1D5CA

Crystal structure of plasmodium falciparum rab6 complexed with gdp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
KYKLVFLGEQAVGKTSIITRFMYDTFDNNYQSTIGIDFLSKTLYLDEGPVRLQLWDTAGQERFRSLIPSYIRDSAAAIVVYDITNRQSFENTTKWIQDILNERGKDVIIALVGNKTDLGDLRKVTYEEGMQKAQEYNTMFHETSAKAGHNIKVLFKKTASKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAB6 GTPASE
publication title Structure of the nucleotide-binding domain of Plasmodium falciparum rab6 in the GDP-bound form.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Endocytosis/exocytosis
total genus 47
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 1999-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1d5cA00
1VHTA 4TSFA 4Z8XA 3P27A 4M1SA 4QNRA 3SEAA 2P6UA 2QMHA 1GNRA 2OAQ1 1XB2A 4D4JA 4I99A 2GK7A 4IVRA 4LJ7A 2OM2A 4B44A 2EFHB 2A5GA 3WP1B 1E94E 2P6RA 3CF2A 2VBCA 2B8WA 1OIWA 1OXXK 4RFSB 4CW7A 3QKUA 1E2FA 4BLPA 5EXSA 2QTHA 1TF5A 5KSOA 1XMVA 2O0JA 1TQ4A 1WQ1R 4Q66C 1XJ0A 2ZRHA 3KQKA 3KQNA 2ZJ5A 4JL8A 3HYTA 4EUNA 4XWAA 1OFTA 4PHHA 4MRNA 2FJUA 4TLCA 4X8LA 5DHFA 2BM1A 1W0KD 4DDUA 5L3SB 1G18A 1ZM9A 1TEVA 1IN7A 3T1VA 1I4LD 1KJWA 3DL0A 4HAXA 4JYCA 4DKXA 2ATVA 2Z4SA 4RKEA 8OHMA 4QBHA 4YXWD 1NSTA 1ZAKA 2D06A 3W5JA 2JLYA 5FOTA 2J5XA 3I3SR 4ZPXA 3WNDA 1LV7A 2A7QA 5TV2A 2FOLA 2GESA 2ZITA 2FWRA 1E2LA 1II0A 3B60A 1MKYA 1FNMA 1L4YA 4F4JA 1KK2A 3VNUA 2EFCB 3DKPA 1Z22A 4G5RA 4BUJA 3ADCA 4DLYA 2GJ9A 4IHQA 3LA6A 2V6JA 4ZO4A 1KMHB 2V1XA 3BFVA 2G9NA 2G83A 5C4GB 1Z06A 3PCRB 1GNQA 1ZM7A 4HZUB 3GLHB 1Z28A 2P3SA 3GJXC 3R7WB 2YVUA 1T9HA 3K8YA 4C0KA 3CRW1 1AS3A 3AKYA 2A78A 1HH4A 2H5EA 1RC8A 3ICEA 3A1WA 1HA3A 1GRRA 5BYJA 1N25A 3W6NA 2IYSA 1TUEA 1COWD 3QVUA 4V02A 3K0FB 5JS8A 2UZ3A 3CX8A 2P65A 4Q1AA 221PA 2OILA 3BAFA 1D8TA 1H8HD 1ZUIA 2E9SA 4DVGA 4I81A 4PQFA 2I3BA 4PHGA 2L0XA 3KUDA 2QL6A 2AFIE 1KAGA 1U0LA 4KO8A 3RSLA 1CTQA 1M7GA 1W36D 2OESA 2G0TA 2B7BA 1RW4A 5KOYA 4MYCA 3P4XA 4EPXA 5J40A 1XJQA 3AF0A 3G5UA 3LBIA 2IBMA 2REXB 4Q48A 2V55B 3TSWA 2ZI3A 3Q5EA 1NL3A 3GLIA 1PUIA 1SVIA 5KO2A 3HYRA 2O8CB 4F91B 3HDTA 2IS1A 3P20A 2VHTA 1P7CA 2ZU0C 4GMDA 4QJ3A 1GILA 2JASA 4BQSA 2CCGA 3IPXA 2R2AA 2HCBA 2GNOA 3PUYA 3IQWA 4Q03A 2NO6A 3WMGA 5FBVB 1Q1EA 2TMKA 2DR3A 2BJVA 3CZQA 1V5WA 2GZAA 1HT1E 3TGPA 1KI1A 3FMFA 1BKDR 4RD3A 3K53A 5B57C 1VYTA 3GLFA 1EFTA 5FPKA 4Q4AA 5GJVC 4WIAA 2C8VA 2D2EA 3WHKA 1R8QA 4OQFA 3QJYA 5JMTA 3JVUA 4TL6A 3WNBA 3GLFB 1DO2A 1GL9B 5DH9A 4IFEA 1A7JA 3ZVMA 4ARZA 4WOPA 1R4AA 2C2HA 2WV9A 3C41J 3LLMA 5AJZA 3RRNA 4D82A 1Z6AA 1Z29A 4FMBB 4ARZB 2ASEA 1NP6A 5DO9A 1JR3D 2YWHA 1SZPA 4MH0R 4ZV4A 1NY5A 4TLAA 3VR5A 3GJ0A 4LHZA 2OT3B 2ZS7A 2HDNB 2ZETA 5EXXA 1YE8A 3CPEA 1QBKC 2QMUA 2GVZC 1FX0B 4A82A 3Q8XB 2RHMA 3CPHA 4BWYA 1E9EA 5FOSA 3WMFA 3TUIC 4DWJA 4TLDA 4PQYA 5FUVA 3GJ3A 3OESA 4JJKA 3AP2A 4LBWA 1QHHB 3ADKA 4R71A 2DWQA 4WZBE 3VQTA 2BBOA 4OQXA 2JIZD 1XTKA 3L2OB 3U61B 2J7PA 1NN3A 3OFNA 4Q5IA 1VCNA 2IK8A 2OV2A 2ZJBA 1FQKA 4V0OA 2ATXA 2VHUA 1J8YF 2BCJQ 1DS6A 1P9NA 4M53A 1Z2CA 1HYQA 3BB1A 5EJEA 1EGAA 3RC8A 5KSYA 1DBSA 1OYWA 3WNCA 4LBZA 1K5GA 4EPTA 1G5RA 2CXXA 1UJ2A 2LCFA 3MCAA 4MKFA 2R6AA 5JHHB 4ZKDA 1XZQA 3EZFA 3K70C 5CLLA 1LS6A 3K1JA 1Q0UA 3QPVA 5FOUA 1UF9A 1XEWY 1HQYE 1Q44A 5CDFE 2GA8A 1YHNA 1ZU5A 1US8A 1P9WA 3O8BA 3QKRB 4DB2A 3FKSD 1US8B 5EXTA 4DT1B 4O2RA 1N6OA 2GAOA 2SHKA 4WXRA 2GBLA 3C8UA 1KZ7B 4Q9JA 4R7ZA 1Z8FA 1GL7A 3RS5A 3CO5A 3AVPA 3KDSE 2W6IA 1R5OA 3W3AA 1W48A 3GLGE 4WVFA 3K70B 2FV8A 4D4MA 1UAAA 4DCUA 4O25A 1P2UA 4I1OA 2C9YA 1W5SA 4U02A 1CJUC 3REFA 2BMDA 2EWVA 4C7OA 2PL3A 2R6FA 4R9UC 2IF2A 4GBMA 1OFHA 4GOKA 4CT5A 1KI9A 2BV3A 2WOOA 2IYRA 1DAIA 1Z0IA 4CRWB 1BYIA 1G9XA 1Z6XA 4B3CA 4RKFA 2R9VA 3ZIAD 3DOEA 3OEED 4M1WA 1G8HA 2F1JA 1FZQA 4A36A 5DI9A 1UDXA 4AY2A 5FI0B 4LYFA 1TU3A 2PZFA 1TF2A 1SXJC 1N6IA 3U3MA 4AKEA 2C04A 2XB4A 1NMXA 2XAUA 4MA4A 4TWZA 4QC2A 2IS6A 4DEYA 4D0NA 3OE7D 3RS0A 2GEUA 1KDTA 2XITA 4LZZA 4DZZA 1SVLA 4TT3A 1BO6A 1NG1A 1E2HA 2ZUBA 2O8EA 1X8JA 3FMPB 1S0UA 2ORWA 2PMKA 1G7RA 4DCVA 2BVNA 2GILA 1NVUQ 2WJIA 4GZMA 1KI2A 1U0JA 1W44A 2R44A 4V03A 1SXJB 1ZIOA 2QPTA 3CPJB 1OH6A 3E2IA 4TMZA 1YKSA 4PQRA 3NXSA 4OHXA 1DTSA 1OYYA 1KI6B 2D3WA 3GEHA 4TSFD 4DSUA 2HYIC 4WXPA 3MRSA 1T3LA 5F98A 2Z0MA 4B43A 1MO3A 3FFBA 4TMVA 2YWFA 4LC0A 2IEZA 2YJTD 1AS0A 4CYMA 4W5WA 3ONWA 1XMJA 3O8CA 1VYUA 5FR1A 1E9AA 3F0TA 3P32A 2DY1A 4IDHA 4NE2A 1KKLA 4HLUC 4UNSA 4UQOA 4B48A 3KJHA 4HB0A 4B73A 4G5OA 3DVLA 3G82C 4Q4JA 4RZXA 3FHCB 3DKVA 1VCOA 4P32A 4U00A 3RNLA 1JXOA 5HTKA 5FBWB 4UJ5A 2CDNA 3ZQ6A 3VX4A 5KTYA 4OI4A 4Z1MA 2XGJA 2J9RA 2GDJA 5JFGA 3KJEA 2ZROA 4QOSA 1NVWQ 3EW9A 4XVUA 3CNOA 4ASUA 5JRZA 1N0WA 3HR7A 3CNNA 1T91A 2O0HA 3CZPA 3ETLA 3VR4A 4AK9A 2WWYA 2ZRMA 3TVTA 4PPGA 3RYTC 1FUUA 1Z6TA 2C77A 4QKQA 3RS4A 1YR9A 5JJLA 2ZIAA 1NIPA 3K0AB 4HZIA 4EJSC 1Z47A 2X19A 1S9DA 1KDOA 4G0NA 5DLQC 4PO1A 2VHJA 1O3YA 2XXAB 4ZDIA 4JLJA 1EFUA 3IEUA 3SI7A 3I8SA 4XD7A 5JLJA 1XP8A 3KXLA 3OAAD 1JXMA 3UWKA 1VKJA 1DPFA 3K0CA 4NH0A 1BYUA 1P4SA 5C4MA 3LRPA 4JYBA 4Z51A 2RGNC 2IS2A 5ANRB 4EJSB 1G17A 1W0KA 2CL0X 2A9KA 4B76A 3I5XA 1E9BA 4LPKA 2BIFA 3MWYW 2KBEA 1OJLA 5C18A 2JCSA 5EE1A 5F9HA 2WJJA 5J4KA 1D2MA 3FE2A 3QBTA 1XD2B 3K9GA 421PA 4MRRA 1HE8B 3HPRA 3K9NA 1YR8A 4ZIRA 3Q72A 2AXNA 1Q1QA 5ELXA 2ZAOA 3EZ7A 1AZSC 1U94A 2GEVA 2OCBA 4IOMA 4Z54A 2JLXA 2PEYA 2IHYA 1Q21A 4A8JA 4A6XA 4NCJA 2NGRA 3W3ZB 3NEJA 4JSTA 4Q4HA 3QPUA 2IYZA 3RDPA 3TSOA 3WBJA 4A8JB 3KFVA 4C0BA 5L3QB 1TQ6A 1F2TA 3CR7A 4G1UC 2GETA 4BLTA 4V0NA 5DNYB 2WJYA 3CW2A 2ZUDA 2QORA 1U90A 1YU9A 3KB2A 4A4DA 2IYVA 4EIWA 4ZI2A 3DOFA 4AYTA 3FHTA 3KTAB 4RZ3A 2CVFA 5JEEA 3VU9B 4X8HA 1VHLA 2W58A 1NBME 4XTCS 1G16A 1WDTA 4XH9B 2GCNA 3BH6A 5CYOA 4D4KA 5KUTA 4BPBA 3GD7A 4HDCA 2ZSBA 2AWNA 4MKHA 4K81B 4MKGA 4IDPA 3U5ZB 4PX9A 2VH5R 3QF4A 1ZW6A 1FW6A 3IGFA 1HUQA 2WSSA 3GFPA 3PENA 3QF4B 4AG5A 4L9WA 4UXJA 4X8MA 3T1OA 3CNLA 1UADA 2F43A 3H1TA 5EP2A 2RAPA 4RVCA 2FU5C 4GPTA 1NVVR 1W4RA 3AEZA 3T12A 4YDHB 4NPHA 5AUNB 4OKSA 3U3OA 1HE1C 3QKTA 5GADl 3SS8A 3VFDA 5FFMA 4B3FX 5G3YA 1ZD8A 1U9IC 2ONKA 3CWZA 1JR6A 1FL9A 1VCMA 2XB2A 2VRWA 3CH4B 5AJWA 2WWHA 2ZRNA 3WP0A 5K8IA 2A3RA 3Q85A 3EAQA 3FFAA 4ESVA 1HY3A 1Z0DA 1NVVQ 1XCPA 2ZS9A 2FN4A 2XZPA 5A4JA 4LJAA 1G3IA 5KDOA 2ZREA 4JJZA 2Z5FA 4B3BA 2XNSA 4KSCA 2CE2X 4LJ8A 1J90A 1Q3TA 1LW7A 3SJBA 2CVHA 3EZ6A 1XCMA 3QF7A 4PANA 5FTKA 4LV8B 1TNDA 3TSZA 5HZHA 5IF9A 3B13B 1AN0A 3LFUA 2QQ0A 5B2ZA 3QI2A 2VA8A 4FD2A 2OCAA 4DXAA 4TMTA 3VMFA 4G5SA 1W1WA 3QUSA 2CMKA 2X2FA 1PVOA 3WHLA 4PXAA 2IXGA 2J7PD 5C1BA 1IXRC 3OFND 1KGDA 1P2TA 3PUXA 4OHZA 3AQ4A 1FMJA 1CIPA 1DG1G 1VG9B 1KAOA 2WPDD 2FPMA 4MUBA 3SHWA 3BK7A 4GT1A 4MRPA 1WRBA 1E0JA 1T6NA 5FPYA 5HZKA 1OH5A 2LKDA 3L0SA 1UKEA 1D6JA 4DLUA 3U4QA 1UKVY 5P21A 3TQFA 1F2UB 4B47A 2IW3A 5TMPA 4QFMA 3B82A 4JL5A 2AK3A 1OV4A 1F48A 3DMNA 1X1RA 4Q19A 5H8WA 4JLNA 3IUYA 4JT4A 3FVQA 2FZLA 2FEMA 1JJ7A 4OJQA 4DLVA 1A2BA 2YHSA 4M9QA 5JWHA 4AURA 2C5LA 3B6EA 3S1AB 1N6NA 2LKCA 5BN4A 2UZIR 1XEXB 2OO7A 3ZZ0A 4WZAE 4C2UA 3PITA 1XTJA 3K70D 4QM6A 1H65A 1KNQA 4BLRA 4A9AA 3EX7C 3LV8A 2W6ID 4ITRC 3GQBA 4Q4LA 2OXCA 4DB4A 3HU3A 1G5TA 4EFLA 3GEIA 5FTLA 1RIFA 3DEFA 3IKJA 4TYYA 3A1VA 1E9CA 1CJTC 3BB4A 4EDHA 2ZS8A 2RGCA 3FYHA 1E2MA 4LHVA 4Q9IA 1HURA 1E4VA 3LWNA 4PAQA 5HKKD 3LBNA 3V00A 1PJRA 1WBBA 1G64A 2YV5A 3LDAA 4M0LA 1OE0A 1JPNA 2ZRPA 3X1XA 5BW8A 3NKVA 1T3HA 2GRJA 3KB1A 3LBHA 3ZJYA 4D4LA 4F92B 5FI1B 4QG7A 3QXSA 4DJTA 1ZCBA 3ECCA 3MUFA 2ZSFA 1F60A 4G01B 1YR7A 3KZ1E 2J0UA 4PAMA 3UIEA 4B3GA 4B3DA 1W2HA 2KB0A 4PPNA 4D80A 4MQBA 3D8BA 2J0UB 1N0VC 4GP7A 4TT3D 2QRZA 1R5BA 1OFIA 3VHLB 2BMFA 3HP1A 3C14C 3WYGA 2V9PA 3MG9A 3GP8A 2WSMA 2XZLA 3RHFA 3IHLA 2IC5A 3CRQA 5JJKA 1G6HA 1FP6A 2VP9A 1J70A 1XXHE 3LW8A 4LJ5A 2BCGY 1GFIA 3VR3A 1CJVC 3SOPA 3A6PC 2BOVA 3U44B 3ND8A 1ZVQA 1QHSA 4URVR 1X6VA 2FA9A 3B8HA 2A30A 3OIYA 4MYHA 1DE0A 3A4MA 3RWMB 5CK5A 1G3RA 1HEIA 2RHDA 2ZTSA 3H86A 2QBYA 3KKMA 4KLZA 1GTVA 1AQUA 3SFZA 3PJRA 2WM9B 3FDIA 2QBYB 4IDQA 2ZPTX 1E1QA 4H1VA 3ZZTA 2J7KA 1RKBA 4UNQA 4AG6A 4AI6A 1N6KA 1XF9A 1C4OA 1SKYE 4DIDA 4MRVA 4DLSA 1IBRA 3NBFA 4F7WA 1FFHA 5FBRB 4P4SA 1G4UR 3M0EA 5FOXA 4LBYA 3WXMA 4Z1MD 4EFMA 5AUOB 1Q20A 2ERYA 3N2EA 4P4SB 1Z63A 1NLFA 1NN0A 2V4ZA 1VIYA 3KX2A 3WRXC 4ASUD 1UEIA 3EIHA 2B92A 4BFYA 2DFTA 3BC1A 2FDCA 3IILA 2ZM5A 2VF7A 1A5TA 4RFSA 2F6RA 1UEJA 3KKPA 3LX5A 4ON9A 1W4CA 3A4NA 1QVAA 1AGRA 3QEJA 4F38A 4AKGA 1X1SA 2KWIA 3ZH9B 1G3UA 2D2FA 2EQBA 3LXRA 2YOHA 4JLOA 4PC2A 2WTUA 4M8NE 1SVKA 1X3SA 2J3EA 1N6LA 4XD7D 1WXQA 2VSOA 1QF9A 5E4FA 1A1VA 2WWXA 4B71A 1KY2A 2BEJA 2J45A 4FWTA 4JZKA 4KFRA 1VCIA 1KK1A 4LJ9A 3ZGXA 1Q22A 4F4CA 5L3SA 3QXCA 2Q21A 5JS7A 1MOZA 2GHIA 3NBXX 4M21A 5LB4A 4G5QA 5JCZA 3SNHA 3AVOA 4DHEA 5B64A 1L8QA 1WF3A 3AGQA 3GEEA 4LC1A 1LS1A 2AWOA 3UPUA 2HT1A 1E2DA 4TTRA 1E3MA 1QG2A 1GSIA 1CU1A 4M1OA 2P2LA 3PUVA 4TMKA 3RANA 4E22A 1FTSA 2EFDB 2FX3A 2JEOA 4UKDA 3LW7A 4PPQA 1N5KA 3PQCA 1D2NA 2C98A 2IYYA 3QG1A 1CRQA 3X2SA 3OAAA 3BBPA 1KMHA 3QKSA 4IXMA 5HR5A 1NJFA 4DSNA 3CB4A 3SJCA 4C4PA 2WAXA 4HZUA 3GLHA 2OG2A 1J99A 3QKSB 1CULC 3ADBA 5KPJA 2NZJA 3LD9A 2VP4A 3R7WA 3ZDQA 4MGYR 3QXHA 4AYWA 2JLVA 1M7HA 2K5UA 2IS4A 1JALA 2CHGA 2AFHE 2VEDA 3EA5A 2JJ8A 3MWLA 2HF8A 2CLCX 3Q7PA 4PZYA 1BH2A 2WVJA 1GKYA 2WMNB 4BRUA 1QG4A 3BOSA 1II8B 3K0FA 3K0SA 3QSYA 3FB4A 3KQLA 1IXSB 2FSIA 2XTZA 1OH7A 4W7SA 2VIIA 2PH1A 2X8AA 4M1KA 2B21A 2FFQA 1IONA 2WSSD 4C30A 4KYIB 3M1IA 4U5XA 1ZD1A 3R9XA 1VYVA 2ZR7A 3B1VA 3DO6A 3WYFA 4DCTA 4ESHA 1CR2A 3UXMA 4KCGA 1A82A 1A2KC 2QT0A 2QM8A 1OXTA 1LNZA 3GJ7A 3NH6A 3Q5DA 2D7CA 1EFHA 3CKLA 1LVGA 1E79A 2OAP1 5GVRA 5IDVA 2REBA 1KDPA 2DFLA 4M9XA 5EQTA 3F5FA 4KHZA 5B30A 4C2TA 2O8CA 1R8SA 4OI2A 2I4IA 1PV4A 3WYAA 4GOJA 2IUSA 4KODA 3FMOB 1DAKA 3HPQA 2QE7A 3MSXA 4YLGA 4CF7A 1MV5A 5AUQA 2IT1A 4Q1EA 4CEHA 4Q1FA 4JLMA 5JJIA 1W7AA 1P9RA 4IEIA 2DB3A 1E32A 5LB2A 2G3YA 4OK5A 4CEHB 1P61B 2A2ZA 3NHBA 4MKIA 4FCWA 3QY0A 4C0SA 3H84A 4JBWA 4BLSA 4W9MC 4JLPA 1IN4A 4TTQA 3TAHA 1YR6A 4LHXA 3RRMA 5EE5B 4Q9HA 2H7VA 2P0EA 3NDPA 4LGMA 1OIVA 1Z0AA 1ESMA 1JEDA 4S2EA 1ESNA 4KAXA 2J0QA 2IYWA 2QPOA 3TUJC 2YWGA 4WZ6A 2ZJOA 4RY2A 3VTKA 3T35A 3A37A 4XIGS 1UBEA 5JWRA 2W2XA 4C0JA 1IY2A 1FX0A 3LQQA 1MABA 4TYWA 5KSPA 121PA 4QXAA 2Y8EA 4O0MA 2W6JA 3P4YA 5JSZA 1F6BA 1OXUA 1MABB 1OLOA 1QHHA 1ZYUA 5EUMA 4MGZR 2GCPA 5JSZB 3NH9A 4NONA 4L4UA 1SGWA 4AD8A 2GK6A 2H17A 1X8LA 3HU2A 1I4TD 1XU4A 1XEWX 2A5YB 3JZMA 4M22A 2V7QA 4OJKA 2P6NA 3EZ9A 3ZVRA 3KQUA 2GXQA 5HE9A 4CZ2A 1XPUA 2F55A 2GZDA 2FPLA 2H1LA 1EFRA 1GRQA 1GIAA 2WPDA 4PFSA 3VR6A 1E6CA 1ZNZA 2ZI4A 2C78A 4QBFA 1E2QA 3SBEA 2FFAA 2ZI6A 3MWKA 2X77A 1T5IA 1JR3E 2BMJA 3B78A 3E1SA 5CB6A 1G8GA 5K8UA 3KQHA 4TZ0A 2XSZA 3QKRA 5L3RA 3KFXA 4AKHA 3SJZA 2QNRA 4DT1A 2RGAA 3NC1C 4HLCA 2ZYUX 1H8EA 3LLUA 2YNMA 2BWJA 2VP6A 1G6OA 1L7VC 3ASYA 4HAYA 4HB4A 2NO1A 4LOAA 1PLKA 1R0YA 1E1RA 1QHGA 1UFQA 2B6HA 2CBZA 4QGFA 2BJWA 1ZUHA 4AC9A 5SZIA 3NEYA 1TUIA 4EQ6B 1RZ3A 2ZRLA 2PLFA 3I1FA 2EW1A 2ZR9A 4KVGA 1VIAA 4L8GA 1S96A 1T0HB 3ADDA 4GDFA 1WCV1 1XZPA 3KJIA 1AJEA 1R0XA 1G7SA 4WA7A 5HKKA 2VP0A 4LYHA 3DM9B 2AD5A 3CF0A 3RWOA 2YC2C 4YMTA 1EESA 2HJVA 3SU8A 5FUWA 3VKHA 4DRZA 3GJ6A 4OQNA 3FHOA 3ASZA 2ZE6A 2BEKA 2DPXA 1IJEA 3MMPA 1DAFA 2ZQ5A 2DCUA 5LD2C 2QAJA 3LXXA 4Z8YA 2CHVA 2QAGC 1Z2AA 2I1VB 2IL1A 3SC3A 3O8DA 5FR2A 4IVQA 1AGPA 4XSHA 1M34E 4ILEA 3GJ8A 1ZRHA 1XTSA 2ZE7A 2YYZA 4NDZA 4GRAA 1E1QD 1ELOA 4R2IA 1B0UA 1U8ZA 2CL7X 2QEQA 4IVPA 4QM7A 1E9FA 1SXJA 2XEXA 2W0SA 1OB5A 3AF1A 4I4LA 1P73A 2KI5A 1XXHB 2RMKA 1D9ZA 1T0JB 2WICA 3V4FA 5FPHA 2C99A 2QAGB 4D81A 4EPYA 1OPXA 1KI6A 5CB8A 2F7SA 3O47A 4XWKA 1CR1A 4JBXA 1HTWA 4V0MA 1XRJA 4B75A 2V1UA 1E96A 1G8YA 4MDEA 5SZJA 1D2EA 4QNMA 3IO3A 1ZM3A 4JLAA 3N70A 1M6NA 1XFAA 2V8OA 721PA 621PA 3CUEF 2DWPA 5IHPA 5TVKA 1CEEA 2HF9A 1RYFA 5FTJA 2EVWX 2GXSA 4URUR 4Q18A 3W8NA 4JVMA 1FTNA 1N5LA 3ZQJA 1DAHA 1UM8A 4HAUA 2OFWA 1NVXQ 1JNYA 4US1R 4IOKA 4UNRA 3CRMA 3CIOA 4RZ2A 3PUWA 3U60B 1ZM4A 2BHRA 1SULA 2OBNA 4RZUA 3NBZC 1M1YE 4QRHA 5G40A 4E07A 1TPZA 2C95A 1R5NA 3PUZA 4HLUA 4NL4H 1U98A 1CLUA 1WE2A 5EP4A 3AVTA 1JAHA 2VYFA 1E9DA 4UXIA 2J59A 5JWOA 4F93B 3BRWD 3K0AA 4NP6A 4XOIA 5AK0A 1SVSA 3D7MA 4LRWA 3FGNA 2CE7A 3D31A 4BGDA 3QQ5A 4YMWA 1YQTA 2XXAA 1SHKA 3TNFA 1MO4A 2GKSA 3BXZA 2WZQA 3H4MA 3T1QA 3EIQA 2OXRA 4B32A 3I72A 2EYUA 2F1RA 4CEIB 2KSQA 1E2JA 1NNEA 3U2QA 3GJ5A 1SQ5A 4M9ZA 2R6CA 4JKIA 4CT4B 1N0UA 1KDRA 2O8FA 5J4YA 3AP3A 3JVVA 2WKPA 4EJSA 2FFHA 1HV8A 2W83A 3EWSA 3TW8B 4DEXA 2XZOA 5FL7A 2W2TA 1NN5A 2O8FB 4B3XA 2ZRFA 4BZXA 4DIEA 1YZGA 4LPSA 1OIXA 3QEOA 3CRVA 3UANA 2GF0A 2GZHA 3I92A 1XD2A 3IIKA 3AKCA 4R98A 1YZNA 4ZKEA 4DSOA 1JBKA 2CLSA 4G5GA 2WJVA 5J4VA 5FUYA 2O52A 1OH8A 2VHQA 4TLBA 2V6IA 1CR0A 3TMKA 1E69A 2RGNA 3OHMA 1E2GA 4A0GA 4OQMA 1IJFA 4A2PA 1P5ZB 2GXAA 1E2NA 3A1SA 5L3QA 1AK2A 4PR0A 3SN6A 3LH5A 4HAWA 3B1YA 1ZNYA 1OW3B 1BS1A 4FMDB 4GNKA 2ZXUA 2PJRA 4V0KA 2ZANA 4URZR 1G21E 1LF5A 1KO7A 4P4UA 3W6OA 4RD2A 1DAEA 1E2EA 1UBGA 2ANBA 2ZI9A 3IQXA 4OK3A 4NCKA 3UATA 1D9XA 2H57A 3AF2A 3KTAA 3QXJA 3PG5A 3VU9A 4BFUA 3SQWA 2QTVB 5E95A 3HU1A 2F9LA 3KXKA 4JSYA 1E2PA 1U8YA 1E79D 2QP9X 3TR5A 2FSGA 2C9CA 2IX3A 2WIBA 3ZYCA 4KBGA 2V3CC 1ZINA 1NMYA 2KE5A 4PC6A 2AR7A 1Z5ZA 3BD9A 4FCTA 2QE7D 3U3KA 2ONJA 4XTRA 2N42A 4RD1A 4P31A 2GF9A 4NBSA 4D6PA 5KNBA 1TU4A 3ZD7A 1CXZA 2O0KA 2QN6A 4ACAA 1ODFA 4R2HA 2A5DA 2GJKA 4DSTA 5JRJA 4KBFA 5TDHA 2ZUCA 2FGJA 2V54A 2QGNA 2ODBA 1PLJA 2NO7A 4GI7A 4QHSA 1ZP6A 5KHOC 1SKQA 3WRYC 4MUAA 1DEKA 2OFXA 4BRWA 1S4QA 1A4RA 2Q0HA 2NPIA 4LV6A 2J46A 3THXB 1OB2A 1HT2E 4U7DA 4DCSA 3UG7A 2QPAA 4YMVA 4OI1A 2WKQA 2ZRIA 2IYQA 4OI0A 3PFIA 1MT0A 2CK3A 1KK0A 2D62A 2IUUA 4JBYA 1DOAA 3GLIE 4A0FA 4DLRA 4CVNA 4JL6A 2XOKD 5HPYB 3BFKA 5EE0A 2RB4A 3UMRA 5GJBA 3OIWA 5CIWA 4HDQB 2P67A 1W0JA 1XPRA 2W6JD 2WWIA 2LWIA 1N2CE 5JECA 4JS0A 4PC1A 1U9IA 4B35A 4TQAA 5DHAA 4L5BA 2O8BA 2QG6A 3EC1A 2I1QA 5J4HA 1JB1A 1FPMA 3A58B 5C2JB 2YOGA 3NWJA 3IDQA 2P5SA 3THWB 2HJGA 2O8BB 4EPVA 3GLFE 3N5CA 5CJPA 1EWRA 3NDBB 1IN8A 2V7QD 1N6HA 4RFVA 4TTPA 3U7EB 4DCNA 3R8FA 4IOLA 3ZS8A 4CGZA 1EFRD 1W5TA 2JLUA 1VG1A 1Q3HA 4NYMR 1K5DA 2E87A 2NIPA 4Q02A 2Q3FA 5H68A 2Q9BA 1F2UA 3F3YA 4Q7LA 2RH5A 4O2LA 3BH7A 2A5FA 4QGHA 4Q21A 2R8RA 4HEJA 3TH5A 2W0MA 3UK6A 4DDVA 2CNWA 2N46A 1CF4A 4PZZA 2GVDC 1ZNWA 2XSZD 4NYMQ 4ZDKA 1E2IA 1Z0JA 1R2QA 3FMIA 2IXEA 4PPFA 2CCKA 4TL7A 3S1AA 3V9PA 4CIDA 2KBFA 3T1TA 1XEXA 2Z4RA 1QDEA 1H8ED 4M1MA 1G8FA 1JPJA 1OXVA 3AUYA 1RRFA 3K09C 2E1RA 3X1WA 1B23P 4AWXA 1TQ2A 5K8LA 2OBLA 4TYQA 2H18A 5SZKB 5EE3A 1E1RD 3GMTA 2AD1A 3BIFA 1CR4A 3AVVA 5AUPB 5DI3B 3T5DA 5F3WB 2CLDX 3IBYA 5L3VA 5CDFA 5TB5A 1NI3A 1U8AA 4Q1DA 1AQYA 1Z07A 4HYYA 2FMXA 4BZPA 4PC7A 5DSZA 3THYA 4E09A 3TVDA 3W34A 1E9SA 1Q57A 2ODEA 2ZSDA 4QGGA 4IDOA 2QY9A 1V43A 2PX0A 3AF3A 4KYUA 4DLZA 3THYB 3FKQA 2YKGA 4CDGA 4OHYA 3GLGA 1KI3A 4PSKA 1RYHA 2HXYA 3NG1A 3GLGB 4LUCA 4O3MA 3WMEA 2VP2A 3VNVA 4M1YA 5CK4A 3T06B 1KIMA 2YC4C 4KJZA 3A8TA 5AWFC 5B58C 2QTFA 4P3YA 1GKIA 4ZCLA 2VHCA 3WBKA 3QENA 4HUQA 2JLSA 5FPTA 4URYR 1GM5A 4B2IA 1SXJD 1UBCA 3B2EA 4HUQB 1GP2A 4C9BA 4NYIR 3AUXA 2O8DB 4I1SA 1OKKA 1FNNA 2BC9A 4TZ6A 4NCHA 2AXPA 2WMOB 1OSNA 1ZCAA 2JATA 3SYLA 3U44A 4ZCMA 1NKTA 3NC0C 3D3QA 4CEJA 4Q9LA 4TLEA 4A6PA 1XMSA 2ZR0A 3Q3JB 2Z6VA 1IN6A 2EFEB 5M04A 2HXSA 4GFDA 4NYIQ 1KSHA 4CEJB 1UKZA 2J87A 6Q21A 1XD8A 5BXQC 2ZI5A 5FOVA 1TF7A 2QM7A 1YZLA 2ZU6A 1MRSA 2FFBA 1G41A 3W9YA 4ABYA 3RC3A 2ZVQX 2ORIA 3QG5A 3QNUA 4II7A 4B6EA 1NSFA 4Q1CA 2PMDA 4N3NA 1SVMA 1U99A 2ODWA 2WAYA 4S35A 4TMWA 4LSGA 3VAAA 2JJ1A 5EZ6B 1W47A 1KZGB 1KSGA 2JLRA 3TRFA 3TIFA 2ZYTX 4YDSA 3HWSA 4WAUA 2ZE5A 3NHAA 2XTMA 3BORA 1RFLA 5E3HA 1T8UA 4V0ME 1KSJA 1EFCA 5FL3A 1MO5A 4MITA 2GEDA 1E0SA 5LPNA 1U0HC 2QSYA 3AVXA 3DPUA 1KI7A 1R10A 2AHOA 4P0TA 4H9GA 1BIFA 3QE0A 4EPWA 2EYQA 2AN9A 1CP2A 1G7CA 1XD9A 3PV0A 2G0NA 2BMEA 1MR3F 4N1AA 2ZAMA 2FNAA 5KDDA 2HV8A 5CM9C 3C7KA 5A5GA 1J2JA 2F1IA 3IO5A 3M6AA 2PBRA 1CKEA 2F3TA 1II9A 1KO8A 2QUZA 1TAGA 3ND9A 1KHTA 2ZE8A 1S9HA 5FL7D 1S3SA 1DG3A 2G6BA 2WIAA 3CH5A 4FWIB 4XWOA 2PJZA 3CX7A 4FIDA 3OZXA 1XTQA 4JVNA 4KFTA 3H0KA 1EXMA 2PT5A 4BZQA 3AVWA 2WWWA 1XMIA 5CLQA 5FPSA 3ZLJA 5E7IA 1IN5A 1Z6YA 2R6DA 5J47A 1QRAA 1OHHA 2ODNA 3BH0A 2ZSAA 3DHWC 3REGA 3SE0A 2FH5B 4KV9A 1ZIPA 4KVAA 1L4UA 1R0ZA 1XWIA 4GSYA 5LBIA 4X8OA 1G19A 2CHQA 4URXR 3I73A 4FMDF 4BFXA 4QBGB 1KNXA 1NLYA 3I32A 4QHYA 1SVWA 1NY6A 5EZ5A 3AGPA 4UXHA 1M2OB 2F3RA 2QU8A 2QA5A 1AZTA 2DHRA 3T5GA 1S3GA 4A92A 1TADA 2HEIA 3DZ8A 4BEJA 1QZXA 4HI0E 4LBVA 3R8CA 3CLVA 2ECKA 1P3JA 3UMSA 3OIVA 4DUGA 2J0VA 3PEWA 1II8A 2IA5A 1GRNA 3SQXA 1E0AA 1N5IA 1P60A 3LVQE 2IF0A 2QMEA 2CJWA 4V0LA 3MJRA 5DIFA 2DFKB 4BFTA 4C0QC 2JJ2A 4HB2A 4D0LB 4WBSA 3QOFA 1SVOA 2OEPA 2CJWB 1QHXA 4JKYA 1JEEA 1XDBA 1RE0A 2GJ8A 1I2MA 1LF0A 4OYHA 4PSAA 4N0EA 4RD6A 2VO1A 3PIRA 5KNDA 4OQLA 3EPLA 3I4LA 2YOFA 4KITB 5D3MA 2ZYVX 4NHOA 4L15A 5JEDA 1NBMA 2MSEB 4HB3A 1ZD9A 4YC7A 4KFUA 4DDWA 2BKEA 4YMSA 5D3MB 3ZVLA 4DLXA 1LY1A 3AB3A 4M2LA 1T8TA 3OF5A 2QENA 2W00A 4POAA 3VKWA 3A1UA 4JVLA 4Q00A 3VX3A 1CJMA 3PEUA 1E98A 1P2SA 3T34A 3TLXA 5FH9A 3RLFA 3R20A 2AKYA 1KJYA 2CK3D 1L2TA 2RKOA 2VLIA 4C0LA 1P6XA 1JQJC 2RGXA 3LX8A 2PX3A 3Q9LA 1UBFA 3B7GA 1BMFD 1OT3A 2ZRKA 3LVRE 1M7BA 2OLKA 3KXIA 4I1UA 2FE4A 3QVVA 1IY1A 1T5LA 1XEFA 2IWHA 2ZRDA 5EP3A 1YZQA 2IEYA 5DN6A 2ZEJA 4LJYA 1W0JD 2A5JA 2WJHA 3SYNA 1KJZA 1W49A 5EXPA 1S1CA 2ZI7A 3K9LA 4DLTA 4BFWA 1NKSA 1ZNXA 2OLJA 2ZJAA 2QT1A 5FTMA 1KI8A 3U7HB 1I4DD 5JI3E 2IYXA 2H92A 1P62B 3E5HA 3IEVA 3KKQA 2UKDA 1X8KA 4FXPA 1DO0A 3EASA 1FUKA 2EFGA 3EWAA 1Q1BA 1TL7C 2PZEA 3BJIC 2BBTA 1YZTA 3GLIB 4NKRA 1GDDA 1WB9A 3THOA 1EX6A 1S2MA 3EC2A 3PEYA 1KO5A 3MAAC 2XOKA 4D25A 5HE8A 4A15A 3K9HA 4ZI3A 4IXNA 3AVYA 1DVRA 1TQDA 1ZUNB 4XJXA 3B5JA 4KXFB 1J8MF 3VHXA 1W4AA 1GUAA 1K6MA 2F1HA 3EXAA 4PSVA 3C16C 1X86B 1W46A 1ONBA 5DGXA 4TQUS 3SBDA 2CNWD 5H70A 4Q4AB 2ERXA 2WBLC 5BN3A 1DELA 3QBVA 2EU8A 3KKOA 4LDJA 3VR2A 3A4LA 4EKDA 4MDFA 4A2WA 1G20E 5F2EA 3X1ZA 1CBUA 2D4HA 4M4SA 2MMCA 3TQCA 2FGKA 3B85A 1G8PA 4J0QA 4FMCB 3L0IB 4ACBA 1K8RA 1JAIA 1C9KA 3IIMA 3TR0A 4HDOB 3BE4A 5TY0A 1IM2A 1E99A 4IOJA 1NIJA 2VL7A 4D0GA 1IQPA 3LO5A 3AKEA 2XTNA 1PUJA 3B1ZA 3C5CA 4OHWA 1YRAA 4B74A 4P4TA 4KLNA 1G3MA 1Y63A 1RVDA 2NQ2C 3D6TB 5KNCA 4FINA 821PA 1OFUX 4MGKR 4PO9A 3W8RA 3R9IA 3U6KA 5JHGB 2PCLA 4BFVA 2IYLD 3C5HA 4MGIR 4EFNA 3EARA 3P1JA 4GOXA 5AR1A 3MD0A 4Q7MB 4E03A 1G4AE 5A0FA 4QJ4A 1UKYA 4TQ9A 2ORVA 4UJ3A 2FSFA 4BLOA 1ETUA 3SYKA 1G5PA 4YQFA 4EQ6A 3ZD6A 2GAAA 3W90A 2GBLC 1QHNA 2OCPA 1TTTA 1AM4D 2AX4A 3ICQB 4AYXA 5BYKA 4GL2A 3FWYA 1BOFA 2MSDB 4XVRA 3OEHD 1IY0A 2R62A 2FF7A 1XPOA 2JAQA 2OHFA 3CX6A 1GKUB 3L8YA 3SZRA 3C15C 4XVQA 1XNJA 521PA 1G291 1WMSA 2G1KA 2WWGA 2NOAA 4C0HA 4DBLC 1OKKD 1PLLA 3NTUA 3TJZA 4OHVA 2JDIA 3RVBA 4HLDA 4JVSB 1EK0A 4C3ZA 2H16A 3PVSA 2HT6A 5GJCA 2PT7A 1E0KA 1E2KA 3SR0A 4QL3A 3BFXA 3EPKA 4LK2A 4MRSA 4KI0A 4QGAA 1SHZA 4C0AC 5TXGA 4PHTA 2AKAB 4PTLA 1PZNA 5LDDC 1VTKA 1F3OA 4C7OB 4PZLA 5IK2A 1JQLB 1Y3AA 4RCZA 2DYKA 5F9FA 1IHUA 3M4YA 1XXHA 2ANCA 3PEVA 4NZYA 2R6GA 2WWFA 1UPTA 2NO9A 4ZDWA 2DWOA 5UKDA 2XNDA 2HLDA 2QAGA 2QZ4A 3CF6R 1MH1A 1YJ5A 2JJ1D 3L0PA 5LD2B 2IXFA 5GVSA 1RPZA 2NTYC 2BDTA 4GP6A 3GJ4A 3ZS9A 5KYKA 2QP3A 2PEZA 3O8RA 4KFSA 3PXGA 4A2QA 1OXSC 1DAGA 1GG2A 3QXXA 5JBQA 4NYJR 4LWZA 1YZUA 3QPWA 1Z08A 4NTZA 2PLRA 2O8EB 2VSFA 1SKYB 1JI0A 5H1YA 1YRBA 2Q9AA 5JCPA 5KSZA 5EE9A 2F9MA 5FUXA 4NYJQ 3TK1A 3AVUA 2J1LA 1RJ9A 1GVNB 4P33A 1S1MA 3BS4A 1WBDA 1VMAA 2WKRA 4TYNA 4D2IA 1RJ9B 2CEAA 2GJSA 1U81A 2XJ4A 4US2R 3H2YA 5BN5A 2UVQA 2ZRGA 5CIQA 3CWQA 3RABA 2IWRA 4Y0AA 3EZ2A 2J0SA 3I8XA 2REOA 4LV5B 4I1VA 5AJVB 2ZRJA 5IT5A 4W5HA 5G53C 3AM1A 4JLKA 4Q9KA 4L16A 1W4BA 1ZU4A 1G1MA 4A0RA 3DDCA 1QVRA 4CEIA 4Q4JB 3MGCA 3B9PA 1RRPA 4JLBA 1OHHD 4WW0A 3W5IA 4B6FA 3U6BA 3HR8A 3L0OA 2FZ4A 3U3RA 5SZHB 4IRUB 1CJKC 3LAWA 4A1FA 4BEBA 4PHFA 5CM8B 5E7JA 4RSGA 4ZCIA 2WHXA 2YWEA 1DAMA 2ZYWX 4BFSA 4PAOA 1WA5A 3L82B 2BBWA 5JI2E 2GCOA 4NMMA 5KDLA 1U2RA 3J81k 2DBYA 2Q3MA 5L8VA 1KK3A 2PCJA 5D3QA 3K0CC 2H8KA 2GCOB 3IIJA 4Q01A 4DUGD 5JZVA 2RGDA 5FBLB 2GJAA 3TW4A 4DDTA 4BASA 2BM0A 5HCIA 4QBIA 2JJ2D 2OFOA 1JECA 1P2VA 4HAZA 1AS2A 2Q9CA 4LCBA 4PO8A 5DYGA 4Y0VA 2QGZA 1C1YA 1GNPA 4HUTA 4D26A 2ZRAA 1AIPA 2C96A 2QQEA 2XX3A 4FN5A 4HLQB 4Q1BA 2VQSA 1GITA 1T3SA 3EA0A 3ZZUA 4LX0A 4IJMA 3RS2A 2Q3HA 5IRCD 4G3XA 1Z6GA 2RGBA 2ZRCA 3U3JA 4LHYA 1NBMD 4JT2A 1QHIA 1GAJA 4A8JC 2JLZA 3P26A 1J7KA 4TMXA 3GCGA 2MMGA 4RD4A 3W6PA 4RCYA 2OCYC 4LHWA 4Q7KA 4N0DA 3DZDA 3GLHE 3OIUA 3KUCA 3BERA 4YXWA 4FI3C 3WY9A 1KI4A 5KU1A 3RS7A 1NJGA 1F5NA 3GPLA 4LYJA 1FP7A 1AKYA 4TL9A 2G77B 2DFNA 1XBTA 3E70C 3N2IA 1QHYA 1VPLA 1G7TA 5AJYA 3B1WA 3SDZA 1RRCA 5GJWC 4MYTA 4ZIRB 4URWR 2BKUA 2CL6X 1UDWA 4RJLA 3UG6A 5FOWA 1LFDB 2IHBA 2QSZA 2OZEA 5DN6D 4JIMA 1LTQA 5E7MA 1VG0B 2PZGA 4Q4HB 3TUZC 2WJGA 2ZJZA 1KY3A 3A1TA 3CM0A 1F2TB 5TARA 3BB3A 1N6PA 1TEXA 4JLVA 4TYPA 2FEOA 1CRPA 2FSHA 1S8FA 2HYDA 4YMUA 3THXA 2VP5A 3B9QA 2OE2A 5DYIA 1NRJB 1IXZA 2FG5A 1RRGA 2QMOA 3IBGA 4JMPA 2W2VA 1O87A 3CBQA 1W36C 5HCNA 1COWA 4IDNA 2ZVPX 1NMZA 4LJ6A 3NIBA 4LYAA 3BGWA 3LY5A 1BMFA 1H8HA 2GTPA 3UWOA 2WOJA 3T15A 5AJXA 4M1TA 3FOZA 3DMDA 1ZMXA 3RRYA 4MYUA 2VSXA 3BWDD 5EP1A 2F43B 1GZSA 3THWA 2IYUA 3KL4A 3CONA 1W36B 2JLQA 2B8TA 2IYTA 4JLDA 1M8PA 4FCVA 5BQ5A 5FTNA 2QP4A 3UKDA 1E4YA 3RS3A 4ZDJA 1Q12A 4XSGA 1KMQA 1ANKA 1P75A 4GMXA 5J5CA 4LI0A 5CJ2A 2G1JA 2ZJYA 4FMCF 3RSOA 5J4LA 4B2PA 2HCJB 1XCGB 4NCIA 3HJNA 4YONB 1FOEB 4QHTA 1KO4A 3NVAA 3I62A 2CCJA 1Z3IX 3B1XA 1KO1A 3L43A 1R7RA 1ZJ6A 4HATA 3EPJA 1VDZA 3IPYA 4K46A 1MRNA 3SFVA 1OF1A 4RD0A 1NF3A 1IOZA 2JLWA 3EIEA 5G3ZA 4HAVA 1VECA 1XJCA 2Q6TA 3DM5A 2AK2A 5DE3A 1N3BA 1DADA 4EPRA 2P5TB 2OUKA 3IHWA 3MJHA 3KJGA 1JR3A 1GOTA 2BBSA 2ZSEA 2EWWA 1G3QA 1R0WA 3AP1A 4H1UA 4L9SA 5DI3A 3UMFA 2AL7A 1DARA 3TE6A 4OBEA 4Q47A 2MSCB 4UNPA 1I2DA 3RRZA 3U4QB 2QI9C 2ZJ2A 1EX7A 2J41A 3AF4A 2VTKA 1NN1A 3QIAA 3I5YA 3A36A 3V4RA 2RGGA 3K09A 5CYPA 5CITA 4KU4A 4BLQA 3FTQA 3T61A 3AVQA 1XTIA 1Z83A 5G41A 5DISB 1AA9A 3VKGA 2JIZA 1YVDA 1MO6A 1XX6A 3F8TA 3GFOA 2Z43A 2IUTA 1E9RA 4B33A 2ZRBA 4KSBA 2JGNA 3R9WA 1FMLA 1FQJA 2JDID 4BFZA 2X2EA 2OBMA 1Z0FA 2HUPA 2D74A 2YZ2A 4IW3B 5FBQB 2KJQA 3X1DA 4B34A 1YZKA 3EG5A 2D7DA 5KPDA 2NMVA 2QRNA 3GFTA 5C46F 2FPKA 4W5JA 2XJ9A 3Q7QA 2NG1A 4GZLA 1ZC4A 1Q1ZA 1P72A 2NPFA 2C9OA 2GWHA 3L8ZA 5IK2D 1GL6A 4Q7JB 3OEHA 1TMKA 1EG7A 3RAPR 3I61A 1Z0KA 4FW9A 2O8DA 3FKSA 2XNDD 2HLDD 2NZ8A 2C03A 2YINC 1KYIA 1VG8A 4OL0A 3CR8A 1D5CA 1KTVA 3TKLA 4E5UA 1HQCA 2NO0A 3SHFA 4BE7B 1KOFA 3ZVNA 3KKNA 3X1YA 3MWJA 4LY6A 2O5VA 4HSEA 3U7GA 3MLEA 4PC3A 3AH8A 1XTRA 2ZJ8A 3PR1A 4OK6A 4IKEA 3EPHA 2VPPA 4M9SA 1ZBDA 1NG9A 4NCNA 3C4JA 4IEEA 2RGEA 1LB1B 4TL8A 3TBKA 3NBYC 4B2LA 4K8OA 3ZIAA 3VR1A 4DC9A 3OEEA 2B7CA 2JA1A 2Z83A 2GXUA 1WP9A 2OSBA 3FPAA 3JZAA 4AIIA 3G0HA 1KSFX 5EUQB 1SXJE 3U7FB 3LNCA 2N1BA 1AKEA 1JJVA 1ZM2A 2R65A 4US0R 4IFBA 1KKMA 1W2GA 1T4GA 4LJ4A 1R6BX 3MFYA 3TAUA 5K8TA 4F4IA 1ZC3A 2QROA 2VF8A 4A0HA 5BWMA 1TX4B 3CRRA 3OE7A 3AKDA 1GWNA 2G88A 4BECA 2X1VA 4DLWA 3LQRA 1IAQA 1M74A 3SJAA 4EAQA 4AKIA 2RCNA 4ERNA 1CS4C 3K0EA 4TN1A 1EWQA 1NLZA 1N6RA 4QJ5A 3AV0B 1N5JA 4NU0A 4UNNA
chains in the Genus database with same CATH superfamily
2JD1A 1VHTA 3CF4G 3NVDA 5DASA 3P27A 4X20A 4Z8XA 3G2HA 1HDEA 2QMHA 1WJGA 4OKNA 1QMPA 1DC5A 1XB2A 1Y3HA 1RWPA 3Q6MA 4D4JA 3HBJA 1YIOA 1I7QB 4G86A 2PUEA 2VWGA 3S44A 1NI4A 4I99A 3FJ1A 2PKQO 3ZX5A 1VLQA 1Q7TA 3C70A 3CMMA 4RXTA 2PUWA 1Z12A 2O1SA 4JU9A 2YV1A 5F5XA 4D1YA 3CF2A 3JVIA 2DRIA 4CW7A 4HUJA 2P62A 2CF5A 4BLPA 5MN4A 3PPWA 4TRJA 2QTHA 1DBPA 1WP4A 1VB3A 5KSOA 3R44A 4PIPA 3GRVA 4MVJP 4L5YA 3RVSA 4M89A 3PDCA 1EFVA 3OZVA 1NT2A 3RHZA 4FB5A 1WQ1R 4NAUA 4PS0A 4W5QA 1T36A 3AIKA 2XNCA 1IBMB 4MHTA 1QCYA 1UDRA 2RHBA 4X65B 4B6PA 3VSAA 1HEUA 1VE7A 3AR2A 4PHHA 2VUUA 4JB3A 2BM1A 4YREA 1KFCB 5TPZA 3ZBTA 5IASA 3S2UA 4I50B 2B4QA 3C8MA 2GZ3A 1IN7A 2OUIA 4RPLA 4YCDA 5A62A 4OFWA 4GBGA 3IJEB 3PSHA 2BZ1A 4JYCA 2P69A 4R1MA 3IR5A 4JIGA 1W93A 4YYEA 5BMOA 4JXJA 3LL7A 2WNHA 2Z4SA 1GTMA 2ZWIA 4MJ3A 1NJ8A 3RG8A 3X2FA 5CA1F 3N6VA 8OHMA 4NZNA 4W7IA 1MOPA 2D06A 3W5JA 2PJUA 4ZT5A 5KVCA 1SHUX 1UP6A 2IHVA 5E6RB 1P9OA 5TV2A 2A9OA 2ZITA 2FWRA 3RROA 4F4JA 1MKYA 4IJWA 3UQYS 3DKPA 2V6FA 5AK3A 1V6AA 3RODA 1ZMBA 1SURA 2X86A 4YGXB 4DLYA 1D6SA 1FSPA 1SZDA 3ACCA 3OC0A 1EZ4A 2JZCA 3LA6A 1UKAA 3AERB 4ZO4A 1WETA 5TMEA 1KMHB 2GEFA 5K20A 4AWBA 3BFVA 1IDOA 1B6RA 1OFVA 2V3VA 5DEIA 1MJ5A 1GNQA 1ZM7A 2QL9A 4HZUB 4RTQA 3GLHB 1H6BA 3ZWWA 1O4VA 5KNCH 1BXKA 1Z28A 2PRKA 2Q6KA 5K0BA 1TM4E 2YVUA 1T9HA 1R1DA 4KO1S 3K8YA 3CRW1 5HJ7A 4C6TB 1RP7A 2SNIE 1SEVA 2VG8A 1IBCA 2COEA 2H5EA 1MB9A 3A1WA 1EVQA 1HA3A 2AF3C 4FYIA 2XCSB 1ZL0A 3ULKA 2I4NA 5JDIC 1L3BA 3QVGA 3BT7A 5JS8A 2POQX 5AHXA 3A1DA 4K6OA 4JR2A 1D8TA 2FPUA 4G1FA 1ISRA 3QVGB 5ICFA 4JI3B 5CDSA 2E9SA 1WSWA 1ZONA 2XRMA 5K3FA 4DVGA 3NATA 1OX4B 3W5VA 1ORDA 5HZMA 2I3BA 2QX8A 5B7QA 2L0XA 2C2GA 3R9XB 3MS7A 1U0LA 2ZYIA 1RYMA 5HHTA 1FTYA 1BHQ1 1NJ6A 1Q7GA 1UKCA 4LRTB 2VTVA 3N3AC 3MS4A 3A3NA 3F7TA 3IP1A 3LBIA 1X8XA 4Q48A 3O3MB 2ZI3A 1ZN8A 1NL3A 4DMFA 3GLIA 4A2CA 1I5RA 1PUIA 2K2WA 1RQ2A 4UU1A 2M6KA 1YQUA 1NNLA 3KYDA 4YUXA 1SRQA 4GI2A 3BX1A 3D1JA 4B46A 4QJ3A 1A0OA 4BQSA 5A6VA 2I67A 3IPXA 4P22A 3Q9NA 4XWYA 3KYDB 3IQWA 3PUYA 4LISA 1FSGA 1Q1EA 3UTDA 3LSTA 2RHJA 3PXEA 2GZAA 4WL0A 3TQHA 4GMFA 3TGPA 1KI1A 4RD3A 1DX4A 1L7PA 2QUIA 1VYTA 3CT6A 1U4OA 3G8BA 2OO5A 1XVIA 2C2XA 3HYCA 3OJXA 4LY9A 4PIVA 5GJVC 1LV8A 4YCBA 1ITZA 1AK9A 1RHJA 5IUJC 4IWYA 2UZ0A 5ER6A 2PLAA 3JVUA 4ZA2A 3M9LA 3W79A 1DO2A 1CVRA 4FNMA 2FPOA 3G88A 3DMRA 2Q5HA 3LX6A 5LWQA 3H3FA 1A7JA 4M54A 3STWA 3C41J 2GLXA 2W4IA 2WV9A 2YX1A 3EVDA 1K9SA 2MSKA 4J4BA 1DWQA 3GC6A 2ETVA 5LBTA 5D5HA 1Z29A 2CLEB 1T4BA 2E2WA 2G63A 1MA0A 4X84A 4BPRA 1QTIA 3L6UA 3QFSA 1DJMA 2QTGA 5HS4A 1UK9A 4MH0R 4YBZA 3FYDA 3UAYA 3R0XA 1EVKA 4EY7A 4ER5A 1FS4A 5H02A 2OT3B 3IDAA 1Z7GA 2CXPA 2FZ5A 4FJ0A 1YE8A 3FX2A 1QBKC 4QOIA 2GVZC 4TRMA 5EXXA 1TRKA 3Q8XB 4BQQA 5KWSA 2QM0A 3B52X 4RPCA 3WMFA 1LZLA 4BMPB 1ONSA 3B1KA 4TLDA 4DWJA 3OESA 4R71A 3AP2A 4GSLA 3FRHA 3H18A 4WZBE 2IXAA 3PT5A 5CUQA 2AI3A 5F2OA 4J29A 1YUBA 3UAXA 3AU8A 3N0TA 1XTKA 5JIBA 3L2OB 2ZT6A 3ROPA 1CHNA 3RJTA 4Q5IA 2IK8A 2OV2A 3J81A 5K6TA 3A3YA 4X71A 8MHTA 4PINA 1FQKA 4Z9FA 2VHUA 3FDZB 4BVGA 3QLUC 1LH0A 1GEEA 1MTOA 4D41A 3IOMA 4O29A 4MIKA 4O4IA 4P3PA 6ABPA 1HLGA 4FR0A 1Q7EA 4LBZA 2CXXA 2K2QB 2W71A 1TPYA 2FW8A 1RFGE 3BXOA 3D64A 3L3BA 5JHHB 3FYSA 3ZV6A 2GEJA 4YMHA 3DGEC 1UOEA 1Q0UA 1DJOA 4N01A 3I2HA 1XEWY 1MHPA 1KDVA 1RBZA 3RF6A 1YJCA 2GA8A 1ZU5A 1NAHA 3ABRB 2MYPA 4H7PA 1DDIA 4CMJA 1SAYA 2JVJA 2VTBB 3OFKA 5F35A 4PHGA 4DT1B 3D6FA 1N6OA 5CRIA 1JLRA 1A9XA 1TDJA 5JPCA 5CNJA 1FRQA 5F78A 2DQKA 4D3DA 3DAOA 3NOVA 4F71A 1EFKA 3KJXA 3LECA 2C2WA 3QLEA 2VRBA 1A9XB 1Y81A 3SQOA 4DDMA 3KDSE 2W6IA 5BORA 2RI0A 2FV8A 3I6IA 1UAAA 1E7WA 3KXDA 3BK2A 3D7NA 1T4MA 4FE7A 4I1OA 4C0XA 5HIKA 2BMDA 2XQIA 2CVPA 3OQVA 3R23A 1TD9A 1UZMA 2BSXA 1M33A 3F3SA 3WKAA 1YGYA 2QV7A 3ZHOA 1QV6A 3OPNA 2YZGA 4GBMA 4PLZA 5ALOA 4DPKA 4Z3KA 1KI9A 2QTNA 3O9VA 2WFLA 1WVMA 4CRWB 1G9XA 4B3CA 3UJBA 1DKPA 5KYXB 1XN1A 2R9VA 1O58A 1C0KA 3DWEX 4C2BA 3OEED 4FJ2A 4I4TF 5BYAA 1A98A 2WFLB 1G8HA 3KPUA 2F1JA 4MCHA 3WDMA 4P5EA 2Z58A 1QF7A 3LYLA 1GPUA 4GH5A 1EM6A 2GOYA 2E4XA 3ZU3A 3KOOA 2JJYA 5HQJA 1LJUA 1TU3A 4AY3A 3U3MA 3PX7A 2C04A 1DQYA 1BAPA 1LQTA 2XMCA 5FIUA 3IAUA 5LU8A 4MJXA 1JPVA 3C43A 2EJCA 3WGUA 6YASA 1Z73A 5LWHA 2Q1SA 3S6JA 3EEBA 2O7RA 4IUCS 2RONA 1ULHA 4L5IA 4DZZA 5K51A 1T9DA 4BNYA 3TRDA 4DUPA 2ZBGA 4F2GA 5DX8A 3UJ7A 1E2HA 4HS9A 3K6SA 4KPGA 2RHCA 2O8EA 3FMPB 4RSHA 3AR9A 4MPPA 1YE5A 4RH3A 3UJHA 5KKNB 2RIRA 1FIUA 4LJRA 3LRTA 2J5BA 3V3TA 3V6MA 2IOFK 3K6SB 1L4KA 3KCNA 2X22A 3IXMA 1U0JA 4YBRA 4V03A 3T9FA 2VWHA 4Y6GB 1TMGE 3IURA 3ZOKA 3P45A 4U39A 2APJA 3E2IA 4TMZA 1QAQA 2EEZA 4YS6A 4HNTA 4MVJG 5B2EA 3ETDA 1U65A 3C6KA 1V6SA 4KQGA 4ZCQA 5ADWA 3ET4A 1R4ZA 5JO9A 3MRSA 2HYIC 6CHYA 4OM7A 4N7RA 2Z0MA 3SM9A 1MO3A 3FFBA 2HNAA 4TXNA 5LC1A 3TLJA 2AOXA 1GGKA 3SICE 4LC0A 2PH5A 3ZR4B 1JVNA 4J07A 4PHCA 4BX0A 4W5WA 2C84A 3VBCA 3EGXA 1E9AA 2ZIXA 3F0TA 2P8JA 3P32A 4IDHA 5A9RA 3IT1A 2IPNA 3AUSA 5JJBA 2JCXA 1I7PA 2JARA 5C3UA 3QEMB 1JDPA 3T4PA 4ZGBA 4QYSA 1MC5A 4Q4JA 1JFRA 2H2GA 2MU1A 3DKVA 4N82A 4MB6A 2AQIA 1JQDA 1Z37A 4ZO6A 3Q3HA 3RFFA 1VIVA 3RNLA 4KQEA 2A1UA 1JKJB 3ZQ6A 2AUMA 5KTYA 5LQNA 1ENOA 1U5AA 1YJXA 4RK1A 4Y1EA 2CMFA 3CVYA 3KJEA 5LL6P 5ERYA 1CJCA 3CNOA 3HY6A 4GE0A 2OHJA 5TPZD 5BPFA 3T1HB 2JD2A 3DVQX 3VR4A 2Y3IA 4BNIA 2WWYA 3UA3A 1GUYA 3GT0A 2XF8A 1VKZA 3R74A 4MAAA 4IR7A 4QKQA 4EZBA 1INLA 2FFJA 2FMHA 1RM4A 3D8RA 4JOCA 3K0AB 4BMVA 4IGKA 4OP2A 5LKAA 2NVUA 2W11A 1YMUA 2QGFA 3V8NA 4G0NA 5DLQC 3PS9A 3JR3A 1N8TA 5AKLA 4AQDA 2XXAB 4ZDIA 1O5TA 3G5TA 1EFUA 3GQVA 3IEUA 2H65A 2NVUB 1W1UA 5JNLA 1T5DX 1W8DA 2QRLA 2R6HA 1JXMA 2W2OA 3L02A 1EK1A 1ZXLA 3AUAA 2DXIA 1VKJA 4JJIA 4WACA 3R7DA 1M72A 5EFZA 1PG0A 2P9FA 1RIIA 3UH1A 1J56A 4NH0A 1JWAB 1DC7A 4XQEA 1HX7A 2WVAA 3PZBA 2IS2A 1J1IA 1TGVA 2FW6A 2HZ7A 3FHJA 5I4IA 2QN3A 3PQ4A 3Q6NA 2CL0X 4FBMA 3CLTD 4LXTA 2A9KA 2JBWA 4B76A 3I5XA 4Q6BA 5D01A 2ZWAA 3HK2A 3S29A 4NSNA 5J4KA 4I6GA 3RAFC 1RI4A 2UVPB 2G0AA 3K9GA 4MRRA 3PNYA 4DRXB 3TM4A 3HPRA 3HEMA 1JLSA 1WHTA 2B7LA 4CLEA 3OP4A 3P9ZA 3K9NA 3AUTA 3Q72A 4MVYA 5I45A 3B7WA 3OTOB 1U94A 3U09A 4RX1A 1HNWB 1WHTB 2GEVA 2W2LD 4Z54A 4G37A 2JLXA 4TVOA 4HNUA 3G1TA 3I76A 2HWXA 4XQ9A 4TV8F 4A6XA 3PQ2A 3L8GA 4GR4A 1EQAA 2X1HA 3W3ZB 1TYCA 1ECGA 1VHDA 3O75A 2IYZA 1QYXA 4KAAA 1SQFA 3WBJA 1ODIA 3ETNA 1XQWA 1ZGCA 3MJFA 4ZICA 2XYVA 3UUEA 3SMVA 5DNYB 3WLIA 1Y9DA 1E5DA 5HGXA 2ZUDA 2QORA 4RVUA 4EIWA 2OV8A 2Z6UA 3FHTA 4W6ZA 2Q27A 1F3LA 3DOFA 4ZOQI 2XCQA 1YS9A 4FHCA 4RZ3A 4ZN6A 3VU9B 5JEEA 3ITEA 4BQPA 4ZODA 2O5RA 4KXMA 1IPEA 1NBME 4JQZA 5EJMA 1LBSA 4WDQA 4BPBA 4GPEA 4G0UA 4MKHA 2VJLA 3B20A 5ALWA 4CF4A 4H1WA 2ZM6B 2R7MA 3BZUA 3N0RA 4Y2YA 4ZVQA 2C5BA 4G9EA 2ZPUA 4KWEA 5HUHA 1DC4A 3DYVA 2P30A 4P4LA 5EJ2A 3ZHCA 4CG3A 1AQ6A 1Q19A 2PO5A 2V8BA 2WSSA 3GFPA 2V9CA 3IGFA 4J7CA 1PR6A 4M9RA 3A2KA 3KEGA 3T9AA 4UXJA 1ZR4A 4IV0A 2Q1XA 4G5XA 3U49A 5J58A 3SY8A 3UCEA 2PSFA 2F43A 3H1TA 4KN8A 4Q3NA 4YAOA 1JHMA 2FU5C 5B37A 1KERA 4GPTA 3WYEA 2WINI 2WE8A 3TTVA 4BQEA 5DNCA 2O3JA 1YDHA 3BWVA 4YDHB 3W2EA 4NPHA 4R8LA 3DLAA 2QR5A 3QKTA 4Q15A 4Q9NA 3TEFA 4EVIA 5GADl 2RAVA 2XGGA 4B3FX 3UWDA 1V1JA 1CDOA 4WVLA 1QQTA 1FRFS 3F73A 1FFWA 2WWHA 1ATZA 4KVFA 4QBTA 3A11A 3KOXA 1M2EA 3Q85A 4Z86A 2FCRA 3DE7X 5JSFA 3T3DA 1Z0DA 2H2DA 1YHZA 3EA4A 1NVVQ 1XWFA 2WRZA 2WD9A 2Q2OA 4RVOA 5JJ5A 4AS3A 2HY7A 2FN4A 2Z6QA 3ONFA 4HQRA 4JP3A 4D7AA 3KM0A 3E7XA 5F2NA 5DM60 4MRMA 3ENWA 3OZAA 3SJBA 3FTEA 4HG2A 3HSSA 1J0BA 2BUAA 4KQIA 1ENYA 3OE4A 3I0ZA 3LFUA 1F0KA 4MRMB 2WJ3A 1T6XA 1MD9A 3QI2A 4EVQA 2Y1EA 2QLFA 3GGGA 5DM2A 3OIGA 3SXJA 3IALA 5KYNA 1AO3A 4L6CA 2IP4A 3VMFA 1UZNA 3PTZA 4LQLA 2NZXA 2J31A 3RBAA 3RHSA 4ND6A 4AZVA 4EJMA 5BO5A 5C1BA 1EG2A 1MVOA 3MGBA 5KVQA 3EXHC 1EA5A 1QUFA 5DCWA 3DZBA 1Z38A 3FLEA 3GT7A 4CI9A 4D57A 4Y0NA 1BC5A 3G0OA 3LRXA 4DN6A 3BDVA 3BK7A 2IY7A 4JOSA 4PZCA 4UC0A 1M2JA 4XWTA 2LKDA 3MD9A 3L0SA 1ZH0A 1N2SA 2P90A 3LPNA 1UKVY 3H65A 3H1FA 1FSSA 2QRHA 1KRXA 2FMTA 1AQLA 2XUAA 5P21A 3TQFA 2GWRA 4LRUA 4B4WA 1F2UB 1XU7A 2IYFA 2GARA 3HUUA 3EODA 4QO7A 3EGWA 2Y66A 5B1SA 3N28A 1BGWA 4P92A 2XMZA 4QFMA 4JL5A 2OD2A 1DFIA 2ES4A 3JQ9C 3KOUA 4Q19A 3E03A 5JAHA 1J97A 1EVEA 2HLNA 4AZ0B 7AT1A 2WYVA 1JJ7A 5K3EA 1AZLA 1NPYA 2PX5A 3S1SA 3BL6A 4DNPA 5JTTA 1NQXA 4BGIA 3PFGA 3ESYA 3VPXA 2Q1UA 1JAXA 2G9UA 4C2UA 3PITA 2OBYA 2CD9A 2NU8A 1XTJA 4EL5A 3D7RA 2QYTA 5DNUA 4E5PA 1ZK4A 2HQOA 1KNQA 4BLRA 4EMUA 3FUVA 4A9AA 3EX7C 1MX3A 4TN5A 2W6ID 1P8JA 4ITRC 2XBMA 2HW8A 3HU3A 4MV6A 2AHRA 3IV9A 1GA4A 1UKBA 3GEIA 5FTLA 1U6KA 3SNKA 1YK0A 3TZHA 3VV3A 3A1VA 3ED5A 1CJTC 3OCYA 4EDHA 2I6SA 3DNMA 4CFSA 4F3TA 2RGCA 3FYHA 3WYBA 1K6JA 2IV2X 3U9SA 2BDEA 2VZ0A 1CWUA 5HKKD 1V3TA 1Z5VA 1I0ZA 3ACDA 3V00A 2V74B 3KYJB 2AG5A 4B6RA 1WBBA 2OOKA 3R75A 1F8XA 3AR3A 1IZ7A 3HRIA 1JH8A 3AMVA 2PTGA 1F1BA 2D13A 3DTVA 3LGXA 4IIBA 1ZCJA 3LBHA 3M4NA 4X00A 3JYHA 4LFAB 1MC4A 4QG7A 3V4VB 3V97A 4RA6B 3ZHRA 4NV0A 1ZCBA 4IG4A 2RIPA 3EC7A 5I9TA 3TD6A 3U9LA 5JV5A 1EVIA 1F60A 2Z30A 3ESXA 3KZ1E 4HNHA 4J7UA 5ALJA 3TCNA 3V8EA 1Y8CA 1WDLA 2J0UA 4YRRA 1GU1A 2O9JA 4E70A 3BXGA 5BV2P 1BCSA 2KB0A 3KOYA 4PPNA 3KHTA 4MQBA 3QTBA 2J0UB 4R1PA 3FVTA 3KTDA 3L8EA 4JXZA 5A3JA 3SGLA 2XQGA 4RTJA 1BCSB 4KKVA 1R5BA 5IF3A 2BMFA 2O2DA 3I2FA 3ZWCA 4P0QB 5K7SA 1O95A 1FFDA 2QTZA 2IPOA 2NNLD 3C14C 4H1TA 1P5JA 2IUYA 3MG9A 4ZHSA 1KY5A 2PSDA 2WSMA 4U6QA 4XDGA 3GLUA 3GP8A 1C0LA 4D97A 5HZGA 1NZFA 3UB2A 4EHIA 2BR5A 1ZPDA 3H3XA 3HHEA 4YROA 4ARIA 4LGVA 4KQMA 4DDHA 4W7HA 5JJKA 1K8YB 2ADMA 1AH2A 1IAVA 1XXHE 3WHIA 1VDMA 3JATA 2GT1A 1FVHA 5T5QA 1GFIA 4P7BA 2XT6A 5HKOA 5BMVA 5EIAA 2J9YB 4IHAA 3Q3IA 5IUKC 3TECE 3VU0A 2RD2A 1JU9A 1FDVA 2VYNA 3JATB 4URVR 5JD5A 3BWEA 4MYHA 5BMVB 1SRRA 1WTCA 4Q9DA 3A4MA 1J7JA 4UU7A 3NBMA 2ZTSA 1TFRA 4C08A 4YV7A 4GQAA 3ZXYA 5A02A 2O2GA 3IQZA 5A4FS 1R6AA 1JLLB 5D2CA 3KKMA 1QNLA 5AI8A 1AQUA 4WSOA 4QSHA 3PC6A 5EHNA 5LZ9A 2FUG1 3FPLA 2LDBA 3RFUA 1F7UA 2G09A 2PG3A 4FGUA 4F45A 4H1VA 1VRCA 3DG9A 1O8CA 1RKBA 4MMXB 4QA9A 1N6KA 1M75A 2WUDA 2YYSA 4DIDA 2CUZA 3O92A 4OHOA 1N36B 4R0MA 5LQSA 4PGFA 4BMXA 4QASA 1X39A 3AG5A 4KMRA 5JCJA 1FK8A 2F3UA 4H7DA 2R00A 3WXMA 3AONB 2ACWA 3ENQA 1Q20A 2ERYA 3N2EA 3P94A 3SZMA 5TEVA 2QT9A 5B1IA 3PJEA 5BVGA 1NBOA 4FQ8A 2H2AA 1VIYA 4XZ3A 3FM9A 4ZVSA 2PL1A 3WRXC 1UEIA 5LSAA 3EIHA 3FZEA 3B6MA 3VR4D 2G5PA 3ZOZA 4U8GA 4BFYA 5BVGB 3BC1A 3QX9A 2ZIUB 1NVGA 2FDCA 1RJDA 4NULA 2OM6A 5AD1A 1DXHA 2FQXA 4CKWA 2WC1A 3LY9A 4L27A 4BBAA 3P7MA 4RFSA 2JBAA 1IVYA 1UEJA 3LX5A 4DLNA 2PVSA 2JGJA 2H1RA 3DTNA 3LYAA 1W4CA 3CUKA 1NXVA 2C5EA 4G24A 1QVAA 4RK4A 4X93A 3WB2A 2OOSA 1DKRA 1SCJA 2DG2A 4AKGA 3ZQKA 3ZH9B 4JFAA 2IODA 4DAEA 1HOTA 4EITA 2I34A 2KYRA 4JLOA 3K1ZA 2R66A 4ZQIA 2XYGA 2QZZA 2B98A 3WWEA 4JJAA 1WXQA 3KPVA 4X95A 4KE6A 3GHHA 5KZMB 5AM0A 2J85A 5KSYA 4B71A 1CPYA 2C1ZA 1TA9A 1BTOA 4LJ9A 2I65A 3O95A 1ADFA 1E2UA 1NA5A 1ZW1A 2FWMX 3FDJA 4F4CA 5I4KA 1H1LB 3IPAA 3QXCA 4Y2TA 4E88A 3UJPA 5JS7A 4M21A 3MC1A 3SIPA 3GAMA 3AVOA 5B64A 3T7TA 1NJSA 3PGVA 2W6MA 3I30X 3PK0A 3PYMA 1CS0B 3MTBA 1WF3A 3GEEA 2NUAA 4BWGA 2YXNA 3UMVA 1QSGA 3QVXA 1GGHA 1QG2A 1GN8A 2NUAB 3KUXA 4X44A 4M1OA 5HIMA 3OQBA 2R8XA 4RABA 3PUVA 3E3LA 4H0NA 1TJNA 3TLKA 4E22A 3UY4A 1WG8A 2BFCB 3BL8A 3R4VA 4P7FA 4IG9A 2C2BA 1ZUWA 2SCUB 4KI7A 4PPQA 4BVEA 1D2NA 2QD1A 3B48A 3QG1A 4F9TA 2XPCA 3N0WA 1LX7A 3QKSA 4IXMA 5HR5A 1C3JA 2MWMA 1NVAA 2WAXA 1T6ZA 3AC0A 2GGSA 3KS9A 5IKEA 4ZOLA 3QKSB 3TQQA 3PFCA 3S2YA 4MGYR 1OMOA 5MF6A 1CY4A 1U3TA 2XB9A 3P9KA 4I1IA 4PYKA 2CHGA 2JIOA 2R1TA 2VEDA 2SKEA 3P9SA 4MR8B 4ZOLB 3MWLA 3SXUB 3N86A 5EIOA 3ISVA 3ZDZB 1L4FA 2HF8A 4WUVA 3ZU4A 3SJUA 4KQWA 1KS9A 4LECA 1JJIA 2H4XA 3NUGA 1YQXA 1SWWA 2WVJA 1SXHA 2PRYA 1KL7A 1QG4A 3ON5A 4P36A 5DHUA 1RC1A 2Z3ZA 1EAMA 4E6EA 5LLDA 3K0FA 4GM4A 1G5IA 3FB4A 3NYQA 4Y2RA 1XAGA 4UHKA 4TV8A 4KN5A 3PNQA 4Y1FA 3ZD9A 1KH3A 4W7SA 1Z2NX 1QRDA 2PH1A 1UIRA 3GN2A 5AKKA 3K1TA 1P6QA 4ALKA 1IONA 2WSSD 3LYHA 4KYIB 1FC0A 2I4OA 5TC4A 2X9NA 3B1VA 1U0GA 1H2ZA 3DO6A 4MTLA 3V8VA 3WYFA 1BEUB 1LEHA 3K6KA 1Y0BA 4EG8A 3UUWA 2QT0A 5LYJB 3Q5DA 4B2YA 4C4AA 2ISCA 4EHNA 2ZUSA 2REBA 2H9YA 2PAFA 2RAFA 4MS1A 3IJRA 3W1EA 3UMGA 2O8CA 3E9YA 1QOQB 2PZJA 4NMXB 4Q6WA 4RZIA 5AKGA 3WYAA 4GOJA 2PVCA 5DMHA 1V3QE 1YRWA 2XLBA 3A3PA 4MR9B 3T7SA 3FMOB 3GNTA 1DAKA 4PBSA 1SB8A 3N8NA 2P27A 4YLGA 2BONA 2YTZA 1GNTA 3DULA 4Q1FA 4JLMA 1SBHA 3VV2A 5DNAA 3ZBUA 5C5DA 5L4SA 1VJ1A 1AOXA 3OQ1A 4F97A 1LX6A 2G3YA 4HNSA 4EGJA 2A2ZA 1RRMA 4N0PA 3NHBA 4MKIA 1X14A 4YDQA 4C0SA 3H84A 5C37A 3A9VA 4W9MC 1GU7A 1IN4A 2FR8C 4TQGA 2VPWA 4QDXA 1M2VA 1Q17A 3RRMA 2LUOA 3LTNC 4D9MA 3WWYA 4HXYA 4NXNB 3PJFA 1C3XA 2QG9A 5FB3A 3VTFA 4S2EA 1ESNA 1V7PC 2I4RA 2JW5A 4CIYA 5IDWA 1B42A 3QBDA 3IA7A 3BXHA 4HRYA 5IVKA 2ZJOA 1JW9B 1P29A 4FNOA 1A9OA 4L08A 3T35A 2Q5JA 3HCAA 3JW8A 4H7IA 3WJ2A 3V7YA 1DKOA 2QPLA 1TM1E 3A37A 2NYRA 2VUSA 2W2XA 3E6AA 1KEEA 2M6LA 3LQQA 5IWAB 2Y8EA 4XDHA 4ZD6A 2UU9B 1G8KA 1XT6A 2DSNA 1KEEB 1X7DA 4XLLA 5DVZA 4ER6A 1QHHA 5K6AC 4XIYA 2YJZA 1YR2A 3SBOA 2GCPA 2I76A 4L4UA 3N3BC 1VYHA 1XSEA 5DBOA 3VHRA 5AIAA 3UOGA 5JS6A 2H17A 4TVKA 1X8LA 1CIJA 2IP2A 3HU2A 1XEWX 4PSDA 1MNAA 1DWPA 2C92A 2FUEA 3ZWPA 1TVKA 3H1PA 3UK2A 3OJOA 2GXQA 3GRRA 1L7BA 4H3HB 5HE9A 5KVAA 1MFPA 3W5BA 1P77A 5BN1A 1TVKB 2EFYA 3F4BA 4XASA 3VKVA 3VR6A 5MN6A 3VYVA 3IT0A 3PD1A 3RVNA 3V42A 1UDCA 5TJ9A 2C78A 5JRDS 4QBFA 5EJGA 3IPCA 2FFAA 4FBLA 4KQCA 5DP1A 4N41A 3A6LA 5JISA 3B78A 4QXQA 2NYVA 1NW3A 2OXFA 4KX3A 2FP3A 4R83A 3ZKWB 1R66A 4C7VA 3SVTA 2JRLA 2GN9A 3WA6A 2FP4B 5L7YA 3JQ8B 5ICMA 2FRVA 4MQ6A 3QKRA 4KTTE 4AKHA 4H7JA 4W4TA 4NBKA 1RMYA 4Z3DA 4F3NA 4B87A 1PT5A 2OR3A 2ORYA 2AMLA 4HLCA 4IF4A 4CV2A 8LDHA 3ABZA 3OA0A 3DTVD 3WX0A 1YTLA 2IHNA 4M98A 1P1RA 3CLHA 3ESAA 5KSWB 4J3FA 2PV0A 4HAYA 4Y67A 4CM8B 3N6XA 3D8NA 4K0KB 1E1RA 1CVLA 1BA3A 3BDIA 3FCXA 4UQLA 3AEQB 4S3MA 1YS4A 4NCXA 4ZYLA 1R8XA 1KY4A 4RVHA 3WLLA 1G59A 3NEYA 2D0DA 1Y8QB 4MVJD 1M0EA 4NESA 4XJTA 3PKIA 2ZRLA 3I1FA 2ZR9A 1KMNA 3ER6A 1P1FA 1O97D 1VIAA 2JRCA 4KVGA 5I9LA 2IIPA 1JFLA 3PQ8A 4JJ8A 1QE5A 5AHWA 3L9XA 3ADDA 2IOHA 4BJ6A 1XZPA 4WQMA 1O95D 1AJEA 2P0AA 1K8ZB 1G7SA 1YU6A 1LDNA 2CMDA 2W6PA 8ABPA 5ERXA 3CF0A 2VVTA 4YMTA 1EESA 2WR8A 3ZU6A 2DJIA 5IJXA 3SU8A 5H0IA 5C53B 4AY6A 5JXIA 4E94A 3IQDB 4GGPA 3DKRA 3FHOA 4HSGA 4NFHA 2ZE6A 3MZ0A 4ZVUA 1BRMA 2DPXA 1IJEA 4WRRA 5ILGA 3RSQA 1ETHA 1MDBA 2Z2YA 3LXXA 2VYND 4MWSA 4C2AA 3SDSA 4CTKA 4BN4A 2VQDA 4BX8A 4CM1A 2OMEA 5JC8A 3SC3A 4O2BB 3OFVA 5CBKA 5DHPA 5IJ0A 2DZDA 5A4IS 2CFTA 1MX1A 1M34E 3V8PA 1CW2B 3DFFA 3KLOA 1MQAA 2DPYA 3OQIA 4HX9A 3GJ8A 1ZRHA 3EGDB 4DE5A 4NDZA 3C5WP 3F97A 2Q3LA 5K0SA 2RGRA 4GLLA 3ZXIA 4ZO9A 4UW9A 3OQIB 3SVZA 5CCEA 3AFMA 4QM7A 3KAKA 3IA2A 1SXJA 3ANNA 2W0SA 4AW9A 1QQAA 3QVLA 1P73A 2KI5A 2PMWB 3ZLVA 4FZVA 6PFKA 1D9ZA 2FW1A 2Q5FA 4UBLA 1TC1A 4M86A 5J2TF 2LZ0A 2QAGB 1OU4A 2QLBA 3PPXA 5JCJD 2X6RA 1KI6A 1ZKMA 1I33A 2ZDHA 3DBIA 3DT9A 3ZUGA 2WYIA 1CR1A 1GNVA 1H1TA 2FZWA 1XRJA 5IZ4A 5BW5A 2V1UA 1YAHA 4MDEA 5SZJA 1L5FA 1D2EA 2ZCUA 3E9EA 3EH1A 3IO3A 1ZM3A 4QNMA 1IU9A 4NENB 4BUZA 1F8GA 2IHJA 5BUZA 3K35A 4H18A 3WDKA 4AF6A 2GFHA 1ENPA 5ALEA 721PA 2CFIA 4KQ9A 2O20A 1K27A 2Z2IA 5GTDA 3C6BA 3F96A 4XJVA 5IPFA 3DC7A 3JD4A 2Y4NA 5TVKA 3TDNA 5J2UF 1CEEA 1OUMA 3E82A 2Y71A 3WK7A 1KH2A 2PR2A 3GUYA 1UM9A 4R0VA 2FLVA 3CCFA 3HWX1 2EVWX 5FTJA 5I7FA 4URUR 4Q18A 4DR4B 3ZQJA 4RC9A 4MWGA 1DAHA 3VYWA 4ND3A 4CCYB 4GBJA 4TOIA 5H59A 3I2IA 1JNYA 3HI4A 5CD9A 3QFCA 4U8HA 1S8NA 3RIXA 1QZUA 1UBUS 4MQEB 1AUVA 1YJAA 1LPPA 3CIOA 3OQMA 2HBQA 5IBQA 5E9WA 2D3TA 2X2OA 2HX1A 4RZUA 2OCLA 1K08A 1M1YE 3COZA 3RVPA 4E07A 4N3GA 1ULUA 3DT6A 3QU9A 4HLUA 3D7SA 4NL4H 2OCXA 4HOYA 4CR7A 1WZCA 2R11A 4V1CI 1CLUA 1RM0A 1WE2A 2NUPB 1IB0A 2W22A 4BMYA 4DZTA 1OFUA 2VYFA 3FAZA 5F51A 3T5BA 4CIVA 3U19A 1QPZA 1Z6QA 3ZPXA 4E1VA 3I23A 3PNSA 5DK4A 3C3XA 4R2MA 3IJPA 4I50F 3TR6A 4BO0A 5AKIA 4NP6A 2ZBRA 2A92A 3ZWKA 1BN6A 4OX9Y 2JANA 2CE7A 2ZT8A 1GU0A 1UXHA 3QQ5A 1VM6A 4KP7A 2XE4A 4YMWA 1I1NA 4Y9SA 2MCFA 2HU2A 4F9FA 2GKSA 1OWMA 3V32A 1DQZA 3EIQA 2HXGA 2ZSUA 2EYUA 1XN4A 2F1RA 1B16A 2K6GA 4NOJA 3V7UA 1EEHA 4H6XA 5HKBA 1NNEA 3NTLA 1HE3A 4EB8A 2BYTA 4JKIA 3CNBA 1VPEA 4WFIA 1H2AS 2OXEA 1UFOA 2F8LA 2UYQA 1D1QA 4Q0MA 1VPWA 3QVJA 4OQZA 3R7LA 2Y1XA 1HV8A 2W83A 2YRFA 4C14A 1UAGA 3W06A 3FWKA 1JG3A 3NW9A 2OBBA 4R8RA 1FBNA 5FX2A 1KQPA 3G8YA 4B3XA 2XGMA 3M89A 5JS2A 4DIEA 2GPYA 5LMZA 4LPSA 1I3OA 2IXTA 2VDKB 3AFGA 3CRVA 2MYUA 5CR9A 3UANA 4YV1A 1CFZA 3I92A 3OKAA 2CLKB 3IIKA 2DH6A 3OCVA 4RVSA 1YZNA 1T13A 2W37A 4DSOA 1Q0QA 1JBKA 3PQ6A 3ZE2B 4Z7QB 4DANA 5J4VA 3BJZA 1E58A 4L4YA 5FUYA 3F5MA 5FDFA 1DINA 1JI3A 2VHQA 4TLBA 2V6IA 3K73O 3LM8A 3L1UA 3O0DA 1CR0A 5CB0A 3TMKA 5GZ3A 1SXIA 5CLHA 5IVDA 1VSQA 3BL5A 3VSCA 1SCUA 1VMIA 4ALNA 1ACJA 2WU1A 4RNCA 3UYLA 5L3QA 4UZEA 1AK2A 3RC1A 1O96B 2EFJA 1SCUB 3GZTB 3SZOA 2ZXUA 1BS1A 4DJEC 5L6MB 2HMVA 4C6SA 2ZANA 5B2FA 1LF5A 1FZTA 2WP8J 3VOBA 1YTUA 2ANBA 4NCKA 4UHJA 1D9XA 2H57A 1EHYA 3G2JA 3IRUA 3KTAA 3QXJA 3HKCA 1MVNA 2LBPA 2F9LA 3KXKA 3QOYA 4IS3A 4PYJA 2C9CA 3U13A 5JY6A 2D1RA 3SCZA 3O82A 4KBGA 3TPCA 3OJEA 1BFUA 5D6NA 2MT9A 4PC6A 3ZXUB 1LCIA 1VL8A 1Z5ZA 2CXQA 2RKBA 3BD9A 3KSDO 3MWDB 3OD5A 4KIUA 4YAEA 3WDLA 5FOQA 3PUJA 3BWCA 4XTRA 4MV7A 3PE3A 1YGPA 5KNBA 4NJMA 1U1CA 1EYZA 3DDWA 3L0CA 1ODFA 4HQNA 3AUUA 4FN4A 3IPRA 4KBFA 5TDHA 5J3JA 4BP1A 1R6TA 4NPCA 1CQJA 1XMXA 1PLJA 3B6IA 4GI7A 2JKZA 4E31A 3HVHA 1ZP6A 5KHOC 4BKMA 5H7XA 3WRYC 3Q8LA 2OFXA 3MXTA 4AO8A 1C8BA 4LDAA 1CQJB 4RMHA 4AZWA 4LV6A 2J46A 1RSZA 4B31A 1OB2A 1HT2E 1DEAA 1QIMA 3KV3O 4OGWA 1DDGA 4PLCA 4YMVA 1ZJYA 1UBSB 4E46A 4ND7A 1QK5A 2WKQA 4PONA 2XMRA 1MT0A 1BVUA 4RO0A 4UU0A 3T7CA 1PRYA 2BI4A 2D8MA 4IQ8A 4C3UA 1JXQA 4TXMA 5A4KA 3WL7A 3LT2A 1RKQA 3BFKA 4JI2B 2BTQB 4FVTA 2VNHA 3HLKA 1RAFA 5LA6B 5A5EA 1JHXA 1DX9A 1W0JA 2FUG6 3NWPA 1O89A 3A04A 1GT6A 4RPKA 1PT7A 1EE1A 2A4MA 4UTNA 4N8SA 1ZL2A 1QCZA 1NWCA 4YP0A 4H6VA 4K9MA 2I7TA 1PDOA 4LRSB 3OPVA 4DCMA 2YOGA 4H08A 1T1EA 3L04A 3K5IA 2HJGA 2Q3DA 2BEUA 5KQMA 3OMWA