2DKOA

Extended substrate recognition in caspase-3 revealed by high resolution x-ray structure analysis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-3
publication title Extended Substrate Recognition in Caspase-3 Revealed by High Resolution X-ray Structure Analysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2dkoA00
3EDRA 2H4WA 3D6MA 4N7JA 4FEAA 4N6OA 4EHLA 2C2ZA 3GJRA 5IASA 1IBCA 1NW9B 3PD0A 4ZVTA 1I51A 3K7EA 4NOJA 5IC6A 2H5IA 3S70A 1I4OA 4PS0A 1RHQA 5IARA 1K86A 4PS1A 2C2OA 4NOLA 5IBRA 4N7MA 4ZVRA 2Y1LA 4ZVPA 5IAEA 3V4OA 4EJFA 1RHUA 4D3ZA 1SC3A 2QL7A 4JJ8A 4NOKA 4AW9A 2J31A 4D3XA 4NBLA 1RWKA 2FQQA 3H11A 2CDRA 3D6FA 3H1PA 3KJNA 1ICEA 4NOMA 4QU5A 2HBZA 3V55A 5H0IA 3NKFA 1GFWA 1RWPA 5JFTA 2FUNB 5IANA 1QTNA 3V4LA 4JJEA 4D3YA 4AWAA 3P45A 1PYOA 4QU8A 2CNOA 2P2CA 2HBRA 1RWMA 4JQZA 2J32A 4QUBA 4QTYA 2H65A 1JXQA 4ZVSA 4DCJA 4JR2A 2H48A 2CNKA 2XYGA 4I1RA 4JJ7A 4QUIA 2CNLA 4EHFA 2J33A 3NS7A 4ZVUA 2QLFA 3QNWA 2K7ZA 3UO8B 3UOAB 2WDPA 3D6HA 4DCOA 4JB8A 3R6GA 1I4EB 3BIJA 2AR9A 1SC4A 4FDLA 2H51A 4IEFB 3E4CA 2NN3C 5IAJA 3ITNA 4QUJA 4QU0A 2CJYA 2HBQA 1M72A 2XZTA 2C2KA 4IYRA 4JR0A 4QUAA 3DEHA 5IAKA 5LUAA 4LSZA 3DEKA 4N6GA 1RWNA 5LUBA 3H11B 2XYHA 3H0EA 4HQ0A 3IBFA 3NR2A 4HVAA 1CP3A 3SIRA 4EHHA 3EDQA 4N6NA 1PAUA 4PRYA 2DKOA 1RWXA 2H4YA 1RHRA 3R5KA 4EHAA 1NMEA 4FGUA 2J30A 3SIPA 5IBPA 3DEJA 1SHLA 3R5JA 1I3OA 4QUDA 2Y0BA 4QULA 3GJTA 3R7NA 1RHJA 4JQYA 2XZDA 4QU9A 1K88A 2HBYA 3V6LA 3GJQA 2CNNA 4JR1A 3KJFA 3S8EA 5K20A 2C1EA 4DCPA 1CVRA 5LU8A 3R7SA 4N5DA 2QL5A 1F9EA 1NMSA 2QL9A 3PCXA 4EHDA 3R7BA 3PD1A 1NMQA 1KMCA 4NBKA 3RJMA 3P4UA 4I1PA 2C2MA 2CJXA 5IC4A 1RHKA 4HQRA 3OD5A 2FP3A 1RE1A 1SC1A 4QTXA 1QDUA 3H13A 1RWOA 4FXOA 2XYPA 5I9TA 3KJQA 5I9BA 2QLBA 5IABA 2H54A 3IBCA 5IAGA 4M9RA 4NBNA 4QUHA 1QX3A 4PRZA 2H5JA 3DEIA 4ZVOA 5LU9A 4QUGA 3R6LA 3V6MA 2QLJA 4ZVQA 5IBCA 4QUEA 4EHNA 4EHKA 1GQFA 1BMQA 3V3KA 1F1JA 1RWVA 4AWBA 1RWWA 1RHMA 3GJSA 1SHJA
chains in the Genus database with same CATH superfamily
3EWIA 1O7JA 1QFMA 1XD9A 1T6BY 3D4LA 5CA0B 3NRJA 1Y63A 4TSFD 1UDXA 3RROA 1UXKA 2CN1A 3NHPA 1H6CA 3LL4A 3UIEA 3MGAA 2XOXA 3VC2A 2RJNA 4NMHA 3CH5A 4D7AA 2FVYA 2DQZA 3D5TA 1FSPA 2H85A 3GB9A 1D1PA 4IIJF 3RUHA 2WVHA 2ZSDA 5DBEX 4U6SA 1GYQA 1QRRA 2G77B 3ZY4A 1UT5A 1ID1A 4IRUB 3FYDA 3A9WA 5J58A 1QHEA 3R41A 4XLTA 4TKZA 2ZG6A 3K0AA 2H8GA 3CNBA 3D3JA 4L5CA 3B6KA 2HFKA 1IHUA 3BIWA 3QELB 4EG7A 5E7JA 4ENPA 5K2MA 3V8QA 4QLBA 4YUZA 3HH8A 4KV7A 1WR8A 2BFDA 5GADl 3TGLA 3RJ5A 2XUPA 2K5UA 1XROA 2PMKA 2XADA 2XQVA 2WPNA 1WETA 4UDYX 4W9RA 2XXAA 2J32A 1H69A 3GLSA 4D46A 5AVXA 3RHTA 4RWEA 5FNVB 5EJ4A 2VDOB 2GOYA 2O2ZA 3BAFA 4BNZA 3SEAA 5JD4A 1JT9A 4UM9B 3KUXA 1O6GA 2G76A 2ID7A 1ADYA 2E4VA 4QQRA 1GTSA 3KYIB 4PC7A 3U80A 6GPBA 3QU4A 4C7VA 3G59A 1NIPA 4CMBA 2VWPA 2ZTSA 4WN9A 1BXZA 5A6VA 4RK7A 4BBZA 3S2IA 1HGXA 1KJJA 1NW6A 1LXCA 1HZZA 5KNDA 1YBAA 3RVMA 4J1TA 1DV2A 1TKBA 1IJKA 4JI1B 1JN0A 1YR8A 2XWSA 2R5NA 4FJ0A 5L9AA 1KTIA 4HDQB 1MW9X 3F8WA 3D0RA 4L5JA 4KUEA 1AV6A 1TEXA 3EZLA 4EMUA 3ZHQA 1GGNA 1E99A 1YJAA 2DHDA 5FWDA 4M8KA 1T5BA 3ZCPA 2WYIA 1YUBA 1IG3A 4KX3A 2NACA 4PZCA 3KELA 4TT8A 2Z2JA 1K0UA 4X7PA 3F46A 2Y76A 2JJ2A 2W6MA 5BSWA 1UXJA 3LUHA 4N82A 4PLCA 5FR2A 2P1ZA 3RS5A 3VR5H 3E9RA 2VWHA 1LX6A 2J6CA 5ALXA 2BE9A 5AXDA 1JXMA 2AN9A 2AZMA 3HCCA 4BIMA 3MTGA 4B79A 1F9EA 1ZGHA 3DCNA 1BDBA 3WYDA 2AC4A 1DJOA 4LHWA 4GM0A 1Y34E 4C6TB 2BPOA 1BWSA 3LUCA 5JAPA 2ZB4A 4CF5A 1VSVA 4HSEA 1OXSC 3C8HA 3MK31 2W4QA 2AFIA 4IIVA 3X1XA 4ZO7A 3I2GA 2XAUA 1MXHA 4K3UA 2IYXA 4DLTA 3EEQA 4U3JB 3ZEIA 2ZZKA 4PNZA 4UW9A 9ABPA 4HFRA 1OILA 1F0NA 3IXMA 5E3HA 5C5IA 4MJ7A 3MWEB 1YE5A 4LDRA 2BFBA 1GIAA 3PQ8A 5BVHA 1J33A 1XZJA 3I6BA 1CV2A 5B6PA 3K09C 1PNRA 4FOTA 3Q9LA 3PDUA 5KSPA 2G83A 1R8QA 4X60A 4IHKA 5MN4A 3T1NA 1G0OA 2BZ0A 1GRRA 1DQRA 1C30B 1DAIA 3ESYA 5KJ6A 2JCSA 2O52A 1EZ1A 4CM9A 1S02A 1YT5A 2R87A 3BF7A 3NT4A 5EXTA 4J49A 1UQTA 2LE0A 1PGQA 2WWGA 3DOCA 3V4SA 4DSAA 5JH7B 4DIKA 5TF0A 4E13A 4QPJC 5DHRA 5IARA 4XKJA 1LPPA 1LLDA 1PD0A 4JGBA 2PX8A 1NG1A 3BK2A 3SJAA 1IG0A 2O8NA 1NJ1A 1BE1A 2OV1A 2XVMA 1HE8B 4YLGA 4MWBA 5JBNA 5JLJA 1M0EA 3T99A 1Z4NA 4WLUA 5EESA 3UBMA 2QRKA 2CUKA 4CN8A 1TYAE 5KTPA 1POWA 4BUCA 1KBQA 3UATA 3QVWA 1P33A 5EZ5A 4LNUA 2IYAA 1WUKS 1H9BA 4HDCA 3OLXA 5K0SA 4J43A 1QAOA 4JUDX 4PSKA 2OD9A 1RLUA 3IVRA 1ZUIA 1XZIA 2PN1A 3I5UA 3BK1A 3E23A 3OOYA 4H0NA 4ILKA 3SLRA 3TLEA 3RWMB 1AKTA 2G07A 2HF7A 1J49A 2A4KA 3GNLA 5I8WA 1G20E 2Z04A 1GSOA 4U2GA 1KO4A 4KQFA 4UJ3A 4HEA1 3SQLA 2SKEA 4PC6A 2Z5VA 3QA3E 3MAJA 2XITA 1H1LB 5HRCA 1KFJB 1PG0A 1QMGA 4D8UA 1G8JA 5JJIA 4CG0A 1RLIA 2LD4A 1JR3D 3TRDA 4YMIA 2YL2A 3DQPA 2IP1A 4R6WA 2HU5A 2J6HA 2ODWA 3DA8A 3MMPA 1JB1A 1RWNA 3D8NA 2WWWA 4B3BA 3FGOA 3LJKA 3A10A 1K4MA 4WOBA 2FFRA 1ECPA 4FUQA 1XALA 2PMBA 3BMXA 3CRMA 3MWDA 1WV0A 3WGOA 1HM5A 3SHVA 2ZT7A 1XCOA 2XXAB 2ZYDA 2J5RA 4QEDA 3ZQKA 4EF6A 3HB4X 1XCJA 2H3EA 4LCBA 5DW0A 5AT1A 4BRWA 1EGQA 2VPWA 3CZMA 1PJBA 1V3VA 3G2NA 4QNMA 4XIFA 3GJQA 4XA8A 5IM5A 3BJRA 2C1EA 2HAEA 4Q1CA 1Y1RA 3OPVA 2GZ1A 4OP3A 4YRNA 5KREA 2QD2A 4Q7MB 4WN9B 2GR9A 2JLXA 2VZEA 5I7SA 3OU7A 3O4IA 2SNIE 4JIMA 4K05A 3REOA 2ZB8A 1W36D 1G9SA 5EWJA 1DAEA 1ULTA 3PWSA 4K6OA 3HJHA 4DM4A 1XAGA 1PGOA 3TW4A 4YBRA 4FFBA 2PSJA 1S3SA 4MRSA 3CEAA 5C1OA 1R8XA 1OFHA 4LKRA 4WXPA 1A8SA 1TLFA 1SXJD 3IBYA 3ZOZA 1JRLA 4S2UA 1UPUA 2N9UA 4NMWA 4PN3A 4N0MA 4Q34A 1MAAA 2XD9A 1E4EA 3EEBA 1ZLXA 2ECQA 3EQ2A 3G88A 5FP0A 4MROA 2DPYA 3VRHA 3FTDA 4JY7A 2V7EA 4KFTA 2J3HA 4PG7A 1N1DA 2X0NA 5D3KA 1UBUS 1UP6A 2C1ZA 2YN0A 4Q0MA 4FEGA 3DC2A 3TSZA 2FN3A 1XX6A 3LPAA 3ERCA 3RVLA 1XYGA 2Z2KA 3VYTB 3AJ8A 1JHPA 2AYZA 2FUG1 2EZ9A 2VJPA 3L07A 3OC0A 4BJ5A 2BR4A 4UAGA 1B00A 5EIFA 5K3SA 2PEZA 2JAPA 3WAJA 4JI0B 2QI9C 3NYWA 3FPFA 5FCDA 2AFIB 1G41A 4XLZA 5JYCA 1I4WA 1SCBA 3LRTA 5C8YF 4ZQFA 1QHNA 4O29A 5KNCD 4MO9A 4C6RA 2YWGA 4EJ6A 3KB6A 4EB6A 1ES9A 1MH1A 2AL7A 2HLHA 2OLKA 3EYAA 3OCUA 1I3KA 1YE8A 5EPUA 1DKMA 3MOSA 3ROMA 1LTQA 1VLQA 2BFBB 3D59A 2OCPA 1K7YA 1MX1A 2EKBA 3GIWA 4I36A 5IZCC 1V43A 3QH4A 5BVHB 3U4MA 1G6KA 1N0HA 3JYNA 2C61A 2X40A 1VSTA 4X41A 3ZCVA 1UANA 4K2HA 1USWA 3S2UA 2GM4A 4R51A 3IPRA 3EGEA 4DLAA 4QTYA 4TSRA 1I0LA 2ZR7A 4Z6KA 2IS2A 3NBUA 5T8KC 1Y4DE 3OFNA 3WBJA 2KB0A 4KXNA 5LDHA 3PC8C 2DFPA 3QSYA 2EYUA 3AFGA 1KOFA 3EGCA 3TBHA 4NONA 2VHXA 4IBOA 4BEVA 1H8HA 4XR4A 1KEWA 2FPIB 2OKGA 3UT6A 4WUTA 4B6QA 3NMUF 3ELWA 4J16C 4LJLA 4WINA 2D74A 3SBXA 3OQOA 2CVZA 4MJ3A 4YH1A 5AK5A 3GLHE 5BYKA 4LJYA 9LDTA 1WZCA 1I13A 2CHVA 2PXHA 5DM4A 5CB4A 2AOUA 1N0WA 4NAVA 1MEJA 4EGCB 1JMVA 1Q3HA 2ZYWX 4QSMA 5HR5A 3GMIA 4GXTA 2B9VA 1J21A 1OFGA 2PFSA 5DCYA 2LPMA 3I6IA 4ENQA 5CDSA 4L8LA 5F1KA 3GLFB 3L77A 3NO4A 5DMXA 2FHSA 4E33A 2AB0A 3RVDA 1C3OB 4E30A 1TM4E 2GZ2A 3IERA 4LNUB 3ETEA 5KHOC 1Y4AE 2CEKA 2XODA 4QOHA 3F7OA 1Y42X 3UKDA 1K88A 2C5HA 4F4CA 4YRTA 2FA9A 1L9XA 4ZT5A 1CUCA 5HG0A 1WQ1R 3FCEA 3DMYA 2HNKA 1XZHA 2Q4EA 1PZGA 5CT5A 4N65A 2YINC 4B4VA 3IHWA 3WIOA 4I1PA 1PZMA 4Y9DA 3WLFA 3PHJA 3ESRA 1RE1A 2G9VA 1EFKA 4MI1A 2OT3B 3TLKA 2YJTD 4FI3F 2CW5A 1X19A 2R8BA 4E08A 1DO8A 2XNSA 2J07A 5KJ1A 5BWMA 1BGVA 4IDHA 3L9XA 4CR7A 3L1JA 3FB4A 3O84A 3OT1A 1BC5A 4DMRA 4Y6LA 3OJOA 2X5NA 3BXPA 3UBTA 1CRZA 1AKMA 1D09A 4CM3A 4JHLA 5LQSA 3I6QA 1Y48E 2JAHA 1NW7A 3TKAA 3FTCA 1F0YA 3V1YA 1X70A 5E1OA 1D2HA 3PDJA 4J90A 4CI0B 2G36A 3RVQA 1EDEA 1MOQA 1YE3A 3ZK9A 4R7GA 3IMKA 2MMGA 1PHRA 4OGLA 2F1OA 3TXAA 1O3YA 4GMFA 5JT1A 3JAMA 3HFGA 4EUFA 1I1OA 5EWJB 1PDWA 4CQJA 1P5ZB 2GD2A 3LS2A 3PDHA 1FUKA 1KPGA 3VPCA 2F48A 1RYEA 4FFBB 1V7ZA 2RBKA 2XNCA 3IEUA 4ZVRA 1UBRS 1U5AA 4R8VA 2X1LA 1E3IA 1FFGA 3PXDA 4DCNA 2JFYA 2O3RA 4IZ6A 3VPHA 4C5AA 4TYWA 4WXEA 3FDZA 4RYDA 3JATB 1E4EB 1WUTA 1G8KA 3IPCA 3TTTA 3N76A 3PUVA 3X1MA 3I72A 4RTQA 3FYUB 3KR1A 3IRUA 5A05A 5KWVA 2C8KA 2RK3A 3G2IA 4JCCA 5AM2A 2ONZA 4LJ4A 3P7MA 1SIUA 1HLGA 3OUTA 4S1VA 2C9MA 4DNPA 4K6CA 1LGYA 2H1WA 3HMKA 1YJBA 3OA2A 3PGA1 4HOYA 4P7FA 4BJ6A 3NHYA 3VAYA 5JJ5A 3U4IA 1NRXA 1LSUA 4CLHA 1IEXA 1QE3A 2AZDA 2R7LA 2CNLA 1J2UA 2WSSA 2F1KA 1S3GA 1A0OA 4QPDA 2P7IA 2GPAA 3RS9A 2PGAA 3JRWA 1X9HA 3ZXUB 5KDDA 1IZ7A 2GF2A 2XDYA 5JSYA 3AH8A 3KXKA 1D07A 3OM8A 2XCLA 3MPOA 3M83A 3O8DA 4YA6A 4OGGA 1YHYA 1Q44A 4EB6B 5FLXA 1KL7A 1SZCA 3NHLA 5KVCA 3V1UA 3ABQB 3DVSX 1KK3A 5EMNA 3WYFA 2DJIA 4ANFA 3G2LA 1NM5A 3ZD9A 2E85A 1QHHA 5GGXA 1ATZA 3VAAA 4CODB 4EHJA 2QORA 3PDIA 3TX6A 2H2IA 1MO2A 1QLJA 1T9GS 5H3HA 1CNFA 1Z4KA 2X5JO 4JDUA 2ZT6A 1JH8A 5HTKA 4CLEA 5ITVA 2QN9A 2XKKA 3GNTA 2Q5IA 3OOEA 3KALA 3KD2A 5HIKA 1XEXA 1XFAA 5IKPA 1J0AA 1VHWA 3TW6A 2I29A 2R6AA 1HRKA 1L7DA 1ZIXA 2F7SA 4JMPA 3EXAA 4FM9A 1PGNA 3VR4D 1E5TA 3LO8A 1YOBA 1QYCA 1SHUX 3PRKE 4QOJA 5H16A 1A7JA 2P35A 2RHJA 4Y2HA 1ST3A 1FFSA 3M6LA 2AOUB 1A69A 2WQZA 3HKEA 3IQXA 2R1UA 4C4PA 1FJHA 3IEPA 2RHLA 4ZOCA 1RWOA 1JDJA 2PKQO 3AY3A 4KWIA 1O0BA 4GOND 1ISJA 4UVHA 3K2IA 4UBKA 1DC6A 1R0CA 3ZU6A 2F4NA 1T3ZA 5EXDA 1FF9A 4BNLA 1P80A 3D3WA 4J0IA 4K9MA 3PLAE 1JF8A 3SSMA 4V0OA 1W4AA 1HE5A 5IMSA 3C1AA 1WKBA 3NCTA 1IJEA 1Z0ZA 1ECFA 1U80A 2WWRA 1BQ4A 2CMFA 2GN6A 3HV0A 2HPAA 3G0GA 3L41A 4YRAA 2WVJA 5KQRA 1GTMA 1S96A 3V80A 4N8EA 1QO7A 4PTYA 2KHZA 2A2ZA 2IYFA 4KQJA 4Q21A 4BB5A 4EITA 1CNEA 4CQNA 5A7HA 1R8YA 2CDAA 3AKEA 3WHLA 3JD0A 1RXYA 2IZOA 3L5OA 4PX2A 2I7CA 2GCNA 3ITKA 4OH1A 4XLLA 2X0FA 3QFRA 1V8BA 3SICE 4D97A 2RI1A 1IHYA 4HNAB 4Y2QA 3TDKA 4W9MC 3VX4A 2F3QA 2Y1LA 3B1KA 3LT2A 3OX3A 4FYKA 4RDCA 3VQTA 2GD0A 2OOKA 5TGTA 4C5BA 5BN4A 2YW9A 1Q1QA 2ZRKA 5J9FA 1E92A 3W9UA 3OT1B 3NBQA 4O4IF 2CWWA 1M7GA 5C51B 3LY9A 4AS1A 4TOIA 4OQEA 1IBMB 3CNLA 3M89A 2WHRA 1KZ1A 5CT4A 3SZUA 2BGMA 5FPKA 3FUXA 1AGRA 3FMOB 4LIPD 4RQAA 1UDBA 3TIGA 4YASA 5UKDA 3OEHA 1QDLB 2AG0A 2R7AA 2VHVA 2G9QA 5MN5A 1FFWA 1VGQA 2EBWA 1WXHA 1Q7TA 1ZYUA 3FETA 3P27A 4I14A 4B6SA 5LQMA 3ZHRA 1EVZA 4M99A 3RUDA 3F6RA 1B93A 2IPMA 4A2PA 1Z15A 1DZIA 3B6EA 1WV1A 4E07A 4TXHA 3EC2A 4Y67A 5FOVA 4LJRA 1GVNB 1ZIPA 2BD0A 1ZNYA 4LG1A 3TW8A 2E3JA 2V6GA 1E9AA 5AJZA 4ZI5A 3ZNNA 1GLGA 4TYNA 2ODBA 3B5IA 1Z47A 4GI3A 3G0BA 4OQNA 5E6SA 4HYQA 2IXTA 4GVPA 1YBFA 3CEJA 3RBVA 1HORA 1I0ZA 4JC4A 1Q5PA 4OB8A 5FBZA 1W19A 2C82A 4BP8A 5THQA 4F2DA 1LI5A 3CRRA 1P19A 2HHLA 2QQ5A 2IOFK 2ZCVA 1J24A 3FDZB 3B82A 2R3SA 4GC5A 4HH4A 5HE8A 3WJ7A 4B3IA 3LWDA 1KE2A 2Q7OE 1QYIA 2ADOA 3RYHA 3LKZA 4TT3D 5ALSA 1U8XX 1M0SA 4KRGA 4LXUA 2VP6A 1T9CA 1NULA 1QPGA 3PXEA 3TTSA 4F8JA 4CIWA 3NALA 4BO4A 1Y1TA 3L46A 4G5YA 3OUZA 3LKDA 4RAOA 4RCVA 5CM2Z 3RC9A 4Y2TA 3QSGA 5EMHA 1NLMA 2GILA 2TMKA 3K92A 3R7NA 1JEQA 2FEOA 4ID3A 3PLNA 3PC3A 3RB8A 3DAOA 4B3MB 4RVNA 1LS6A 3FAZA 4G65A 4I3GA 1PDVA 2Y1KA 3IUYA 5HGJA 1KOGA 3FJ1A 4NZNA 4DQLA 5FTJA 4B3GA 3FZQA 5E9QA 5SYAA 4Z4EA 2QE6A 1IM8A 2G9NA 1KRXA 2SBTA 4MW9A 2CHEA 3DE6X 1IPFA 3DYVA 3NUZA 3WWEA 1GR1A 3U6KA 3LXMA 3DMHA 1TXGA 2G04A 4GPIB 4QQ8A 1EPUA 3DE7X 4S3MA 1JJVA 3R8XA 1DTSA 2AFHA 2JCGA 2YNMC 3IQEA 1K9SA 3ZDBA 2HWXA 3VU0A 4H77A 1SOAA 4GRDA 2BAGA 4I55A 1SBIA 2NOAA 4ZN6A 1MX3A 1RJWA 2OXFA 3I1JA 5AW1A 2PO5A 3H9CA 1W0KD 1U0RA 4YMTA 1QHHB 1JNYA 3MT8A 4JOCA 4H7DA 4A0SA 2WMDA 1PR5A 3PDIB 4HDNA 3JQAD 2FWPA 2NUTA 1FJ2A 1U0EA 4N5IX 2FNAA 5JRDS 1VKZA 4LOLA 4LE2A 4NFLA 4QPZA 3UXEA 1IOLA 3Q6IA 4HADA 3GA7A 1E62A 4J76A 4DUPA 2A3NA 2E49A 3L1VA 4EX7A 2RJ3A 2B1RA 2G5PA 2FW0A 1BQEA 1FMTA 1K3UB 1VBMA 2XVYA 2OQIA 2R6R1 2ZLBA 4BLSA 3O1JC 3W2FA 1XMVA 3WL8A 5IC6A 1J0XO 2OXEA 3R9WA 4GOXA 3AHDA 8LDHA 1TUBB 3HKEB 5LVAA 4EG0A 2FMUA 1ONNA 2XTNA 5IH7A 3OZVA 4Z54A 2JBHA 3H6HA 3TN7A 3GWGA 3BRWA 3O47A 1LPOA 1XA0A 5HIMA 1ZAKA 3OEEA 1XZMA 3OX2A 1GFZA 4DLNA 2GN8A 1W1UA 3EXIA 3HCOA 2H1SA 4RLSA 4CMHA 4F86A 1ZPDA 3NOXA 4ETIA 3D3WB 4UATA 3PNQA 5L3VA 2B9EA 1QQ6A 2IHJA 1ZZGA 3K8QA 4NBLA 1U7UA 1RQRA 1MJGM 4G23A 1R6TA 1WB4A 3BEDA 1G1MA 3BWYA 5T64A 4QNNA 4D3YA 1S2NA 3LCJA 3UA3A 4L5AA 3HJGA 1FFDA 3R20A 3R1IA 1Y7IA 3GCGA 1LBSA 1A9QA 3ZE6A 4K9DA 1URPA 3G0OA 5HKAA 4M7RA 3HBLA 3VPGA 4QYWA 4KPGA 4LHSA 2FW9A 1UK6A 4JLNA 4GI5A 4MAAA 4FBLA 4K46A 1E1MA 1JYEA 2OBFA 4GC9A 4AJIA 4EPWA 3N8DA 5ALVA 2IHVA 2GX6A 3HKDA 3DJYA 3D3QA 5H7XA 1X1QA 3KYJB 4GQBA 421PA 4DMHA 1XQ6A 5BN4B 1J5EB 1Y1KE 2BFOA 4WK4B 4NNOA 1C7QA 4MVJD 3L06A 1FPMA 4EVQA 1NLYA 4I1YA 1IXZA 1Z35A 2YXEA 3WWPA 5I9LA 1LC0A 4KBFA 1FQKA 1JGTA 1R0RE 2YR0A 4KUHA 5KQLA 2P8JA 1FRNA 5HW0A 4MWEA 4RVSA 1N3BA 4NYMQ 4MVJP 3IB6A 2PGDA 5B4TA 2O1EA 2XTMA 4M0DA 3LM8A 1E5LA 5BURA 3HEMA 3ADKA 4JLWA 5CVCA 4L5YA 2RG7A 4RZ3A 2XEXA 5FOTA 1ZCBA 2QD3A 3VISA 2W6QA 1F8XA 5KQGA 3L3BA 4P0PB 4F92B 3AHIA 4QBKA 1JA1A 1QIJA 3DP9A 1UZNA 3TSYA 2H06A 3TW8B 4X44A 4P3NA 3QWAA 2BGUA 2PR2A 3T9FA 5JYEA 1V16A 2OHGA 2DAPA 3ZH2A 3WRYA 1ZSYA 4HXYA 2VQFB 4A3SA 3G5UA 3BTSA 3HUEA 4GI2A 1O95C 3B5JA 1PR0A 5C1PA 4B17A 3BF8A 2F3PA 5F33A 3E0XA 3TZEA 4ER5A 5I7EA 2VWGA 2DFTA 3Q3JB 1N25A 4I5EA 2HW8A 5BOSB 1GAEO 5JHGB 2JIZD 1OA0A 1WIWA 4YR7A 1CFJA 3QBEA 2YIVX 3Q8XB 4G4IA 4KLNA 3ZTYA 2P5TB 2JVJA 5D5HA 2AXPA 2WZDA 4KAFA 4DV2B 2RGYA 2GBLA 3D6TB 3TKYA 1ND5A 4IQ8A 3MT9A 2ZJOA 5FBVB 1SHJA 1JEQB 3LD9A 4MWGA 4XIJA 3VDXA 2JW5A 5BUSA 1Y4ZA 2P9EA 4BNYA 4DY6A 3ZY6A 4EGJA 2Q8QA 4MTLA 4B73A 3UUFA 1XMSA 3LDGA 3LAWA 3KSRA 1J8YF 3QFHA 2CEAA 1W88B 3R6TA 3UUEA 4Z1OA 3HXMA 1WSAA 4F5DA 5LP6C 1NJGA 2OQRA 3FJYA 4D82A 4GXQA 5EP1A 2ZIGA 2EHDA 4RCZA 1PK7A 2H5IA 1I4OA 2GZAA 5FTMA 1DTWA 3GL9A 2QRGA 3DEAA 4C4SA 1M8GA 1XA4A 2AFHB 3AKYA 2CD7A 1WEKA 1CC1S 1EHIA 2IYZA 4G8BA 4H7JA 4JJZA 3WB0A 5FWNA 3CLVA 3L7YA 4I55B 4JODA 1WU7A 4KKVA 4QOEA 2FOXA 5L3QA 1BCSA 4AG5A 1QOZA 4AYWA 3WLIA 4HDNB 2EW2A 1R5JA 4GZ6A 1NVTA 1XYYA 2NUTB 4LF8B 2IKSA 2PD6A 2ZJYA 3AF2A 1PZEA 4DJJA 4EI9A 1OB2A 3G13A 2AW5A 2NZYA 2O3SA 4UNIA 5CH3A 2F6RA 4D1YA 1RZRA 3MSXA 1KRWA 1V7CA 4G9EA 4MW2A 4DRXA 4P7JA 4P80A 1HYBA 2PH5A 3KZXA 2DLNA 4ZVSA 3WR5A 3TLAA 4MK4A 1QGED 3A32A 3AUSA 3C3PA 3NIDB 4X54A 2A3RA 2IU3A 4ZGGA 5J2UF 3FIUA 1W9MA 4CDRA 2VHQA 3BZBA 2WFAA 1ODFA 5JDIC 4HZIA 2QN1A 1D0SA 3JSAA 3EXHC 4MQ4A 2B1JA 3ZJUA 1OH7A 4FDLA 2H00A 2P4EA 3ZVMA 1CEYA 3THOA 3EXIB 1GP2A 2CJYA 3WLAA 3FJOA 4FFNA 1O8BA 1AX9A 2QB5A 3NC0C 4MLZA 2Q2NA 2X6RA 3E84A 3KXDA 3W3ZB 3MB8A 4MR9A 1TRKA 4QD3A 4WPGA 4G5RA 1OREA 3QIVA 4HGNA 1FSGA 4DSTA 3N6RA 3UB4A 5JC1A 1PGPA 4H18A 4RV4A 4P4UA 4EY5A 1NV8A 1RDFA 5EIBC 1Z9BA 2H1RA 3B3FA 3LMKA 1OX4A 3E7DA 2WOJA 4HLCA 3RQSA 1WS6A 4JEMA 1TFRA 3PFWO 5GJWC 3VZBA 5K3FA 2EW8A 3ET4A 1OFUA 1D8AA 3QE2A 1UMDA 3F7NA 1HNXB 2PS1A 4Q3NA 2HK6A 3DEFA 1OA1A 1S8NA 2WF6A 3IIJA 2IYTA 3HKDB 4UBMA 1QOPB 4YVFA 3Q5GA 5TMPA 3A9RA 4R1NA 4OGKA 5C7YA 1RQGA 2XDWA 4Z4IA 3PQCA 3B9PA 5HWSA 1IXYA 1CU1A 3RHFA 3C3KA 4DLUA 4Q5IA 4PC3A 2X76A 1GL3A 1HETA 4OXXA 1IK6A 2OG1A 3RUCA 4OFWA 1FXSA 4IIFA 4R84A 2OCIA 2IV2X 1WMDA 2P0AA 2AFIE 4KK3A 4WGGA 3R7AA 3RBAA 3SQMA 3LTEA 1I6MA 2GNPA 1YR2A 4RK6A 5LBUA 4KR7A 5BN5A 3RG2A 2C4WA 1ZL2A 3B3JA 1FNNA 4UNSA 2NSHA 2HXSA 1KOLA 2A0UA 2LBPA 5C80A 2H4WA 1DKQA 2O1WA 4ZO9A 5E0KB 3SXJA 1KK0A 2UYYA 3ONNA 1Y3HA 5IMBA 4FS8A 2BI4A 4ENSA 1EJ2A 1ZJJA 2YX1A 1V16B 4B7UA 1UIRA 2Q0XA 4B6OA 5ARDA 3X43A 4KLZA 3QENA 5K5EA 5BMOA 2YZGA 2D54A 2V7UA 1SVNA 3BCRA 4OREX 4TUYF 3T5TA 5NLLA 5KNDH 4OHBA 5ITSA 1FW6A 1GQRA 3QEJA 4QVGA 4MGKR 1TW2A 1H2XA 2ZSEA 1Z16A 2ZYHA 1G18A 3CX3A 4GZMA 4HZGA 1TUIA 4OYLA 2FU5C 1W9HA 2O0HA 2OO5A 1L4UA 2JRLA 2QSYA 2ZI3A 2V0GA 2J3EA 3N8IA 2W5UA 4FN5A 3T7RA 3AUKA 1V8FA 2WHYA 5KAMA 1TDJA 1I3LA 2FXIA 3Q7TA 4H1UA 3V1LA 1QRSA 1E6KA 1XL1A 5C2JB 4GEGA 1Y1PA 3Q85A 4XOUA 3PI6A 1UFVA 3C6BA 1Q7RA 4LF9B 3EEOA 4PW0A 4B9AA 2QD1A 3RSSA 3L7IA 2B1QA 5T7BA 1N78A 1VTKA 1V8OA 1A3CA 3F6CA 5KWJA 5LWQA 2IL1A 3GLFE 2IEIA 1VLLA 1LI7A 3RU3A 1GCOA 5F5NA 5AM4A 5K3AA 4JC0A 3T4XA 1YU9A 4E6PA 1NNSA 4GLOA 3ONFA 3RAPR 4JI5B 1AGNA 5FA5A 4L0QA 2VTKA 4C0QC 3GIDA 1EK6A 3PXGA 1Q57A 1MEOA 1DTWB 1U4OA 4RMHA 1TI7A 5HQTA 1RJEA 1VYUA 5ESDA 1JG7A 4KSCA 4EKYA 3RM3A 2NN3C 4ZK6A 1XDSA 3BE6A 3WRXA 5F7XA 4L4YA 5DNWA 5L3QB 3ISVA 2WSYB 1IC6A 1OVGA 3GGDA 4BAGA 4RQUA 3K4QA 1E7YA 3BZUA 3FWKA 5TR9A 1G8FA 4KMOA 4QYIA 4LHEA 3B1ZA 1KC3A 1OFTA 1T5SA 3KUCA 4DA4A 4Q7KA 1TCCA 4JI3B 3U09A 1H2RS 3H2SA 4DRXB 3E15A 3R5XA 5JAUA 4L9AA 4TKLA 2FMIA 3UGQA 4JHXA 4XYLA 121PA 1AQUA 2M9MA 3B6ZA 4G5GA 2R8YA 2NSJA 3QWHA 4R81A 4L6CA 1Z73A 3BFVA 4LA4A 4OXYA 4B8ZA 3GPCA 4GSKA 2Q8PA 3PC2A 2QY9A 4G4GA 3MAAC 3W4JA 1SG0A 3OBIA 2RKBA 3WWCA 1O97D 3HABA 1SKQA 5K0CA 3I5YA 3S8YA 2JEOA 3WK6A 1IWPB 4LBYA 5JQWA 1Q50A 1THGA 1PR2A 1PSZA 3NX4A 2AUTA 3AL3A 3BGWA 4QJ5A 4CMIA 4BUZA 1BHJA 4IJWA 3PTAA 3W77A 1QVWA 4EFKA 3BJZA 1QX3A 1T35A 3I9FA 3ILHA 1P9RA 3PP8A 4I9HA 4Z0HO 2EZ4A 4MR9B 3NP7A 3FLAA 4L6IA 1UKCA 1KZYC 5JNRA 5CEJA 4G0XA 4HGRA 2PWAA 4LGMA 2QPLA 4DIMA 5IWAB 5HE9A 2JIDA 4XX1A 5F3WB 2QENA 3P19A 5KJFA 2H4XA 5BQOA 4DV0B 1OX4B 4JQOA 1GA6A 1IBSA 1NT4A 1RJGA 1G5PA 1FYXA 4EJSB 4UC0A 4ACAA 5FD8A 1A5AB 1WY5A 2ZI5A 3JQ6A 4DMGA 1UMDB 4DG5A 2OCYC 3QLEA 4YJ2F 4HAVA 2EFGA 5I8ZA 3IQIX 4BQRA 3MF4A 1XWWA 5L95A 2DPGA 2V7XA 4X3OA 5K3BA 1V71A 1IHDA 2BJVA 2FPRA 3IUJA 4KXQA 4IXDA 5GJBA 3ZPXA 1RHQA 4FOOA 1NQ5A 5AQ1A 4NQZA 1G55A 4AECA 4MW0A 4OKNA 2QUAA 4RY9A 2MSDB 3PVZA 5JD6A 2D59A 1U5CA 4PLFA 3CF6R 3LO5A 4DC1A 3M6XA 1FYWA 4DCSA 4DJAA 1FDTA 1N2OA 3T7CA 3T9EA 3U7FB 1YZLA 1GCIA 2C4UA 3QKTA 4OMFG 2V6BA 3ZYZA 1IM5A 1JHMA 3DE4X 5D84A 4DR1B 4Z3KA 2KI5A 1WKCA 1MC8A 3DP7A 5ALGA 2AEJA 2ZUVA 3GN1A 1AQNA 1TPYA 3U62A 4B6RA 5CBKA 1RIIA 4TV8F 1HKHA 2ZJ3A 4KE6A 3FW1A 3L8GA 3TNLA 4YAIA 3MMZA 1MUUA 1BG6A 2PMWB 3P96A 1UOQA 1YJCA 2XBUA 4GWGA 4JR2A 4YMSA 3W0LB 5HIAA 2YIJA 4YP7A 1MABA 3ZWPA 1IY0A 4NV1A 1WABA 1HDYA 4H1WA 4G4SP 2DBYA 4LQCA 3VOAA 1OXUA 3PEUA 4YCLA 2BFEA 5K6AA 1YFLA 1XA3A 2Z9BA 4J1NA 4PZUA 2D1YA 5JAZA 4YCAA 3DKRA 4XTCS 3TVDA 3ZIUA 4RY0A 2MMCA 4LC0A 4PRLA 2NVBA 2K6GA 2VH2A 1GAXA 4J0QA 2HDHA 1DLIA 1RAAA 3UUGA 3H0EA 2BEJA 3EIWA 1Z68A 3OETA 4X00A 2I7DA 3NTUA 3GLVA 1TGVA 5DBOA 2R4TA 5LLSA 2CUTA 3ZD8A 2A1UA 1KEVA 1RI1A 3R7LA 2J7KA 1V8ZA 4MKHA 2O8CA 5ALHA 2XOKA 1V8DA 3D6JA 5AOVA 4OHPA 3PFFA 5LYYA 2A9FA 4CLRA 2ZYUX 1FMJA 2AQIA 1TF7A 3HA2A 3K4PA 4MKZA 2G4VA 4NBUA 3VTZA 2YJ5A 4HLNA 4I46A 3TL2A 1Y3DE 4QAJA 4ZAZA 4UQLA 2Y0PA 4DTIA 5J43A 2IS1A 1BH6A 2YN2A 3DF9A 3HB0A 4J07A 4U02A 5I7AA 5E4FA 3R7SA 5EY5B 3VR6H 4CM6A 3I34X 2CF5A 5FFFA 1KZ9A 1KMCA 1MQ9A 1Q0ZA 3S3TA 5J2TA 3EQ8A 4DQDA 5FHRA 4Z5XA 4FLMA 1AK1A 1NNEA 3EEIA 1M2EA 3DO5A 1SC1A 1XB2A 3LC1O 4BYGA 4F8YA 4Q00A 3G5MA 3C4JA 4TYQA 5B7PA 2NADA 1J97A 4V3CA 1JEEA 1EP9A 3R3HA 3IEMA 4Q1BA 3P0FA 5A03A 4GOKA 1R15A 2Y0CA 4A7PA 5CFQA 1XCPA 3LK6A 1A8IA 1L4LA 1CR0A 2YHSA 3EPPA 4PZYA 1WRBA 4QYIB 5LP1A 4LSMA 1U2DA 2HEIA 4MI6A 4W7IA 1KH2A 3TR0A 4TL8A 3U3XA 2JVIA 3EF3A 2FETA 2YTZA 3QLUC 5LJIA 1SKBA 1GPYA 5AW9A 5AW3A 1JFSA 3A1VA 1EX6A 1I80A 4EW6A 1RHMA 3ENVA 4Q3CA 4XWTA 1YBMA 3KKNA 1WUJS 1E4OA 4YQEA 4BZQA 4RANA 1E98A 4M54A 2BBWA 3N7TA 2GF9A 1T5HX 4RTPA 1ZITA 4IH4A 2IKQA 3FPSA 4I1IA 1NASA 3EY4A 1Q3KA 1XTKA 4D0NA 1COZA 2VDQB 4ZFNA 1MG0A 5B3JC 5CB6A 5CA1F 4MQMA 4E70A 2ZDQA 3HM2A 2FOLA 1KZHA 1WMFA 3CO0S 4CMIB 1NJ5A 4ZVKA 1HZJA 4OJMX 1P2GA 1C14A 4PZPA 4Q47A 4EHIA 2JLWA 3E48A 5G3YA 1YL5A 1KVTA 5KNLA 5ICGA 5H02A 3P32A 3ND9A 3M8KA 5I5GA 5ICCA 1ISFA 1K7SN 3EFOA 2XLBA 1E2MA 1F48A 2ECPA 4FHDA 4HDAA 4TMTA 2XF8A 4A6PA 4FZ5A 3ZTTA 1I14A 3OJLA 1OHHD 4MDHA 4QVIA 1Q6YA 1R12A 1FFHA 4KXWA 4M0LA 2ETVA 3ZXIA 3H9BA 5AESA 4H15A 1XDGA 3LW7A 4DCGA 1OV4A 3K20A 4EF4A 4X7MA 4LV8B 1B8UA 3SSAA 3EBLA 2I6QA 2WZQA 3KRTA 4EJ2A 3FFBA 1T1JA 2YFQA 5HDQA 3ZWVA 1KAOA 2PT5A 1IZYA 3EIEA 1LUAA 4MP3A 2QUHA 3DD1A 4NAHA 3VGPA 3ES9A 1LZLA 2H29A 4NAUA 3WNBA 5HYVA 1K8XB 3QYPA 1BMFA 3DMDA 3TEMA 1WDKA 1XQWA 2FSVA 3G0IA 3H99A 4HP8A 3HYLA 3PITA 5G0TA 1PEKE 1PR1A 2BI8A 3SKVA 3ZE7A 4IW3B 2GFHA 1GPWB 1S3IA 2QI9F 4FBGA 2C5EA 1H6AA 1TO1E 4UBJA 1B0UA 1U28A 2EJCA 3OLQA 4WY8A 5TMEA 2W2KA 3KT0A 3ZK7A 1DIBA 5I9SA 5KNBD 1Y1SA 2VT2A 3A9TA 1QZ3A 2XB4A 2GWRA 2HQSA 1NQWA 3Q8MA 4JLKA 3U1TA 4A1FA 4R69A 3L7MA 4BRSA 3DL0A 2Y1OA 1U9JA 3IB3A 4ZOLF 2DBQA 1U2EA 4WZAA 4BLOA 4DADA 1EEXB 3L40A 4AMYA 3EH1A 2FLWA 2FR1A 3GCXA 3IUPA 4HNSA 3M3PA 2EEZA 3HCDA 5AKGA 2G7MC 5JS6A 3P9IA 3GDOA 1MABB 1W36C 1BKYA 1SVLA 1JQEA 1TJNA 2YY7A 1A1VA 2VHJA 3GZTB 2YMMA 5C4GB 4RJKA 5B12A 1EX7A 1ZI8A 2BFEB 5DM0A 4DHWA 2WUEA 2D5AA 3HDGA 2JFZA 3N58A 5C18A 2RG1A 5JOQA 3ZLJA 2DSNA 1XZBA 4BV2A 2PX4A 4DN6A 3PJEA 1SBZA 3L1HA 1SXJC 1XRPA 3TS1A 3QG5A 4L5IA 1IWBB 1KYIA 4LRXA 3ZWWA 1EE9A 1OXKB 5IABA 1CYDA 1KJQA 2GN4A 2C4NA 2UYGA 5AHWA 1ZD3A 2E5FA 1KFEB 4M9RA 4WK6A 3REQA 4DEXA 3LT0A 3RD5A 4BQPA 3EXG2 4NV0A 3QPAA 2BGRA 3UG6A 2PA3A 4ESHA 3VKVA 4JXZA 1NLFA 4U00A 3LYHA 1ONOA 2A1UB 3L5KA 4KGDA 1GPBA 4PC2A 4ER6A 2O8CB 4BKUA 1HO3A 5JC8A 1ODJA 2C97A 2VRWA 4CLRB 2ZSUA 2BKEA 1CY4A 3OJXA 3T0GA 1V5GA 1ULZA 3LGAA 4RQBA 2H1FA 4PNEA 3A14A 2C83A 2C5FA 4MVXA 2VAVA 1X77A 4EHLA 4GOLD 3IP6A 5BT8A 2QMZA 4O2RA 5ADWA 1NPTO 4PGGA 2HUPA 1RYNA 5J2TB 2V54A 3FDIA 3K7EA 1FDOA 2FEPA 3T9CA 2IIQA 3QI2A 7ABPA 1XXHB 3KBBA 5DU2A 1WZIA 1ZR2A 2A5GA 4I5GA 4EEKA 4NMXB 1AS2A 4GICA 2NO6A 1R2QA 4AKIA 1KP2A 3L9WA 4HPXB 4BECA 2HJSA 1IZ8A 4CTKA 2G82A 1D2NA 3NBXX 2A5JA 4PR0A 5KNDD 3SLGA 3V4PB 4HI0E 2RGXA 3H11A 3TCXB 1XN1A 3TNJA 1FVFA 3GJ4A 4JGIA 2BFCA 2JFGA 2EG5A 5G2OA 4B6FA 4ETWA 1YR6A 2BMEA 2GASA 2UUAB 4WACA 5CTJA 1QFJA 2R48A 1FXWA 3FLBA 2FUNB 2YJ3A 1N57A 4BKQA 1MT3A 4AWAA 4FWBA 5CFPA 1SA0A 1T4DA 3LVFO 4KIFA 5F7OA 4PWYA 2J0UA 4ZT3A 4ZT2A 5M29A 1E96A 4WNYA 1YCFA 2NP6A 4NZMA 3VHLB 3A25A 4LQDA 4ZYWA 2JJ2D 5ELLA 4MJXA 1SD2A 3GQVA 1KMMA 3DO8A 3GEIA 3NU1A 1J06A 4UFPA 2CHGA 1ZI9A 3MT0A 1EVKA 4B45A 2EU8A 4MS3B 2Z9DA 5HZMA 4BVKA 5K7SA 2NP7A 1M2GA 4PR3A 4AVYA 3V8NA 1QE0A 4MUXA 2IYSA 2XZTA 3GFSA 3IXQA 2C2KA 5JXGA 3E9MA 3EFOB 3VTAA 1GGMA 3ZQUA 1Z6PA 1TK9A 1CCWA 2PD3A 4HQ0A 1X8KA 4TZTA 3JZMA 4AJOA 1YIAA 4FINA 2FQXA 3E9NA 4LVOA 4DCVA 3T95A 3GD5A 4FIZA 4Q1EA 5DNAA 5E38A 4AJHA 1NXPA 1KZGB 3NH6A 5DFAA 3TZCA 3BXZA 2C0CA 1N6PA 4Z53A 3EVCA 1A97A 3CNHA 4AJJA 4DVGA 4NARA 1HQKA 1YKFA 1KWKA 5CVVA 1GCUA 2J08A 2RGAA 3HA5A 3RF7A 2VK2A 1QB8A 1GV0A 2VF2A 1CIPA 2ZTUA 3KHKA 4JMLA 3LI2A 4PZ0A 3KJXA 3I5XA 1OPRA 2VZ8A 3EPHA 1PR4A 3HZZA 2M6LA 4Z7NB 2OFWA 2JJMA 2XE6A 1Y3CE 4P7BA 2YHAA 4ZO4A 3BXEA 5F21A 5ULLA 3N0XA 2QUIA 4YWJA 3AI2A 4E5MA 1NRWA 1ML4A 4JC5A 1JMKC 4CM9D 2GEBA 4UM7A 4F84A 4BRZA 3OI7A 3SJZA 4BJ1A 5EJMA 3GJZA 4AX8A 3H65A 4MV6A 5HEKA 1E8MA 3ASUA 3RRFA 4CCAA 3NHMA 2BELA 2Q9BA 1K2VN 5C52B 3BCSA 1M34B 2Q3LA 3MUOA 5LSAA 1Z0AA 1NW8A 4OFZA 2RH4A 1N75A 3SZRA 1PTKA 1WE2A 3QK7A 1QVVA 3D4PA 3NEAA 2FV8A 4URYR 4XE5A 3QE0A 3H19A 4WZAB 2FW1A 2B99A 3OPYA 1MENA 2ZIEA 1IB0A 5EWMA 4PHCA 5GP1A 1AKEA 3B78A 4WHMA 5DB4A 3UC9A 4JZKA 3BE4A 2GBIA 2P9CA 4ZAFA 2HRBA 4DA8A 4EWLA 1TLTA 2BTOA 3NH9A 3OQ1A 1KY4A 1PDOA 3GJ0A 1ZOSA 1JFTA 2JCXA 2AD5A 3RSOA 2GPTA 2RGDA 4D4LA 4G5QA 1JDBB 2PL3A 1A8UA 3EVNA 3NJ4A 4FKBA 1NYRA 4JJGA 1A4XA 1Q0RA 2AEMA 2VXBA 4LX8A 4Q9AA 5JAHA 5IAAA 4PX3A 1EA7A 1S1MA 1WNTA 1M5RA 2FPUA 3TGPA 3TAXA 3Q7RA 5L6MB 3CGGA 3VC1A 2RCNA 3F6YA 2VAWA 1F8YA 1FFEA 1F6WA 3UN1A 4X20A 3R3VA 3REQB 1UBMS 2E1RA 3GG9A 4V2IA 2GHIA 2Q50A 2V8OA 3M6UA 4ARIA 4AZVA 2WILA 1XK6A 3NWEA 4JXKA 4G8JA 1ULSA 4PYMA 3QRWA 1DBIA 4CWAA 1K6JA 4ARAA 5CD9A 5LZ4A 4O2BA 4KO2S 5HOEA 3OQVA 1FS6A 1QYDA 3IV7A 4UCQA 4IAOA 4B3HA 3MRVA 4M89A 1B3RA 2C07A 3N3BC 4LXYA 5DBFA 1KSJA 1BROA 3IP5A 3AVQA 2CNOA 4W5HA 4FDUA 1YAJA 2I33A 3VR0A 1SN7A 3VR2A 2WP8J 4LOAA 3JCZA 1V3UA 3T7IA 1VL8A 3OF5A 4US1R 1IQRA 4YONB 5LQNA 3LY8A 1CJBA 4PV7A 1SBYA 2JF0A 1W8IA 2HK8A 3TQOA 2AWNA 3CS3A 2QT1A 4GE0A 5EPOA 4A1OA 1L4NA 2C99A 4EVIA 2R751 4BP3A 4PLWA 2HZBA 4KFUA 3STHA 3WGHA 1FMCA 4JSRA 4XGNA 2F8LA 1GEGA 1NPYA 3I9MA 4X0EA 3T3PB 1V95A 1UWKA 2EARA 4YT4A 4DLVA 1RYMA 4PIPA 5ARBA 3H11B 4BATA 1S0UA 4BNWA 4GNRA 2BFCB 4OO3A 1EK0A 1XMIA 4QYXA 3H5WA 4Q18A 1JBEA 1GSIA 3BPSA 4AMVA 3EDQA 1QIKA 2CFRA 4P53A 3I0ZA 5AW0A 4IHJF 3FPCA 1JG6A 3PF9A 3QXGA 4IWYA 4PONA 1SA0B 2XMBA 5COBA 2J0UB 3SZOA 2CFCA 4AKGA 3I62A 3AUFA 3L7DA 3W8EA 1JKXA 2J9YB 2W2VA 3HR8A 3LDAA 4H1TA 2R86A 1EHCA 1XRJA 4J94A 3HJUA 5P21A 4C4ZA 4K26A 2FF7A 3F4LA 5TVKA 4PBTA 2IYUA 3P4UA 2OFXA 4HNHA 3GA5A 1D9ZA 3QYJA 1BU8A 4JUBA 4LHVA 4NR0A 3LT4A 4JH0A 1DC8A 3T1HB 3H97A 2Y71A 4TWZA 2EZTA 2P40A 3VBCA 1RVDA 3SDBA 5K8IA 2BGIA 2EFHB 3E1KA 2JG3A 1XZGA 2OCXA 3IESA 4JYPA 3HNRA 3N8HA 2WUGA 1K8YB 1U5BA 5J40A 2CLCX 3UYLA 1J5PA 4B0OA 4JSTA 4M86A 4DW8A 5BW8A 3ZV5A 3SYTA 3AYZB 3G5AA 3KU4A 1Z34A 1X92A 3D3EA 4QQFA 3A6EA 3NT2A 5A9SA 2V3VA 2OHJA 2ZRNA 5K3CA 3V2HA 2R6CA 4AY5A 5KX5B 4MA0A 3U4QA 4N01A 3UQYS 3LBNA 2E6KA 1T3GA 1V4BA 4YJGA 4P3PA 4EGAA 1A95A 1VE3A 1GZ7A 2H0AA 3M6FA 4U2EA 3P0JA 1NFFA 2V7VA 4Q1AA 1CLEA 1HDOA 1Q0QA 4MRAA 2O8EA 1DPFA 1F06A 1DAHA 3WYNA 3TZKA 4RLFA 1VLMA 2ID8A 3OFND 5P8WA 4A0RA 1DADA 5AI4A 1PG5A 4TMYA 1GPH1 1H8HD 5B58T 3DHVA 3RIGA 1FDSA 4ZTZB 3TZLA 1VI6A 3W3AD 3CXUA 2RGRA 2AS0A 4O4HA 1B8OA 2BEKA 3COZA 4U4AA 4QODA 3B13B 3ZDQA 2R44A 3E35A 1AKRA 4JLAA 4PXYA 1OF1A 3VPBA 5KYGA 1I94B 2HBZA 3TNFA 5D6NA 5EWMB 2EX1A 2OHOA 2QLNA 1N8NA 3HCEA 4N0EA 1N1GA 2JEYA 2ZBDA 1RSZA 1K27A 4IDBA 2VATA 4FE7A 3W5IA 4TQ9A 3C39A 3EISA 5A4FS 5JR3A 3E9ZA 1N33B 3EGXA 5EE1A 1PS8A 1VLVA 2XRYA 3UK6A 3KEGA 3I1YA 1S2GA 2IHZA 3L1UA 4YY3B 4NYIR 3C7AA 2YUTA 4IIJA 3EMKA 4MHSA 4YAWA 3UV3A 3G1UA 4IDPA 1A04A 3OLWA 4Y1GA 3H17A 1NW5A 2GO7A 2HRQA 2EFEB 3PI7A 3R3YA 4N9QA 1WZEA 4XPZA 3ZE1B 1E1LA 3VJMA 4YYZA 2IQIA 3MZ0A 4ZVUA 3O2NA 4DR2B 3NEYA 2E4WA 3KL2A 4ZANA 2QMHA 3BE5A 2RAFA 1X86B 4HWOA 2PL5A 3O93A 1SU8A 2Q5CA 3NVKI 2XCSB 1Q1EA 3SK0A 4XB6B 1GZDA 5HJ5A 1VBKA 1NGSA 4XFDA 2CUNA 3WKBA 1FIUA 3FKJA 2P0EA 3QUTA 5JBQA 4OK6A 4KJZA 4E2FA 1PQUA 4BBPA 4DBLE 1E1KA 3JVVA 5BQXA 1UL1X 4K86A 4O2BB 5ECGC 3OFJA 3NR2A 4JJ6A 4MEAA 4RVGA 4OA5A 1AF4A 1PT8A 3KJGA 4YJKA 5CNIA 3CX4A 4LZWA 4LE0A 1HDCA 2D0OB 1WPQA 4MYCA 3GLGA 1FSZA 5BQ3A 4Y6RA 5HUJA 1ZMOA 2BONA 2V8BA 3WS7A 2IFTA 2BHLA 4L76A 1P3DA 5HNKA 1QRDA 3K5IA 2JFHA 4E5YA 2BMDA 3CNNA 5FFMA 4J6FA 2O23A 5CM8B 3BSWA 3LG2A 4C4XA 5B7NA 3PCXA 3ORQA 4WXHA 4OI1A 3CO5A 2AI2A 3Q9UA 4QSHA 2UZ3A 1YTLA 3UKJA 1Z0KA 3CLKA 2ZATA 3K0KA 4TLBA 4FU0A 1H4SA 1E66A 2R79A 3DDUA 3OP4A 4M8SA 5K45A 4FGWA 1YS1X 3K32A 1H0SA 5FPQA 5D86A 2NO4A 4N12A 3TTUA 4XZ3A 3WGYA 5A5FA 3DAGA 4AJ2A 4G1UC 4A16A 2PIAA 2Q3HA 5KVSA 2YVUA 4FS3A 3ZE0B 1VZ3A 3QXXA 1WXGA 2YZ7A 3E0QA 5GGYA 4N0QA 3VO1A 2WUWE 3CCFA 2B21A 4S12A 4YFYA 4MP6A 4K6MA 1WPXA 2FZWA 2WHXA 4LXXA 4PG6A 2FSHA 2YCLA 3MJRA 3GHYA 4B4OA 1G2OA 2JJ1A 4AB1A 3USZA 1PK8A 1ZD9A 3WGMA 4JOQA 2AGVA 4FE4A 4FR0A 4TROA 5B6JA 1WVIA 1F4VA 2KMLA 4G5FA 3A1TA 2V3CC 3VDRA 2O54A 2AJLI 1RPTA 1XDZA 3QLVC 1UWVA 1XTVA 1ZKDA 2HF2A 2INGX 2VPQA 3MUEA 4FYWA 5SZHB 2CVOA 1GFSA 1V47A 2QTFA 4EAAA 1MW8X 3DBOB 4GDFA 5G0SA 4CEHB 5DGIA 4UAUA 2CXHA 3H5VA 3A9UA 3KB1A 1E8NA 6REQB 4YJ3A 2HRDA 3JQ9C 4WFIA 2J9XB 2NV2B 1J42A 5FTNA 3GCDA 1TYZA 5EHXA 4B48A 1YRYE 2FI1A 1IY8A 1ZU4A 1ZOOA 4RIEA 1OXTA 4KUGA 1QFXA 1U5BB 1CUFA 3OURA 1OH8A 1I1HA 1VIVA 4OM7A 5CXXA 3PGMA 4OBWA 4P3OA 2C2WA 2X13A 4L75A 1YZVA 2FH5B 2AZTA 4G0OA 1B1CA 3K3PA 4JZYA 4LDNA 4V24A 5A9SB 3JRXA 3PJRA 3U4QB 4JVNA 3CE9A 1A50B 2A1TS 1DU4A 5IT5A 3DMTC 4KPUA 1UMKA 2GMWA 3I42A 1ARZA 4CM5A 1HFEL 4BFSA 3MTDA 2O8EB 1BKSB 4GZ3A 2AKYA 3JWHA 5CBPA 4MYRA 3U4GA 1B6RA 2Z8XA 4IJUA 4WFKA 1ZVVA 3OJCA 5HBGA 1OX5A 5AOBA 2YOHA 3KV1A 4FB4A 1QQ5A 4HX2A 621PA 3HO6A 3K73O 2BMJA 3BREA 1WXFA 2VK4A 4CKYA 5LP6F 1I3CA 1R0SA 3EZXA 3IFSA 2C3UA 4O4HB 4Y0VA 1Q7GA 4O08A 5HFNA 2NTVA 2ZPAA 3HP4A 5F2OA 1GPKA 3LBHA 5EXEA 4E94A 2J46A 2P8SA 2FPLA 2NIPA 4ZCIA 9LDBA 2PRJA 3NBMA 5JNVA 4R7ZA 5DLDA 4M1YA 1Z4MA 4W5QA 4Q15A 2H4YA 1RBZA 3MMNA 3N8GA 3D1JA 3V4VB 1JZSA 2FMHA 1FXUA 1NKSA 5I9MA 8AT1A 3FRJA 2Q9UA 3P9CA 2BHRA 3LX5A 3QHPA 3R5JA 5IJZA 1NZDA 4I5IA 1V1RB 3P9QA 3DV9A 1ENOA 4Z51A 5KQSA 1P7WA 4KQHA 4IIJB 4EUEA 1NL3A 3IH5A 4QASA 4HEQA 1W1IA 1XP8A 3E7PA 2F1IA 3WLEA 3GLIA 1Z0SA 3ROGA 2DTXA 4FILA 3W4KA 2HADA 4HYYA 1MIOB 4MDYA 1N2SA 1RXCA 3F71A 3ON5A 3VYRB 4NCJA 4REOA 2FN4A 3AVOA 2VBCA 5CITA 1VL0A 3OQBA 4L7QA 3MN1A 3RHSA 1F2UA 3ZIDA 4RAQA 3QKWA 4BZPA 1Y33E 5K4AA 3UFBA 5LZ8A 3FCYA 3VOSA 3HADA 5LA6F 4M46A 2P4HX 1A9YA 2QG6A 3WSWA 2G7ZA 2BR5A 3G2JA 4ON9A 1RAFA 3H5IA 2AN3A 3IAXA 4XRRA 5G3ZA 4K0KB 4GHWA 4OI2A 4IKPA 1KVUA 2AK2A 5EL0A 1G2QA 1R6AA 5HZKA 1RXSA 3KQWA 3W5CA 3GLGB 1CXZA 2IP2A 3R6DA 4TS1A 6REQA 3E70C 5CFNA 4RHYA 3RRXA 2IZ5A 2QE7A 3I61A 2JK0A 4W6ZA 2CVPA 2VP5A 4NWIA 5EJ5A 2BTEA 3CVWA 3TCKA 3H2YA 9MHTA 5TPWA 4MHOA 5JANA 3OEHD 3P9ZA 2FN8A 3CMCO 3GFQA 1X1BA 4KYTA 3P2JA 4K40A 2ZIVB 10MHA 1E7QA 5AK6A 4DA0A 4BEWA 5BMVA 2X77A 5CH8A 4KPFC 3OZEA 3OO1A 3K96A 2O6HA 5FWYA 4DUZB 4BLVA 3GEBA 1S2MA 4CQLA 2R66A 1VG8A 2G08A 5E8JA 2FSSA 3HHPA 4B76A 5JEDA 5TXGA 1B6GA 2IOQA 3A1CA 1QV9A 1KI8A 1GYPA 4HGOA 3FVRA 3KPJA 4IILA 4DLWA 4ZZ1A 1NJSA 1YNOA 4GRIA 2ZETA 4BO8A 3EQ7A 4TS9A 2VJBA 4OV6B 4CMEA 4IWNA 2I66A 2OYRA 4OFBA 3EVAA 3X2SA 2PWZA 4ZEWA 1FDVA 3V1MA 2ZM5A 4KDEA 1OB5A 5IANA 4RD6A 4YR9A 1QLHA 3ZK8A 3UB2A 2QX6A 1AQLA 3B3AA 1P4SA 3BWBA 4GLFA 1P9WA 2FFHA 2WHQA 1XC7A 1XZ8A 1JW9B 4UNPA 1B1AA 1VJGA 2J3JA 2PQ2A 3HNPA 1Y6ZA 4NK4A 5KKAA 3C3AA 4X6YA 2YVQA 3N53A 2KPOA 1T24A 4MXDA 3D8HA 4ARBA 4E7PA 1FNSA 1WDWB 2H52A 1QG4A 4DNQA 1BJRE 3OEWA 4ZCLA 4YJ3B 4GUDA 4GD3Q 5HPYB 2PPLA 2VDMB 3KYDA 1QYWA 2DQ4A 5JAOA 1NW4A 3VI4B 2R00A 3TZ6A 2PS0A 2Y3IA 3A28A 4I6GA 4D45A 1Q92A 3NETA 4GWKA 4GI7A 5I7FA 3BRCA 4BX8A 2QZJA 1TEVA 2FSFA 2XBLA 4N6GA 3LV8A 3FHLA 4X93A 3PHBE 5ADUS 3U0BA 2L42A 2LCIA 2X2EA 1YZ3A 2MSEB 4I4TF 4WMLA 5L45A 4C29A 2P2DA 4H3SA 3I04A 2IXEA 4BQEA 1NQTA 1LPAB 3DMRA 4KPUB 4WFQA 5E4YA 1OYYA 5EZYA 4MQUA 3A1DA 2NZXA 1MIHA 2KW5A 3PEYA 1DE0A 2NTNA 2JGKA 5DM60 5LMZA 1P3Y1 2P6OA 4DZRA 3LK7A 5CBPB 2IBSA 1PFYA 1TGYA 2DTEA 3GFVA 3H5OA 1Q1BA 1BFDA 3OO0A 2IWRA 5AVWA 2QL9A 1WSWA 3A1EA 2NYVA 1PT9A 4N1AA 4NU8X 1IHOA 4YP9A 5KSWB 1QGAA 3FSGA 3H2JA 3PCRB 4KQKA 1YI1A 5DH9A 2R25B 3PRJA 4TTAA 2PUTA 2C7VA 5AOCA 2Q8NA 3FPHA 1WU8A 4F3TA 2QG4A 1OZAA 5FUXA 2PUBA 1JQLB 1MA3A 2ZRPA 3CBQA 4QIHA 2B36A 3T5PA 2CDNA 1G3UA 3BRWD 1XXHE 4NABA 1LNZA 2E9SA 2VUUA 3OEED 3WE7A 4ZMSA 1RC8A 2R47A 4RGVA 4Z2YA 5IBCA 4M0MA 1ZL0A 3CX8A 5F3RA 3MA0A 1PX0A 1WZ2A 3ENWA 4FP9A 4RPCA 7YASA 2WFMA 3I2FA 4CKEA 5L3ZA 1B8NA 1PO7A 2JBAA 1JIUA 3B1VA 3BN3A 2H4FA 3Q9SA 4B34A 2FRDC 3GC6A 2OENG 1NOJA 2DYKA 2QLLA 1AGPA 1LZKA 2IX9A 1ZC3A 3G6KA 3NKLA 5FF9A 4ZCTA 4OPMA 3GLIB 4BY9E 3UMRA 3M5PA 3O6VA 4RKWA 5JXIA 4KPEC 1ZM4A 1ZIOA 4G4SO 2GZMA 1E9RA 4RL4A 2F2TA 2PXXA 3EYWA 5J1TB 1P91A 3S70A 3KVYA 1IN7A 4ZQCB 3SSOA 4D2IA 1O6FA 1F2UB 1TW3A 1BAPA 3OQPA 4LDQA 2YFKA 4MWSA 4XCVA 1KR2A 1N8TA 4C20A 3EIOA 4WADA 3SR3A 5A2GA 1AUPA 3A6FA 4N7MA 3NHBA 3OWHA 2FZ5A 5BR7A 3I5AA 2BSAA 4C4OA 1BX0A 3HA3A 3IRVA 1Y9DA 1DEXA 1HLPA 2EQBA 2BRUC 2ZSBA 4R9UC 3R5HA 4I1VA 2FPKA 4JLPA 4DBVO 2A84A 5AW6A 3E22B 4FNMA 5G40A 1T0IA 5DJ5A 4MA4A 1BD3A 2HH9A 1SQGA 1SVUA 3H2IA 1E0KA 1G7RA 1BE0A 2HUNA 2PS9A 3HVHA 3TMAA 5JW6A 1ZNZA 3SBEA 1G2PA 3EOZA 2Q7DA 5TPWB 2ATVA 5ITZA 2PLAA 4I08A 2NPFA 4IF6A 5EWLA 5FI0B 4C1BA 2X9NA 4GX2A 4Z3DA 1UAAA 1B14A 4GLJA 1E2DA 3FVVA 3U1VA 4X64B 3ESAA 3E58A 4LWZA 4JV5B 4NCHA 5FWYB 3K1AA 5EIEA 2QVYX 1XVUA 1ECCA 2QLFA 3B1JA 4L07A 4YHBA 4C89A 1XZPA 5AVVA 4LOHA 1GU0A 4HDMB 4CPDA 2JHAA 4GP6A 4PBSA 2ACVA 3PX3A 2IZ7A 1V37A 4QU0A 1M72A 2LUOA 2H7CA 3VZQA 5EE0A 1JKIA 3PHIA 3PNVA 3LE8A 4MYDA 3EPLA 5DK6A 4Q4AA 3TEFA 4CCYA 8ATCA 4O3MA 2GK3A 5GOZA 1GQQA 3KC2A 4QGAA 3I6ZA 4IUDS 2OFPA 2YV5A 2XQKA 4YAEA 3INGA 2G1UA 2GAAA 1TO6A 3KKZA 5DOVA 3I9LA 4D0GA 3BXGA 1M34E 3PPVA 5AHXA 3VKFA 4Q6BA 1KU0A 3HN6A 1E9EA 1WCWA 1DNPA 2E4ZA 2IPXA 1O97C 2DUJA 4MINA 3GQBB 4UHFA 3W5JA 5C8YB 3S2GA 4J2HA 4HN2A 1DMSA 4AZ0A 2F1JA 3D0KA 4WZAE 4N41A 5LIPA 3OM9A 4LVUA 2Q5QA 1PFGA 1XF1A 3EGOA 1RLTA 3EAQA 4CHTA 3KYDB 3W5AA 3A4LA 3MTAA 5LMNB 4NDZA 3PRHA 4WNIA 1CR4A 5EJEA 4FHFA 5LN1A 2E18A 4J3JA 4O4LA 5U9CA 2ZIUB 3CH7A 3I04M 4D9EA 3SM3A 4M53A 2NSYA 1KYTA 1DBRA 1T9DA 1YF3A 3FHOA 4FNGA 4RE6A 3MBIA 3OZWA 1GZSA 5KHAA 4F06A 1UQRA 4E31A 3AJEA 3NZEA 1VLHA 1CQJA 1A76A 3PWKA 3EBOA 1PFKA 1G6HA 1SM4A 3EGDB 3IIIA 3O75A 1XGKA 4MIOA 3RSHA 1BWPA 4BMPB 1H65A 1HQDA 2R7NA 5EZYB 2C5BA 3DAHA 1DXHA 2NQ8A 2PRSA 5GTDA 3GEMA 1RZRD 1XVAA 3PYMA 1XRSB 3GLUA 2F00A 2P77A 4L8WB 4DXAA 3CZAA 4F2PA 4AZSA 1W94A 4JQCA 4WOCA 2PRYA 2JLCA 3VOTA 4HH1A 1TUEA 3DF7A 4Y6PA 4J0GA 2H6EA 3FNEA 4Q3EA 1Y6FA 4IX1A 1MTOA 1YC2A 4A5OA 1Z5WA 3KKEA 3NC4A 3HXLA 4D0LB 5DX1A 3WRVA 1F0KA 4DLZA 4RDIA 2NUAA 4KQ6A 2HA0A 2CZGA 5KOIA 2JZOA 1PLJA 4B83A 5H4HA 5JMOA 4ZV7A 1G4UR 2PWYA 1HQYE 2W48A 4JDPA 4B81A 3PFIA 4X84A 1HBJA 3L84A 3PUXA 3BKWA 3COYA 4QGBA 4Y9TA 1E2JA 2JIPA 4WLNA 4CKEB 2Z43A 5A71A 2JBAB 1LV8A 3EF0A 3LDHA 4QO8A 3UWSA 3ZH9B 2EXXA 4IINA 4K87A 1WUIS 3Q0TA 3RIYA 5DTEA 3GK3A 5C3UA 1VMKA 2XI4A 1KVQA 1T9BA 3DZIA 4ZVLA 1NP3A 2QYHA 2ESRA 3K9HA 4WCFC 4CFSA 2Y27A 3EY9A 1II8B 5DO9A 1TZMA 2JA1A 3HUUA 4BMYA 3BG5A 5ERGB 2Q2WA 3CRQA 3DKVA 5C81A 4ZV9A 1BN7A 3MYRA 2IXDA 3ODGA 4JL5A 4RZQA 1X7WA 1L4HA 2I3DA 2I4LA 4O4IA 4IQGA 1LPBB 1D6NA 3VNSA 2F43A 3BD9A 2VP9A 4P35A 1SUWA 1RCUA 1TU3A 4BGDA 2OVFA 2CNBA 3GZJA 1A71A 4H6PA 4DDKA 1BEEA 4O6VA 5IDWA 1R4NA 4KXUA 4O4JF 2EF1A 1BN6A 1J2TA 3M1YA 1T26A 4DSNA 2J0EA 3TOXA 5BWOA 1TEZA 1Q0UA 3O1LA 1QDEA 4UHEA 1RWXA 1NNI1 1E3TA 3NHSA 3Q5DA 5EJFA 4MVJI 5J63A 5CK5A 3ZCUA 5ITZB 1DJLA 4IOJA 4BLPA 2VYCA 4H7PA 1SK9A 2YQZA 1WMBA 3IMCA 5EWLB 4W4TA 5AI9A 4NF2A 3HB5X 3EIFA 5KO2A 1MDFA 4W1QA 3D0OA 3EQZA 4XX0A 4E1VA 1I9CA 3R7WA 2OHFA 1MD9A 3FDJA 3RS8A 5A5EA 3K1AB 5AVYA 4JKYA 1B8VA 2B6NA 5IUNC 5TLSA 5IS2A 3QFTA 2ZS8A 1PKXA 3KOXA 2XUJA 2W6ID 3EWSA 4G0QA 3QUAA 5FUWA 4NHEA 3GHHA 2HEGA 2WM9B 4R8SA 1N2EA 4I7EA 4PN7A 3L8ZA 4KACA 1XTBA 2JZNA 3GPBA 3R9KA 4EECA 2P9BA 3AGPA 1XIVA 2AG5A 1A4IA 2P1RA 3HDYA 4EP1A 3T7JA 2BMWA 5JZSA 1IUOA 2CUZA 3K1ZA 4NBNA 4CCYB 5CEFA 3FBTA 4IYJA 3ECAA 3DBIA 3JVIA 1LLUA 1WOYA 4TVKA 3GRPA 3SQWA 3KE9A 5C8YA 1RWVA 4WBNA 1F17A 2GPWA 4Z9BA 3AVWA 2W93A 3BIXA 4N8DA 2I54A 1XO1A 1Y9EA 1U7TA 3DLCA 5C4IA 1VL6A 1KEZA 2PVCA 3GN2A 3I6MA 2QYTA 3WAKA 1VCHA 4IZIA 2PUVA 1WSBA 1WPGA 3GNQA 4R1OA 5TT1A 4AZ0B 3FWPA 3JYHA 2YBEA 4BUJA 1M1ZA 2E21A 1HOXA 5JE8A 3KWJA 2MR5A 4BXOB 3DS8A 2WW8A 5FO0A 1WD7A 5B3KA 4AS2A 2EL9A 5DNUA 5IKMA 2ODEA 3LVQE 3I4CA 2ECFA 5INTA 3JD1A 4IMJB 2BH9A 4AFNA 3PQ7A 1EFCA 4QL3A 2GXAA 2PWBA 3SVLA 4O4LB 1IK4A 1XMQB 3PEVA 4YQYA 3I4LA 4B7XA 3SEFA 4B46A 3C74A 4DLXA 4LRTB 3L8YA 1NUTA 2VJQA 5ETJA 1TU0A 4JN6B 1CJKC 4KH1A 4AW9A 4EYGA 1Z26A 3I28A 4OYYA 3J80A 1CQJB 2QRMA 4ZTUB 2D2IA 3L8CA 3U40A 2YWFA 2PG3A 4CU5A 5CURA 1GGEA 4HEA6 2FSGA 5D85A 3P94A 4WDRA 3GI1A 4INPA 3C7KA 1FYDA 5CJJA 2W71A 1B15A 2OWDA 4NG5A 2WJJA 1JSLA 3PSHA 3REFA 4UUAA 2DERA 3A6KA 1T15A 5GPBA 2B37A 2NU9A 4YO7A 2E55A 4WFJA 3QQ5A 1SOVA 4LBVA 1IQPA 1JDTA 2BUCA 2CNKA 2XW6A 1XQVA 1CFZA 1IH8A 1PGJA 2I4IA 3H2ZA 1E7MA 1F6DA 4KIUA 3KVVA 5IVDA 5GINE 4TXNA 4Q9NA 4Q9JA 5BT9A 3UO8B 1D0IA 2K7ZA 1YWGO 3DEYX 2ZZNA 3W8RA 3VSBA 4QFCA 3LFTA 1MRSA 2CLLB 4LCJA 2NUAB 5LQUA 1TZJA 1Y98A 4FYIA 3ANYB 1K4YA 1T0HB 3QITA 1YR7A 2X1MA 2QQ0A 2C0QA 4BO1A 4NKRA 1JAYA 1CEQA 3N2IA 3QUCA 5HKKA 3KZMA 1RBQA 2PUAA 1U63A 2Q7XA 3BIOA 3D64A 3DC7A 1RC1A 2CE2X 1O4WA 4I4NA 1MRZA 2ET6A 1KI3A 1E1NA 2BM9A 3WGQA 3B1XA 2E2WA 1E5DA 4MRVA 4OVKA 2XZDA 3AFMA 4CQMB 3PD7A 1VMDA 4OCZA 3KJFA 2PH3A 4TWRA 3CZ9A 4HWSA 3QX7A 4Q3LA 1VHTA 1CVRA 4YPVA 5LQRA 4XFJA 1RQ7A 1X7WB 1YR9A 3R5SA 4IHQA 4O4IB 2W43A 1A8QA 4C0KA 3CZPA 3A1NA 5NULA 2ARKA 2PMFA 2WUFA 1PR3A 1I2CA 2PZMA 1AKUA 2B30A 2D1TA 2F43B 2I2AA 2QQGA 2ZJ4A 2ZJ6A 2ZTVA 3BMNB 3P0EA 1EM8A 2F1RA 4PZDA 1T43A 1VE6A 1YS2X 5DTMA 3FHCB 3C97A 3A6DA 3MGBA 3PA6A 1OKKA 3LZCA 1WMAA 3QVMA 4DXDA 2IZ0A 1TK2A 5FWXA 1R4NB 2FG7C 2QEQA 1O9HA 2HOQA 1ZOPA 3C7DB 3EFHA 4YIKA 4EPTA 1DJPA 3RVSA 3LUGA 2N42A 5H5JA 5I8PA 1BMQA 1A8HA 1SNYA 3W9YA 3GUYA 5CLQA 2XUAA 4MV0A 2POCA 3O1IC 3Q40A 3RVJA 3WFJA 4DCUA 1MTZA 1P61B 4XX0B 1PTJA 5AO9A 1J00A 1D4FA 1ESCA 1Z0IA 1ZISA 2BKAA 2QN3A 2X9GA 2Y05A 3A6JA 3GU3A 1VYTA 4HS4A 3A4NA 3O5AA 4JENA 1VYVA 3BD6A 2Q3FA 4OAPA 3SPXA 1XCBA 5AP9A 4ERNA 4EUSA 5IASA 3N74A 4MIYA 1KGDA 3ESBA 1TU4A 3TIVA 5KB3A 5BW5A 1U2RA 1L8QA 4OGFA 1GUYA 3AUUA 1HZZC 1QANA 1O8CA 1RJ9B 1EQUA 4J1TC 3SS8A 1KQPA 3VU9A 1EUZA 1D5CA 1YDHA 1LB1B 3DTNA 1FP6A 4OJYA 4BGUA 1ABBA 3U7HB 1G19A 2ZRGA 4E12A 3OZTA 3PNMA 2CXRA 3U26A 3KSUA 2VJYA 4C3VA 1OT3A 2XJ9A 4R3UC 1AOXA 3QVXA 4J1SA 4QJBA 4I50F 3J7TA 1QZZA 3UAXA 1ICEA 4QU5A 3GJYA 1RAGA 2JAXA 5IYZF 1VDMA 5H0IA 5JG7A 3WB2A 3DLBA 1X8XA 3L43A 2ZYGA 3B1YA 3PFGA 1I4DD 3AZQA 4IUCS 2NYRA 2EZUA 3OC6A 3AEKA 3VYUB 4U0JA 3NASA 3QUSA 3RGGA 4OBBA 3VH2A 2F55A 3HN7A 4G1BA 4RPJA 2XOKD 4RWZA 4BWGA 1EIZA 4YWHA 2ZJ2A 1KI9A 3CA8A 3VHXA 2VT7A 3V1KA 1D5WA 2DFLA 4P92A 5DNCA 2DGDA 3HL0A 3P52A 3BJIC 2QPTA 2YHUA 4I9NA 4S1NA 3T61A 4F4HA 4I2NA 4G41A 1SUSA 4KQWA 1FRQA 4B6GA 4NZPA 4R2XA 1FYFA 4ODIA 4AURA 2R9VA 1FVOA 2CLKB 2WIJA 4ENUA 3URKA 5GZ3A 3O4GA 1FMLA 4TTTS 1EUDB 1ZEMA 4RXTA 3PXUA 3TI9A 3U9LA 3B38A 5I3CA 1L0BA 5DSXA 2X0DA 2Y8EA 4ER0A 3MGKA 3ZC3A 3RE1A 4PFKA 2HRCA 4I1OA 1OOEA 2PWPA 2OBYA 2YJZA 5M3BA 1U0NA 1DQNA 3VKHA 1Q0LA 2VDNB 1B43A 3ND6A 4LISA 1G17A 1DDGA 3DLPX 4JBIA 4TLDA 4HLUC 3VDNB 1D6MA 2I2DA 4TVOA 2NU9B 4JQYA 3A9CA 4C0LA 4QU9A 5BYJA 4MKRA 4G26A 2WIFA 1ORHA 2QQFA 2VNKA 4OTZA 1MAWA 3PDWA 4V02A 5E0OA 1AUXA 1U3UA 3GJ5A 1JHAA 1T29A 2CBXA 2C9ZA 4KVGA 3R23A 4NJEA 4WA7A 2KSQA 2WJHA 4DILA 3TB4A 3TM5A 4Q9DA 4P83A 1XJCA 1FQOA 3IJRA 1A27A 5AUQA 1NQVA 1XJ0A 1IEQA 1E2BA 1ZA2A 5BWBA 5CHYA 5CIYA 3IOYA 2WJGA 1R37A 2X9VA 3R0ZA 4H3HB 4MW1A 4ERXA 1ISHA 2YVLA 4W7HA 2D13A 2OYSA 4KIWA 3H4TA 3BXHA 2QGZA 3FOFC 2C2XA 2WNIA 3I0MA 3I9KA 4TL6A 2GCIA 5ALIA 1XPJA 3ZBUA 4KYUA 1LBEA 5IVKA 3MJEA 4QELA 4M0KA 2VQ3A 3ROTA 1BE8A 5SZKB 2G0TA 1ML3A 3L8DA 4Z7OB 4GR5A 1U1DA 5J1SB 1XZQA 3SNKA 4ASUA 4Y3UA 5IP5A 3D2BA 3VPAA 5H59A 2Z3ZA 4QHSA 4BMDA 4G1EB 2Z2IA 4NBVA 1SY7A 4WL0A 5IJWA 2PHZA 1CZHA 2X1VA 3KLPX 4TRRA 5FL7A 1GAQA 1L5NA 3S68A 3GJRA 1KQ3A 3OY2A 4CTMA 4IH9A 3SJCA 5CCEA 1H3FA 1G8SA 3CW8X 3OSZA 3WYBA 3G5LA 4IV8A 2ZUSA 1EM8B 4D4KA 3OUUA 2RHRA 4X1IB 1UAYA 4TLMB 3FMVA 5JWHA 4AYXA 3QX3A 4B2LA 4RTLA 1GT91 1XEAA 3DD5A 3AKDA 1D9XA 5KSYA 3H1GA 4CUKA 5FWXB 3AP2A 1BMFD 3ILSA 2XGMA 1TYBE 2OBNA 2QP9X 4AJNA 4AJ9A 4BOYA 1YQUA 1BWRA 3NAGA 3SNHA 5KWSA 3ZW7A 3LYUA 2HO4A 1Y9AA 4EZBA 2J6IA 4XIIA 2HQRA 4IGKA 3OE5A 1VFPA 2AC7A 3HDQA 1ZMRA 4OP1A 3DOEA 4XD7A 5D1NA 3WLQA 4D3SA 3LCUA 4LMBA 4OXQA 3FZYA 1LRJA 1C2YA 3ZNOA 2Z1MA 4FGSA 1GSAA 1LBIA 3UJPA 1IN6A 1NLZA 2B35A 4TUYA 3JQEA 3OQJA 4PPQA 4DANA 1YFJA 1MB2A 1PL7A 1QJCA 4WIAA 4XJSA 4JD5A 1GEEA 2O5VA 2FE4A 1OWMA 2FPSA 3BSYA 2ORIA 5CYGA 3RH0A 1GV1A 3FYHA 3LQYA 3RAJA 1WF3A 1XN4A 3URMA 5LNK6 2F3SA 1I6WA 3VNVA 4YN3A 4IZHA 5DSTA 1BVHA 3F6BX 5BV0A 2Q45A 3F5QA 4KRXA 1M74A 3ICWA 1PS0A 1IATA 2C42A 1MO4A 3U7QA 1BE6A 3FWNA 2IUTA 1USUA 2VR1A 5HRAA 4Q24A 4K6KA 4C88A 2W2LA 1JBQA 4EAQA 5DYGA 4H6WA 1DDOA 2DWCA 1SIOA 3BKXA 4Y9RA 2I3BA 4RTRA 1RBYA 5ECDA 1XTSA 3FUUA 3LHDA 1XZEA 2GXQA 4MYSA 1UZMA 5BSEA 1MO3A 2FQWA 4IFBA 2AJ8A 1E60A 3P9NA 1TA9A 4Z4QA 2ERXA 4HPJB 3ISJA 4KJXA 1Z6QA 2YS6A 3VHXB 1Q95A 3T6KA 4DCPA 2OCDA 4XIYA 1FLNA 1O9GA 2X3UA 4G01B 1JHXA 1E69A 3K5HA 4C04A 2Y1XA 4F9TA 1U3FA 5A4IS 5CLHA 4J0CA 3NYIA 1G5TA 3HBFA 3IILA 5HMLA 3V8VA 3FI9A 2H57A 4NVRA 4RDXA 3NT5A 3EFBA 4MQ5A 1DOZA 3OQNA 1E8DA 1VKNA 2V4ZA 3UK7A 1FRZA 1S9HA 4DAEA 4GU5A 2Q3DA 5EOVA 3T9AA 1ISGA 2C00A 1FQJA 1I6KA 1OC4A 1NBAA 3HLYA 4IXNA 5KEIA 1VKOA 2E5LB 2NO5A 2NZ2A 3EIUA 5ALQA 4AN4A 1M5UA 2ZIFA 3M2PA 4E0BA 4EUNA 1GPAA 3NHRA 3G9TA 4A0GA 3QMPA 4KI7A 2GDJA 1E2FA 3GXOA 5AXAA 4CTJA 2C0PA 3Q1KA 5D00A 3DTVA 2ZWIA 3ND8A 2NV6A 1EDBA 3OHMA 4COKA 3O8NA 4AWXA 1HV8A 1JHQA 1I32A 3ILXA 4YALA 1K6EA 4W5JA 1ZK4A 4EYSA 3GDGA 1KZ6A 8ADHA 4LOIA 2ZRAA 3EIXA 1X1DA 2WAMA 4NJEB 4R2JA 3TLCA 5IUJC 1O08A 1P2UA 4TKVA 5HBRA 4MB6A 4PFQA 4UM5A 2EEPA 5DTQA 5B64A 2O8DB 1K7XB 3P20A 5LNK1 4JI7B 2R1TA 1GADO 2I4MA 2OM2A 5TQJA 3AOGA 1MJNA 4BDTA 5AK0A 4U63A 721PA 4UHJA 4QBIA 3WJAA 2ZRIA 3H3FA 1R5OA 4EKIA 1RHUA 3WFZA 1UAGA 2ANCA 4QYTA 1XEWX 4JBXA 3VNRA 1RPJA 1I5RA 4PG5A 4C9BA 2YXBA 2A7XA 3TLXA 4NNPA 4B6PA 3GRFA 4YJ2A 5KU7A 3WNZA 4JP3A 1X15A 5DEOA 2AV6A 3R0XA 1CULC 1LC3A 4JP1A 4B32A 4JQZA 4OQZA 5T4FA 1PL0A 2RHOA 4AO6A 4KCGA 1GRVA 3BB1A 3E9CA 3GJ6A 4HEHA 2G1PA 2PKEA 4RTMA 1N8SA 4CMAA 3WK7A 4A9AA 5DN6A 1E6LA 2BBOA 1N2GA 1ODSA 2CDBA 4LJ8A 5JYBA 1G6Q1 1GZ3A 3CURA 4C4TA 2QLTA 3GXBA 3AZPA 1Q7BA 3LF2A 1DLJA 4XPIA 3KG2A 1QE5A 2W22A 2X15A 4RHFA 3QBVA 4RVHA 1WHSA 3NG1A 1IJFA 2EL7A 4HS9A 4HBZA 3F3YA 1NMYA 1WDTA 2CXPA 1I36A 1C7FA 2VYVA 2WM3A 3JQFA 2CXQA 2G9RA 3PC7A 4GQAA 3WMFA 5TQVA 4DPMA 4AD8A 2WP0A 4ITRC 1RP1A 3F5MA 4LAFA 4M36A 2QTCA 2XYHA 4JBNA 4V2UA 4RBNA 1QNLA 1IBKB 4HN4B 2D2VA 1R6VA 2DTDA 3ZS8A 3DTYA 3FMIA 2F8MA 1CY1A 3HFJA 5CW2A 3RK0A 4YRMA 5HP4A 1BS2A 3QKRA 5PNTA 2P9TA 4V0SA 1Q0PA 4TUYB 4WESA 4DWVA 5DE3A 3R0QA 3M1LA 2NO1A 4PGFA 2WAOA 1EG2A 3ZCXA 4ZGBA 4RD4A 2ZROA 4HQLA 4F5YA 1PP4A 4D26A 3MCUA 4LZAA 4B8YA 2OD2A 3DVQX 4JP8A 5JQGF 1TT7A 2J87A 3MCWA 5JCZA 7AT1A <