1D5CA

Crystal structure of plasmodium falciparum rab6 complexed with gdp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
b'KYKLVFLGEQAVGKTSIITRFMYDTFDNNYQSTIGIDFLSKTLYLDEGPVRLQLWDTAGQERFRSLIPSYIRDSAAAIVVYDITNRQSFENTTKWIQDILNERGKDVIIALVGNKTDLGDLRKVTYEEGMQKAQEYNTMFHETSAKAGHNIKVLFKKTASKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAB6 GTPASE
publication title Structure of the nucleotide-binding domain of Plasmodium falciparum rab6 in the GDP-bound form.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Endocytosis/exocytosis
total genus 47
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 1999-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1d5cA00
2W0SA 3AUXA 3FKQA 4CT4B 1F2TB 2IS6A 4LV8B 3O47A 2O8EB 3SQXA 1XDBA 4QGFA 2ORVA 1XRJA 1N25A 3B8HA 4H9GA 1QHXA 4BFUA 3CX7A 3Q5DA 4JSYA 1Q20A 4HEJA 4BZPA 1ZUNB 621PA 4L9SA 5G41A 4W9MC 1O3YA 1E9AA 1U2RA 1YZKA 4JVMA 4A15A 1DO0A 2IT1A 2RB4A 2J9RA 4GNKA 2V3CC 2I4IA 4XD7D 3X1ZA 1SVWA 2FG5A 4AYWA 1G5RA 4FXPA 3KQNA 3LY5A 1A82A 5FPHA 3CX8A 3U6KA 4XVRA 3KX2A 3AUYA 2WJYA 4NYMR 3CR7A 1MR3F 2AWNA 3L8YA 1ZCAA 1XCGB 3QG5A 2RGXA 2VP4A 2CNWD 2IEZA 2IWRA 4HB2A 3RC8A 5FOVA 4QC2A 4LPKA 2QM8A 1QVRA 3H1TA 3DHWC 5AJWA 3SC3A 4F4JA 4ZI3A 2DPXA 2QT1A 4LJAA 4BRWA 4CF7A 2O8BA 1R0WA 4NKRA 4GZLA 4PHGA 2ZJOA 4WZBE 3AKDA 3RS3A 3AVUA 2QP9X 4DLSA 4RFVA 3B6EA 4WOPA 5BWMA 1U8YA 2WM9B 4TMTA 4UQOA 4URVR 3O8CA 3GJ4A 4RSGA 4U02A 2IA5A 3A58B 2F3RA 2ZRAA 4LI0A 3CPJB 5FTKA 5KYKA 2QPTA 4Z51A 5L8VA 4JZKA 3N5CA 3KQHA 1KYIA 2J0UB 4JL6A 3K8YA 1DAMA 5DGXA 1CJTC 2AN9A 3CWZA 1OH7A 4LHYA 4RCZA 1GNPA 4QL3A 4B47A 3SHFA 3A1UA 1X8KA 1KSHA 1P9WA 4HLUC 3IO5A 1ZCBA 1UDWA 2OV2A 2F1HA 1PUIA 5BN3A 1L8QA 3QF4B 2PZGA 3R20A 1NMXA 1GRRA 4B33A 2O0KA 1JXOA 1QDEA 4TL6A 3VX4A 4Q1EA 3KDSE 1V43A 2YOFA 2O8CA 3SDZA 5C18A 4WZ6A 3H84A 5KDLA 2Z83A 2YHSA 3AB3A 3QKUA 2NG1A 1FTNA 4JLMA 3THYA 3CLVA 1ETUA 2DFTA 2ZIAA 4TN1A 1Y3AA 2WIAA 3WYAA 3BB3A 3U6BA 3FVQA 2ODNA 2A5FA 2J59A 1P9RA 4DXAA 1NSTA 1TEVA 3FYHA 4DBLC 1MO3A 3IIKA 1U98A 3FTQA 1KI4A 2JIZA 1HV8A 1VYVA 4JLKA 1YR8A 1Q3HA 2AXPA 1WF3A 3GLGE 3ZVLA 2PX0A 2FDCA 3PIRA 1H8EA 1N2CE 4L8GA 3REFA 1FQKA 1G3QA 4JLDA 1JPJA 1VG9B 2CNWA 2QG6A 3E70C 4HAVA 1Z8FA 2WWYA 4P31A 2ZANA 3K0AA 3K0FB 1ESNA 4M1SA 4OK3A 4OHWA 4Q4HA 3SQWA 1G8YA 2BMJA 1DAGA 1FX0B 3FB4A 4HAYA 3GJ6A 3IIMA 3R9WA 2J5XA 5EE9A 1XTKA 1T8UA 1SXJA 3LX8A 4NL4H 4ZKEA 3PUZA 1NN0A 3VNUA 4MYTA 2QROA 3FPAA 3PUYA 3QBTA 3L8ZA 5AUOB 3WYFA 1XZPA 5AUNB 3PUVA 5FPYA 3TK1A 3DOEA 1E2LA 3A37A 4CEJB 4N0EA 1F5NA 1NBMD 1ESMA 3PG5A 3KJHA 1YZGA 4ZIRA 1JXMA 3V9PA 1LF0A 3W8NA 4BFYA 4C0HA 4IXNA 1UBGA 1GM5A 4Q66C 3HDTA 1CR1A 2G77B 3CPHA 3K53A 3PR1A 4OQXA 3F5FA 4YMVA 4HDOB 4Z8YA 3WMEA 3MFYA 4HATA 4YC7A 3TBKA 4QHSA 2CLCX 421PA 1DVRA 3T06B 2VSFA 4LV6A 4XTRA 1KO1A 4MRPA 3AH8A 1N5IA 2OUKA 2W00A 1KMQA 1E0SA 5FBRB 1KI7A 1S1MA 2B8WA 4GOXA 3SJZA 2MSEB 5JI3E 3GLFA 1XXHE 3DMDA 4CT5A 2CL7X 1NMYA 5EXXA 3G0HA 1NL3A 1HYQA 3GP8A 3Q5EA 3WMFA 4QXAA 4BUJA 3RRZA 1OHHD 1JR3E 2GESA 2ZE6A 1NVXQ 3HWSA 4FMCB 1PLKA 1MO4A 2JLYA 1UPTA 4TL9A 1ZNXA 2IYYA 1NN3A 2GK6A 2NGRA 3CWQA 4QNRA 3I8XA 1IXRC 3CO5A 2VP2A 1KDRA 1CRQA 3KKOA 4JVLA 1JI0A 2A30A 4RJLA 3THXA 2CL0X 2DFNA 1TU3A 1L4YA 2A5DA 2C9OA 2G3YA 3D3QA 2BIFA 5CM8B 5IDVA 3B1VA 4IJMA 2GF0A 3QXSA 4GRAA 1W2HA 2DFKB 3OAAD 3WHLA 2H16A 5C4MA 1GL9B 1W36B 2JJ2D 1Z6TA 3V4RA 1E2QA 3B1YA 2QT0A 1KI6B 1ZUIA 3OF5A 1MRSA 2WJGA 4JKYA 3TUJC 3AP1A 2OAQ1 3EC1A 4A2QA 1W36C 3NG1A 2QU8A 4Q9HA 1XCMA 3EAQA 3QEJA 1DTSA 3ZH9B 4BE7B 3PVSA 1TEXA 1U90A 5JI2E 5FI1B 2GJ8A 2HCBA 4QOSA 4JBXA 2QTFA 5J4HA 2FEOA 2ZS8A 1G7RA 4YDSA 3U2QA 2PJZA 1CTQA 3U61B 2FE4A 3QSYA 1Z22A 1LY1A 2W6JA 3GEIA 3PFIA 2IYUA 1CU1A 1NRJB 1E94E 1S96A 1XEWY 2VP0A 3CONA 3LO5A 3Q9LA 4M1KA 2QGZA 1PJRA 4KITB 4XVQA 3ADCA 4C0BA 5EXSA 4US2R 2EWVA 3H86A 5EE5B 4XVUA 4WIAA 2IHBA 5EE1A 3U60B 3QJYA 3L0OA 1O87A 5B58C 2V55B 2WPDA 2ZJBA 4BECA 5BYKA 5KU1A 1Z0IA 2CBZA 2J41A 3WNBA 4C4PA 2JLZA 1W4RA 2IWHA 1CR4A 4HUQA 1Q44A 1OFTA 2F7SA 4XSGA 3MJHA 5EUQB 1E2PA 1Z6XA 4LDJA 2FSIA 1J7KA 4CEHB 2HUPA 4KJZA 2Q0HA 4AURA 1TAGA 2ODBA 4P33A 4DDVA 5E7IA 1N6LA 3RS5A 2AD1A 3AGQA 1Z6GA 1J8YF 3EZ9A 521PA 2J45A 2R9VA 2JDID 1W4AA 2LKCA 2WVJA 4TLDA 3VR4A 2PZFA 1KO7A 2PT5A 1NY6A 5FTJA 1RRGA 1D8TA 1N5JA 1E2GA 3U3OA 4TMZA 1P2SA 3BB1A 5FTNA 3BC1A 2V1UA 4AC9A 3BGWA 4LJ6A 4TLEA 4EPVA 1KMHB 1NN1A 3NDPA 5KOYA 1GKUB 1R0YA 3FGNA 1E1QA 3L82B 1HQYE 4IVQA 2X2FA 1PV4A 1RRFA 4E5UA 1OT3A 3OAAA 3KFVA 4B43A 5KSZA 1I2DA 2PEYA 1S9DA 3ZJYA 3IEUA 1E99A 2RGCA 4B34A 3T1TA 1Z28A 4YMTA 4F92B 4OYHA 3ICEA 1YZTA 5B57C 3U7GA 2MSCB 1U9IC 4NYIQ 2ERXA 1P3JA 1AA9A 3KKNA 1P73A 5E95A 4A6PA 4QGAA 1NKSA 2PMKA 4I4LA 2XEXA 3WBJA 3QG1A 3CZPA 1XJCA 2RHDA 3BE4A 4DSTA 2QZ4A 3GEEA 1AS3A 1TQDA 4BZQA 5DI3A 1N0UA 3AVOA 2H1LA 2ASEA 1QHGA 1M6NA 1QZXA 2ZRNA 4KBFA 4PO8A 3BH6A 1RW4A 3ICQB 5JZVA 2ZRPA 4LV5B 1GVNB 5HCNA 2XGJA 5LPNA 4D4MA 4PZZA 2FF7A 4DRZA 1XD2B 4A1FA 2X19A 1TNDA 4OI0A 5HKKA 4LZZA 4NYJR 4PSVA 4QBIA 4URUR 2WICA 1K5GA 2QEQA 3C7KA 3P4YA 1EFTA 4ASUA 1W44A 3UG6A 4M1TA 3IUYA 4NTZA 1II0A 3VU9A 3SOPA 4MRNA 3TLXA 5L3SA 2XZLA 2OCPA 1HQCA 4RVCA 1G8GA 1U81A 2CHVA 3SYNA 2ZRHA 4K46A 2AX4A 4PX9A 3AEZA 3SEAA 2GXAA 1T3LA 2R6AA 1DAFA 3BD9A 4LY6A 2DCUA 2GZAA 3A6PC 1M74A 1JR6A 2WWGA 2EYQA 3WP0A 4PC7A 4MYCA 5D3QA 4IDPA 1VHTA 1JPNA 2QY9A 2W2TA 3C4JA 1IN6A 2O5VA 3MSXA 1E9EA 2QSZA 2FNAA 3A4NA 3IKJA 1T0HB 2IXFA 3K9NA 4DLUA 1Z47A 1ZJ6A 3B78A 1D9ZA 3U3KA 3R9XA 5D3MB 3VR3A 4ZKDA 3U44A 4G5GA 4LHXA 3GPLA 4HZUB 2F43A 1VYUA 2V7QD 4FCWA 1TUEA 2VH5R 3QEOA 4OL0A 5F2EA 1II8B 3V00A 1JEEA 1R0ZA 4IRUB 4PAMA 2QAGB 1OSNA 4W5WA 1SVOA 4PXAA 3RVBA 3CPEA 2JAQA 3OIUA 4Z1MA 2C99A 2Q3HA 5JWRA 1HH4A 721PA 1XTSA 2BMDA 2CVHA 2LWIA 2RGDA 3DM9B 2G83A 2HJGA 1N0WA 2RAPA 4PC2A 5FL7D 1DO2A 2JATA 4PAQA 2VTKA 1ZINA 2GJAA 2DWQA 2QAGC 3FMPB 3Q7QA 1MRNA 4A9AA 3AP2A 3W34A 2MMGA 3FHCB 3VTKA 1SXJE 2G9NA 3O8RA 1KI2A 3BH0A 1TQ6A 1ZIOA 1WDTA 1ZP6A 2FPKA 1VCNA 4LBYA 4LPSA 4JJKA 3WNDA 2GDJA 2PEZA 1G8PA 5JFGA 4AY2A 1YR7A 1C4OA 2HJVA 4O2RA 5CITA 2AL7A 2ATXA 2ZI6A 4EPXA 4M1YA 1UJ2A 2B7BA 2H5EA 5CDFA 4C2UA 3S1AA 3EPHA 4B2LA 1KSJA 2ZI9A 4OHXA 1MOZA 2BWJA 3M0EA 3MGCA 2ZEJA 4FMDF 1E1RA 4BLPA 2GF9A 2Z4SA 4C0KA 3UWOA 4DSUA 4A8JA 1J99A 3LQRA 3CBQA 4WXRA 3T12A 1QHSA 3NVAA 4E07A 1NG9A 1W48A 2OFWA 1ZRHA 2DYKA 3AKCA 2P5SA 3REGA 1XMJA 4PPFA 1Z29A 2ZPTX 1S2MA 2BEKA 3LBHA 5HCIA 3P1JA 1X1RA 3TAHA 2XNDD 2IEYA 3GLFE 3SR0A 3AVQA 3K70B 4JS0A 4QKQA 1G41A 3B2EA 4XSHA 2NIPA 2WWIA 1GKYA 4LSGA 2FEMA 2DY1A 3B1ZA 1ZM4A 4EPRA 4RFSB 4G3XA 3EPKA 1AQYA 2QRNA 1KKLA 1AGRA 5LD2C 2N1BA 3K70C 4LBWA 2R44A 1E2JA 1E2IA 2IS2A 4V0KA 4A6XA 3EW9A 1BYUA 5ELXA 2VHJA 2G6BA 2YWGA 5CK5A 3NBYC 4DLYA 2ZYVX 1OV4A 4A36A 2FFAA 4JLAA 3WNCA 8OHMA 5AUPB 3IHWA 4HLDA 4B6EA 1ZNWA 4PQRA 5JBQA 3FHTA 2ODWA 2ZJAA 5KPDA 1Z63A 3FMFA 2C04A 1GITA 1KGDA 1RYHA 2WMNB 5SZHB 1Y63A 2OLKA 4M0LA 3UATA 2UZIR 3N2EA 2UKDA 3TSWA 4ARZA 1E9RA 1DPFA 4I81A 2KJQA 2RHMA 1E79D 4M22A 4PC1A 1ODFA 4V0MA 4QJ3A 1CXZA 4JYBA 4D26A 3KQUA 4C2TA 2QL6A 4OHZA 3PITA 4W5HA 2BKEA 1XPUA 4OK5A 3VR2A 2B7CA 4YDHB 3A8TA 1NVVQ 4IDQA 1HY3A 3CF2A 4MGKR 3VR1A 4KBGA 2W83A 1OIWA 4R2IA 2UVQA 2J0VA 2ZUDA 2P5TB 5AK0A 1E4VA 2OM2A 5FPTA 3K0EA 5DI9A 5KSYA 1BKDR 3WXMA 4DLRA 1KZGB 3HR8A 2XXAB 3BAFA 4DEXA 2REOA 3BFKA 3T1QA 4NCJA 2B92A 1HEIA 3IPYA 4PANA 4HUTA 4LYHA 5KSOA 2EVWX 1TQ4A 2IYVA 4BQSA 3AVYA 4NP6A 5DE3A 4C0JA 4BWYA 1G6HA 2XNDA 5HE8A 5HR5A 1XP8A 4DWJA 2GEVA 2VO1A 4B74A 2GCOA 3E5HA 1JAIA 4K8OA 1VPLA 1HE8B 4DB2A 4OI2A 4AD8A 2J0SA 4ZDWA 4M21A 2H17A 3SHWA 1H8HA 2WV9A 2NPFA 2C9CA 1AZTA 3CH4B 4BGDA 3AKEA 4DDWA 4Q5IA 3A1WA 2BC9A 2CE2X 1F60A 3EZ6A 4Q01A 3ZLJA 1WXQA 1U0JA 1QF9A 2ZI7A 4MITA 4TTPA 4PC6A 5CB6A 3T34A 1N6PA 1XEXB 4EJSB 221PA 3QBVA 2P6RA 2H57A 5P21A 4RZ2A 2PH1A 2ORIA 2Z43A 3LDAA 1N6NA 4NCKA 3W6NA 4B3BA 2PX3A 1IN4A 5KDDA 5L3VA 1GTVA 1BYIA 2JGNA 3QY0A 1HTWA 4JLNA 1XEFA 1N5LA 1G3IA 2OBNA 4EJSC 2VF7A 3OIVA 4KI0A 1Z3IX 3KZ1E 4D0NA 1BOFA 3EA5A 1WB9A 4P4SA 2NZ8A 1PLLA 3I3SR 4BLQA 2AR7A 1FQJA 1KDTA 1F48A 2ZS7A 4KHZA 1CBUA 1K5DA 1SVMA 4KODA 4Q47A 3WY9A 3KXIA 3VR6A 1H65A 3VNVA 1U8AA 1T91A 3BS4A 4D4LA 1XJQA 5EZ6B 2GVDC 2ZYWX 3GMTA 2G1JA 2DHRA 2J3EA 1P7CA 2CMKA 2YKGA 2CLSA 4A92A 2ONJA 3TSZA 4FW9A 1FNMA 3ADDA 3KJIA 3R9IA 4PO9A 2FFHA 1DELA 5CB8A 2D62A 2OCAA 2VEDA 5EQTA 2ZITA 1XU4A 4EPTA 3LW8A 2OCYC 2ZYTX 4KFRA 2ZRIA 2IHYA 3WYGA 2IUTA 2RCNA 3RS7A 4DSNA 5DLQC 1VG1A 1ZD1A 1X3SA 1IN5A 4X8HA 1UKYA 5DNYB 4HB0A 3L0IB 4ZDJA 4YMWA 1OFIA 4C9BA 2BHRA 2KB0A 1XCPA 1ZMXA 2EFDB 3KUCA 5SZIA 2WMOB 2F1RA 4CYMA 1OFUX 4Q21A 1M8PA 1OXTA 3GCGA 1N6HA 4B71A 4KFUA 4F93B 4D80A 2OXCA 5JSZB 1WRBA 1IONA 2JLSA 1KI3A 1XB2A 3L43A 1RJ9A 1N6IA 1X8LA 4M4SA 3QKSA 1KK0A 1U0LA 3CX6A 3LX5A 4V02A 3ASZA 4MUBA 3WP1B 3TQFA 3QXCA 5FI0B 1UF9A 3HPRA 3TUZC 1CR0A 4R2HA 2K5UA 2OAP1 1AS2A 4JJZA 2WJHA 3FMIA 1BMFD 1TPZA 2OEPA 1Q57A 2ZUBA 2P0EA 5CM9C 1VKJA 2R62A 2HT1A 3QF7A 3RWOA 5EP4A 5TB5A 1XX6A 1QG2A 2P6NA 4KCGA 2ZUCA 1NF3A 3OIYA 4DLXA 1DBSA 1QHNA 2V6IA 2F1IA 4ZDIA 5K8UA 1HT2E 3TQCA 4NYIR 5DYIA 2GJSA 1KIMA 2OZEA 1E2MA 2YNMA 5CDFE 2VHQA 2OE2A 2ZS9A 1SVIA 3DO6A 1TX4B 2F9LA 1J2JA 5KPJA 3G5UA 4DCSA 1YRAA 2B6HA 5SZJA 1XTQA 4LGMA 4CEIA 3TW4A 3QPUA 3JZMA 1VYTA 3BIFA 3RRYA 3A4MA 3CM0A 2BVNA 4QJ4A 3GLIE 5H8WA 1Z6AA 5CIQA 5FBVB 2C95A 4GBMA 4PHTA 3NC1C 3DKPA 3GJ3A 1NMZA 2OBMA 2WJJA 3KXLA 1DOAA 2C8VA 4IDHA 4LJ8A 4Q4JA 3RS4A 3W6OA 4PPNA 4K81B 5JWOA 4XD7A 3X2SA 1E0AA 3A1VA 4AKEA 1I2MA 3X1WA 3DDCA 1FP7A 1MABA 4JYCA 3E2IA 3NXSA 4QHTA 4DCUA 1G7CA 4AWXA 1KAOA 2G0TA 2AD5A 2FA9A 2P67A 2GBLA 2C78A 3D7MA 3GLHA 4QG7A 3WMGA 4R71A 3THWA 2YZ2A 2ZSBA 3UMFA 1Z07A 4J0QA 4QBHA 2C03A 3PQCA 2JLWA 1US8B 4A0GA 4N1AA 1AS0A 3H2YA 3SI7A 3R7WA 1X6VA 2FSGA 1S3GA 2VPPA 2QMUA 4GZMA 4LBVA 3G82C 4DKXA 3W5JA 5E4FA 2ZJYA 3TJZA 3BBPA 2XTNA 5J5CA 3T61A 4GL2A 2J87A 4Q7KA 2FX3A 4JLBA 3HU1A 4PR0A 5L3QB 4X8OA 1VCIA 3LXRA 3V4FA 3BERA 4EDHA 3CRRA 1G8HA 1ZM3A 2QI9C 3RS2A 3NEYA 5E7JA 1BMFA 2QQ0A 2VP6A 3ADKA 1RE0A 4RD1A 4HZIA 2OFXA 2A78A 4V0ME 1AIPA 1M2OB 4B48A 3TSOA 3KJGA 3QPVA 4PO1A 4GFDA 4HSEA 2O52A 4KFSA 1KK1A 1ONBA 3N2IA 4LYFA 4FN5A 4M8NE 3EX7C 3ZIAD 4QGGA 3GJ5A 4KSCA 2OG2A 5A4JA 2IYTA 2VA8A 2E9SA 3D31A 4URXR 3VMFA 3AQ4A 1ZNYA 1A4RA 2G1KA 2KBEA 2N46A 1FMJA 4NDZA 5KUTA 4L15A 4NCHA 4NE2A 2PLFA 2MMCA 3KXKA 4DUGD 1KHTA 1F2UA 2VIIA 3CKLA 1YHNA 4OBEA 3JVUA 4A2WA 1UEJA 1QHHA 2GCNA 1F3OA 2F1JA 3L0PA 4JIMA 3ADBA 1W1WA 3ZQ6A 1KY2A 1GL6A 3OEHD 3K09A 2A5GA 3BXZA 4Q4AA 5B2ZA 1KAGA 3CRVA 1B0UA 1NNEA 2AKAB 1JJVA 3KTAA 1CP2A 3K0CC 3QXHA 4ZV4A 2VF8A 2GEDA 3GFTA 5BXQC 2J1LA 1P61B 4C30A 1G20E 4IXMA 2IC5A 3ETLA 3EZ2A 4EQ6B 2RGNC 1VTKA 4ACAA 4AI6A 5AJZA 5CK4A 2F3TA 4RZXA 2NO7A 2YWHA 2CHQA 1X8JA 4WA7A 1E9CA 2JASA 3MLEA 2BBSA 2JJ1D 2PCJA 3MD0A 1KI9A 1E0JA 1XF9A 1W4BA 2BEJA 4IOJA 1SGWA 1KKMA 2FWRA 2XNSA 2R8RA 3GD7A 4G5SA 1KNXA 2CXXA 2IYXA 4HAXA 4TSFD 2IYSA 2O8EA 5FOSA 2GWHA 2NQ2C 4KSBA 5LBIA 4C0AC 1R10A 3DL0A 4OQLA 2RGAA 1SQ5A 4QBFA 2GXSA 1V5WA 4KVGA 3C14C 4R9UC 1G7SA 1BS1A 2IK8A 5KSPA 1BO6A 1W0JD 1GUAA 3NEJA 5M04A 1ZIPA 4JT4A 4AKHA 3P4XA 4PSAA 1J8MF 2WSMA 2WWXA 4DIDA 2SHKA 4ZCMA 5JEDA 4B35A 1IY1A 2IF2A 4TYWA 2ZREA 4KLZA 1IN8A 3ND9A 4LK2A 4TMXA 2ZROA 3TVTA 1P2UA 3MG9A 4JL5A 2O8FB 5IHPA 1R6BX 2RGGA 1AKYA 3GFOA 2QBYB 1NBMA 1UM8A 4TWZA 3EG5A 3QPWA 5G40A 4DHEA 3QVUA 3ZIAA 3AP3A 4O2LA 2GILA 1E32A 2Q3FA 1KZ7B 2QTVB 3KKMA 3AVXA 4NH0A 2WWFA 3SYLA 3SJBA 1KO5A 1P4SA 4R98A 1NY5A 3MUFA 5HZKA 1PUJA 3OE7D 3GLGB 2BJVA 3I8SA 4G5QA 3W8RA 2OCBA 4DIEA 5FBQB 2ERYA 2H92A 3OEHA 3A1TA 5EZ5A 2BM1A 2ZI3A 1Q22A 2LKDA 5DISB 2ZXUA 1OHHA 2J0UA 4HLUA 1R8SA 2NOAA 4D0GA 1MH1A 4POAA 4XTCS 3SJCA 5IRCD 2V1XA 3UXMA 2AFIE 2XTMA 4ZCLA 3GQBA 5FTLA 2IYQA 4TQAA 1VECA 1CJVC 4DCVA 2Q6TA 2CDNA 2D3WA 2HDNB 4DCNA 4TL8A 2CK3D 5FTMA 3MJRA 2JJ1A 3TW8B 3X1XA 4II7A 3QF4A 5JRJA 2JJ2A 2NPIA 2YWEA 1Z83A 1JB1A 1P2TA 1II9A 3NHBA 4PSKA 2Y8EA 4TSFA 5F3WB 4HB4A 2PCLA 3QKRB 1CR2A 2FV8A 1QRAA 3QVVA 3CNLA 4I99A 2F9MA 1PVOA 1XMSA 2ZM5A 3UKDA 4H1UA 2P65A 5J4VA 2ZE7A 1C9KA 1KJWA 1ZAKA 1TMKA 3ZGXA 1W0JA 2REXB 2Q9CA 3EA0A 1OE0A 2Z0MA 4DT1A 4MDFA 3ZVRA 4B3DA 5TARA 1GDDA 2ZETA 4LOAA 4C7OB 4EUNA 3IQWA 4FMCF 3RC3A 1NI3A 1XXHB 2GHIA 1U94A 2A5YB 2R65A 4BLTA 1LS6A 1RC8A 4NMMA 3ZS9A 3NTUA 4MRSA 5B64A 2D7CA 3F0TA 1AZSC 4D6PA 1W36D 2NMVA 1M7GA 2ZE8A 4URYR 4HLQB 3K0FA 1Z2CA 3UG7A 3RAPR 1FPMA 1QBKC 4UJ3A 2IXGA 4Q48A 3KQKA 2GJ9A 3RRNA 4FINA 1MV5A 2J7PD 3T1VA 1P62B 2NO6A 3FWYA 3LBNA 3PCRB 5JRZA 2GCOB 2AXNA 2FMXA 2OT3B 1KI1A 2V4ZA 5EXPA 2GCPA 2IXEA 2ZQ5A 3RYTC 4DLVA 3PV0A 2IS4A 3IEVA 4ERNA 1ZBDA 3TIFA 1Q0UA 1WE2A 4NCIA 2QNRA 2FSFA 1GIAA 4U00A 1SVSA 1KOFA 1GILA 2EW1A 4BFXA 4XWOA 3CRMA 4DB4A 4MGYR 3TGPA 2JDIA 1CEEA 2KBFA 121PA 3WRYC 4JVSB 4ZI2A 1QVAA 4CEJA 2IYZA 3DZDA 2EQBA 1K6MA 2VQSA 4PQFA 3B5JA 3T1OA 3I5XA 5DHAA 3MMPA 4ESVA 4JLJA 3P26A 4B3FX 1GL7A 2HF9A 4D2IA 4JVNA 4ITRC 2JLXA 1TF2A 5TDHA 1AN0A 1T6NA 5FUWA 5DHFA 4DLTA 1Q12A 5H1YA 4IHQA 2O8DB 2FGKA 1XNJA 1W49A 1W5TA 1W2GA 1Q1EA 4DEYA 5CLQA 4ZPXA 1ZM7A 4MRVA 3R8CA 4A4DA 2XZOA 3GLHE 2VL7A 1CJKC 2WJIA 2FFBA 2FPMA 2AK3A 2YYZA 2D2FA 1M34E 2YJTD 2QPAA 2HXSA 2BMFA 3KKQA 1E2NA 1P9NA 2QTHA 5AJYA 2LCFA 2PJRA 2EYUA 3TVDA 2FGJA 1NIPA 4YONB 2Z4RA 3IILA 4M1WA 4Z8XA 1SHZA 2BMEA 4EIWA 2GAOA 1R5BA 4RCYA 2FSHA 2FJUA 1NN5A 5EJEA 3NBZC 3A1SA 2C5LA 1XEWX 4Q1FA 1UFQA 3DOFA 1OKKD 4Q03A 1IN7A 2Q9AA 3EWSA 4ZO4A 4FCTA 1DG3A 2QMHA 5GVSA 5FUVA 3RS0A 3I4LA 3QXJA 1KI6A 2YOHA 3PEWA 1G17A 5EP2A 4G5OA 2BM0A 4Q7LA 2GVZC 3GLIA 5BW8A 2J7PA 4NCNA 2I1QA 1NVUQ 4TL7A 3LBIA 1XBTA 1NLYA 4UNRA 4MQBA 2W2VA 4Q1CA 1CS4C 4UNQA 1QHIA 2ZAOA 1QHYA 4KV9A 4AK9A 2ZSEA 1P6XA 5G3YA 3BFXA 4LJYA 1XFAA 2CE7A 1G19A 4BZXA 2X1VA 4IOLA 3L2OB 5K8IA 4UXJA 1L4UA 3TMKA 1WMSA 1E0KA 2C96A 1WP9A 2BOVA 4KFTA 3TE6A 1D2MA 3B85A 4IEEA 4M9SA 1DAHA 1YU9A 1IBRA 2JEOA 4TTRA 5G3ZA 4XWAA 1ZD9A 4XOIA 2O8BB 1JR3D 4QNMA 1VIAA 2ORWA 3LVQE 2RGEA 1YJ5A 4M9XA 5AUQA 4QM6A 5TVKA 1OJLA 1XMVA 4DLZA 1A5TA 3OZXA 2V7QA 2WAYA 4JT2A 2PZEA 3DZ8A 4LCBA 2A2ZA 3ZZTA 1OYYA 1SKYE 4BLOA 3U3RA 1EFRD 4EPYA 3CR8A 3UIEA 2RGBA 2A9KA 1N6KA 2ONKA 2ZU0C 1NLFA 4CEHA 1OW3B 3UMSA 1LF5A 5EP1A 1T3SA 4D4JA 5FL7A 5KO2A 1E98A 1N6RA 2QSYA 2V8OA 4D25A 4YQFA 5J47A 3VHLB 4XH9B 1HA3A 2X8AA 1ZU4A 4D0LB 4D4KA 4LJ5A 4TYPA 3U7FB 2XJ9A 3NBFA 3FHOA 1OB5A 4UXIA 4BFWA 3VKWA 2FZ4A 3PXGA 5DO9A 5FUYA 2O8CB 1YZLA 2RKOA 2ZVPX 1KMHA 1W47A 3QXXA 3EC2A 1OKKA 1ZC3A 2A7QA 3SS8A 3IPXA 2YC2C 3THYB 5FOUA 1SVLA 1U9IA 2FU5C 2WBLC 1NBME 2GA8A 2ZSAA 3RNLA 4A2PA 3LVRE 5JECA 3CW2A 1HT1E 2HF8A 3K9LA 4RZ3A 3SBEA 1CRPA 2XZPA 3ZQJA 1ANKA 4A0FA 1LW7A 4M1OA 4R7ZA 1CULC 1ZUHA 4MYHA 2VSXA 2CCGA 1P60A 2QN6A 1KJYA 2AKYA 3EWAA 5IT5A 4AG5A 4URWR 3CUEF 4JL8A 1R5OA 3LD9A 2ZYUX 4OJQA 3GJXC 5CLLA 5CYPA 4YMSA 1EG7A 1EK0A 2JLRA 1RFLA 1AQUA 5BYJA 1X86B 3MWJA 4RD0A 3AF2A 4OQNA 1E2EA 2ATVA 3K0AB 1EGAA 1D6JA 2PL3A 4MA4A 4Q4HB 3NH9A 2WIBA 1OIXA 2ANBA 2BDTA 1P75A 3KUDA 4TLBA 4CRWB 3R7WB 4JBYA 1E4YA 5KNCA 4TYYA 2I3BA 1G3RA 1XD2A 1OH5A 4I1SA 5FBLB 2CVFA 5CIWA 1KSFX 3U7EB 1I4TD 1SXJB 1RPZA 1JQLB 4BFVA 1IHUA 3W5IA 4A0HA 3JVVA 1EFUA 2HXYA 1UAAA 1YQTA 4M9QA 3O8DA 4Q9IA 3VR5A 1OB2A 2ZRCA 3KB2A 1SXJC 2A3RA 2WWHA 1E2HA 3C41J 2VHCA 4V0LA 5EXTA 2BBOA 2X77A 2ZRKA 3SJAA 4X8MA 2Q21A 2GTPA 3TR5A 2ZI5A 3K70D 2VHUA 2WZQA 1R8QA 4ZIRB 4QM7A 1E79A 1MT0A 4LHZA 2FFQA 4JMPA 5JS8A 1G1MA 2H8KA 1R0XA 2ZRMA 2MSDB 1XZQA 3ZDQA 2CCKA 2G88A 2ZR9A 1OH8A 4LYJA 3UANA 1FZQA 2BBWA 5D3MA 1QHHB 5AJXA 3LH5A 2GZDA 4LUCA 1J90A 1JALA 1Z0AA 5DIFA 4HZUA 1L2TA 2YV5A 4NYJQ 1OIVA 4QGHA 3MAAC 3GLFB 5CJPA 2HCJB 1K8RA 4HAWA 1GNRA 3KB1A 3AVPA 3P32A 4FI3C 3AF3A 3DEFA 2QAGA 4Q4LA 1XJ0A 3SBDA 4B6FA 3EIHA 3ZD7A 4FWTA 5JWHA 6Q21A 5BN4A 3OFND 1TTTA 4O25A 3GFPA 5EE3A 5TXGA 2RH5A 2ZJ2A 4GDFA 1LFDB 2GJKA 1UKEA 3THXB 4PFSA 1KK2A 3I5YA 2EFGA 5KNBA 1C1YA 1LNZA 2F55A 2WOOA 1XTIA 3HYTA 1PZNA 4LX0A 4P4TA 2ECKA 4GOKA 4G5RA 1OYWA 1NIJA 1E9DA 5FOXA 4U7DA 3BORA 1G8FA 4TMVA 2WJVA 4LC0A 4C0SA 1MKYA 3NH6A 1GP2A 3L0SA 4OKSA 1M7BA 4YXWD 2ZJ5A 2NZJA 1UBFA 1BH2A 2Z6VA 2ZRDA 1FP6A 2WWWA 2YVUA 3KJEA 4KYIB 4KYUA 1E2KA 2F6RA 4M53A 5AWFC 5UKDA 4OK6A 1T9HA 4Q00A 2IF0A 1N0VC 5JMTA 5CYOA 4XJXA 5DSZA 1AKEA 3AF0A 1W4CA 2JIZD 4UNSA 2XX3A 3SFZA 1S9HA 1AM4D 2NTYC 1WQ1R 1DEKA 1TF7A 1D2NA 4TTQA 1SZPA 1M1YE 1H8ED 2GETA 3HYRA 1XD8A 1ZVQA 3PUXA 3RHFA 3AM1A 4AIIA 2E87A 3LLUA 4A0RA 4Q7MB 1KO4A 4LRWA 1EFHA 1RVDA 3KQLA 1G4UR 4TMKA 4URZR 2EFHB 2JA1A 3CF6R 4IVPA 4KVAA 4RFSA 4LJ9A 5J4YA 4JBWA 1R7RA 5DN6D 4AYTA 3QKTA 1RRPA 4HYYA 2ZAMA 4BASA 4TQUS 1YR6A 1L7VC 4HUQB 1DARA 1GFIA 4MKIA 3F3YA 1SXJD 3PEUA 4B32A 3AVTA 1P2VA 4US1R 4OI1A 2W58A 3WHKA 2YC4C 4B3CA 4BFSA 4TZ0A 3EARA 2CL6X 5FFMA 5BN5A 2QQEA 2ZRBA 4NZYA 3EPJA 1YZQA 1A2KC 1VIYA 1S1CA 4E03A 1OFHA 2X2EA 1IXZA 3IBYA 1KI8A 4LBZA 1KSGA 4E22A 3IHLA 3TAUA 3OFNA 3I72A 2PMDA 5FL3A 1NJGA 1IQPA 4GPTA 5K8LA 1FUKA 4IOMA 3ZYCA 1G64A 2WAXA 3RRMA 1E9SA 1KTVA 3RLFA 3U7HB 3R8FA 2WTUA 3C5CA 4RD4A 4L9WA 4W5JA 4MKGA 2XB2A 1LTQA 2WOJA 3A4LA 2IYRA 4IEIA 4YXWA 1EX7A 2P3SA 5J40A 3MWLA 5FUXA 4TMWA 4WVFA 4F4IA 3U4QA 4NONA 2PT7A 3Q7PA 1OXXK 2XB4A 4MUAA 1XTRA 3PEVA 3EASA 5F98A 3QQ5A 5JLJA 4Q1BA 5B30A 4DT1B 1Z08A 2XXAA 4MYUA 3WBKA 2DWPA 5C46F 1OXSC 4LJ7A 5DI3B 1UKVY 3PEYA 1IY2A 1W46A 3IGFA 4WXPA 5IK2D 3NHAA 4V0NA 4UNNA 3SE0A 1KY3A 5CJ2A 3ASYA 2OILA 5KDOA 1IY0A 1XPOA 3D6TB 3A36A 3ZS8A 4Y0AA 1Z2AA 1GRNA 2D74A 4LHWA 4BLRA 2QPOA 2W6ID 2E1RA 1EWRA 4HI0E 5TV2A 3AVWA 5C1BA 3K9HA 1X1SA 5EUMA 2L0XA 2ZJ8A 4GSYA 3GJ8A 4D81A 5DN6A 4MGZR 3BB4A 3U3JA 4PPGA 1PLJA 3VU9B 5L3SB 1JEDA 1G16A 1J70A 3QI2A 4IFBA 4RKFA 3NDBB 3LA6A 3NIBA 4JSTA 4OI4A 5HTKA 2BV3A 3RWMB 3X1YA 4EPWA 2B21A 4PZLA 3RDPA 4BFTA 4I1UA 1LVGA 5FOTA 4F4CA 4IDNA 1CLUA 1DAKA 3BK7A 4WW0A 3UK6A 4DVGA 3MWKA 2GNOA 3QIAA 4TZ6A 2GKSA 2W6JD 1XEXA 2XJ4A 3EIQA 1YZUA 4ON9A 4DJTA 4EJSA 3QNUA 3ZVMA 3OEED 4HLCA 1N5KA 2HLDD 2P2LA 2ZSFA 3HJNA 5ANRB 2ZI4A 1IJEA 3M1IA 4Q9JA 2WKPA 4XWKA 4KLNA 2WSSD 3AGPA 1UBEA 2GZHA 2FPLA 4V0OA 1OXUA 2EU8A 2D4HA 1R5NA 2C2HA 4G01B 4B3XA 3DM5A 3C16C 4NPHA 3FFAA 2OESA 3U44B 1G291 2BCGY 3LAWA 5FBWB 4OHVA 2F43B 1WA5A 1Z5ZA 5FR2A 1AGPA 1DADA 1R2QA 2WPDD 4EAQA 1B23P 2OBLA 4DCTA 2QAJA 2IX3A 1Z06A 4TLAA 1W0KD 2DR3A 4MH0R 2FH5B 3B82A 3LFUA 2DB3A 1NG1A 4Q18A 1S0UA 2KE5A 1ELOA 3I73A 2CJWA 3ZZ0A 1Q3TA 1N3BA 2O0JA 3N70A 1VG0B 4KXFB 4ESHA 4MDEA 2QE7D 1ZD8A 2D2EA 1Q1BA 4M9ZA 2TMKA 1F2TA 1YZNA 1WBBA 2P6UA 3E1SA 1Q21A 2V9PA 2JLQA 3MCAA 1GAJA 4IVRA 1FOEB 1KK3A 1YR9A 3WRXC 4FIDA 4PZYA 2IS1A 3VQTA 1W7AA 1VDZA 2H7VA 1JNYA 4MRRA 2VBCA 5IK2A 4RD2A 1DG1G 1LB1B 3AVVA 1WBDA 4ZDKA 3HR7A 5E3HA 1E1QD 2HV8A 2UZ3A 1P72A 5AR1A 4MKHA 1TADA 4HB3A 3S1AB 5H70A 2W6IA 4TYNA 3DMNA 2GAAA 3Q8XB 2HYIC 1Z6YA 1AJEA 4D82A 1JAHA 5F9FA 4XIGS 4A8JB 3ONWA 4JLPA 1G9XA 1UDXA 3GLIB 3H4MA 2IBMA 3U5ZB 2AK2A 4B3GA 1E9BA 4M2LA 2GK7A 1D9XA 1SKQA 3IBGA 3OESA 5L3RA 3VKHA 3B60A 4QBGB 1G21E 2OXRA 4A8JC 3T5DA 5JSZA 1HURA 1TF5A 4N3NA 4IDOA 4DUGA 1I4DD 2HYDA 1RZ3A 1SHKA 2DFLA 3Q72A 1E3MA 3OEEA 2HLDA 5JJIA 1NJFA 5FH9A 1TU4A 1Q1ZA 1YRBA 2EWWA 3AF1A 5H68A 1YKSA 3J81k 2WSSA 4WBSA 3LXXA 1U99A 5GJCA 2GEUA 1TQ2A 1U8ZA 1QG4A 1T8TA 4B75A 5AJVB 5DYGA 4PQYA 1NVVR 5HKKD 3SNHA 5J4LA 3P20A 2C9YA 3W90A 5TMPA 4C0QC 1RRCA 3FKSD 3SYKA 1E6CA 4ASUD 1E69A 2HEIA 4YMUA 4CW7A 1M7HA 4LYAA 1W0KA 3AV0B 4NYMQ 2AFHE 5JS7A 4V03A 2R6GA 2ZRJA 1SVKA 5K8TA 2IYLD 4LJ4A 4ARZB 2REBA 4X8LA 1A7JA 4GOJA 4EKDA 3ZVNA 2XOKD 4HDQB 4Y0VA 2QE7A 5G53C 5DH9A 1TUIA 3HP1A 1NP6A 4P4UA 3I62A 2GRJA 2H18A 3IDQA 4PC3A 5C4GB 4TQ9A 1G5TA 4BPBA 1EX6A 1G5PA 2QA5A 4IW3B 2VP9A 3B1WA 4QJ5A 2FN4A 4B44A 3IIJA 2EFCB 2NO0A 4FMDB 4HDCA 1GKIA 3UMRA 3B1XA 5JCZA 2GXQA 4L4UA 1IXSB 4KU4A 3M4YA 5KHOC 2R6CA 4DLWA 1T5IA 4YLGA 4CDGA 4Q02A 4Z1MD 4N0DA 1G3MA 3RSOA 3T5GA 5EE0A 1JECA 1A2BA 3LV8A 3P27A 5JCPA 2VSOA 4HAUA 3FDIA 1UEIA 4BEBA 1RKBA 2XTZA 2NO9A 4MKFA 4IKEA 3B9PA 3I32A 1Z0DA 3CRQA 4KO8A 3VX3A 1EWQA 3IQXA 5HPYB 2IUUA 4F7WA 3ECCA 1US8A 1VCMA 4RKEA 5JJLA 3W3AA 1GNQA 1FX0A 3W6PA 3OE7A 3K1JA 3VAAA 3C5HA 4KAXA 4ABYA 3CIOA 3T15A 2VRWA 2CHGA 2XAUA 3M6AA 2QMOA 1COWD 3UPUA 4QFMA 5L3QA 2VLIA 1FW6A 1E1RD 4CIDA 1R4AA 3VFDA 1A1VA 4P3YA 1UBCA 1Z0JA 5KNDA 1JQJC 3FKSA 4TT3D 3FFBA 4Q9LA 5GJVC 1IAQA 2O0HA 4PHFA 1G4AE 2QORA 2VYFA 1NVWQ 5C2JB 3CNOA 4OQFA 4G1UC 1I4LD 4AKGA 5J4KA 3MRSA 4EFNA 1ZNZA 1KNQA 5EP3A 3QOFA 1T0JB 2CK3A 4DSOA 2D06A 3RSLA 5HE9A 3I1FA 1MO5A 2XOKA 2J0QA 5LDDC 1XWIA 1HE1C 2BCJQ 4A82A 4B2PA 3LW7A 2ODEA 1EFCA 3K0CA 1IJFA 2KI5A 4Q7JB 4EFMA 4P4SB 1CJMA 3ZZUA 2CCJA 4B73A 1FFHA 2Q9BA 1EXMA 2RGNA 3W3ZB 2W0MA 4CVNA 4GMDA 2VP5A 1KDOA 3VKGA 4QRHA 3T35A 3B9QA 2QGNA 2V54A 3O8BA 1GOTA 1KDPA 1DAIA 2AHOA 3TKLA 2ZSDA 4EQ6A 2YWFA 2JLUA 5FOWA 3PJRA 4S2EA 1KO8A 1VCOA 3HU2A 4NHOA 1N6OA 1MO6A 1VG8A 5FPSA 2HT6A 1OLOA 1CIPA 2W2XA 2ZJZA 3BRWD 1E96A 4GI7A 4P0TA 3U3MA 2KWIA 3SU8A 2IYWA 1LV7A 1ZC4A 4LHVA 1EESA 1GZSA 3LQQA 1GRQA 4Q1DA 3X1DA 3KKPA 821PA 4RY2A 1VHLA 4B2IA 2ZVQX 2ZRLA 2C98A 2XSZD 2XITA 2ZR7A 4QHYA 5LB2A 1Q1QA 4UJ5A 1ZM2A 2GXUA 4ACBA 5GVRA 3RANA 4I1OA 5FR1A 1U0HC 4AG6A 3EXAA 1OPXA 3OIWA 3SN6A 1UADA 3EPLA 2EFEB 2V6JA 4DC9A 1XPRA 2KSQA 3KL4A 1XTJA 3PUWA 1AK2A 4BFZA 4UKDA 3QE0A 2YOGA 4O0MA 2AWOA 3C15C 3EZFA 1COWA 3QUSA 4NU0A 2A5JA 3MWYW 5E7MA 2O8FA 1DE0A 1RIFA 3HPQA 4JLVA 2ZRGA 4TT3A 2DBYA 3VHXA 2OFOA 2QBYA 2JLVA 1G3UA 5TY0A 4W7SA 1NSFA 3BFVA 4ILEA 3GEHA 4Z54A 1RJ9B 3CB4A 2FOLA 4HAZA 3QKSB 2J46A 3CZQA 3BJIC 1E2FA 4OQMA 1XD9A 5LD2B 4OJKA 3TR0A 5JHHB 4JLOA 1TL7C 4PTLA 4FMBB 3DKVA 1CF4A 1NKTA 3GLGA 1ZU5A 2JCSA 4MGIR 2NO1A 2WKRA 3LWNA 3BOSA 2OHFA 3BWDD 3GJ7A 4L16A 4BRUA 5KTYA 3OHMA 3HU3A 1H8HD 3CF0A 1YE8A 4FWIB 3IO3A 2PBRA 4C3ZA 4B76A 4BEJA 4CGZA 3QENA 3THOA 5HZHA 2BBTA 2ZE5A 1LS1A 2OSBA 3I61A 1S8FA 2Z5FA 4DZZA 4C0LA 3PENA 4IFEA 1BIFA 1DAEA 5F9HA 2BKUA 4Q1AA 4GP6A 4BLSA 1Z0FA 2ZR0A 1D2EA 2R2AA 4RD3A 5JHGB 1UKZA 4TLCA 2R6DA 4CEIB 1SULA 1W5SA 2G0NA 4UXHA 3TH5A 2WHXA 3KFXA 5GJBA 2XSZA 3NKVA 4FD2A 3QKRA 3FE2A 1G18A 2CLDX 4GMXA 5GJWC 4ZCIA 3SFVA 4Q4JB 2PLRA 4WZAE 1DS6A 2QENA 3GJ0A 1P5ZB 4PPQA 2DWOA 1MABB 4I1VA 4CZ2A 3LRPA 3U4QB 4C7OA 3BH7A 4E09A 1GG2A 4TYQA 4L5BA 2QRZA 3AKYA 3FOZA 5GADl 3Q85A 5BQ5A 1XXHA 3GLHB 3TRFA 4DDTA 1WCV1 2QUZA 3THWB 3C8UA 1CJUC 2Q3MA 1KJZA 3H0KA 4G0NA 3K9GA 1D5CA 4GP7A 4LC1A 5A0FA 1JR3A 1G7TA 4NBSA 1IM2A 2QP4A 3RABA 1OF1A 1NLZA 1FUUA 2GBLC 1G6OA 2J7KA 2OO7A 1YVDA 2VHTA 5JEEA 1E2DA 2JJ8A 2QP3A 3I92A 1FTSA 1E9FA 3LLMA 4GT1A 3ND8A 4OHYA 1ZW6A 2CEAA 5LB4A 4FCVA 3K0SA 1EFRA 2IW3A 4S35A 1JJ7A 3NWJA 1FMLA 2RMKA 3DVLA 1FNNA 2C77A 3UWKA 1Z0KA 3AF4A 2QM7A 1S4QA 1RYFA 3TNFA 2ANCA 3TUIC 1T3HA 3F8TA 4H1VA 5A5GA 4F91B 3ZD6A 4Q9KA 4M1MA 4UNPA 3B13B 1FL9A 3LNCA 1HUQA 1XMIA 1F2UB 1GWNA 2ZRFA 3B7GA 1ZM9A 2IUSA 3EZ7A 1CKEA 3Q3JB 4AYXA 4RZUA 4RD6A 3NC0C 2ZU6A 3CH5A 5JJKA 4P32A 1S3SA 4AKIA 3CRW1 1T5LA 1GSIA 3DPUA 2N42A 2QMEA 1II8A 4Q4AB 2O8DA 3W9YA 3KTAB 2D7DA 3FMOB 2YINC 3JZAA 3EIEA 2ZTSA 4Q19A 1IOZA 3D8BA 4LWZA 2WKQA 2FZLA 2IL1A 4DDUA 4F38A 2I1VB 1OXVA 3K09C 4IOKA 4US0R 2B8TA 2R6FA 5IF9A 3CNNA 1JBKA 1F6BA 4JKIA 5SZKB 3SZRA 4WAUA 1ZYUA 4O3MA 2BJWA 5FPKA 1T4GA 2CJWB 1OH6A 1SKYB 4EFLA 3NBXX 4U5XA 1VMAA 4PAOA 4PHHA 2OLJA
chains in the Genus database with same CATH superfamily
1F2TB 2IS6A 4NDAA 4RVOA 4LV8B 5F33A 1Z7EA 4PSDA 3UJPA 2O8EB 5JATA 3L77A 4CLXA 1RWQA 5ICEA 3RPEA 3IE0A 3B8HA 1Z38A 4X20B 3HI6A 1D2RA 2ATCA 3Q5DA 4JSYA 1MC4A 1YJAA 3A0RB 1PFKA 1Z88A 3IALA 1L4BA 3SICE 3ZK8A 4BZPA 2O1EA 4YV2A 1UZAA 4KOAA 1QPBA 5G41A 4W9MC 1O3YA 3F49S 3C3YA 2F8SA 3G2HA 4JVMA 2J33A 3TTTA 4MROA 5CB4A 1G0NA 3SDSA 5FAKA 1IC6A 2G1PA 2RB4A 2ZLBA 4DYHA 3HA5A 3MCWA 1QPGA 4GPAA 4XD7D 3KEOA 1SVWA 1OFVA 4LQCA 4RJJA 2OWEA 4FXPA 2WNIA 1W2WB 3O4VA 5FPHA 3WDKA 3CX8A 1T2FA 4AP6A 4K6OA 1BQ3A 3R0IA 4XVRA 2DHCA 2WJYA 1DWQA 1ZI8A 3CR7A 1ITZA 3EYWA 1MR3F 1L4HA 1Q1GA 1KFBB 3QG5A 4ZYXA 2F90A 2RGXA 2VP4A 3F74A 4X3CA 4KAFA 2NAPA 4BFLA 1AQ6A 3TDMA 5LIPA 4JQCA 4QC2A 2G72A 3QWAA 2SCUA 1QVRA 5BWLA 1J49A 3KSDO 2FQWA 1CUEA 1G1AA 3GIWA 3QJGA 5EC8A 2DPXA 3SZ3A 4EB6A 1WVMA 3Q40A 5BR4A 1R0WA 4PHGA 2A35A 4GZLA 5EMHA 2VJPA 1U6KA 3A3KA 4CQMA 5CU7A 2BYTA 4X9XA 3JWIA 4KQMA 1XU7A 3H2BA 2WM9B 4UQOA 4URVR 3VO8A 3A58B 2YWXA 5KYKA 4RZQA 1H9BA 1OASA 1VP3A 4BVLA 4JC8A 3SFTA 1KXJA 2C58A 4BX9A 4U7FA 4C88A 3AOEC 2AB0A 1Y8AA 3EPPA 4HH1A 1Y4DE 1DAMA 3JQGB 1XZGA 1X70A 2QRGA 3AM4A 1JDSA 2AN9A 1N57A 5CR9A 5REQB 4DADA 1TM2A 5C53B 3CWZA 1H1LB 1SCUA 4LHYA 4OHRA 2Q4TA 1ORIA 5LNK6 1OH7A 3D7NA 3BJEA 1ECBA 1Z34A 3GQBB 4R8VA 5K4GA 2JGJA 3N53A 3A1UA 4S12A 1PEYA 5AJTA 1F0NA 5ALXA 2C20A 3DXZA 2R4UA 2Q6KA 4I3GA 4U1RA 4IWXA 2F1HA 2IU4A 3RYCB 1JHYA 3LYHA 4DRYA 4RVSA 5ELMA 1HF3A 2YJGA 3K2QA 1TT5B 3WRWA 2YXBA 1LBSA 1XZHA 1KETA 3PNPA 3R20A 4DQ0A 2YHIB 1SO8A 4HKTA 3CLRD 3VX4A 3HB0A 1QZUA 3T99A 3V9AA 3PLAE 4DA0A 4CKZA 4BHTA 2Z83A 3DNPA 3EY4A 1AG9A 2HRBA 2YHSA 3AB3A 2NG1A 3M4XA 3QKUA 4K9PA 1YU6A 1FTNA 4CM4A 2J5BA 3O8OB 2ZIAA 3AJRA 5L51A 1Y3AA 2RBGA 1LK7A 1KORA 4GI5A 2N75A 3WYAA 4Q4CA 3RIXA 1JB9A 2ODNA 1KZYC 2A5FA 3NOXA 5K6AA 5IS2A 5JT1A 3KFLA 1NJ5A 1GT91 1QOQB 2ZYHA 3KQMA 4WMLA 2BL4A 4I9HA 5C5DA 4JDUA 4EY8A 3DLAA 4ZK6A 3CN9A 3GLQA 4B46A 2JIZA 2RIPA 1HV8A 4JLKA 2WDZA 3O2QB 1IHYA 4UHFA 4ETMA 1HORA 3PIRA 4YI3A 2HMTA 5JYEA 4HGYA 2HDHA 4AJEA 3FTFA 3REFA 1FQKA 1CPYA 4JLDA 2BFFB 4U5QA 3PFKA 2QG6A 4RSMA 1DZIA 2WWYA 2UZ1B 3ANNA 4IDEA 5ALYA 2NXCA 1QTIA 5KOHA 1RAEA 4P4GA 2FPGA 5CA1B 3SQMA 3DZHA 1QANA 4OK3A 1NZJA 1L5QA 3SQWA 4X0EA 1Y1KE 5EJMA 4M6WA 5G0VA 3NHSA 2DBVO 3IIMA 2RH8A 1SXJA 1R16A 1KIFA 4I3FA 2ZXEA 2DR2A 1J22A 4WBXC 1Z4QA 3R6GA 1T2CA 2B78A 2R7NA 5ITZA 3VNUA 1A8IA 2VAVA 1ZZGA 1PJQA 3ZH2A 4RA6B 1ID1A 1QMPA 4YV1A 5I8WA 3PSHA 3QBTA 4U63A 2OO5A 4FGJA 4MB6A 3WLNA 1IPHA 2NACA 3WYFA 4FZJA 4IP0A 4KK4A 3AF6A 1WMAA 2A1UB 1LQUA 2JFQA 3JQEA 3PUVA 1LLCA 3TK1A 4YQZA 1RR6A 3EG9B 1FDTA 4ZAFA 1YZGA 2VZ9A 3R7FA 1JEJA 4Q6BA 3TXAA 3UJAA 1UODA 3V9PA 2JFZA 2C4HA 1QNFA 3BE6A 4QOEA 1QOZA 5AKHA 3ZCTA 4WKPA 4B8ZA 1CR1A 3BSSA 2G77B 2P2CA 3RTEA 3PUHA 3F5FA 4YMVA 3RSQA 2GEJA 1E7YA 3W2EA 1O9HA 2IP2A 3MFYA 2E7ZA 3WMEA 2AMJA 2OHVA 4ZYLA 4B3MB 1KARA 4G41A 2IHVA 5ECGC 3MQFA 3FLAA 3UBMA 1N5IA 2PBFA 3P5BA 1XGKA 4R8KA 1I0ZA 2B8WA 3A2LA 3GLFA 2AQKA 1XXHE 4J2TA 5LYJA 3DMDA 1RAHA 4EJSA 3ZJTA 4TZTA 4PLPA 2XQIA 3V6MA 2ZK7A 4B6JA 3GP8A 3UFXB 1UC4B 1AUQA 3I76A 2X3UA 3D8TA 3FSJX 1V48A 2IEAA 3U9TA 1DUIA 1PJBA 1SA0B 1YMQA 2QTRA 2ZUWA 4FMCB 3ZBTA 4PVDA 3C1OA 3CLTD 2JLYA 3VR4D 5TX7A 1ZNXA 2IYYA 1NN3A 5BNWA 2QRHA 4UTPA 3I8XA 5CLJA 5ISMA 2Q8PA 2J31A 3KKOA 1JI0A 2VPYA 3KSUA 2NMVA 1D4FA 1TU3A 4IRXA 6REQB 4IQGA 5LB2A 2H0QA 5CM8B 1H93A 1U0BB 2XIJA 4IJWA 3PHIA 3B1VA 4YGYA 5IAJA 5IDVA 1HK7A 1X1TA 4GLFA 1RKQA 3IEKA 2BKAA 2QMQA 3DQZA 1T43A 4M55A 3C87A 1H9AA 2HI0A 1FBTA 2I7VA 4UM8B 2AJ8A 3WHLA 1ZRSA 2JJ2D 1Y8CA 1Z6TA 1WTCA 4AT1A 3I3OA 3B1YA 2XPCA 4MJLA 4ISCA 4WNIA 3OF5A 1RPNA 3OZCA 1F20A 4J0IA 2OAQ1 4A2QA 3OTGA 3GUYA 5IM5A 3DVSX 3F8WA 4C21A 2XB6A 1JHPA 2W4MA 1EUYA 5GZ6A 3A31A 4QXQA 3NG1A 1WW3A 5EIWA 3A6FA 1XCMA 1DNPA 2ZKLA 1DTSA 4Q9HA 5KWEA 2J30A 3F9IA 3PVSA 5AW6A 4UTVA 2GJ8A 2HCBA 4KUGA 4UTZA 1ZD2P 4JBXA 4KWIA 3VPBA 1OI2A 1NVGA 2FEOA 2ZS8A 1G7RA 4YDSA 4DIKA 4KZKA 3GVCA 2G82A 1CTQA 2QRVB 2AYXA 3RCBA 1KMCA 1UMCB 3QSYA 3PZBA 2XNKA 3GEIA 3P71T 2JRCA 1EX9A 4ZJPA 3KTOA 1Z3CA 3I8OA 4LXHA 4QYXA 1RQ7A 4W82A 2IHZA 4XVQA 4YCJA 4C0BA 4R2JA 5I6DA 5EXSA 4HQRA 4LAFA 4US2R 2EWVA 4FSDA 4E5PA 1A9RA 3FYUC 5EE5B 4WIAA 3T9DA 3BEDA 3E84A 4W5RA 2V9CA 3L0OA 4Y7CA 1YRQA 1IK6A 1DGQA 1W52X 1O87A 4LDRA 3DEAA 1SCDA 2V55B 2W8BA 4BECA 2C4NA 1Z0IA 2CBZA 2E18A 2X5XA 3KYJB 3HKCA 5AP9A 2JLZA 4KE7A 4EKNB 3EJWA 3F96A 4FN4A 1HLPA 2D1SA 4HN4B 1IBSA 1NF8A 4GEGA 1L1EA 3OP4A 4GKAA 2GD6A 4ED9A 2G4LA 3KG2A 1UFKA 2JGFA 2Q0HA 1TAGA 1NUSA 1T1EA 3U49A 1T36A 2VAWA 2DLCX 1FTYA 1G8JA 3KR9A 4HYEA 4P92A 4Y2RA 2R9VA 2QLBA 3EUFA 2AV6A 3R40A 5D7BA 1PYDA 3GZNB 3TQQA 1W4AA 3VR4A 5ALFA 2JK1A 3RFFA 1KO7A 1O5IA 3ZWPA 1SCAA 3SDBA 4QTXA 5CH3A 1RRGA 2DAPA 1UJCA 1D8TA 3U3OA 4BX0A 3B70A 2Q4RA 4NY1A 4AC9A 4CLDA 1LKZA 1IVYA 1THZA 2NZXA 5EKDA 1L5GB 3RE1A 1FJ2A 1KMHB 1Y6JA 3AYXB 1Y37A 3DMTC 5E4TA 3QVXA 2GO1A 3UUGA 3L82B 3WVNA 4IVQA 5K8CA 4J0EA 3MIIA 1A8UA 2PEYA 3KPYA 4MKZA 2H1CA 4DV7B 2PL9A 3OOSA 3KLMX 5F1OA 2Z8XA 3WYEA 3T1TA 2WJPA 1A9ZA 3C7AA 3H2IA 2XGSA 4JUDX 4JMLA 3REQA 2C2YA 2CMDA 3V2GA 2VJAA 3IAM6 4GPIB 1YZTA 4CR8A 4R9SA 1U9IC 2ERXA 4L3WA 5G2OA 1WQ4A 1AA9A 2ZBRA 3IP7A 3GFGA 4AUKA 4EMTA 5E95A 1BX0A 4QGAA 4AUMA 1NKSA 1ONNA 4N4AA 4Y2UA 3C6KA 1QSGA 2LRHA 2A33A 5EJAA 1C9NA 4R2LA 3LVFO 1QO0D 1L8XA 1ZXLA 4ZALA 2FFJA 1VJ0A 3FBTA 3AVOA 4RU1A 2W93A 1QZXA 3OKAA 3HCWA 1N5OX 5EL0A 3W5AA 4KAJA 2BDUA 2WAAA 5DLEA 1RW4A 1KYWA 5JZVA 2I7DA 4EJ6A 1YJ8A 3ZV7A 4D9IA 2XGJA 1IPFA 3MJDA 1KFKB 4IIDA 4M89A 2MSWA 1XAGA 1DBWA 1YIOA 3VGJA 4BC1A 2E4AA 1DIRA 5EHGA 4RL6A 5CDHA 1XD2B 4A1FA 4DLLA 4EGQA 4YJ2F 4TMYA 4Z0TA 2GNAA 2AOUA 1K7EB 1Q1AA 2P2NA 3ORSA 4NYJR 5HKKA 1K5GA 1QP7A 2GARA 2V3VA 1JU3A 3A10A 4GLJA 1XMOB 1JZTA 2IVFA 4R3NA 1W44A 3OJOA 4NTZA 2PKCA 4NBWA 1F14A 5L3SA 3TLXA 3I2HA 4OFXA 1IDOA 1U1CA 1YRLA 1HMYA 2XZLA 4RVCA 1G8GA 4MWGA 2WT8A 5ADWA 4K46A 1Z7GA 5CA0B 3KQPA 2HK7A 2WVAA 1BRMA 3IFSA 3QLJA 2RI1A 2HBRA 4JDPA 2GZAA 2HADA 1AHHA 4UM5A 1M74A 1R88A 1JR6A 2EYQA 4MAAA 3RV4A 1EE2A 2HNBA 1IBLB 1VHTA 1JPNA 1M6EX 3C4JA 2PNFA 3FOAA 3CZAA 3DE4X 3EXHC 3MSXA 3EEYA 4CG2A 5KYUA 1UWCA 2NADA 4FYWA 3SKXA 2EW2A 3UUFA 2XMSA 5TS2A 3K9NA 4CT0A 1CUVA 1KY4A 1Z47A 4ZOLA 4KSYA 4CV2A 2DXIA 1G66A 4F46A 1ZJ6A 1JMKC 3ZHXA 4EWLA 5IJ0A 4JYAB 3GN1A 3D3EA 1JL3A 5D3MB 5EWJA 5TMDA 3MMZA 1U02A 3CLSC 2DPGA 2XKAA 4G5GA 3ZV6A 3IEIA 4HZUB 3C3CA 2YMPA 1PYGA 2F43A 2ECQA 3JR7A 4FCWA 2Q2OA 5FFNA 1JBEA 3ADPA 3QEOA 5F2EA 3V00A 2AN5A 1JEEA 4CM1A 1Z5NA 1DBVO 4RANA 5HM8A 3PFFA 1XA4A 2JAQA 3OA2A 4Z1MA 4U8HA 1VFPA 1HH4A 3HCPA 2BMDA 2CVHA 2LWIA 3AB8A 3H18A 4CIVA 1N0WA 4PC2A 5AJHA 1X7WA 1VBNA 2FW1A 2VTKA 4WLOA 1SR8A 2GJAA 4A9AA 3FMPB 4S1OA 2O50A 1Y98A 4P2GA 5AKEA 1WHSB 3O83A 2BGIA 5FQNA 3U4CA 4LF7B 3F9RA 3B1KA 4Y2TA 5CH5A 1I9GA 1NJ1A 1QUEA 1SXJE 2HMYB 2WHPB 3L7OA 4D6YA 2H52A 3CLUD 1F8YA 1ZIOA 1WDTA 3TFQA 1VCNA 1CFJA 2C2KA 3ESDA 4QYWA 4R7GA 5AXCA 2YZ7A 3HB9A 4B6RA 3CUSA 2PEZA 4YRPA 3CGGA 2QRKA 2CXSA 2HAEA 2JJMA 4Z9FA 2FWIA 3TS1A 1YR7A 2X58A 5D1NA 4Y2QA 1C4OA 5HQ3B 1P0IA 2NXWA 2O7QA 4ATNA 4ZVNA 1YNSA 1KBQA 2V7XA 3VKVA 1N1EA 1UDCA 2GZ2A 4GH5A 4WLUA 3S1AA 4E7OA 2ZI9A 1MOZA 2BWJA 4FMDF 1XRQA 4BJ6A 1N7JA 3EEOA 4KN5A 4LY0A 1LK0A 4DARA 1A4IA 2GF9A 4C0KA 3H4TA 3VDNB 3WDLA 5H9WA 2H2AA 1J99A 2PKRA 3ZLBA 3CBQA 4WXRA 1PFVA 1JPVA 2PSSA 1QHSA 3O92A 4NPCA 4R6WA 1ULTA 3Q8WA 3O3OB 1W48A 5LOVF 2RG7A 5GM1A 2JBAB 4J0KA 1NR5A 4MUGA 2WD7B 1YFJA 1Z29A 2ZPTX 2HLHA 3C3AA 1KHHA 1K98A 3LBHA 4FFWA 2UDPA 3K9CA 4OBWA 4Y6SA 2VG8A 1OU4A 1QKKA 3P1JA 3QPDA 4IDCA 1X1RA 5CCDA 2XNDD 3TTWA 1CJBA 2Y76A 3GLFE 2JD0A 4XAQA 1SWWA 1V4VA 3I0NA 4QKQA 1F9EA 2YS6A 4KXLA 2OBFA 4XSHA 4C5BA 4PN3A 2H7YA 5HUJA 2FEMA 3R8XA 2Y1EA 1BEUB 2WTEA 3O74A 4M0EA 2IH5A 4ZODA 4PZAA 2SCUB 5G1OA 3D1LA 3DAHA 1AQYA 3EXFA 3SR3A 1KKLA 2XKBA 3LPLA 5KNCD 2FUEA 4PTZA 1T5HX 4I55A 4V0KA 4A6XA 1Z8DA 1B0ZA 3EW9A 3PQDA 1VPWA 1RWXA 2C0QA 4O4HF 5ELXA 1HLFA 2YWGA 1L5ZA 1MNAA 4U3JA 4DLYA 5DIZA 4UHCA 3N2ZB 3EVNA 4YR7A 5AUPB 1Q7RA 4L7VA 3E3MA 1WAMA 2DKNA 1VKZA 2Z57A 3O3CA 4B6EA 4V1CI 5JBQA 3FHTA 1DC3A 4BQIA 4B81A 3HKEB 3G5LA 4MJXA 1TJ3A 2PWYA 4HWGA 1EGMB 1PWXA 2YFHA 2ZJAA 2YYAA 4U2BA 7YASA 2C04A 5KU7A 1EUCA 1RYHA 4LCEA 1Y63A 1SPBS 4M0LA 1XTBA 4ARZA 2RG1A 2WLTA 4KOEC 4RTSA 3WL7A 1E9RA 2NZVG 1UIMA 3ZK7A 1CY4A 3OEYA 3ON5A 1QDUA 4DNXA 3R44A 3PE4A 4X1YA 1ZJWA 4HJRA 4M22A 1QHEA 4AFNA 7ABPA 5KTNA 4LNAA 1A69A 3I9OA 3DAFA 1EXVA 3TG8A 3V8MA 1QZ3A 2F1KA 2L17A 1KS2A 1XDGA 3E9DA 4JZYA 4OHZA 2XUHA 2FB9A 1NDHA 2GYYA 2DUUA 4CF3A 3FFXA 2XRMA 3A8TA 4K05A 3H6GA 4IDQA 3VR1A 4CHGA 1IG0A 3A0UA 3Q7RA 4JUIA 1SD5A 2W83A 3KPJA 4V2UA 3KR0A 2UVQA 1RACA 2W2LD 1NR1A 1I7LA 2J3MA 1IOVA 1TM3E 1W88B 4X61A 2YV2A 4IIFA 1GTMA 1QCZA 4I6EA 4DLRA 3HR8A 3G6WA 2Y93A 1HDOA 4RXMA 2JK0A 4DEXA 2REOA 1EP9A 3ZR4B 5B3LA 3BFKA 1I7DA 5I7RA 1TCVA 4DS3A 3PB3A 2C5AA 3IPYA 3N0WA 5L7YA 1M1ZA 2EVWX 1OLUB 5DRYA 3W4KA 2WABA 3VJRA 2D5BA 3GNLA 1AE1A 5FOQA 1YVRA 4L57A 4BWYA 1G20A 5BYAA 1G6HA 5B1DA 4D4MA 2XNDA 5HE8A 3DL7A 4EELA 4F60A 5IMBA 1E2BA 1C50A 4DWOA 5I4IA 3VDQA 2FZVA 4FOPA 3AQIA 3IB3A 3LL7A 3OJXA 1ZG3A 3Q3VA 1HXHA 3BA6A 3EF3A 2EIHA 3Q10A 4N3CA 4BB0A 1QFXA 5D01A 4YDQA 2CV1A 2O2XA 1V25A 1BD4A 1U3FA 1RP1A 3H6KA 2WF6A 4O1MA 3RFVA 3S5JA 1JFSA 1DUVG 4MR7B 1Y0BA 4OI2A 2IZZA 3JAKB 4A16A 4ZDWA 4M6WB 1WHTB 2IXTA 2MCFA 1D1QA 9ABPA 4ZJYA 2REQB 4OXIA 2C9CA 5KVAA 3H05A 4U9IS 4BCDA 3CH4B 3M9LA 4QXOA 2O57A 3KPUA 4ESOA 5TQ0B 4ENUA 1AX9A 2JKVA 3A1WA 3A6LA 3IIEA 4YBZA 3ZLJA 2VYCA 5G1PA 5ITZB 1U0JA 2EERA 2XA9A 3LDUA 3DB1A 2VVTA 5F2OA 5MF6A 1Q0SA 2Z2ZA 4LRSB 4PBRA 221PA 2H57A 2ZGVA 3LDAA 1PK8A 1OZGA 2PX3A 1K4MA 3DDSA 4A8TA 4ZC8A 4DM4A 1UXOA 2JGNA 1W6RA 3QY0A 2YWBA 1JR4A 2OZVA 1GUYA 1PR5A 4MS3A 2Y68A 3DJYA 5WRFA 1G3IA 1HDZA 3SQLA 3PDHA 1Z3IX 1UDRA 5KWJA 1LCIA 3ZXIA 3T7TA 4K9LA 2YV4A 4LEIA 5NLLA 5EHQA 4BVKA 1Q2UA 3P2IA 4NFYA 1Q77A 2CN1A 3TWOA 1RXCA 2AR7A 1DFIA 1FQJA 1PWZA 4RY8A 4IH1A 3D7KA 2OZLB 4OFWA 1CBUA 2FN3A 3KOYA 1K5DA 2GKGA 4TM8A 4DMRA 1SJ9A 5BWCA 3AFNA 3KXIA 1ADBA 4KR7A 1KVRA 1WUIS 1T0BA 2QRQA 2E82A 1T26A 1U8AA 1BTOA 2W2LA 1C41A 5KCZA 2UYOA 2W43A 5GONF 4DG5A 4F45A 2CT8A 1FFBA 3GMTA 3HGMA 3N2LA 3TSCA 4E70A 2JHFA 3RYIA 4JKOA 4XPIA 2FW9A 1GNSA 1UT8A 3DEYX 5F78A 3S27A 5DNWA 4OGKA 4YJHA 4DZRA 3QV1A 5SICE 3R9IA 4OX9B 4QPZA 2JB9A 4CKEB 1YTUA 3O4RA 5CB8A 3WIEA 3ZHRA 2ZITA 4O02B 3PLRA 4NJEA 1IB0A 4TRJA 3IULA 2JIOA 5GM2A 2BI4A 2ZRIA 4TMFA 3X3HA 3RS7A 4DSNA 2XYVA 4PZDA 1QB7A 1X3SA 1RHKA 2OWDA 2H2HA 3DUFA 3NQ41 5DNYB 5CX1A 4ZDJA 2V7WA 2B2XA 4B09A 1ADYA 5CXXA 2HD4A 3B3QA 3LKDA 2MT9A 4NJOA 4AF7A 3ABZA 1F17A 1GGNA 3NETA 1O9GA 4ZVLA 4BRZA 4EYOA 4U7GA 4AY5A 4CYMA 1DX6A 1KQOA 4C07A 4Q21A 3HVHA 1DOZA 3F6RA 4PHCA 1NJ2A 1LLUA 4HBZA 2OXCA 1ID8A 3DUWA 4WOKA 4KIJA 2D5IA 1KI3A 2A58A 3L43A 1U1GA 1GR0A 2BEVB 4OM8A 3JQFC 4XGQA 2VRCD 4JXJA 1Q0HA 2G5CA 2XF8A 2WJZB 1XRMA 1K7XB 1YBMA 3BVPA 2OQRA 3HPRA 3HRIA 4IWNA 3K6SB 3LYAA 1DC5A 1R9MA 2QR2A 3CUKA 2TS1A 4R2HA 4YRJA 3TUZC 3GQVA 1ISIA 1I3OA 2HH9A 2OGZA 2WJHA 4UEJA 2O07A 3M2TA 3T5PA 2P0EA 2W90A 3BMXA 1TGYA 3OURA 5BV0A 2R62A 5JXWA 4NNJA 1DAPA 1Y89A 2E4YA 3QF7A 3M3PA 1H23A 1XX6A 2IYPA 4HWKA 3RWOA 3S6JA 2ZUCA 5B6PA 4DFDA 4DLXA 1DBSA 2I6XA 2EAUA 1ULAA 3E7WA 1IQRA 3A9VA 3CF4A 5JQGF 1AK1A 2EG9A 2F1IA 2HZBA 2E48A 1AO0A 4JH0A 2CXUA 1B73A 1DJLA 3KLBA 2LD4A 5C5CA 5DYIA 4LX8A 3U1BA 4IJ6A 3L1JA 1GYRA 4KH1A 4N7MA 3ZE8A 4NZOA 3OKCA 4YY3B 1NTRA 1E2MA 3IDOA 3VYUB 1UIRA 4QTUB 4QOIA 3NU1A 1B42A 1SVIA 2QQGA 2ZS9A 3NHJA 1QYDA 1LSOA 3IV9A 1J2JA 4BV2A 4E2YA 4DCSA 1EJ2A 5IUNC 1YRAA 2VDJA 2I4OA 2V7UA 4GZ3A 2GBCA 5CLGA 5AOVA 5A6VA 4CEIA 3F2IA 3NM4A 3QPUA 1L5LA 3K4PA 3KQWA 5JFOA 5L95A 2I2BA 2O3SA 3A4MA 2XE4A 3AINA 4QJ4A 4FKZA 5CIQA 3EFHA 3BJZA 5CVCA 1N7IA 3FPSA 5BW4A 1XT6A 2QYOA 1R12A 4MR9B 3GJ3A 3NCHA 3VBEA 4CDRA 5IT4A 1MT3A 1UJBA 1DOAA 2C8VA 2WJJA 4L8VA 4LJ8A 3W6OA 3I37X 3IMKA 4K81B 4F86A 3M89A 4KDRA 1PE0A 2IY9A 3VJLA 1PTKA 3A1VA 3JQ8B 2WG2A 2JCXA 5LMNB 1I2MA 4O08A 5AK4A 3NVDA 5AW5A 3ED1A 1QRRA 5DYWA 3EPRA 3U7QB 1PR6A 3D4IA 3DH0A 2OFPA 3KKZA 4H3HB 1JAYA 4YUYA 1R64A 2H1IA 4XJSA 5DXFA 2GHTA 4MP3A 3VKFA 5L53A 3GLHA 2P67A 3UB2A 2GBLA 3QMPA 3D7MA 1DCFA 1S2NA 1Z07A 4QBHA 2C03A 1E3WB 1PT7A 2D1FA 1US8B 3PQCA 5TJHA 3VC2A 3OQNA 1AS0A 2O3TA 2H2FA 3SI7A 4FFRA 1S3GA 2VPXA 4XWTA 5JANA 2BH9A 2QMUA 1E62A 1RAFA 4P0QB 4DKXA 1IZ7A 1E1DA 2VRCA 2ZJYA 1DHRA 3ASVA 4AWAA 3BBPA 1EFAA 4RDXA 1J1ZA 1V16B 4PAGA 4BGEA 4YUZA 2QE6A 2LV8A 4LE2A 4O4JB 1Z5GA 4IIUA 4WVLA 1GZVA 5EFZA 3FNIA 5C8DA 5T4HA 1CQIA 5JAOA 4RPKA 2BLLA 4XIYA 5NULA 2NT3A 1VMDA 4EL0A 3CRRA 1U7DA 1HLGA 3A05A 5LVAA 2VP6A 3NCTA 3ADKA 1RE0A 3KOWA 2A78A 2P9GA 3O0TA 3D7LA 1A4UA 2UVPA 1AIPA 5FWYB 3T3HA 4KP7A 3TSOA 1KIAA 5CT6A 4B48A 2D6FA 4GFDA 1ODLA 3WWEA 2OYSA 1DRUA 2BHSA 3NANA 3D3KA 4LYFA 2EHDA 4CMBA 4D02A 4Z49A 1OROA 1X13A 1LSUA 3BWMA 4GR5A 3IBSA 4P4NA 1Z0ZA 3W1VA 4URXR 1CERA 1PNQA 1U9ZA 1A4RA 1VHJA 2G1KA 2KBEA 2N46A 3OLXA 5KUTA 4H6VA 4L15A 1M3SA 1RLOA 3WIVA 4MHTA 1IL0A 5FBZA 3CKLA 1PDOA 3D2BA 4OBEA 4A2WA 2UXBB 2YIJA 5DHSA 2Q3LA 5D5QA 5HZMA 5KYUB 2H08A 1F3OA 1W1WA 3FN4A 2P1DA 3H4IA 3V8BA 3DEIA 1R0KA 4Y6LA 1K92A 3OEHD 5JPDA 4YFVA 2A5GA 1RJWA 1DOHA 1Y5MA 3BXZA 4M1ZA 1KAGA 3F7NA 2O2SA 3CRVA 4INJA 3W9SA 1B0UA 4OJYA 4RACA 1XNQB 2XVAA 3K0CC 4QDOA 1Y3DE 4D9JA 3N74A 5F7JA 4QM6A 1T0PA 3GFTA 3E9EA 5BXQC 3WQBA 4R40A 2IYFA 1G20E 4B6QA 2IC5A 1CDEA 4PG7A 3ZK9A 4RZXA 1ZWKA 1RP7A 1FSSA 1X8JA 2JIPA 2PK3A 1C14A 2L2QA 2POQX 2SKCA 5E9AA 1Y3HA 1U3DA 1WY5A 5G4KB 2JASA 2AOTA 2ZWMA 2EX1A 1CZNA 1H6CA 3MD0A 3KSRA 4NF2A 1X7WB 1E0JA 1XF9A 4FOTA 1V11B 1D04A 5IN5A 1SGWA 1KKMA 2B4TO 2FWRA 1NA5A 2XNSA 3CVXA 4OXYA 3X0DA 1K88A 1M2FA 1YFKA 2FR0A 4ZCSA 2GWHA 1FC0A 1HC7A 3C1UA 2M6KA 3MT9A 2HREA 5DZSA 4OJTA 1I7SB 1MLDA 2ZCJA 2O4CA 2RGAA 1SQ5A 2X22A 5TQJA 1KS9A 2G25A 1YVPA 4KVGA 3C14C 4JD5A 1ZUNA 1VYHA 2H3EA 1G6Q1 1W0JD 3NX4A 4YRKA 1ULSA 3UEOA 1JG4A 1A4XA 3C7DB 4AKHA 5ALUA 5A0TA 4R83A 4WN9A 2BUBA 1S2LA 2V0NA 2YWJA 2SHKA 2G17A 4LYDA 3FUWA 2BTQB 1KKUA 1D4ZA 2IF2A 3F5QA 3R1IA 2P27A 3H5VA 2G8LA 3I58A 1YS4A 2DPMA 1KR2A 2ZROA 3OX3A 4GX5A 2TMDA 4XFDA 4LF5B 3H04A 5GGXA 1K2VN 3GFOA 5AW4A 1NBMA 4R1TA 2ODAA 2Q2NA 4YJGA 5HEKA 2I3DA 2VXCA 3EG5A 4IAOA 4DHEA 1GGVA 4IGAA 2ATEA 2PA0A 4O2LA 5H9VA 3WHIA 1E32A 2QL9A 3NDIA 1QIDA 2QIOA 5I4BA 3DTVA 1GU1A 3P4UA 3SYLA 5GV8A 4I1RA 5LUAA 1XVUA 4R98A 3FGOA 3DE3X 5TEWA 1DQZA 3OOEA 1QK3A 2DUWA 5HZKA 4LYGA 4MQMA 3R7BA 1JKMA 2VUHB 3I0MA 3I8SA 1N2CB 4KQIA 1CCWA 4QPDA 3W8RA 1NBAA 2HRDA 3NYWA 2QTNA 5FBQB 4MEJA 3OEHA 3HI4A 1KOGA 2MOKA 4MARA 1Q7CA 2BM1A 2QL7A 3WO0A 2LKDA 1UFRA 1DRVA 2QI9F 3CJQA 1OHHA 3P0IA 4IZ6A 3S44A 4HLUA 4WASA 2NOAA 3WSTA 4TXLA 4BQRA 3UH1A 5IRCD 1JT2A 1T1SA 3EQ2A 2V1XA 4M86A 5ALDA 2JL1A 1TVKB 4LXXA 4RMIA 1SK8A 4ZCLA 1Z2DA 2CNNA 2IYQA 1GZ7A 4TQAA 3AFOA 1E9VA 3EQ9A 3NALA 5T8KC 2WINI 2Q6TA 1SN7A 4DCVA 3PFGA 5HIAA 1BJKA 2HQ1A 2CK3D 2FE1A 3MHPA 4GPZA 2EFJA 1EX1A 1C7IA 3FGZA 4J0GA 3WBBA 3MAJA 4MW7A 4WHMA 4AS2A 2WFZA 1JDTA 4II7A 4EUFA 5I7HA 5JRJA 3OETA 4DWWA 2NPIA 4NZNA 2YWEA 1Z83A 1JB1A 1K3TA 7MHTA 3DXYA 2VJDA 5IBCA 4X1YB 5EIBC 3NHBA 4PSKA 2VP3A 1NULA 4D7AA 2WW8A 4C89A 5F2NA 3QKRB 5FO0A 2WTAA 2FV8A 2Y0BA 5BVGA 1KEVA 1XMSA 3VMMA 1NSYA 5J4VA 3T9AA 3WIOA 3M33A 1KJWA 1ZAKA 1O5OA 1L5WA 1TMKA 3BTVA 1W0JA 3DMPA 3ZGXA 1CQWA 4CIAA 3QX9A 4BE9A 4RK0A 4KH0A 5HRAA 2PO7A 1X9IA 1ZA2A 2CY0A 3EAGA 4PZCA 4U2DA 3DT8A 4MMXB 3IKTA 3OLVA 1ABEA 3ISJA 3RC3A 4QO7A 4I1PA 1S89A 1NI3A 2YXNA 2GHIA 3V7NA 3WGLA 5BSRA 3NTUA 2ZDGA 3ANLA 3B5IA 5F76A 4ND1A 2A9JA 2D7CA 3B6MA 3F0TA 1O8CA 4WK4B 2WMYA 1KAQA 3AEKB 4Y67A 3D4NA 1EDBA 1B8PA 5DYNA 2DFVA 3AR2A 2RHJA 3ELDA 4MUJA 4QREA 3C3MA 4UM7A 4AS3A 1Z2CA 4YWHA 3ZWNA 3RK1A 3ZE2B 3HEBA 2GLTA 3QUCA 1MAWA 1RBQA 1TT7A 1V5EA 3RRNA 1TAUA 3T1VA 2FAXA 4IX9A 5FLXA 3LBNA 2OT3B 5EXPA 1E1KA 2V4ZA 3JARA 2IXEA 2Y0DA 1XJWA 1J2EA 1MTZA 2WA2A 3A25A 4DLVA 4MI9A 5BR7A 2IOQA 3NRCA 1WU7A 4E6EA 3WS7A 1XVLA 2QNRA 1GIAA 4YJ3B 1H2XA 2IXDA 2Y0CA 1M73E 2EW1A 4X91A 4BFXA 2P9YA 3CRMA 3I9FA 3RV3A 5KYGA 2PRYA 4YAEA 3K1TA 4PGAA 5DBIA 4CM9D 2JDIA 2O7VA 2Q4BA 3LUJA 121PA 3H7AA 3WRYC 1CEEA 1LBIA 4D0SA 2WY2D 3OWHA 4DPKA 4CEJA 1PL6A 1Z4IA 1KOJA 4KWEA 3BG5A 1Z17A 4PQFA 3OZAA 1GQOA 1ZWLA 2JLAA 4PGHA 2QTCA 1I6LA 2Y4NA 2Q2WA 3E9MA 3ZWWA 1YZYA 1GL7A 2HF9A 4B3FX 4D2IA 4QGBA 4YRDA 3ZZ1A 1G5QA 1T6NA 1WMBA 5FUWA 1NNLA 2JBHA 4DLTA 2CBGA 2CWDA 3AZOA 5H1YA 5JG7A 2IIPA 4FLFA 1M1NB 1IHPA 2PPVA 1HFWA 1W2GA 3OJFA 4WE3A 3RUPA 3AZQA 2FFRA 1M1YA 1Q1EA 3G02A 4DEYA 4ZPXA 1FW8A 3TLGA 3GLHE 3WWCA 1MOSA 1K97A 3K1AA 3RBAA 4BUZA 2R6HA 2QPAA 2Z30A 3ZKWB 3DO8A 1BRTA 4LS3A 2VAMA 3NXKA 1P9NA 4FOLA 3TVDA 3II6X 2AEEA 1MXHA 5EXDA 2ASVA 2Z2IA 1OBHA 1R8XA 3RVKA 1K0FA 4EIWA 3T5AA 4MV7A 5IH7A 1N2SA 1Q19A 3DCNA 4ADSG 3LO8A 1N0HA 1WPQA 4GL4A 3M70A 1SBZA 3KK0A 3MB5A 3K94A 4F8JA 4WBNB 1T1RA 1TUGA 1PZMA 2RE8A 1PT9A 3IAHA 1ZCFA 2O2IA 3OT1A 2ZBUA 5FP0A 4F1JA 1T34A 3EWSA 3KVOA 2I6TA 2HFKA 3OVMA 2FOXA 4FCTA 2WYIA 4WXMA 3WMWA 3ZV3A 4DXHA 1FFGA 3I4LA 3JD0A 2YOHA 4W8OA 4G5OA 2BM0A 4HG2A 2OPHA 2GVZC 3GLIA 1DLIA 2HMWA 3KWFA 1XBTA 1NLYA 2Q41A 4K88A 4B84A 4Q1CA 3HL0A 4FDMA 2ZAOA 3ANXA 1CDOA 3DUFB 3IE1A 4AK9A 2ZSEA 3T3GA 3HYNA 2YXEA 1YL5A 4P0PB 1E0DA 3IT3A 3BHNA 4BZXA 2Z2KA 4IOLA 2HPVA 3L2OB 4IV5A 1WMDA 1R8JA 4LWQA 1QG6A 4HS9A 1L4UA 4RX1A 2VQ6A 2HBQA 4CM9A 5D3KA 3U16A 2BOVA 4I0WB 4KFTA 4NS4A 3TE6A 3HWRA 1D2MA 4N0PA 4BO8A 2A0YA 4M9SA 2JFUA 1IBRA 1L7AA 4XWAA 5DT2A 1FXSA 1WPRA 2O8BB 1TAHA 3KS9A 5LJLA 1L4NA 1X15A 2IY7A 1SOVA 1QAMA 2CB0A 2B0CA 1EWVA 3LVQE 3NT5A 1ZGGA 4OU5A 1XIVA 2XMQA 2YHBA 4RBNA 5HA5A 1OJLA 2QD2A 5IMSA 3DKIA 4OO3A 1A5TA 1FS4A 2AJCA 4FEAA 5D51S 2PZEA 1LLFA 3V8RA 5AI0A 5BMOA 1GCOA 1YR1A 2FN8A 2H5JA 1SC6A 1LVHA 4P82A 5HS6A 5I45A 5IU6A 3DLPX 3EY9A 4UD6A 2VJLA 2V6BA 3ZY2A 4AJJA 4AICA 4F2GA 1C2YA 4CEHA 3N8KA 4LWPA 1GN8A 2PIAA 3AETB 3HXTA 4CMEA 3I1IA 1NFFA 1EGVB 4QTZA 2JRLA 2ZULA 1T3SA 1Z7YA 2DG2A 1PS0A 4YN3A 5FL7A 4CLHA 5KO2A 1GLVA 4G1BA 2FPRA