2DKOA

Extended substrate recognition in caspase-3 revealed by high resolution x-ray structure analysis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-3
publication title Extended Substrate Recognition in Caspase-3 Revealed by High Resolution X-ray Structure Analysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2dkoA00
4QUIA 1RWVA 3SIRA 1NMEA 2QLBA 1K86A 4QUDA 4AWBA 1QX3A 3E4CA 2QLFA 3OD5A 2FQQA 2H5IA 4IEFB 1NMSA 2XZDA 3DEKA 3D6MA 4FGUA 4EJFA 2H4WA 2HBYA 2XZTA 4QU8A 2C2KA 5IAKA 1SHJA 1RHJA 4QUHA 1RWMA 3P4UA 3BIJA 3V4LA 2Y1LA 2HBRA 4D3XA 1RWNA 4D3YA 4PRZA 5IAEA 4DCJA 5LU9A 1QDUA 4QUEA 2H4YA 1RHUA 3EDRA 2Y0BA 4JQZA 4QUBA 4JQYA 5IAJA 2H54A 3R7NA 1QTNA 1RHRA 3D6HA 3SIPA 1SC3A 2HBZA 4QUJA 3S70A 2AR9A 4JB8A 3UOAB 4M9RA 3R7SA 4FEAA 2CJYA 1F1JA 5IABA 4ZVTA 1I3OA 4PRYA 4DCOA 1SC1A 2QL7A 3DEJA 5I9TA 1CVRA 4QUGA 3DEHA 3H11B 3H1PA 4QUAA 2C1EA 2FUNB 4N6OA 4EHKA 5IBRA 2QL9A 4JR1A 1RHKA 5IARA 2HBQA 1RHQA 2CNOA 3V6LA 2CDRA 4N7MA 3R6GA 3S8EA 4DCPA 4HQ0A 4JJ8A 4NOMA 5LUBA 5LUAA 2C2ZA 2CNLA 3R6LA 5IANA 2J33A 2J31A 1M72A 1RWKA 4N6NA 2J30A 2NN3C 3H0EA 4ZVSA 3V55A 2FP3A 4HVAA 4IYRA 1SC4A 4FXOA 2H5JA 3UO8B 4HQRA 2XYHA 4QU9A 2XYPA 4ZVOA 2K7ZA 2DKOA 3IBFA 4ZVPA 2QLJA 3R5KA 3D6FA 5I9BA 3GJQA 1ICEA 1SHLA 4AWAA 4EHNA 3RJMA 4JR2A 3KJFA 5IBCA 4FDLA 5H0IA 4EHDA 2XYGA 2H65A 1K88A 5IASA 1RHMA 4JJEA 1PYOA 1IBCA 4NBLA 3KJQA 3PCXA 4EHAA 4ZVUA 4PS0A 3DEIA 5IAGA 2CNKA 4ZVRA 4I1RA 4JJ7A 4N6GA 4D3ZA 1GFWA 4NOKA 4QU0A 2J32A 4N5DA 1RWWA 3H11A 4PS1A 4AW9A 1GQFA 2H51A 3KJNA 2QL5A 3NS7A 1JXQA 4LSZA 3V6MA 1NMQA 3EDQA 3R5JA 4ZVQA 4NBKA 2WDPA 1RWOA 4EHFA 1I4OA 3PD0A 3ITNA 3NKFA 1NW9B 3GJRA 1BMQA 3K7EA 5LU8A 3PD1A 4QU5A 4EHHA 5JFTA 3GJTA 1F9EA 2H48A 5K20A 3H13A 4NOJA 4NBNA 2C2MA 4I1PA 1PAUA 3V3KA 2C2OA 4JR0A 3V4OA 4QULA 4EHLA 5IC4A 2CJXA 2CNNA 1RWXA 4NOLA 4QTYA 3IBCA 1RE1A 3R7BA 5IBPA 4QTXA 3NR2A 3P45A 1KMCA 2P2CA 1CP3A 4N7JA 1I4EB 3GJSA 1RWPA 5IC6A 1I51A 3QNWA
chains in the Genus database with same CATH superfamily
1RZRA 2NGRA 3GRKA 2I6XA 4MUFA 4BNUA 4Y9TA 3L8EA 3NB0A 4I55A 4PCUA 2Q2WA 1H0RA 1PZHA 2R87A 3EEYA 3HS3A 3KWMA 2PHZA 3UAVA 4BEWA 2YYAA 2MSLA 3P2OA 1IB0A 3U9LA 2ZJFA 2ZJ1A 1GNQA 1N0VC 5FFFA 4J0DA 3WLOA 2CLOB 5BWNA 1BDMA 2NO5A 5CK4A 3WTCA 2VTBA 1EFHA 3EZXA 2C4TA 1EJBA 4MA0A 4F5YA 3JVDA 4DR5B 1K75A 5EQFA 1DJMA 1XMIA 2XVYA 2P62A 4GMHA 4HTFB 5H3LA 2I55A 5DE3A 5AK0A 3GPLA 1GRCA 4Z9XA 2WYOA 3HJHA 1KSJA 3PXGA 1Q7GA 3OU7A 3RUDA 4O2LA 4TRMA 4C30A 4BJ6A 5DI3B 2BE9A 1KAOA 2OBYA 4V0RA 4YUYA 1AVTA 1BU8A 1FFDA 4G5GA 2XSZA 1QC5B 3QJYA 5D85A 5T7BA 1U1GA 2E4ZA 3PX2A 3ZY6A 1N8NA 1XFDA 5DTEA 3I9V6 2YVLA 1MN6A 3TD6A 4DZZA 2GVNA 5FBVB 4N3AA 1TC1A 1H2AS 1WXGA 2WI8A 4EPXA 3QVWA 4WNAB 5DK6A 2F64A 2G08A 3B6JA 1HV8A 4X1KA 2A35A 1T2FA 2IYVA 2RIRA 4OI4A 4COOA 4CMIB 4U7DA 3Q8KA 1XG5A 1UP7A 2VVTA 3PDIA 2E5LB 2N46A 2VK1A 1NZJA 4FK8A 1U0RA 1HWYA 3O4FA 1FVXA 1UJ2A 3HA3A 3KOXA 1XA0A 2EJBA 4YRLA 3D3JA 4IDFA 5LL6P 1OC4A 3LX4A 5BV1A 1D1SA 3OT4A 2IH5A 4RZ3A 5H83A 1KFJB 1NZFA 3PFCA 5HGXA 5SV2A 3UTCA 4EA8A 3IMGA 2LTAA 3KJGA 2I6UA 2OC9A 2WD8A 4EKNB 2FQWA 1Z6TA 3ZH9B 1T0UA 2HPAA 2AL7A 5FH9A 4DVJA 5JZVA 1Z13A 3ICWA 3Q0TA 4I4TA 3TVDA 1Y8AA 2HGSA 4KV9A 2P2LA 5IUKC 2QPTA 1WU7A 3KOYA 5A03A 2CLMB 1J70A 1MJGA 4G4SP 4AY5A 4JN6B 4JLNA 3VR6A 1S01A 1TEXA 2I3GA 5IAGA 4TS1A 3SAJA 1YV9A 2VN8A 2XRFA 4IUBS 121PA 1UK8A 4XVRA 4MB2A 5K03A 2PV7A 3DL0A 1NQXA 5ESWA 3PTLA 4FT2A 3OIDA 3R7LA 5CTJA 2I33A 3R9IA 4LQLA 2QNBA 3R09A 3E9DA 1RRVA 4KFRA 4HQ6A 3VR6H 4H16A 5ESDA 4U6SA 1KNXA 3U81A 5GONB 4JUBA 5FWDA 5B3JC 5K3CA 2G04A 3GLHA 4B76A 3MCZA 3MJHA 2AFIB 3C4JA 1QU3A 4KN5A 3RSSA 5LP6F 3GNQA 4FD3A 4YJGB 1UXOA 4YQZA 4EOGA 3EDYA 3TX6A 1I4EB 2HDWA 3QEJA 1NVWQ 1U1EA 4F4UA 2XCIA 4MP8A 2A5FA 1CY7A 2AG1A 3ESBA 4M1ZA 5AVZA 1V6AA 1V3UA 2C7RA 1YU6A 4F4HA 3KOMA 2QF7A 4AN4A 1MEEA 5DYIA 4EY8A 1RC0A 4QDUA 1R37A 4JKIA 5KYUA 4FZ5A 4JXKA 3CCBA 3FCYA 5JWOA 4OFWA 2CE7A 4RDIA 4FGUA 5AJUA 4MZXA 2CD7A 4GYYA 2OFFA 4TXNA 4D02A 5JAHA 3O8NA 4NZNA 3GLHE 1W76A 3DB1A 4P0QB 3WIUA 5TIIA 2OE2A 2GKGA 4AVYA 4D9BA 4KW7A 3VVCA 3ZHTA 1NJ6A 2GUGA 4FYHA 4UTOA 4DY6A 1ZN9A 4ZI2A 3ADPA 4U7HA 1YA8A 1KEEA 3PXAA 4JQYA 4R71A 5F23A 4DZRA 3KD3A 4OQXA 4PBTA 3JYNA 4BNDB 3ED5A 3QA3E 3P96A 5CB0A 2ABWA 2E9SA 1USKA 2WIGA 2OYCA 3U1VA 2ONYA 3HPRA 1SUBA 3ABRB 4YGYA 2GSDA 5L3RA 1IJBA 1DWPA 2VDNB 3TQHA 4CUJA 4ZODA 4MINA 4Q1AA 1QBKC 1NW8A 1HSZA 1MEOA 3H8JA 5HDQA 4JI3B 4O2BF 1DFHA 5AVOA 1Z68A 3PQ3A 1VDZA 1FP2A 3L1VA 2IPAB 4R9RA 2B4QA 4EUHA 3BORA 2E4YA 5CJJA 3MJSA 3O5AA 3RU2A 1HKHA 5BVHA 4QWMA 5LNK1 2QUKA 4L08A 3IBSA 1WSWA 2FEXA 2H1FA 3OUZA 3MAJA 1C1YA 3BH7A 1ELOA 4RNDB 3CLTD 3DQPA 2WU0A 5F5XA 1X1SA 3I28A 3BWVA 1GZ4A 3EJ6A 3RF7A 1ICEA 2JGNA 4BGIA 1IJEA 2NYUA 3G7UA 1EG7A 1AQYA 3M49A 3OHMA 4H3VA 4DNPA 3AX6A 3H9BA 3WKCA 3AP2A 3NKVA 2GEFA 4P4GA 4Y7CA 4FP9A 4WEOA 3WWZA 2WTUA 1WXWA 2RGGA 3W06A 4D8YA 5G2OA 2Q41A 2YX1A 2EFCB 1SD2A 2DFTA 1BJTA 2QRZA 2VYNA 1D0IA 1AN9A 3B7WA 2XD9A 3JS5A 1H2FA 1R0LA 4JI0B 4EBBA 2CZQA 5L3QB 4YO8A 1XD9A 3DMGA 3VC3A 1GIAA 1CNMA 4O08A 2F62A 3GJ5A 3ZPXA 3SXUA 4BB5A 2EKLA 5DGHA 5LLSA 1JVSA 1XWFA 4RIEA 4J0GA 3RQIA 3IC5A 3Q4GA 2I03A 3EDOA 1A9ZA 1L5YA 3DGFC 4O6VA 3RRMA 4XVUA 1X39A 2BP7A 1P74A 2XH8A 3FBTA 4Q0MA 4E33A 1N3BA 1UXIA 1S7GA 4WUVA 4RL4A 4UREA 1MO5A 5ITZA 4G8BA 5K3EA 4HYYA 1S2LA 4OIMA 4LUCA 5BWLA 2Q2NA 1DV2A 2OORA 3U44B 4HADA 3V4VB 2HDHA 4ARCA 1GZDA 4RLFA 4JR0A 4D4JA 2ZAYA 4QREA 1L4BA 1Y33E 4Q3NA 2WV9A 3O9MA 4CCYB 4XWAA 4C7MA 4HWKA 2YHIB 4ZGWA 2BRUA 4BN0A 1NV8A 3FZGA 2GAIA 3O4GA 3ZXXA 2ZAOA 3BAZA 4RHXA 4RD1A 1MRNA 3TL2A 1YVUA 1O77A 1E1YA 3S7TA 3CH4B 3IUJA 4LJAA 4X92A 5F12A 3AW8A 5B6JA 6REQA 3U4IA 1SIUA 3HCCA 3AQ4A 4MJXA 3SC6A 3UB3A 1IVYA 2ASVA 3EYWA 4BIMA 5A4KA 1KC1A 5JVDA 2H5IA 1IZ8A 2JIPA 4BU0A 1E4EB 4HPJB 2P2ZA 3L92A 5SZKB 4W6ZA 4DL9A 1QFJA 1Y98A 4ENSA 3RIXA 1KPGA 1PX0A 1GPLA 2FAXA 4BEJA 2BM8A 2O3JA 5K4GA 1QYRA 3P9IA 2FP4A 4Y18A 1Y8CA 2ODQA 1YRYE 3H75A 4XTRA 4EA9A 4DRZA 1T2EA 2OMEA 4Q24A 2ESRA 2C5EA 3FPAA 421PA 4RDXA 2WD9A 3P71T 3GV0A 5AHRA 3G6WA 3OQIA 1QTNA 3Q8LA 1L7QA 3WXMA 5K0ZA 5K3BA 1KOLA 2QYSA 1LZKA 1QYXA 2ANCA 1U9CA 1YA4A 2BFFB 2GJ8A 2XNCA 2NXCA 4FU0A 3IV9A 2ETVA 4U7GA 4XIFA 2QZSA 3OAAD 4AT1A 1UKZA 1W2WB 3NRJA 4PZ0A 3THSA 3FFWA 3QKTA 1YQDA 5DBGA 2ZTUA 3AY6A 3U4HA 4F4CA 3NETA 1N1DA 4LY3A 2VJQA 3ZWNA 3AB3A 1XDZA 3BGWA 4OI0A 4ZEVA 3LO8A 7REQB 3HCRA 3IQXA 1KSHA 3KXIA 4KIWA 1QH9A 3LL7A 1S3SA 1E3JA 3E58A 1QHGA 3HY6A 1U5BA 5I8PA 3D3WA 5H5JA 4ARVA 3RIMA 2WJVA 4ERNA 4FILA 3OJ0A 2NT3A 5IN5A 3DM9B 4DR6B 2OT3B 5LXTB 2WWWA 4UM9B 1MBZA 1WMFA 1ZG3A 1QCDA 3T3IA 2HB6A 4QQKA 1YL6A 5DM1A 1F3OA 2FMKA 2QN3A 3V8PA 3IUBA 2G9QA 1CUGA 4IV0A 2I22A 1QHSA 2HRQA 2JL1A 2HSJA 1XPOA 4TSKA 4RTJA 4N8SA 4N12A 3OICA 1GUAA 5EZYF 2ZT6A 3NG1A 5DASA 3NDIA 1AHIA 1KYQA 2E4VA 3NC1C 5J5AA 3LIIA 4L8VA 1J0EA 5KPJA 1QG4A 3CVVA 4L5YA 2JIBA 4RXTA 4TMFA 3LP8A 4B1FA 4LY9A 5JZSA 1GAXA 1KRXA 2H2AA 2D4HA 2P9FA 1LJLA 2XOKD 1CDOA 3GEIA 3P0EA 5BNIA 1F6BA 1VYTA 2EP7A 3DZIA 3ETJA 3NGXA 1D0VA 2HSEA 3LF1A 2ZQYA 3AF4A 4M9XA 4Z0PA 4Z5XA 5CT4A 1W48A 3WIBA 4AICA 1H42A 2GHTA 4LXXA 2FFJA 4RQUA 2PSFA 1T5LA 2HU2A 3NHYA 1T0HB 2N42A 5FUMA 6CHYA 1XZPA 2CJFA 4R2MA 5EN4A 5JNRA 2CLHB 2HDOA 2RCNA 1GSIA 5I01A 4BC1A 5CAEA 2AEEA 2B34A 3EWAA 3SC2A 5FDFA 2ACWA 4KSYA 2UYCA 1R1DA 3ENZA 3FNHA 3JQ9A 5TSDA 2WM2A 1KK2A 2AQKA 2YVAA 1NOJA 1X74A 4K9SA 3I1JA 4C3ZA 3FNRA 2NXEA 2E82A 2G17A 4WFIA 1OR8A 5DRTA 4A0GA 4S24A 3VBCA 1K06A 1MO4A 2BY4A 1VMKA 1LFDB 3PUVA 1DOHA 2P7IA 2WHQA 4RZIA 4FBMA 2WC1A 3COZA 5LZ5A 1X2BA 5LQUA 3PUWA 3WYNA 2PUVA 1HDXA 3WLPA 3CUVA 4UQOA 2WT8A 3A27A 3IODA 3O9VA 1T34A 3OZGA 3ITDA 4X54A 3LTNC 3H5RA 3I2GA 1PQWA 3MRXA 4GECA 4LJ8A 4QNMA 2YXDA 1OI3A 1YJCA 3GRUA 1W4AA 4CM6A 4D9KA 1QRTA 2GRAA 1HRDA 3V46A 1GPKA 2H17A 1RJGA 5DM2A 4M9ZA 3BXZA 4C4RA 4FFBB 3D8TA 1Z2AA 5AVVA 1QANA 5BR1A 1X19A 4D74A 3DCYA 1T0PA 2OFOA 4Q05A 3E0XA 5K3DA 2ZDQA 2WM3A 3BWMA 4AJLA 4BNGA 3ECCA 5ELLA 1HTBA 1XTVA 3QVLA 3HL4A 1TLTA 2PT7A 4GD3Q 4GX5A 2I62A 3ZX4A 3AFOA 2QGZA 1U2GA 3GUVA 3KTOA 2JLYA 1E1CB 2XQJA 4LDPA 3ZBTA 1U7HA 2FOIA 5K3FB 3M33A 4DJEC 4LPKA 2CHVA 2JLZA 2Q6OA 2C99A 3NYQA 4FNMA 4ZVTA 2D0PB 4BKPA 4RYLA 4ACAA 4FFWA 4JVMA 1XTUA 4GMXA 4RTPA 4BVFA 4LBYA 4GBED 2Z6VA 4UM7A 3KPVA 1KI2A 2BGLA 3C5WP 2OCAA 3JATA 5DNAA 2JPDA 5FFMA 1ZVMA 1OWMA 2VR1A 4NR0A 2ZTLA 4KDCA 1HZJA 2RGYA 2Y1WA 4UTNA 4JA2A 4P82A 1Y5RA 1JXAA 4ZVSA 4W99A 4FJ2A 4PAGA 1JECA 4X60A 4C14A 3GY0A 4LOKA 2D7CA 2VCYA 2XA9A 2PX0A 4GWGA 5EJMA 1YTLA 2VF2A 3P9XA 3KTAB 4ND4A 2G8NA 1YVRA 4CMGA 1DTEA 2ISQA 2ZS8A 5A1TA 1ZCFA 1ZUIA 2QAJA 4DLBA 3PIRA 5A6SB 1YCDA 1ZU4A 5AMXA 4FBGA 3T06B 4MQLA 4EUSA 2B2NA 3ONFA 5CDGA 2JGDA 3AKZA 4LZOA 1N25A 5FNVA 3VC2A 5JHHB 3LCMA 4ES6A 1ID8A 1IBCA 1KZ7B 1K97A 2BTOA 4RK7A 1OYWA 2G0AA 2WZDA 3DKPA 5MGBA 3H6GA 5AJYA 2PUWA 5K0JA 1ZDMA 1F2UA 2DUWA 1OROA 5CM9C 4M3NA 1LLCA 2DCUA 4XX0B 4ND3A 4GXTA 1KMHB 1P5ZB 2IZ1A 2VWQA 1T36A 2IUTA 4R3UC 1U0OC 4Y9SA 3MIZA 2J45A 3EVNA 4GS5A 1X7DA 4HUQA 5GJBA 2FZCA 2RHGB 4KN6A 4YA6A 1YDHA 3ZY5A 3BWDD 5LU8A 4N9QA 3LWNA 1UK7A 4A8HA 3E3AA 3S2UA 1F06A 1OZAA 2PD6A 3W4IA 4LZLA 1ADBA 1JFLA 1G8YA 1OFTA 1RQGA 5FX2A 2CJXA 1GPBA 2O3UA 2QMOA 1E1QD 1OGIA 4WCFC 4BFCA 1FJ2A 3FVWA 2VDPB 4GICA 2ACKA 2P77A 2D3TA 4PQFA 1SELA 2NO4A 3D0OA 5BN4B 1IRXA 2D1SA 3PNSA 1ILWA 2H5LA 4ISCA 1G0NA 2GXSA 3CB4A 3EIWA 2ZJ5A 4GR5A 3CX4A 1CRWG 3TW4A 4ZEOA 3HXLA 2IEGA 1ZCBA 2GQ0A 4JCCA 4JUDX 1JU9A 4I36A 2V7GA 2G4CA 3CO5A 1XIVA 3BTVA 3PJEA 1QGUB 3P2KA 3TZKA 1J24A 9GPBA 4XDGA 1IBLB 5L7YA 4U63A 2RIPA 4UU7A 3NOXA 4XDYA 2YN0A 4FZ3A 1VKHA 3FBWA 4D9GA 2EX1A 1B2RA 1GPJA 4AJHA 1URPA 3PHLA 4PZUA 2BF4A 4R6XA 5H4HA 1PK7A 5LQKA 3PNQA 3NT4A 1RP1A 3WL8A 1QDUA 2ZB4A 2JDIA 3UMBA 5B2FA 1GZ7A 2YMPA 3D8NA 2FV8A 1HOXA 1IAVA 3KU1A 2Q7OE 3V9PA 1N1EA 5IEJA 3RODA 3EDCA 4XVHA 1UWVA 5DHUA 3FCUB 1V5FA 2MMCA 1ESNA 1Q1NA 3SQOA 2HEIA 3ZG6A 2XY4A 3NBQA 2SHKA 4LKRA 5JBIA 1N75A 3AETA 1O5OA 1A8SA 3QPAA 5TQ2A 4PAWA 3WJ1A 2R6AA 3GDHA 4QJ3A 2AGVA 4ND8B 1NXQA 5DT9A 5F73A 3ROKA 3TL3A 2YINC 3FVTA 1L8AA 4XCVA 2MTBA 5IARA 4BKOA 2N75A 1QE5A 2PXCA 1PSZA 1Q11A 4B3MB 2ASEA 2WY2D 1IBMB 2GNAA 2IYQA 2OYSA 2OZLA 3AY7A 1OJLA 3NEJA 4GRIA 2FU5C 1D1QA 5EKXA 1PWEA 1T8WA 4QXOA 3W4KA 2FTKE 4C5CA 3OZWA 5JECA 3AF6A 3FTFA 4XRGA 1GVHA 1L8QA 1MH9A 4LW8A 1UPAA 3D7SA 4QBGB 4ZOBA 5FJJA 1OGYA 4UHBA 3VV3A 1JMYA 3OZVA 3AUYA 4LNHA 1ZHOA 2I80A 2DKOA 4F9GA 3B9QA 1K63A 3FY4A 2J3LA 1U5AA 2E5WA 4NKRA 3UCXA 1XMXA 5DBFA 2PKRA 3JALB 4EUFA 1PSDA 1V11B 1WSBA 4MS1B 4BNNA 2KLBA 4LHWA 3D0QA 4C0XA 3SX4A 4B5LA 2WKWA 2H1VA 3IQWA 2I2XB 4ESVA 3ENKA 2I4TA 2WP0A 3GLFB 2BTEA 2HJRA 3T7AA 1OIVA 2IF2A 1XTPA 1XLTC 2ORWA 4XB1A 3WYGA 2PEYA 4XVQA 4EY6A 4Y0NA 4HEQA 1MNAA 4HFRA 5K3SA 4CLHA 4D8XA 1EUZA 3RAJA 1ZM7A 1VL2A 4PQYA 1L7NA 3SVLA 3AR4A 1Q15A 2Y27A 3KYDB 1KTVA 2HIGA 5CNKA 2FDRA 4K40A 4LJ9A 5AVWA 1HE5A 1B93A 1IXRC 1P45A 1SKYB 3DS8A 4MVJM 2FZ4A 3EZFA 1NKTA 3CUWA 3MB8A 2IXGA 4YH1A 2HNBA 5AUQA 1JHOA 1G98A 4RM2A 1DO0A 5KOHA 2V65A 2V6FA 3K9WA 4UPVA 3H9JA 3VBEA 2CHFA 1H66A 2JHPA 5I7VA 1D4OA 1TUGA 2F59A 1QSGA 1ETUA 1CDDA 4JP5A 1WB9A 4YXFA 1NW6A 5J43A 2NYAA 1J49A 1H6CA 4L95C 4UEQA 4C2UA 5JHGB 3RHZA 1PLKA 3JVVA 3ON5A 4JJZA 3HBJA 1AN0A 2C2HA 3A1SA 2UU9B 2OUKA 1UC5B 2RI1A 1K8RA 3U3DA 5ALEA 2I7VA 4LKOA 1QTQA 5ER9A 2HYIC 1A9SA 2E0IA 1MQ9A 3AJDA 2OV2A 3WWCA 3EXG1 4IFIA 4W6QA 1P3DA 1GDHA 3SJCA 4B9EA 2UZAA 3KBBA 1HQKA 1JYSA 2BMWA 3A6LA 3TPZA 1RXEA 5C3MA 5ES4B 1UPXA 4ZTZB 4OA8A 4H6VA 2D06A 2SCUB 2XVAA 3AUSA 1FFYA 1VYUA 2UYOA 4J8PA 5K3AA 1U8UA 2WZBA 4JJ4A 3G8YA 3K2QA 3KCNA 1PL7A 3O4VA 2QYTA 3ZVRA 5JCJD 1E6MA 1QVRA 3HMKA 4INJA 1XELA 4RVFA 5DX0A 4A23A 4CKXA 1MVLA 2XWBF 5CG2A 4MV0A 2FG5A 3T1HB 2N0SA 5D6OA 1OT5A 4CUKA 1LVHA 1QCYA 1A7KA 4GR9A 4IFEA 1DGQA 4DUZB 4IGEA 4RO0A 1Q77A 1SJ9A 5EWJB 1YQQA 4LOLA 4R98A 1TUBA 1L4UA 4UD2A 4RBNA 3VISA 3NYWA 1MFZA 1PJ8A 2D8MA 1O95A 2QROA 2X0KA 2Y1XA 3GFQA 4N5IX 5ALLA 3W5UA 1SG9A 5JH7F 1YVPA 2DLCX 2C8VA 2J4DA 2FMTA 3EVCA 2PRJA 3IKMB 1VZ3A 1RLMA 4QUGA 3GEBA 4FHFA 4N5NA 4HLDA 4O2BB 3IFSA 5FBRB 3L0ZA 3NDRA 4MH0R 1Q91A 2KBEA 3CLSD 2WSMA 3EK2A 3QE4A 4GX2A 4L6IA 4QEKA 5TQVA 2VQ6A 4N7MA 1N6HA 4P98A 4IJWA 4BO9A 4D1YA 3U3XA 3L4JA 5DN6D 1G16A 2CNLA 4MMXB 3MNFA 4B6SA 3EZ2A 2GF0A 3L77A 1M6WA 2BEWB 3GDOA 4N1AA 5L3ZA 3SZRA 3TBKA 1JHMA 2PL1A 3DF7A 4GLJA 3QPCA 2IUUA 1NKVA 2C29D 4CDRA 1QS0A 4EKDA 2NUTA 1KIMA 1N5IA 1PTJC 1S2NA 1WD5A 3GJXC 3F4BA 3NATA 1XTKA 2JD2A 1KI1A 3LUJA 4EZEA 3H19A 3PRKE 5FPKA 5EPEA 3NZEA 3UWSA 1N36B 1MENA 1YIDA 4ENQA 1YBVA 2X1HA 2PLWA 2WIJA 4J0FA 4R8RA 1IXZA 2ZWOA 3EF1A 4Q1CA 5CVVA 3WBBA 2MDTA 5J2TA 2B5OA 1E0KA 2DXIA 3DLPX 1B76A 1R88A 3F8WA 3H9CA 4Q4JA 1W4BA 1EUDA 4XJTA 4FI3C 3AR6A 1TA0A 3G2LA 4ENPA 2CL0X 1UODA 1BZYA 1NWHA 2BI4A 3L1KA 4BNIA 5A7FA 3A3NA 5H4GA 4LOHA 1D2EA 3E1KA 5KPDA 1APBA 2AOUA 3HCFA 3H7AA 4G0MA 1B16A 2P9CA 5E6SA 1I80A 3GFBA 3WMFA 3CLRC 4OUKX 1BIFA 4M1YA 4PONA 1OH6A 3HZZA 3JTEA 2VRCA 1DQPA 2CNBA 1Y6JA 2C54A 2J9GA 2A1UB 2V9CA 4OGFA 3K0KA 1RAAA 3BKXA 4C7OA 4GZ6A 4EPYA 1YJ5A 1GYQA 4CR8A 4D96A 2YFHA 5EXDA 1OA0A 5J40A 3MOIA 4BGEA 1JJIA 4C03A 1IB6A 4X20A 5C80A 2HOQA 1RYDA 1F60A 5IDYA 4GNRA 1TI7A 1SC6A 1Y7HA 1J8QA 2AXQA 3WL7A 4LTMA 1QKIA 3Q3JB 2NQTA 1SBCA 2C92A 4QQ8A 13PKA 2R8OA 3NHSA 1X14A 4WXHA 1XMVA 3U3ZA 1E8MA 4J2HA 3N9IA 6PFKA 4MIEA 5L45A 1BYUA 4KPYA 1PW5A 1NRWA 3BRWA 5BT9A 4EEKA 1P8AA 2QRVB 4C3VA 1F7UA 3H99A 4U4AA 5FPTA 1JEJA 3SICE 3M3PA 4IL5A 1FC0A 1OYVA 1S0UA 4DQVA 1SHTX 2JJ1A 2PS9A 3OA0A 1I3KA 1AD2A 1CJCA 4JP8A 4DMFA 2A5GA 1UWLA 1YDMA 4CIYA 1E9CA 5FWNA 4X1YA 2ADMA 1PZGA 2ZU0C 3CPSA 4QJ4A 3U9SA 1ISMA 5EIAA 5ELMA 1PFKA 3KEOA 1NE2A 1P33A 3OKCA 5HGJA 2HWYA 1SCBA 1X7XB 2AZTA 1G3MA 4Z3KA 3LDAA 1Z63A 2BFDA 5JE8A 4OP3A 4YRZA 1ZRMA 2MT9A 3G23A 3N0RA 2X6TA 3FHJA 3FYUC 4B34A 3RRYA 2I4IA 2JCXA 3ASUA 3TR6A 4UEKA 3U7QB 4KRFA 1DHRA 3UAOA 3X2FA 5FOVA 1AIPA 3DZHA 1YS2X 2CVZA 3HUUA 3ONWA 3W1WA 3Q7QA 3ZE9A 4AY4A 1IY2A 1U7XA 2DR2A 3F7TA 2IYSA 2Z1DA 2PKCA 2ZJ4A 3DEJA 4AJJA 2OOSA 1B6TA 2B8NA 2I0FA 3CRQA 2ZQ5A 4PZDA 4DW8A 1AO0A 4ZHQA 2PE5A 2ZE6A 2NSJA 3KHSA 2J7PA 3QBEA 2F43B 2IYXA 1ZVKA 3EUFA 3EXEA 3O8LA 2CNOA 1VQ1A 4E12A 2Y68A 3AHIA 1ESDA 3GRZA 3CWCA 3P26A 3UA4A 4MMYB 1HTTA 4JI4B 1NOKA 1JDBB 1IG0A 1Y4SA 5DHRA 4MJ3A 3WLKX 1QO0A 1YMQA 5BSGA 3PHHA 2BV3A 5EP2A 3F1KA 4KXUA 2UAGA 3JWPA 3PC7A 5H02A 1PFWA 4GX1A 2RBEA 4FX2A 3IDFA 3NAMA 2BELA 4RZUA 3HVJA 2ZCUA 4IWXA 4ZOCA 2VQEB 3JQCA 3R20A 1GQ2A 2RMKA 1RKXA 3K3PA 5J23A 4Q12A 4AZ0A 4RTQA 3F9IA 5H0IA 3WBKA 3OZAA 2HA5A 4UVDA 2AFHA 3DDNA 4QIHA 3D6UA 2G9UA 3HFGA 1Z56C 1XU7A 1N77A 3OFND 4S05A 6ADHA 4LWZA 4YRPA 3WLNA 3ZZUA 1QRUA 2V6BA 1B15A 3JD4A 3S5JA 2GXUA 1BDJA 3JWJA 2REOA 1OFUX 3VDRA 2COKA 3M6UA 3FRIA 2EARA 3KQUA 1BWRA 4AKHA 2I1WA 1X9HA 2P9YA 1S4QA 3O4RA 1YS6A 5GIOE 4O4JA 1IY0A 1FDVA 1H1LB 4MPPA 3RQSA 2IVFA 3V4SA 4A82A 2B8JA 2AFHE 4V2UA 5TGDA 4A8JB 2ZRMA 1XZBA 4I2NA 4IOJA 4U8HA 1YK0A 4YQEA 5AD1A 5TE9A 5BP7A 3FOEC 5FBHA 2ZRIA 2CDCA 3U13A 3DOCA 2C7PA 1SKBA 1UQUA 1T8RA 2BEVB 2DSNA 4JJAA 3S2EA 4MDHA 2GESA 3R3WA 1SQFA 4OLFA 1CS0B 1ULBA 2NWQA 3RDPA 5KOJA 3CW2A 2XB9A 3R0VA 1PT6A 4BE7B 1NIPA 1OI7A 1ULSA 4LJYA 4UHFA 3FPSA 5TDHA 3VC7A 5CEJA 2WWFA 2BUBA 2ZUWA 1U6KA 2V96A 1NQWA 1ZA1A 2OBMA 3GFPA 3PDJA 3RJ5A 4AP6A 3RUCA 2QG9A 4DSAA 1VPEA 2Q2OA 2DY1A 2ZTVA 4IEEA 4LYYA 4PLVA 3L7LA 4QUBA 4RJIA 5E6RA 4FB5A 1MZPA 4OK5A 2LCQA 3UVEA 3EVAA 3FNIA 3GJYA 2OTCA 4GM0A 1EX7A 2VKQA 1OKKD 4V0QA 1P6QA 4LWPA 1E2GA 2V98A 3BQMB 3SYLA 3ZV5A 2EBFX 1QZTA 1P8JA 4PV7A 3WGHA 5FQNA 3PKJA 3H1FA 3VHLB 1U0JA 1ZONA 2HV9A 2ODTX 2ZKIA 5AM4A 2WSSA 3DFFA 1IBRA 3T38A 3UTDA 1M2NA 1T25A 2PLRA 3NHJA 1VHWA 4I99A 2C78A 5E4JA 3TTWA 2Y0BA 3TJMA 1U9JA 1JR2A 3R7DA 1XO1A 3CNNA 3RK1A 4TKMA 1NN5A 1KSFX 5AOVA 4DUGD 4DA0A 2H29A 1W1UA 1A71A 4GLLA 3TMYA 2ZRFA 1AS3A 2CJYA 4HGYA 4DBLC 1WV1A 2JW5A 5A62A 1KL7A 2EBUA 3IUNA 1HRKA 1Z28A 4HWTA 1AV7A 2PZBA 4YDHB 1I0IA 3EX7C 1I3OA 1OFHA 2GOYA 2R1VB 3O8OA 4IIYA 2VLIA 4ZQHA 1V71A 5I9TA 1UZAA 3TTYA 2C9OA 3ZVNA 1P80A 3E7XA 1E59A 1D7AA 3OCCA 1DTSA 5IBRA 2IPLA 3WGQA 1W5AA 2BFMA 2FEAA 3UMJA 3KR1A 1P2SA 4Q21A 1GTRA 2GPJA 3FVQA 3IVMA 4BMDA 2XF8A 3A6FA 2GN2A 3A6JA 5AHWA 1OBVA 4G2TA 4JJKA 4PU0A 5JMPA 2VAXA 1ZUD1 4DCPA 3MWDB 4EFNA 4BGUA 3WZMA 3AQIA 4YCDA 3JWIA 4BRZA 1E9SA 3I53A 4G9GA 4YMIA 4CL2A 4G67A 4MI6A 2C4MA 1WA5A 3UPUA 3Q9NA 5JCZA 1K1EA 1FDIA 1GRRA 2GEUA 3DF9A 4ZDKA 6Q21A 4E51A 3JYPA 4RABA 1XMSA 2JANA 3UK1A 2W58A 1SCDA 1KGDA 4ALIA 2ZCJA 1Y82A 3TZLA 3NOVA 3A06A 3E7WA 4ADSG 4DLLA 2PFKA 5IJWA 4AXBA 4M53A 4NPAA 2DWOA 1DVRA 1XXHB 2W2LA 5EWMB 5EIEA 4U02A 3SGLA 1RXIA 2W2KB 2YNMC 1M1YA 3EVDA 4HQLA 2BONA 4IG9A 1J4AA 3DOIA 4RY2A 4UE6A 3ZHBA 4OFXA 4BQNA 4RH1A 3B70A 1V1MA 3DONA 3FCSB 3PGXA 5I9SA 3WGUA 2I6FA 5CT6A 4C21A 1DKPA 4JLWA 1DZIA 3ZHYA 4FR5A 1V3VA 4V38A 3CUEF 3UWMA 5IF9A 1TM7E 1PEYA 2CXHA 4M1OA 4XIYA 4P4SB 4EKIA 3JQAB 3QKRA 4G4IA 4HY3A 4RORA 1W1IA 2YS7A 3Q41A 4XUCA 4JOQA 2GKSA 1RFLA 5EGSA 3K0EA 2QIOA 5CVUA 1IHXA 2E2WA 2JFWA 5DWQA 3WS7A 5FAKA 2EDAA 4GL4A 4X7BA 1UMKA 2XUIA 3JAWA 1UBFA 1HT2E 2QE7A 1ISGA 1YRQA 3RTBA 3K6SB 4FWIB 3T3OA 1X70A 2QZJA 4FE3A 5LZ9A 1A5TA 3N6RA 4MVCA 4R81A 5BQ3A 1ZJWA 3J7AC 1IZ9A 2VNIA 1GTG1 2FUEA 1M1YE 2BOVA 3BMNB 3HXTA 4PHTA 5DP2A 5T4FA 5HRCA 2C00A 3NBMA 3LBIA 1QMPA 4DSNA 1T6ZA 1KH1A 4DPLA 1C50A 1ZMBA 2H3EA 3LKDA 4OJYA 2RAVA 1J8VA 2WWRA 3RAEC 3PNPA 1RE1A 1C2TA 2GXQA 2FSUA 1F2TA 1F2VA 4Q19A 4HNGA 2FPKA 1JEQA 2ZI4A 3BULA 2XXJA 4MWZA 4W5HA 4YALA 1JSLA 4I1YA 3MXTA 1Y42X 2PGXA 3WADA 4NBRA 3LBFA 3O1JC 5L53A 3KYIB 1ZITA 2SBTA 3EOAI 5C9ZA 2PCJA 3JSAA 5AVYA 4F2GA 1B23P 4X8MA 2GYWA 1VRCA 5C1DA 3VR4D 4KFCA 1H8HD 2FXVA 4NS1A 5DJ5A 1X6VA 3O4IA 2AJBA 3QU9A 3QVUA 5F98A 1K8XB 3CA8A 3FWHA 4AF8A 3DVQX 3U60B 1MU0A 1EXMA 3KE8A 4IQGA 3ER8A 3MJ4A 4UDXX 4DMUB 4Y2HA 1EP1B 1GRNA 3N58A 1SHJA 1SM4A 3PG5A 4DLNA 1KI6B 3Q12A 3BUSA 3R3HA 3HYCA 2KQUA 3ELWA 4M83A 4PG6A 1A7UA 5B7GA 1KAHA 2Y1LA 4JHLA 5LNK6 1HEIA 3L93A 2G6BA 2Q5IA 3CLRD 1HH4A 3HRIA 3IDSA 3OH8A 3ZXSA 3TQFA 4D41A 2QNIA 3DHVA 3IMEA 1CQWA 2FPMA 5KYYB 1WXEA 1KVRA 3EXAA 4I50A 4TTTS 1S8FA 1KJZA 3QEMA 2P2YA 4HUJA 3ZVKA 1QV6A 1Z0IA 5HRAA 1GL3A 5C51B 3AVXA 3LDUA 2JLRA 2OB2A 3WO0A 3BFPA 1A2OA 1GQRA 1E3TA 1U1CA 5D5PA 1Q14A 2JGLA 2WTEA 3LUDA 1N2IA 4DARA 3AUFA 2JNWA 1TT5A 2EZ8A 4ZI7A 5BQOA 4ER6A 3GJ8A 4TQGA 2WMYA 5JMOA 1KAEA 1XRQA 3I8SA 4CLOB 2R48A 1I10A 3R6TA 3I9KA 3EBOA 2C98A 3MGKA 3QP9A 3UHJA 2HSWA 2FY8A 1L8XA 1E1KA 2PS1A 4WDRA 3CVOA 3TLBA 4P84A 4B3IA 5JNSA 3EPPA 3UJHA 5GIPE 2E7ZA 3TW8B 5G4LA 4F93B 1CZNA 3AESA 2ETXA 3WKEA 1AGNA 2HQBA 4H7EA 4MARA 2O8EA 2G9VA 1U65A 5JZBA 1YQTA 2VLBA 1PIWA 3L79A 1JVBA 2IDMA 3QU4A 3CUKA 4JL8A 3U0VA 5KNBA 4D97A 2Q0QA 2N1BA 5B30A 4ZANA 3LQ4A 1WETA 3C3EA 5EE0A 2PKYX 1LEHA 2YXLA 1XRMA 3MA0A 4MVWA 2CSUA 3ZBUA 2GO1A 3FDXA 5KQGA 3P9CA 1ZMXA 2WWYA 4LFBB 3KJEA 3OIFA 4LEIA 3I72A 3K0HA 4GDMA 1U0EA 4F9TA 4J4TA 2ZIEA 1FDUA 2J41A 1PW7A 3LXRA 2XR1A 1JZSA 1ZD9A 1PNVA 2J4FA 2X0JA 5KNBH 3TVTA 4PS1A 2ONKA 5C1OA 4U3JB 2PZKA 3O8QB 1PUXA 2GF2A 2HA6A 2GM3A 4P32A 4Q18A 4Y6LA 5JO0A 4N0EA 3WGZA 1NUTA 5AXDA 4Z4QA 1XZQA 3VYSB 1KJIA 2JD1A 3TSAA 3ZZMA 1AHPA 3NDJA 2Q5OA 3IGFA 3WDMA 2NTYC 2CDAA 2DFLA 3ZVLA 1HF3A 3R8FA 3QBJA 3I37X 2QXUA 1O94C 4LVUA 1DIOB 5LN1A 4IFTA 3K5WA 4A15A 4G25A 2BD0A 5CT5A 5JDIC 2I2WA 1M74A 2X2FA 3OT1A 5CDFA 4EL5A 5BR4A 1E89A 5IP5A 4IG4A 4H1TA 1FYXA 3ORHA 2Y77A 3IP7A 3NGLA 1IHPA 2IRWA 3R3SA 4B4KA 5AKYA 4YJ2F 3QKSA 4HDOB 4FMPA 1M1NA 3ZWVA 5CT9A 3BIWA 4GOND 4AJKA 4JLMA 1A5BB 1W29A 1LV8A 3NCTA 4YECA 1MKYA 5ALIA 5BWBA 1A88A 5JD4A 1G17A 2Y66A 4DDKA 2CXXA 2I71A 4F04A 1RBYA 2XMCA 3DMTA 2C5HA 2GWHA 3JYOA 1JB1A 3PYMA 2AMJA 3OJWA 2DRIA 2C8KA 2J46A 1L3BA 2VHTA 4C6SA 3FGOA 4AO6A 2FPXA 4BFXA 5JFOA 4WOBA 4OHVA 1ADGA 1SCAA 5CK5A 2W6MA 1QUEA 4WLEA 1GAWA 1QZUA 5CDFE 2OQRA 1JLRA 1EHIA 3SMQA 4OHRA 2E6KA 1A8PA 1R64A 1XJ0A 4YJFA 2C9DA 4BCCA 3WLFA 1VGVA 4D6YA 5FR2A 1VC2A 2VF7A 3I8XA 4WK2B 3L1IA 3VGPA 4YRSA 2V03A 2UYYA 1RBMA 1RYYA 3VSCA 1TRHA 3A6KA 2Y0DA 4KQHA 3M4XA 4GGPA 4L74A 3V2HA 2MOKA 3DJYA 5AKZA 1O8BA 2X1LA 4M7PA 1ZW6A 2NU9B 3AHEA 5JH7B 3SX0A 1SG0A 5AK6A 1P29A 2PBZA 3IAM6 2C8LA 4JASB 2OO7A 4A2WA 3ZZNA 1AQ6A 1LB1B 1P2FA 1GCIA 2D2IA 2FUG1 3K0CC 3NUGA 3NVMB 4C6TA 1ABBA 4DMKA 1XNJA 4AMYA 2AIRA 1UAGA 2PX3A 1SA0B 3IJEB 3HXQA 4OHUA 4LE2A 2QWXA 3F5DA 1H3NA 5CM2Z 4TSRA 3QOYA 3R2JA 2FG7C 2FEWB 3RVDA 3V55A 2WZQA 1OSNA 3RFTA 1GTMA 3KS9A 4OQDA 4E32A 5IJ0B 4KVGA 2NV2B 1MA3A 3HG7A 4TVOA 2J5BA 4P6VF 1QYCA 4EWLA 1C7JA 1G6KA 5EKTA 1MQAA 3DYVA 4IWNA 3A6DA 3C8DA 3D3QA 4J7CA 1PGOA 4FW9A 2WHXA 3N53A 4IIJF 3ZE8A 2RHJA 3ICEA 3QOXA 4UNNA 3UAXA 4N7BA 5LIPA 3TRFA 2GZHA 3OFSA 4L5AA 4DLPA 3A37A 2ZYWX 1XZCA 1VJTA 3AU9A 4F92B 3FNFA 4KQKA 4E4YA 1TU4A 5BW4A 1C0IA 3DM5A 1PL6A 1NBIA 1R66A 4QAQA 4XA8A 4B3TB 3AHCA 1LQTA 3STWA 1ZLXA 2HF7A 2QRPA 2QAGB 4RPJA 5T67A 2RK3A 1E5LA 4HGZA 3CRMA 4PR3A 4QO7A 4Y6QA 5F7JA 3SDZA 4US2R 2W42A 4E2ZA 2G07A 3O9ZA 4LJKA 2C0QA 4EG6A 1K7YA 5DHQA 5B7NA 5ITWA 2VJPA 1KF0A 2WT9A 3OZCA 4KI7A 3ROEA 4HT3B 2ZXFA 3ZDQA 4EI8A 3WRWA 2O8BA 2ISSD 4ESHA 4WBNA 1NQOA 1ACMA 2W00A 3HR4A 3OMLA 4NJMA 4W1SA 3IVGA 4G5SA 4KMRA 3E2IA 2D3WA 2PA0A 4D92A 1C1XB 5JRZA 4AIRA 4ZK6A 4EJ0A 3OE1A 4QGGA 4ND7A 1B1CA 1LXCA 5AVQA 2GJAA 2ZITA 1J0AA 1H69A 1O7JA 3CTMA 1Q1BA 4QLAA 1JG3A 4POOA 1M5UA 4RUKA 1TEZA 4R8SA 3IPCA 1AZWA 3E3OA 3EG9A 1NXSA 4JI6B 1VJRA 1U04A 2OHGA 3WNCA 4M1TA 4UTPA 2D1FA 3JWEA 1SUFA 3QOWA 4DDVA 2A88A 1CXZA 2O7RA 3E3MA 3TI9A 3STXA 1I51A 1YAJA 1IQUA 3WICA 4BJ1A 2YNMD 1U2TA 5BW6B 3ZYZA 5L4LA 3FZQA 1B8NA 3AEXA 3C1TA 1JILA 1ECFA 2KJQA 3ZEAA 3IIJA 1WX1A 1LSUA 1GYRA 2ADOA 1R6BX 5JRJA 2D1YA 3GA0A 2WEKA 4MW5A 1GZUA 1QVAA 2AYZA 2IYPA 2ZREA 2VCEA 1JFFA 4TT3A 3TINA 1PR1A 1Z8NA 1JU3A 2CHQA 1TC2A 1GSAA 3N76A 3R9KA 1UDBA 5KWVA 3R7NA 1FFHA 1N6NA 3G13A 1V3TA 4RSHA 1FYFA 3RS4A 3KYJB 3LFUA 3C24A 3WOVA 2RGCA 3KJIA 3JVEA 2WUWE 4HXEB 2Q9UA 3AUJB 2PD4A 3ZWMA 3OE7A 1OAOC 3Q87B 4UEWA 1EJ2A 1GGMA 3GLTA 2P6PA 2QSUA 2VYCA 3KOWA 4P3XA 1MXFA 2MSEB 1ENYA 1PKEA 3PPWA 4Q5IA 1H5NA 1NYQA 4ARZB 4URYR 1W2GA 1S8OA 2R751 2HN9A 1XEWY 4PNPA 1MIOA 4UCXA 2CUTA 1XTBA 3CLUC 3BF7A 3DMRA 2CLEB 1SVKA 4E1BA 3EGEA 3T4XA 3VKFA 2G88A 2X7XA 3OOEA 4V0MA 5AVJA 2FWJA 3FPLA 3TLXA 1JZQA 3TJZA 4F71A 1DX6A 3B5IA 1R8YA 2O9JA 3RVKA 2R2GA 3FI9A 5KHAA 1KZ6A 1Z34A 3RC9A 2H31A 1OLOA 4DNQA 4XYLA 3MD9A 1Z8FA 5HS6A 3FSGA 2QXTA 4DG5A 5GAJA 1JTVA 3VR5A 4DKXA 1I2CA 3QVSA 3CHYA 4HVLA 3LZDA 3ML1A 1MRZA 3AG6A 4P93A 2IEBA 2HJVA 3AK4A 2PUAA 4QJBA 2Q3MA 2WYWA 3QG1A 3A14A 3DE2X 3KDPA 2F8SA 2R84A 1N7JA 2OD7A 3GAZA 2F55A 1XDUA 1J8MF 1YVDA 1ZU5A 2BR3A 3JZMA 2ODAA 3FMOB 4V0ME 4BWYA 2EFEB 1TM2A 3VR5H 1JBEA 2O8VA 4TTQA 5E4TA 4IHJB 4XI9A 2C84A 1KIFA 3DFZA 4QELA 2FSIA 5DF1A 4U0KA 4Q7LA 3C8UA 4TTRA 4WRRA 3CT6A 3VDQA 2I1VB 1NBAA 3SLRA 5KDDA 1KETA 2IIBA 2FFHA 1G2QA 4M21A 5K0CA 1Y81A 4K9NA 1HDIA 1SXQA 1GAQA 1S3FA 3MQ4A 1V45E 3K0SA 2SNIE 2WDPA 4EHFA 4NY1A 3PTZA 4RM3A 5ARCA 3ADCA 1DBSA 3EXFB 1S2DA 2KWIA 5IKOA 4F60A 3GLGB 2RAPA 4I1SA 5G1OA 4AYWA 3E53A 3EZ6A 1IIBA 3R4CA 2IS1A 2XDQB 1Y0BA 5DLQC 5CDSA 4OXXA 1GR0A 1GTZA 1RC1A 2Y1KA 1ZL2A 1X80B 3IVRA 4B2YA 3RTGA 5EMNA 1ZUHA 3GRVA 4ND6A 5AW9A 5C8XA 3IELA 1P60A 1U2RA 3OESA 2BFOA 5JXWA 3SSOA 4E5VA 4YUXA 1ISHA 4FEEA 1XEWX 1ZSVA 2HAEA 2HWUA 3BICA 3QV1A 1B6GA 3KKMA 4IIHA 1C4WA 1GPMA 2I7XA 4RJKA 3OJEA 3CISA 2PUCA 5AESA 1P73A 3DMPA 3DVRX 4BO8A 1GG2A 1PDOA 2RARA 2BKLA 2B1RA 2NO9A 4AWBA 1MT3A 1AHNA 2B1QA 4R2LA 1JQ3A 1OV6A 4OJTA 4RGBA 5HFNA 5JT1A 5C8DA 4EY7A 1VSTA 3Q2KA 1DAIA 1JQKA 2Q3BA 2VCHA 3EARA 3PENA 4UBJA 2C57A 5EKSA 4KO3S 1I7LA 3X2SA 4BWFB 1BXGB 3RS9A 2YRXA 3G82C 4Y9DA 2CEKA 1R6UA 4HB2A 4KNWA 5E7JA 5J58A 2OCBA 4D3YA 3FWNA 5ALZA 1RLUA 4KR0A 2H4YA 5EZSA 1QF9A 1Z2PX 3I39X 1D2AA 3NYIA 4JQZA 5L3SA 1AZLA 3O38A 5BT8A 3QTLA 1CRPA 4DVGA 1VMDA 1OYOA 1SBTA 1E5XA 4EGFA 1QH8B 3I6YA 3ZTTA 4KREA 3UBTA 1RLJA 1O94D 2JAXA 4YFVA 2IPNA 5COAA 3GJ7A 4RESA 3D54D 4J0EA 4MUEA 3WFZA 3QKWA 1XU4A 4OL0A 2H6EA 4UUAA 3UXHA 1V1RA 3UATA 1A9QA 1N9GB 4CMEA 3E3NA 4E2XA 2AG5A 2WU4A 1Z3CA 3UJBA 3ZV3A 3PVSA 5KCZA 3JX9A 1BMTA 4W7IA 5F51A 2JIZA 1JR6A 3LHKA 4OXQA 3P0JA 4C22A 3V4FA 2F1OA 4C4SA 3S40A 2JGJA 2BSQA 4QC2A 5CFLA 2BMAA 1B3RA 1QYDA 2CWDA 2E4AA 3VZDA 4HDKA 4A91A 4YRDA 1FTQA 1SPXA 3Q98A 1SC4A 4EECA 3PC2A 5EMKA 2JI4A 3AEKB 3N8GA 1HQYE 2XXAB 4PHCA 3ZNPA 4FDTA 5D3MB 1D3AA 1BCRA 2Z9CA 2VK4A 3KVVA 5F64A 5C5EA 4DLRA 1EK5A 1YBMA 4WOCA 4ZYLA 2PRIA 1WLSA 1WQ1R 4B3GA 4OSPA 1I4TD 4PLWA 4K6OA 2OV8A 2ZPAA 5IZCA 4KE7A 3ESAA 4ZVUA 4A4DA 3DOEA 2B4RO 2C0PA 4Z1OA 1QVZA 3USZA 1TTHA 3SJBA 1M0EA 1PD0A 4I1RA 3OIUA 1V7ZA 1FQWA 4K05A 1A4RA 4YUZA 5FIUA 2QTVB 4FGJA 2C3MA 4X71A 2XJ9A 2ERCA 4K5QA 2HU5A 4CLRB 4KWHA 4TKZA 1XMPA 1U02A 3A1FA 4TLLB 1XEXA 4Y1RB 1RLOA 1NPTO 6GPBA 3DAHA 4KVZA 3RARA 3BGVA 1USVA 3U40A 2QOEA 3N8DA 3VR3D 1MJNA 4CIWA 1J2JA 2WVJA 1F8UA 2XB4A 3OQ6A 1Z4JA 4H77A 2JLUA 3W3AA 1F14A 3LX8A 2R4TA 4BWGA 4I1PA 4D9CA 1Z4OA 3WHPA 2RG1A 2OB1A 3NVAA 4K03A 2EBHX 2XCLA 3P0HA 3IAS1 3Q7IA 2JG3A 3IBCA 4EBFA 1J1IA 2AOTA 4CM4A 1RCTE 1FVOA 2R8PA 4DJDC 1AY0A 5JTUA 4TUYA 4X62B 3GGOA 1L5VA 3A7EA 4WNIA 5DYYA 4HD8A 5CCXA 3DZKA 2VHUA 3PUJA 1AKMA 1FS6A 3L7YA 3W3AH 1RQLA 3NJ8A 4MPDA 4EPRA 1NR1A 1KU6A 3HDJA 2JBHA 2ZWMA 1MVOA 4QNRA 4DEVA 3GG9A 4EUEA 5T8KC 1FQJA 3ITEA 4ZT5A 4MP6A 1K6JA 1AB6A 1MQSA 1SH7A 3HUFA 5IEBA 4QPDA 5L3VA 2NZWA 1GCOA 1PBNA 4CKZA 2X8BA 2PZAA 1CZUA 1KAQA 3QYFA 4N40A 4RADA 1M5RA 1CQIB 1MCZA 1QWSA 2BR5A 2DSTA 2GFIA 2Q50A 3HJGA 2QJTA 3IP1A 1XTZA 4WASA 1SIOA 1E6EA 1L4GA 1BYIA 1Y63A 2ZIAA 3QELB 2EC5A 2FYTA 4AZWA 1I9GA 4UM5A 2ZE8A 1EFUA 2O57A 3DPUA 5H81A 4AB1A 3ILVA 1FNNA 2EJUA 1Y4ZA 2C0CA 2UZ1B 3WMXA 2HK8A 1PR4A 2XQGA 4K9DA 3RAGA 1EBFA 5JZMA 4I3GA 3SM3A 1EH5A 2V0NA 3IUMA 4HTFA 1T0IA 1OPXA 1KDYA 4BQEA 3A9RA 3TX2A 3VU9A 3OM0A 5CGQB 3TNDA 1R4NB 3Q10A 2A0XA 5D3ZA 3AERB 3PL1A 2YQ4A 1RAIA 2VBFA 3RR2A 4EGAA 2FLVA 2PNFA 1SUSA 3AFHA 4IXTA 1CFJA 1O6GA 4RWZA 2Q46A 5DI3A 3OX4A 1QQ5A 1M10A 3SHFA 3WKDA 3BB3A 1QC5A 3ES9A 4I9UA 5EMLA 5A3VA 3ILHA 3DBLB 1XZJA 3CVWA 4I1IA 3BZWA 2J31A 3CKYA 4RHTA 3UPTA 3A4MA 1C9EA 5EHGA 5CLIA 4RVGA 1N4DA 2AN1A 1TXGA 2DPHA 2IZ6A 3IA7A 4RF5A 3ZY3A 4WNAA 3T15A 3ZCRA 4XARA 2Q4EA 4XR9A 5TQ0A 3JQQA 3S2GA 1U3UA 3TQSA 4CMIA 3I5AA 4DLVA 4QYIB 4AWAA 4I6EA 2I3AA 3KJFA 4HNAB 2OORC 2XMGA 2H16A 1KKMA 2HM7A 3QIAA 3UJPA 4YMUA 3EC1A 3VX4A 3AT1A 1SNYA 2EU8A 3HL0A 1RYZA 3LNTA 1LFAA 4RC9A 3HO8A 2HA2A 3DDHA 1L5HB 5HCIA 3EW9A 4FJ1A 5FUVA 3V7YA 2O1SA 3UNXA 2QRLA 3LOPA 2HLNA 4ML3A 5K09A 3L7CA 2C9CA 3NVDA 2HGZA 5B6IA 2BGRA 5HZHA 4KO1S 1I2MA 2IUYA 3KSDO 3P2YA 1Y8ZA 2PJZA 4HRYA 3GX1A 3H11A 1DV1A 1Z7BA 2O05A 3HJAA 3FUUA 4N8DA 2Z5GA 2GPWA 1BAPA 2ECQA 4K9QA 1WHTB 3CLUD 2WQZA 2GO7A 4QRIA 1R16A 2GEJA 1N3YA 2E1PA 3S8MA 1W59A 5KJ6A 1K6MA 4O1MA 3K8YA 4GXNA 2FFRA 3AVPA 4Q00A 5E1MA 2GWRA 4ARSA 1MC4A 2QTCA 3AR3A 3D4PA 3TNLA 2DMRA 1YRHA 1LUAA 4BUCA 1T8TA 1E2NA 4GSYA 3DNPA 5TPZA 3PA6A 4C0AC 1NHWA 4L6AA 5BN5B 2EGHA 2Y67A 3TOZA 5A4MS 2VSNA 4M46A 5DRYA 2VTKA 4HAVA 2OXFA 3R9XB 2IS6A 4YJ2B 1F17A 3CR7A 1KYWA 1O6CA 1X7ZA 4MOWA 3FWPA 4CLEA 2VT6A 1XE3A 5GONA 1CUWA 1N2OA 4MRMB 5EQTA 4ZYVA 1HE4A 3IOEA 2WVGA 5GY7A 2BZ0A 3V2GA 5FA5A 2ZBUA 2AJCA 1GXSB 2F1JA 3DEZA 5HIIA 2AFIA 2CLDX 2PUTA 2WPDD 3K2EA 4WBSA 2JRLA 3U6KA 3I1IA 1EEXB 4DIBA 2Y0CA 1E69A 1JIVA 2HXGA 2P2DA 3R41A 1ZQ1A 2VBIA 4YJGA 1LPNA 4Q4HB 1SIBE 3P27A 5FTJA 3ZJ4A 1RZRD 1CY6A 1VJCA 1ZNYA 1KEPA 4TMTA 2VDKB 4RTLA 4TZ6A 2GBPA 4WXYB 3OZIA 2XDWA 3BXGA 4GPD1 4DLZA 4KYVA 1U7ZA 4LY0A 1VIMA 3EGCA 2YZGA 1IM8A 3MSCA 1V95A 2IQ5A 2RHHA 1T8PA 3KR0A 5JD5A 1OI4A 5IABA 4Q9DA 4IDAA 2PGAA 1DIHA 2AFIE 4AJPA 4C89A 1WKBA 4J1TA 3H2HA 4L4ZA 1DAEA 3MHTA 1M6VB 4Q39A 5AW7A 2QSZA 4BEBA 2I65A 3TIXB 2PUEA 4HN4B 2YJ3A 2K6GA 4UBLA 3VX3A 3MTDA 4BNDA 1HE3A 1USWA 4JUIA 3RROA 2XSZD 3QBTA 4MRSA 4E5DA 4ZMSA 3ROQA 4L3WA 1Z5UA 3BRCA 2F3UA 3NTQA 3W5DA 2O8CB 4M2LA 3UJ8A 1A95A 1FNCA 1Z6PA 3FPEA 3RSZA 4KQIA 5B12A 1KI7A 2K4MA 1R3DA 2VTDA 4L5CA 5ERXA 2Z4RA 3VPGA 4ICIA 2GLTA 1K8YB 1QMGA 4Q02A 4G36A 1Z5VA 1ZKDA 3OZRA 4HQRA 1MB9A 4PSAA 2F67A 1C3OB 3QITA 5EHNA 3JQ9C 4LC1A 1E0SA 2IOHA 3HLYA 2MJLA 4IIJB 2FUKA 4B9AA 3L4EA 5CDTA 1LNZA 4OHKA 3EGOA 4P1ZA 3RSGA 1PS8A 1UT5A 2HO5A 1J9GA 2I1LA 2OBFA 4YRKA 4OH7A 4OL9A 4B5KA 4C2AA 4IPTA 3G8DA 1R2QA 1WNFA 5EJ4A 3TTXA 3H4MA 1SCIA 2ATEA 4IP0A 3HN7A 4LZZA 2A9RA 4F6RB 1DMRA 3DHWC 3T3GA 2IE0A 4E3WA 2HWWA 4D3ZA 1ZVJA 4EVIA 4JJ6A 4LJ6A 1T9GR 5C1PA 4YREA 2Q7XA 2RB4A 3PR1A 4RSGA 4J7XA 1TTTA 2NO7A 2ZIFA 1EE2A 3UT6A 1QB7A 4XLTA 2XMDA 4TMVA 4DG8A 3EFEA 4HYQA 3VR6D 5BMVA 2NACA 3CG0A 2G7MC 4F4IA 1SCNE 4J91A 3LBHA 3WLTA 5LFAA 2W7TA 1KKLA 4X6YA 1WOMA 4C0QC 4XGRA 1AUPA 1PG0A 1XCGB 1ZMRA 2VFAA 2VDQB 3NNSA 2EFDB 3CJQA 3Q2IA 3UK2A 2HJGA 3ORYA 4QUKA 3T61A 3NQ41 4JBIA 4C0HA 3HVRA 4LMRA 5F2KA 3VA7A 1U2GC 2E18A 3AWDA 3L41A 1QO7A 3KJHA 1T8SA 3TZCA 4AKIA 2VPWA 4Z2AA 2QKYA 1KBQA 2ECOA 1D6SA 3ET5A 3EBLA 4D8TA 1HEUA 1FFGA 1XTIA 1KZGB 5LDGA 4PXSA 4WGFA 3SZGA 1P7CA 4CCYA 4E5YA 4UXJA 2CCJA 5CH8A 4EPWA 3VOSA 3FDZB 1UZNA 3EA4A 3HB4X 4LA4A 5K9ZA 1K0FA 1Y89A 3AUTA 3F0TA 4U2FA 3ZWBA 3RYTC 2HREA 1KK0A 3NTVA 3CMMA 5BRAA 1CW2B 3CKKA 3FZEA 1YL5A 2DPGA 1JQLB 4OTZA 2VF5X 1KI9A 1SUEA 1XQVA 3TW0A 3USES 5BSWA 4TQUS 5F7XA 1DG9A 5EJGA 3WGOA 4NXNB 4BP8A 1UKBA 2B2CA 3MAGA 1G7SA 1ZD5A 3HO1A 1JU4A 3F7OA 1XQYA 2BGNA 1RI1A 4N0DA 1NT2A 5CNIA 5JS1A 4GC5A 2F48A 2GN4A 1A9XA 1Q0RA 4QOJA 1KIAA 3K2IA 1IHDA 2WM9B 1F20A 3V7UA 4A2QA 2GCEA 1VLHA 5GOTA 3QXCA 2DHDA 1K7SN 5CB4F 7YASA 2FX5A 1E9EA 1JT2A 1DJQA 2GBFA 5BQXA 1HFJA 3BIFA 5K2MA 1P7PA 2Y9MB 4B8YA 4EGSA 1I7PA 3QX9A 2EYQA 2XT6A 1JIIA 2REQB 5G1PA 4BO3A 2BFFA 2YWRA 3CF0A 2OHFA 1YT5A 2P90A 3C3MA 2ZOSA 4ZO9A 1NLZA 1D4AA 1IEVA 1Z25A 3BJZA 4M37A 2B99A 3RBVA 4AG6A 5I7HA 1GUBA 2G7ZA 4FMBB 5B55A 1EGAA 3HSSA 2WIDA 1JQEA 3MILA 3N7AA 4NNOA 7REQA 1O9HA 3WSVA 1Z5PA 3FF1A 4KCGA 4ZRDA 1R74A 3AHFA 2VAMA 3L8DA 4PBRA 5J59A 2CUNA 3T7KA 5JAUA 1Y80A 1AGXA 3BE4A 3IE0A 4YIKA 4ZT2A 1KJQA 1R5BA 3OWHA 2EFGA 5U1PA 2QTFA 4AF6A 1LU9A 1MJHA 2X42A 3UK7A 2D2FA 2VOEA 1NV9A 1J7JA 2ID9A 4D5EA 4I55B 2IIPA 3Q40A 2BFNA 3B36A 4PWZA 4BMVA 4CM3A 3LPNA 4BMPB 2IUFA 5LZ4A 4BQRA 2P35A 3ASZA 5JCOA 4I5GA 5GZ6A 3T3HA 4OHFA 5I8ZA 4P38A 3KB1A 4CCSA 5CDUA 5EHXA 4Q4AB 1TIPA 4TVBA 2FX3A 2DWUA 2R4UA 3R5TA 1P2TA 4IF6A 5ADWA 5JAIA 1G1AA 2HIMA 4G5OA 3CEAA 3C87A 3EGWA 2UUAB 2X76A 2WF8A 1KO1A 1Z4PX 2VYND 3ORRA 3X1XA 4X94A 2Z8ZA 4J9VA 1D1PA 3CRVA 4AY3A 4QSHA 3DL7A 1O96B 3WNDA 4BVAA 4CEIB 1GCGA 1G8FA 1GCUA 2I4LA 4WL0A 1U9YA 3PGKA 2C2WA 4BMOB 4U7JA 2VHZA 5DLYA 1ZIOA 3M6MD 4I7EA 1A2QA 3GGSA 2QD2A 2MSDB 3Q11A 2C2MA 1JJAA 4FS3A 1NNI1 4K87A 1TQ8A 4WGGA 4X3PA 5F76A 5KAMA 1NQVA 3I30X 3WL4A 2OBLA 1ZH8A 5DB4A 4YWHA 3GBSA 1KE2A 3RC7A 5D00A 2I87A 2ZEJA 4P3KA 3ZBQA 4FZRA 3ACCA 1EDDA 3ICPA 4OHWA 3V4ZA 1H65A 4UNRA 4OQEA 3HBMA 1F5SA 3T94A 3T3EA 3DH0A 2VYVD 4ZAYA 3URMA 4H6XA 1FFBA 6LDHA 4N76A 1Q95A 2UZ0A 5JNVA 2RONA 4C5BA 1PF7E 3E9NA 2C2KA 4HP8A 4LMPA 1NNSA 3CIOA 4RVUA 1JJVA 4LV5B 2V4ZA 4YHHB 2ZIGA 4YLGA 2IPXA 4PYJA 5ESRA 3HBFA 1U0GA 3D43A 1ONSA 2CDNA 1IU9A 2EATA 1H1TA 2XGJA 3SFZA 4ZA2A 1E96A 2QR2A 3CF4G 1S3IA 3KAPA 3ORSA 2H2HA 5DNWA 2QM7A 3HCWA 2NUAB 3NBAA 3O3NB 1SO8A 2XHZA 2CLCX 3RTEA 4B4UA 3A1VA 3EC2A 4F5ZA 4KPFC 3BD6A 4AQDA 2GN8A 1UM8A 4JEIA 4IKPA 3EXG2 5F35A 4UBOA 3QVVA 1XD8A 4H1WA 3ISVA 1W0JA 3DEAA 1RPTA 3IV6A 3UH0A 4BMCA 3D7NA 3I3SR 2UZ3A 1IEQA 5BN1A 1E1CA 3VYUB 3S55A 5K3FA 1TT7A 1G5PA 1HR0B 3D81A 4YRRA 3IIEA 1XB2A 1IUKA 3KB6A 4UHCA 2GTPA 4GL2A 1TDJA 4HZGA 1EVZA 1DBIA 2XMZA 3GVPA 1EDBA 3DBIA 4G85A 1ECPA 3DJFA 3UGTA 3SQMA 1BX3A 4JJIA 3IUPA 3LY8A 3G2NA 3ZLJA 2IBMA 5FI3A 1E2EA 1XK7A 1E4OA 3FSRA 4ABTA 3H1AA 3ZGZA 4ZVOA 2RHLA 4LOIA 3E7PA 4Z8YA 3SZUA 4NBUA 4XVCA 1CUFA 5BXYA 2W48A 4MGKR 4JEMA 1UP6A 3WMWA 3D6AA 3IEPA 4S1NA 3VH1A 3S44A 2Q1UA 1B6SA 2XI4A 4KQ1A 4RF4A 4ZDIA 4GKJB 5KNDA 2YDXA 1KY4A 1YBFA 4GPEA 3GGGA 1GAJA 2PMWB 1JB9A 5KYUB 1CZOA 3C3KA 3CVJA 1NKSA 4NENA 2GF9A 2RAUA 5CJPA 5FJIA 3JQDA 1EG2A 3KTAA 3SCZA 2H07A 1D6NA 3IAHA 3ZDFA 1L5FA 2FN3A 3THWB 3A4TA 3G5UA 1KYVA 5A6SA 3H8SA 2ZBQA 1RI3A 3IRUA 2D13A 3WV4A 3DDCA 5L7WA 4YMTA 1YFLA 1MIHA 3OF3A 1EESA 1OUMA 2CWWA 4B4DA 2BH9A 1C81A 1DX4A 1V7PC 3ND8A 2RK4A 3CWQA 4OMCA 4BMXA 3STTA 1GN9A 4YV2A 5IJZA 5KNDH 3GEDA 3IEIA 3EGIA 2QLNA 4U5XA 3IUSA 1VCIA 2A5LA 3IO3A 2Y6VA 1NAIA 2V7PA 4XQ9A 5JS8A 1XN1A 4PPYA 2XRYA 4MB6A 4UXHA 3WGKA 4RF3A 3G0OA 4XX0A 1FVHA 3OAAA 3T9CA 3FTQA 2PMFA 2OD9A 5KWIA 1KMHA 2PJRA 2OO3A 1J06A 3OP4A 4N65A 3ZJYA 2VZ8A 4QYWA 1HFWA 2QTTA 2A3RA 3B1JA 3NR2A 2CJPA 2I6TA 1RC8A 2OCYC 2QS9A 4CMHA 3T7SA 1O95C 2XUPA 4LOAA 4NAUA 1C80A 1DG3A 3C43A 2I8CA 3E23A 4FE4A 4E21A 3FB1A 3QOFA 1PVOA 1NJFA 1JG7A 3KT0A 4H27A 3FWYA 1KAGA 1YR2A 2YL2A 1T3LA 3PHCA 4HRAA 1YB7A 2QVLA 5B58C 4XD2A 2WD7B 2PS3A 5CHYA 3NWJA 3AKCA 4XDZA 5BN4A 4XFJA 1EX6A 5HZMA 5ED4A 3QSGA 2V0GA 3LT5A 4FINA 4DJJA 4MV5A 1GHTA 1G7RA 1H9BA 1KERA 4HKTA 2ERYA 4AG5A 4JYCA 5JJKA 1ZUNB 2PJUA 2YIDA 5AK5A 2B8EA 2XUKA 2R7KA 1QGUA 4KXLA 5KSOA 3CNQS 2L82A 3MXOA 2GD0A 3C39A 4YP7A 2TECE 2EW2A 4RIIA 3UOAB 1QNLA 3VU8A 3W90A 1F1JA 2GARA 1F4LA 1P44A 4LE0A 4H7PA 1U2SA 2PGNA 2ZXUA 3B2EA 2NVWA 4D81A 3A11A 3SXUB 5FL7A 2F1IA 1RFGE 1Z7WA 1AKUA 1SUDA 3UOGA 1CRQA 3GEHA 4EO7A 1IXKA 4BBAA 5K8LA 5L51A 1U80A 3GZNA 4NU6A 4ALLA 3HC7A 3K32A 5E0KB 1P4HA 3LC7O 4GMGA 3EAGA 4IJVA 3UB4A 3IQZA 2P69A 4J76A 1SULA 4US0R 5ITZB 3ZDCA 5HUHA 2YHUA 4K28A 3QFTA 5JUWA 3N7UA 3V5NA 3MERA 1UFKA 1BCSB 1KHHA 2C2ZA 1ST3A 2P3LA 2ZJ2A 3P9PA 1NVFA 5DK4A 1HLDA 4JX9A 3ICVA 4BYGA 3N6VA 4IJUA 2XUAA 4B7XA 2EYUA 3J81k 1XAGA 2W11A 1DKOA 2HA7A 2HRZA 2Y0PA 3GNLA 3CE9A 1IOWA 3KALA 3GDWA 1Q6ZA 2HF2A 4ID9A 1MC1A 4RX1A 1RRFA 4ZO8A 4M22A 1OXBB 2GPNA 3TOCA 3QXSA 1WVGA 2IYNA 4PF1A 2HZBA 2IK8A 1XCOA 2W6ZA 3BDIA 3PXDA 3EIQA 4FDLA 1XD2B 5DX1A 3C1AA 4D45A 1JSCA 3CW8X 2Q5QA 3FIUA 3X1WA 1T1IA 3C6XA 1ORWA 3E48A 2RH8A 1QFSA 3NMUF 5CA0F 1E60A 2C9MA 4BLTA 4MRAA 4PN7A 1L4YA 1SKMA 1ZCZA 1HYQA 4NYIR 4D9FA 5EUCA 4FR2A 3D59A 4RL6A 2Z98A 3JALA 5TT0A 1V11A 2QT9A 2VUUA 4MS1A 1VE9A 4E08A 5FYDA 5DWVA 3WWYA 5HKKA 3OCUA 1DQSA 2GI4A 3DW1X 4G1EB 5DKFA 2PFGA 5CBPB 2LKCA 4DSZA 2UXDB 7MHTA 3V33A 3OQIB 3HWSA 3AR9A 1WU8A 1FY2A 3L7MA 5BO5A 2PMBA 4CCAA 1YZHA 1FA9A 1D2NA 3DLAA 3STUA 1KO8A 5HVNA 5JANA 1O2DA 4OHZA 4YY3B 4FHGA 2RDMA 2R7MA 2M6RA 5A04A 2FRXA 4F8EA 4D3SA 2XMSA 1NTRA 1PAUA 2R44A 4WFQA 1A9YA 4N03A 4ZU3A 5IULC 2OG2A 3KYDA 4EY4A 4JYPA 3SKXA 5A05A 3V9AA 2ZYSA 5M5BA 2BMEA 1ZGZA 4KTTE 4QATA 5IS2A 3JSXA 2HFJA 4N7JA 3IVCA 1UKCA 3MT0A 4K7JA 5K99A 4P5PA 4Y8VA 2VNHA 2YFYA 4HH0A 2W8BB 3STYA 4L3OA 1EE9A 3KFVA 4Y2JA 1HL3A 3UWDA 4HQNA 4QUDA 5T57A 2YWDA 3R7AA 3UMCA 3LPCA 1T5TA 3HKBB 2MSWA 4ND1A 5LP6A 3N2KB 3RWMB 3VNVA 5K8TA 5BWMA 4CFZA 2HW8A 1CD5A 1J07A 4OLJA 4W9NA 4BFVA 1QIFA 1WG8A 4CDNA 1RYEA 4DXAA 1TCCA 3AIMA 4CM1A 5LD2B 4KNYA 4DF3A 1TL7C 1SKYE 2PAAA 3Q7SA 3MUFA 5H80A 1SRRA 1ZM3A 3SHWA 1VMAA 4A1OA 3CT4A 5JCPA 2R6GA 4YVFA 3UKDA 1FW8A 2GZ2A 2JC3A 4FR0A 5IFLA 1VLZA 1XYVA 4QPCA 4NI5A 1E3WB 1XQ1A 1CQJA 3TZQA 2SCUA 4R2KA 4WDQA 2I7CA 1Y1QA 3RHTA 3GCZA 1DXYA 4L28A 4ZCIA 4FQ5A 4D2IA 3AO0B 3BJMA 4A0QA 4Q3OA 1C3EA 3TDKA 5A02A 2H1LA 5C52B 4AO7A 1U2PA 4JBXA 2JDID 1P18A 3DWEX 1K7XB 4I0WB 2WWVD 5JALA 1UH5A 1RJDA 3PUYA 5AJWA 4NFHA 3OLYA 4Z8XA 5EWJA 4D0RA 2QVGA 3CQ9A 2IHVA 4CLXA 3E82A 3D7MA 3NXSA 2CW5A 3K0AB 1CR2A 1PFUA 2PG3A 3HU5A 2J0QA 1U0NA 2VA8A 3R6LA 4B8ZA 4IKEA 3HA7A 5B1EA 3BD7A 5E9JA 3WZLA 4EFLA 3H5AA 3TZ6A 3W5CA 2JI9A 3N2EA 3ZK9A 1G2PA 1PNTA 1GGFA 2I1QA 4O2BA 4EHJA 4LYFA 4B3RB 5ECGC 5ICGA 3RCBA 1PQYA 2Q3JA 3I01M 2BI7A 3DDZX 2WUGA 4QBKA 3GJQA 3VH3A 4K9KA 3A6HA 1TYAE 1WXHA 2A14A 3KK0A 4KXQA 3RTDA 3PUZA 2P41A 5DOVA 2BFWA 3AGPA 1E5VA 1RMTA 1N7HA 4PINA 2BEWA 4XYBA 4A2PA 1X7YB 4K9RA 5JAZA 2FDCA 4C4PA 1EWRA 2V1UA 3VKHA 5CX4A 4FFRA 2KW5A 5TMBA 4EJSB 4MAAA 1W6UA 2V6GA 3OY2A 1WPXA 3U39A 4JBWA 5LPNA 5KWJA 1MO3A 3OFJA 3VDXA 1YZYA 2A7QA 1DIBA 3V8BA 1XDWA 3TKLA 2I4MA 4B7AA 3HUDA 3TG8A 4PYQA 2VPZA 5KTPA 1CUJA 3IE1A 2X9NA 1SU6A 3EFBA 3M9LA 5EL0A 1W94A 4YFYA 1JR4A 4UJ5A 2ZYVX 3EOBI 3GD5A 3GRFA 4OB8A 1VDMA 2QP3A 3CCCA 4HHEA 1GSHA 2D0IA 2O4CA 3MCAA 4B3HA 2HR1A 1KS9A 2RHCA 4QASA 5FOUA 4KFTA 1IOZA 3OQHA 2C3PA 1CFZA 3FROA 5C53B 3SD7A 1FFWA 3T0FA 3SX2A 3E18A 1QVWA 1L1RA 4PCLA 2VP5A 3AJAA 3BGSA 1BOOA 3G5LA 4HMPA 1WEHA 5CPFA 4AX8A 4DCSA 5IUJC 4OX9B 1C29B 3JATB 1CJBA 2FB9A 3UWOA 4ID3A 1ZR2A 1SCJA 2Q5JA 3EE6A 4C05A 4CT4B 2CMKA 3C70A 2QW0X 3BFJA 3M2TA 4MVXA 3SBEA 2ZUUA 4NZZA 3X1DA 1RABA 2X2OA 4KQMA 1PLLA 1XQXA 3KFLA 2W2TA 1OX5A 4BZPA 3REFA 3OCYA 5AKKA 2F2TA 3A9VA 3E5NA 3KQKA 621PA 4BVHA 2LKDA 1ZW1A 3K6RA 3HCPA 4LNAA 4ONEA 3TCXB 3HNRA 3WGMA 1LCIA 1V3QE 3N70A 4HDMB 4LCEA 3DMFA 2GN6A 2HMYB 5E3IA 5BRNA 2IS4A 4IYJA 5JG7A 3EVTA 4FIDA 4EW6A 1K9SA 4PAMA 2QRVA 3UGQA 2QQFA 1VXRA 4FTWA 2TMDA 4HH1A 4YTEA 4RY9A 1TJ5A 5FNVB 3WOHA 4RVCA 2J5QA 1Y1SA 2JLCA 2ZBGA 2HBZA 1EK6A 2AFRA 1WUTA 3L9WA 3O03A 5TRTA 5CLFA 1SEPA 2AOVA 1P4RA 2JFBA 1XCBA 4M6WB 3S2SA 3EA5A 1X7XA 4IGAA 4PRYA 3FOCA 5CB4B 1HKUA 4QOSA 3S1LA 3G3EA 3H1TA 1R6XA 3O3OB 1RPJA 2A0FA 3PITA 5ANRB 5I4KA 3NEYA 1GP2A 1GZ3A 4BTLA 2JI6A 3ERCA 1J2UA 3B1FA 4Q9LA 4R7GA 1P2GA 5HZGA 3TZHA 2O7QA 3ABQB 4HUQB 1O95D 1BXZA 4DV2B 5PNTA 4BCDA 3GF4A 3AM1A 1RQRA 3ILYA 1ADFA 1V4BA 2G0TA 2ORVA 3CMCO 4MWGA 3L0PA 3LO5A 5T3YA 3LNCA 1HPLA 4YT5A 5M3BA 3DMDA 1UEXC 4ZU1X 3RU9A 4DLKA 1IVNA 1GPDG 2NU8A 3S5UA 1FLNA 3TAUA 1QLJA 1A9OA 3FX2A 1TKRA 3FTDA 3ANXA 3ZUPA 5EP3A 3A1NA 2VDWB 4G0QA 4N5LA 4PYLA 4NCJA 4TV9F 3IP9A 2XV1A 1MX3A 2JVJA 3TEJA 1EM6A 5J4KA 1C0LA 5JNTA 1AA9A 1V4VA 3IQFA 1V47A 4LNUB 1G3RA 1PJTA 3V1KA 3GYGA 3WLMA 3IAS6 1YJQA 3C7KA 3MBKA 3V1MA 1TE2A 4NV1A 3IEVA 3HLTA 4WJZA 4LE1A 1E2HA 2Y76A 3UMFA 4DYDA 3PJRA 2P0YA 4O4IF 3TSOA 4NYIQ 3LQYA 1U3WA 5EZYA 1A0OA 3S2YA 1GZ5A 4LZPA 1AMOA 4BQFA 5IDWA 2A0UA 3K16A 1EK2A 2H0AA 2ATVA 3WLSA 3IAXA 2BAGA 4OOFA 4Y30A 5EFOA 2PWPA 1FP6A 1NW9B 1ZGBA 2IW3A 4L85A 4ZAFA 3PQ7A 1YQEA 2EQ5A 1SBHA 3W8NA 3ECSA 2V5AA 4I8DA 4JOCA 3RBAA 3BE5A 3PIIA 1K4MA 5LQDA 1KO5A 1FPMA 1M73E 1TZKA 3WVNA 4OF4A 1DUSA 2OENG 2YIMA 4KXYA 4BBZA 3VZSA 5CCBA 1NQTA 1H1LA 1K4YA 2VRCD 3HKCB 4EB6A 1G8JA 1G5FA 2QY6A 5DTQA 5AXAA 2AC2A 3F3SA 4A8JA 2VP4A 1D0SA 1SCUA 2D2XA 2VJAA 3BTUA 1FSZA 3EZNA 4GPZA 4L8FA 3DT6A 3GUZA 3OZTA 3OQMA 4F1KA 5DN6A 2BEVA 1SOWA 3E1GA 3ZW7A 2RCYA 3VJRA 1CS0A 1DJPA 4FN4A 4CVNA 3K73O 2DFPA 4O5OA 2X4GA 4M4SA 4EZBA 3TLZA 1M0WA 1FFEA 3DDOA 3KUUA 4ZPJA 5EERA 2H4WA 3H84A 5AM0A 3E2MA 5FP0A 5LP1A 5E7QA 3WB0A 5CM8B 1NA5A 3NBXX 1EA5A 1TCVA 4HBZA 1TLFA 4U00A 3UFXB 1VFPA 4RXMA 1KI4A 2ZJYA 3WYDA 5KX5F 3U3JA 1ETHA 2PT6A 2JLXA 1XCMA 4J0KA 2FSGA 1WZEA 2JJ1D 1UBGA 2P6MA 4KPGA 4W8GA 5IAJA 3N39C 5ALDA 3UAGA 4BNXA 2WLTA 2LDXA 1RCFA 4EMBA 5C3UA 4RKFA 1AX9A 3NFYA 1Z4QA 5KTOA 3NIWA 2KYRA 1DC6A 3K92A 1PFYA 1Z07A 4WZBE 3GP3A 1RSZA 5BY2A 1XALA 3AF0A 3L3BA 1ZAKA 4W1QA 1S2IA 3KXPA 4ZDWA 1N2HA 4MIOA 3PQ4A 4EF4A 1PGNA 3PHBE 1J7KA 2Q0HA 1ZVVA 4EVRA 3CF4A 1KJWA 4TZKA 3C97A 2X86A 1D07A 1K8ZB 5KOHB 2EKBA 1OB2A 2R1VA 2JB9A 2XIJA 3LG2A 1F0PA 3NHAA 2RGEA 5CX1A 2BM0A 2J7PD 3AXTA 3B1WA 3G6KA 3TM5A 3GJ4A 4D4LA 1W88B 3DKIA 4IDEA 1W7AA 3L02A 3E84A 2X9LA 4ZVPA 4DWVA 3KKNA 1WHSB 1SU4A 1AQUA 1SR8A 2V0CA 1F8FA 3THXB 4JLAA 2HT6A 3MWDA 4RKQA 1HO3A 2WF9A 4K6KA 4QICA 4RA6B 3SBOA 3CCFA 4UEJA 1JTFA 6NULA 2WV7A 1QO0D 2PMCA 3OVMA 1MGPA 1PEDA 4J1NA 1ABEA 3PUIA 3LE8A 3SJZA 2X9GA 1BWPA 2ZSAA 3QH4A 1VL0A 2XE6A 4HDQB 5E8JA 1FRNA 5FBZA 1E2UA 3GT0A 3WJ7A 5I7RA 1SVUA 1RBQA 4RTOA 4IBOA 4TS3A 3EF0A 5DMHA 1JQ5A 2J9XB 1THMA 1JQAA 4IS2A 1XXHA 3DMTC 5EWMA 2EJWA 2R00A 4XWTA 3LGXA 1EKXA 4P81A 3FNGA 4JDPA 3ZDYB 2W2KA 1N5OX 1I6LA 4DDWA 4HYTA 2G83A 4B6GA 2ODNA 2Q45A 2ZSUA 1EP2B 4M38A 1NNEA 5C46F 4JLOA 3GT3A 2NYRA 5LBTA 4TM8A 3RJ9A 4NWIA 2G5TA 3UXEA 3H0KA 4P4SA 3JQAA 4FHDA 1EB9A 4FX5A 5I45A 5CMLA 1PGJA 1E2IA 2WJ6A 4Q3BA 5EJ7A 2F1KA 2QMYA 1C7RA 1XTRA 2ID4A 3NC0C 2AXEA 1AK2A 2O7SA 4CXMA 4N3CA 3K6SA 4TX1A 5KMGA 1XXHE 3P19A 2ONZA 3RRZA 4C4AA 4O3FA 3W6UA 1FCJA 3BMNA 4HATA 2NZVG 3MHPA 2BDUA 2J0UB 4ZCRA 5HA5A 3PPIA 4IO1A 3NHKA 3QXGA 1Z4MA 4AQ7A 1I7SB 2CB0A 4RQBA 2VZEA 4YJHB 1Q20A 5EZQA 3DT9A 2PRKA 1G3QA 1H5UA 4LBZA 3TD2A 3GOQA 5AM1A 4TZ0A 2O54A 2B4KA 4AZTA 5HR5A 1AE1A 4M89A 1WE2A 3EQ6A 3FPJA 3HY3A 4ME6A 4ZIRB 3FLBA 4O8ZA 3INTA 1YBAA 2WYUA 3TTVA 3UJCA 3WLLA 4AMZA 4X44A 4QQRA 2CF5A 4YRIA 1II8B 1HQCA 3NXKA 3BCSA 5GOZA 3BK2A 4PO3X 2J9ZB 1NJGA 3K8ZA 4ZMBA 4D9JA 3OETA 3NIBA 2GHQA 1EM8B 4FD2A 3ZU2A 4LWOA 5K45A 2P8JA 5LDDC 1F9AA 3U3KA 4UZEA 5EXTA 5DYTA 2GZDA 1VGRA 1VKOA 3RUHA 3FJ1A 3H1EA 4V0OA 1Z0DA 3OFNA 2F9LA 3ZQ6A 4MV1A 1BXKA 3I9LA 1T13A 5ALTA 1KI6A 3COSA 5TF0A 1AQNA 3DHEA 1ZN2A 2O2CA 1STOA 2WSSD 4IOKA 1UADA 4S1TA 1EUCB 4KV7A 1NRJB 4RFLA 2QL7A 4LECA 4OHPA 3JQ7B 1UP4A 3LXMA 2PGJA 1Z4IA 2KI5A 2X5OA 4CV1A 4IZIA 2AOUB 5KKAA 2L2QA 5AOBA 4M1KA 1EAYA <