2DKOA

Extended substrate recognition in caspase-3 revealed by high resolution x-ray structure analysis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extended Substrate Recognition in Caspase-3 Revealed by High Resolution X-ray Structure Analysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-3
total genus 50
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2dkoA00
2C2KA 1RHRA 4NOKA 3S70A 1NMSA 1PAUA 3NS7A 4ZVRA 3H1PA 2NN3C 4PS1A 4JR0A 3H0EA 2Y0BA 4QUDA 4QUGA 3R5KA 5IC4A 3IBCA 4FGUA 2FUNB 1I4OA 4FDLA 4N7JA 4ZVOA 4NBLA 3KJQA 4FEAA 1RWNA 4N6GA 4EHKA 3IBFA 4NBKA 5IAEA 3K7EA 3KJFA 4ZVUA 1F9EA 1RHQA 1RHJA 2CJYA 4N6NA 4QU0A 4AWBA 2WDPA 3D6MA 3EDRA 2J32A 2K7ZA 3UOAB 2H51A 3KJNA 2H48A 2QLJA 2XZDA 4QUAA 3GJRA 2CNLA 3P4UA 3DEIA 3R5JA 5H0IA 3BIJA 2FQQA 2H5IA 2AR9A 1RHUA 4PS0A 4QU5A 4QTYA 2H4YA 2QL9A 4EHHA 3S8EA 5IAGA 1F1JA 4IEFB 3DEKA 2P2CA 4QUJA 4EHLA 4N7MA 2H5JA 3NR2A 4DCPA 4EHNA 2HBRA 1SC1A 4EHDA 3V3KA 4EJFA 1NMQA 3EDQA 4AW9A 2C2OA 2CNOA 1QDUA 2QLFA 2HBYA 4I1RA 4JQYA 4M9RA 4HQRA 4HQ0A 1RWOA 3R7BA 4D3YA 3NKFA 4JR2A 3V4OA 5JFTA 3GJQA 3PCXA 4AWAA 1RWKA 5I9BA 5IASA 2CJXA 3DEHA 4QU9A 1NW9B 4JB8A 5LUBA 2H65A 5IBCA 2XYHA 1PYOA 4ZVPA 2XYGA 3V6LA 2HBZA 2XYPA 4QUHA 2C2MA 1RHMA 2J33A 1RWMA 1SHLA 4JR1A 2H54A 3GJTA 3R6GA 4JJEA 5IARA 4QTXA 1RHKA 4FXOA 2C1EA 1IBCA 2C2ZA 2J30A 4IYRA 1K86A 1M72A 4QUBA 1NMEA 1I4EB 3R7NA 4D3ZA 4QULA 2J31A 5IAKA 4QUEA 5I9TA 4ZVTA 3H13A 1SC4A 3DEJA 4QU8A 3E4CA 5IBRA 3R7SA 4JJ8A 4DCOA 5LU8A 2CNKA 5IBPA 3V55A 4ZVSA 5LU9A 3H11B 2CDRA 4NOJA 3PD1A 3SIPA 3OD5A 2CNNA 1RWPA 3SIRA 1I51A 5IAJA 4NBNA 4NOMA 2QLBA 3ITNA 4PRZA 4EHFA 3PD0A 1CVRA 3R6LA 1RWVA 4ZVQA 3D6HA 4DCJA 3UO8B 5IANA 2QL5A 3D6FA 4HVAA 4I1PA 4D3XA 1RE1A 1CP3A 4N5DA 1ICEA 4PRYA 3V4LA 5LUAA 1RWWA 4JJ7A 3V6MA 5IC6A 5IABA 3QNWA 2HBQA 2QL7A 1K88A 2Y1LA 1QTNA 2DKOA 2H4WA 1SC3A 1SHJA 2FP3A 4JQZA 1GQFA 1KMCA 1BMQA 4LSZA 5K20A 1RWXA 1JXQA 3GJSA 4NOLA 4QUIA 1GFWA 4N6OA 1I3OA 3RJMA 4EHAA 3P45A 3H11A 2XZTA 1QX3A
chains in the Genus database with same CATH superfamily
1TJNA 3W5HA 4CM9A 4D81A 2CDCA 1LH0A 3H0EA 3LX6A 1G3QA 3L93A 2EGGA 5IKOA 2ECFA 1PQ4A 1E92A 1ODTC 1OY1A 3RVRA 1U9JA 3FSEA 4QA9A 4C3VA 5BV0A 1M1YA 621PA 3C7TA 3JAWB 3E03A 2FSVA 1U2EA 2PUTA 2CMGA 4KUHA 3TW4A 4BO4A 1TAGA 4CL0A 3H9QA 2CE7A 1I33A 2V5AA 1WZIA 2B82A 4ZO9A 3Q4GA 2Q1UA 4WGFA 1YD7A 1H1LB 2D6FA 1XJQA 2R5NA 2XNKA 1VMAA 1XNHA 2IYUA 2JAOA 4DGQA 5J1SB 1F9AA 4L07A 5BWCA 4PLFA 5B58T 4RTMA 1KARA 5HM6A 1N7IA 4ISCA 1L4HA 1BTOA 1LTHR 2OXRA 2QDXA 3DDSA 3F71A 4E5SA 2QM8A 1DS6A 4HDAA 5AHOA 2Y1CA 2RHTA 3Q3HA 1WU8A 3BJZA 1EM8A 1TVKB 4A26A 1U2RA 3PJRA 4EHNA 1SC1A 2LXNA 2BEUB 4OAPA 4UHJA 1WE2A 3F7MA 5IJWA 3THYB 4PPNA 1R4MA 1ZRNA 3KR0A 2JA1A 4ZIRA 4XFDA 2BFEB 2HBYA 3DCNA 4IEEA 2Q4EA 4HUJA 5IZCA 2R25B 5CFLA 2HMUA 2CXSA 3D5EA 4RXUA 2VLBA 1ZDMA 4QT4A 1JH9A 3FGNA 3BFPA 4OB7A 4J29A 2GPWA 2EAUA 2WSSA 1ATZA 2DZDA 5BYBA 1KRWA 2EJBA 3SEFA 3R6GA 1C9EA 4K3UA 3ZHSA 2TMKA 1B00A 4GRDA 3UBTA 1TLTA 2J30A 3D7MA 2C0QA 3DTYA 3A8TA 5L3ZA 3RUPA 4ZI3A 3VVCA 2O8CA 3JAKA 1DEHA 4EG0A 4BUZA 2HHLA 2JLQA 3EWIA 5FLYA 2FWBA 4TMVA 4YCNA 2BMEA 1I7DA 5AVSA 3OFNA 4O1HA 2X0JA 1S2NA 3CH4B 5AXBA 2QSJA 4D9GA 3I6YA 13PKA 1W5TA 2X23A 3B3QA 3N70A 4NZ9A 4RJKA 5D3QA 4DMMA 5L7WA 3K96A 2VSXA 1UXJA 5G0WA 1S3SA 3U9SA 1FJHA 1CLEA 2AE1A 4YX9A 2PRJA 2R1TA 4CR8A 4KR3A 3DF7A 2WT8A 4O8CA 5EP4A 5FNZA 2PRZA 1A7KA 3TX2A 2TECE 3E22A 4Z8XA 4CM6A 2J4CA 2VSNA 4H0FA 5LQSA 1EPUA 4TYPA 1TUGA 1IG3A 1EDBA 2D0OB 2H92A 4M55A 5SZJA 3TSZA 4LJYA 2OOKA 1IMOA 4M83A 5EP3A 1ZNZA 4CMAA 1BXGB 1UBRS 4FNAA 4RMGA 1C5KA 4OK5A 4TWJA 2MINA 2AN5A 3TL3A 2FX2A 3QVLA 2QTLA 1R0SA 3G5TA 2JEZA 1Y7PA 2W2LA 1XPOA 4MP8A 4Y6OA 1D2AA 2DKOA 1QO0A 2GTIA 1GZDA 3WHPA 5ALNA 1R0KA 3IUPA 2O54A 1WCYA 4PG7A 1RLMA 1YU6A 4WLOA 5CITA 5I3CA 1CDZA 1VL6A 4LYYA 4FI3C 1IWOA 1K3FA 2J9GA 2QVZX 3Q6IA 3VO8A 3FLEA 4M86A 4XWTA 1F06A 2NPIA 5DI9A 3RW9A 5LIRA 2CLDX 3NEJA 1N5IA 2JAUA 3TH5A 1M67A 3F49S 3BF7A 3H84A 4REOA 3V4RA 3Q5DA 3JYQA 1ISGA 4UEQA 3R7WB 3L4EA 2G5PA 2VSYA 1OGYA 4X94A 3LX8A 3NT4A 4XSVA 4HVTA 2PGJA 1MPXA 1ZCZA 2VSQA 4IBOA 4MSUA 3DVSX 3PGJA 3A2KA 1OI2A 2ATXA 1ONSA 4HBZA 1PIWA 1RQGA 2FSSA 2DWCA 5KWJA 3T4XA 2SCUA 3GRRA 5AK5A 5KVCA 2CBZA 4RY8A 4MR7B 2EBWA 3HP1A 4DJDC 4D3DA 1ENZA 2R1VA 4DG5A 5HKOA 2JC3A 1ZINA 2O3SA 2W4MA 3CUYA 2DOKA 3FMVA 2JI9A 3LX5A 5JOQA 1CBUA 1P31A 1VIAA 3LLVA 4OCZA 4R9UC 2IW3A 4TV8F 2XUIA 1IN4A 2J3IA 1N5OX 4L8GA 3L7BA 3ZCQA 4C0BA 4UBOA 3S8EA 4DB4A 5CP8A 2W48A 4NXMB 4G63A 1UFQA 1MO6A 4RFLA 1GWNA 3JQGA 4UAGA 2OB2A 3TE6A 2OM6A 3DVAB 3PUIA 3T9DA 4CM1A 1MV8A 4P2GA 2X77A 1WD5A 2WKWA 1P62B 1RPZA 1FJGB 3T5TA 1RYYA 1NYTA 3H6GA 2BMAA 5JSFA 4PCUA 3FMGA 3RAPR 1WQ3A 3VU3A 2GESA 4QO8A 3MCWA 4LJ8A 4EFDA 3AXTA 1YRYE 5CJ2A 2X1VA 3O7MA 3NASA 2G9UA 4WOJA 2AUNA 4DWOA 3RS2A 2F9MA 1OA1A 2JVJA 5A4MS 3W34A 1IJBA 3RU3A 1PYOA 3GPLA 3PJFA 3VSEA 3ZQ6A 3RC7A 2IKQA 2FSFA 1U0TA 3WY9A 3CZPA 1V3QE 3IVXA 4XGNA 1GUYA 2C92A 1EFPA 3OM9A 4LDNA 2BEWA 4FKZA 4C3ZA 2PS1A 4CQMB 4EDFA 5HIAA 3A6LA 1BDIA 3FPEA 2ZYAA 4DLWA 5MN5A 3V1NA 5I01A 2E18A 2QP3A 3OCZA 3ROMA 1X6VA 5DE3A 1WPRA 2O52A 3D3KA 1U28A 3WYBA 4DAEA 1HQYE 1RXCA 2JFZA 3GLTA 2QD2A 5JJBA 3KD2A 4GSYA 3FWHA 4G0ZA 2OUIA 2AMJA 2X5KO 3LWNA 4LSGA 5JNUA 4REQA 4XR4A 5FWXB 4E21A 3WYFA 1E2HA 1N2EA 4FFRA 5FHQA 3SHVA 1Y63A 3CW9A 2D2VA 2ZPTX 4YUXA 2FFHA 2FWAA 3PZRA 5HHTA 4ZV4A 1L4UA 1PDWA 4ZJPA 1IY9A 2CNDA 1OMOA 3I6IA 2J5RA 4INAA 5DASA 4FR2A 3I6QA 4B4UA 2BEVA 3SJ7A 2QD4A 2J07A 4ZOCA 3RFUA 5K3FA 3ETDA 3CTPA 4RA6A 4CDNA 2FDCA 1ZYUA 4DUGD 1T2EA 1Q77A 2IEYA 1TUEA 1Z2CA 4P83A 3OLZA 3LUKA 4FFBB 4H77A 5EZYA 5AYVA 2R7AA 4F3TA 5FWDA 1IBMB 1TKRA 4C76A 2PGNA 5E0KB 5I8ZA 3NHRA 2XF2A 4LSWA 1O57A 2AFHE 5F3RA 3E0QA 3A31A 3KOYA 3MT7A 5F77A 1HH4A 2IIVA 4HN9A 1BC5A 4MMYB 4UHDA 2W0SA 5AI5A 1GL9B 3A9TA 2Q5CA 3O03A 4JC0A 4RPGA 1X7DA 3CX3A 2QQ5A 3VZQA 5HUQA 4RU1A 1H22A 1MR3F 3WSTA 3D1JA 1N5LA 4AO7A 4C21A 3PLNA 5KX5B 4MV1A 3BWMA 3OQNA 2O2JA 1Z47A 2PLFA 3A6GA 4TTPA 1HQCA 4KXQA 5LWHA 3EIFA 5KOHA 5KMGB 5A4KA 1H2YA 1O8CA 1QZTA 1FDRA 2YHAA 4LK2A 2BTQA 2OEPA 3FDXA 4LPSA 5H5JA 4Z4CA 4PAGA 1Q0ZA 1P8AA 1V8OA 3ABRB 1P60A 3OTOB 2WWTA 1NNEA 2WWVD 2IIBA 2E5FA 2V3WA 2WUGA 3AC0A 3II6X 3KQTA 4ZRDA 3ZZ0A 3LLCA 1MJGA 2H51A 4IJMA 4AYXA 4TMKA 1SVKA 3KK0A 2CSXA 2CZGA 3HZHA 1E20A 4JP3A 1AG9A 1NE2A 3F97A 3QXHA 1ORTA 4I66A 2NVUB 1BOOA 3MWJA 4W5NA 3WK7A 2W98A 3F7OA 3HDYA 4Q4JA 4NULA 4KHPB 3UGTA 2WI8A 3DV2A 5A3SA 3UAGA 4CJXA 1IDN1 1GUDA 1KI6A 1T5SA 1OT5A 3KJHA 1M2OB 2E48A 3TBFA 1X74A 5LQAA 5D5PA 1ADCA 4W82A 5AT1A 2W2QA 3BX1A 3SZOA 2VT3A 4RK0A 4L4YA 1NW4A 3ZCXA 3GT7A 1LVUA 1MOSA 4NNJA 5CCDA 3TM5A 1PJ8A 1SQ6A 4BO6A 1R0BA 1DKQA 4JUBA 1GRVA 1A72A 3GJ5A 5TB5A 4PZZA 4X0EA 2C42A 1IRXA 1DC7A 2KM1A 1VBMA 2JJMA 3CPHA 5ICCA 4ENWA 5JYEA 3SQMA 3MOGA 3TGWA 4BMNA 4LC0A 2AL7A 2HWYA 4LG1A 1G4HA 4KAXA 4MQLA 2ZSHA 3FYHA 3A6HA 1K66A 1AK9A 2WJIA 4GKVA 4RXMA 4YJFA 3SJCA 3VX4A 1SG9A 1H69A 1VE5A 4J9UE 3RIYA 5AM2A 1GEEA 5EE3A 3S3TA 4OUDA 5NULA 2WHXA 4Q3DA 4QE3A 1U1GA 2PY6A 1IQUA 2FRDA 2HZ7A 3LPAA 3MTEA 4BNHA 3QVVA 1MNAA 1WCIB 4CV0A 4GP9A 2IP4A 3RR2A 2FWRA 4UZSA 3ETEA 3D4LA 3NYIA 2VSOA 3UMVA 2NYRA 1RIIA 1SNYA 4KTVE 3ZKWB 1M76A 4P5EA 4IFBA 4MB2A 2BFPA 4V1CB 2PKWA 5IBQA 5BWMA 5EWJA 2X9LA 1T13A 1OAAA 3OQ6A 3L1JA 4YP0A 3M0EA 3ST7A 5JATA 3PD0A 2AFRA 3WGGA 2OCYC 3G59A 3LRXA 5I4IA 4IIJA 4DT1B 1ZCBA 4D3SA 4KIGA 3GRPA 3D6FA 2O2CA 5KQLA 3IAUA 3SSMA 5F1YA 3UC5A 4EMSA 2OHIA 4V0OA 4W6ZA 3UCXA 2VVTA 2W6PA 3WGHA 4MP3A 1VGQA 2QI9C 1UBMS 1J20A 4E1AA 1DZ3A 3R8CA 1GLVA 1DXOA 5COBA 2VTKA 2C4VA 3HV2A 2I03A 2PJZA 2YN4A 3HJTA 4QEDA 4QT0A 5IVIA 2DSNA 3LY9A 4L08A 1U3CA 3EULA 2B8NA 1XDBA 2BHLA 2OFXA 3CZCA 4G5OA 1J70A 3PC3A 1T8UA 4YDHB 4QPZA 1XXLA 4C4AA 4ZO7A 3A3NA 1Y9ZA 3VDXA 2ZBUA 4FUQA 4Z9FA 5IZCC 1IZ0A 1E62A 4IJUA 3UEOA 2R79A 1IUKA 2PGAA 3RTGA 4QBIA 2G07A 2LDBA 3LXRA 4ZIRB 4Q9JA 4DM4A 1IZ7A 3TR5A 3GRZA 2Z2XA 4EG1A 4P3NA 3O1IC 4FZ3A 1K8YB 4CLXA 2F1OA 2V9PA 1XZQA 4QGBA 2VEOA 1RMYA 2FI1A 3PFCA 4G9BA 3I76A 4KNWA 3UIEA 2OHJA 1LBIA 4HG2A 4I4TA 4L3VA 4JIMA 4HNTA 5DM70 3CSSA 4D9CA 2XD4A 3U31A 2X7XA 3Q7QA 3FMOB 1NVTA 3ANLA 3JZMA 4PLVA 4REMA 1TUIA 1PD0A 2QJWA 3ED5A 1QH0A 3VR5H 2R87A 3CXUA 3GUHA 4IY1A 3Q8MA 1EK1A 2JGEA 4FOPA 4HDMB 4TXJA 3PR2B 3RTEA 1XP5A 3S68A 3HVRA 3WGJA 2Q50A 5ALDA 3T3OA 3KEQA 1EU1A 1N1GA 4MLZA 1EEXB 4JMPA 2FK8A 4IF6A 2ZROA 1DL5A 1BOFA 1LDYA 3BRQA 3CO5A 3ETCA 1XYYA 2XHZA 1A7AA 3ZE6A 5JWOA 1UMKA 3PE4A 4OP3A 2VIIA 1Q1ZA 4WZBB 4X1OA 1M34B 3NAQA 4DIUA 1B42A 2IS6A 4ZGGA 3JALB 4ZC8A 3IR7A 4KGDA 1PR1A 4MVJG 1KKMA 1SVSA 3BK7A 4D8YA 5BPFA 1OI3A 2EKQA 4HTAA 2P3LA 2XVMA 1WO8A 2PKYX 2ONYA 1K97A 3MILA 1HT1E 4WRRA 3UT5A 3V8NA 3ZK8A 3ZTYA 3MSCA 5D1HA 4ZAVA 1YZUA 5C52B 5B1SA 5HBGA 3AW8A 4AJ4A 2V0CA 3DE0X 2XYGA 5ALZA 1ZGJA 1KH3A 4CUKA 3B6JA 2WFMA 2CB0A 3JSAA 2YIDA 2W71A 1Q16A 3MUNA 4GPAA 2CFSA 3A2NA 3OKAA 4RHCA 2E21A 3KB8A 1GR0A 5ITVA 1NMEA 5HRUA 2B83A 4XDGA 4DXAA 1A50B 3IMEA 1LDNA 1P0MA 3VHXB 3ZLTA 4KR0A 2N75A 3OA0A 4P38A 2WUVA 2JGFA 3ORSA 1TIKA 1R0RE 2YMLA 4EAAA 1R6AA 1SBHA 1GHTA 2R84A 3P94A 2ZRPA 3Q1LA 4UE2A 5DGHA 2KYRA 2Z95A 3X1XA 3P27A 4PNEA 2VBCA 2XDQB 4M2LA 1JAZA 1GGNA 4U2EA 3A0UA 2IK8A 2QX9A 4PPGA 1XAJA 2C9OA 2CWWA 4DMKA 1KEKA 1EWYA 5K2OA 1QG0A 3GUCA 4QAJA 3HK2A 3GD5A 3ITEA 4J49A 1PZHA 4EI7A 1FW8A 4U8HA 5T4BA 1JR3E 5AKIA 2QRJA 2DKFA 4EFLA 4MR7A 1TVCA 3GQBA 2AN9A 3Q0EA 4LV8B 4JELA 4RUKA 3RT1A 2Y6UA 3PNKA 2FB9A 3FKQA 3QI7A 5F73A 2C83A 2P3QA 2C5HA 4Q7QA 1OBOA 1P0CA 2GVNA 4DUZB 2FP3A 1ETUA 2NZYA 2R7LA 3DBHA 2CFOA 5HEKA 2Z5VA 1Z06A 1WW3A 1TM3E 3E9EA 4LGMA 2HNKA 1BVYF 1C4KA 1JSXA 2AG1A 3DCYA 1F0PA 2BI8A 1UIMA 4RCYA 4KR9A 2ODAA 1ADGA 1U8TA 3OPQA 3MWGA 1G17A 3O8QB 5K3AA 2HLDD 4WBNA 1OB2A 1PNQA 5KSWB 2ZRCA 2NO4A 3SJAA 4LOIA 4LHVA 4X65B 4X8OA 1RACA 4NTZA 1EA5A 4JSYA 2IWHA 1HEIA 5C0OE 4YIKA 1SWVA 2OGUA 1DKUA 4C0XA 2XCTB 4MUIA 1YDMA 5A6VA 5BNFA 2A0UA 1DQZA 2ZR0A 3SICE 4YHBA 4BIIA 3FY4A 3KAJA 2H16A 2HF8A 2RGWA 2WD8A 2KX7A 4MYCA 4OHXA 4WBSA 5K1ZA 3VR5D 3WGTA 5K45A 4UOZA 1KNXA 2BEWB 1G64A 1SVLA 4C22A 4RGVA 1KVUA 3FCYA 3CKYA 1C1DA 4NU6A 1E2UA 2UVDA 4EUSA 1ML4A 4HDNB 4Y1RA 4QC2A 3BDAA 5ALOA 1QQAA 3OZCA 1VYUA 1UDAA 3I30X 1M3SA 1Z75A 1JBKA 2VDVE 3HEMA 1U3FA 3KDSE 2BLNA 1KDVA 4QDZA 4RQTA 4S2UA 3VDMA 4LJ6A 4DEYA 4KPFC 2VTVA 1ONBA 4V38A 4FT4A 1E94E 3SVZA 2VQEB 1CB7A 2VJAA 4BUCA 4R98A 5CAEB 5ELXA 1MDBA 2XVYA 3TCKA 1DSSG 1WB5A 2Z4TA 2ZUFA 1EVYA 1TQ2A 4TLCA 1LRKA 4ZZ1A 1NW8A 4ALLA 4WY5A 1JVBA 1JILA 4MGZR 4AC9A 4JBIA 4G25A 2PUVA 2XYQA 4Q5IA 4A6EA 3NM4A 2AIRA 2WZDA 4FIDA 5EMLA 2QP4A 2YMPA 2HBZA 3L1VA 1CDEA 3KZVA 1M34E 4N49A 4PQRA 4AFNA 2W7TA 1LX6A 2AOUA 1Y5LA 2QT0A 3GQVA 2VZ9A 3NOQA 1XTIA 3OEHA 5AUQA 1JYEA 1TMYA 2J4FA 1NBME 4DHEA 1T4CA 1AQLA 1WPGA 4QGSA 4R71A 2CLKB 5C8XA 3GFSA 5IMBA 5D85A 2WFLB 2E4YA 4KQ6A 5A9TA 4XRGA 5JRJA 5HIJA 3DE3X 1DFGA 1XT6A 2QTAA 5IKMA 4KAAA 1UPBA 2QVGA 3A04A 3MINB 5TQJA 1P9RA 1TD9A 3GWZA 4JVNA 1QRUA 2B7LA 2Y1WA 3R2JA 4JBHA 2BF7A 2OKCA 1DIOB 1Z3CA 4L0CA 4OTZA 3IP7A 1YO6A 2B0JA 1C0PA 4NQRA 1GO2A 3CT6A 1M6EX 3LYAA 3RYIA 5LBTA 1Z2NX 3LK7A 4LYHA 5TEWA 4XWWA 3PC8C 3DAYA 5KNBH 3RVNA 5U1PA 3NUQA 4GYJA 1UDXA 2VQSA 3QUTA 1SCDA 5K0CA 3LHIA 4HNSA 2QUIA 4B6EA 2Z8YM 1JHMA 1X14A 2G08A 2W37A 3HBJA 2CXOA 5LZ9A 4MV9A 3E1GA 3B1KA 1YUBA 3ESXA 5ALUA 1YNSA 1PUJA 2EJWA 2PZGA 4XKJA 2RHCA 4RYDA 2D8AA 2CXTA 5FWAA 1F5SA 3U5ZB 4C0SA 2B94A 1DG9A 2GR9A 1IATA 3S2IA 1IXRC 4CQLB 1BQ4A 1WBJB 1NA5A 4BPRA 4MVCA 3COZA 1QFYA 1P1JA 2JGNA 1UBGA 1NJ8A 2FPPA 3N8KA 1KO1A 3CURA 5JE8A 3I3SR 3P96A 3UHJA 2Q62A 4I3GA 5KJ1A 3Q7EA 3HYTA 1JLMA 3E0XA 4NATA 4DXDA 1Z39A 3ESYA 4NP6A 3K70D 2XUKA 2B9VA 4GUAA 1DNPA 3ZY4A 4R8RA 2HYIC 2B8JA 2W6QA 2GJ8A 2ZFUA 3BKWA 3H2KA 3K6SA 1DOAA 3EBOA 1UK9A 3PDIB 4NCKA 5ALMA 2V7TA 4BMCA 1H94A 2GYWA 2ZRIA 3T9CA 1Q12A 3PENA 3B8HA 1EGHA 1UBSB 3NTRA 2NO6A 1R15A 4CCYB 5JQGB 4CM4A 3ZDZB 5C37A 1GPNA 3A28A 4UASA 5DW3A 2A0WA 4MPPA 4ZYZA 2VAPA 3AI7A 4YJFB 3GLIB 4A15A 2P65A 1Z4QA 5EE1A 5HE9A 3BGDA 3S1SA 1W0CA 5LQUA 3L6RA 1L5GB 4IGAA 4LXQA 4RADA 2YWFA 2VJLA 4N5MA 1CLUA 3AG5A 1VKOA 1XUOA 1YBAA 1GPDG 2A3NA 2APJA 1L3CA 1KPHA 1SZJG 3A6FA 4FLMA 2OP1A 4XJVA 1M6NA 2Z98A 5CLFA 1N6KA 1CUXA 3A1SA 4B76A 2ZI3A 2X5JO 2H4ZA 4CIXA 4G0NA 2I8LA 3GXBA 4BFTA 2AFIA 1ZOIA 4Z3OA 1TJ3A 2IIQA 4D44A 2PMDA 4FYJA 2BZSA 4I7EA 5BQXA 1BDJA 4OYYA 1AY0A 1VDZA 1Z12A 4KK3A 1OH5A 1KFBB 2GEVA 4J1QA 5F2KA 4ZQHA 2VJYA 1IY0A 5C1BA 3W77A 4BQRA 3IFSA 4DT1A 5AESA 3WJAA 4IPTA 4YP7A 1ULAA 4IFTA 1XXHA 3U61B 4XIIA 1N75A 1KQ3A 1A96A 1CUBA 1QH9A 3X44A 1NN1A 1GQOA 1RZVA 1KOGA 2VHVA 4GGPA 4QUHA 1VOTA 3RGGA 3CJQA 1ZZEA 3GHHA 4IRMA 4YCMA 1LW6E 3G9QA 5LP1A 2G4CA 4Q02A 1U2DC 5B2FA 4FSDA 4DY4A 5GAJA 3WGQA 4TLAA 4FX2A 4TSFD 3UANA 1VHTA 2TMDA 3NWPA 3QHAA 4Q00A 1LZLA 4GKAA 4RVCA 3WB1A 1FFBA 1QP0A 1Y1SA 1YC2A 2NQ2C 1EVLA 4LNHA 4X20A 1JG4A 4B45A 2V5UA 3SOZA 2OBLA 4A0RA 4FMBB 4BP1A 1BXKA 1EWKA 1EVKA 1THGA 2CCJA 1T8SA 2JBAB 3C45A 4OK6A 2WJGA 3TB6A 2V7GA 3QK7A 1WY7A 1ICIA 1TJ4A 3Q3VA 3KPWA 4PLHA 4TVKA 3MUEA 4PZYA 5KTYA 3TSAA 5TMEA 3UKJA 1U8XX 2YVKA 2IE0A 2FYTA 3UJPA 1M2VB 1U0SY 2GWRA 1T1IA 1FS4A 4FZRA 4X93A 1EEHA 2YJ3A 2ZQZA 1FMTA 1EQUA 3T1HB 5AQ1A 1I01A 4G26A 2I2WA 4QLBA 3HKDB 5T6MA 1OOEA 1ZUNA 4U7DA 1P29A 2ZUCA 2A3RA 3A1DA 1KP2A 3UW1A 3GBPA 3PRHA 2C5EA 3IEIA 4M38A 3JPWA 3V48A 4C04A 3FCCA 4CLEA 4DCSA 2VF5X 2GCEA 2ACVA 5F4BA 3JX9A 1LF0A 4FB5A 3DKIA 3MF4A 3AX6A 4OKIA 5BOVA 2DUMA 3D6AA 3KRTA 1LFDB 3LO5A 1W36D 3D7NA 5CXUA 3AYZB 4M9UA 3N5KA 4WZBA 3TB4A 3QKTA 1A8UA 1FYXA 1FDWA 1AV7A 2ZJ0A 3CLVA 5U4XA 1L9XA 3JU3A 3KC2A 4JFAA 3W3AH 2R44A 4DDHA 1F2TB 5DHRA 1AXGA 4D9KA 2ONJA 4IXDA 4OQZA 4BWGA 4QGGA 1YB7A 3OLXA 4OGLA 4WWHA 1I2AA 2ZRBA 4FDLA 1SIWA 5HX7A 3RVSA 2QZJA 1QZUA 1E1QD 2XWQA 2AXEA 2PYZA 2XGSA 4O4JB 4B3CA 5JDIA 4I6JA 4AJIA 2PBFA 2FUG1 2HDOA 2ONZA 3LDFA 5EWLB 1KMHA 2DEUA 4OB6A 1P4GA 2V6FA 3O47A 1W5BA 4PY2A 3A4MA 5EGNA 4NYJR 1I4LD 4ROSA 1NOIA 5KNBA 1NZFA 4HAUA 4JLSA 1XFAA 1UPXA 4DA6A 4LF9B 2Y77A 1V3TA 2BBOA 1TMKA 3QITA 2R66A 3JQBC 4G4SO 1XWIA 2OK7A 3I2YX 5EJFA 3TZHA 1APBA 3QUAA 4KRGA 4IX9A 5F3DA 4QELA 1WMSA 2VUSA 3JSXA 5AW8A 2D0PB 3OFVA 4JT2A 2AKAB 3FPFA 4BBJA 1ISPA 3RAGA 2NXJA 3LXUX 1PFUA 2F6RA 1A04A 1WF3A 2V7VA 3QTTA 3AILA 7MHTA 4NHEA 4HFRA 1C8VB 2B25A 1X38A 1PZXA 2GPJA 2UZAA 3EFOB 4D3YA 2PKQP 1ESDA 2QIOA 4GRIA 2MTBA 5CA1A 2YNMA 4WK2B 1HNWB 2EIHA 1RYBA 1V4BA 1ZUHA 4QG3A 1X2BA 3JQ7A 5B36A 1B3BA 2OHVA 3F5QA 3NFRA 1UMDA 3CLSC 1OC2A 3AHEA 5E3HA 4I46A 4EI8A 5EIAA 1EVEA 4S3MA 1ZH6A 2D2XA 3FF4A 3A14A 4JEMA 4MGYR 1SUFA 3BXGA 4E2XA 5CVUA 1EKXA 2I4TA 4KBFA 1C3EA 5FP0A 4W9MC 3L8DA 3AUSA 1NMZA 3VJLA 1ABBA 1LKZA 1JQ5A 3WLEA 3PHCA 3EIHA 1SIOA 2SKDA 3UK2A 1SZPA 1E1CA 2ZXFA 2CHFA 2N0SA 1VSTA 5DZSA 3ZNOA 2FZVA 1U1EA 2OTCA 2UYGA 2IBSA 5BN3A 3ELBA 4PZEA 4WE3A 2PX8A 2R6AA 3EVFA 4ND5A 4IR7A 1XZJA 4LXGA 1X7GA 4BMDA 3AF3A 4PQFA 2IT1A 5JVDB 1UP6A 5K0NA 1IPEA 4HS4A 4N5IX 2Q99A 3G5AA 4P7KA 4QZVA 2QN2A 1ZI6A 5JC8A 3MERA 3OZWA 3W5AA 3AGPA 5DHSA 3TNYA 1YTUA 1NOKA 3GEMA 1K7SN 4RTSA 1YSCA 4ILKA 1EB8A 1JE1A 5IDYA 1LGYA 1KK3A 3RSLA 1L1EA 5KJ6A 3WOVA 3T15A 1T24A 3ZWQA 1C1DB 3AJRA 4ZCQA 3OHSX 1G66A 4MW5A 3OUTA 4NFYA 1P9OA 3AOEA 4N3AA 1UT5A 4ABYA 4CF4A 5JADA 1WMDA 3MS7A 5HFAA 4YMHA 1ZVMA 1P9WA 1PJZA 3RWMB 1OXUA 2Z04A 3LOQA 1DWQA 4FNOA 1M1UA 1TQ6A 1SC9A 3K8QA 3D6TB 1QP8A 2ZEJA 5CEJA 1HZZA 2PRSA 2AFHA 4QPNA 5K4AA 1XTJA 3H86A 4F96A 3SQDA 3WWEA 2W2VA 1QX3A 4UXHA 1G20E 1ZRSA 3FHJA 4HNAB 1J1IA 5DK6A 3UHPA 2EWMA 4HV4A 3ZI7A 1U9IA 1RKQA 3AJAA 4QECA 3WK6A 2FDRA 3ONVA 4H7IA 3DTNA 5GWXA 4QUGA 4EFKA 3FSGA 3LF2A 3M6UA 4LYDA 1R37A 4JYBA 3IKLA 2F59A 2O14A 3QJ5A 3TLBA 5JAUA 1JYFA 2PUEA 2AJTA 3C3EA 4M98A 3KQWA 4OM8A 1EDOA 3BL8A 1YFZA 3RC2A 3RROA 1EZ1A 3HDJA 3QBTA 4EARA 3CKKA 1QB7A 4GXTA 3EQ2A 4QU0A 3SKVA 1CY6A 2QTBA 4G5GA 3NBQA 1T4CB 1ZM9A 1U0EA 3GAAA 2IYXA 1C81A 1D2EA 3MHPA 4DEVA 4OK3A 1ZNWA 3DBRA 3VTZA 1P2VA 3R5JA 3G79A 1VRCA 2UZ4A 1HQKA 1NKSA 1P1IA 2GSWA 2JH8A 1PTKA 2X3UA 3HNRA 2F2TA 2Q4RA 4FLFA 4P33A 1L4YA 4PFJA 5EUBA 1L5HA 4D9FA 2HNAA 4E7PA 1JIVA 9ATCA 2V3VA 2SICE 3NO4A 5GONB 4L8YA 1AHNA 4M1SA 4BQIA 5IRCD 4CIDA 1TMOA 2HJGA 4ZP1A 3EOAI 4KH0A 4IAOA 3PNVA 4MVJI 5AUOB 1XZKA 2R00A 3FTDA 4KXVA 1LEHA 2EWVA 4RTRA 2EX0A 1J5XA 3G5UA 3T4PA 2M32A 4URHA 3DLCA 1HEUA 1M1NB 4LXUA 3CIFA 4AURA 1HE5A 2A67A 3IHTA 2JFWA 2MIIA 1TT5A 2YC2C 4KX3A 5LP6C 5JSKA 1AHIA 3RT7A 1CRZA 1X1EA 5JSZB 3D64A 4KN8A 1JE0A 3GLFB 3DAGA 4OVKA 5SY6A 4F3YA 4EH1A 4AIRA 4R69A 4BKUA 4UOEA 1NNI1 1MRNA 3HLYA 1M33A 2I54A 4QBHA 3FKSA 3N59A 2I76A 1ZOPA 2F3UA 5EJIA 1U7DA 3PWTA 1SC4A 1F38A 2BRUC 2IYEA 2GZRA 4E07A 3K3PA 3JVUA 3NI2A 1JKJA 3SIXA 5L6LB 1CY2A 1Z6TA 2EP8A 2BI7A 2IF2A 2WWHA 1Q7EA 4BBZA 2RJOA 2JNWA 5CH8A 5G41A 4DCVA 5CGQB 4JVLA 5T4HA 2AJLI 3PPWA 1WXIA 2P8JA 3R8FA 1V6AA 4YACA 4AP6A 5C5EA 3ANXA 4R8MA 1DBWA 5TPZD 1TCVA 1ZM4A 3ULKA 5E6RB 3P32A 4L6IA 3FNGA 1BDHA 3UBMA 1QGED 2IEGA 3RSCA 5CJPA 4Z54A 1J6UA 4P5PA 3RRMA 3S2FA 4BO5A 3EIOA 2PO7A 3FFXA 1U0FA 2LTAA 3EXHB 3H5WA 3I9JA 3R6TA 4LI0A 4P08A 5FOUA 4YPFA 4DB2A 5COAA 1N77A 1D6SA 2ZQ5A 3D7KA 3GUZA 1UJ2A 3ILXA 4J9VA 4G85A 1KAEA 1W2GA 3FNRA 3LVQE 4HAZA 4L9WA 3SOPA 4D4JA 1K88A 2BSQA 5JXJA 4YMIA 5EKTA 5DT2A 1V1JA 4BVKA 3U4GA 1UMCA 3FN4A 4TS3A 7ADHA 3OKPA 4FHZA 2E4VA 4NCHA 1I36A 3SYKA 1PHRA 3V8BA 5KNCD 2W8BB 4Z9BA 2QMEA 3G0CA 1E60A 5IS2A 2XB2A 2D7JA 1FTWA 3FROA 2D4HA 3CTMA 3E3OA 4LI3X 2X2FA 3ZE7A 1GA1A 1JXMA 3CMCO 3SMVA 4HDSA 4A16A 1V43A 1EYZA 5LYJB 1NULA 3AVUA 3P2IA 5IC4A 3P2OA 4O5OA 1XXHB 4RPLA 4YC7A 4LY3A 1P77A 4TMYA 5I7SA 1RQRA 2HCFA 4RF3A 2W6IA 1A2BA 5LZ7A 4BGUA 5HWSA 5KWIA 3OCJA 4U02A 4P31A 3JWEA 2ZW9A 3HCOA 4ND6A 1WUHS 3A9RA 4H1HA 1ZM2A 1SD5A 1JWLA 3BMQB 3C5HA 5E9JA 5I9LA 2GAOA 4C14A 5DTRA 3K15A 4LJ9A 2W8ZA 3GEEA 5KNDD 2ZE7A 4C0HA 2DPLA 3BDIA 2G9ZA 4M1QA 5KU1A 4YH1A 4TL9A 3PJGA 1ADFA 4RK1A 1ORDA 2QN8A 4LDRA 2XNHA 1PZGA 4LVUA 2HRDA 4UBIA 3V8MA 1FX1A 1DCTA 5JMOA 2A4KA 1HNXB 2BFBB 2O2ZA 1RP1A 4IIUA 4J3NA 4AG3A 5BSRA 4B34A 4ER3A 2Z58A 5L95A 3IXLA 4PLCA 4HGNA 3A1UA 3WAGA 1EE1A 2GZHA 5EE9A 3ADKA 3QVUA 3PL1A 4ARVA 5IDXA 3UMMA 3FPKA 3PA8A 1CP2A 4PTZA 4RPCA 1KTIA 3PWKA 3WWDA 3TG8A 4L95C 4J0EA 1EK6A 1QMPA 3HRHA 3BIFA 3JQQA 4LYGA 4MDHA 1NXTA 3JQEA 3SF8A 3F6CA 4PQGA 4F4FA 5J47A 1GZ5A 3UWMA 4BPBA 1JPVA 1T4MA 3CGWA 1DIAA 1NF3A 2BDEA 3K9WA 1QYXA 4K86A 1BHSA 1KR2A 3H2BA 1CHDA 3N2GA 4I50B 3U40A 3O2NA 4MNTA 3LBYA 4IDPA 1FFCA 3T12A 3TKAA 5K8LA 2AKYA 4DF3A 3J80A 2QL6A 3ZVRA 2Q45A 4YT2A 4ZYLA 5KNDH 2V54A 3JYOA 2VTEA 3QYJA 1B1AA 3GDWA 4JITA 2EIXA 3HKDA 2KJQA 3G85A 4DLSA 1T2DA 1SN7A 4ZREA 2UZIR 4O4IF 1TQ8A 1A2QA 2B8EA 4MVXA 3CM0A 3VOBA 4OGFA 5I7HA 1ZW6A 1KIFA 1DAIA 4UNNA 4W1PA 4HRVA 3KUDA 1ZPDA 4LRYA 2GVZC 2O19A 2ORED 1Z0ZA 2ZVPX 3QFSA 4B80A 2W42A 1ENYA 1LTKA 3G2PA 5COQA 3DXYA 1OV4A 5E8JA 2ZJ8A 1OIWA 1YOVB 2F3SA 3PGMA 2Q6TA 2PX4A 3X3HA 3ZCRA 3WP1B 1NDUA 3A6DA 4DZRA 1PD1A 4MR8B 2O3QA 2J9FA 3BXZA 3K2BA 1S4MA 1V35A 1SUDA 2DKNA 2MCFA 3SHQA 3E2PA 3M5CA 4MVJA 3G7NA 1Z15A 5FWYB 5F9HA 1D2CA 1L7QA 5CH5A 1UBOS 2HUNA 4UU7A 2FZEA 3QX7A 5C3UA 4BNDA 4UM9D 3K09A 3T3NA 2RHOA 4O4JA 3PDWA 3SYNA 1P6XA 2HEIA 3H42B 1D1SA 4XB6B 4RAQA 4ES6A 1MJHA 4CEHB 1YJCA 3L0SA 3QM1A 4Z0HO 3V4PB 1IOLA 1H6BA 1MJFA 1T43A 1Y48E 2QRZA 3P9ZA 4YJ3F 5CX1B 5D7NA 1SOUA 4RZ2A 3G49A 3K9NA 4GBJA 3MYYA 1A7JA 1FDSA 4QM6A 3TNDA 1FMJA 1OXXK 4WCFA 5TEVA 1TIBA 2H3HA 1NMYA 1S3FA 1LUAA 2PO5A 4ME6A 4DTCA 4JJFA 5EIHA 3P71T 4O0LA 3RYCB 1YZFA 2JVIA 1G0NA 4R0VA 3IILA 3HADA 5JPCA 3GJ6A 2O23A 5LNK6 4X00A 1V9LA 4LZLA 5DX1A 3IUMA 5C8DA 5KVSA 3IPLA 4RV9A 3T5AA 4FZ5A 1FTSA 5FUYA 2WIJA 2ZKLA 8LDHA 2RAUA 5B7NA 5FT9A 1BAPA 1MQ8B 1EQ2A 2IBMA 4YCSA 4DV0B 3BIXA 3PDUA 4IQFA 4M37A 1I10A 5A5EA 1KGDA 3AM5A 4K81B 4AL4A 3LHKA 3AZOA 3DG9A 5J9FA 5C31A 2ZIAA 1B0ZA 1W6RA 3DONA 2J7PA 5FLXA 1J5EB 3CNEA 1X0XA 3E23A 2Y0EA 2J45A 3DAPA 5AVJA 2IYRA 1NNUA 2HPHA 1V8DA 3TKLA 1BYUA 5LBUA 1XDDA 3KYJB 4OXKA 2QTTA 3UJ7A 4X8MA 1UMDB 1QOPB 2HXSA 4URVR 3N8NA 1KVRA 1L8XA 1F60A 1MORA 2H63A 4K6HA 3AIKA 4PSVA 3VYVA 1RBZA 2PD6A 1ODJA 1NDHA 4MI3A 4TKVA 2JZNA 2DBQA 4GI7A 2Q0QA 2IDMA 2WYWA 4KXFB 3HVKA 3RC3A 1FNCA 3N0TA 1TF5A 1TM5E 1UBUS 2OVBA 1BE6A 2VJDA 5AKJA 3REFA 5B12A 1D07A 4QNRA 5BSMA 1S8OA 4E51A 1Z88A 2R65A 5KNCH 3U44A 1Y3DE 4G41A 4B9EA 4ZICA 1DCFA 1W48A 2A6PA 2IWRA 3ZV5A 5SY9A 3DWFA 2Y2UA 2ACKA 1E9FA 4DOMA 4OJMX 3C97A 2HRQA 3UUEA 3ORFA 1FFXA 5EI5A 1UBNA 3H87A 2YIVX 3P2EA 3W5DA 3ROQA 3DT9A 2GCOB 1ZI9A 3RH0A 3DLIA 2WUDA 4HQRA 2P11A 3M1LA 3NZEA 3PF9A 2XTAA 3MB5A 4HZGA 1OYVA 1EH5A 1RWKA 4LNAA 3ZCUA 1OH8A 2P4EA 2NZJA 2RGGA 2WM2A 3OPYB 4HDRA 5DSXA 2HT1A 4RVFA 3TL2A 1AO3A 3KDAA 3PP8A 3AESA 4Q9HA 4MVJD 3NKLA 2ILVA 1V0JA 1HZZC 4G56A 1YIAA 2JHAA 4UTOA 4A2WA 2FVYA 4C20A 2Y0CA 2XVZA 4G8CA 3UK0A 5C7OO 2GNAA 4O1IA 3DA8A 2ASEA 4A5OA 2AZXA 4HMQA 4QDKA 2J6BA 4LCEA 1C50A 3TQQA 1WCXA 2AFHB 1BDBA 3D54D 2DP4E 3SHFA 4ZHSA 3BGSA 3M3HA 3K35A 1PBNA 4HEA1 1YHNA 4LZPA 1HMPA 2ZUUA 4TXLA 1IONA 2IEDA 1BJRE 1P1CA 3C39A 2G80A 4O63O 4X85A 1YDGA 2R4TA 4KXUA 3Q0IA 1N6LA 5H9VA 3FVWA 4IDDA 4RSRA 1TOAA 3M6MD 4G4JA 2P35A 4IXNA 4BFYA 4E14A 4NE9A 1I7QB 4ZAGA 2J85A 4DAOA 1HLGA 3ZWXA 1OV6A 2UVPA 1RWWA 3QPAA 4XB2A 1H1DA 1YBMA 2CK3D 3KL4A 1FU8A 2OQ2A 3CN9A 3CLTD 3KTFA 3SP1A 1GZ4A 4IV5A 3B20A 4NU5A 3H6HA 3AF4A 3N86A 2ETXA 1A9YA 1FQOA 1QV7A 3D6UA 4N01A 4WBNF 2IS1A 3U6KA 2FFBA 3KE9A 1WKBA 2WFAA 2ZTLA 3V1UA 2XMRA 3PJEA 1VCMA 1WOYA 1EFCA 2C77A 2RARA 2WW8A 3MS2A 5DYWA 5IF9A 1G2QA 2QTGA 4WPGA 1LBEA 4CCSA 3ZQKA 3A3YA 1JZTA 2PTGA 4GMFA 5DNVA 4F97A 1JLHA 3ZS9A 1B14A 3BCRA 1IM8A 1KEVA 1R18A 5FTJA 1ZGCA 2IYWA 2Q9BA 2YTZA 1Z6PA 3DP7A 4NCJA 4ZKEA 5TQ0A 3RAJA 3ZD6A 2TSYB 5EMHA 1E2KA 4LHWA 3P9IA 4AKEA 4D9JA 3ZBQA 1YTLA 1A8QA 9LDBA 2F17A 2ZCVA 1TTHA 2JS7A 5KDLA 4R8LA 1RI1A 1G8FA 4UHBA 1LK0A 1IHPA 1WM1A 4MWTA 2N42A 3GLFA 4UTZA 4H1WA 4W7HA 5CXXA 1B4DA 2AWOA 2PWZA 3O2QB 4HAYA 4TMXA 2CL0X 4MQFA 5A4IS 3N76A 1YB2A 5EE0A 4EPRA 1RRMA 4WKOA 5F78A 4DM3A 3G17A 2D2IA 4M0EA 2BKEA 3LIIA 4XX0B 1RQLA 5FJJA 3KALA 5ALIA 3CZ5A 2HK6A 2ZU0C 4NJEA 4X5OA 3SSNA 3BKXA 4H1VA 2GLTA 5EQTA 3LCJA 4ID9A 1G291 4X45A 4DCJA 2HHCA 4JBLA 1MIHA 2ET6A 2AE2A 4HRXA 4ALIA 3RARA 3PHBE 3DOUA 1SG0A 1KI3A 3SD7A 3GIWA 3ESQA 4LZJA 3EZ6A 5HDBB 1N0VC 3VC3A 3W6PA 5LDHA 1KYVA 1VYHA 3KJZA 5DWQA 3WWYA 3ZDBA 1Q7CA 3GJQA 2YC4C 2ZULA 4YR9A 4A0QA 1AS2A 2GJKA 4PYQA 1E6KA 4H2DA 1II8B 5I51A 4NMWA 4YJHB 3URKA 1G2IA 3HDVA 4LF6B 1PJCA 2UVQA 2C9ZA 2JK1A 1XJ0A 3B6KA 2BIFA 2O5VA 3HDHA 4KRXA 4IEIA 3ZNPA 4BB5A 4ZPXA 4NAHA 2C1EA 2ZYTX 4LDPA 1CF2O 2JA2A 3GLVA 3QOXA 6REQB 1EHYA 3K1YA 5EJ2A 3L6DA 1LWOA 4QXOA 5AW0A 3OJCA 5FPKA 3WIBA 1EB9A 3E4CA 3GT4A 3WQRA 3ZX5A 1NAHA 1UFVA 1YI8A 1ULHA 3M83A 4RL4A 5B3JA 5CFOA 1L7BA 1W4RA 4RD2A 1RPTA 2VHUA 4B46A 4X90A 3WISA 3KB1A 4OMDA 4EJ6A 1M54A 4C7JA 4ZAXA 2UZ1B 4HWRA 4NWIA 5FLKA 2Z3ZA 1R10A 3ZU5A 5A04A 5LOVB 5KWEA 2QAGC 3LY7A 3TQHA 1DDIA 1AXEA 1FOEB 2R7KA 3U4CA 4BN5A 5JAQA 3QKSA 1WY5A 1HM5A 4DY6A 3GNTA 3AJ8A 1BD4A 2XTMA 2IPAB 5KREA 1J2RA 5KX5F 4HZUA 2B6NA 3DTVD 2NUPB 2XR1A 2OBYA 3NHBA 4MWGA 5I6DA 4Q9KA 3N8HA 3U2QA 1CWUA 1H9BA 1WCWA 1M83A 3QZUA 2RK4A 2I2DA 4P4UA 3C15C 4DABA 4MVYA 4F2HA 4V2UA 1NMXA 1FDOA 1GKYA 4PYOA 4WT7A 1G38A 4UAJA 4TTSA 2WUEA 3L7IA 3Q88A 3PTAA 1T2CA 2EKLA 2RSLA 3SS8A 2XODA 3Q8KA 1G20A 3SF8B 2YWBA 2Q7OE 1IAQA 2PN1A 4BLPA 2XB4A 821PA 4YJ2A 1NMSA 5FI0B 3N2GB 3KKOA 1CNFA 2EKPA 4EG3A 3JQ6A 4ZCRA 4WZAA 3SC4A 2OBBA 1ZXXA 3D0RA 4X1YB 3HGQA 1FLNA 2FZKA 3THWB 1P4SA 2WJHA 4DIOA 4GQBA 3KU4A 1F9EA 1NR5A 3GJ0A 1HXHA 1ZBDA 1DO2A 1NW7A 3NV7A 3QVSA 2HSZA 2ZVQX 4NRDA 4QATA 3UMSA 3IP3A 3A70A 2I91A 4UCWA 3PNSA 3CKLA 2P40A 2J0QA 3DS8A 2XA1A 1KY3A 2H48A 3NQ41 1L9KA 2ZI4A 4YCJA 3ZLBA 1K7FB 2WJ6A 3ORYA 2V9ZA 3P5SA 2VXOA 4Q6BA 3IMFA 2ZSEA 2VUUA 3QPDA 2P4UA 1GAQA 4XSHA 2BYTA 4MUGA 2ZYWX 2J0SA 3KUCA 4NL4H 3C1AA 1V5IA 2MSDB 4FS3A 4MUFA 5B7PA 3QE9Y 2FZWA 4HAXA 1OX4A 5ITWA 4L0DA 2HU5A 4KIFA 2BTEA 4E5KA 1MKYA 1VL5A 3WLAA 3QHQA 1CETA 1QPZA 3HYNA 1YA8A 3HE3A 2HEGA 1Z9BA 2QTCA 1N2JA 4JP2A 4MAMA 5H68A 1J00A 1GCIA 1YB5A 4CN8A 5JCXA 1HA3A 1LBHA 5BPHA 4CG3A 3T34A 4XFJA 3IAHA 1NJ5A 4CL2A 3W2FA 1LBSA 3N0WA 4PZ0A 1OR8A 1F7UA 1W2HA 4FC6A 2EHJA 3WDSA 1L4BA 2X2PA 4WESA 4RTPA 3OICA 1VXRA 3O1JC 4JP1A 4EYQA 4CU2A 3M1IA 1M0EA 1XDZA 3MXOA 4OV6B 3AFMA 4YROA 3VTKA 4P58A 3QPCA 3WFJA 2BFOA 1JZSA 3HSSA 3ZE2B 1TZ2A 4AN1A 4QJ3A 1Q95A 1KI2A 1EUCB 4TWIA 2ZU6A 4UBKA 5LNK1 1B1CA 2VDLB 2EXXA 1YNOA 4CVNA 5AKYA 3VHLB 5FPYA 5BMVA 1KY2A 1IN1A 1JG3A 1LJUA 1RS0A 1LB1B 3IIKA 2JASA 4DS3A 4PHGA 2ZQYA 1E3WB 1UPFA 5B1IA 2I7VA 4DLLA 5HS4A 2BF4A 4K6GA 1XTTA 1I4TD 2YJGA 1HYHA 2WP8J 4QQNA 3K0AA 1DFHA 1A76A 2AQ8A 4FDUA 5EE5B 4XRRA 2IU4A 4V1CI 5FR1A 2C5SA 3L7NA 1FRVA 1XTBA 4JLMA 1B0PA 2PJDA 4TMZA 1UC5B 1E1MA 1DUIA 5JBIA 1EGMB 3ACBA 5AKZA 4Y2VA 2JATA 3LL4A 5CIQA 1BS1A 2EDAA 3U4IA 5I9IA 1HFJA 3WIOA 1HV8A 3IR6A 2B7CA 3GH1A 3PQEA 4JB0A 3NH9A 1UMBA 3A7DA 1BHJA 1NUTA 1Z5PA 1JA0A 1KEPA 1BVHA 1GQFA 3FBTA 4O33A 3UQYS 3DE6X 1QTIA 4XGQA 3VR3D 4KV7A 3WDLA 3FJ1A 1R74A 2ZCUA 1E59A 2CLMB 3BFKA 1KBQA 2NUAA 2PV7A 2WSYB 4HH3C 1FFXB 1C80A 2JK0A 3NDPA 3DD1A 1R0XA 5EQDA 1V5WA 5DWVA 4MUNA 4WZAE 3MTBA 4WIAA 1P4JA 1FFWA 2ZS8A 3MWDB 3VVLA 5JXIA 5IAAA 2FUNB 5E1BA 1UC8A 4QGFA 1CUWA 2WAOA 2ZGVA 2HTFA 4LFCB 3ZR4B 3INNA 3T1OA 1JB1A 1NKTA 4K9NA 2X8JA 2EF0A 3VYTB 5CG1A 3E70C 5EZ5A 1L7OA 4UPDA 2ZDGA 1VG0B 3CG0A 5I9MA 4OYLA 3NTLA 2GFQA 4ESHA 1DRKA 1QKKA 3AR8A 3LA6A 3PNOA 2K7ZA 3GAMA 3PUZA 4XIFA 2MSCB 3JRNA 3QWAA 5JPDA 5CFZA 3C3JA 1GT91 3HJCA 1EP2B 1T91A 5CPBA 1X9HA 3C5WP 1RIFA 3ZOKA 3NIFB 5K3OA 3FZYA 2I2XB 4BRUA 2C88A 2Z3WA 1L5MA 4EY3A 1UDWA 4U63A 2RGRA 1IOVA 1HE1C 3GHYA 1WU7A 4EL0A 3HL0A 1YCGA 3IAS1 4HXYA 1V5EA 1KEZA 1NXVA 3D59A 3HKCA 4J07A 1E0JA 2P9FA 4D25A 4KHZA 5TPWB 4BN0A 2DBVO 1VA5A 4HEJA 4BO3A 1MZPA 2CXHA 4MV3A 1NJSA 1PL7A 4BL5A 3PQ2A 4DA0A 1NF2A 1WTCA 3CF6R 3OX3A 3H3JA 1KZHA 3KCQA 3SG0A 1D0VA 4G0QA 2JGKA 1IEVA 4BQOA 3GLGA 2V74B 4R31A 1I32A 4RVDA 2XOKA 3V6LA 1VXOA 3KZCA 5FA8A 2O8FA 5DJ5A 3AK4A 2PWPA 4HO1X 2YVAA 3RHTA 5EJ5A 1N2GA 1CQPA 4ZC1A 4BMYA 3WRXA 2YV5A 2FSVC 1UUFA 1X1BA 3DMPA 3PC8A 3OZEA 3RQIA 1PUIA 4F5ZA 4II2A 3HTXA 2HSJA 3AUKA 1SEVA 3LUHA 1BCRA 3R7SA 4UBMA 3V55A 2JFUA 4TSFA 3P4XA 3MTDA 4F9EA 3ZN2A 1JAYA 5B6PA 2EP7A 1JR4A 4W7IA 1L7NA 3THRA 1W0JA 2CB9A 4X60A 5K0TA 1IXKA 3OO0A 1UBLS 4KLCA 4C03A 3ANNA 4K6KA 1MTZA 2IC5A 1CR1A 1ZIXA 1CZOA 1O89A 4ALMA 4IO0A 5C4IA 1QG2A 1X92A 1XQXA 3BMCA 1RPAA 4M3NA 1GXSA 3BFJA 5JUWA 4INZA 4CT0A 4MLCA 3CZRA 3IS3A 4Q3NA 4C1NA 3WLQA 2O2YA 4WSOA 1P17A 1ORRA 4GMGA 4MQFB 2G5GX 5D3KA 2ZB7A 3W06A 2HN9A 4XZ3A 2JGRA 3LQYA 3OX2A 1G6KA 3QF7A 4IH9A 6CHYA 4WK0B 5FOXA 1KWGA 4UDYX 3OJ0A 2H85A 2G9VA 4XJTA 3W9SA 1E2MA 4GU5A 4BFUA 5BSHA 5GTDA 1W1IA 1U3UA 1VHWA 4FYVA 5EHGA 1E2IA 2I87A 3LZCA 1U65A 1DDOA 2C5LA 4C4SA 2PXHA 2Q3EA 3E48A 4DBLC 4N6OA 4OJQA 4Z7OB 1JDTA 2UXCB 3DCIA 4IIDA 3H11A 4KGZA 4A82A 5HIKA 4G23A 4RETA 1ZD5A 4LDAA 1JFRA 3IYLW 4K0KB 2QLNA 2EKBA 2GXUA 4HKTA 4TLDA 3JD1A 4NZMA 3NIWA 2JKVA 4MQEB 2HQOA 4MAAA 1FFSA 2WYHA 2C57A 3TEMA 4Q3CA 3WR5A 5I7AA 3E3AA 4B43A 1D4ZA 4LJRA 3IT1A 1ZG3A 4DDKA 2OAEA 3DE4X 1EA7A 3JASA 2W2KB 3SM3A 2ZRKA 2PL5A 3HPRA 1B0AA 2QRHA 5JQWA 3UN1A 1VFPA 4DLBA 1K68A 1XELA 2BDTA 3IP8A 2DWPA 4L9RA 1XJWA 3LVRE 1NM5A 2JVKA 3G8AA 4M1TA 4OGKA 3RRNA 2PLWA 1E69A 4F4HA 2IQ5A 4LS3A 1QCCA 1RE0A 2QZSA 1A69A 4MK4A 1CQZA 4EMBA 3F73A 1JMKC 1WAMA 4DDUA 4NYMR 4QLAA 3E7XA 3M6AA 4BKPA 5EGSA 4Z86A 2EFDB 3L5OA 1IBSA 3H1FA 4ZEXA 2BHNA 4RV4A 4EWLA 1G8YA 3G2JA 4F5YA 4H1UA 1CS4C 4ZT7A 4CT4B 1XEXB 2E4XA 3Q72A 3PDCA 4F06A 1JR3D 1MXHA 3P9RA 4RS3A 2QLFA 2XBLA 5FOVA 3BXEA 1UPAA 5CVTA 2CMKA 1ZSVA 2QJFA 2ACEA 2IE8A 4F6CA 1QQTA 2QM7A 1TTTA 3CW2A 3WRYA 3BQMB 1JAXA 1YB1A 2RK3A 1PZEA 1OSNA 3M7IA 3CU5A 3R6DA 2AZTA 2IU0A 2G6BA 4WXMA 3G0OA 3JR7A 4MVWA 4EHJA 2X1MA 4RDXA 2C31A 1SHLA 1M1YE 5FTWA 3M1YA 4ZEWA 4TKUA 1V16A 3PUYA 2DH6A 3KTAA 4BNIA 1NVUQ 4BECA 1RAGA 1UODA 4G86A 1ZKDA 1HY3A 2P7IA 2VPPA 3HFGA 2Q8QA 2V59A 3FPLA 3OPNA 5H1YA 1G20B 5FULA 4H6PA 3A1TA 4IS3A 5E7MA 1XCGB 3TE7A 4NARA 4ESEA 2F4VB 3VR2A 2WWWA 1P39A 3KD3A 3MIZA 3QEOA 4RELA 5GOTA 3QNMA 1SHTX 1EHIA 1JMVA 4UDNA 2CL6X 3EQ7A 1VHQA 2J3EA 3LYHA 4ZDIA 2D54A 1C9DB 1DRWA 4B6QA 1K6EA 1EJ0A 1P2DA 4GF5A 1KYWA 3HB9A 3LDHA 3AT1A 3WIVA 2ODQA 3VGJA 4D26A 4K9OA 3ETGA 4EJ0A 3M5DA 1VJ1A 3FYUB 2D59A 3EXEB 3E3MA 1ZJJA 4FNGA 1XZIA 2R751 1K0UA 2HC9A 2QWXA 3CUWA 2GZMA 4OHOA 3L01A 3SFZA 1G8GA 2Q4BA 1QTNA 1IY2A 4I14A 4CLHA 4NBTA 5A5VA 3D3NA 2AEJA 3E15A 4HYYA 4UDOA 1KI4A 2G88A 4HQLA 3LBIA 1OX4B 1PGQA 3PWZA 4YONB 2IOHA 4MV7A 4MAFA 2PLNA 3AY7A 3B48A 3H5IA 4XD7D 5DYGA 4HJRA 4MPTA 5DYNA 1SBZA 2PBRA 3Q7SA 4WKCA 3CVXA 3FGZA 4U39A 4U9UA 3WDMA 2J5QA 3LIPA 3MCAA 4DMHA 1DIGA 1Y7HA 4PS1A 4ZAZA 4EHIA 2NTNA 5JS6A 1L7DA 4ID3A 3EY4A 1P0QA 1DT5A 3WKCA 5CB4B 3AETA 2J0UB 4KREA 1EAYA 4GLOA 1X39A 2HD4A 4M53A 2HUPA 2PX6A 2M1ZA 5DLPA 2IHJA 2H8GA 3KQSA 2JDIA 5BWBA 1Z63A 2PKXA 3WC4A 2QYSA 1CUJA 1AGYA 1NYQA 4PX5A 2F43A 4UHKA 5DHUA 2HU8A 2Z1MA 4V3BA 4ZQEA 2FN3A 5HZGA 4IJ6A 1V4NA 1IN7A 4INPA 4IDEA 2EKZA 4C3UA 1DU4A 1U63A 1VCHA 2XD9A 3LT0A 4XM2A 5LSAA 1WHTB 4P7JA 2A5GA 2B92A 2QX6A 3DEKA 1ZM3A 4FC7A 3COVA 5CTJA 1YGPA 3GN1A 3R7AA 1E79D 3SBOA 3LCRA 1DQSA 1E3WA 1RR6A 3A58B 3CWQA 1LQ2A 4LJ5A 4BRZA 5KOYA 1DAGA 3DUFA 3F0TA 5D6OA 3TUZC 1M7GA 1QE3A 3EF1A 3S2SA 5EWMB 2WZQA 3EDQA 2FQXA 1XD9A 2EG5A 1F2DA 2YVUA 4W6QA 2O2XA 1FY2A 3U7EB 4EA9A 1XD8A 4JBWA 2NO7A 3EXG2 2NU9A 3LZ6A 4GQIA 1H0KA 3TW0A 3H1TA 2YHBA 3CZ9A 3PPYA 3UXYA 3WL3A 9LDTA 1L7AA 2C59A 3DZFA 1LI7A 3WYDA 2SNIE 2I5PO 5IT0A 1NBHA 4RMNA 2FPOA 2QY6A 2XYPA 3H9BA 2J08A 3KEMA 2CLIB 2OQRA 2ZUEA 4QTXA 3CN7A 4DC9A 2VTBB 3HJGA 3HLTA 2I80A 4G4IA 1IUOA 2C5FA 3HJRA 1HWYA 3HBAA 4L6CA 2XMDA 1ZAYA 1BMTA 1RJFA 3ENQA 5DOVA 3OF3A 3ABZA 4IVRA 2CZCA 2JAHA 5EUQB 3UHOA 3TBHA 4WN3A 5EHIA 5E2BA 4AG5A 2KPOA 2X6TA 4MRNA 4TOIA 4GKJB 3BL5A 3V4VB 1Z5OA 3CA8A 4NNPA 5GQSA 1TXGA 4PAWA 4F91B 2G67A 3ACCA 5JMPA 4JYPA 3I83A 4OP1A 4RD0A 1BE0A 1PX2A 1FMCA 1SU8A 4IRUB 4DNOA 1U9IC 2VK2A 4DNFA 1FCJA 5I7WA 5HNKA 2CNWD 1RWQA 2ZS7A 3E27A 3OCXA 2I2FA 3N7TA 4MEBA 4EUNA 2LIPA 2A9RA 1I0IA 1B74A 5F12A 1V8FA 2YXLA 2G5TA 2Y8EA 3LNCA 4LVOA 5ICGA 5G4KA 5EPOA 3WSWA 4QHYA 1KAHA 4POOA 4UVDA 5JLAA 3N58A 2PKCA 1NYLA 1PJQA 2P6RA 1DQRA 4BV3A 2IV2X 1QHNA 4N0DA 2IUUA 3DAOA 1JB9A 4JL8A 3IHKA 3OHMA 1A98A 3I9FA 4TSKA 4PNZA 4ZDWA 4D02A 1R4NB 1LK5A 1GSIA 4I1OA 2MR6A 3HKCB 1G8HA 3PUJA 4KP7A 4KSCA 5JCJA 1H3FA 5K5EA 4KJZA 1L2TA 4E32A 1Q57A 3UK1A 1A9OA 1CZLA 2Y0BA 1S7CA 2G1JA 3R23A 2QVYX 3EARA 4MIKA 3R74A 1SXHA 2F3RA 3TFOA 4KGXA 2JANA 1Z0KA 2P78A 3NUZA 2BFWA 1QJ4A 4EIWA 3MT0A 4Q9AA 2GGSA 2FW0A 3IQWA 3DZIA 4NZZA 2R8EA 4PHHA 1MHTA 1Z7EA 4ZRNA 5DNCA 2J7PD 1IVYA 3SC2A 1U2QA 1DC4A 1K9SA 4CETA 4MCAA 3FOCA 4Q7EA 3KSAC 2O2DA 3GVPA 2O2SA 1AJEA 1Z36A 1IE3A 3PDJA 4JJGA 4LISA 1IOWA 1S2OA 1RXUA 4B17A 3JAKB 5AI0A 1S9HA 2EP5A 4C89A 5HSGA 3WIDA 3H9EO 3L41A 1LW7A 4KXYA 1QAQA 2KBEA 1LK7A 3P9QA 2NYAA 1Y6GA 1BCRB 4EPVA 4I1VA 1TCAA 3AHDA 2VK4A 3WAJA 2QXYA 3OLCX 1YU9A 4M54A 1J9GA 4ONEA 4WOPA 4B3IA 1GQ2A 3KXDA 4EX7A 4Q7MB 3MD9A 3RANA 1AS3A 2HPZA 1JW9B 4ITRC 2ZZMA 2EX4A 3HN2A 4QD3A 1P1FA 3T5PA 3RRBA 1DQNA 4EMUA 5D2CA 4UFPA 4Q39A 1IHUA 3A25A 3T54A 2XZPA 1HSOA 3GR6A 2BP7B 5H70A 1YDHA 1J39A 4E46A 4KFCA 5LBIA 3R9IA 1I5OA 1PLKA 2MYNA 2AV6A 1FNDA 3BZUA 1PO7A 4NZOA 1ZOSA 1YWGO 3DEHA 5HS6A 3B3AA 1EWRA 5TGTA 3WB0A 2AS0A 2BM9A 1PR0A 2R6FA 5JSYA 4BTEA 1N9GA 5DT9A 3GWGA 2Z4SA 3MAJA 4LYFA 5DP2A 2RHHA 2IEBA 2AD5A 5HDQA 4AMZA 1JEQA 3C3XA 4FBMA 4BJHB 3G9TA 4LE0A 3H2ZA 1F4LA 1KDZA 4PBSA 4PAMA 1X0VA 1U7UA 2FWIA 4OI1A 1YVRA 2AHRA 2HW8A 4L4XA 4M99A 5FF9A 4L74A 4IZHA 3P0HA 4YUAA 3NM6B 4IQ8A 4US0R 2BFCB 3H11B 1ZW1A 2PEYA 2X7JA 3FUUA 1VLQA 3VU8A 4DLRA 5KZMB 4I81A 2X1HA 2UUOA 4RULA 3TQCA 3IC5A 1P61B 2NTYC 1D7OA 2PFGA 3NBZC 3TLYA 2YZ2A 1YRWA 3O8OB 3DZ8A 1RKXA 3TTWA 3KDPA 3VYSB 3L8MA 2DT5A 2RH5A 4C4ZA 2VDMB 2VXCA 3QKRB 1JDUA 1KFEB 4DWWA 1VLHA 3WRXC 4KNYA 1GV1A 3LQ2A 3DB1A 2BEKA 3C3WA 4WKNA 1IXYA 4NCAA 4Y9UA 2QW8A 1AQUA 1PS8A 3BSFA 1Y98A 3T3MB 4KO1S 1MPTA 2R5FA 1JVSA 5IJ9B 3GA7A 3RPEA 3HG7A 1T8TA 1QF9A 3A11A 5CVJA 2P90A 5ULLA 4ZCIA 3N0VA 1V47A 5J40A 1X19A 1XB2A 4JZKA 1DHTA 5JJLA 2N3ZA 4XGKA 3HY6A 1RXEA 4RESA 1V9SA 1IXZA 3QYAA 5FTKA 3A32A 4ZOLF 2K2WA 2QLTA 1G0OA 4ZT4A 4LHYA 3NBMA 2O1XA 5EAIA 2QLMA 2GCNA 4KSYA 3G2MA 3QWHA 3V2GA 7MDHA 1EXWA 3NANA 1T9CA 4GSLA 2FGKA 1XNJA 4U7WA 1UQUA 3FB1A 1W34A 3S8YA 4QUDA 4DJAA 3LUGA 4A8JC 4B4DA 2VWGA 1SVWA 1T10A 2VP4A 1Y8QA 3C7AA 4EPTA 4WY2A 3ZU4A 4EVIA 5A4DA 3AEQB 4XM1A 3NBUA 2J41A 3P4YA 3VH3A 4DBVO 4ZAWA 1B41A 3KELA 4KPUA 4PLPA 2FWPA 4HXEB 5ETJA 5EXDA 1NVEA 3R3SA 3TM4A 3D8RA 3URMA 3EZGA 1M75A 1Y3IA 2JH3A 2XUGA 3SXJA 5GZ1A 4HLDA 2P30A 1F3LA 3FOFC 3EBLA 1JT9A 1WZNA 1LJ8A 2VC2B 4L16A 5KNCA 1DPFA 1U1DA 3GFOA 4TRNA 4TTJA 1UFRA 4EDHA 1JRLA 3UWOA 1TC2A 2ZB2A 2QUAA 4XH9B 1EK0A 1ZI8A 2O2GA 5FWXA 1IEWA 1WG8A 2EFHB 3L6OO 4G09A 5F51A 3RHSA 4I4TF 3UJDA 1XTSA 1Y82A 5AHXA 1N1DA 1FDTA 3WQSB 4DDVA 5JASA 1EFVB 1KDTA 3I1FA 5GGYA 3VU0A 3FTQA 3L4BC 3B13B 4O02B 1KXJA 2NYVA 1HYEA 4KQHA 2BEVB 3VZSA 1QVRA 4RTJA 1ZIYA 3DMFA 4I0WB 1YJQA 1HL3A 1NI4B 4FMCB 4JI2B 2ATCA 2IFTA 2ZVDA 5AWFC 5BO5A 3UXEA 4F9FA 2WG2A 3BWVA 3U7HB 4KKVA 4COOA 4F93B 3CLTC 1BXRA 5BSGA 1FTGA 4CF7A 3ODGA 3ZNNA 2QZ9A 1YK0A 3TG2A 2FMHA 2OC9A 4RDHA 2DFDA 3WG9A 4DKXA 3IXMA 1GPJA 1QBGA 3M2TA 3IPCA 2VNAA 1G55A 1R6VA 1MEJA 1N8SA 1JS1X 1T26A 3LBHA 3LD9A 5DULA 3WNZA 1SXPA 2ZI6A 1CQXA 4QTTB 3AOGA 2PUHA 4E5PA 3QG5A 2H1WA 5CB4F 1T8RA 4AP5A 1DTEA 1W1UA 2J5KA 1ORHA 2BE7A 2AH5A 1R0ZA 4L8WB 4KYTA 4FMDF 4K87A 1LPNA 1NR7A 1Y5RA 1KK1A 1FW6A 1GSAA 4PFQA 4BNZA 3AETB 3MTAA 4PFSA 1XDUA 1BEZA 1Z5UA 3IUNA 3PI6A 3R6LA 2YHIA 4L9SA 5EHZA 1ILEA 1J1UA 4YDQA 4MROA 1TFUA 4QICA 4EG6A 1ECPA 4L1KA 1NFFA 1VG9B 2GN4A 3H2GA 1XCLA 4DIKA 2HSDA 4Q4DA 3FBGA 4P2BA 5ALFA 5FUWA 1CHNA 4F45A 1Z17A 2Q3LA 1MABA 3OOHA 1QH1A 2CY0A 5FPTA 3KZOA 2DGDA 2JIMA 5G1NA 3VXKA 1NTRA 2VLIA 3GOQA 3UA4A 3BTOA 4DIBA 4N65A 3QNUA 1K3UB 3NC1C 2OPHA 2PQ2A 4HSGA 4JYCA 1GPH1 5K4HA 4LN1A 4PN3A 1OE0A 1PT9A 4IDFA 4RIGA 3CNBA 3C41J 5BVGA 2I2BA 1MFPA 1ECGA 2QA5A 2CE2X 4C6RA 4OXIA 1G7TA 3A4LA 1K3TA 5CDFE 5LKRA 3FD8A 4PZPA 3K5IA 4MJXA 3BBPA 1DJLA 1DWPA 1KKLA 2ALJA 3K20A 1XE3A 4RJJA 5C1IA 4PYRA 3W04A 4ETIA 1Z7GA 4GMKA 4X71A 4UCFA 1K08A 1NFRA 3ER6A 2C4HA 5CFMA 5K4GA 1NBWB 1SUBA 2X76A 3HDGA 2EC5A 3SBDA 1BX3A 2J3QA 2XNDA 3C6MA 3O9MA 1SVNA 1XZMA 2HADA 4IJKA 4KDFA 3AY6A 3HMQA 3ZYCA 1G8AA 3B7WA 1FPMA 3G9ZA 3T7CA 1BD3A 4L3WA 3UFBA 4DJ5X 2J3LA 3AJEA 3FSGD 3UJAA 2C5GA 5CDGA 4RK6A 2I7TA 4WKPA 1PR9A 2A5DA 1JHUA 3C7CB 3DNFA 4UEOA 2ZSJA 3EEOA 2GZAA 1UPUA 1R3UA 2Q29A 3IHLA 5MGBA 2QLJA 1BG6A 1BQ3A 1KR5A 3CEJA 1R0CA 3C98A 4JIGA 4CM5A 5KTKA 4X61A 1QRSA 3HO1A 1SK8A 2DERA 1XU4A 2TYSB 3SF0A 2A14A 2J6CA 2AR7A 1U0BB 2REBA 4ZALA 2H2FA 3KEOA 4G5SA 1SA0B 2XCIA 3PI7A 3O4FA 2O7QA 2ENWA 3LZDA 4J76A 2VHZA 3KPVA 3M89A 1ZQ1A 2DRIA 4LA4A 4PZAA 2FPXA 4UULA 2NIPA 4XQCA 5TF0A 4F46A 2Y4NA 4UAVA 3ML1A 4B33A 1E3IA 1GCOA 1QUEA 5A5FA 4D0LB 1C4XA 4XCVA 3L4BA 2YBEA 5H9WA 2FWJA 4U1RA 1Y9AA 2VT6A 3SY8A 4HNQA 1NASA 2ODNA 5G4KB 2HJ9A 4P81A 4QJ5A 2ZREA 3OIVA 1MFZA 4DREA 4MVJH 1MNQA 4IF4A 5JIBA 2P4QA 1DJQA 4PQYA 3MUFA 2OAQ1 3K8YA 3UW3A 1C3OA 1TQDA 1A2KC 2IW1A 2YWCA 3O8LA 4FDVA 2DPGA 4RHXA 4WNAA 2EFYA 1GKIA 3QXXA 4GKBA 2CEAA 1JG6A 1Y81A 3ISJA 4D3ZA 3LT4A 4CUZA 5KYXB 3IB3A 4OFXA 4F4DA 4UEKA 5J23A 3EVTA 1I80A 4JI3B 2KB0A 1NSYA 3E6AA 1O3YA 1ATIA 1UKBA 3EXAA 4M7PA 4M1KA 5CLQA 3BH6A 4DMGA 4D8UA 2WA2A 4BO8A 1ZRMA 2DHRA 3VAYA 4RKFA 4PBRA 2IPMA 2QYOA 4HUQA 4NBNA 3NHSA 3I2HA 5AVOA 1DO8A 1LFAA 2B6HA 5FORA 5TVKA 4QBFA 3QU9A 2BJWA 2W6JA 3MCZA 4N8DA 2FG5A 1GZVA 5CIWA 5THKA 2RI1A 1IBKB 1YDWA 4PZLA 3BJEA 5HF8A 4ARIA 2YNMD 3CUTA 3RK1A 2ZIFA 5KJEA 2PD4A 4IXTA 3PQ6A 3CT4A 1NF8A 3FWNA 4KBYA 4RMJA 3U7GA 1WMFA 1X8XA 4NS1A 3AEUA 3JQFA 2XGOA 4M6WA 4OO3A 5J59A 5BRAA 4MA0A 4YCCA 1UWVA 3OPYI 1VIVA 2EV9A 4HDMA 4ZZ0A 1CERA 4P4TA 3VNAA 2RIRA 1YONA 2CVZA 3C85A 4GX1A 1VSVA 3KR9A 4S24A 4DZZA 1E5VA 1CRPA 3DQPA 5K0GA 3O91A 1AV6A 4RFVA 1Z83A 1F1BA 3W8FA 3OZ7A 3OZBA 2HOQA 2Z08A 4QVGA 5C1PA 2PMEA 4LX0A 5CCEA 1RFLA 3DQQA 4X66B 1XXHE 2QPTA 4WK4B 4PZCA 1OZHA 3HL4A 4PCLA 4N41A 3TQIA 2E5LB 3ZHTA 4DV4B 1W85B 2D5BA 3EXG1 4EGSA 1YVEI 4WXHA 4ZCLA 4BXOB 2V65A 3HYRA 1NQVA 4OG2A 2NU6B 5IJAA 4HPJB 3SSAA 3DMDA 5C7YA 1E1QA 1OGJA 3W8NA 3OJOA 4BYGA 2Q28A 2WPNA 1E8NA 1A4UA 4QFMA 1N9GB 1FZQA 1I1QB 1PG5A 3GT0A 1X7HA 5KYWB 1QGOA 2XDYA 3HNOA 1ORVA 4R1OA 3OLVA 2FN8A 3KLBA 2QV7A 1NN5A 4HL6A 1M0TA 4PSUA 4DBLE 5MN6A 5T64A 1ZLYA 3VHXA 3KVYA 3F5DA 3KSZO 4EFMA 4G07A 4D6XA 3MAGA 3I8SA 1VBNA 3PC7A 1UM9A 4L78A 1AHPA 2CD9A 3D6JA 3PC4A 4WEOA 3FOWA 3WMRA 4DLKA 4ZZ3A 3VR6A 1ZEMA 4FE3A 1TTQB 1NVFA 1TE2A 4TL6A 3L0OA 3FNEA 3DPSA 3P0JA 2X5XA 4HX5A 4WLEA 1S1CA 3R0XA 1I6KA 2BH9A 3DHEA 2I67A 3ISTA 3DTVA 4K9LA 2FR8A 2JI8A 2DHEA 2PBZA 5JZ9A 3VPSA 1K6MA 3NNNA 4QSHA 2ZB8A 5HTKA 1PKEA 1GGJA 1E5XA 1NXSA 2VXYA 4KSBA 1PR3A 4Q21A 3FNFA 4H6XA 3K05A 2HSWA 5KTOA 3UAYA 2JHCA 3IVMA 4ZI7A 4Q1BA 3WLHA 3ZTWA 5CD1A 1KO8A 2AQIA 5J2UF 4B0OA 3ZH2A 2ANBA 4YPOA 2Y0DA 2YCLA 1PNVA 1JECA 2V6GA 5KIAA 1OH7A 3EA4A 2OGSA 2DQ4A 4LAFA 4QODA 1W94A 2CWDA 1FP2A 2CVPA 4JI5B 1FPQA 4FFOA 4U9IS 1P2FA 3U3XA 3HJBA 4FOTA 2E2WA 4L57A 1FTNA 3DO5A 1NPTO 3T5DA 5CW2A 1ZJ6A 1R2QA 2I3BA 3BHNA 4OHUA 5CBPA 4L5JA 4S04A 3IUJA 4LNUB 2WMYA 3K2QA 4NMLA 1DO0A 3ZTTA 1CR0A 1ZD3A 3KVNA 2A33A 4O3FA 2YNMC 2F64A 3HU5A 3CF4G 4Q15A 1U2ZA 4EGCB 2AEFA 2H57A 2F62A 2FZ5A 2BE9A 1A1SA 4WH0A 4RKWA 3T94A 2EL9A 4PO1A 3DFUA 3R5SA 1U5AA 5ENDA 5G3ZA 4TN5A 5JZMA 2Z56A 4OJTA 4GSKA 2O5EA 4DSUA 2J9RA 4TL7A 3L1IA 4QOIA 1XA4A 4DADA 4D80A 3DVLA 1GNSA 2BPOA 4J6EA 4ODIA 2ORWA 3MMSA 4JFRA 2B0CA 5BSKA 3RVQA 1L8AA 4C01A 2RGBA 4IGIA 5BOSB 3LW7A 4P4LA 1XLVA 3DOIA 5HP4A 4OLHA 1ODFA 2IV7A 4LGVA 2EDCA 3K0HA 4FEYA 1X1DA 3FUTA 4HAOA 2HI0A 4LXHA 3PICA 5DXJA 3VZCA 1NR1A 5EEGA 1L5NA 3T61A 3AR3A 2ZRLA 3D4PA 3PSHA 1U5CA 2BMFA 2GTPA 2QX7A 1OJ7A 1F5NA 1LF5A 1XQVA 4QSMA 4D4MA 1OLUB 4WNYA 2A1TR 4ZGWA 2W6NA 4EY7A 1E89A 4MA5A 3NOOA 5CEFA 2HXGA 4QHSA 3AKZA 3EHEA 3TPFA 2F3TA 3MZ0A 1I2DA 1E0DA 2Z09A 2G4VA 1S2GA 4DN6A 4ENQA 5IZ4A 2IKSA 1EBFA 1QYWA 2UYHA 2QRKA 2EOAA 3ZGOA 4CI9A 1M8PA 5L9AA 3JR3A 1X7YA 2VYND 5L51A 1QIMA 1L8QA 1SUCA 1MG5A 4MX8A 4PO3X 4YJKA 4Y2UA 4FYKA 4HWSA 1NFQA 1LLUA 3ES9A 4Q48A 4Z4FA 1F4VA 1F2UB 2QAGB 2JCVA 2V4UA 2O7RA 2Z9DA 1XU9A 3AFOA 1ULSA 3SQWA 5L4LA 3SR0A 4C87A 2LDXA 2ZIUB 3RU9A 5B3LA 1SXJE 4A6PA 1NV8A 5FFNA 1OU4A 5TF4A 2VJNA 2OILA 3QUQA 1NOJA 3OMLA 3BK2A 4ZHQF 5CCXA 2YW2A 2A1TS 2W4QA 3WL4A 4EUEA 4DR3B 3MT8A 3R9XB 3F74A 2LGJA 3DHWC 4EOGA 4IILA 2NMVA 2FPIB 1MT3A 2EKDA 5BXYA 3IO5A 3SNHA 3CEHA 2QX8A 3QW4B 1E2GA 2Y93A 3B2EA 4RA9B 4WXYB 3O21A 3STTA 1QUFA 3ICVA 1O4VA 3RADC 3L1UA 4RS4A 4RTKA 4DQKA 3G2NA 1U8FO 2WJJA 2CV2A 3DLBA 4K28A 1U9ZA 1BEUB 3A2LA 3ADBA 1IBLB 3TTYA 4RKRA 1CD5A 2FPPB 4Z7NB 4ZCTA 4MS4B 1HOXA 3T5MA 3HJFA 3E1SA 2AX3A 4PCAA 3VYRB 4DCOA 2VO1A 3PL5A 1ZCJA 3HRIA 1IY1A 4QQFA 4B82A 3G8CA 1GFIA 3QSGA 4O2AF 1H5NA 3TEFA 3TIGA 2PRKA 3T3GA 3HXKA 4LHZA 5CIYA 3LO8A 2OV3A 3V34A 5FTMA 4IVQA 4M9CA 2BCEA 1O96B 3PDIA 1MX9A 2YYYA 1XF1A 4KWHA 1QGDA 2BMDA 3KKZA 3PE6A 4R41A 1U5BB 3DV9A 4TM8A 1AA9A 1Y6JA 4JVOA 7YASA 4TRRA 1P74A 4K46A 4GLLA 2H2WA 4QBGB 1MP0A 4KN6A 4PVCA 1RAEA 2CHQA 3QXSA 2XLCA 3GFFA 2Y1XA 1DTWA 1P18A 3O2SB 3F8TA 3TSYA 4IHJA 1K6IA 2V6MA 3GRKA 5EYPB 1CXZA 2QW0X 3NX4A 4POAA 4FFNA 4D43A 1UADA 1GADO 3B1WA 3H4TA 4O8ZA 1SVMA 5L7YA 10MHA 1GIAA 1ZS9A 1I9CA 4P7GA 2QT1A 2F4NA 4YCDA 4RLQA 1KJNA 3QEJA 1AGPA 1BW9A 1Y3CE 5FBKA 4AAYA 5LP6A 4U9HS 1RYZA 3CRVA 2XUFA 3OJWA 2AG6A 4RH3A 1XTKA 1XMQB 1Q7GA 1Y4ZA 3V7WA 3NBFA 1TPYA 3NWEA 3QU2A 5LQJA 1ONPA 3LVBA 2QI9F 3HGTA 3QWBA 2JLAA 2HCJB 1QC5B 2MYTA 2BWJA 1ZC4A 3FMIA 1QHEA 2YZ7A 5DCUA 1E1RD 1T5IA 2GT1A 3VPHA 4ZVRA 3R5HA 1R4ZA 1WPQA 3VR5A 4BQFA 5GGXA 3UWKA 1QAMA 3IBCA 1Y89A 4JN6B 4Q3LA 1I4OA 3VO2A 3E2IA 2GPBA 3EH2A 1GKKA 4ZT5A 3SLGA 4TV8A 4C06A 2I6UA 4QQKA 1WVGA 4BCBA 1ADJA 3RYHA 2A1UA 3ZZTA 4CKCA 2GYUA 3SZMA 3WGIA 4P36A 1GA4A 2IH2A 4R1QA 4WLFA 3UNXA 3QMMA 4YVFA 4D6PA 3TZQA 1WXEA 3S2YA 4GFDA 4Y2YA 1KZ1A 1HG1A 4Y2PA 1G9TA 5KYXA 1J8MF 2AOWA 2F3PA 3DKRA 2QR2A 5FA6A 4K1XA 3REQA 3HU2A 1VKHA 4WOKA 5AOVA 4YMUA 1A4IA 2C7VA 2ZBDA 1FRQA 2J7KA 4X20B 3SC3A 5ADUS 4LGCA 2IPNA 1L1QA 3OH8A 3ROTA 4YB8A 3AF0A 1EVIA 2Z0MA 1BCSA 3QYFA 3IAAA 4EQ6B 3ZWPA 3OMWA 1S7GA 4FBLA 2A7QA 4L6AA 5EMKA 3ZDRA 3KQOA 3LRPA 4BX9A 5ECDA 4R1PA 3OU7A 2D00A 3FRHA 3LQ4A 4KW7A 4WECA 2OCBA 3B60A 1NVKA 2GPNA 4DJJA 5ALVA 1W46A 2GYVA 1KK0A 4PSCA 4I8DA 4L75A 1QO9A 5AOCA 3V1LA 4O2AA 4TROA 3D8UA 4YAWA 1M2VA 3DKKA 3W5JA 2JBHA 3RC9A 4CXMA 2I6SA 2GZ1A 1ND5A 2C3UA 3AEKA 5EIBD 2I65A 2WKQA 3HB0A 2QTFA 2CFCA 1ZUNB 3IQIX 5LLSA 2VI5A 2NNWB 2C2MA 1RHMA 4MW7A 3HEBA 4IIGA 4NENA 1TYAE 1D1PA 2H1FA 1FVFA 4RD1A 2XUZA 5C8YA