1D5CA

Crystal structure of plasmodium falciparum rab6 complexed with gdp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
KYKLVFLGEQAVGKTSIITRFMYDTFDNNYQSTIGIDFLSKTLYLDEGPVRLQLWDTAGQERFRSLIPSYIRDSAAAIVVYDITNRQSFENTTKWIQDILNERGKDVIIALVGNKTDLGDLRKVTYEEGMQKAQEYNTMFHETSAKAGHNIKVLFKKTASKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAB6 GTPASE
publication title Structure of the nucleotide-binding domain of Plasmodium falciparum rab6 in the GDP-bound form.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Endocytosis/exocytosis
total genus 47
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 1999-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1d5cA00
4D4LA 5JJLA 4PPGA 1DPFA 5C18A 4KITB 4YLGA 2N1BA 1UBGA 1ZU5A 4KBFA 3Q85A 4XD7D 3GJ5A 3PV0A 2Q9AA 121PA 1CP2A 1RIFA 4MUAA 4TTRA 1TPZA 2QP9X 4QGGA 3HU3A 4ESVA 5DI9A 3GEEA 2L0XA 1N6NA 4JSYA 4PPQA 3FKQA 3QG5A 4L9SA 4C9BA 5SZIA 1IQPA 1XJQA 2YKGA 2ZRJA 3V9PA 4NCIA 4G3XA 4HB4A 3G0HA 3JZAA 3QXHA 3EASA 2IUUA 3F3YA 2FJUA 3OEHA 1EWQA 4PFSA 1VMAA 4PSAA 2X1VA 4JS0A 1WCV1 1NJFA 2XSZA 2ZUBA 2VF7A 2CCKA 4RZ3A 1XTJA 5FBLB 1WP9A 1US8A 3CZPA 4GI7A 1IN7A 3CRQA 4B2PA 2O8DA 1E4VA 5FR1A 1XTRA 4X8LA 5CIQA 3U60B 4Q19A 2DYKA 1GL9B 3G82C 4R71A 3LBHA 3TRFA 1KI7A 4M1MA 5HTKA 3ICQB 4B3FX 1T0JB 2QA5A 3TAUA 3UWOA 4CW7A 1NMXA 3D6TB 4ZIRA 3CRRA 2CNWA 1UDWA 1HY3A 2JIZA 5EE5B 1BH2A 4V0NA 1IXZA 4A8JC 3R9WA 1OKKD 4MKFA 1GUAA 3SOPA 2EW1A 1S3SA 1N5KA 3GLGE 5JCPA 3VU9A 2GBLA 1H8ED 4F91B 3ASYA 2QMUA 3B9PA 4BEJA 4TMWA 1NMZA 2FZLA 3THOA 2F1IA 3HDTA 3KQNA 3IPYA 4KV9A 1VCOA 3SFVA 5EP2A 1Q1QA 1GP2A 3OAAD 2DWQA 3O8DA 1G7CA 4DLYA 5J40A 1G8HA 2ZS8A 4US2R 2O52A 4KCGA 4DLXA 1K5DA 3I73A 6Q21A 3GLGA 621PA 4A4DA 4P4SA 1T4GA 1G19A 1W48A 5IDVA 4AG5A 4ARZB 3LX8A 2JLQA 2ZJ8A 2X8AA 4MGKR 1JPNA 1KY2A 3AF0A 3DZ8A 3TSWA 1MO5A 1T9HA 4M53A 1DAKA 3AP3A 4EJSA 4C7OA 3GLHE 1G18A 2IYSA 2IHBA 3D3QA 3NBYC 5TARA 1E79A 4UJ5A 3KB1A 4CRWB 2WTUA 4BQSA 1ZMXA 4A0GA 2BIFA 4MYTA 3EZ9A 3TBKA 4FWTA 2XZPA 3BB4A 3LVQE 4JBXA 1HH4A 2ZRMA 4G5SA 3F0TA 3NWJA 4JMPA 4WA7A 4JIMA 3VMFA 2FSHA 1IONA 1GIAA 1ZNYA 3K9HA 3QPWA 4YXWA 1EX6A 3W6NA 4LPSA 4DRZA 2PLFA 4IDOA 5KOYA 1DO2A 3GLHA 4F93B 2XJ4A 3CRMA 3AF4A 5AJYA 5KSPA 1E9BA 2AKAB 1K5GA 4D0LB 4G0NA 1IN6A 3NG1A 1Z5ZA 4GZMA 1M6NA 1KO1A 2F9LA 3VR3A 2N42A 2BBSA 3CZQA 5JI3E 4NE2A 4OQXA 1US8B 1VG9B 4QBFA 1U8AA 5LBIA 5DSZA 4DLVA 5ELXA 2C2HA 2R6GA 3EW9A 4KVGA 4EIWA 1KSGA 4EPTA 2IYWA 3DPUA 3JVUA 1HQCA 4JVMA 5L3VA 4AKHA 3CF2A 4D4MA 2ZU6A 4L16A 1ZU4A 4H9GA 5TMPA 1E2IA 2R8RA 2JLZA 3VAAA 5C46F 5AK0A 2B8WA 2VLIA 4GMXA 1E2PA 2MSDB 1SZPA 2KWIA 1G4UR 2ANCA 4JKIA 5JWHA 2ZJYA 2OO7A 2WVJA 1O87A 3SJCA 4D26A 5A0FA 1RYHA 1ESNA 2IC5A 3QKTA 4NZYA 2WWYA 4RD4A 4B6EA 2ZE5A 4TZ0A 4PO1A 2P2LA 1P6XA 4J0QA 4JBWA 3VU9B 3U6KA 4MYHA 1HT1E 1KJYA 2O8CA 1E2KA 1Q22A 2FFAA 5DHAA 5EZ6B 4RZ2A 2J41A 4ZCLA 1TQ4A 3H0KA 4DDVA 2P5TB 3KL4A 5FOTA 1GL6A 2BWJA 1Q57A 4YMWA 3RVBA 3GLGB 3PG5A 2F43A 4P4SB 5BN4A 4B34A 1UM8A 4KI0A 1WA5A 2XX3A 4KODA 1JALA 3K09A 4EJSB 4GP6A 5HKKA 4JL8A 4C7OB 2AK2A 2QMEA 3AKYA 5EQTA 4EPYA 1M7BA 2QGZA 3AKCA 4EDHA 1MOZA 2NO6A 3NH6A 1J90A 4P31A 3N2EA 4BFXA 3P26A 4EUNA 3EIQA 1JI0A 2QZ4A 5G41A 2Q3FA 1OW3B 3MWLA 2QQEA 5JEEA 4LSGA 1NLZA 4Q4LA 4N0EA 1ZM9A 2IYUA 1E99A 3GLHB 2ZJ2A 3QOFA 2VP4A 3THYA 5CM8B 1FNMA 2BKUA 1XEXB 3KTAA 1OFUX 3LNCA 1E9AA 3KXIA 3RRZA 1NIJA 1CJTC 1XJ0A 1COWD 3H86A 4DCNA 4DEYA 2AKYA 2IYXA 2CL0X 1GVNB 4MH0R 3FMPB 1R4AA 4BWYA 4F4IA 1DEKA 3GFOA 1Q3HA 4QG7A 3PEVA 1ZNWA 2Z43A 3OIWA 3FDIA 5G53C 3A1SA 3SHWA 4F38A 1IAQA 1A2KC 2YOHA 3FHOA 3IIJA 3T1TA 1QHGA 2ZR7A 2C5LA 3K0CA 4LX0A 4AC9A 3C8UA 2FFQA 1HT2E 1XCPA 1DG3A 3KDSE 1AKEA 3IBGA 3LBIA 2PMDA 2V4ZA 2ERYA 2ZUDA 4LRWA 5FOVA 4PAMA 2NO0A 1TX4B 2GZHA 2ODEA 2Z4RA 2ZIAA 2GNOA 3CIOA 3LW7A 3N2IA 3BD9A 3AGPA 1CJKC 2BCGY 2GBLC 4DCUA 1PLKA 2YJTD 4QFMA 1ZRHA 2CLDX 4YXWD 2H7VA 4O2RA 2ECKA 2QGNA 1DELA 1J2JA 4OK3A 5JLJA 2GRJA 3GFPA 1K6MA 2ZE8A 3W5JA 2F3RA 1N6PA 1TAGA 3OF5A 4RKEA 1IY2A 4LJ6A 2WSSD 4R98A 3I5XA 4URUR 1UKYA 1Z47A 3RS5A 3AF3A 3QG1A 2F43B 2R62A 1PVOA 1E2LA 2ASEA 4HDOB 1AIPA 1Z63A 4WAUA 2ZXUA 3DZDA 3SQWA 2R6AA 1G64A 1E9FA 4U00A 3WYFA 5EJEA 3PITA 2BMJA 4WBSA 2YWGA 4IOJA 4URZR 3LH5A 3OFNA 4LI0A 2RGGA 4NKRA 2OT3B 3CW2A 5AJWA 3CKLA 3OEEA 4YMVA 4DC9A 2V8OA 1FOEB 1OXTA 2H16A 1UJ2A 4M8NE 521PA 3KUDA 3IHLA 1KIMA 4P0TA 2R6CA 2VP9A 1G1MA 4EPWA 3T34A 4QHTA 3D7MA 2OZEA 1E96A 1VPLA 1XTQA 1P3JA 3GEIA 4DB2A 3UMRA 2OG2A 4RY2A 1YJ5A 2P6NA 2VTKA 1JAHA 1N0VC 1R5BA 1L4UA 3A4LA 1KI9A 5GJWC 3RANA 1OSNA 3HPQA 1N2CE 1GRRA 3EXAA 4V02A 4WW0A 3WNBA 4Q18A 1ZD1A 5HCIA 2FNAA 1W0KD 4CDGA 2P6RA 4PC3A 3I62A 1DO0A 1G8PA 3I3SR 3R8FA 4HAUA 4IDPA 2NZ8A 4HZIA 3ZQJA 2KB0A 5E7JA 2AFIE 1P72A 2QE7A 3FKSD 3GJ4A 2F1RA 1G5PA 2XAUA 4CEJA 1NRJB 2C95A 2V7QA 2VA8A 4JLOA 4URWR 3AVOA 4B32A 3ZVMA 1PV4A 1Z6GA 4XIGS 5FBVB 2GF0A 3SJZA 4UNQA 2H8KA 2IXFA 1II9A 1QF9A 4IDNA 2JASA 3PCRB 3E5HA 4M1KA 4RD0A 3KKNA 2EWWA 1GM5A 3IQXA 3TH5A 4CYMA 1ZM7A 5HE9A 1NN0A 3VX4A 4Q48A 5CB8A 1MO6A 2DPXA 4JLPA 1PUJA 2HT6A 2OFXA 2QI9C 3R9XA 5C4MA 1GTVA 2QT1A 3VQTA 2ZI9A 1G3QA 2KE5A 3OZXA 5FL3A 2XNSA 3VNVA 2C96A 4HZUB 4P32A 4A0RA 4C0JA 1BS1A 1J70A 1TUEA 5AUQA 4MDEA 821PA 3S1AA 1S0UA 4DLWA 2V1XA 5DN6A 1YHNA 2O8BA 2QPTA 3BERA 3K09C 2OV2A 2HJVA 4QGHA 2IEYA 2OLJA 3WMEA 4EQ6A 4MKHA 4B75A 4PZYA 1XEFA 2J7KA 3DOEA 4LY6A 1AZSC 1SGWA 1CRQA 1U90A 4MITA 4Q4AA 3PUXA 3K70B 1YR6A 5FUXA 4NYJR 1QRAA 4CGZA 1KI8A 1I4DD 4NCKA 3O8BA 2G1JA 4OQLA 2R6DA 5EZ5A 1G3IA 1KOFA 2TMKA 1KJZA 2WHXA 2PCJA 2QAGB 3EPJA 5JWOA 1MKYA 4X8MA 1OH8A 1MRSA 3MD0A 1RJ9B 5F3WB 2CBZA 5DI3A 3R7WA 2QQ0A 3PUYA 3A1UA 2WJIA 3WXMA 3SQXA 3P1JA 2WWGA 2CHVA 1KK3A 2FU5C 3RS3A 5F9FA 1ZCBA 3QQ5A 4IDHA 1H8HA 1Q1EA 2VQSA 4OI2A 4F4CA 2ZE6A 3K0CC 1E69A 4TZ6A 2ZUCA 2GWHA 1FTNA 1RRGA 4V0OA 3L0PA 2HYDA 1Y3AA 1JAIA 2FPMA 3CWZA 3AEZA 1R8QA 5FPTA 3AVYA 5AJZA 1NBMD 4QM7A 2A5GA 1E9RA 3TSOA 2H5EA 4OHWA 1W36B 1SVSA 2Q6TA 4TWZA 3WHKA 2V55B 1JBKA 1T3SA 2J0QA 2D4HA 2D2EA 1Z6YA 3V00A 5J4LA 3PVSA 1OH5A 2HF8A 2REOA 2W6ID 4JVLA 3M1IA 5KSZA 4JLDA 1IN5A 4KYIB 1YRBA 4BRWA 1ZUHA 5L3QB 4M9XA 5F2EA 4LJ4A 1NN1A 3B1ZA 3BWDD 2FOLA 2ZRHA 1YR9A 4UNPA 4HAYA 5J4VA 2AD5A 1RYFA 4IFEA 5EXPA 2OBMA 1JXOA 2RHDA 3DMDA 4RFSB 3KKPA 2GF9A 1XTKA 3FTQA 2OAQ1 5FTNA 2GVZC 4ZDJA 3S1AB 5KTYA 2OXRA 2R9VA 4NBSA 2O8BB 2ZRBA 3LO5A 4QHYA 4KLZA 3VKGA 2ZRGA 1LV7A 2ZYUX 5FUWA 3SN6A 1BMFD 2WWIA 3LBNA 5G3YA 4BLSA 2QE7D 3LAWA 1S2MA 1W2GA 2BV3A 4TT3D 3AUXA 5IK2A 5JWRA 5DO9A 2JJ1A 3NH9A 1WF3A 4GP7A 4PHTA 3FVQA 4DLTA 2VIIA 1XMIA 4EAQA 2G77B 1WQ1R 2ZYTX 4F4JA 3EPLA 5F9HA 1E0JA 2IF2A 4LC1A 4Q1AA 1G5RA 1SHZA 3KQLA 1W0JA 1W36D 4BECA 4R9UC 1NNEA 2NO7A 2VHCA 2WWWA 3B9QA 5EP4A 4CEHA 2QAGC 1CRPA 2PZEA 3AVTA 4NP6A 2PL3A 2RGCA 3EIEA 3QF4A 2X2FA 4JLJA 2GCNA 4RVCA 4AKEA 2JDIA 5IHPA 4F7WA 2CVHA 3MMPA 1KDTA 4N1AA 5DI3B 5AR1A 2JLXA 3O8RA 1D2MA 2OCAA 2PT7A 1ZW6A 3B7GA 4TTPA 1KZ7B 2EYQA 3CF6R 3ZGXA 2AXPA 1OV4A 3GPLA 2H17A 1FP6A 1G8YA 4LV6A 1KHTA 2JJ8A 4YONB 1HA3A 2H1LA 2ZPTX 1XD9A 4B47A 4AKGA 4NYMR 3FE2A 2OE2A 5DLQC 1KYIA 4AK9A 2AWOA 4LPKA 2YOGA 2YHSA 1Z0DA 4WOPA 1TF2A 4B48A 4B74A 2OUKA 3C7KA 4ACAA 1JR6A 5P21A 3W3AA 3TVTA 1JPJA 1SHKA 3CF0A 1AGPA 1B0UA 4MYCA 2MSCB 5LB4A 2FSIA 3ZLJA 2PJZA 3HWSA 2G88A 5GVRA 4H1VA 2PEYA 1W36C 4PPNA 3EPKA 1M74A 1XDBA 4MGZR 1UKEA 2A5FA 3SJBA 1VCIA 2CCJA 1U0HC 4A82A 1G291 2Z0MA 1HE1C 3KXKA 2BC9A 4A0FA 2E9SA 3W6PA 2GXUA 5FL7A 3ZQ6A 4MDFA 1R6BX 4QJ5A 3X1WA 4URYR 3LW8A 1N6OA 2WMOB 3CX6A 1T6NA 4DDTA 1CJVC 1KO8A 3SEAA 2IUSA 4ZDKA 1KSHA 1XXHE 1E2NA 1F6BA 1GNQA 2CJWB 4KBGA 4JBYA 4A2PA 2ZM5A 5CLLA 3UMFA 2BEKA 3CR8A 2O8FB 1XCMA 4C30A 1KDRA 3F5FA 1E2FA 3B13B 1RC8A 4DT1A 4AG6A 3W34A 4FCTA 3QPUA 2GXAA 3CWQA 3U2QA 1V43A 2WPDD 4TL6A 2BBTA 4DSNA 3BB3A 3PEUA 1Q44A 3L82B 3QUSA 4FD2A 1XXHA 2AWNA 5FR2A 1N3BA 4JT2A 4Q4JA 3IHWA 3NC1C 4PHHA 2EFHB 2FA9A 2CE7A 3MG9A 4XTRA 1Z08A 3GLIE 3I1FA 2GESA 4KAXA 4CEHB 1T5IA 2VF8A 3A36A 4XWOA 3AP2A 3LLUA 3SZRA 3ZYCA 2YVUA 1NN5A 1E98A 2ZSDA 4NH0A 5KNDA 4FMCF 3N70A 4DIDA 1IJEA 3KFVA 4M1TA 4WXRA 4QOSA 4CVNA 1FQJA 3CNLA 3A4NA 5DE3A 1ZJ6A 4JYCA 5JCZA 3U7EB 3GLIA 3QBVA 4TTQA 1W4AA 1NKSA 3ZD7A 2RGNC 3TKLA 2FG5A 5KDLA 1SKYE 4TYNA 2CL6X 1G7TA 4CF7A 4Q9IA 4LJ7A 4PZLA 2ANBA 4DIEA 2ZI5A 2QU8A 3PR1A 1P73A 4BFTA 5C2JB 2QSYA 1KNXA 1U9IA 2VBCA 4D25A 1QHHA 3D8BA 1KI6A 4UXJA 3TR0A 3QEJA 1IHUA 4WZAE 5L3SA 2W6JA 2DY1A 1RPZA 1E1QD 4V0ME 5IK2D 1AQYA 1KDPA 2DFNA 3FPAA 4LHVA 3BJIC 1ZC3A 2G3YA 5CYOA 4IJMA 5HZHA 4ZPXA 2HLDA 3QKUA 4Q7JB 4A9AA 5KU1A 3AQ4A 4CT5A 2EYUA 4NL4H 4Z1MD 4HLDA 3VR6A 1E2DA 3H4MA 4NONA 3AF2A 4OHVA 1OHHA 3SYNA 3K1JA 2Z6VA 3PQCA 3T15A 3WMGA 1ELOA 2XEXA 3ZZ0A 1VYTA 4V0MA 2HCJB 1X1RA 3I72A 1E9DA 4KFUA 2PH1A 2UKDA 3E70C 1T8TA 4UQOA 3U6BA 1WBDA 3QVUA 1E2HA 2NO9A 3OESA 4KO8A 3HJNA 3ADBA 1E6CA 1GILA 1NN3A 3MUFA 4UNRA 2QPAA 3KKOA 1AS0A 3ND9A 3BIFA 2IYYA 4DT1B 4PO8A 3BORA 4LZZA 4BFUA 3GQBA 4ASUD 1GNPA 1AK2A 2ZANA 3SE0A 5DYIA 4LBYA 4MRNA 1KK2A 1XPRA 3QF7A 1XXHB 3IDQA 3THXA 4QBIA 3W6OA 3MRSA 5EUQB 2AFHE 4OI4A 4Q4JB 4JLMA 1PJRA 4B3BA 2IT1A 3SYLA 1VG8A 1LTQA 2GTPA 2FH5B 2OBNA 3OHMA 4WZBE 1NVVQ 1P9WA 1MO3A 2YWFA 1Z6XA 3ECCA 4PZZA 1DAIA 5GJVC 4BGDA 5E7IA 2NZJA 5SZKB 5E3HA 2FV8A 4DCTA 1G8GA 4GSYA 4LYFA 4TMZA 1IXRC 3PJRA 1QHNA 2CLCX 2CL7X 4IOMA 4OHZA 1N25A 1ZNXA 4FMDF 3DM9B 4NPHA 3SC3A 2GKSA 3TSZA 3O8CA 5K8TA 2I1QA 2J5XA 1TQ2A 2IS4A 1ZD8A 421PA 4W5JA 2VP5A 3GLIB 5TB5A 1FZQA 4BPBA 3C15C 4N0DA 1R8SA 1SVLA 3U61B 3VHXA 2GK7A 2RHMA 1XWIA 1DAHA 3CPEA 5ANRB 2ORWA 3SDZA 2N46A 2VRWA 5EP1A 1F2UA 1E2QA 1KJWA 1QHHB 2XTNA 3OE7A 1U81A 1MV5A 1FUUA 1XP8A 2GAAA 4IFBA 4C3ZA 5L3SB 3AVWA 1YVDA 1XD8A 3RS7A 1KI2A 1GNRA 1M8PA 2A3RA 2BMDA 1VG1A 2QP3A 1NL3A 4P4UA 4A15A 2QN6A 2QT0A 1SXJE 1SKYB 2ZI4A 5KPDA 2J0SA 3OIVA 5CJ2A 5AJVB 4M1SA 1W4BA 3KJGA 3IO5A 2IXEA 4LWZA 2O8DB 2WJJA 3PENA 4D4KA 1U94A 2CK3D 2W2XA 1NSFA 2VP6A 5GADl 3TQCA 5H1YA 2W00A 1VCMA 1I4LD 3BK7A 4MRPA 2X77A 2OM2A 2PT5A 3FGNA 3A58B 4BFYA 4ERNA 1LF0A 2B7CA 3DEFA 1I2MA 2P5SA 2A5YB 1SXJA 3EA5A 5FPHA 2D7DA 4MKIA 2YC2C 3UANA 4ZIRB 2YC4C 3WY9A 5A5GA 3QXCA 2IXGA 2DWPA 5G40A 1S1CA 4BLPA 2P67A 3IILA 1A4RA 2ZJBA 1N6HA 4US0R 1W46A 221PA 4C0LA 1HEIA 2WIAA 1FUKA 2JLRA 1V5WA 3BBPA 2GHIA 3I5YA 1E0AA 4X8OA 4FIDA 3THXB 1TEVA 5C4GB 3NEYA 2OXCA 2ZJAA 3NBFA 3BFXA 4KFTA 3NVAA 4DDWA 3OEHD 4RD6A 3X1ZA 2XSZD 2ATVA 2QEQA 3MAAC 3T1OA 2V54A 1I2DA 1FPMA 3CNOA 4MUBA 4Q7LA 1ANKA 2XJ9A 4LDJA 3A4MA 3AM1A 4TLAA 4QNRA 3Q5DA 1Q12A 5J5CA 4KSBA 3TIFA 3Q8XB 2DFLA 5E95A 3ZIAA 2GJAA 2QL6A 2HJGA 5FTMA 3RS4A 1E4YA 1DVRA 2CNWD 2JIZD 1ZNZA 3LVRE 5BWMA 4FINA 1X86B 1QG4A 3THWA 1NVUQ 3A37A 5AUOB 1U0JA 1Q3TA 1P2UA 1Z0AA 5IRCD 4Q5IA 1FMLA 2FN4A 2QMOA 1SVIA 2VHJA 3PUWA 2CVFA 1YR8A 2ZS9A 4TSFA 2JLWA 4DCSA 4DCVA 3REFA 4A6PA 1YZGA 3NBZC 1EWRA 4LJAA 2FWRA 2QNRA 5GJCA 1TTTA 5DGXA 4U02A 1CIPA 1II0A 1ONBA 1P2VA 2C9YA 4JLNA 4YDSA 2JLSA 3UG6A 4PQYA 1AS2A 1CLUA 1ZINA 2O8EA 1DG1G 2NO1A 2JAQA 2E87A 1JEDA 2EWVA 1DAEA 4C0KA 1SXJB 4LYAA 5EXXA 1E79D 1ETUA 2WWFA 1X8KA 1ZM4A 3ZVRA 1XU4A 4O0MA 2XZOA 3KJEA 3MSXA 4FW9A 1ZM3A 2AD1A 3EC2A 3B1WA 1RE0A 3TE6A 1GDDA 1N6RA 3ICEA 2YOFA 1U99A 4I1OA 2QG6A 5EE1A 2ZVQX 2ZI6A 1UFQA 3QJYA 3AB3A 3B1XA 4D0GA 2O8CB 2KBFA 4WIAA 3QXJA 4W5HA 2ZAMA 3QVVA 5TDHA 1KK0A 2NGRA 1KI4A 2QY9A 5C1BA 1DE0A 5FUYA 1UBCA 2IK8A 2VHUA 2KSQA 2VHTA 4XVQA 4PPFA 4EPRA 2JGNA 1AS3A 2QAJA 2QENA 3BB1A 4XH9B 1DAFA 4LYJA 2C03A 4OYHA 1XJCA 2A78A 1E1RA 2IBMA 4JYBA 4EJSC 4CIDA 4G01B 2YV5A 5FI1B 4I1SA 1BO6A 2GXQA 2RGBA 3LXXA 5DNYB 1XZQA 5CYPA 5JJKA 4JKYA 5JS8A 4TMVA 4HI0E 3FMOB 1BYUA 2F9MA 1ZP6A 3GD7A 4G1UC 4QGAA 3UMSA 1YZKA 5KDDA 4IVRA 1OE0A 1UF9A 5JI2E 1OXVA 1G16A 3DHWC 4FXPA 1VKJA 2MMGA 4HLUA 4PC1A 3TJZA 1YZQA 1CULC 1JB1A 3AP1A 2D7CA 4S2EA 1VHLA 2YZ2A 4LBWA 3THWB 2RAPA 4R2HA 1RRPA 3QI2A 3TQFA 4D4JA 4KHZA 3L8ZA 2QSZA 4PC6A 2REBA 5GVSA 4DSOA 1GG2A 4A2QA 4EFNA 3THYB 1NVXQ 4DJTA 4OHYA 1EG7A 5B58C 2FF7A 3PEYA 2ZETA 2K5UA 3KTAB 3B82A 4DUGA 1R0WA 1G3MA 3BRWD 1VTKA 3RWMB 3UWKA 1P62B 3F8TA 5FOSA 4IXMA 4TMXA 4D80A 2HXYA 4IEIA 4D82A 1XZPA 3MLEA 2ZYVX 4ZKEA 5SZJA 1E32A 2CMKA 4O2LA 2NQ2C 2V6JA 2W83A 4XWKA 1TQDA 4DXAA 2FEMA 1AZTA 4HUQA 4ZI2A 1D5CA 1S4QA 2X2EA 2ZS7A 4HAWA 4XVUA 1UADA 2QTVB 4Q47A 4TN1A 1TF7A 4FWIB 1NVWQ 5KNBA 4HLQB 2ZVPX 2O0HA 2FMXA 3REGA 2J7PA 1SXJC 2WWHA 5HKKD 3SI7A 3UK6A 4II7A 5HPYB 3IUYA 2F1HA 1YZUA 5E4FA 3RC8A 1WXQA 3RABA 1KDOA 1HE8B 3ZIAD 1KK1A 1SULA 2JJ2A 5EE0A 3UKDA 2IHYA 1Z2CA 2F7SA 3FFAA 2FGKA 2EFEB 2XTMA 3ZVNA 4NYIQ 2OLKA 2QBYA 1MT0A 2C77A 1CEEA 2B7BA 1Z07A 3T1VA 3B8HA 4GMDA 5LDDC 4B3XA 3W9YA 1FL9A 3GEHA 5CITA 3EZ2A 4TSFD 2LCFA 1D9ZA 3C4JA 2OFWA 3TUZC 2IW3A 2XOKA 1ZIPA 4KU4A 1UEIA 3CUEF 2G83A 5SZHB 1CR4A 4L9WA 5HZKA 3FYHA 1XD2A 5EXTA 1X3SA 2IYRA 1T0HB 2HDNB 2WIBA 4OK5A 2BDTA 2HUPA 2CXXA 4E09A 2BJWA 4W9MC 1S96A 4LJ5A 1VDZA 2EVWX 4ILEA 3MFYA 3P27A 5CJPA 3DOFA 3SBEA 3ADDA 2DR3A 3RRMA 4BFVA 1P4SA 5FUVA 4K8OA 4Q9JA 1SVMA 1YR7A 3K9NA 3U3RA 2XB2A 2JCSA 1ZIOA 1P7CA 3U3MA 4Q00A 1JR3E 3CNNA 3RLFA 1GFIA 2A30A 1OJLA 1D8TA 2OCBA 2IYLD 1EFHA 1KSJA 2VP2A 5BW8A 2IS2A 1MRNA 3PIRA 3QKRA 1L8QA 4M0LA 1Y63A 1KAOA 4JLBA 2C8VA 2AN9A 4OBEA 3B6EA 4B44A 1E9CA 3C16C 1XBTA 3TNFA 2C78A 1X8JA 1KMHA 4QKQA 1KY3A 5KO2A 1T8UA 2R6FA 2CHGA 4BZQA 3E1SA 1Z3IX 2EU8A 3KJHA 3QEOA 2ZR9A 4POAA 2ONKA 3M4YA 1JR3A 3CR7A 2PX3A 4W7SA 2IWHA 1KKLA 1OH6A 2HEIA 4M1OA 4DLSA 1TL7C 4HUQB 1Q1BA 3KUCA 4OQMA 1KTVA 1JECA 1XNJA 1WMSA 4XSHA 3TVDA 4EPVA 3IEVA 4KJZA 1C4OA 4TLCA 4RZUA 1R0XA 4URXR 3X1XA 5A4JA 5K8IA 1OLOA 1QHXA 1SKQA 3AVUA 4CEJB 2ZRFA 3HR7A 4QJ4A 1NLFA 2GILA 3KQUA 3KFXA 3K70D 1GKYA 4Q1EA 2VSFA 3OFND 1EFTA 2QORA 3EARA 4Q1BA 5H70A 1NMYA 4LHZA 5FTLA 1Z8FA 2P0EA 1D2NA 2ZE7A 4AIIA 3OEED 5CIWA 4NYMQ 1M2OB 2RGXA 1AN0A 2QBYB 3NTUA 2ZRNA 2WMNB 4URVR 2A2ZA 2C99A 2R44A 3DL0A 1WB9A 2RB4A 4RKFA 3RYTC 2J0VA 2PCLA 4PTLA 4B35A 4XJXA 4XTCS 4C4PA 1VECA 3UG7A 1IJFA 1LFDB 2RH5A 1XD2B 1Z0FA 3EZ7A 4ZDIA 1G21E 1WE2A 2BVNA 4OI0A 4OL0A 4Q1FA 4RD3A 4GRAA 2GCPA 3TR5A 3QENA 1NLYA 2QTHA 1NY6A 2BBWA 4B76A 2FDCA 1II8A 3QXXA 2GJ9A 1F3OA 4RD1A 4EQ6B 3GLFE 2OESA 5KDOA 4DWJA 3NHAA 2D2FA 4JJZA 1P2SA 2WZQA 3K70C 3Q9LA 1XCGB 3CPHA 4Q4AB 3LQQA 4ZO4A 3W3ZB 1EK0A 2V7QD 3AVQA 1TU4A 4LHWA 4O3MA 3N5CA 4S35A 2YINC 3U7GA 1N5IA 4A92A 1OIXA 1VHTA 2OCPA 4Z51A 3Q7PA 4JLVA 1E9SA 3NDPA 5FOXA 2BM0A 1ZUNB 2FSFA 3ETLA 4Q4HA 4AURA 5EXSA 2LKCA 3QKRB 4GT1A 4A8JA 3R20A 1JQJC 4MA4A 3GLFA 2ZU0C 3EC1A 3MWKA 3PUZA 4TYYA 3R7WB 1SVKA 4C0AC 1LF5A 1E2EA 1UAAA 3CLVA 1FW6A 5BXQC 2IF0A 1J8MF 3WYAA 2XOKD 3SU8A 5IT5A 5KYKA 4OJQA 2J1LA 1Z22A 3NHBA 4L8GA 1QDEA 3FFBA 3NDBB 3ADCA 3HU2A 4FCVA 1W7AA 3UATA 4Q1DA 1GL7A 1RVDA 5DN6D 4P4TA 4PQRA 4BFSA 3PUVA 5FTJA 4TL7A 4DHEA 1T3LA 3L0SA 3W5IA 3AVVA 4TYPA 5L3RA 2CEAA 2W58A 1XMVA 3NKVA 1AM4D 1G7SA 2ZRIA 5UKDA 5JS7A 2JLYA 5AJXA 2J9RA 2PEZA 1ESMA 1R7RA 1WRBA 1BIFA 1P2TA 1RRCA 1P75A 5JRZA 4C0BA 5FFMA 1RKBA 2HV8A 3KXLA 5CDFE 1OKKA 1XTSA 1PUIA 3WMFA 3QPVA 2R2AA 1ODFA 4JVNA 5M04A 3KJIA 2X19A 4MRVA 1R5NA 1VCNA 2ZSFA 3IGFA 3HR8A 4BE7B 3M0EA 4P33A 4V03A 3DMNA 3NEJA 2VYFA 3B5JA 2J3EA 1H65A 4PANA 1W4CA 4A1FA 4PAOA 2OBLA 5BN3A 4QL3A 2ZJ5A 2QROA 2AXNA 2NMVA 1CU1A 1GZSA 1I4TD 1XEWY 3HPRA 4M1WA 1KO4A 4KLNA 5CDFA 1H8HD 1W4RA 2XTZA 4AI6A 1Q20A 4NTZA 1UDXA 3CH5A 5TXGA 4EFLA 3VTKA 2ZRLA 3FMIA 4GZLA 1ZBDA 3K0AA 1L7VC 4TL8A 2SHKA 1II8B 3Q5EA 3QBTA 4B33A 3BH7A 4QC2A 3H2YA 3LV8A 4Q1CA 3KKQA 4IW3B 5FBWB 2YNMA 3TW8B 1ZAKA 3WRYC 1ZVQA 2G0NA 4JLKA 4C2UA 1IY0A 3O47A 1K8RA 4Q7KA 2IL1A 4LK2A 3X2SA 4Q02A 1CR2A 4UNNA 4GL2A 1FQKA 4ZCMA 1OYYA 1ZD9A 1MH1A 5DYGA 1KI1A 1XMSA 4BLOA 4EFMA 2O0JA 4JLAA 4XWAA 1YE8A 2ZSBA 3AGQA 3K8YA 3QF4B 4A8JB 3GLFB 4TYWA 1R2QA 1GRNA 4PAQA 1HV8A 5JHHB 3HYRA 3MJHA 3E2IA 4YC7A 2ZAOA 5G3ZA 1CTQA 1KZGB 2D06A 4UNSA 2ZQ5A 5D3MA 3BS4A 5CK4A 3VHLB 1VIYA 1N6IA 4B43A 4I1VA 1Z0IA 4AYTA 3AKDA 3KB2A 4HYYA 4TLBA 1OF1A 2EFCB 2ZJOA 1OFTA 1F2TA 2G9NA 4ARZA 3U3JA 1LS6A 3RRYA 3BH6A 4AKIA 1L4YA 4HSEA 2C9OA 4R2IA 2V6IA 3VR5A 3B85A 4TLEA 3W90A 4PXAA 2ODWA 3CM0A 2JJ1D 2FX3A 1YZTA 2VO1A 4HB0A 3QNUA 5JHGB 2V1UA 5TVKA 4LHXA 1VYUA 3MWYW 4Z8YA 4E5UA 3R8CA 3C5HA 1W0JD 4RCZA 4A2WA 5F98A 2JLVA 1TQ6A 5JBQA 4F92B 1ZC4A 2ZREA 2YWEA 4GFDA 5BYKA 4IXNA 4OHXA 2FEOA 1W1WA 4HAZA 3ZD6A 2JDID 2ZSAA 1O3YA 1YQTA 1RRFA 4H1UA 3TMKA 3ONWA 3W8NA 2QMHA 3CONA 4TYQA 4M21A 4YMTA 4JT4A 2WJYA 1P61B 4QBHA 5EE9A 3T5DA 3UPUA 1Z28A 4EPXA 1D2EA 3V4FA 1OB5A 1C1YA 2GVDC 3KQKA 5FPYA 3EZFA 4NHOA 1NG9A 3EG5A 4OKSA 4FMCB 3TAHA 4QRHA 5FBRB 4BASA 2BCJQ 3K0AB 2W0SA 3FHCB 2GJSA 3U3OA 1OYWA 1S9HA 2O0KA 4Y0VA 1BKDR 3ZJYA 1YRAA 2GEVA 1GWNA 3T35A 2G1KA 3DM5A 1DADA 3CX7A 4GOJA 2ZRAA 4KXFB 4M22A 1UEJA 2OSBA 3K9LA 2I4IA 3LFUA 2ATXA 4JL6A 4NCJA 2RCNA 3TK1A 2ONJA 1HTWA 2BHRA 4D81A 3VKWA 1EFRA 2KBEA 5FL7D 4C0QC 2WICA 2PJRA 1E3MA 1YZLA 1FX0A 3K0FA 3K0EA 5JZVA 2OAP1 2CHQA 1KSFX 2NTYC 1CR0A 1VYVA 3A1TA 4LJ8A 1MO4A 3WBJA 5D3MB 4KFRA 1XPOA 1COWA 1NY5A 4GBMA 4MQBA 1OXSC 4WZ6A 1A82A 4CZ2A 4LJ9A 1FTSA 3R9IA 4M9QA 1AQUA 1NSTA 2REXB 1T91A 1DARA 4PO9A 1F2TB 2BOVA 3T12A 2RGDA 3IEUA 4QM6A 1NF3A 1KO5A 1KI6B 2NG1A 4AY2A 4B73A 3TGPA 1IY1A 4PC2A 1T5LA 4HLCA 1HUQA 3A1VA 4BFWA 1XRJA 4HDCA 1A5TA 1W47A 2B21A 2H18A 3A1WA 5FOUA 4G5QA 8OHMA 2C04A 1YZNA 1C9KA 1OFHA 4DBLC 3EWSA 2XGJA 4NDZA 1TF5A 2UVQA 1OT3A 4RCYA 3ADKA 1JNYA 1GSIA 5FPKA 3WNCA 2VSXA 1P9NA 1VG0B 2D3WA 3L0OA 4XVRA 4HB2A 1W44A 1NKTA 3SHFA 3TUJC 1YU9A 1XEXA 3EAQA 1ZM2A 4AD8A 1Z2AA 2WSSA 1IN8A 3P20A 4PHFA 3RHFA 4CT4B 2HF9A 1B23P 1IBRA 4FMDB 4G5OA 5AWFC 3VFDA 5FTKA 1VIAA 3RAPR 5B30A 3BOSA 1XX6A 2OFOA 1KI3A 2Q3MA 1SQ5A 1JJVA 2WAYA 4B71A 4QBGB 2RKOA 1UKVY 2W6JD 2B6HA 3HP1A 2J0UA 4BZXA 1DAGA 1FFHA 3I92A 4IVQA 1NVVR 1QG2A 4B3DA 1E9EA 4TQAA 3A8TA 2HLDD 2BBOA 4GDFA 1F5NA 4LCBA 5CLQA 5H8WA 2OILA 4OK6A 4D6PA 4IOKA 1OHHD 2WJHA 2BEJA 5KPJA 1XF9A 2KI5A 4FN5A 1SVOA 1FX0B 3K0FB 3D31A 1A2BA 3LRPA 4GNKA 5EUMA 5B2ZA 1EX7A 2GEUA 2IUTA 1WBBA 3GJ0A 1N5JA 2YWHA 5TY0A 4BZPA 4D0NA 5KUTA 3AV0B 4Z54A 3VR1A 1W0KA 4QGFA 2AX4A 4Y0AA 3PFIA 1U9IC 4U5XA 4RFVA 1F2UB 4M2LA 1R0YA 2D74A 3SS8A 2BM1A 4WXPA 4DKXA 3P32A 3FKSA 2FZ4A 2PZFA 3T61A 2W2VA 1G6HA 5FBQB 4MRSA 3V4RA 1Z6TA 4AYXA 1DAMA 1BYIA 4K46A 5FI0B 3X1YA 1ZCAA 1TADA 3U7HB 3NBXX 4KSCA 1EFUA 4I4LA 2Z83A 5FH9A 4V0LA 2Q9BA 2EFGA 1JXMA 1EFCA 2J59A 3MGCA 2OEPA 4O25A 2DFTA 2B8TA 2NOAA 4TMKA 3WYGA 1KKMA 1KNQA 4MRRA 4KFSA 1EFRD 4JZKA 4QXAA 2DHRA 3CB4A 4MGYR 4PSKA 1CJUC 3U44A 2WKQA 4B3CA 3NC0C 3OIUA 1QVAA 3VNUA 1MR3F 1KAGA 2HCBA 3KKMA 4LUCA 2I1VB 5D3QA 2QM7A 4Q01A 2ODBA 4RZXA 4JL5A 4QNMA 3VKHA 2H92A 4A6XA 2IWRA 2P65A 4BLRA 1R5OA 4GPTA 2GZAA 2NPIA 5EP3A 1G8FA 4OJKA 1CXZA 1CS4C 1AGRA 3I4LA 4Q9LA 3OE7D 1G41A 3CX8A 4JVSB 2FSGA 3ZZUA 2J0UB 4WVFA 1G9XA 1QZXA 4B3GA 5CB6A 4DB4A 4U7DA 1IM2A 2BJVA 1TMKA 3LWNA 4YQFA 3I61A 2PLRA 1S8FA 1CR1A 4BLTA 2QRZA 3MCAA 1Z6AA 3C14C 3BH0A 3KX2A 1LY1A 3GFTA 3BAFA 1J99A 2Y8EA 4UXIA 5DIFA 2XXAA 3ND8A 1TUIA 4B2LA 3VX3A 1JQLB 5GJBA 2FPLA 1LW7A 2ZTSA 4YMUA 1NBME 1SXJD 2VSOA 1W2HA 3ZDQA 2IYVA 4HEJA 3U5ZB 4HZUA 3IO3A 3QXSA 4LV5B 4ABYA 4C0HA 1PLJA 2OHFA 2ZI3A 4P3YA 2ERXA 1P9RA 2R65A 3B78A 1OH7A 2IEZA 1NJGA 3PXGA 3QY0A 3SJAA 3EZ6A 4IVPA 4M9ZA 3SYKA 4DLZA 2LWIA 2JLUA 4EKDA 2P6UA 4MYUA 3FMFA 1XPUA 3L2OB 3G5UA 1NBMA 2W2TA 4M1YA 3TW4A 5AUNB 1R10A 3LX5A 3DKVA 3QKSA 4NYJQ 1M7HA 3L43A 2DCUA 4NMMA 4OI1A 1XB2A 3UIEA 3U4QA 1XFAA 2PMKA 1TEXA 2UZIR 2OCYC 3LY5A 2GXSA 5FOWA 2XITA 3QSYA 2FFHA 2GAOA 4BLQA 3AVXA 2DB3A 4I99A 5TV2A 1G3RA 2VHQA 1U2RA 2JA1A 1A1VA 2W6IA 3X1DA 2QAGA 4ZI3A 3LLMA 3WHLA 5JSZA 2Q21A 3MWJA 1D6JA 1RJ9A 1LB1B 3U44B 2WKRA 4HATA 4X8HA 2O8EB 1N5LA 1OIWA 2EFDB 3ZH9B 3RDPA 4AWXA 3NIBA 1DBSA 1TNDA 2ORIA 1J8YF 4ITRC 4MGIR 4E22A 4HUTA 1Z29A 4G5GA 5J47A 2H57A 2DBYA 2QPOA 2WJGA 1M34E 1NP6A 3B2EA 4QHSA 3CBQA 1GRQA 2WBLC 3T06B 1U8ZA 2A9KA 1PZNA 2A7QA 1BMFA 3DDCA 4KYUA 4RD2A 4RJLA 3EIHA 2VEDA 4C0SA 3RC3A 5JRJA 2ORVA 3Q7QA 4TT3A 1GKIA 2BMFA 2IX3A 3ZS8A 5JEDA 1OB2A 1M1YE 4IHQA 2GK6A 1Z83A 5KNCA 2WSMA 1RZ3A 3DO6A 4LHYA 4PQFA 2P3SA 2WM9B 3WP0A 5J4KA 1A7JA 2ZI7A 1Q0UA 2WKPA 4K81B 1OIVA 2GJKA 4IKEA 4ESHA 4ZV4A 3I8XA 3BFKA 1DTSA 1FMJA 1JJ7A 2NIPA 2WOJA 4NU0A 2Q9CA 4NCNA 4MKGA 2IS1A 5L3QA 1U8YA 2XXAB 2ZYWX 1G17A 1OPXA 4HB3A 2GA8A 1P60A 5LD2B 3VR2A 2WJVA 3BFVA 3GJ3A 5BYJA 4PR0A 2W0MA 2Q0HA 3IPXA 2B92A 4LYHA 4ZKDA 2E1RA 4RFSA 3LDAA 4PC7A 4TL9A 3ZS9A 4NCHA 2VL7A 4KVAA 2VP0A 2LKDA 3GCGA 5DH9A 3TLXA 5L8VA 1Z06A 1E2JA 4XOIA 4Q21A 2ZITA 5B57C 4I81A 1N6KA 2ZRKA 1N0UA 3AKEA 3KQHA 1FP7A 2CE2X 3QKSB 3L0IB 3RWOA 3U4QB 1G6OA 2FE4A 1XTIA 2J46A 4V0KA 1AKYA 2AR7A 3IQWA 2ZSEA 4M4SA 1YKSA 2HT1A 1IN4A 1DOAA 1G4AE 5JSZB 1E1RD 4L4UA 1LVGA 1CBUA 5BN5A 5LPNA 2JEOA 2ZEJA 5JFGA 3U3KA 2ZR0A 2DWOA 1UBEA 3LA6A 3C5CA 2PBRA 4US1R 4TMTA 3RRNA 2BMEA 4DLUA 1Z0KA 2XB4A 2QM8A 2RGNA 4B6FA 1XMJA 2ZROA 4HAVA 5EE3A 3WBKA 1UPTA 4NYIR 2QRNA 3GJ7A 3CPJB 3IIMA 4IEEA 1RFLA 4M9SA 1GKUB 2WPDA 2RGEA 4BUJA 4D2IA 1ZUIA 2XNDA 3RS0A 3UXMA 3J81k 4E03A 1GOTA 4GOXA 2J45A 1X1SA 3GJ6A 5E7MA 4DSUA 2RGAA 4DUGD 4G5RA 3AH8A 1NI3A 3IBYA 2C98A 3H1TA 4JSTA 5LB2A 2GZDA 3WNDA 2YYZA 2O5VA 4AYWA 4DLRA 2IYTA 3JZMA 3AVPA 3GJ8A 1ZYUA 4OQFA 2AK3A 2EQBA 1QHIA 3SNHA 1AA9A 5B64A 1E0KA 5JECA 2FFBA 3Q3JB 1LNZA 1QHSA 4ZCIA 1N6LA 3M6AA 4L15A 5LD2C 3BE4A 4R7ZA 1UKZA 1IXSB 2J7PD 2GEDA 3CO5A 5KHOC 3VR4A 5JMTA 1X6VA 3GMTA 2JATA 4FCWA 2CJWA 4IRUB 1EGAA 1R0ZA 1W5TA 4HLUC 4Q66C 4XD7A 4YDHB 721PA 5K8LA 1EESA 5J4YA 2WOOA 3RSLA 3ZZTA 3SR0A 3A6PC 2AHOA 2JJ2D 3FHTA 2O8FA 3B1YA 3BGWA 3TUIC 5KSOA 3PEWA 1KMQA 2A5DA 2WAXA 3P4YA 1P5ZB 2WWXA 3ASZA 4IOLA 4LBZA 4I1UA 5HE8A 2GETA 1JEEA 3T5GA 1F60A 2I3BA 2PX0A 2J87A 3I8SA 1J7KA 1KMHB 1TU3A 1U0LA 3BC1A 1E1QA 1HQYE 5KSYA 4CEIA 3HYTA 5HCNA 3RNLA 3K53A 1IOZA 3B1VA 1N0WA 3L8YA 3K9GA 2Z4SA 1AJEA 4LBVA 4QJ3A 1OXXK 4Z1MA 5J4HA 1S9DA 3FB4A 4ON9A 1E0SA 2CCGA 1G3UA 1Q21A 1D9XA 4LJYA 3OIYA 3U7FB 1MABA 3WP1B 3C41J 3LXRA 2GCOA 4BRUA 4UKDA 5DISB 1QHYA 4OQNA 1UBFA 3B60A 4Q9HA 3KZ1E 2CDNA 4ZDWA 1SVWA 2MSEB 1QVRA 1E2MA 1S3GA 5HR5A 1HYQA 1G5TA 3GJXC 1Q1ZA 2AL7A 3DVLA 3EA0A 4GOKA 4LGMA 4Q03A 4ACBA 4JJKA 3HU1A 2FGJA 4PHGA 3EPHA 4PSVA 3T1QA 3NXSA 1S1MA 4BFZA 1Z0JA 2ZRDA 4ASUA 3JVVA 2IYZA 2G0TA 1H8EA 4L5BA 4A36A 4DZZA 4HAXA 4YMSA 3K0SA 4PX9A 4LC0A 2F1JA 1X8LA 4DVGA 2PZGA 4RSGA 3BXZA 1E2GA 5BQ5A 3MJRA 3SBDA 3QIAA 3WRXC 1G7RA 4DDUA 2ZJZA 3OAAA 1W5SA 2ZRPA 4B2IA 1GITA 3AUYA 4HDQB 4DEXA 2ZRCA 2GDJA 3LD9A 4N3NA 2VPPA 1JR3D 5AUPB 2HXSA 2IA5A 2V3CC 4C2TA 5DHFA 3RSOA 3DKPA 4UJ3A 1DS6A 1CKEA 1LS1A 3AF1A 2FPKA 4BEBA 3CRVA 5CM9C 4A0HA 1W49A 3IIKA 3EWAA 1FNNA 1G20E 3I32A 4TLDA 5H68A 1WDTA 2A5JA 1E94E 4DSTA 3EX7C 3H84A 2Z5FA 2QUZA 3CRW1 2BKEA 2Q3HA 5CK5A 2F55A 3SFZA 4LV8B 4W5WA 1NIPA 3LQRA 1RW4A 2IYQA 4XSGA 4E07A 2D62A 4Q4HB 2WV9A 4Q7MB 4FI3C 4Q9KA 2VH5R 5FPSA 1U98A 3RS2A 3CH4B 3P4XA 2V9PA 1QBKC 5K8UA 3FOZA 2IS6A 3GP8A 4TQUS 1CJMA 1PLLA 2XNDD 1HURA 2G6BA 5IF9A 1GAJA 2UZ3A 2C9CA 4CEIB 4IDQA 2GJ8A 2F6RA 1XEWX 1F48A 1BOFA 1NG1A 1M7GA 3W8RA 5JJIA 2HYIC 1OFIA 2RMKA 1KO7A 3QE0A 2MMCA 4LOAA 2XZLA 4Z8XA 3ZVLA 4TQ9A 2NPFA 1OXUA 4UXHA 2KJQA 2CLSA 1MABB 2ODNA 2QP4A 1L2TA 3IKJA 1T3HA 3Q72A 1CF4A 2CK3A 4FMBB 1EXMA 2GCOB 3FWYA 2F3TA 2QTFA 2DFKB 1KGDA
chains in the Genus database with same CATH superfamily
1DRJA 3NGLA 4UBLA 5KYUB 5C18A 2FW7A 4KITB 4R31A 3SR4A 3A3PA 3CS3A 3F97A 4NJEB 4PYJA 4KBFA 1K7XB 3OQ6A 3PV0A 2C1XA 2Y4OA 3DDHA 2Y77A 4MUAA 1PW5A 2QP9X 1R12A 3DDOA 5EWLB 5I4KA 2J3KA 2YYAA 5DI9A 3GEEA 4POOA 4X9XA 4JSYA 4PPQA 3A3YA 1IRIA 4M54A 1VBMA 1T24A 3VYSB 1U3TA 4MJLA 3BZUA 3E7FA 2VDLB 4CXMA 4TV9A 4B0OA 4YUAA 4IKOA 3V9PA 1ADJA 2CNDA 2A8YA 3I0ZA 4NCIA 1DZ3A 1VJ1A 5T4HA 5JYDA 1T6YA 1YV9A 4AXXA 3CZAA 2Q1TA 5F33A 5CW2A 5BNTA 3G0HA 2XTJA 1SQ0A 3JZAA 3QXHA 1J25A 1JFFB 3I23A 1F51E 4D9HA 1EUQA 2IUUA 3F3YA 2FJUA 3DFFA 2C7VA 4F3TA 4OU4A 4PSAA 5JLAA 1N7JA 1WCV1 2XSZA 3TW6A 3HEMA 4LTDA 4HYQA 4Z9BA 4N5NA 3WLJA 4RZ3A 2VF2A 1CP3A 1WP9A 3F47A 4ERXA 5A4KA 1QGOA 1YRLA 2Z8YA 4GLLA 1QTQA 5ALHA 4ZVSA 5K4GA 2V59A 4B2PA 1XTRA 3CHYA 3MILA 4X8LA 1NMSA 5CIQA 4ZJUA 3U60B 2DYKA 4F4HA 3LRXA 1R66A 3V97A 4EJFA 4OLJA 1I0IA 2MSLA 1KI7A 4M1MA 1K66A 4IX1A 4X7PA 3S2FA 1CZUA 1R0LA 1AGNA 3UEOA 1RHKA 1WCXA 2QA5A 4NMWA 5KNCH 4CETA 1V7PC 4ND3A 4EUHA 4Q21A 3R2JA 4KXXA 4J94A 4ZIRA 3F74A 4TTSA 2JIZA 4DR5B 1L5LA 5EE5B 4J8PA 1BH2A 1S7CA 5LOVB 4LJRA 1C1DA 3PJEA 5AW9A 4FDTA 1I14A 1OKKD 3PC7A 1H42A 5LC1A 3I09A 1S3SA 4PV7A 5JCPA 4U2GA 4ZMSA 4C7BA 3DAOA 3A31A 1RADA 1V4NA 4KQ9A 1EUZA 3HDTA 3LCCA 3KQNA 4KV9A 2E5WA 2UVPB 3EFEA 3ZDAA 1AQLA 4IG9A 5IVKA 2ETXA 1BWSA 3OAAD 2DWQA 4EABA 4YRCA 4TXMA 2R7AA 3OJCA 4DA4A 2O52A 4TM8A 1I4EB 3DOOA 4DLXA 3MMZA 3V8QA 4RLFA 1BFKA 1QF7A 4FJ1A 3UMCA 5BSEA 3BKXA 1JEQA 3I73A 4EG7A 6Q21A 621PA 4A4DA 3GLGA 4XUCA 1E6EA 2GYYA 3TNJA 3EUEA 4AG5A 3RM3A 3LX8A 2ZJ8A 4MGKR 3RVPA 3AF0A 3OPYB 4FOPA 1JLLB 3WKCA 4BAGA 4LRXA 4M53A 3V7FA 4LCEA 4EJSA 3AP3A 3M3PA 4IF4A 1DJMA 3H5RA 4B4KA 5F35A 1ORWA 2IHBA 3T7TA 4O8CA 3NBYC 5F7XA 1E79A 4CRWB 3KB1A 2WTUA 3A0UA 1ZMXA 1OREA 1CJSA 1TKCA 3C3KA 1PJSA 4QNNA 4IFTA 1JB9A 1GCOA 2I03A 2H4WA 2HBZA 3SOZA 1BWRA 2CMHA 3CZ9A 3RIMA 4HCJA 4DBVO 2PPVA 1R0CA 1PS0A 3F0TA 3NWJA 4G5SA 3P2KA 4RZSA 3VMFA 1D07A 2FSHA 1LDGA 1RXYA 1XZ8A 1G5IA 2GN6A 3W6NA 4C6TA 4HXGA 1EX6A 3AY6A 4LPSA 4Z3OA 5KOYA 1FYWA 4X20A 4JBLA 1XYGA 1BVHA 4KQ2A 1FLVA 2XJ4A 3CRMA 3V7UA 3AF4A 5AJYA 5KSPA 1E9BA 4Z9AA 1K5GA 3QLEA 5I5EA 4D0LB 2ZYAA 4JB2A 1Z5ZA 2AYZA 3VDMA 3V1YA 1T3ZA 1VB3A 3BWCA 3A14A 4CTKA 2BBSA 2GA9A 2YVLA 1IUOA 3CZQA 4OQXA 5TQ2A 1PVDA 3F96A 3QOWA 4BNNA 4J7AA 4QD3A 3O9ZA 5DBFA 1US8B 1UWLA 1VG9B 4QBFA 3D8TA 5DSZA 1GPMA 2A9RA 2BR4A 3F5QA 4ND8A 2VRCD 1AXRA 2NU8B 4KVGA 3UQZA 5K0SA 5E4JA 1IEXA 1SUIA 1Y6QA 3FYTA 3SSMA 1JLMA 3IKLA 4CE6A 2HTEA 1ZD3A 4JVMA 2YNMC 4C7XA 1MQ9A 2FUG6 2PSFA 2HSEA 2O19A 1JG7A 4L16A 3DGEC 2QX4A 3WLOA 4IZ6A 1XVVA 5E1DA 1WG8A 2JLZA 1XTBA 4GMXA 2JANA 5J58A 4KN6A 3BXPA 3PKJA 2MSDB 5B3KA 1EXVA 1SC9A 4OB6A 4QJIA 5JWHA 2EXXA 3PUJA 4Z86A 4N9QA 2GO1A 3SJCA 4DA0A 5A0FA 4G0UA 4J1SA 3DFZA 2WWYA 5BYAA 1R4MB 2W8BB 2XCLA 5HQTA 1THZA 1CV2A 3MT9A 4TZ0A 1U2SA 5I7HA 4JBWA 1P6XA 4J0QA 1IHYA 1HM5A 3VU9B 4EJSB 1YZ3A 4EJ6A 2VZEA 1C4WA 1FDSA 2PAAA 3DBOB 4YO7A 2TMYA 3W4IA 1HT0A 1QZTA 3W5SA 2EKDA 1Q22A 3AL3A 1TFRA 3P2JA 3PICA 4XGRA 3QEKA 5E2IA 2IPOA 2WF9A 3KJNA 4EP1A 1PJQA 5DHAA 1RNLA 4FFWA 2VYQA 4IWNA 2JAWA 4QATA 1A9YA 3UJDA 4BO4A 2WFLA 3L8FA 3ZWQA 4DNQA 4QJBA 4A8HA 4F3KA 5FOTA 3ME5A 1GL6A 1M1NA 3SBOA 3PG5A 1E1MA 4P4SB 3FLBA 1UM8A 2Y05A 3HUTA 4KQCA 1LQUA 4KODA 3FYUB 4LNHA 2IEDA 4MQFB 2L19A 2QNIA 3I9FA 4RACA 5HKKA 2FSUA 5AVTA 3ZG6A 5EQTA 1JV2B 1M7BA 4ZTBA 2QGZA 1QO0D 1C41A 3AKCA 5CP8A 3VSAA 4DILA 3DXZA 2BMAA 3EODA 5JS2A 4UHKA 4QTZA 4RZIA 4OSEA 2NO6A 2B1RA 3EUFA 2RHBA 3P26A 3GELA 3DVAB 2QSJA 4MCJA 2XNCA 4EA6A 2DHEA 2QZ4A 3QVGB 1REQA 3HNRA 4HGNA 4ZYWA 1SXQA 4I50A 4PG8A 4Y2HA 5T4FA 1NLZA 3IMFA 1KQOA 2DUJA 4TSRA 2IYUA 1C7RA 2GLXA 1GA6A 3GLHB 1QWSA 3FOAA 4HN9A 5CM8B 1ZK4A 1TA4A 2R8BA 4KQXA 5EYPA 2BKUA 3ZCUA 2IDKA 1ZESA 2Q4RA 4XM2A 4CKWA 1NIJA 4Q1VA 3IIEA 3WZLA 1COWD 1T1GA 3H86A 4MW2A 3WGLA 4DCNA 5C51B 2AKYA 4XR9A 3TTUA 1Q84A 2DETA 2BTEA 3BHIA 3KHUA 5F3RA 1BCRA 3N2GA 1R4AA 4EHIA 4F4IA 2YJGA 4WFIA 1COZA 3PEVA 1YXMA 1H5QA 3OQ1A 3OIWA 5BUQA 1KEEA 3A1SA 3DWFA 3GGSA 2PLAA 1IAQA 3KOWA 1DBPA 1ZJ4A 2HRCA 1X13A 2ZUUA 1KC3A 3PHLA 1BU8A 2C5HA 4RWZA 1CF2O 4MCAA 4P82A 3C8UA 2MYTA 4L7QA 2II6A 1UOPA 4RVSA 4UZSA 1Z6QA 1AKEA 1JLKA 5IEBA 3T38A 1U7PA 2V4ZA 4Y2TA 2WUDA 1R4ZA 2ZUDA 1I13A 2V7EA 1TX4B 3KCQA 4E15A 2Z4RA 3BIXA 3NFRA 3ZKAA 5BOSA 1K97A 5KVVA 3I6MA 3ICCA 3DO5A 4YUYA 3CV3A 3ESZA 2FXVA 2RKBA 4DCUA 3FRIA 1OUMA 4ZQBA 2GERA 2YJTD 4QFMA 1FXWA 5K3AA 2O59A 2V0NA 1YJXA 4JNKA 2PRZA 1XQXA 3NQ41 3BDIA 3WWYA 4YXWD 5KJFA 2ECKA 1W93A 1X7ZB 3WA6A 2P11A 1PV2A 2UUOA 3IXMA 4LE2A 4MPPA 4F4FA 4BQPA 2ZKLA 4J90A 2F3RA 2R96A 3MOIA 3OF5A 4DSAA 3OCYA 4LJ6A 4OJNA 1UDCA 4YJHB 4CCAA 3I5XA 2A4KA 3KSDO 5DEOA 3RS5A 4J4BA 3UPDA 3GHHA 3JQFC 4DC1A 2F43B 3PKZA 2IQIA 4LSMA 4X63A 4EGQA 1Z63A 4LSZA 4P3NA 4X71A 4DA7A 2DC1A 2R6AA 3VVLA 3ORRA 1E9FA 4U00A 2VDRB 2AB0A 3M81A 3HS3A 2YWGA 3QKIA 4JI2B 4ZHQB 5H3LA 4IWXA 1OASA 2I2FA 5CEFA 8ATCA 4BO9A 1MUUA 3LY9A 5EIOA 2VTBA 2G08A 2PXCA 2OT3B 5SY4A 4MHOA 5AJWA 5EMLA 5KTRA 5EIFA 3TX2A 4NCXA 2XBLA 3OOHA 1D5WA 2OL4A 1MZPA 3QFCA 2V8OA 4LN1A 1NKVA 2ET6A 3V7NA 5BUSA 2IZOA 4BMXA 1H4QA 4EVQA 5CYGA 4I5EA 1UJ2A 6REQB 4D3ZA 8GPBA 1RKVA 4XD2A 1KIMA 1SHJA 4DQLA 3GZTB 3A9CA 4EPWA 3FBWA 4QHTA 3IAM1 4F71A 3D7MA 2OZEA 3GEIA 2NWQA 2QVXX 3TZHA 5KYYB 3NRCA 1A71A 3SAJA 4J6FA 2C00A 1YJ5A 2P6NA 2ZJ0A 1JAHA 3OCWA 3PB3A 3A4LA 8LDHA 1A2OA 3CF4G 4AJPA 2A59A 1KI9A 3OQOA 2A4MA 5EEGA 4N01A 4C3VA 1N2CE 4YS6A 3WNBA 1ZGHA 3U09A 2I80A 2ZBRA 5IW8A 3EVZA 4U7PB 4Y6OA 5JAOA 1FTQA 1OWOA 2IE8A 3OFJA 1EGVB 2CDRA 2D59A 5HGXA 4NSNA 2NZ8A 3DBVO 1J22A 2Q3EA 5DM4A 3ZQJA 5HRAA 1CYEA 3W6ZA 2AFIE 1P72A 3S68A 2WJ6A 3SQOA 4XXHA 5I47A 3GJ4A 5DRTA 1E3IA 1JX6A 2F1RA 1GGFA 4H4CA 5FNZA 1J23A 2JJQA 2Z4TA 3L7CA 3R6GA 1NRJB 4YMHA 3OWHA 5JJ5A 4CEJA 2BL4A 3AR3A 4KNWA 4URWR 3AVOA 1EUYA 2HA5A 3NBMA 1FS4A 1PV4A 1KS2A 3NCTA 3O5AA 2H8KA 3IDOA 4IIFA 3LT5A 3WC4A 2ZB2A 3EJ6A 1II9A 3AG5A 1E3WB 3DYVA 4KGZA 3E5HA 4EL5A 1RMQA 3D4OA 3IQXA 3TH5A 1LWOA 4CG1A 3G0CA 1NN0A 2V7WA 2FZGA 4OM7A 2N0SA 4CT0A 2FK7A 3O4RA 1RBYA 1MO6A 2DPXA 1GCUA 3EK2A 3GN2A 1P5FA 2WHYA 4X62B 2Y1LA 3ER9A 5ALIA 3R9XA 3A3NA 2QT1A 2ZI9A 3BCHA 2KE5A 4WSOA 5BPFA 4MW1A 3MOGA 2V8BA 1SCKA 2C96A 4HZUB 3WLRA 1RABA 4KAAA 1BS1A 1TUEA 4MDEA 4QZVA 5J5VA 4HHEA 3VV2A 4FKMA 1VJ5A 3CLRC 1GYPA 1A5ZA 4QGHA 4RUKA 2IEYA 1I2AA 4KX5A 2C94A 5MN4A 4ZHSA 4LY6A 5CAEB 3BGSA 3R7SA 5CB0A 1CRQA 4KK3A 4Q4AA 2P4SA 4NFHA 1M75A 4PFQA 1YR6A 1Z4OA 2W2PA 3BE8A 1FFWA 2BMVA 3WDLA 3T6KA 3WO1A 2R8OA 4LXIA 4M1ZA 3CURA 2JGIA 3RC2A 1O97C 4CMKA 4D9MA 5IJWA 3FTEA 4ZALA 1FXUA 3FWKA 4O4HF 3H6HA 4ENWA 1VMDA 1XCOA 1TPYA 3MAJA 3QTTA 1RXWA 2O54A 2IODA 3WK9A 2QAGB 3PGMA 3PQDA 3E22B 5LM3A 3JQ8B 4DMFA 4QBKA 1RJ9B 1RM3A 1TZKA 2BEVB 1OGJA 2JFYA 4OD0A 3R7WA 4LOHA 5DI3A 2QQ0A 3RUDA 2NYVA 2WUVA 3PUYA 3TQTA 1E5DA 4C6RA 1ECPA 2M1XA 2QHXA 3CISA 3HCAA 3JQBA 3WXMA 2JH8A 3P1JA 4P34A 1G2IA 1IZ8A 1GKKA 2JCXA 3TTYA 4HNVA 3RS3A 4WESA 1ZCBA 4XGNA 2FZ5A 3Q88A 2ZYRA 1O6BA 4WHMA 5HDQA 5KJEA 3V1UA 5IZ4A 5EIHA 4HGRA 2BGLA 1O54A 5ICGA 3UMMA 4ZQCB 1OLSA 5COAA 2ZE6A 2GM9A 1FUIA 2WIJA 3GMSA 3MCTA 4G1CA 1YIDA 2VSYA 2P79A 2JJMA 1RRGA 2GWHA 2ZUCA 3F67A 2P77A 3FGOA 3PNQA 4Q34A 1RAAA 4QE3A 4RLHA 4YRFA 2FWPA 3MOSA 3ZHVA 4UAVA 2FPMA 4CUKA 5DSXA 4CQNA 1EZZA 2W4MA 4H7HA 3AVYA 3GLQA 1V8BA 3EXEB 1B16A 1HDEA 1E9RA 4QM7A 4OHPA 4D8TA 1TM7E 3B6JA 4GMGA 3TIVA 1F8FA 2QW0X 4DOMA 4D4HA 4ZODA 4D0SA 1N2IA 4EY3A 1QP8A 3INRA 3RSGA 3EG9B 1LU9A 1V5EA 4HQ6A 2G1PA 5J4LA 3WLSA 1A4XA 4E7OA 1BD4A 3PVSA 4JQSA 2J0QA 1I6WA 4JVLA 4ZRMA 4PNZA 3BHJA 1M0WA 4B5LA 1K5HA 3IPAA 3N2NA 2DUWA 1UINA 5F2EA 3GEPA 1AO3A 2WJPA 5CGZA 4YCDA 2FOLA 3AYXB 1J2UA 5ITZA 3BGIA 1QG6A 1JXQA 1S2GA 5H83A 2AN1A 1L4LA 3AEXA 4IFEA 5EXPA 5C80A 2W6MA 2RHDA 2H1RA 4GO1A 2Q4DA 3R7DA 5ER9A 1XQ6A 2DT5A 2JIBA 1YZHA 3C1OA 4JJ8A 3QJ5A 4WJZA 3S1AB 5KTYA 2EP8A 3MS2A 1SBNE 1W4LA 3T95A 3LO5A 4QDKA 1N8NA 1U11A 2YVQA 2OA0A 4N8DA 2GK3A 3RU2A 1EFLA 1W59A 3SN6A 3WHPA 2BEWA 3LBNA 5G3YA 5A03A 3LAWA 2GNAA 3OPXA 1OGYA 1S2MA 4TT3D 4XLZA 4ALLA 5IK2A 4ATNA 4DXHA 1ULAA 2JJ1A 3N76A 4GP7A 1FJ2A 2VIIA 1XMIA 1G98A 4MV8A 2VJDA 4WDRA 3Q87B 4EAQA 1YH3A 3A3OA 4RW0A 1E0JA 1XE3A 3KHKA 4Q1AA 2Q0SA 1I3KA 2BGUA 1W0JA 2G76A 4P5PA 4CLRB 5A6SA 3KQLA 1EKXA 2B8EA 4CEHA 4MV4A 4HY3A 4RSHA 3PEFA 4YPOA 4L95C 2YIJA 2PZEA 2WKWA 4JA0A 4B7XA 1HMPA 1TVCA 3HJRA 2PL3A 4LMAA 2UYQA 3OUZA 4EVSA 3IVXA 4RVCA 3H1GA 1VL6A 2CVHA 2JLXA 1KDTA 1PD0A 1T8SA 3OJWA 2OCAA 1U3UA 2C0CA 2OXEA 1LSSA 2DTXA 3AK4A 4JA2A 5HMLA 4E6EA 5KYNA 4D8UA 1YOBA 2AXPA 3VR2D 1BDHA 1YMVA 3G88A 1YZYA 3C97A 1T8PA 3ZU4A 1VPWA 1KHTA 5DCLA 2HNKA 4I3FA 3UM9A 2FRDC 4OYYA 5JAIA 2OE2A 3NHUA 3NHWA 4UCXA 1AHHA 1WOMA 5D6OA 2Q2QA 2YHSA 1Z0DA 3KOOA 3LUHA 4WOPA 2Q0QA 4B74A 2NV0A 2OUKA 3EQ7A 1XDUA 5HHTA 4WVLA 1RZRD 1JR6A 1S8AA 3ZDXB 3DCYA 4K88A 1I7DA 1HNXB 2W9XA 4DAEA 3ROGA 1Z5NA 3C5WP 3LUAA 3I58A 1R6TA 5CW1A 4HWOA 3IAM6 4C21A 5AVRA 3HWSA 5I7VA 2PLWA 5CG1A 3SY8A 1SKBA 4EGCB 2FPIA 2PEYA 5HEKA 4IUCS 2HOQA 2HJWA 1M74A 2ZIZA 3GVPA 4MGZR 5LZ4A 1UKEA 1XNGA 3AY0A 5EI5A 3SJBA 2WC1A 4EGFA 2QY6A 3UMYA 1H69A 2Z0MA 1UMDB 1BKSB 1M2VA 1ZITA 2H4ZA 3KXKA 2IGTA 5IH3A 1EK2A 1XVUA 2V6FA 4O2AF 1HEYA 4IDEA 4S04A 5ALNA 3PX2A 5FL7A 1VA4A 4MDFA 2QUIA 2C07A 1CUYA 2R0QC 2FUEA 3TO5A 4URYR 4H0CA 2HPZA 2WSLA 2XGSA 5I9MA 3I04M 3ZWMA 3SEAA 5DMHA 2IUSA 4XRGA 2NQTA 5BSTA 3MINA 2ZJ7A 3C3BA 3Q3EA 4FFPA 1E2NA 1SUSA 3NETA 3PE3A 1I36A 1OFGA 3FCSB 4KBGA 4WY2A 4AMZA 3L40A 2ZM5A 5E7QA 4YQYA 3K9FC 1D09A 3UMFA 4BY9E 2WSIA 3FSRA 1NQWA 3MJFA 3EOBI 1NGSA 4RHCA 3S2EA 3P9KA 2BPOA 2O06A 2ONZA 1RSZA 2NU7B 3F5FA 3EQZA 3FCYA 3B13B 3LDFA 4OHCA 3V55A 1DLJA 3SMQA 3IUSA 3QPUA 4JP2A 1VIDA 4B3IA 3HKEA 1V7QA 1TJPB 3E2PA 2B1IA 2ZT7A 3GRYA 5G02A 1H2XA 2BBTA 2FKAA 1VXOA 3DZGA 1DFHA 3L82B 3OTIA 4NS4A 4KREA 5FR2A 3NAMA 4TKLA 1N3BA 3IHWA 1WEKA 4B6PA 4D9KA 1VP9A 3SLRA 4BQRA 3OZCA 1MX5A 2VAMA 1Z0UA 3DLAA 1FYDA 4XTRA 2FMHA 1Z08A 2APJA 2YJ5A 5DGCA 3T9CA 3GLIE 4KLCA 4JP5A 3RBVA 4LQ4A 4M0PA 2BFBA 4M0UA 2XLBA 3A36A 1UK6A 5HIIA 2E5LB 2BGMA 5H80A 2G9VA 3KEGA 1PL0A 3HKBB 3OHSX 2YZKA 5TSDA 3OPVA 1YZFA 1E98A 1WU8A 1Z74A 4NATA 3DZCA 3N7TA 2AXQA 3DSRA 2CFIA 1IJEA 1ZMRA 2C2GA 4X60A 4B6OA 3ZJVA 1YDGA 2TMDA 1UP7A 3C6YA 3CNLA 4RVOA 1WOYA 1I3MA 4AN0A 1IG0A 1O77A 4MR8A 4P0QB 1SURA 4ENQA 5IM4F 1T5TA 1P2DA 1RPAA 1D7AA 3LLCA 2X8JB 1NKSA 4TTQA 3M2TA 3H3XA 3TKLA 2FG5A 5FUQA 5K6AA 3ZD7A 5AVKA 4TYNA 1FQOA 2P30A 4JHXA 3DLPX 5LDHA 1SUFA 2ZXFA 3KPWA 3RVNA 5DNDA 2QTAA 2ZI5A 4EITA 2QU8A 2EZTA 4BFTA 1QE0A 1SC6A 1SIWA 1U9IA 4JUBA 4D25A 1B26A 2VUHB 2W98A 5IF3A 4M60A 1KI6A 3FR7A 3RYHB 1V11A 2X1LA 2X0NA 1M5TA 1F8YA 4XIYA 3IOMA 3VO8A 1PJLA 3ZY2A 5CFRA 4EYEA 3HN6A 4NESA 1AQYA 4PZEA 3GP3A 2X76A 3TL3A 3D8RA 4Y0NA 1GUBA 4A0QA 4F86A 1B74A 3QKUA 4Q7JB 2X7JA 1AQNA 1DHRA 4KO4S 1YIOA 4NL4H 1B0AA 1BMDA 3MYYA 1U1FA 1UK8A 1U04A 4OHVA 5HCUA 1BHSA 3EIWA 5THXA 2KLHA 1AZWA 2GBCA 4I08A 4PXSA 2Z6VA 1WUJS 1XZAA 2FW6A 1SD1A 3PQCA 4Q6BA 3T15A 1PR6A 2WLSA 2LIPA 2PQ0A 2XEXA 4NBVA 5FORA 5G1NA 3WMWA 5F12A 3H5IA 3CG0A 3PDIA 1AKWA 2HCJB 2L69A 4JYAB 2UKDA 3U6BA 1T8TA 3LF1A 1N9GB 1WBDA 3QVUA 4PGMA 4J16A 5BRJA 2UUPA 3IUJA 5JTUA 2X4LA 4KO8A 4MUEA 2AN3A 3WDSA 3AY3A 1E6CA 4X41A 3EF0A 3ADBA 3MUFA 3K20A 4N39A 1RAIA 4MGHA 4DDHA 4DHWA 2VZLA 2GZMA 2DUNA 3IP6A 1KY5A 2B6NA 4PO8A 4QU0A 4BFUA 4F11A 1YFLA 1GNPA 1AK2A 4NZPA 3SE0A 2ZBDA 3VZPA 1XPRA 1HWYA 1QQ5A 2QLJA 3GLKA 1XXHB 1RHJA 1UL1X 4D9BA 4JQZA 1BEUB 1RWKA 1JVSA 4QBIA 3W6OA 3G6KA 3ZWYA 4F5ZA 1Z2NX 4FE3A 3TM4A 5AM4A 2OBNA 4WZBE 4QOJA 1NVVQ 1QCYA 2YWFA 1Z6XA 2J3LA 2OHXA 1PJAA 1VJCA 3DG9A 4PZZA 1V8ZA 3D6AA 4B9AA 3W06A 4LK3A 3A10A 4E7PA 5KKNB 4KGXA 2CLFB 4GGMX 5DSTA 4GSYA 2W93A 4IVNA 4TMZA 1QTNA 3PJRA 4AB1A 2WQ6A 1A4IA 2WUWE 1QHNA 2CLCX 3NT5A 2I3AA 1P0PA 1L4EA 1N25A 1ZNXA 2H2AA 4J1TA 2PT9A 1A8SA 2GKSA 2OWDA 5AOBA 3H2BA 3V8PA 5K8TA 1HLPA 3OCZA 4G25A 4GOOD 3O91A 5ELLA 3II6X 3OD1A 2X40A 2RHHA 4LEIA 2IS4A 3O8QA 3QKWA 1WP4A 2VYNA 2C0QA 3BDAA 4PZ9A 5TB5A 4FX2A 5IULC 2PXXA 3U61B 1IK6A 2DR0A 2R8ZA 3JQ6A 5JCJA 1DAHA 3E5NA 5ANRB 4R51A 3UCEA 1LC3A 2VRWA 2XHEA 1QJCA 1F2UA 4FSHA 2PUFA 2YFYA 1KJWA 2ZIGA 1FB5A 2P9EA 3OE7A 3E53A 3DCIA 3C3WA 3ZY6A 3HCDA 4C3ZA 5BORA 4RE5A 1FDUA 2IHTA 2PGNA 3JX9A 1KI2A 1C9MA 5JZMA 1VG1A 1NL3A 1Z68A 3SNKA 4ISBA 3KZMA 5FPPA 2QN6A 2QT0A 2ZI4A 5JCZA 3ZDCA 2J0SA 1CS0B 1JE0A 2HSGA 2YWRA 5EN4A 2WSBA 3L07A 2PPLA 4ZVRA 1Q7TA 1ZPDA 4FJ0A 3GAFA 1AHIA 3OIDA 2P90A 4X1KA 3KJGA 4XB1A 2IXEA 5A3RA 1RM0A 3HVIA 3DOHA 1UWVA 4D4KA 2EARA 2VPTA 4G5XA 1KP2A 5DGTA 5GADl 1X7YA 3PTLA 4WZAB 5H1YA 1B6RA 1L5QA 3AESA 3DC2A 3RLIA 3W2GA 1I4LD 1XAJA 3BK7A 2WV7A 2OM2A 1OD6A 1Q5PA 2QZSA 2NTNA 4N5DA 4BFYA 4Z49A 3KT3A 1LF0A 1NJ1A 1KDYA 3BTOA 1SHLA 4H6PA 4J49A 4YRZA 7ABPA 5LIRA 3QEAZ 4ZOEA 4Y2UA 2V65A 3K05A 2D7DA 1XAHA 4MKIA 4ZIRB 1HDOA 4YY3B 3UFXA 3VI4B 5KIAA 4BATA 2Y99A 2IXGA 2DWPA 1NT2A 3UJPA 3WLPA 4BLPA 3BXFA 1MB2A 4CBVA 2ZJBA 1JZSA 1JILA 2GASA 2VLBA 4BNXA 3ZV6A 1N6HA 2O6LA 3Q3IA 1L4GA 1W46A 1W5EA 221PA 3TX6A 2O2XA 4ILKA 4RGBA 1FUKA 1V5WA 5JYEA 4O8ZA 2OORA 3ONNA 3I5YA 1QGZA 1Q7RA 1TTHA 4X8OA 3IDZA 3M6LA 1TEVA 1Y98A 3PPVA 2PZAA 4TPKA 3OT5A 5BO5A 1V3TA 1KJIA 4HEHA 4PG6A 1X1BA 4B4DA 3VI3B 3R3UA 4BVHA 4N82A 3X1ZA 1G2PA 4ZMBA 1JDTA 2XSZD 4EO4A 5ICCA 2HR1A 4MVYA 3JYQA 1HLDA 3L6UA 2VDVE 3A9RA 4EO9A 3TTTA 1ONOA 2OMKA 2PVPA 3A04A 3K5HA 4LDJA 2ID8A 5ALXA 4A8TA 2XUZA 4YAUA 3ZDZB 3AM1A 1SOVA 2XMSA 4G0VA 2XDWA 3DQQA 1GG5A 2A9JA 1QH1A 1U28A 5IYZF 3Q5DA 3ZGNA 3MJTA 3WAGA 4DLAA 5BQOA 1QK4A 2JS7A 4BCDA 3A26A 5AOVA 3WGGA 3Q8XB 5AVXA 1GSHA 1T4MA 2DFLA 1CIVA 4LXXA 2V7UA 3IMGA 5A62A 4C1BA 3DBRA 3OETA 1F0YA 2Q3DA 4TS4A 1H4SA 4DARA 1E4YA 4ZZ3A 1JLSA 2JIZD 3DTNA 2WHQA 5G4LA 5C52B 3LPAA 1U8CB 1KPIA 3KOZA 2IUYA 2Q1SA 4GKJB 5KBYA 1NVUQ 4BNKA 4GVXA 3STWA 1U0JA 1UT6A 1QV7A 3L4EA 5KNDH 3DEYX 3VTFA 3WJ1A 5FCDA 4R8VA 1PG5A 4X6LA 4NOLA 3R3SA 1I4WA 2VHJA 1LC0A 1J5PA 1JG3A 4RJIA 4BX9A 1FC0A 4PR3A 4DCSA 2OZLB 5A7FA 1BA2A 2OCXA 4ARUA 1A9TA 2OBYA 4MUNA 5T4BA 1UAYA 4WK4B 3REFA 4A6PA 3T4XA 3ZXXA 5C81A 2CT8A 3RSFA 4LJAA 1Z2PX 4BDSA 3DXYA 2FWRA 2QNRA 3HCRA 5KOJB 4HWRA 4HDNA 3ZJ4A 4Q3NA 2VG8A 4EB0A 2Z9BA 3OMLA 4E4TA 3ZH2A 4MV6A 5B2EA 1E3DA 4EX6A 1DCTA 4K6KA 1II0A 1ONBA 4NH4A 3T99A 4JLNA 4L5IA 2VQ6A 3W3AH 5JCOC 4W5OA 1YJCA 4L8LA 3ES9A 3SHQA 2H7XA 2ZAGA 1S89A 5KYXB 2NO1A 2MR5A 1BTOA 4J16C 4DQVA 3A2KA 4F60A 2O7VA 5AKGA 2BCEA 2JHGA 3IP1A 3NVMB 2B2CA 3JQGB 1E79D 3E9NA 1P44A 3QX8A 4HWPA 1ETUA 5KYWB 2CVPA 2G5PA 3GY0A 1L0BA 1CNFA 4KDRA 2GF2A 3H4VA 3D4PA 3HR4A 2L42A 3TE7A 2CV2A 1A8UA 4FW9A 3EC2A 5D84A 3CFYA 3DP9A 5CDHA 2B2XA 1U99A 3AZOA 1DJQA 2J5RA 1VJTA 5LZ2A 5EE1A 1WW2A 2ZVQX 4J3FA 3ZGOA 2ZUVA 2FWIA 3DMGA 2HMUA 3B1XA 4WXHA 1W85A 4ZOCA 1A9PA 4D0GA 4ZYTA 1EWVA 1RWOA 4JJ7A 2HSWA 2FSSA 3AETB 1NXWA 3IHTA 4JN6B 3QM1A 3KO8A 2NNWB 4K87A 3UOAB 3W6UA 5AVZA 5C1BA 2B4KA 3T9DA 3OH8A 3T3OA 4CG3A 2BFNA 3COYA 3IX7A 4XVQA 3H05A 5BRNA 4AMVA 3D6JA 3EMDA 2JGNA 4UM5A 1XRPA 4OEHA 1OFVA 2EKLA 1M1NB 1MVLA 3FTPA 3RT9A 4HTFA 3LNTA 5ALVA 3FPEA 2XDQA 3TS1A 4ZZ1A 1GZ7A 5TLSA 4LYJA 4DZRA 1EG2A 1HL7A 2C03A 2O3SA 2XWPA 2QRVA 4RK1A 4TMYA 1Y4DE 4EHBA 4ER5A 1KH1A 4GU5A 4Q6WA 5HIJA 1PFWA 1O0CA 4YXFA 1BO6A 5DNYB 2AMLA 3NHKA 4MQ4A 5JJKA 1D6SA 5JS8A 2XR1A 3OTWA 2J9FA 3FN4A 3JD2A 2QTMA 3FMOB 3GD7A 3KUXA 1ZP6A 4G1UC 4HI0E 4QGAA 1YTLA 1YZKA 1VLHA 1OE0A 3G2JA 4PYIA 3LQ1A 3DFKA 2O23A 4PC1A 2OHHA 2IE0A 2DU8A 5DLDA 3PYXA 2D7CA 4H1TA 4CTJA 2YZ2A 3NRJA 4LBWA 3D2AA 5FRDA 5B7QA 4I50B 5HRCA 4DAOA 5AOCA 2Z2KA 3L7JA 4Q12A 4D4JA 1C7JA 4E5NA 2I4LA 4M7OA 4NY1A 2P91A 5C8YF 1AU9A 2CNLA 2W48A 5E1OA 3FVRA 2GZ2A 3JD0A 2Q7DA 1OBVA 1TKRA 4BVEA 2AVDA 3TGLA 1EG7A 2FRXA 5B58C 1KZ9A 3WSTA 2FZKA 1CUBA 4ZV7A 3RIGA 4PYMA 1Z7EA 1E8MA 3SM9A 1G3MA 3RWMB 5HFAA 3UWKA 1M9NA 1P62B 2XQIA 4NDAA 4IF6A 4IXMA 1WD5A 1NRWA 4O4JB 1GA4A 3WK4A 4CF6A 2ZTVA 1E32A 2CMKA 3DTVA 2NQ2C 1XL0A 4O2LA 1EZ1A 2FEWB 3CC8A 1JU3A 3HJGA 4CDNA 3ETNA 3RU9A 4XWKA 3O1IC 4JU8A 1TQDA 2PKQP 4DWOA 1CZRA 3RU3A 2BJHA 3AEYA 3VZRA 3RFCA 2PGDA 1M1ZA 3DV0A 3G23A 4XB6B 5A4AA 1CE8B 5A1JA 2QMQA 4NAUA 4PRLA 4C7VA 3A9TA 2ZVPX 2O0HA 3CLRD 4HLQB 4ANFA 2J7PA 4NQZA 5HKKD 1JH9A 3SI7A 5HPYB 2VI5A 3RC8A 2Y9PB 2XCTB 4MSUA 3EWIA 1HE8B 4F4UA 4NFYA 5C7IO 1SVUA 2X1HA 3QYFA 5EE0A 3VC2A 2RJ3A 2D00A 3UKDA 1P17A 2PKYX 3AX6A 2GTHA 3FFAA 4KBYA 4J0IA 4TTVA 2H2DA 3VR6H 4Q3KA 2EFEB 1M2OA 4NYIQ 1DQPA 4MZDA 3D81A 2C77A 3CN7A 1UMCA 3GNTA 4V24A 2B7BA 1KFJB 3V32A 4MZXA 4CF4A 4DMUB 2UU9B 1NHGA 5EJAA 4B3XA 2EERA 4RH1A 4ZC1A 1ZAYA 1L5HB 1RBMA 4A27A 3GEHA 1HFEL 4WXYB 1QOZA 3WLIA 3DLTA 2LCFA 3RSSA 5C8VA 3TUZC 2IW3A 4O4HA 1IY8A 2Y1WA 2ZTLA 3MMSA 1UEIA 1T9BA 4I6EA 4KU4A 3T4EA 4E0BA 4CQMA 1XQ9A 1QHFA 4L4YA 3C3PA 1VSVA 2WUFA 3H6KA 4IGFA 2GFIA 3E15A 2JD2A 2CXXA 3FH0A 4DJFC 3Q3CA 1QJ4A 4YP7A 3EDMA 4E09A 3R7FA 4WTOA 2BJWA 4UTNA 3P5BA 2P9ZA 3QLUC 2P2NA 2QYSA 1F5SA 1P1CA 3D6FA 3EIOA 4LJ5A 4YRPA 4ILEA 3MFYA 3STYA 2IBTA 3LPNA 2Y27A 3GGOA 4HGOA 2VAVA 4Y9DA 3DOFA 5CJPA 1NW7A 2NM0A 3BTSA 4NC9A 5LU8A 2DR3A 4IL5A 4MUJA 1P4SA 1UXJA 1MXHA 1RWWA 4GPIB 1NVEA 3K9NA 3N75A 4OB8A 2JCSA 4RABA 4FEYA 2Y93A 3U3RA 4EAAA 5MDHA 5DHSA 2CFOA 1ZFNA 1ZIOA 3OX4A 3TOVA 1JR3E 3CNNA 1Y5NA 4ALNA 1Y8RB 3LTNC 1YDFA 1PR9A 1GD1O 1D8TA 1YO6A 3H2SA 2IYLD 3JAWA 3I5MA 4L8YA 1CX9B 2WTMA 3E7WA 5C1IA 4BO0A 1L8QA 3LT4A 1FJHA 1V3UA 1KAOA 1Y63A 1Y8QA 4JLBA 2JFPA 2AN9A 8AT1A 5FJJA 1E9CA 3DDWA 4NU5A 4Y2RA 4AXBA 3EOAI 1WCWA 2WJ3A 1P3Y1 5SY6A 2C2BA 2H2HA 4QELA 5MHTA 1FCJA 4BZQA 4CL2A 1MNQA 3IT1A 3EGDA 3KJHA 2ONKA 3VJLA 5BQFA 2PX3A 1AF4A 3HUEA 4N4AA 2IXTA 2CKDA 3NHRA 1DWUA 1R64A 1T6ZA 1U6JA 2WQZA 4Y9SA 2PUTA 3TKAA 1TDJA 4DLSA 4XWYA 5CBKA 2GB4A 4CFYA 5JUWA 5LQKA 1Q1BA 4IQ4A 2HU7A 1WMSA 1C4OA 2C0PA 4TLCA 4RZUA 3FTDA 4WFJA 5A4JA 1ZW1A 2FPGB 4CV2A 4DPMA 1SKQA 2JAUA 5BWBA 4CEJB 1J0EA 3HR7A 1BKYA 3V3TA 4OBXA 4QJ4A 2P0YA 5EJ7A 3K70D 1L7RA 4YVFA 4WLOA 4B8WA 3EARA 4UMDA 4HZGA 3NAQA 2EKBA 4LHZA 1Z8FA 4XPZA 5FTLA 2IZ1A 1ZUD1 5A5VA 4AMBA 1QYIA 5B6PA 3O92A 5JANA