 3GJXC 4UHHA 1HDOA 3DE3X 3MELA 4E5KA 2YNMA 2VT2A 2YWRA 1KEUA 4NE9A 1DZ3A 3INRA 3DOUA 5BT9A 4TV9F 3K1JA 3K8ZA 1XLVA 5IT5A 2VI5A 2PQMA 1P1IA 1KAOA 1YCHA 3H65A 2GGSA 3VJLA 2FZGA 4Q9NA 1KARA 1SUDA 4NR0A 3KXPA 3GFVA 4KDEA 2QM0A 5BN4B 1NFFA 1JWAB 3GLQA 1FCJA 1YZFA 4N0PA 5EMKA 3WGUA 3PUVA 2XTNA 3GLKA 3ULKA 2W8BB 1UOQA 1V5GA 2WKWA 3FX2A 3L6RA 4IJWA 2B7LA 3HU2A 3HJGA 3JQ7B 5ARCA 2YXLA 3FKQA 2DU8A 1XNHA 1Y3AA 3P2EA 4GPAA 2ZB2A 4HS4A 4BKMA 4MVJP 2PQ6A 1B6TA 1TYBE 4HNTA 5KSYA 4NABA 3T9DA 1CJBA 2AJLI 5JISA 4KEAA 3GRPA 4L15A 2RGEA 3V1KA 4CMEC 3U7FB 3BXXA 4JC0A 2XB6A 4JUCA 1XROA 2UV8A 3FKSA 2QZSA 3LBHA 2QXTA 3Q8WA 1J1IA 1TUBA 1IN8A 2J6HA 3I4FA 5HIJA 3R6DA 1I7DA 3K5IA 3DR5A 3X0DA 3EK2A 3AG6A 1C5KA 3L06A 3R23A 2OHXA 4RSMA 5AW7A 4GW3A 5AVYA 4E3ZA 4MIEA 1KU6A 3S0JA 2XNSA 4I14A 1MV8A 4EGAA 5BW6B 3GVPA 1I7QB 1TM7E 5K2OA 1UIMA 1LBEA 2OM2A 3GNLA 2QP4A 4DSNA 2EARA 3S1AB 1I1QB 3HMKA 4XGQA 2IPXA 2IVZA 5ITZA 8ATCA 3K30A 3P9IA 1GZSA 1A2QA 3BUSA 1JBQA 2A8YA 4EVRA 2BEWA 3WWDA 2H5JA 2QRZA 2WHEA 3H2IA 2PJUA 3V5NA 3AVWA 1ZN8A 1SQGA 3DM5A 2PLAA 2VRBA 3PD1A 3RE1A 5KDLA 5HA5A 1DHTA 1OWNA 4HS9A 5CIWA 3UJDA 4C29A 4DMLA 3GJYA 1QS0B 3KJGA 3GA5A 3M49A 4MP3A 4XDZA 1R0ZA 3ZQ4A 4DZRA 2ZSEA 4HO1X 3R7WA 1YR6A 1KDOA 1FDTA 3G9QA 1HFKA 4YV2A 1O96B 5TDHA 4NCKA 3HA2A 1LPMA 1L3IA 4EYKA 1Y5LA 3JARA 2AHRA 5TC4A 1GPLA 3LYAA 1JWLA 3DS8A 2VWPA 2OILA 4RFSB 4LJ9A 5COBA 2XUGA 3PNLA 1Q7BA 2HJRA 2XHEA 5H80A 4ZCIA 4ZIRA 3RFTA 1CZRA 3NVKI 2JFQA 1MJGA 1BE1A 2YTZA 5AVTA 3UPTA 2DLCX 5ALJA 4RTSA 1WY7A 1MR3F 4L2IB 1NJ6A 4KX3A 4MKGA 1QF7A 4PGHA 4S04A 3ZDAA 3LC2O 1MABA 4AW9A 3AFOA 5AIBA 2OTCA 3AYXB 5DLYA 2GHTA 3W9BA 1NRJB 5ECGC 3UT5B 2NV6A 1OH5A 3W9UA 1B0ZA 1G291 3Q2OA 2FETA 1BU5A 3IT3A 5IUJC 3ER9A 3V2UA 2BH2A 1HE2A 1JL3A 1DQPA 1U65A 3HPQA 4L16A 3WRVA 5BRNA 2AMVA 2X9NA 1SVIA 5DXJA 1AKRA 1U7ZA 3SD7A 4MI9A 3UBMA 4A0HA 4BNDA 1ZM7A 3CE9A 3X44A 4TKUA 4F84A 1C3VA 2WJVA 5LQKA 3VZQA 1ZMXA 3O26A 3OZIA 3R0IA 3MBOA 3WLRA 2YWBA 4UQOA 4PHFA 3NR2A 5TQVA 5FIUA 1NM5A 3KZCA 3ZCXA 4L5CA 2WD8A 1W2WB 2BJWA 4OF4A 3C5EA 4AXBA 4OAOA 1OIXA 3MT9A 1ZUIA 4CQMB 4Z9YA 3DDUA 2B30A 1SHUX 1CUVA 4HWKA 2JI6A 4XLTA 3NWEA 1TCBA 4MEAA 4E1AA 1T9DA 4HUTA 2C5GA 3D7KA 4RZXA 4UOEA 1Q7CA 3UGTA 2MHCA 3KUKA 3IVRA 3T61A 2B1GA 3PJGA 1JU9A 4M38A 1U0EA 1WMBA 1YONA 2WAMA 1QH8A 2X2PA 2ACVA 1DCFA 2ONYA 2YDYA 4KPFC 4KR9A 4M8NE 1OT5A 2F43A 2ZITA 3I52A 3Q8LA 2HLHA 1CC1S 4JDPA 2LRHA 1XTSA 3FYHA 2EBUA 4R8SA 4ZQFA 4NPCA 3TKAA 4EZBA 2JFZA 3CUVA 5DO9A 4WOCA 1U98A 4KO3S 3BSFA 5AUPB 3A58B 3ER6A 5K6TA 2J6BA 4U4AA 5A3QA 2C3YA 3TRHA 1R8SA 4ARCA 4L78A 3ZH9B 4EGFA 3QFHA 2ZIZA 4JFAA 1AKUA 5KQRA 1VJCA 2H52A 3RK4A 4NVRA 5EE0A 1QSGA 4Q7QA 1C4WA 1Z0UA 2Y6UA 3DTVD 1I9GA 1PIWA 3KHTA 3VJKA 4B80A 1R0WA 4NHOA 1NYQA 4WOBA 5LYJA 4LCJA 4LVUA 5EFOA 1ATIA 1X1TA 1YC5A 3F74A 3WKDA 4B34A 1Z5ZA 1LEHA 1T2FA 3N7UA 1OLXB 1RBMA 4ALKA 5EE3A 4MX8A 1J07A 2QW1A 1B6SA 1F2TB 4YAEA 3WLPA 4MB0A 3O6VA 1W2HA 3LQRA 2GHQA 4ZAGA 3M1YA 4GNKA 4LHVA 1NVKA 1RYZA 3UO8B 3W1WA 4FZRA 1TA9A 2I6QA 1QHHB 2V4UA 1VJ5A 4QXRA 4KFCA 4M1QA 3UUWA 4D3XA 2JGLA 3OEHA 5KHOC 3JTEA 4ZEOA 4FR2A 4YMSA 2XCTB 1ZY2A 3DZFA 2Z8YM 4NBLA 5CLQA 4WKCA 4L08A 4TXJA 2YOFA 5HJEA 1PNVA 1VKRA 1E6WA 2ZYDA 3L6UA 1OTYA 3D0KA 2GYYA 4YUXA 2X2EA 2DFPA 3BBLA 1ZK1A 4URUR 5TVGA 1SG9A 1ZISA 1HBJA 2W58A 2EGUA 4E15A 1K8YB 3KJZA 5EJFA 3FF1A 5DI3A 3VVLA 2Q49A 4N6GA 3W6OA 1JAIA 1GQQA 3ID6C 3MOIA 3V4PB 4HZIA 4A0FA 1P6QA 2W6JA 4OYYA 4DIKA 4C87A 3GUHA 2PRJA 5INTA 3IE1A 2CLDX 3HWX1 4Q82A 4TN1A 1Y1PA 2ZE5A 1T0UA 5D5QA 5CB0A 2IZ0A 3WGNA 4MDEA 2VLIA 1J7JA 4D8UA 4X8MA 4LQ4A 2HOQA 1JAHA 2O7QA 1E6MA 3PNQA 3OVMA 4KI7A 5F64A 3T9FA 1HX7A 1XMVA 5JE8A 1LSSA 3TW8B 2G1KA 4E21A 2PANA 2PPVA 4LAFA 1K7YA 2VZ0A 1V9CA 2EVWX 4S12A 3ESXA 1JEYB 3RR2A 1SO8A 2BZGA 5GV8A 5HSGA 1J56A 3IERA 3VH3A 2IZ6A 2HMUA 1MVOA 1Z5NA 2VTKA 3KJFA 4ZO4A 1DQSA 3F6CA 5KQPA 2X5KO 4QUAA 3A4TA 3C6ZA 3UGQA 3V8RA 3THRA 2NYUA 3GJ5A 4MA5A 5JRDS 2NSDA 3R8CA 4Z1OA 1P9NA 4M8SA 2PYZA 2Z9DA 3C8UA 3H8SA 4JA2A 4MVXA 4YALA 3UK0A 4C4RA 1RM0A 1RKQA 2DC1A 5FTNA 4C20A 3NHPA 3ZVLA 5ALHA 3OTQA 4MQFA 2ZS9A 5ALVA 2OORC 2FSVC 1KH1A 2QROA 3JWEA 4J0JA 5A6SA 4DC0A 5JY1A 4L22A 2GBIA 4PYNA 2A5LA 1N32B 2V6MA 3QTBA 2AI2A 4JOSA 2QRHA 5H68A 3SJBA 2VR1A 2P9HA 2R3SA 3HV0A 4UXHA 3WIOA 1Y6GA 4G1VA 4A9AA 3SZRA 2A88A 3H2JA 3DLBA 2ZLBA 2Y0CA 5C8ZA 1T1JA 2P6NA 1T3SA 5FJIA 3G5LA 3GFPA 1T8RA 3CF4A 1FRNA 4OYRA 3BWYA 4L3VA 4XX0A 4ZARA 3I01M 3M0EA 3Q9NA 4HWPA 4CCYB 5KC9A 1LSUA 3G0OA 4FYPA 1M76A 3BERA 3QLUA 2YIMA 3CNBA 2TS1A 5CDHA 1E3EA 5LIRA 1CQIB 4BQFA 1QYRA 4EUEA 4HB3A 3JAWB 3SHFA 1USGA 3U49A 4ZQCB 1ZD1A 2W11A 2WWYA 1F8FA 3JX9A 5HF6A 4BNUA 2IYLD 3B6JA 5TPZD 3OIDA 3O8OA 4LECA 5AVJA 5JPCA 4QYWA 3UK1A 1HFWA 3FWYA 5K01A 2ZUFA 2AFHE 3HCRA 4ER3A 2EHJA 4LSWA 2IS4A 1BJRE 1OI7A 2W43A 1PZFA 3C3BA 3B38A 3A36A 3ZD9A 1W9HA 3VTZA 2PDAA 1RZ3A 2GVDC 3U31A 3UHJA 3WB2A 1OTHA 2GSWA 1DKPA 3BQMB 2V4ZA 1P39A 3NJRA 4EJMA 3VPDA 3AT1A 1BYUA 1N2IA 1H2AS 2MYPA 4DMCA 1QH1B 2AX4A 4OJNA 3FPEA 3TOCA 5LOVB 3QU7A 4US2R 5CVCA 2VHUA 3T5TA 3FWKA 4K9PA 2M6LA 3W0LB 5EQFA 3K0SA 5G41A 1KKUA 4DIMA 1J1UA 3E7FA 3PUXA 4MP8A 1ENPA 3A25A 1V2GA 3CT6A 3PXAA 5JAPA 1NL3A 4NICA 4YPVA 1VE3A 1EFHA 4XWWA 5JCJA 2G82A 2UAGA 1X7WA 2IYUA 5DSXA 4EDFA 4RS3A 5KOJB 4BQIA 1GXSB 4Y9TA 3C6BA 5CFZA 2FX3A 3WMGA 3RC7A 5CW2A 2AEEA 3KDPA 3CEAA 1SC9A 2Z0MA 4EFDA 5KPDA 5C37A 1OAOA 1YIAA 2R00C 2X0KA 1L4GA 1ZXXA 2ZVPX 2G9ZA 2YXDA 3EOAI 4B2LA 4OHRA 4BJHB 1XXHB 2AKYA 3TGPA 4LI3X 4V0RA 4DYHA 4UU7A 3OPYA 2HJSA 2Q4EA 5GONA 1JQJC 1PFUA 1FFAA 2WUWE 4L3WA 4KAFA 5JW6A 4PXAA 4UHEA 2F00A 3H5AA 3FTFA 1SQ6A 4HX9A 5B2ZA 2MJLA 2P0EA 4Y2RA 2VDQB 1YOVA 1R8YA 2Q62A 3LUPA 2XUPA 5KTSA 4ZT3A 4UEQA 2A3RA 2F4VB 5BR7A 2OV8A 3A3PA 3RSQA 4K03A 4ID9A 1YCFA 2R6JA 3I2GA 3T1QA 1NJ5A 1TZMA 2IHYA 4GOXA 1QF9A 1HE1C 1AKMA 2BV3A 2RGBA 4H0NA 1E58A 4IV0A 1N78A 1CUJA 1EFLA 1MRNA 2P3LA 4JYMA 4PANA 4TMXA 2IP2A 4YCSA 1R4ZA 3TZ6A 1JHUA 1MQ9A 2C99A 3K5WA 3V8QA 2I7XA 4ZOLA 2Z3ZA 1PT6A 3PF8A 4MKRA 1PWYE 2AG6A 3L7MA 3KAPA 1GJRA 1XVLA 2PS0A 2RJOA 4IO1A 1C80A 1K8XB 4BLUA 3TSAA 4Z1MD 5F7OA 1PP4A 4C0XA 2Q9CA 4OQ4A 2PH3A 3OD5A 1U3TA 2PRKA 2FWRA 2VTDA 3H0CA 4N76A 3OT1B 4FFOA 4QUDA 2B35A 2HRZA 4MR7B 5LP6C 3TD2A 3BMQB 2YV5A 1GSIA 3GCXA 1L7VC 3E1KA 4IJ6A 2HHJA 1GZ7A 4L95C 4M8LA 4QBGB 5CYOA 3WMRA 3PNPA 4ZAYA 2G77B 4TWIA 1O58A 5B1HA 1YGPA 3RJ9A 3TLGA 4WJLA 3VDXA 4WTOA 1L4KA 3LL4A 4CR8A 4YDSA 5CLJA 1GO2A 4DNXA 4EB8A 5F2NA 4EMBA 3COSA 1AUPA 3BD7A 1QAQA 3OQ1A 5DTJA 1ZVVA 1KJQA 4Z53A 4N3CA 1KJNA 1KI6B 1TIKA 2JLCA 2VQSA 2YQZA 1PZNA 1G20A 1YDFA 2PZGA 1N8NA 4RV9A 2QGFA 2V58A 1BEEA 3DT6A 1QGUB 3C3MA 2HU2A 1X39A 4FKBA 1PZMA 2D1TA 3W5CA 5IKEA 3ONNA 4RUKA 1E1KA 5AYVA 4S1VA 1FUIA 3NOOA 2A58A 5BW4A 4MSUA 621PA 2YC2C 3KSUA 1OU4A 3SSOA 3NUQA 1ZOLA 3IUSA 4HZGA 2OXIA 1DE0A 1IDN1 1OW3B 4DJ5X 2AMFA 5KNCD 2EZUA 3ZDBA 3L7IA 4LDQA 4XWOA 4TSFA 5K51A 1TEHA 1E3WB 2PA3A 1NQAO 3B36A 3NCTA 1SK8A 4B7ZA 4F6RB 2I91A 3OFNA 1KY5A 2FX5A 1E4OA 3F97A 2LPMA 3ICCA 1U8YA 1M72A 3BCUA 4EARA 4WJZA 3RUDA 4QELA 3KLOA 1IHDA 4O8CA 5JVDB 4INAA 1XEWY 3QELA 4BEWA 4M7PA 3D6AA 3EFEA 2H63A 1GKIA 1XLTA 2Q6LA 3HLTA 1U9JA 3VI3B 2Z3WA 1JP7A 5FOXA 3TL6A 5LU9A 4R7TA 1P5FA 3N2GB 4KYVA 1ZP6A 4CJXA 1TU3A 1U3UA 3BAFA 3STUA 4I50B 1F6DA 3CG0A 3ZUGA 2BPOA 4IP0A 4QICA 2EOAA 1JLRA 4BXOA 1Z6GA 2GEBA 4QAJA 3SOPA 2QPLA 3K2IA 2GZRA 1M6NA 4GD3Q 4LNAA 1A97A 1XWIA 3U7QB 5LB4A 5KSWB 4RGVA 3G2MA 3EH1A 3R3HA 1EUYA 5KYXB 2HWWA 5CVDA 2ZQ5A 4C0AC 1Z5WA 3LKDA 3AMVA 4QFDA 4YQFA 1D2AA 1KKLA 1U1FA 3DAYA 3V8EA 2QMQA 5IT4A 1TB4A 8GPBA 3TJRA 4IDFA 3ZHCA 4A4DA 2VUSA 2QTWB 5KO2A 5ADVA 4D0NA 1RQRA 1TFRA 2C5LA 4FZVA 1R6TA 2DF8A 4LPSA 1D4ZA 3RYFA 5AKIA 5TF4A 2BFPA 4Q18A 3WLHA 4F5EA 4CLRA 4RENA 4UE2A 2V7QD 1P2BA 4FX5A 4ZPXA 4ZAVA 5I9MA 3U4QA 3TOXA 1NF8A 4Q3DA 4DA0A 4G0OA 1VRCA 2I1LA 4PHCA 4M21A 4RORA 1ADCA 2GZSA 1MHTA 3QBJA 1E59A 1ND6A 2PGDA 2C3OA 2XEDA 3DBRB 2K7FA 2CNWA 3AM5A 3PR3A 3JYQA 2X7JA 4U7PB 5DGTA 2WV9A 4QHSA 1I5RA 1U5CA 3K09C 4WBSA 4OLBA 1A98A 1L8AA 2OOSA 2ZIUB 2B0CA 3FWZA 5B2FA 5KAPA 1EVJA 3OIYA 2AXEA 2GAJA 1WHTA 2BFCB 5EKDA 1BHSA 3GYBA 4AIRA 1Y4UA 1QO0A 2E5WA 1OFUX 3FLBA 2Y2VA 5TEVA 1G5TA 2DFTA 4LSGA 4EB3A 1CQZA 3RFFA 3CUTA 5BW5A 3NHFA 4L5BA 4LI0A 3BGIA 1XAIA 5BVGB 7REQA 2C92A 2PUFA 4LOLA 4IDQA 5IEBA 3TQFA 4F21A 1NN5A 3HKEB 3H3XA 2D06A 1I30A 4G1BA 1ID8A 1H2HA 1DTSA 4ZOBA 1GRQA 1KVRA 1DAKA 2Q6KA 5ALDA 1Y3IA 1JHMA 2BEVA 4M9CA 3HBNA 1LBQA 3JQBC 1VLVA 3KT8A 3N76A 4HAUA 1P7YA 3LFHA 5CGQB 3VC3A 5K9ZA 3EDOA 2C2HA 2PSSA 1AQJA 5GZ6A 5JPIA 1J4AA 1PVOA 1L5OA 4R1QA 3S3TA 4GU5A 1PL6A 3D7RA 1DX4A 4G67A 4GMKA 1KOGA 1YL5A 4YAGA 1KJZA 3ADCA 1HT0A 2FN8A 2GTHA 1FX0B 3HM9A 4HDCA 3MM4A 3I23A 1G7TA 3NIDB 2O19A 5HKBA 2XZLA 1E1CB 1JLLB 1VSVA 4KHPB 3T1NA 1S2OA 1ZH2A 3QF4A 3CW8X 3TTYA 3JXEA 5FUVA 4H60A 1JHXA 3E8SA 2PLWA 3HA5A 4CI0B 4G84A 3C5WP 1XELA 3G79A 1ZFNA 3M4ZA 2WIJA 1FW8A 1S1MA 1DTEA 2HPAA 2J31A 2QQ5A 1MOPA 3HXPA 3JZMA 4NYJR 1MD9A 4QUJA 2CCGA 1TLTA 5I6DA 1SCUA 3M6VA 3AEQB 3O9VA 4NMLA 3DMNA 1RLTA 1AQNA 4JI7B 5L7WA 4MDYA 4FFBB 3FDIA 1Y1LA 2HZBA 2VP3A 3LK7A 3GPBA 1D6JA 3NRJA 3FTEA 3GWGA 4P7BA 5IZCA 2V96A 3KHSA 4Q3EA 2O0HA 5E1BA 4L07A 3NXKA 4EFNA 1IY9A 1G4HA 4AKIA 3SYTA 3LXXA 3I6QA 4IS2A 4EUNA 4I1RA 5C80A 2J5XA 3AUTA 1EDOA 3FJ1A 3M4XA 3KEMA 1BMDA 2FPXA 4R1LA 4G8DA 1P1KA 1TQ8A 1V7ZA 5FULA 4DTCA 3TRKA 3AVVA 1KXJA 3E1GA 3ZTWA 1V43A 4FYYA 1GZHB 4U7FA 2Q99A 1YBHA 4DV2B 1RI5A 2WMOB 5AKXA 3W5VA 2GXQA 1XZEA 4DT1B 4FC6A 2AE2A 1OH7A 1PJQA 2R8RA 1FYVA 3EFBA 4KTTE 1X7YA 2PU7A 2HDHA 2VZ9A 2UU9B 4BY9E 4QYIB 1KDZA 1Y8AA 2F2TA 4AWBA 4OYHA 3CVVA 2QM7A 2CFSA 4E3WA 3OHMA 2PEYA 1TO6A 2D5BA 2OBMA 4X61A 4RS4A 2D5LA 4Y1RB 1YRBA 2HDWA 1N57A 3TK1A 3KR1A 3FVQA 4HAYA 1IRXA 4MDFA 1J0EA 2B34A 3CC8A 4MPTA 2O2DA 4C21A 4AKHA 5K1ZA 1MU0A 3JAKA 1JFRA 3O84A 2DHEA 1PKXA 1XHFA 1NU8A 3PEUA 3I9V6 3ZH2A 1BN7A 5F9FA 1LI4A 1ULBA 2V9PA 1EFPB 3IUEA 3RVOA 4NU6A 5KNDA 1NA5A 3SQDA 5JLJA 3V8PA 3VR4A 3ZHBA 1VDZA 3MJEA 2ZWIA 3P0HA 5BWBA 1V0JA 2VG8A 4HGZA 5F73A 3S2UA 1M1ZA 1DBQA 1I2ZA 3I6BA 3VYWA 1LPPA 4DRZA 2F8SA 2ZTVA 1XMXA 4OJMX 1SUCA 2GVNA 4WXPA 1E6KA 3DBHA 2W8ZA 4HNRA 4J07A 4BWVA 5JMTA 1DUIA 2L0XA 1APBA 4KREA 1RJDA 2ENUA 1RHMA 4NYIR 2ZJ3A 3I42A 5GMOA 5T4FA 3PD7A 3M5DA 3PDHA 4QGGA 3TIFA 4YP6A 2VVTA 2C0QA 1DELA 1OLSA 1R00A 2B2XA 4JLSA 5K3AA 2GR9A 3RYIA 1DRJA 5CTJA 1L5NA 2IF2A 3EMBA 5SZIA 5IM4A 3IR5A 2QUIA 3JQRA 3M33A 1KEEB 3AETA 2Y1GA 3VR6D 2ZXEA 3CUWA 4JEIA 1ESZA 1R5OA 4UBJA 3BEOA 3U7JA 1MO2A 4PYOA 3WK9A 4A3SA 1Z15A 5C8VA 4HQ0A 1V6CA 2A0KA 2A30A 5KSZA 5F7JA 5EQJB 5LWQA 3IVCA 5BSRA 2IHNA 1G1AA 5LZ5A 3SE7A 5KVSA 5IJ0A 4FGWA 5BQ5A 1MDFA 3ZI4A 1LC0A 1PG0A 2C9DA 1YZNA 2FMUA 3HKDA 3JQFC 3D1LA 4LY6A 2O2XA 4HNQA 3NW9A 1KSJA 2HQBA 4JQOA 1BE6A 4YLGA 4Y2UA 5CNMA 5EKTA 5KJ6A 4MWSA 2IY7A 3AILA 1NURA 4LYDA 2G6TA 4NU5A 5D84A 2GEDA 2VT7A 4OA5A 3TR5A 3V7FA 1PT9A 1E9EA 5KYUA 3RSFA 1EVIA 1HZZA 3V97A 2NUAA 4GO1A 4M76B 2Q5CA 2G1JA 2ODAA 3CWQA 4UTXA 2I7CA 4X1KA 4PRYA 4FDVA 3PYXA 3ECAA 3ZZTA 4QFBA 5BYJA 3SHQA 4DM7A 5B64A 2NTNA 1QIEA 2VH1A 2CNBA 1YRLA 2JAQA 3N5CA 4ZGGA 2V1XA 5DCYA 2C9ZA 3ND9A 3T35A 4D8WA 1JSLA 2XZOA 4MW5A 3LHDA 1M7HA 2BFDA 4IDHA 4DR3B 1Z88A 2K4MA 3UC5A 4I5FA 1OXKB 2GN0A 3WGGA 3CSUA 1CU1A 4NV3A 4HZUA 3ZY5A 4C4TA 3THXA 4GEKA 4N5HX 3Q7IA 3ZWCA 1FXSA 3K05A 3KPVA 3O83A 4GE3A 4E22A 1F1BA 1GQYA 2ETXA 2VHJA 3ZE1B 1E8NA 4KBGA 4DA6A 2GCEA 3U7GA 3DEKA 2GWRA 2PUEA 3UPDA 4UMVA 5HM6A 3HP7A 1FQKA 2WWWA 1X87A 4F5DA 1CS4C 1K27A 1DQZA 1UOEA 3DMDA 4XB6B 4DAEA 4BLOA 3MCZA 1CRLA 4CG2A 4C6HA 5KNBA 3O3NB 3QYAA 3HCAA 4HX5A 4DDTA 1KYIA 3LQYA 2GN1A 2HA4A 4RYDA 4AJIA 4GKBA 3B9QA 2DPMA 4ARBA 2FSIA 4OA8A 1DBVO 1XRJA 3NVDA 1AO3A 3P2IA 4FP9A 3WLNA 3ZLTA 4C06A 4DLYA 5IASA 4MCIA 3N2EA 1PJ3A 2Y9PB 4K2HA 2C20A 3RUEA 4RHEA 4G01B 3ZE0B 4QRHA 3OZ7A 2HA7A 2IV3A 4BVBA 4X8HA 2HMVA 2SHKA 3I2HA 1TW2A 2REQB 1H9CA 1XFDA 1P0MA 3D6VA 4ECEA 4M0LA 4O4JF 3KR2A 2Q1WA 2GD1O 3PDWA 1FDUA 2QIPA 3ZLJA 2NWQA 2KHZA 3IS3A 1L4NA 3TW4A 4FNMA 5E8JA 1DWQA 4BMCA 5KMGB 5BYBA 3JYHA 5IXJA 4PLGA 1WVMA 3IA7A 5AQEA 1U7DA 1OBHA 2YN0A 3PTLA 5JS8A 1KRHA 2QRKA 3KZVA 1OF1A 2QMZA 4D8YA 1E1MA 1XCBA 3OFJA 3O75A 5DOZA 4ZXPA 5TQ0A 4DJEC 4ZMSA 2ZJZA 5A03A 2LVBA 5BRJA 3H4TA 3I09A 5TMBA 3T41A 1Z4IA 4KB5A 5CD9A 4Z9XA 2OD9A 1EBUA 4X1OA 1RRCA 1E8MA 1KI2A 5E9AA 4PYLA 5BN4A 1H6BA 2WF9A 4MYCA 4WY8A 2AI3A 4ZT7A 3EARA 5LYYA 3VMMA 1ZNZA 4C7OB 3CM0A 3PKZA 1DCKA 3PWTA 5DB4A 3KQOA 3L6EA 5CLLA 4MWTA 3UKDA 3DMHA 2ZB3A 3CXRA 3ORSA 1KERA 4AT1A 2O3UA 5B5SA 1T9AA 1Z4JA 4HH3C 2LCFA 4MK4A 1GNTA 4I46A 4GUAA 4HXFB 3WGVA 3GCDA 5I5EA 3TUZC 5AXDA 4NWIA 3ILXA 1HLFA 3ASVA 4J2OA 5DLPA 5TARA 2W4QA 3EDCA 2ZZKA 4UM7A 4W7HA 1Q1BA 2UVDA 1U1GA 2XMRA 4Z51A 4LIPD 1K7SN 2O8VA 3RSSA 3GXOA 3QKRB 1QOZA 3T5PA 1IXRC 3LTEA 3UV3A 3W1VA 2WLSA 3EEBA 4HGPA 2RKOA 3E4CA