1D5CA

Crystal structure of plasmodium falciparum rab6 complexed with gdp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
KYKLVFLGEQAVGKTSIITRFMYDTFDNNYQSTIGIDFLSKTLYLDEGPVRLQLWDTAGQERFRSLIPSYIRDSAAAIVVYDITNRQSFENTTKWIQDILNERGKDVIIALVGNKTDLGDLRKVTYEEGMQKAQEYNTMFHETSAKAGHNIKVLFKKTASKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords RAB6 GTPASE
publication title Structure of the nucleotide-binding domain of Plasmodium falciparum rab6 in the GDP-bound form.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 47
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 1999-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1d5cA00
3H4MA 4EFMA 4F93B 1Q1BA 2O8DB 3CPHA 2VP9A 3M0EA 4YMWA 1GSIA 4Q4JA 1T3LA 1Z2CA 1E1QD 2ZJAA 2DWPA 4KBGA 3ZH9B 4A4DA 4XWOA 3NIBA 2YOHA 1BMFA 1WF3A 1DS6A 1X8LA 3TAHA 4BE7B 4PC7A 4NDZA 4Z1MD 2HYIC 2I3BA 1ESNA 2OBNA 2AXNA 2B92A 4IDHA 4TL7A 1Z6GA 4OKSA 3SQWA 2XB4A 3B1VA 4QRHA 1NMYA 4D4KA 2FEMA 3RRZA 1NKSA 1T6NA 1U0LA 4M8NE 2W6ID 3OFND 1VG1A 3NWJA 4B33A 4L5BA 4WOPA 3ZD7A 4FMDB 4QGFA 1Z22A 2G3YA 3F0TA 1JXOA 1M1YE 2GXUA 1XJ0A 1JJVA 5TMPA 2BWJA 1FNNA 4NCNA 1HA3A 1WMSA 4XSHA 5B30A 1OYYA 4KI0A 3CZQA 1Z0AA 3AEZA 2CK3D 3BJIC 1S3SA 4D25A 2FN4A 1N6OA 4TLCA 1VPLA 3LQRA 1EFRA 4URWR 1W0JD 3R9IA 3AVXA 1S0UA 3EARA 1W4AA 4ARZA 2Z0MA 4ZPXA 1T5LA 1SVSA 4DXAA 1M7GA 4GBMA 4B3GA 2FFAA 4UXJA 4TWZA 3X1ZA 4HAWA 2F1HA 1YHNA 2YWGA 4XIGS 3K70B 3V4RA 4HUQB 4OJQA 4NBSA 5BN3A 5F2EA 3U7HB 2RHMA 1ZNXA 1LF5A 2ZRIA 4BZPA 4FIDA 2JAQA 2CL0X 2IYYA 2XX3A 3GJ8A 1NG1A 3PUXA 4NYIQ 4DCTA 1E9SA 4WZ6A 1W0JA 5G53C 2AK2A 2VA8A 2J0SA 3LXXA 2RB4A 2ZU0C 2ZSDA 1JBKA 3W3ZB 1FUUA 4ZO4A 4QHTA 4A82A 3U6KA 5JEEA 5DISB 3GLIB 1KZ7B 2A5FA 3R9WA 5LBIA 3SN6A 2W2VA 1TU3A 3PENA 4JYCA 1GRNA 4UJ3A 3BFXA 4JT2A 3IBYA 1D2MA 3BH6A 1E99A 2VHUA 3RVBA 3Q7QA 4C9BA 3FHTA 1TAGA 3X1WA 2AKAB 5KDDA 2GCNA 1KZGB 5E7MA 4RD6A 3BOSA 5FOWA 2JLRA 3CPEA 2IX3A 2ATVA 2WMNB 2AWOA 1DAGA 3QBVA 5DNYB 3AM1A 1SGWA 2OV2A 1P61B 1G20E 3QF4B 3U60B 5KSOA 2DR3A 4CEIB 1HYQA 3T1OA 1U8AA 2GCOB 2JDID 3B82A 1N6IA 2GEUA 4ZIRA 3ONWA 4ESHA 2VH5R 3QKRA 4JLJA 2CL7X 1NKTA 2GJ8A 4M1KA 2ONJA 3RLFA 1XB2A 4PC3A 4LBYA 4JL5A 4TMXA 1FUKA 2MMCA 4QXAA 1YZTA 2XJ9A 4TQAA 1G64A 3SU8A 1ONBA 1R8SA 3T34A 4LV8B 2WZQA 2D3WA 4CEHB 3ZJYA 4M9ZA 2JDIA 4ASUA 1GNQA 1ZNYA 1AZTA 1ZYUA 4P4UA 4PQRA 3V4FA 4D4LA 2JJ8A 3LY5A 2D06A 5CYOA 3W5JA 3LLMA 3WBJA 5CLLA 1CTQA 4FWTA 1HQCA 4HLCA 2FPMA 4DZZA 2R6FA 1Z6YA 3BGWA 1WDTA 2AX4A 1I4LD 5CJ2A 1Q0UA 4KBFA 2PX3A 1NLYA 3SZRA 1ZM7A 1OIWA 2QRNA 3VQTA 3AF3A 1N6LA 5FR1A 3RS4A 1OFUX 1S1MA 2D4HA 2ORIA 4CYMA 621PA 3AVWA 4DVGA 2V4ZA 3IQXA 2ZIAA 3AKDA 3NEYA 4TMKA 5K8LA 5KU1A 2J46A 3X1XA 3SQXA 4GFDA 2WJVA 4HLUC 2ZJ5A 1OXUA 3VR2A 1X86B 2GZHA 1OB2A 2X1VA 4G3XA 2QE7D 1TF7A 3OF5A 1W7AA 4A8JB 3MFYA 1G3QA 1II8A 5ELXA 2BMDA 1AS2A 2GZDA 3GD7A 4BRUA 4DSNA 1W36B 4AG6A 3SI7A 4JSTA 1W4RA 4E22A 2BMEA 3FVQA 2XJ4A 2WICA 4RZXA 1OSNA 1G5PA 4RD4A 4LJ4A 1G5TA 2ZRNA 4DDWA 3GJ0A 2FZ4A 3K9NA 1T8UA 5IT5A 4FINA 3L0SA 1BO6A 1DG3A 4I1OA 1TF5A 1US8B 3CF0A 3PEYA 1BIFA 1AJEA 4KFSA 2GBLC 1ZBDA 4DUGD 3ZGXA 1UF9A 1XZPA 2QEQA 3U7FB 2IYXA 3DMNA 5LD2B 1U0HC 2AD5A 2NGRA 1S2MA 4UNNA 4OI1A 1FQJA 3W8NA 1A4RA 2C9CA 1H8HD 2FG5A 2ZYUX 3KKNA 3NC1C 2IYLD 1AN0A 2JCSA 3LV8A 3Q7PA 4DLZA 2WHXA 1G7SA 5P21A 3SBEA 1EFCA 4P33A 5L3SB 4JL6A 4LPKA 5D3MB 2LWIA 2GCPA 1KY3A 2H18A 4LUCA 1AM4D 2C8VA 4E5UA 3GJ5A 2F55A 2V54A 4EPXA 4DUGA 2DCUA 2ERXA 1KK2A 4P32A 2BJWA 4TQ9A 1NNEA 1N5JA 1F2TB 2QAGA 1IOZA 4LX0A 1D9XA 4V0NA 2XXAB 1NVUQ 1P9RA 2JLQA 2DHRA 2OUKA 1XPOA 2VBCA 1G41A 4D4JA 1GRQA 3BK7A 3PFIA 4M1YA 1CF4A 3DPUA 5IK2D 2KSQA 1OKKD 5JI2E 3PV0A 1MO3A 2RGDA 2ZRBA 2TMKA 4TTPA 5JMTA 1V43A 3B2EA 5C18A 3TW8B 3QXCA 1KK0A 1XTSA 4GRAA 3VMFA 4OI4A 3L0PA 3A1WA 3MUFA 2GESA 3QXJA 4NZYA 1T0HB 1E9CA 3THYA 2ZRAA 3R9XA 4URZR 4LJ7A 2QN6A 3T15A 3D6TB 4EJSB 4D4MA 3AP1A 2XNSA 4PTLA 1D5CA 4E07A 3HDTA 2ZUDA 4ZDKA 4C2UA 2QSYA 1DAIA 1NN0A 3DM5A 4Z8YA 4HAUA 3UIEA 1ZNZA 3EPKA 1OE0A 3BS4A 1OV4A 4Q4AA 1G5RA 2IS1A 3FE2A 3K53A 1XZQA 1GILA 1Y3AA 3C14C 4XH9B 1RYFA 2W0SA 2SHKA 2WSSA 2GJ9A 2NIPA 1CIPA 4TLEA 1GOTA 4O3MA 1W5SA 3I72A 2X19A 4RFVA 4D81A 2XZLA 2PJRA 3QJYA 1X1RA 2R6DA 2YVUA 4JKIA 3A1TA 2X2EA 1QHXA 5L3RA 3K0AB 3AUYA 5DYGA 4URUR 5E95A 2ZJBA 1ZUNB 4L4UA 5FOUA 5JCPA 3TMKA 3VR3A 3SYNA 2RGBA 2IS2A 1Q57A 3TAUA 3A4MA 1PZNA 3CIOA 4V03A 1QG2A 2V9PA 5KPJA 4URYR 2JJ1A 1VG9B 1U90A 1IY1A 1JPJA 2WIAA 3AVPA 2WTUA 1P2VA 2XITA 1YZKA 2OXRA 3PG5A 4DT1B 1NI3A 1M6NA 1NN5A 1XTQA 1KAGA 2OEPA 2Q3FA 1G19A 3KKMA 4WIAA 1ELOA 3WBKA 3WMEA 2QMUA 3M4YA 3RWMB 4B3FX 4MRVA 1E4VA 4NU0A 2ZQ5A 2Q9AA 4JVSB 2CCJA 1BOFA 1G8GA 1O87A 1KI6B 1ZINA 2C5LA 4PPQA 1AGPA 5FBVB 5C4MA 1EFUA 3W6NA 2CBZA 4B48A 1OH7A 3P32A 4Q1AA 2OCAA 4PSKA 1UAAA 5JLJA 2QG6A 4IOKA 2W2TA 1AS3A 1KYIA 3HU2A 3DKPA 4KODA 1IN5A 4BZXA 3T5GA 1A7JA 3Q85A 4MQBA 3AF1A 4EFLA 3GJ6A 4DLTA 3MWLA 4W5JA 1E2MA 4HEJA 2G1JA 1RJ9A 2QMEA 3VHXA 3RSOA 1T91A 1SVIA 1C1YA 5DGXA 4N1AA 2WIBA 4G01B 1W46A 4XTCS 1FL9A 4LGMA 1KI2A 2HF9A 4HZUB 3HYTA 4IDQA 4TLAA 5DI3A 3B8HA 3C5HA 3IPYA 3QBTA 2QM7A 3MRSA 4BEJA 3EZ2A 1NVXQ 1UJ2A 4OQMA 3CLVA 2OLJA 3F5FA 4BFYA 4GSYA 4UNSA 3KKPA 1P9WA 5DYIA 4TMZA 4K81B 4CIDA 3P1JA 1XFAA 4TQUS 2IXGA 2VSFA 1MO5A 4TYQA 1QBKC 3OZXA 3KL4A 2R8RA 2G88A 2KBEA 3UATA 3K9GA 3HYRA 4PHGA 4DEXA 3FGNA 4US0R 4P3YA 4ZI2A 5J4YA 1W5TA 1GKYA 3D31A 3NVAA 2XNDA 3NH6A 2ANBA 2ERYA 3C4JA 3W3AA 3THOA 1AGRA 5EE3A 3O8CA 3EPLA 1NSTA 1W49A 4YONB 4EUNA 1LV7A 3CR8A 2ZPTX 4PZLA 3TKLA 2R2AA 1OXSC 3QPVA 1KJWA 3A1VA 2FJUA 1UKEA 3BC1A 3FOZA 1FQKA 4M53A 2ZYTX 3QSYA 4B73A 1MKYA 5FTLA 4TT3A 5JSZA 4C0BA 2F9MA 4EPWA 4II7A 4ZCLA 2OBLA 3QI2A 2PZGA 1XMIA 4MUBA 2IF2A 3ND9A 3B1YA 1Q1EA 2QUZA 1DELA 3DM9B 3FFBA 1JNYA 4KCGA 3B13B 4Y0VA 1KSFX 4RCZA 4EFNA 2I4IA 1UEIA 1F48A 5FPYA 1YR9A 1EX7A 4PXAA 3SE0A 3I61A 4IDNA 3KFXA 4D80A 1E9EA 2F43B 2ZRDA 2PL3A 4AKEA 3VFDA 2HJGA 3IQWA 4YMVA 4KITB 3AKCA 1XMVA 2D74A 2J1LA 1II0A 1A5TA 5EZ6B 1KO8A 3R7WA 1KJZA 3DZ8A 3ZVMA 2QMHA 4JT4A 2OE2A 2ATXA 3FMIA 2GRJA 3EIHA 1LTQA 3DEFA 3DOFA 5JBQA 2C2HA 5F3WB 4D0GA 2ZR0A 2BMFA 2Z5FA 1E2HA 4HDQB 5IHPA 1AS0A 1DBSA 3G5UA 4MUAA 3CRQA 1W48A 2J0VA 4DHEA 3LLUA 3NBFA 2F3TA 4OL0A 3WYAA 4W7SA 1CR1A 1ZRHA 3AV0B 2VPPA 4Z54A 4OHYA 2QT1A 2VQSA 1VG8A 2E9SA 5FPKA 2GBLA 2J0UA 4O2RA 4R2IA 4UNQA 1G3IA 2ORWA 4AK9A 2FWRA 2F3RA 3QVVA 5L3QA 5E7JA 1G18A 5H8WA 2PT7A 2CLSA 4C0KA 1R7RA 2GETA 1G7RA 3FPAA 4F91B 3AVTA 2B21A 3NKVA 4NP6A 3REGA 1U94A 4YMSA 3PVSA 1VCIA 2PZEA 3AF4A 4RFSB 2O8BB 4TSFA 2Z83A 1EWQA 2ZYWX 1XTJA 1U98A 1E2FA 4UKDA 5FTJA 3WHLA 4BLTA 5CJPA 721PA 1KGDA 1HURA 1U9IA 3LVRE 1P60A 2ZRFA 1DE0A 2WPDD 1W36C 1VCOA 4M4SA 2O8FB 5C46F 5GJVC 3CH4B 3CUEF 1XP8A 1JALA 2IW3A 4PSAA 5FOTA 4D6PA 1QF9A 3TSWA 1XF9A 2J3EA 3OAAD 1YU9A 3U6BA 3ADDA 4Z51A 3LX8A 4A6PA 3AF2A 3KTAA 4LY6A 5H1YA 2XEXA 1XXHB 1N6RA 3OEHA 3TH5A 1GL7A 3WNDA 2ZRGA 3QF7A 3CWZA 4NH0A 1SXJA 1JB1A 4ZDWA 4B6EA 1Z28A 2D2FA 3VU9B 3CWQA 4LZZA 1YKSA 1OH6A 1NBME 4DB2A 3BXZA 1GAJA 2DFKB 4L9SA 4EIWA 2F1IA 2OHFA 3BD9A 2NZ8A 1XJQA 1J7KA 5FPTA 3S1AB 2HYDA 2VP0A 4YXWD 5JWOA 3PJRA 3BFKA 3RANA 4TTRA 4PX9A 4UXHA 2A2ZA 4TL9A 1KO7A 4CEJA 4DCNA 1J8YF 5DE3A 2FNAA 1X1SA 4PQFA 4D26A 1VG0B 3N70A 2ZI4A 3SYKA 3A8TA 1Q12A 4B2LA 3KUDA 1XD2A 1I4TD 4B32A 2NO9A 4YXWA 2NZJA 1NLZA 5AJYA 2BM0A 5B2ZA 5IF9A 4H9GA 1WBDA 1W0KD 2LCFA 4RVCA 2P2LA 2IHBA 1GVNB 2BBOA 1M34E 1IN4A 5AJVB 1TQ6A 3IEUA 1YJ5A 2F9LA 2ZTSA 1FZQA 1T0JB 2EW1A 5KYKA 3VKHA 1UKZA 2PLFA 1CP2A 2WV9A 3ETLA 3N5CA 4GP7A 5SZKB 1ZUHA 4QKQA 1RC8A 4IRUB 3QG1A 2OZEA 3LW7A 5G41A 2UZ3A 3LW8A 5H70A 1XXHE 2C9OA 3R8CA 4IXNA 4A36A 3EZFA 5FUWA 3N2IA 2NPFA 2IUSA 1W0KA 2RGCA 2FV8A 2VEDA 3QKTA 2Q3MA 2YC4C 1AKEA 2DYKA 3IBGA 3O47A 3EIQA 4GOKA 1XPRA 4DJTA 2X8AA 4QBIA 4A1FA 2J41A 2B8TA 2IYUA 2XTMA 2GF0A 3FKSA 2J9RA 2E1RA 2NPIA 2RMKA 1LF0A 4LK2A 4OHVA 1GNPA 1VIAA 4L16A 4M0LA 4DDVA 1NP6A 3KQKA 3TLXA 5J47A 3ZVNA 1E1RD 4XSGA 4Q4LA 1E2JA 4KSCA 2XTZA 3QKSA 5FUXA 1QHNA 1UADA 4OK3A 1CBUA 2ZRMA 3C16C 4QL3A 4MDEA 4F92B 1JEDA 3ADBA 3W8RA 2IS4A 2V7QA 1KHTA 4PAQA 2IYRA 2ZJYA 4P4SB 5EXTA 2YOFA 1CULC 1DPFA 3HU3A 3IILA 3V9PA 1CJUC 1ZM3A 1G3MA 1XEFA 4E03A 3WRYC 1HTWA 4KFRA 4FXPA 2RGEA 5CIQA 4OHZA 1O3YA 4HB0A 4JYBA 2FZLA 2W00A 4GL2A 5CK5A 4HAVA 4Q01A 3SHFA 1SXJE 1G7TA 1KSHA 4TYPA 1N0VC 3GQBA 5JHHB 1OIVA 1CLUA 1Q3HA 5K8UA 4HATA 3TVTA 2ODBA 2G1KA 4LJ5A 1Z07A 4K46A 2DFTA 1E1QA 5G3YA 2PCJA 4XVUA 1ETUA 3AB3A 1X8JA 5G40A 3RNLA 2RGGA 3OEED 4HLQB 4LSGA 3VNVA 2YV5A 2ZSFA 4V0MA 3THXA 4Z1MA 3TNFA 1YZQA 2NO1A 4IFBA 4MYTA 3X1YA 3NG1A 4LI0A 1DAKA 5TY0A 3A4NA 1ZC4A 2W6IA 3OFNA 4Q4JB 1TTTA 2G83A 3IUYA 4HDOB 4QC2A 1OHHD 2AHOA 1KY2A 1MV5A 3EXAA 1GL9B 1MO6A 3K0SA 1N25A 4L8GA 2N1BA 1PLKA 2FFBA 4KYIB 1FFHA 2EWVA 2A30A 2CK3A 3LD9A 1SHZA 4NL4H 4B47A 2XZPA 2PMDA 4B71A 4B34A 4L9WA 5FUYA 1NL3A 2OESA 3CX8A 2QPTA 1BS1A 1Z29A 2YC2C 4LYFA 2BBWA 3WYFA 4A92A 4GP6A 1SVLA 3CNOA 3GEIA 4PAOA 5EP3A 1OXVA 1E0SA 3EPJA 2IYSA 2J7KA 5GJCA 4ZV4A 4GPTA 3Q8XB 5AWFC 1N2CE 4LBWA 4Q1EA 3ZVRA 2C99A 3GPLA 1KSJA 4RCYA 3UXMA 4ARZB 4WA7A 1T9HA 2IC5A 3LO5A 4A0GA 1TU4A 4NKRA 5EE1A 5EUMA 2ODNA 3EC1A 2IYTA 1KI8A 1RFLA 4Q9LA 3UKDA 5KNCA 1XEWX 2QA5A 4JJKA 3K0FA 2DWOA 2P3SA 1HUQA 1R2QA 4JLNA 2BVNA 1TX4B 1QG4A 1E32A 1FOEB 2Q9CA 3OE7D 1N6KA 3AP3A 4JSYA 4Q1DA 5FOSA 5FTMA 3KKQA 2O8EA 1KK1A 5BN4A 3CRVA 1NJGA 1GNRA 3FHCB 4XOIA 1E2QA 1Q3TA 1GG2A 3ECCA 2IEYA 1TQDA 2P67A 1RPZA 1E79D 2ZJOA 3QPUA 1P73A 1IQPA 3VR1A 2EFDB 1P62B 4FMBB 5EP1A 1II9A 3TR5A 3HJNA 2GVZC 4DLVA 1PLJA 2GWHA 1CJMA 2WWGA 3RRNA 3UG6A 1CR4A 2A9KA 4HB2A 4RY2A 1IONA 1W36D 3DVLA 2I1QA 1L4YA 2BEJA 4TL8A 4CT4B 1E9RA 1P75A 3RC8A 3MJRA 2QSZA 2ODWA 5TXGA 2J59A 1QHHA 2NOAA 1Z3IX 4JBXA 2C04A 1N5IA 2IK8A 4ZIRB 4A2PA 3CRMA 4TZ6A 3W34A 3QKRB 4V0ME 4N3NA 2P6NA 3C41J 4Q7JB 3PCRB 3RRYA 4JLDA 2FPLA 4NTZA 1P5ZB 3BBPA 2J7PD 2KWIA 5J40A 4FW9A 4AD8A 3L0IB 4MKHA 2Y8EA 1RRPA 1KAOA 5EUQB 3U3MA 1TNDA 1P7CA 4M21A 3OIYA 4MGZR 5EQTA 4QM7A 4G5OA 2QU8A 1J90A 1WB9A 2GILA 5KOYA 1XEXA 3B7GA 4M2LA 1M2OB 4H1VA 1MH1A 2EYQA 1W47A 3CH5A 3OIUA 3DL0A 2UZIR 2JASA 3LRPA 3EASA 5TARA 2IYWA 4HLDA 1G7CA 1XCPA 4KLNA 3H86A 4LJ9A 4QHSA 2IWHA 3T12A 2XGJA 1NIJA 3W6OA 2J7PA 2QE7A 2GHIA 3P20A 4M1SA 4B44A 2CHGA 4N0EA 5L3VA 1J2JA 1Q20A 1B23P 1EX6A 1H8ED 3NBXX 5HTKA 1G6OA 1XD8A 2QMOA 4B76A 4BRWA 3A36A 2IXFA 3GJ3A 1F3OA 1J99A 3AVQA 1D9ZA 2HT6A 3OHMA 2DBYA 2ZI7A 1NRJB 1Z0FA 2ZI3A 3I32A 3B1XA 1Q1ZA 2OO7A 1F60A 5FH9A 3K0CC 4V02A 5JRZA 4Q21A 2ZVPX 2BIFA 3KXIA 4B2IA 1NVVQ 2ZRPA 3ZD6A 2J45A 1H8EA 1II8B 4IEIA 4OBEA 2YYZA 3HR8A 5GVRA 3V00A 3WNCA 4FI3C 4I81A 5LPNA 4Y0AA 3WXMA 3GLFA 1D8TA 1EXMA 4PZZA 1E2DA 2GA8A 4XWKA 2MSDB 4EPVA 2YOGA 3EC2A 4TMWA 3TR0A 1VIYA 3LBHA 5JHGB 3ZZTA 4DIDA 2EFGA 4RZ3A 1MRNA 1H8HA 1FW6A 2PEZA 3VNUA 2PH1A 4MKFA 2N42A 4NYJQ 1UDXA 3Q5EA 3E5HA 1XRJA 2IUTA 3WMGA 2FGJA 2HJVA 3HP1A 1VCNA 2WJIA 3DOEA 1HQYE 5BYJA 3A37A 4IOJA 3D7MA 4JZKA 3U44A 3FYHA 1OFHA 2QENA 2D7CA 2YWHA 4DLYA 5A0FA 3WP0A 1OH8A 3LBIA 5HZKA 1QRAA 2GDJA 1MABA 2QPOA 1YRAA 4NCKA 5F9HA 1Z0JA 1PUIA 2WJJA 3SEAA 1DAEA 1MO4A 4U5XA 1QZXA 3SJBA 4DDTA 4JL8A 3MG9A 2Q21A 4LC1A 5JS8A 1DAHA 3ZYCA 1ZAKA 2UVQA 4QNMA 4QFMA 1OLOA 4DCVA 4IKEA 5IK2A 1GITA 2VSXA 1EWRA 1VMAA 1OKKA 821PA 2PX0A 2R6CA 1A1VA 2FFQA 2QAGB 3NBZC 4P0TA 2ORVA 3QUSA 2CVHA 4UNPA 3UWKA 4NYMR 4MRSA 5EE9A 4Q9JA 1Z6XA 1G8HA 2CNWD 3AH8A 1SZPA 3B85A 2F7SA 4K8OA 3IDQA 1EFTA 2ZROA 2AK3A 1TUEA 2GXQA 4Q4HA 4RKFA 3LAWA 2NO6A 1TMKA 1UBFA 1DO0A 4C7OA 4FMCF 2FSFA 5FBLB 3VTKA 4I1VA 1YR6A 4OK6A 2F1RA 5BWMA 1XMJA 5KTYA 1XNJA 3A6PC 3O8DA 4JLKA 5AUOB 4MH0R 4QGGA 4AYTA 2OCBA 1COWD 1ANKA 2KI5A 2WJYA 4B3DA 4AYWA 4PC6A 5JJKA 4KVGA 2I1VB 4I99A 4F4CA 1A82A 2O52A 3ASYA 3QQ5A 3LNCA 4M1TA 3A1SA 1R10A 2GF9A 5EP4A 2H16A 4B75A 3THYB 3THWA 1OW3B 3EPHA 2H7VA 3KQLA 1IAQA 2FH5B 3P4XA 3WNBA 5HE8A 1UBGA 1IXZA 4A2QA 2OBMA 1DAFA 1E0JA 2W6JD 3E70C 5H68A 1CR0A 1RRGA 1COWA 4D0LB 4Q4AB 4UXIA 4AYXA 1TUIA 2A5JA 3BORA 1OT3A 5FR2A 2HV8A 1E69A 4Q1BA 1XJCA 1PVOA 4GMXA 1H65A 2P5TB 2W83A 3GLGA 2NTYC 3SJCA 3GLFE 3NH9A 2PEYA 2PMKA 1KJYA 1ZM9A 3SJAA 1ZD1A 1CU1A 3F3YA 1NLFA 3K8YA 4I1SA 1OB5A 3BH0A 1L4UA 2VP4A 2YZ2A 1TADA 4HZIA 4LWZA 4NYIR 4BASA 4DSOA 3U4QA 2OAQ1 3I5XA 4WZAE 1KDPA 2IWRA 1ZNWA 1GTVA 3EZ9A 3A1UA 2XB2A 4M9SA 2B8WA 3OIWA 3MCAA 2ZR9A 2Q6TA 2ZE7A 4JVMA 3HPQA 4PO8A 2VRWA 4BFUA 4W5WA 1R6BX 3U5ZB 1IN6A 2IF0A 3CRRA 4TN1A 4W5HA 4DDUA 3A4LA 1AZSC 2NO0A 2ZRJA 2GEVA 2BJVA 3KQNA 5J4LA 4OK5A 2Z4SA 3QPWA 3K70C 5CLQA 2IL1A 8OHMA 2HLDD 2NO7A 2VSOA 1W2GA 4UJ5A 4TYNA 4MDFA 2G77B 3GJ7A 1IBRA 4D0NA 4QOSA 2FDCA 3QVUA 3CX7A 3EW9A 3EA5A 4POAA 2QP3A 4EPYA 2QORA 3L2OB 1NG9A 4R7ZA 1FMJA 4HB3A 2JLUA 4QM6A 1RJ9B 4ON9A 2IYZA 2F6RA 2D2EA 5DSZA 1IY2A 2V1XA 2VIIA 4FMDF 1J8MF 1T4GA 2IT1A 4LYHA 5FOVA 1LS6A 3KXLA 2G9NA 1T3SA 2DFLA 3ZS9A 1G8PA 1E98A 1KO1A 4J0QA 4GMDA 1E0KA 2FSIA 1R4AA 4KXFB 3VR6A 1GL6A 5DI3B 1YZLA 3UANA 1LFDB 4US1R 2IS6A 2QT0A 2LKDA 4AKHA 1D6JA 1L7VC 2G6BA 4V0KA 1OXXK 4JLPA 2CL6X 4IOLA 2BEKA 2EFCB 1VYUA 3NTUA 1E2EA 4Q47A 5DHFA 1G16A 5KSPA 4F4IA 5AK0A 3VHLB 4AKGA 4B35A 4JLBA 4BLSA 3ND8A 5IRCD 4U00A 1GM5A 3K1JA 3JVVA 2OXCA 4ACBA 3FMFA 3ZZ0A 5CK4A 3ZDQA 1G4AE 4HLUA 3RSLA 2FEOA 2WMOB 1E3MA 2BBSA 4NPHA 1A2BA 2OCPA 4BEBA 1UBCA 3NHBA 3NDPA 4BZQA 3ZS8A 3GLHA 3FDIA 4OQLA 2OFXA 1W1WA 5SZJA 2AR7A 3U7GA 2OAP1 4R71A 5UKDA 3GLGE 2XSZD 2ZSAA 2QQEA 1ESMA 3GCGA 4EQ6A 1G17A 4DLUA 4I1UA 2XAUA 2OFWA 4LHZA 5E7IA 3BIFA 4ACAA 4WAUA 5HPYB 4EPRA 1R0XA 2BMJA 3W9YA 2GKSA 4C30A 5JSZB 1CEEA 4CF7A 5GVSA 1XCMA 1GUAA 3LFUA 5C1BA 4ZCIA 3T1TA 3WMFA 2WWHA 2ZE6A 1ZM4A 5KPDA 4DLSA 3KJEA 4RZUA 1XD9A 4BLPA 3IGFA 2ZS7A 3SFZA 3IEVA 4ABYA 3CNLA 3EG5A 4DLWA 3ZIAD 2NQ2C 5EXSA 1C4OA 1NF3A 2XSZA 3RS3A 1JR3D 2JEOA 2HDNB 2VF7A 4XD7D 1JXMA 1ZD8A 2D62A 1L8QA 1IXSB 2ZJ8A 4NCIA 5ANRB 3UMFA 3GFPA 3SS8A 1N0UA 4FCTA 4QGHA 3TSOA 4HUTA 4A8JC 3QOFA 1VDZA 3K0CA 4KU4A 3TBKA 1M7HA 3R7WB 3CPJB 4KO8A 1NVVR 5KSZA 3WY9A 2YHSA 2B7CA 2WKRA 1S3GA 4LYAA 3G82C 1XX6A 2HUPA 4XJXA 3M1IA 2V6JA 3WRXC 2FSHA 1U0JA 4LJAA 1VYVA 5JJIA 4KYUA 1I4DD 5JWHA 3TVDA 2QGNA 4DEYA 1XCGB 3UMSA 2IXEA 4DSUA 3MWJA 1SKQA 2DPXA 5JECA 4YLGA 2J0UB 4NYJR 2WPDA 5E4FA 1E2IA 1Z2AA 3K09C 4PFSA 4ERNA 2ZSBA 5L3QB 2WWYA 5LD2C 1F2UA 4TYWA 1Z8FA 2IEZA 1G8YA 2JIZD 3EX7C 1TPZA 3OAAA 4LV6A 5HZHA 2V6IA 1KK3A 3BFVA 1IM2A 4IEEA 4LV5B 4QNRA 6Q21A 3CKLA 2A5GA 1UKVY 3K9LA 5EE0A 3FHOA 4F7WA 2VP6A 4IFEA 4PPNA 4XTRA 3NHAA 1WBBA 1OFTA 3SHWA 3W90A 5A4JA 5CM8B 1SKYB 2OG2A 3UMRA 1SQ5A 2FMXA 4MYCA 2GK6A 2OLKA 3B1ZA 3OESA 5FI1B 1LB1B 3TUJC 1WP9A 1KMHA 4Q18A 4RD1A 4MGIR 1FX0A 5TB5A 2QY9A 4IDOA 2ANCA 1NVWQ 4DCSA 2V8OA 2Q0HA 4C0SA 1OH5A 2DWQA 1GIAA 3KTAB 5FL3A 1BYIA 2ZI6A 4LHVA 2VYFA 4FMCB 4UNRA 2CE7A 1KTVA 1Q21A 1OJLA 1TEXA 4A15A 2EFEB 1SXJB 3GLHE 4RSGA 2CJWA 2GXAA 2V1UA 1KIMA 4G1UC 2DB3A 1JJ7A 1E2KA 1C9KA 2AXPA 1CJTC 3GEHA 5K8TA 5B64A 1R0YA 3B6EA 3U3OA 5IDVA 5FL7D 1G9XA 1V5WA 1YR8A 4KJZA 2YJTD 2J0QA 4DC9A 3FWYA 2JLZA 4F38A 3SOPA 3IIJA 2CXXA 4BLRA 1XDBA 2ZI5A 3BB3A 4KSBA 4EJSC 3SDZA 4M22A 2O8CA 3B9PA 1Z6TA 4G5QA 4AIIA 1GKUB 4JLOA 4IXMA 4CEJB 1FTSA 4MRPA 1RW4A 2ZI9A 1K8RA 1G291 1P3JA 1XEWY 3T1VA 4ZKDA 1B0UA 2IBMA 1VKJA 1IN8A 4URVR 1YZNA 1JPNA 1XD2B 2IUUA 3ZQ6A 2O8DA 4R2HA 3RS5A 3PQCA 3M6AA 5TVKA 3BAFA 3X2SA 1LY1A 4BQSA 2EU8A 3PIRA 4HYYA 1R8QA 1DTSA 1GRRA 5DN6D 1SKYE 5FFMA 3AF0A 1XTKA 3I92A 3RS2A 2A5YB 1N6PA 4GI7A 1ZIPA 3REFA 2P6UA 1Z5ZA 4GT1A 4B74A 1CRPA 2PT5A 2DFNA 3Q3JB 1TF2A 4V0OA 2ZEJA 4Z8XA 2V55B 1E1RA 5JWRA 2MSCB 5EJEA 3QENA 1EGAA 1BMFD 3MAAC 1Z63A 3K70D 1L2TA 3A58B 2DY1A 3T1QA 5A5GA 3IO3A 1YZGA 1NMZA 5DN6A 2UKDA 3DZDA 4KVAA 4R98A 1KI7A 1T5IA 5FTNA 2OILA 1WCV1 3KZ1E 4NE2A 4CW7A 1E9FA 4E09A 2A7QA 2JLYA 1PLLA 5KSYA 4LJYA 2CVFA 3MSXA 1VTKA 3IIKA 5KHOC 2XTNA 4AC9A 3CB4A 3HU1A 5AJWA 4OHXA 4DCUA 4HSEA 4MKIA 4LRWA 3K9HA 4Q03A 4PHTA 4A6XA 5KO2A 1DO2A 1G3RA 2KE5A 3QKSB 3ZZUA 2GAOA 4HUQA 2C9YA 3CRW1 3TUZC 1R0ZA 1QVRA 1U8ZA 1D2NA 1OYWA 2QROA 3QEOA 1SHKA 4LHYA 4RKEA 1EFRD 3QNUA 1ZD9A 1J70A 3JZAA 4Q48A 2QBYB 3RRMA 2ZM5A 4NCHA 2MSEB 4WBSA 1NY5A 3AQ4A 4Q7MB 3UK6A 1I2DA 2WOJA 2ZU6A 5GADl 4X8MA 3OEEA 1RYHA 1EG7A 1SVMA 3NC0C 1KKLA 3VR5A 1DAMA 3GLIA 3B60A 5JFGA 3AGQA 3FFAA 1KKMA 3FKQA 3IIMA 4HB4A 4TTQA 1G6HA 1NSFA 3KJIA 3KUCA 1IN7A 2ZUBA 4UQOA 2C77A 5KNDA 4EAQA 1HH4A 5M04A 2WAYA 5KUTA 3QXSA 4ZI3A 1OXTA 5JRJA 4ZKEA 1YR7A 2JLXA 1OHHA 2EWWA 4LBVA 4FD2A 3QF4A 1RZ3A 4QJ3A 1KI9A 3THXB 5FUVA 2GNOA 1UDWA 3EWSA 4CEIA 1NN1A 2GCOA 2P65A 4DSTA 3AVVA 3Q9LA 4OQXA 3BE4A 3PEVA 2X2FA 1AQYA 1OPXA 2WBLC 5DH9A 4FCWA 4D82A 4CGZA 4GOJA 5J5CA 1X3SA 3UPUA 5KDLA 3I3SR 4BUJA 4EDHA 1OFIA 2W0MA 1JQLB 5HCNA 3U61B 3ICEA 3BWDD 2H1LA 4IVQA 3ZLJA 4CEHA 3ADKA 4BECA 1Z6AA 1DADA 3EWAA 3RAPR 3GEEA 2H17A 2C98A 4IOMA 4BFTA 1Z0DA 2W58A 3UWOA 3E2IA 4HI0E 5CYPA 2ZRCA 4JVLA 3PXGA 2P6RA 1G8FA 1P4SA 2FPKA 2OSBA 1VHTA 4AKIA 2C03A 4S35A 5GJBA 3VKGA 5JEDA 2ONKA 1JR6A 2GEDA 1E2LA 2H57A 2A5DA 4TYYA 4ASUD 2ODEA 2YWFA 5BYKA 4Q1FA 1GWNA 3KJGA 2AL7A 3OE7A 1MR3F 3C8UA 2HXSA 3NEJA 3VX3A 5SZHB 1KNQA 2WKPA 5CB6A 2R6GA 2FGKA 2WJHA 2H5EA 3KDSE 4Q9IA 3ZQJA 5EXXA 1E79A 4LHWA 3WHKA 4A8JA 1EK0A 2PCLA 3K0FB 2RCNA 4M1WA 4DRZA 5FTKA 1MRSA 1CXZA 2FA9A 3JVUA 5AR1A 3RWOA 4DLXA 1GZSA 1K6MA 4MITA 4OJKA 2O8EB 4Q1CA 3KX2A 4LBZA 2GZAA 5DO9A 3BERA 1W4BA 5FBQB 5HKKD 4G5GA 3RS7A 2EYUA 4LPSA 5TDHA 3SJZA 2GXSA 121PA 1N6HA 2E87A 4BFVA 3J81k 2H8KA 4WVFA 5LDDC 1OIXA 1US8A 1QDEA 3HR7A 4BFXA 5JI3E 1ZVQA 2Q3HA 3GLIE 5E3HA 1LVGA 4AWXA 3GJ4A 1UFQA 2WKQA 2JLSA 3HWSA 3CF6R 4MGKR 2C95A 2REOA 2NG1A 3RC3A 4Q02A 3K09A 1K5DA 2N46A 1SVKA 4PPGA 1R5OA 3UG7A 4Q9KA 5BXQC 5HKKA 3MGCA 4JLMA 3AVYA 2QBYA 1XBTA 1FP7A 1UM8A 2A3RA 3DKVA 2BKUA 2GAAA 1QHHB 3MJHA 3O8BA 4RD3A 3TQCA 3QXHA 4GDFA 5KNBA 5L3SA 5D3MA 3LH5A 1CS4C 1Y63A 4CDGA 1JECA 4QJ5A 4DKXA 1Z06A 2IHYA 4LJ6A 4BLOA 2HXYA 3ADCA 5DIFA 3N2EA 4QBFA 1JAHA 4H1UA 2G0NA 3KJHA 1FTNA 1ZIOA 1F2TA 1PUJA 1X6VA 2X77A 2ZVQX 1RE0A 4TZ0A 1R5NA 3H1TA 1N3BA 4A0RA 2XXAA 4NMMA 2W2XA 2VP5A 2QP4A 2VF8A 2ZRKA 5EZ5A 1K5GA 3RYTC 1XEXB 2AN9A 1RKBA 5FI0B 2BHRA 1NN3A 2O0HA 2QM8A 4C4PA 2B7BA 4DBLC 4C0LA 3E1SA 1BKDR 4XWAA 3TSZA 4B2PA 5J4KA 1S1CA 1YE8A 3BB4A 1G3UA 2H92A 4A2WA 1PV4A 1HEIA 1HY3A 3EIEA 1U9IC 2RHDA 1KI3A 1NMXA 2HCJB 4JVNA 3CX6A 4OQNA 2BCJQ 1E2PA 2ZREA 1AKYA 2EQBA 3U3RA 1AA9A 4EJSA 3P26A 2IA5A 1EFHA 1WA5A 4KFTA 5HCIA 2AKYA 2QTFA 1HV8A 2ZJZA 4ILEA 3IPXA 2HCBA 2ASEA 4GNKA 3KB1A 3KQHA 2VO1A 4BFSA 1Z47A 1AQUA 1X8KA 1U99A 4IW3B 4U02A 4I4LA 2JGNA 3B9QA 3GP8A 1SXJC 1M8PA 2GVDC 3GLFB 2RGNC 1HE8B 4PHFA 1WQ1R 3PUWA 3F8TA 2EFHB 3KKOA 2JLWA 1S4QA 1ODFA 3BH7A 1A2KC 4KV9A 3P4YA 4QG7A 421PA 2ZE8A 4FN5A 4GZLA 4NCJA 5LB4A 1E9BA 3K0AA 2VTKA 3CNNA 3U2QA 1AK2A 3AGPA 2ZSEA 3L82B 4MYHA 5J4VA 3U44B 2WSSD 1S9DA 2JATA 2CHVA 1UPTA 3RABA 3KXKA 3QKUA 2FOLA 1GKIA 5FBWB 3LXRA 2REXB 1ZP6A 1E4YA 4DT1A 1KDOA 1MABB 2QTVB 2RKOA 3TGPA 4BFWA 3DHWC 3PUYA 1Z0KA 1WRBA 2CNWA 3LQQA 2J87A 3Q72A 3R20A 1ZCAA 4Q9HA 1W4CA 1JQJC 3OIVA 1QHSA 4WXPA 3NDBB 3TUIC 2EVWX 1HT2E 2F1JA 2QQ0A 4C0AC 5BW8A 1KI6A 1U2RA 2JJ1D 3FTQA 3QIAA 1G4UR 1YVDA 3I4LA 1ZUIA 4YDSA 4C0QC 1W2HA 1S96A 1P2SA 5FPSA 3CF2A 2K5UA 4JS0A 1GP2A 3H84A 4B3XA 3CBQA 4JIMA 1U8YA 1VYTA 1SVWA 3TW4A 2BM1A 4QHYA 2WAXA 4N0DA 4HDCA 4CRWB 2V3CC 4QGAA 4Q4HB 4ZDJA 1GFIA 3FMOB 2CCKA 3PR1A 4PANA 1M74A 3MWYW 5GJWC 4LHXA 1G21E 2Z6VA 4PZYA 4C7OB 4XVRA 5G3ZA 4LCBA 1E2NA 5AJXA 5HR5A 4KFUA 3HPRA 2W6JA 4Q5IA 1FNMA 3T35A 1E9DA 2CLDX 3TK1A 1I2MA 4HZUA 3DMDA 4XVQA 3FB4A 3B78A 1JEEA 2PJZA 3RHFA 3MLEA 2JLVA 1CRQA 3SYLA 1N6NA 1P2UA 4P31A 3THWB 1DG1G 2RAPA 1R0WA 2ZUCA 2ZE5A 4KLZA 4U7DA 3KB2A 2P0EA 1G1MA 1TL7C 1YQTA 4JJZA 1KO5A 3VX4A 3AVOA 2ZAMA 5LB2A 1LNZA 4DIEA 4BGDA 4ZCMA 1CR2A 4CVNA 4CT5A 3AVUA 1TQ2A 5CIWA 1P72A 4PHHA 3NXSA 2ZAOA 4MGYR 4MYUA 4C2TA 2O5VA 4FWIB 3U3KA 3CW2A 1XPUA 2CE2X 2R62A 3KQUA 1ZJ6A 1EESA 4JLAA 2R9VA 2GJAA 4IVPA 4PC2A 1Q22A 5AUQA 4PO1A 3EZ6A 1XTIA 4PPFA 2ZR7A 3GLGB 2FX3A 4P4TA 1KNXA 4MRNA 3AKEA 2FE4A 2QPAA 2CCGA 2CMKA 3MWKA 5F9FA 2FSGA 2VHJA 2Z43A 4G5RA 4RD0A 3EAQA 5JZVA 2BV3A 2CDNA 3QG5A 4IVRA 1F6BA 1E9AA 1T8TA 2JJ2D 2QP9X 5JS7A 4O0MA 2WOOA 3TJZA 5JJLA 2Z4RA 5D3QA 3L8ZA 4C0HA 1JI0A 3U4QB 4G5SA 5C2JB 1XTRA 2XNDD 2D7DA 1FP6A 3DO6A 4R9UC 2HLDA 1AIPA 2BBTA 3FMPB 2ZITA 4TMVA 521PA 1M7BA 3D8BA 3LX5A 4JKYA 1DOAA 1KSGA 2OCYC 4LDJA 4YQFA 4AY2A 3BB1A 2CEAA 2HT1A 2NMVA 3TRFA 3LVQE 3T61A 4DB4A 1NBMD 3C7KA 1ZC3A 4AI6A 4LOAA 5CDFA 4AURA 3GJXC 1UBEA 2JJ2A 4JBWA 1CJVC 2FF7A 2ZJ2A 4TT3D 3GFTA 3IHWA 4B43A 1S8FA 2F43A 4X8HA 2CLCX 1WXQA 4PO9A 4IDPA 3PEWA 3CO5A 2VHTA 2WVJA 1CKEA 3BRWD 1FPMA 2WM9B 3IO5A 4M9XA 3RDPA 2ZS8A 2FU5C 4KAXA 1NBMA 1S9HA 3CZPA 4V0LA 3L8YA 1E0AA 2GJSA 2WWXA 4OHWA 3AUXA 3SR0A 2JA1A 2J5XA 4JMPA 2ZS9A 4A9AA 3LA6A 4Q7LA 4PC1A 4IJMA 4MRRA 3K0EA 4PQYA 3AKYA 1MT0A 1PJRA 1QHIA 3C15C 1IHUA 3I5YA 1R5BA 3CONA 2ZANA 2ZETA 1E96A 4M1OA 4PAMA 1P9NA 4PR0A 3QXXA 221PA 1QHGA 4S2EA 3MMPA 4NONA 3H2YA 1SULA 1IY0A 2IYVA 4GZMA 3W6PA 4B3BA 4DWJA 3U3JA 1E2GA 5KDOA 2IYQA 1BYUA 4RFSA 2O8BA 2BOVA 5HE9A 3L43A 3QE0A 1NIPA 5B58C 3RS0A 3VR4A 1SVOA 2KJQA 5AUNB 2ZXUA 2C78A 2P5SA 3B1WA 1CJKC 1NJFA 1E6CA 3SBDA 2O8FA 2QI9C 4B6FA 1D2EA 2KBFA 4WXRA 1LW7A 4Q7KA 1RRFA 1T3HA 2VL7A 2WWWA 2ZRHA 3I73A 1IXRC 1YRBA 4FCVA 4TSFD 5SZIA 4RJLA 3TQFA 4WW0A 3EZ7A 2RGXA 2AD1A 3GLHB 3I8SA 1W44A 3DDCA 3PITA 4TLDA 1XXHA 1VECA 3ZIAA 2PLRA 3CM0A 3I8XA 4DLRA 3O8RA 1JR3A 1KDTA 4NHOA 4EQ6B 5J4HA 4XD7A 3LDAA 2GJKA 4BFZA 1HE1C 1VCMA 3VU9A 3C5CA 2O0JA 4BWYA 3U7EB 4F4JA 4JLVA 1F5NA 1WE2A 3B5JA 5JCZA 2XZOA 4RD2A 4AG5A 4EKDA 3MD0A 3G0HA 3KFVA 2WJGA 2YINC 1LS1A 4TMTA 1QHYA 4EPTA 2B6HA 3S1AA 3OEHD 1KI4A 5F98A 2BCGY 1UKYA 2R65A 2R6AA 1Z83A 1SXJD 1VHLA 2AFIE 4ESVA 4BPBA 2BKEA 4M9QA 1ZM2A 2QTHA 1IJFA 2YKGA 1N5KA 2WWIA 4LJ8A 5CDFE 3IKJA 5BN5A 2YNMA 2OT3B 4HAXA 3Q5DA 1KO4A 4ZDIA 3D3QA 2CHQA 1ZW6A 4YDHB 3P27A 2WWFA 5CITA 5DLQC 5EE5B 2AFHE 3CR7A 1TEVA 1Q1QA 4HAYA 3WP1B 4TLBA 2VLIA 4OI2A 3WYGA 2RGNA 4RZ2A 3L0OA 2JIZA 3H0KA 4C3ZA 5TV2A 4KHZA 2A78A 2R44A 2ZYVX 1RRCA 2QNRA 4PSVA 1HT1E 1XWIA 2GTPA 3PUZA 1Z0IA 3T5DA 4A0FA 2VHCA 4OYHA 4JBYA 5DHAA 3ICQB 2HEIA 4YMTA 4D2IA 1ZCBA 5FPHA 1ZU5A 5AUPB 1F2UB 3SFVA 4QJ4A 3VAAA 3W5IA 3GMTA 3JZMA 3I1FA 2XOKD 2O0KA 2QZ4A 2OFOA 1N0WA 1N5LA 4Q19A 5BQ5A 3ZVLA 5B57C 1BH2A 1E94E 3QY0A 5DI9A 4G0NA 1XU4A 2REBA 5EP2A 1NY6A 1Z08A 4QBGB 4O25A 2BDTA 2L0XA 1UEJA 1ZMXA 2WSMA 2AWNA 5EXPA 5FOXA 3T06B 1KDRA 4M1MA 3EA0A 1RIFA 1Q44A 1U81A 1KMHB 2PBRA 2Q9BA 3SC3A 3TIFA 3IHLA 2ECKA 2QAGC 1FX0B 2XOKA 1IJEA 4LYJA 4Q66C 3QEJA 1DEKA 4LC0A 1TQ4A 3VKWA 2PZFA 5L8VA 1KOFA 2QL6A 5FL7A 2GK7A 3PEUA 4OI0A 4IHQA 2VP2A 3FKSD 1KI1A 4US2R 1P6XA 4W9MC 2MMGA 4P4SA 3TE6A 1DARA 3PUVA 4ITRC 1OF1A 1QVAA 5CM9C 2KB0A 1FMLA 4CZ2A 1YZUA 4BLQA 2CJWB 2ZRLA 5FBRB 1ZU4A 4X8OA 2C96A 4YC7A 1JR3E 1P2TA 4L15A 3LBNA 3NBYC 4C0JA 2RH5A 5AJZA 1JAIA 2V7QD 3I62A 4WZBE 2G0TA 2QRZA 2HF8A 3AP2A 2LKCA 2YWEA 5CB8A 2O8CB 3SNHA 3R8FA 1DVRA 1MOZA 4X8LA 4HAZA 4B3CA 4MA4A 4A0HA 1KMQA 2RGAA 4TL6A 4OQFA 4NYMQ 4YMUA 4QBHA 2OM2A 4URXR 5K8IA 2QGZA 1XMSA 1RVDA 1GDDA 2VHQA 3ASZA 5C4GB 2QAJA 3GFOA 3LWNA 4Q00A 2BC9A 2FFHA 4GOXA 3X1DA 4O2LA 4MKGA
chains in the Genus database with same CATH superfamily
3LCMA 3V7WA 4F93B 3RADC 2VP9A 3HZRA 4X95A 4Q4JA 3TLMA 4H3KB 4O8ZA 1L5ZA 3EZXA 1WHTA 1UPUA 4QGSA 2DWPA 5EC8A 3I4FA 2X0RA 1SRQA 5EPOA 1ZH2A 1NZJA 1SAYA 5BYBA 5U4XA 2OK8A 3AM5A 4AP9A 4U4AA 3PQ3A 2QX6A 1JHYA 2NTNA 1K5PA 1NDHA 3IP9A 1GZUA 4Y2UA 4JBIA 3B6MA 4L5YA 4YJGA 1HSZA 1CQWA 4OKSA 5FKJA 3B1VA 3FZQA 2JFPA 2OAGA 3V3KA 3Q6IA 4JELA 3FZGA 2IEDA 2F3QA 4QGBA 1U0GA 2W6ID 1J2TA 2QNBA 4DSAA 2X9NA 4QATA 5MN6A 1LBTA 1XTTA 5BNFA 1Z22A 5F52A 3KHTA 1ST3A 4OMDA 5ELLA 1B0AA 3UQZA 1O6GA 1JXOA 3DAFA 2GXUA 1EX1A 3ANSA 1ZA1A 1GU1A 1VIDA 1C8VB 1ZCZA 2X5KO 4RTSA 1JTEA 1R64A 4WBNF 1P2FA 4BKOA 4B84A 4PAWA 3CZQA 2Q8PA 3ZBTA 3AEZA 3SC2A 2CK3D 4J90A 4M60A 1CUSA 1VPLA 4CMIA 4PW0A 1EFRA 4URWR 4CLEA 4DA9A 1MW8X 3A7EA 4FFBA 3TNLA 2PUEA 3AVXA 3R3YA 2Z0MA 4ZPXA 4ARZA 4YRAA 3R0XA 1SVSA 3ZCXA 3GUCA 1HQKA 4HQKA 1M7GA 1B42A 1WZIA 2WZBA 4GBMA 4XYMA 2FFAA 3HJAA 4DXAA 4B3GA 2P9GA 5IM5A 2F1HA 1YHNA 3V4RA 2YMMA 3WK5A 3RCBA 5BN3A 2LRHA 2X14A 5EMNA 5F2EA 1XMPA 4KR9A 3VPGA 1QK4A 3U7HB 1ZNXA 1FYVA 1CJBA 3T7AA 4EGJA 1DBVO 2CL0X 4OVKA 1NG1A 3H19A 1M8FA 4WN9A 2I91A 3GGCA 3WLHA 3PFFA 2ZT7A 1TZMA 2P7HA 3FN4A 2J0SA 1ORWA 2RB4A 4D9BA 1K0FA 3RSFA 2HLHA 1XVAA 4EYGA 1Z4IA 1SD5A 4HGNA 5K3DA 4A82A 1UMDA 1N3IA 3DR5A 4MYSA 1F14A 4YRIA 4DY6A 3D6AA 1JJFA 3DAGA 4MITA 3RJ5A 2W2VA 3ETCA 4NOMA 3OJOA 4DNQA 5KNCD 1F06A 1GRNA 3KKEA 3RVBA 3HUDA 5C3UA 3U37A 2VHUA 3Q7QA 1C0KA 4FKMA 3OEWA 4HHEA 4TUYB 2Y2VA 1E5TA 3NHRA 2I8CA 1FB5A 4KQHA 5FOWA 3CPEA 1QFSA 3D8TA 3H6KA 4IMRA 3MUOA 3QBVA 5DGIA 1ZSYA 5D01A 1XRMA 2RB5A 3IVAA 4C05A 5KINB 1E8NA 3C8DA 1Z7GA 3KDPA 2LCQA 2HFKA 3R6LA 2RI1A 4MINA 5E38A 2DR3A 1KMIY 1KMCA 2PVSA 4L7QA 5IT9A 3ROEA 4QXRA 5LIPA 3EUEA 4BYGA 2JDID 4BU0A 1N6IA 1R0KA 2XUPA 4QD3A 5LZ4A 1I14A 1J1IA 2VH5R 2K7FA 2CXOA 3ZCPA 2CL7X 4M1EA 2HWYA 1E3JA 4F4DA 1E4EB 1SFRA 1W59A 2ZTLA 4EMBA 1FUKA 2B7LA 4QXAA 3WYBA 3SZGA 4DCCA 3SU8A 2DKOA 4LNAA 1R8SA 3LX6A 3JYLA 5JARA 5AVRA 1L1EA 2WZQA 4LDZA 3AHEA 1EVZA 5BUCA 3G2KA 1J8QA 4M9ZA 3CKKA 1GNTA 2A9QA 1V5GA 5CVEA 3G0BA 1ZYUA 4D8WA 4DLKA 4CIVA 4Q7QA 1ZVJA 4DWWA 3WBJA 3LLMA 1V8BA 4LCEA 1M2OA 3U0VA 3JD3A 5I5EA 3Q6MA 4HLCA 5CFNA 3V5NA 3C3MA 4WOJA 3JALB 3SXPA 2XDQB 4HDRA 3AFGA 2D1YA 3WJAA 2YYSA 3TXAA 3VC7A 2JBWA 3AEUA 4IQ0A 2R4TA 2GN2A 3FUWA 4KBFA 4WNIA 3S8MA 3ETNA 4J1SA 4RXMA 5GZ3A 2FR0A 1FE8A 1S8NA 4HNAA 1ZM7A 3D8HA 2XUOA 3KPJA 4M8SA 5F2KA 1MVNA 2Q5LA 3BXHA 2WG1A 3TZBA 4J1NA 2H7YA 4CYMA 621PA 3IKMB 2CZQA 4DVGA 5HQ3A 1NSYA 3L7YA 2FRDA 3BWYA 3KC2A 1XFDA 5K8LA 5KU1A 2J46A 1G8AA 1EFPB 4GFDA 2WJVA 4OBXA 3VR2A 4LYEA 1X86B 5DLPA 4M99A 4OAPA 4LC9A 4MUEA 2O7QA 4RDHA 4BVGA 4CNQA 4KRFA 4BO1A 1MEEA 3ESDA 1WXGA 3O9MA 4LOKA 1J2YA 3HYNA 1F7VA 3K5HA 2XMGA 2R00C 5LOVA 3JQFC 2PIAA 4NY1A 2GZDA 4QWWA 3GD7A 5FPQA 2IY7A 4RPIA 5B1IA 3JVEA 4DSNA 1W36B 1JZTA 3O4RA 4A3SA 4AG6A 1HR0B 3P0EA 4JSTA 3UN1A 2BMEA 2Y66A 1GY8A 2WICA 2HMYB 5FORA 4RD4A 4H27A 4YDQA 2HRCA 2HU2A 4E1AA 2GCEA 3MS4A 4JUBA 5EMLA 5JUWA 2FOIA 2GWRA 1Y7IA 1Y3FE 4I1OA 1TU0A 1TF5A 1US8B 3LWZA 5F76A 2AH5A 3JATB 5HBGA 2FLVA 5IU6A 4KQXA 4M6WA 1BIFA 5FJJA 3TF5A 1N2SA 2GBLC 2VDWA 3DB1A 1FJGB 4R83A 3C8HA 4WCDA 1UF9A 3ZGXA 4R8MA 4DUGD 2ECFA 5HSGA 3L07A 4ZC1A 3SXUB 5C9ZA 3VPCA 2IYXA 2W6PA 4D44A 4MCJA 4EKGA 5LD2B 3EHDA 3P0FA 4F71A 4YPVA 2NGRA 2A35A 4OI1A 3W8NA 4DUPA 1A4RA 4FX5A 3C43A 2WYWA 2IYLD 3L7KA 3CLTD 3LV8A 3NC1C 3R0QA 4QICA 3VBEA 4QT0A 4P33A 4ZVKA 1RM5A 2GCPA 1KY3A 2H18A 4LUCA 1ICIA 1AM4D 4E5UA 4QOEA 2V54A 4UEWA 3VBCA 1XZGA 2M2IA 2ERXA 1KK2A 3HZOA 1NNEA 4S3MA 3LA8A 1BKYA 3GCZA 1T36B 4YT8A 5THQA 1R18A 4HQOA 2PKWA 3KYJB 1L3BA 3DEZA 1N5JA 5FOQA 3MA0A 4ZOLF 1QJ4A 4M54A 1T5TA 3GMSA 2X8WA 2ZVJA 3I9MA 2ZFUA 1YQQA 1IOZA 3PFGA 4ZI7A 1JXQA 5BR8B 3VISA 3L0ZA 3EZNA 4RELA 1AZWA 1QWOA 3L6UA 4WE3A 1G8KA 2IU4A 2Q50A 3GELA 3JYNA 4MJ3A 3GPDG 2VBCA 4FQ5A 1IQ0A 2QMQA 4HN4B 1GQ2A 1JYSA 5FWYA 1SH7A 1LLUA 5JVDB 3L0YA 3PFIA 4B7CA 4MPDA 5LQKA 5D5PA 1CCWA 3WA7A 1IFXA 1GGKA 4CHGA 5LSAA 3OQPA 1PR6A 1U7TA 1Z2PX 3PV0A 3WIDA 5JI2E 1MO3A 4D9GA 2BGWA 2PRJA 5JFOA 3P0IA 1NU6A 1R00A 1R4NA 4IXWA 4TTPA 4CMKA 4L28A 2PL9A 4IMPA 1JFRA 3AWIA 3L7CA 4PFJA 4CR6A 1LK7A 1V43A 1U3DA 3BL5A 1N7HA 4MQLA 3W77A 5L7YA 1EUQA 3EXHB 1FYXA 3A1WA 4CLHA 1V7ZA 2YRWA 4R6WA 2PNJA 3THYA 2BTEA 3R9XA 1VJ5A 2QN6A 2E55A 1DC4A 2D0IA 2RHCA 3HUFA 3DQQA 4E07A 4MARA 3FD8A 4K03A 4Q24A 4MTCA 1DAIA 4MVJG 1NN0A 2X5JO 3GD5A 4FLFA 4HAUA 2AJ8A 1O9HA 1I10A 3QX8A 1B93A 3O95A 2YN0A 5FV7A 1F0KA 4A03A 1NQUA 4R2JA 3L1IA 2PL1A 4Q4AA 3VO8A 4FKZA 4OQZA 1JILA 4EB0A 5FXMA 1A5ZA 4IUDS 2QTTA 3VZCA 1VE9A 3K53A 4N47A 1Y3AA 1H2BA 3ZTWA 5EGNA 1X1QA 4F60A 2BFWA 2E21A 4DV3B 3C1AA 1XRQA 4FHCA 4TPKA 1DJLA 3LT1A 1WB6A 2O48X 3BCSA 3EBOA 2CHFA 4U9HS 5D85A 4CIBA 1WZNA 1T29A 2ECOA 2X19A 4RFVA 4D81A 4MP3A 4WNCA 1L4EA 3QJYA 3DZFA 4OGWA 5LQMA 1YVPA 2V6BA 3LQ1A 2JIBA 2X2EA 3C1TA 2QQFA 4IF6A 2W7TA 2OGZA 4QECA 4O4LA 2Q6KA 4RANA 1XU9A 5E95A 3S1LA 3FDZA 4RS3A 4OFBA 3LIPA 4X5OA 1IB0A 5JCPA 1UXKA 4LTDA 1PZXA 1WDMA 1JU4A 2AV6A 3SYNA 5F23A 5EIBD 2RGBA 2IS2A 1Q57A 5EZQA 1MMFB 2WT9A 1JN0A 5A7GA 1YL7A 3WOVA 1QG2A 5KPJA 1E3LA 2GYVA 3SQNA 1VG9B 1QG0A 2FN9A 2AR0A 1BE0A 4GU5A 3D8SA 2G9UA 2PS3A 1IIBA 2YICA 3PGA1 3R7SA 3SCZA 1NI3A 1BDMA 4EF6A 1XTQA 2OUIA 3MF4A 4IHKA 1G19A 4P7GA 3KBOA 4WESA 4ZRMA 3ROZA 3RWMB 4MRVA 4WFJA 3DTTA 4X3PA 1Z0ZA 3PGLA 2Q9AA 4NV1A 1P9OA 1BOFA 1XQWA 4TSKA 1KZHA 1QPZA 4J7CA 2PGDA 4ISCA 8GPBA 1HFKA 3TN7A 4PPQA 3N76A 1EFUA 2CXNA 2VAVA 4MWTA 4TKUA 4B48A 3P32A 5DNCA 1PEAA 4KO2S 1EWTA 2VWHA 3E5RA 4IOKA 4AY5A 1WXFA 3HU2A 4IH4A 4JR1A 4KODA 1CHDA 3WLSA 4FU0A 4C03A 1Y1TA 3ZCUA 1E64A 1NM5A 1VM6A 3Q85A 4MQBA 3W8DA 1GLGA 1V37A 5PNTA 3GJ6A 2NYAA 3MWLA 3WDLA 7AT1A 1Z6QA 5H5JA 1IVNA 5LXTF 1RHUA 2G1JA 4X97A 3GAFA 3BDAA 3EQ8A 3MJDA 3RSOA 3TEMA 1F38A 2AG8A 1T91A 3JQ7A 1C1YA 1C7EA 2CMFA 1JHAA 1NBIA 1OU4A 2WD9A 3E9CA 4M0FA 1W46A 3QVJA 1FL9A 4MCHA 4NESA 4G56A 4E5DA 4LGMA 3T7RA 2QZSA 1T4CA 1Y8RA 2CUKA 2FXIA 4QXMA 3UAXA 1NP3A 3HYTA 2H9IA 3T6KA 3U9SA 1SO8A 3AR8A 3P7MA 1QS0A 3IPYA 3QEAZ 3QBTA 4KV7A 3RI3A 3O3MB 4CT0A 4ENWA 3R7NA 1UJ2A 3WMXA 4OQMA 2OLJA 4BFYA 4OGGA 1FY2A 2B83A 2CZCA 3TM5A 3A1CA 5DYIA 4IZ6A 3C7AA 3M6WA 3UKOA 2C5EA 4BFLA 3P1JA 4CQJA 4F96A 5TRTA 2IXGA 2DUJA 2ODQA 4TRMA 4D9KA 5GZ1A 1QBKC 3L4KA 4BQRA 3KL4A 4DN6A 2XBMA 1TM5E 3Q4GA 1IM5A 2CWDA 2VHYA 2VUIB 2W98A 3PSAA 4P8RA 2QVCA 4B2YA 5JD6A 2QTAA 4W82A 5HX7A 4DEXA 4JX9A 4F4UA 3KHSA 1FXSA 2I8LA 4P3YA 4YGYA 3M1AA 1W5TA 4YCMA 1GKYA 3D31A 5CT8A 3CV3A 1BE6A 4ZAWA 1DMRA 3A9WA 4XLZA 3H16A 1BU5A 2WWRA 2OZPA 2Z98A 4FKBA 5EL0A 5AVKA 1EZZA 2ANBA 1WUHS 4I55A 4OHCA 5AI9A 3R76A 3THOA 3O8CA 1NSTA 3H7IA 4YONB 3GJSA 5AM5A 3HJHA 4P7BA 2QLNA 4PZLA 1GPH1 1R0CA 3QPVA 1KJWA 1H5UA 1CW2B 3SZMA 4I36A 1PWHA 1UKEA 4ZMRA 4R9SA 1FQKA 3QKWA 4TT3A 3C6BA 5JAMA 5JV5A 4C0BA 5B1DA 1MVLA 2F48A 2PA0A 2OBLA 5FBZA 4KNVA 4LNUB 1Y3IA 5M34A 3GRUA 4LISA 3CH7A 2QUZA 4RKRA 1DELA 2O7SA 3I53A 5DNVA 3ZJTA 2G9ZA 3ZGNA 2BEWA 3DZBA 2Z5LA 3FR8A 2GM3A 3B13B 1XLWA 4Y0VA 5P8WA 2M6RA 4KIUA 4MHSA 1UEIA 3ZHXA 4EAAA 1JAZA 2XT6A 4KR0A 1YR9A 1ZQ1A 1EX7A 4PXAA 2OYRA 3RASA 3RVOA 4TZKA 1P2GA 4ZAZA 1X74A 1Z2EA 3AR4A 4MW7A 4OL9A 2J3KA 3MUEA 1P1JA 1X80B 3VFDA 1ZI6A 2NZ2A 1V3VA 4ENVA 4ZFNA 2K4MA 3QMVA 4J91A 3ZV7A 1XMVA 2Z8ZA 1U1CA 3DPIA 3R7WA 5FHQA 4YJ2B 1KJZA 1IJBA 1YRLA 1CT9A 2ATXA 2OE2A 1NI5A 3EVDA 3R09A 5HILA 5IS2A 5T8KA 3I1JA 1P7WA 4E15A 3DEFA 1A3CA 4N82A 5KYXB 5F3WB 5LP6C 2UUBB 2VPTA 2ZR0A 1XRLA 2RG1A 3BE8A 1UQRA 2Z5FA 1E2HA 1V8FA 1CQIB 4MV1A 2FVYA 3G59A 1JDUA 1DBSA 3WBFA 1NE7A 4FFRA 2P0YA 4B6GA 3KVRA 4LX8A 4DHEA 3HN7A 3ITDA 4C6RA 1FW8A 5BT8A 5I7SA 2CKMA 3NT2A 1F4LA 1SUSA 4XLTA 2WA1A 4FBGA 2QT1A 2VQSA 5KNCH 4OHYA 2IXBA 4MRMA 3TMYA 4LQCA 4O2RA 4UNQA 2ZIWB 4K9SA 2H9YA 1U2DC 1JH9A 1J49A 5BNZA 3QVVA 3FETA 1GGHA 5E7JA 6YASA 1E1LA 3TQQA 1E7SA 3JZDA 4CM8A 4EVSA 4FOTA 3AVTA 4NP6A 1U0OC 3DLHA 1E60A 1U1FA 4RFSB 2IBSA 2D5IA 4Z6KA 5I9SA 5IT0A 1KGDA 3KAQA 4JAVC 4W7IA 1GPMA 5LQSA 1NPYA 1KJNA 4RF5A 1RJWA 3LVRE 1P60A 3ZEAA 3E1KA 1U2GC 1DE0A 1O6BA 2PN1A 3WG9A 4EEXA 1U7DA 4LWQA 4BAGA 2O8FB 3NUZA 1OFGA 2W4IA 3CH4B 3CUEF 4HNHA 1JALA 5FOTA 5CG1A 4EYQA 3L4JA 3ODPA 1UBRS 2NP7A 3LVBA 1CQJB 3U6BA 3ADDA 2JI8A 3ROKA 3KYCB 3W2HA 1MDBA 2QI9F 3LX8A 5E1BA 3ST7A 1N57A 1Y7LA 4F6RB 1T9GR 3AF2A 4I50A 4LGCA 5H1YA 2P6OA 7ABPA 5F3DA 3TZCA 2QRUA 1N6RA 2ZBQA 4X3OA 1FFBA 1R4MB 1Y98A 4K7JA 2ZRGA 2BFOA 3CWZA 4TTSA 3RRJA 4YMHA 2I34A 3RAFC 1UM9B 4ZDWA 4D9JA 4E1VA 1N34B 2D2FA 1PUXA 3CWQA 4LZZA 1YKSA 5DM1A 3BXZA 3R5JA 4P35A 2O4UX 3UENA 3KWLA 1JE1A 2F1IA 5EZYA 5K5EA 1MOQA 2VZEA 4QARA 4CFSA 2DR0A 4EGAA 4RK1A 3PJRA 3FCOA 3BFKA 3H8JA 2YXDA 3DOCA 4YO7A 3F2IA 5CD1A 4L27A 3LPAA 1TK3A 4N18A 3QU2A 1ISPA 3L4SO 3FLBA 3AM4A 4C3VA 1TT5B 1EZ1A 1M0SA 3OT4A 2OENG 2P90A 2FPXA 4BJHB 2Z6QA 1VG0B 4K6MA 4QVKA 2KHZA 3FIUA 2NPOA 3HCDA 3SYKA 4K1LA 1CZOA 5BOSB 4B85A 2EZTA 1GQFA 4Q4DA 3VDRA 1I4TD 4L08A 3WGYA 5TJ9A 2XUQA 4CF5A 2BEVA 2NZJA 3UMMA 3MEQA 1J5EB 4DG8A 5TMDA 2BM0A 1R6XA 4UU0A 4MRAA 1WS6A 2O8NA 2JFVA 3DVAB 4X1YB 5G2OA 3D6VA 3IHKA 4CV3A 3LCJA 4RAQA 5IHXA 4GSLA 1PHPA 1M34E 1LLFA 2G0AA 4OUDA 4TX1A 5CLHA 3H87A 2C3UA 1YJ5A 5FLYA 4LHSA 3M4NA 4Z4GA 5H80A 1R37A 1CY8A 1UKZA 2XLCA 1Y6FA 3ETLA 1K6XA 4F6LA 1ZUHA 3B2NA 1OAOA 4QBTA 4LYDA 4ZCSA 2OZEA 4V38A 3OBBA 2C9OA 3R8CA 3RUIA 1BTOA 1TEZA 3EZFA 1ZJWA 1F6WA 5FDFA 3DE0X 2RGCA 1LNQA 1W0KA 1FDIA 4PNEA 2BY4A 5AW3A 3TQOA 1AKEA 2DYKA 2WD7A 3SYRA 1K6JA 4QBIA 3Q0EA 5JG7A 2B8TA 2AYXA 3ZIUA 2BONA 2E1RA 3VTZA 4BWGA 4LK2A 1LBHA 3I6QA 3QUCA 4JU9A 4OHVA 5H83A 4JV5B 4L16A 4DT1A 1Q77A 4QPPA 3M1LA 3TLXA 3KQKA 2XVAA 3KEMA 3QWBA 1IZ7A 2FYTA 1JHOA 3HQ4O 2P2CA 4Q4LA 4XSGA 4YALA 1E2JA 1T8WA 4KSCA 1X2EA 1EJ6A 2XTZA 3MWGA 5AESA 4Y2SA 1UADA 4B4OA 1CBUA 4KMMA 1V7QA 4QL3A 4ZO7A 2TSYB 5F78A 3FSRA 5JSHA 1JEDA 5JZMA 4ZVSA 2IS4A 2V7QA 1XA3A 3CX3A 1J22A 3ER6A 3W5CA 1PR3A 2WYVA 4IS3A 4P4SB 5H02A 2NTJA 2PU7A 4XGQA 3NM4A 3HMKA 4JBHA 4BO6A 1Z56C 1HTWA 2RGEA 5GTDA 5L4SA 3A9CA 1UBTS 2CFTA 2XF8A 4MUJA 3DVRX 2FZLA 1XK6A 1RWVA 2W00A 3G88A 5CH5A 3OPVA 5FUBA 5DOZA 1SXJE 1C9MA 1G7TA 3NOOA 1N0VC 2P77A 3JQQA 4G84A 3H2BA 4IXTA 4K05A 4JT8A 4TYPA 4YTEA 2YN4A 1OIVA 5GONF 3VH1A 5EG5A 1AKQA 2ZWVA 2CDCA 3NASA 3JQGB 1NURA 1XQ9A 4HWPA 3VSCA 3MCZA 1C4XA 3BWCA 4DUYB 5G3YA 1P0FA 2ZUVA 4H7KA 3OEED 3LDUA 3R0IA 4HLQB 4AUNA 4F2WA 5FYDA 5JU6A 4Z4IA 3ABZA 3B3AA 3CX4A 4FNGA 1D09A 3DQZA 4IKPA 3T4PA 2CSXA 2GCGA 3HJFA 5IN5A 4CIXA 3TNFA 2NO1A 3E7FA 3OU7A 2V7XA 4GYJA 5HTOA 1ZWKA 3QPAA 4OP2A 4GKAA 5HJ5A 4LI0A 5EZSA 3JAWA 3T5MA 4JXZA 2AN4A 2CBGA 4E08A 3K6SB 2W6IA 3FF1A 3ULKA 1YIDA 1BN6A 1QBGA 2WU4A 3IUYA 4AJJA 1CRWG 3KO8A 1IHPA 2AHOA 2BF7A 3HWRA 4YRRA 4AUMA 5KYWA 4ZI2A 1DHTA 3AI1A 3OQVA 4RENA 1QG6A 5KQPA 3BFPA 4ND8A 1MO6A 1ICEA 4R31A 3VZPA 1BD4A 2JI6A 5ITWA 4DMRA 5D00A 2FFBA 2CK3A 1SHZA 4AL4A 2PMDA 1HLDA 2H5JA 4B71A 3CVYA 1JWLA 2OESA 2XLBA 2V03A 5J5VA 4JI8B 1V7PC 2YHAA 3K6RA 3AQIA 1BS1A 1MA3A 4LYFA 2AJDA 2IEBA 1OA0A 3GDGA 3ZU2A 1IDN1 2EQ5A 3A4TA 1AUPA 5ITSA 1PX0A 2ONZA 1SVLA 3CNOA 3AHCA 3GEIA 1GZ5A 4KE8A 5EP3A 1Q84A 5JJ5A 1E0SA 1UP6A 5BSUA 2J7KA 1QQTA 2CFCA 3AOEC 5GJCA 2Y6VA 3PWSA 1FSFA 3IAFA 3LOQA 2JVIA 4CMEA 2XCUA 3OWOA 4H1WA 4Q1EA 5AW8A 2FQWA 3MTBA 3DZCA 3OWXA 2YJ4A 2NTEA 5EVJA 1IN1A 1E3WB 1GPYA 2B3TA 1ZK2A 2PBZA 3UXMA 5GM1A 1T9HA 5F5LA 4Q6WA 1TU4A 4WJZA 1W85B 4MQMA 4ND7A 5CT5A 3VPXA 1GFWA 4NKRA 1N7GA 2PH3A 2ODNA 1BFUA 4I1YA 2HA2A 3QELB 1D6NA 3UKDA 5KOJA 1PTKA 4HWTA 4U7TB 4JJKA 5KNCA 2OOKA 5AW1A 2VTVA 2XDAA 1HUQA 4UHDA 3FUVA 4XFDA 5LLSA 3AHFA 2Q9CA 4JSYA 4LXTA 4EY8A 1T9CA 2JLAA 3AP3A 3LU1A 4Z9FA 1N5DA 1TQ8A 2G5TA 3H6HA 3PHBE 5JNTA 2HN9A 3S2ZA 2FPGA 2OYCA 3QE4A 4C5AA 4ZVQA 3GJQA 4R8KA 1C30A 1NV9A 4ESEA 1CDOA 1OBHA 3NB0A 4IIBA 3WYNA 3DLIA 1H4VB 3IKVA 2BGGA 1O97D 2WYIA 4F45A 1MCZA 3AY6A 4UUQA 5HQTA 4LTNA 1PLJA 3CMCO 3OM9A 4GGPA 1P0QA 3ZX5A 3RU2A 2ZYAA 3HEAA 4G23A 1YRWA 3CW9A 3ZCTA 3FOCA 1W36D 3DVLA 2I1QA 2BEJA 1RHMA 5K0TA 2GBFA 3V4LA 3W0LB 1OBOA 4AJOA 1U80A 1YV9A 4BMSA 3RC8A 4OXYA 5J2TA 1GYQA 1Z74A 1AHHA 4MV3A 1AC5A 2DPGA 3AONB 1E20A 1QHHA 2WFMA 1X2BA 3A3KA 1Z3IX 3FGPA 4JBXA 5ADHA 2FKAA 4DPKA 1R6UA 1T25A 1M54A 3LYLA 3W34A 4LXQA 3QKRB 4I3GA 3NZEA 4UUAA 3SE7A 5EHXA 3MXOA 2Q4OA 4C20A 2A6PA 3BVPA 4ROTA 2Q7OE 1B43A 1RQXA 3QP9A 2NUAA 3L6DA 1YVEI 3T5BA 2FPLA 1MLDA 1PW7A 1BA2A 1PDOA 5COBA 3GGJA 3BBPA 3RVSA 2KWIA 1LPAB 1A5BB 1WBJB 2XRMA 4QOHA 4AD8A 2MSNA 3C6QA 3HACA 3L0IB 1A7UA 3JTEA 2BLNA 2B1JA 4CGYA 3PX7A 5EUQB 3O38A 2D2VA 5EQTA 3ZUPA 1NJ6A 2QN8A 4LZWA 2G17A 4KQ1A 1ZVKA 2GILA 4U7WA 1XEXA 4M2LA 5J9FA 1U0RA 4Z4EA 3PZRA 4H1VA 1AKUA 2NU7B 4JUFA 1AUVA 1MH1A 2O20A 4FQ8A 4YVFA 3TSCA 4CV1A 4ER7A 1ZHHA 3OJEA 3LRPA 1N5RA 3EASA 3M2PA 3P2YA 4Y2VA 1IZ0A 5BV8A 4HLDA 1DFGA 3DC2A 4KLNA 4QHSA 3U81A 4RORA 3P2OA 1IHYA 4Y7DA 4XM1A 3RFXA 2CMHA 1IQRA 2J7PA 4XW2A 3KBBA 3W6OA 3I2KA 5M2QA 1AHPA 4WEOA 4UULA 2CHGA 4N0EA 4U6QA 1BRMA 1J2JA 1EE1A 3I1IA 1EP9A 3NBXX 3QTTA 1B26A 1G6OA 1R6TA 2VYVD 3GI1A 1EGMB 3K3PA 3O3OB 1KF0A 4ARSA 1EDBA 3AVQA 4BIIA 1D9ZA 5EXDA 1UDAA 2D5LA 4K26A 5ER6A 4DMKA 1PAUA 2RH4A 2ZI7A 3M4JA 1NRJB 2QXYA 4HYTA 4UTZA 2WF6A 1Z0FA 4MMZB 3L8FA 1TJYA 4BAUA 2NU9B 1AKMA 4UDNA 1EUDA 4DVJA 2Q5EA 4MV9A 2OO7A 4AUKA 3ZXSA 3THXA 5JRZA 1NVAA 1KYZA 4YP1A 3D81A 2VYQA 5DCUA 4B2IA 1E1DA 2ZRPA 4OB7A 4Y2JA 3V8NA 3ZD6A 1SUIA 2J45A 4IEIA 1PK9A 3HR8A 2YYAA 3UYLA 4PM4A 5BOVA 1MB9A 1RPNA 4IYRA 3PHCA 3FTFA 1K66A 4FI3C 3TQSA 4JEUA 3GLFA 1RWXA 1RYNA 3M9XA 1D8TA 3IIIA 3NBUA 3TBFA 1E2DA 5KJ6A 3H1BA 2WHQA 3BIJA 5CFRA 2ZAIA 5KS2A 4EPVA 1N33B 2I6FA 4TMWA 1GNVA 3COZA 3I23A 5JHGB 4G6ZA 3LP8A 5CFOA 2XWBF 1BN7A 1VL1A 1FW6A 2P2ZA 2PEZA 2VJYA 3R3ZA 4H18A 4IFIA 3RBXA 5BRNA 4R8VA 3V1MA 3M49A 5AVXA 1IG0A 2LE0A 2FG7C 4UCXA 1UDXA 4PYLA 3ZWAA 1P17A 2PMFA 2HJVA 3I9FA 2VFAA 4GOOD 4OO3A 3RUAA 3X2FA 2HQSA 2WJIA 2C3MA 3Q3HA 5F7JA 2GNAA 5KWVA 5GP1A 2B20A 3U44A 3FYHA 2HWWA 4DLYA 2I3ZA 2KPOA 3JQAB 3LBIA 4X6XA 4BGUA 6REQB 1GGNA 1J23A 3GR6A 1JMYA 3THRA 2XYHA 5CAEA 1MABA 1RRKA 2QTVA 3DXXA 2QPOA 2B4KA 2RI6A 4PEVA 2CHEA 1KJIA 4QEZA 2Z04A 1IOLA 5HFJA 3WLAA 1MO4A 1D2RA 3IVXA 4E94A 5EUBA 5IAOA 1QZXA 3WAGA 4AMGA 4DDTA 2V98A 4WDRA 5K8VA 3QVSA 5IZCA 4EOGA 3K30A 3FIJA 3OY7A 2O2XA 1GQSA 2E5WA 3C7TA 3BGVA 3IR5A 3S81A 2VR1A 3DNPA 1OLOA 4QFMA 4BNUA 2VSXA 1R6DA 3WLFA 1EVQA 3HDYA 821PA 5M3BA 1NJ8A 4UZFA 3WO0A 1TAQA 4G37A 3NBZC 2F64A 4WWHA 4UNPA 4NYMR 3O6VA 1K9SA 4MRSA 2TS1A 1BH6A 1Z6XA 1G8HA 3AH8A 2F4NA 1V3QE 3RIHA 1JTFA 4HQ0A 1R9JA 1ODLA 2HBQA 3F8WA 4JGIA 4K8OA 5H3HA 5MGNA 5JE8A 3IDQA 5J59A 3GWZA 2ZROA 4DGQA 4CUZA 1SUBA 2GXQA 4RX1A 4HF7A 4G1VA 3BIXA 3LAWA 3BMOA 4M8LA 4MLPA 1UBFA 1SRRA 3NHMA 3FWPA 1M1UA 4H16A 3T9FA 1IHDA 1HZZA 4OK6A 1ISJA 3BE6A 5JMPA 1XMJA 5BWMA 1XNJA 3W6ZA 5AUOB 3B1JA 1A8PA 1Y6ZA 1ANKA 3DONA 2AUTA 3E05A 4KH1A 2VQEB 3LSTA 2IYAA 1U1IA 3EFEA 5JJKA 4KVGA 1DV1A 1DUVG 1H1LB 2I1VB 1BMTA 3DTYA 4FYHA 2O52A 4ZALA 1OX6A 3LUFA 3TCNA 2VQ3A 4OA5A 3BCUA 3ZU5A 4C14A 2I6UA 2IEAA 2GF9A 2G08A 2H16A 3N8KA 1MPTA 3AESA 1A95A 1OW3B 1MX1A 1WY5A 2HQOA 1SUFA 2P9BA 4OF4A 1C8LA 3IDSA 3R7DA 3EPHA 1BDBA 4C08A 2H7VA 3LGSA 1UKCA 4L9AA 2QN2A 3A11A 1L3CA 1SBQA 3SR4A 1UBGA 4F5WA 4A2QA 4YRQA 4D8YA 2IPAB 1NASA 3RJ9A 1JLHA 2Y67A 3NWOA 3DMTA 4GBJA 4KWTA 1I6KA 2BZGA 3BE5A 4D0LB 2IQIA 2BGIA 3KV1A 4CL3A 4IIEA 1QSGA 1Q91A 3LCRA 3AR2A 3TRJA 3G9QA 2XXJA 3IV6A 2JHPA 4R8SA 2EP7A 4GZ3A 5BQFA 1E69A 4Q1BA 1XJCA 1PVOA 2VDQB 5TQJA 1X1DA 1H65A 4O2BF 2OCDA 3WK4A 4FC6A 2NTYC 3G2QA 4MWZA 1L4GA 1BVYF 2HA5A 2M1ZA 2PEYA 1FDOA 3PT5A 1KJYA 1ZM9A 2PX5A 3VKUA 3LCVB 4S0XA 3DV2A 4FUQA 3R3XA 4AS3A 5TQ0B 3RYFB 2JKVA 1PR5A 1VKZA 2C7VA 1A9PA 1Q7GA 1TADA 1N3LA 1YGYA 2AXQA 2JGEA 2YZ2A 3RUDA 5A2GA 5LP1A 4EHAA 3ER8A 1SEVA 3ZWWA 2PU5A 3ZZ1A 1P4AA 3OJFA 3D0KA 2OAQ1 1WIWA 3VA7A 1KDPA 1ODKA 1SHTX 3NS7A 4PLHA 1GTVA 2ZZKA 3AEXA 3EZ9A 4PG4A 3SSMA 3RVKA 2XE7A 4L73A 4M9SA 3OIWA 3NUGA 2ZR9A 1ID8A 3HYLA 2P1ZA 3FCEA 3AF5A 4GR9A 5ECGC 1AG9A 2VRWA 4JJ6A 4UD6A 2KS6A 4Y7CA 3T9DA 4BFUA 3D2BA 2WA2A 5DBFA 3ZD9A 2W2LD 5FWXB 3UK7A 5B6JA 4W5HA 3GJRA 3RHSA 1PKEA 2NO0A 2ZRJA 2DP4E 5AM0A 4X9XA 4JP5A 4XGKA 5DN9A 3MCWA 5SY4A 1VHDA 2Z5VA 4RKWA 4LF5B 3L46A 1X1CA 3H1FA 3O26A 1QYXA 5I8WA 5CYFA 3K70C 1C8KA 1P0CA 1VIVA 2JGLA 5ALMA 1Z38A 1FFEA 3L6CA 3V1YA 3DE6X 3WMWA 3WKEA 4AU1A 1WCWA 5I7RA 1XVVA 3N53A 2QUBA 1RJFA 2GOYA 5FI3A 2P9QA 3CX7A 2DLNA 2Y1WA 5E0KB 3K73O 3OOSA 3R0ZA 1E7MA 2WU1A 3KOZA 3KZCA 3LF1A 3PC4A 1B7GO 5ULLA 5C5CA 2YZKA 4R7ZA 1FMJA 3CVWA 2JLUA 3V9AA 2MSKA 4CV0A 3UBMA 4NENB 2D2EA 2WUVA 4PTZA 3NHUA 3RQSA 2V1XA 1W88B 3DXFA 1J8MF 3GEDA 3HBMA 3KR0A 3OX2A 4N0PA 4B3MB 1LS6A 3DQPA 1IH8A 4MLZA 1T5DX 2QRKA 1E6EA 4G5FA 1T3SA 1LDYA 1UK9A 2DFLA 4TTAA 4YT2A 4MZXA 2GPYA 4J0QA 4N6NA 4BVBA 3R1IA 1E0KA 2R1ZA 1YE3A 3NJ8A 3RSZA 3RVNA 5L45A 5KWEA 3E22A 4B0PA 2G4CA 1NJ1A 3BK2A 3KQSA 3Q3VA 4OPMA 5BSWA 2YCLA 2D13A 4GD3Q 4KKXB 4PE5B 2CF5A 4QVIA 4BJ5A 4AKHA 2G6BA 5CURA 3CVXA 3IIEA 1M1ZA 2Z3ZA 3WHIA 4ATNA 1CZLA 3WKAA 2PWAA 5JBIA 4E5NA 1T9DA 1Y5LA 4OGLA 5JXHA 3VHLB 5KAPA 3WQRA 1QGUB 2VZ9A 1JSZA 4JI1B 2WWVD 3DDZX 4U00A 4WUVA 3KXPA 3K1JA 4WINA 5GPBA 3ZW8A 2I5PO 3A26A 3EIOA 1Z2OX 4N49A 1TKRA 1J2RA 1E3DA 3MWFA 3ZZ0A 2X4LA 5I5GA 1QKKA 2A8YA 1X7GA 4YJFB 4BKUA 1E3MA 3CJRA 4C7MA 1A2BA 2OCPA 4E14A 2F90A 5AP9A 2F8TA 1E63A 3MNFA 4ZVPA 3GLHA 1ZS9A 4OQLA 1EFLA 4JJ8A 1W1WA 3N87A 3S2YA 4F3RA 1PT5A 3WI7A 4X24A 1A50B 3GLGE 1P4RA 2ZSAA 1S8OA 2Q3BA 3WWCA 2J30A 4CKCB 1T0PA 4I1UA 2OFWA 3GLRA 4WAUA 2JLBA 5HPYB 3IBTA 4C7VA 3TQRA 4CF7A 1JEYA 1F0PA 1G5IA 4Y1EA 1TD1A 2QG4A 4MQUA 3QFHA 1Y89A 4LSMA 4ZCIA 3BHNA 3HA2A 1EJBA 2SKCA 5BSMA 1TM2A 3KJEA 4DLSA 5KPDA 4GO1A 1KQPA 3L4BA 1X7XA 4XOUA 3SFZA 4CG0A 4CM9A 1ORIA 3FZEA 3Q3GE 3EG5A 5A1JA 1VI5A 1NQ5A 2HRZA 5HP4A 1CE8B 5LIRA 2HKIA 1A9YA 2OXEA 2C8KA 3AI3A 1MN6A 5DWDA 4GPD1 2PG3A 1JXMA 2VXOA 2D62A 1QF7A 1SG9A 4G0UA 5ANRB 2BM8A 3UMFA 1NWHA 3AUFA 1VE5A 4HQ6A 3SS8A 1L7PA 4JI3B 1Z7WA 4FCTA 3KKZA 2A14A 4QGHA 3IP7A 3H5OA 4GMHA 5LYYA 4XQ9A 4DQXA 1NQXA 3K0CA 1WY7A 4YROA 3SX0A