4RY0A

Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
287
structure length
287
Chain Sequence
MADLIAIITPAHDNPFFKAEAVGAEAKAKELGYETLVMTHDDDANKQSEMIDTAIGRGAKAIILDNAGADASVAAVKKAKDAGIPSFLIDREINATGVAVAQIVSNNYQGAQLGAQEFVKLMGEKGNYVELVGKESDTNAGIRSQGYHDVIDDYPEMKSVAKQSANWSQTEAYSKMETILQANPDIKGVISGNDTMAMGAIAALQAAGRKDVIVVGFDGSNDVRDSIKSGGIKATVLQPAYAQAQLAVEQADAYIKNKTTPKEEKQLMDCVLINADNAGKLETFALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ribose ABC transporter, substrate-binding protein
publication title Crystal Structure of Ribose Transporter Solute Binding Protein from Rhizobium Etly, Target Efi-511357
rcsb
source organism Rhizobium etli cfn 42
molecule tags Transport protein
total genus 121
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2014-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ry0A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ry0A01
1RNLA 1ZAYA 4GNRA 3O74A 4RK6A 4Z99A 2HSGA 4JA2A 1PNTA 3OQMA 2JRLA 3CU5A 1D4ZA 2I6FA 2YHBA 3KG2A 3OM0A 1MB0A 1KGSA 3K9CA 5GQSA 3SY8A 2FKAA 3FGZA 4RZSA 5JS2A 3IP6A 2Q5CA 2N9UA 4PICA 2B4AA 4Z4IA 3SAJA 3SG0A 3LUDA 4RK5A 4WWHA 5DGCA 3Q41A 1DBWA 4G0XA 2PE5A 3QLVA 1Z2DA 2E4YA 3EQ2A 3G85A 4B09A 4YO7A 4Z4CA 3OMXA 4MR8B 6CHYA 5HM6A 3D02A 3QEMB 2O20A 1BDHA 3E61A 3OMWA 4FE4A 4G0QA 5KWSA 4IRXA 4G0PA 2PUCA 3LUCA 2MSLA 3MIZA 5IUNC 2E4UA 4PZ0A 3GBPA 1MVOA 1JLKA 3LUAA 2YHAA 3RQIA 1JFTA 3CZ5A 1YVUA 4JB0A 2E4VA 1R8JA 3CRNA 3QLTA 4N76A 2FN9A 3DGFC 2VUHB 3I5AA 2F8TA 2QU7A 1D1PA 4YS6A 1ABEA 1RPJA 2VYCA 4YV7A 1DC7A 1A04A 3BRSA 1QP7A 4ETNA 1JF8A 1QO0D 1NY5A 3TMYA 1JHZA 2FXIA 2MSWA 5IX8A 3HS3A 3RVJA 1D1QA 3QX8A 1ZVVA 1U04A 4H3HB 3F73A 1VRVA 2HQOA 1KRWA 4OBBA 1ISRA 3CKMA 1ZDMA 2PUDA 1HEYA 3HUTA 1E6KA 1QO0A 4P1ZA 3C3WA 5DTEA 3T6KA 2OENG 3QLVC 2BGGA 2F8SA 3IDOA 4MS3B 1YK1A 1MAVA 1XHEA 4Q6BA 1AB5A 3KHTA 3QX9A 1KMIY 3R0JA 4WUTA 4Z0NA 4Z4EA 3OLWA 1DZ3A 5F64A 2MYPA 3KLOA 2GBPA 3M9WA 5CNMA 4RXUA 3A0RB 3UK0A 5BR1A 3H5VA 1DP4A 1DC8A 5TE9A 1K68A 4WXMA 3JTEA 4G0OA 4MPTA 4MQFB 3VNAA 2E4WA 1URPA 3RVRA 4Y9TA 1EWVA 4JOQA 3ILHA 3FFXA 3KJXA 1M5UA 3O1IC 5FBHA 4DQDA 2PL9A 2QZJA 1YMVA 4OATA 3B2NA 1QP0A 3CFYA 4MR7B 4M88A 2RDMA 4RKRA 5KQLA 4OTZA 1BDJA 1YIOA 3N6VA 1W25A 3I45A 5GOTA 5TPWB 3HM9A 3BBLA 1JH9A 5TQ2A 1WETA 4KREA 1YMUA 3N0XA 3P9YA 2LBPA 2MYUA 4KZKA 1AB6A 2M1ZA 3O75A 3IP7A 4MS4B 2NT3A 2PUFA 4EVQA 3L49A 1VLZA 2NT4A 4HYEA 3HJFA 4O1IA 3CLKA 4F8JA 3N8IA 4KVFA 4F11A 4Q6WA 3BRQA 4WZZA 4FB4A 1NXPA 3IP5A 5TPWA 3MMNA 2FMFA 3RVPA 5KI6A 1IIBA 1TM2A 1BA2A 5IEJA 4MS4A 1DJMA 4OG2A 4PYRA 3CZCA 4KFCA 2IYNA 1B00A 2L17A 1EWKA 2L2QA 5HKOA 4YP9A 4W5NA 3CG0A 1DCMA 5C5CA 2JK1A 3DLBA 1ABFA 3KTOA 1JYFA 3H1GA 1LJUA 3MF4A 3W9SA 4RDCA 1LBHA 4KNYA 3QK7A 3MA0A 4NICA 4XFKA 2M98A 5T7BA 4G0ZA 4JAVC 2PUEA 4F3TA 2B1JA 1F51E 1U2PA 3HDVA 3DZDA 2A9PA 2E4ZA 2MYNA 4G0MA 4XARA 1RZRD 2PAFA 2AYZA 3TO5A 1M2FA 3Q7SA 5JNTA 4NCAA 3D8UA 4UHJA 3CS3A 3OLVA 2FW0A 3I09A 1TVMA 1C0EA 4MAAA 4HNRA 3O1JC 2H3HA 4F06A 2FSPA 4Z4GA 4ML3A 1EAYA 3UKJA 2FMIA 5FBKA 2LUOA 1RZRA 1M2EA 4F12A 3MM4A 3L6UA 1EWTA 1Z12A 1XHFA 3HXMA 1ZH4A 4Z4FA 1DRKA 1QMPA 3H5LA 1YTUA 3ROFA 2PMCA 2JVJA 1QNLA 3H5IA 1U0SY 4S04A 3KYIB 3T38A 3KKEA 4IMJB 1JL3A 2QW1A 3RVNA 2L19A 4E7OA 1NXTA 4Q7EA 1A2OA 1Z26A 3LKVA 4RK1A 3C3KA 4RK7A 1NXSA 1QP4A 3EDCA 4S05A 1L5ZA 4LDAA 2JB9A 4N03A 3NHZA 2CD7A 2GI4A 2WJAA 1QPZA 3HO1A 4KRFA 3H1FA 1CYEA 3O2QB 3RVKA 1KRXA 2FTKE 2RGYA 3HDGA 1A0OA 3KSMA 1GUBA 1NTRA 2A9OA 4XASA 3TB6A 3O1HB 4WT7A 5DCLA 3LTEA 4EYKA 1M5TA 2LPMA 3EJWA 1USGA 4YGXB 2QVGA 4RXMA 3A10A 5DKFA 3HCWA 4W5RA 5JS1A 3T95A 3KYJB 1Z2EA 3KCNA 1JBEA 5JNWA 2CWDA 4KPYA 1ZY2A 2J48A 1C4WA 5TQ0B 4W5OA 1D2AA 4HNSA 2NZUG 2IPNA 4MQEA 4LX8A 4IILA 1BDIA 5HSGA 3M9XA 5BQ3A 4XXHA 5T3YA 1APBA 2GKGA 1E6MA 3H5OA 4NV3A 4H60A 2HQBA 5PNTA 4RY0A 3F7NA 4YR7A 4QICA 4MLDA 1ZH2A 2NUBA 1ZGGA 3HUUA 3GRCA 4D6XA 4JASB 3TD9A 3EAFA 3OO0A 4IMIB 2WMYA 5TQ0A 5KC8A 2RJNA 2PUBA 1TLFA 1Z15A 5TQJA 4N41A 4UHKA 1LK0A 3N0RA 1W9HA 1ISSA 3GYBA 3F6PA 1BVHA 3IPAA 3NBMA 2X7XA 4RSMA 2LIVA 3LUHA 4N0PA 1PEAA 5TQ2B 3LUFA 3DBIA 1ZHHA 4D74A 3N0WA 1DCFA 2FMKA 1CHNA 1NXOA 4Z4HA 3QEKA 3KLNA 4KV7A 3RVMA 4PEVA 2FN8A 3Q15C 2FMHA 5FWYB 2JVKA 3EQZA 3O2SB 3HSYA 1Z13A 4N47A 3HVRA 1EFAA 4RY9A 4MS1B 1YK0A 3O2JA 4MLCA 2PJUA 2IPLA 3GL9A 2P4UA 1DCKA 1DBPA 1I3CA 3GV0A 2R47A 2QVCA 2W42A 3CNBA 4LE0A 5JNRA 2FLWA 5EWLA 4QYWA 5FWYA 2R4QA 3CTPA 1FQWA 4RKQA 2KYRA 4HNQA 1FFWA 4H3KB 4RU1A 4MS1A 4W5QA 1Y1LA 3H1EA 3LUGA 3VNBA 3ILYA 2VK2A 3NNDA 4Z9AA 1H9CA 2RJOA 5E3JA 1Z18A 2VUIB 1JDNA 5HQJA 1U8TA 2FEKA 3C3MA 1RXEA 4RS3A 2E4XA 3LUJA 3O21A 3S99A 3RVLA 1NXVA 1USIA 2GWRA 4E7PA 4GPAA 2GX6A 3N75A 4G86A 4LZLA 5I4CA 4EYQA 1JDPA 5JNVA 3MYYA 5IBQA 2FQYA 4RK4A 4D6YA 1UDRA 3HK2A 4DN6A 2FEWB 2JCGA 1GLGA 1TJYA 2FQWA 1JWLA 2CHFA 1QQAA 3T8YA 4ZYLA 2IDMA 3E3MA 1E6LA 1PEYA 4EVRA 5IUKC 4W5TA 1PHRA 3N53A 4MR9A 3HZHA 1GCGA 5IEBA 3GBVA 4RK0A 3EODA 2MSKA 5ABPA 3JVDA 3JY6A 3ROTA 4FE7A 2ID9A 1QQBA 4EGSA 4RXTA 4O1HA 2QSJA 1CEYA 1D5WA 2QR3A 3QELB 4EYOA 2FEPA 2L18A 5BRAA 5EWMB 2IPMA 2PKXA 3OQOA 5CHYA 4P98A 5D2CA 4ZMSA 3BILA 2H0AA 1S8NA 5KQGA 4LRQA 3URMA 4TLLB 2WY2D 1MB3A 4EUKA 2PUAA 1P2FA 4MQEB 1NXWA 2WWVD 4EYGA 3IPCA 3NNSA 4EY3A 5B3JA 1TMYA 2HQRA 3QELA 3BREA 3Q7RA 5KQPA 5EWMA 4ZJPA 5ED4A 2IPAB 1GUDA 3IP9A 8ABPA 4ETIA 4KQCA 1GCAA 2QXYA 1DG9A 2HPHA 5IULC 4ETMA 1SXIA 4PE5B 4L4UA 1ZN2A 4RWEA 1NATA 2PLNA 4XLTA 4MRMB 3EULA 1RXIA 1NXXA 4JB2A 3H75A 4YRZA 4OLAA 1L5YA 4CBVA 3JS5A 2ZWMA 2ZAYA 7ABPA 4MR8A 4N0QA 3JVIA 2TMYA 1JFVA 2HJ9A 1BAPA 1ZITA 2IOYA 3QEMA 4IF4A 1PNRA 2CHEA 4TMYA 4XAQA 3RH0A 4G0YA 3QLUA 2MYTA 3H5WA 1SRRA 3H6GA 3LUKA 4MYRA 5FWXB 4LE1A 1SD5A 4MRMA 3M6MD 4YCSA 4QPJC 3NHMA 3SQNA 2A9QA 3GT7A 1FSPA 1JFSA 3RVQA 4YWHA 4KK4A 4KK3A 3F6CA 1P6QA 1U2QA 1JYEA 3FFWA 3G1WA 3LOPA 2FLKA 4MGEA 5B3JC 4QYMA 4LDZA 1K66A 3FDFA 4OLBA 5FWXA 3H5TA 3K4HA 1SXHA 4Z9BA 1J56A 5EWLB 3TX6A 4KMRA 4RV5A 1ZESA 2AYXA 1EHCA 3C6QA 3JPWA 5CNKA 3SNKA 1OXKB 1USKA 2A9RA 2WJWA 2R48A 4WXEA 4NQRA 3JPYA 2WB4A 3LFTA 3Q7TA 3UUGA 5C5EA 2DRIA 2V0NA 3NNNA 3HV2A 3OQNA 5IUJC 3A3KA 1P6UA 3CHYA 2JBAB 1LJLA 4RY8A 3EGCA 4YLEA 3DGEC 4MS3A 3OM1A 5JNUA 2JVIA 2WRZA 5JNSA 3SM9A 5KC9A 1VPWA 5IC5A 2PUGA 5EWJB 3QLUC 3C97A 4TN5A 2OQRA 3RVSA 5TPZD 1ZGZA 3HEBA 4G97A 3A0UA 1YS6A 3Q9SA 3OLZA 4NCBA 3OLXA 3FFTA 2XDYA 3LKBA 2JBAA 2R25B 4L85A 9ABPA 3H6HA 1XWWA 4ZPJA 1Z16A 1YS7A 5CNIA 1Z25A 4MQFA 5TPZA 1SXGA 2FVYA 1QKKA 1Z17A 5EWJA 4MR9B 3OO1A 3CG4A 1FFSA 3FMVA 1PUXA 1FFGA 5KQMA 5BRJA 4ZMRA 2PL1A 2QV0A 4O5AA 3GWGA 4MR7A 3RVOA 2ID7A 2NZVG 3KS9A 3GA5A 3DLHA 1F4VA 6ABPA 1DBQA 1DRJA 1T34A 4IGAA 2P9HA 4TLMB 4DADA 1JX6A 2LP4Y 3LMKA 1E2BA 4EVSA 5CNJA 3OLYA 1MIHA 4LE2A 3I42A 4KQ9A 5DLEA 1P8AA 4JP1A 1VKRA 3MQ4A 1OXBB 2IKSA 2FQXA 1LBIA
chains in the Genus database with same CATH superfamily
1NPDA 1SOAA 2OHIA 3DP7A 1C0PA 4UDOA 4UM7A 4MIEA 1V43A 1XPJA 2P6OA 4ZU3A 3RW9A 2EYQA 3UCXA 1MBZA 2F8MA 3CLHA 3CR3C 2LRHA 4F4HA 4M38A 1FB5A 4BV8A 2IS1A 2NTNA 1MX5A 4JYMA 4L57A 2DPXA 4D99A 4LN1A 2EU8A 5AW4A 1FZTA 1U8EA 2Y1EA 4C7OA 1DO2A 3O84A 4IDFA 4AS1A 1Y3CE 3DOEA 3LAWA 3ZIUA 4RTRA 4LF9B 1X92A 3G5AA 1QK5A 4RVNA 4MUYA 2ZDQA 3LUDA 1A9RA 2FB9A 1WO8A 4Q9IA 3KQOA 3ZVLA 2NSDA 3I6YA 1ZC4A 4B6SA 3SIWA 4MR8B 4AYTA 2R6R1 2F55A 2Q3BA 1GNPA 1WTCA 3H2JA 4R8MA 1PJSA 2JGNA 2J6HA 3HXPA 4HGRA 4HQKA 3ZK8A 1E4VA 4ZC1A 3TCNA 4DXAA 5THKA 1DRUA 3L6CA 4P0QB 1WDWB 3K9GA 3MIZA 3PIRA 3R09A 4IV0A 4MIKA 3RJMA 1SXJA 1RKBA 4LYEA 3MJEA 5AESA 2WLSA 1W4AA 1M7GA 4Q15A 1NUSA 3SCZA 4F5EA 1T3ZA 4EO4A 2JA2A 3RT1A 5JCZA 1T36A 4M0FA 3QLJA 4GX5A 4KDCA 4M9RA 4U0KA 4F60A 2FOXA 2MSEB 1K1EA 2GK3A 5ANRB 5HX7A 4KZPA 2VYCA 4WECA 4WZAA 4PQRA 2HMVA 3BRSA 1SB8A 2WUFA 4C7MA 3MWEA 4S1OA 5KUTA 1E1QA 2VTVA 1P44A 1JR3E 5DGIA 3RVJA 3TW0A 5BW8A 1MX1A 1UBSB 3H86A 3FB1A 2EL9A 5ALLA 2W2PA 3MWFA 1XCPA 2VDJA 3D1JA 3OJXA 1HT0A 2HIGA 1DEXA 3JRWA 1AA9A 1OHHA 4B3SB 2Z2XA 3GLFE 2UXCB 3L8EA 1YK1A 2KQUA 1FXWA 3KQKA 4TRMA 2DC1A 4CLDA 3RARA 4Q9HA 1YJQA 2IYUA 2MHCA 3CINA 1KMIY 5J4KA 1HSOA 2FPRA 5CNMA 4RXUA 5KU1A 4X91A 1N5DA 5AP9A 4CWAA 4P3XA 4KTVE 4DLKA 1FLVA 2GN2A 4G5FA 1CR6A 4ZQBA 1PU2A 2C3OA 1EJ0A 1UXOA 2BWJA 2NQ2C 2BFCA 5CB4B 2NYRA 3BH7A 2YS6A 4E3ZA 1K6XA 5DIFA 4R1NA 1EIWA 4OGWA 4HDNB 2Y1OA 4YRRA 5F3DA 3SS8A 1W52X 4MV6A 1NLZA 4ZD6A 1E99A 3L0OA 1L3IA 4HO1X 5H9VA 3ETGA 4F4JA 5KNCA 4LY9A 1GG8A 4KMMA 1UC5B 3U0VA 4RKRA 2H8GA 4N7JA 3WMXA 1X80A 2XNJA 1BCSA 3DAFA 2GZ2A 3PRJA 4QEKA 1FUKA 3HJGA 3T3MB 2ZB2A 1XZ8A 1G8HA 4OQQA 4MKXA 5EE5B 4HNTA 3OHPA 5FPHA 4J3JA 1SUWA 5DB4A 3QOXA 2C3UA 4YJ2A 4HYEA 1TUGA 3ROGA 3EWAA 3B1FA 3EDRA 3R3YA 3MBIA 1TVKB 1BDBA 1FVFA 4HAXA 3RBAA 3WADA 4EUFA 1VYTA 5GVRA 4FFWA 1JIIA 1UDAA 3GFBA 3T7AA 4K28A 4DIOA 3W5IA 2XXAB 3EDYA 3MCWA 4RC9A 4RE6A 1T91A 1MIOB 3ZCTA 4K6FA 1SZDA 4PM4A 1QHXA 5IEJA 1L5KA 1T9KA 4MS4A 4O0MA 1AN0A 3LY7A 2P6RA 2E9SA 4BUJA 4DR7B 4QOGA 2CC2A 1AKTA 2O4UX 5BMVB 4LXQA 4W7SA 1KAGA 2Q5QA 4UCQA 1IZ0A 1W29A 2O6HA 3BBPA 4FFPA 3DLBA 1IULA 1ZD4A 4ZOAA 3VO8A 3DJFA 4QDOA 4TTSA 5J4HA 1ESEA 3PKZA 1EWQA 3PWKA 1KEWA 1TU4A 5EP3A 2UZ0A 4JAVC 2VK8A 3FUVA 1IBCA 2OHVA 5IM4A 3LRXA 1V8BA 4KPUB 3H1AA 1LSSA 2G04A 1SNYA 4MEBA 1LDNA 3K8YA 4FJ1A 1XQXA 5DCYA 1JU3A 4JBXA 4UFNA 3R76A 2XWQA 3UEOA 2ZJ2A 4W7HA 1B23P 4PLTA 1N2SA 5I7OA 4U00A 5L4SA 3B48A 3FVQA 4BXOB 2ZI9A 1B8UA 3EBPA 3GMIA 2HRBA 1I5RA 4X60A 4Z7OB 4ACBA 5D7NA 5LNK6 4F04A 3Q2KA 1MC8A 3GD5A 1KBOA 1U28A 4IDQA 3VAZA 4HHEA 2H1OA 1MW9X 4LJ4A 4FIZA 1JIKA 1QGYA 2JIDA 1LSUA 5K3CA 1Z22A 3ROFA 2X2EA 3EGEA 2Y0EA 1JRLA 3NUGA 5CTJA 2H11A 1SVUA 1JAHA 2QRVB 1NMZA 2JEZA 3ESYA 2DUWA 1GA4A 3ZIAD 5AVTA 3HXQA 3GHYA 2YMPA 2O8CB 4BTLA 2JL1A 2VWQA 3KPYA 4ZXPA 5KNCH 1BMQA 2M6RA 1DBVO 2GHTA 4ZCIA 3L07A 5K0SA 4TXJA 2IZ7A 2X9VA 2ERCA 5DTMA 1ODTC 2UYGA 2XBUA 3NHZA 5ALMA 3WKAA 1N32B 2QAJA 3DOCA 2BMFA 4XCQA 3SOZA 1ZKDA 5DIZA 2P9EA 4E4TA 4DMMA 1DG3A 3RDPA 3NQ41 1OZAA 3L18A 2ZYRA 4ARUA 2BKLA 1L7AA 1NOKA 1FRZA 2RHWA 3CH7A 3GLHA 3PGA1 2WKPA 2O1EA 3R8FA 1U6IA 3EIXA 3R5HA 5CIYA 1VL2A 4IH1A 1T6NA 1PWHA 4RD4A 4CR8A 4BX0A 1P74A 3GRVA 1UBRS 1USUA 3INRA 4BGUA 1SG9A 2O1WA 2IPNA 4IILA 2II6A 4H7JA 3L93A 4NESA 1MAAA 5BR8B 4GECA 2GK4A 1WWKA 1EA5A 2BKAA 4XX1A 2ONZA 3RC3A 2OT3B 3FZEA 2CY0A 4RY2A 3RJ5A 2BHTA 1BXGB 2YWEA 3QW4B 4S1NA 1E63A 3OJCA 5SYNA 1WV1A 4E2WA 1BFDA 3HN6A 4BFXA 3S2EA 9LDTA 2JJYA 1QOPB 5F5NA 3WK4A 2EG5A 4G4GA 4E11A 3UF0A 4HGYA 4WEOA 2JGRA 3EIOA 5TT1A 3V33A 3F0TA 2RK3A 2X6RA 5KTYA 1E2GA 1XLTA 3A3NA 1MC5A 1NUAA 3B38A 3PUJA 3LUFA 2NTEA 3LBYA 4AF6A 3N0WA 1DCFA 3H4MA 2BCJQ 3BJEA 4BVBA 4XVRA 3S8YA 4M9UA 2ATEA 4M49A 3ROXA 1RHJA 4AB1A 3P0HA 2O7QA 4YHHB 2PJDA 3EH2A 4IO0A 5FBQB 3NG1A 2BSAA 4HB3A 3A1FA 4G1UC 1FP7A 1H8EA 2HCBA 3P0RA 4RMHA 1CUJA 3EGWA 3UMMA 5T67A 2W2LA 4RH3A 1MEEA 1NDHA 4OOFA 2XA2A 3DTVA 1CNFA 2JD2A 2QVZX 3NTRA 2BM9A 3ZE9A 3C15C 3O8RA 2YCLA 4NBRA 5AW8A 4R3WA 1KQOA 1QYRA 3LWZA 4JU9A 4Y67A 4ZOBA 3DHNA 3EGXA 3GMTA 4RKQA 2B8WA 2QD5A 4MIYA 4E31A 5DM70 1A3CA 3KKMA 4MJ7A 3BE5A 1TO1E 3FPBA 4ZU6X 2I7DA 5SYMA 3RBVA 5KTKA 1FQKA 1Q1EA 3DZJA 3IQGX 4RDIA 4XR9A 1EUQA 3PX7A 2H00A 4C4OA 2OILA 1WUTA 4MKHA 2VUIB 4PCUA 1BS1A 2G0AA 3PX3A 2WLTA 2YTZA 3SN6A 2FZCA 2JFBA 3PCRB 2Q9CA 3OFKA 4Q3KA 5FB3A 4J0JA 4L27A 5L7YA 5JQGB 4N4AA 4B4VA 3QXXA 1FFXB 2DCUA 4AJ9A 1EDEA 1FNMA 1RXYA 4PC6A 1VLVA 3D5EA 3PE6A 3IDAA 4MB2A 1BMDA 5AW3A 2WAAA 3F90A 5HF6A 4MOWA 1BWRA 1PWYE 5EHXA 4FFSA 4IIEA 2OCGA 4FEEA 3ELBA 1CT9A 2FQWA 2CHFA 1JHRA 3D43A 4B3IA 2ZI6A 3BFJA 3GN1A 3MCUA 3VSAA 3EFEA 5GV7A 1J09A 4TVKA 1VE9A 1SC4A 2WIKA 2GHIA 4DDMA 4EHDA 4L5JA 2G77B 3MZ0A 3SXPA 5K0ZA 5KWIA 1QVRA 5A4AA 3EODA 3G82C 1EXNA 1GU1A 4M1OA 4KIJA 4MEAA 4B3DA 4LHWA 4C0LA 1T1GA 4JHXA 5BNIA 2YJ6A 2QRMA 1XBTA 4HH1A 1ENZA 4BNLA 5JAOA 1BWQA 1VCOA 4MCIA 1U90A 2NX2A 4WBNF 2FEPA 2INGX 2PWAA 3ZCVA 1SN7A 4AN1A 2O2CA 2YXPX 5GP1A 1J7KA 3PBKA 3RFFA 1G4AE 3GDWA 3EF1A 1ZMRA 4N3NA 4QATA 4B76A 3VNVA 2G82A 2XQFA 2ZE8A 5EMJA 1TOAA 5ALQA 3ZTWA 3FPCA 3TB4A 3QOFA 3M6IA 1AS2A 2AK2A 3C6BA 5T8KA 3T1QA 1PT6A 5H7XA 3F4KA 3PV0A 4MDEA 3TPZA 4IY1A 5A1JA 2WE7A 2WYOA 1OLSB 1ZXLA 2ZFUA 4ZDWA 2QP9X 2L0XA 1DEOA 1Y8QB 2BGMA 3TW4A 1JA9A 1Z5PA 1IVYA 2ODTX 1CR1A 5CFOA 3SYRA 4X1YB 3THWB 4LY6A 2WZBA 4FTWA 2X3UA 3V4OA 1P1JA 3BQNB 5KPDA 3IHTA 2F64A 3JD0A 1I6KA 2YJNA 4PE5B 2FEAA 1FQJA 2FZGA 1QH8A 5KOHA 2VKQA 4FI3C 2AZ4A 1A8SA 2YVAA 4IFEA 2QB5A 3R7WA 3RG2A 5IBRA 2Q07A 4QOFA 2J87A 3O9ZA 2ZWIA 3QU5A 2NV6A 2XMQA 5I9BA 4AZ3A 4L2IB 7ABPA 3L6EA 4BO1A 2CFSA 5C46F 1KBZA 3K9HA 2GVNA 3LPAA 4ZVNA 3LVFO 4YMHA 1E7QA 1FUYB 4L0QA 3IGFA 2QVBA 3O26A 5JXGA 1HYHA 3UFXB 3AI2A 3DDSA 4NV1A 4GI1A 4IIGA 3O92A 3DCNA 3H8WA 1G5PA 1N9GA 4RYDA 1Z0ZA 1QH9A 1UZAA 2ZRPA 1JFSA 3I0NA 3H2KA 1QR2A 4XIFA 1GAJA 4R1OA 1KQ3A 1VCMA 3ZV6A 4TQAA 4B48A 1ZINA 2ZREA 4D4HA 5CD1A 1Q0PA 1O95C 1GTJ1 5F77A 4KGDA 4QDXA 3PEEA 4WLOA 3UY4A 4I2VA 1BXKA 1TQ4A 1N2CE 5FWXA 2QMZA 5LMCA 3K4HA 2DVMA 2CVQA 1AS0A 1UPXA 1G16A 1XHLA 1J2EA 2DFDA 3A7DA 3K05A 2PS9A 2GFQA 5CNKA 1AZWA 1JDZA 1OXKB 3VKUA 3ZQKA 1XDGA 4EW2A 5A5VA 5ICGA 3EDQA 1W87A 2Q1XA 4GZLA 5L6MB 1M2OA 2FF7A 1DADA 2E89A 2ATXA 4HCJA 2PVPA 3I3OA 4H6XA 5GONA 3NNNA 3VYVA 2V7UA 1OX4A 3ZWYA 2CHGA 4DNQA 1VL6A 2PANA 3GNLA 2JLCA 2ZJAA 4JUFA 1OT5A 4CKWA 4X44A 4HY3A 4YLEA 1I3NA 5CVVA 4MS3A 3O83A 2GEBA 2IX9A 5TGTA 1FX0B 1V47A 1CETA 3BWMA 2PWBA 2JIZD 4K2AA 2P11A 1J07A 1LUAA 2OSBA 1JVBA 4TN5A 5D1NA 3LHIA 1P4GA 3QF4B 5KSZA 1X9GA 2W6ID 3QU2A 3TIVA 1ZD8A 2B4RO 4BNNA 4L73A 3QE0A 1EFPB 4X0EA 1UWVA 4JT8A 2WD8A 1L5LA 1Y3HA 2B4KA 1B6TA 1AF4A 1C7IA 2RAFA 1JXQA 3P7MA 5LWHA 3QZUA 4G9BA 2BEUA 1JQEA 1R1DA 1UXGA 2BFWA 2C61A 2FJUA 3BXXA 1QGOA 3IVGA 4FLFA 2Z2YA 4GM0A 4RZ2A 5CT8A 1KKMA 1F4PA 2G7ZA 4Q9JA 1JUDA 2P9GA 3GJRA 4MR9B 4QECA 1L7BA 1TECE 2CGEA 2ODNA 2RHRA 2ZWPA 3BGDA 3DAYA 3JSXA 1GFWA 1EXMA 4JJAA 2WUGA 1YI1A 4EL0A 4CMHA 2PMEA 2QV0A 4GP6A 3VISA 4JJEA 1OLUA 2ZCUA 3GYGA 1Q74A 1VJGA 3QY0A 2D6FA 1WKBA 3E8XA 3R24A 1TFUA 4O8CA 4BBZA 2POQX 3M6LA 1Z6AA 3BXFA 5DEOA 3TS1A 2H63A 2ZBFA 2E37A 1AUVA 1PG5A 3GCGA 2EQ5A 1LZKA 1RWXA 3JQCA 3ORSA 4LRWA 1MFZA 1KA9H 3C7KA 1MB4A 3IERA 4PLCA 4WK6A 1LBIA 1XQ6A 1YBFA 3DV0A 3H11A 3IOCA 4IIDA 3GPLA 4DUYB 3D4IA 5EIFA 1IHOA 3RVDA 1VLHA 1M34A 2K7ZA 3H5RA 4IEEA 1XRJA 4LQ4A 2C2YA 4MUKA 4TLDA 1E9AA 2BR3A 4IXDA 1EQAA 3ILXA 2RIRA 3H3FA 2V6MA 1P7CA 2H2HA 3AR7A 3KG2A 4YAEA 2JZNA 2OLJA 4L5YA 1NNI1 1CUCA 4GT1A 2RB5A 1RM5A 3T3DA 2N9UA 1TZJA 5E2IA 2DZDA 2ODAA 1QQ6A 1RJEA 1SULA 1NVMB 2BTQB 2Q3EA 2X9LA 3B1WA 2SKCA 1U0HC 4C05A 1UP4A 1QZ3A 3AR3A 4L8GA 4FN4A 1GG9A 4CLRA 1VL8A 1H5UA 1EA7A 4CF4A 1FMLA 5IKOA 5CFMA 5DEIA 5JDIA 3MBKA 3K0AB 1XVIA 1C50A 1J9EA 3OTHA 1RYBA 3CJTA 2ZIUB 3H65A 1EGVB 2D5LA 4FYHA 1UFOA 4PAQA 2E4UA 1M2JA 2AB0A 5F52A 2EG9A 3GJXC 3HBNA 2YHAA 1G8YA 4N76A 2VYNA 2J41A 4RVUA 2Q27A 3AHEA 4FGKA 4QC2A 3R23A 1SK9A 4HB2A 1PG0A 4QUDA 2HT6A 4YS6A 2YVLA 2H2IA 4GXRA 3ZYZA 4HTAA 3VGJA 2G9UA 2A5DA 4J1NA 4WNIA 5BSRA 3R8XA 4OJKA 1GGVA 4FFMA 5IM5A 3TAHA 3IODA 3E9QA 3WIBA 1GUAA 1T13A 1QDLB 1GT6A 2VHQA 2YVQA 4BV2A 3QX8A 1SFRA 1VCHA 1N3IA 1U3TA 4HDSB 5LYYA 4KQKA 1KNQA 1L5QA 1P0PA 2JLRA 1J5XA 2QNRA 3CKMA 1AZTA 5JD5A 5IH3A 4HN2A 1N92A 3F7OA 4EKEA 2W5UA 3EHDA 1FFDA 1WNTA 2X9GA 3WZLA 1BE6A 1M67A 3LD9A 3AUSA 4NFHA 4DSOA 5EE0A 2IJGX 3HRKA 3NIDB 3NALA 1MNQA 1E9DA 1AB5A 3Q8KA 5CFPA 1BXRA 1ONSA 3OD1A 2PQMA 1X3LA 5F9FA 3IPLA 2FPSA 5AW5A 2P1ZA 2ZR9A 4C4SA 4KNVA 2W83A 4J3FA 4MP3A 4W6QA 5AW2A 1AMNA 2YWXA 4TROA 3NVAA 2GF0A 3NIBA 1IM5A 4BE7B 3EAGA 3GG9A 1E0AA 3KZ1E 3MXTA 4CHTA 3A4TA 3BTOA 2I2WA 1L4HA 3MWYW 3CLUC 3K0SA 2QUKA 4BU0A 1M74A 1JB1A 1XF9A 2ZITA 1KIFA 4HWGA 5EQFA 4Z7NB 5AUOB 4Y1EA 3QBEA 3NV7A 4UU8A 2EXXA 3KR9A 3N8KA 3ETDA 1CX9B 3K5WA 3QU9A 4A2PA 3C8DA 2NO7A 2J4FA 3FBWA 3HJUA 5FKJA 4YT4A 3IXLA 2DH5A 1BGVA 3G2JA 1C1DA 3ST7A 3UO8B 4EKGA 2PQ6A 4FS3A 1T26A 2FR0A 3IQEA 2GSWA 4A5SA 1BE1A 1LBEA 2EGHA 1FUIA 4P58A 3FCOA 4R2KA 3FRJA 2E55A 5DE3A 1XZBA 4P81A 4X3PA 3N2GA 1R0KA 3M4YA 1BGXT 5K0LA 5JIBA 2P67A 3EMDA 2QRKA 4QARA 3M9LA 2G0NA 3AIOA 1E1YA 1L5VA 2IWRA 2WD7B 1KDPA 2B7CA 1NXPA 2ZYSA 1X1AA 5BN4B 2I4IA 2BDUA 2H0RA 1MGOA 2FPIB 2VJLA 2XNDA 2ACKA 4EA7A 5B2EA 5LYJF 1XRPA 4OHOA 2XE8A 3JD3A 1KZGB 2X1HA 4LKRA 4DKXA 1IVNA 4J0DA 4E5KA 2Z2JA 4B87A 5FA6A 2IC5A 3EVGA 2WMDA 3GRKA 1Y4ZA 5IW8A 3JWEA 2DQ4A 4Q9DA 4A73A 1MTOA 1H94A 2IUFA 3FCSB 4P5DA 4W5JA 5BRNA 5JO0A 4FWTA 4HSGA 4HN9A 5AJUA 2VAPA 3V00A 1PW5A 5E8JA 1CRWG 4TOIA 4BX8A 3DZDA 2VNIA 1JVSA 1QOQB 1WXQA 1XVTA 2AYYA 3GEIA 5D85A 3VR2D 2VQEB 3IR6A 1ZEMA 3TNYA 3Q7SA 4RANA 1PV2A 1IONA 1XZAA 2B1QA 4CIYA 3V1UA 4KWIA 1S1CA 2EOAA 4P08A 1EVJA 3CUTA 3NVMB 4DV4B 3PHIA 4ABTA 1PVVA 3D4BA 3IMFA 4ER0A 3MAJA 1WXEA 2JFVA 4GKBA 4U2GA 1XXHA 3FTFA 3TW8B 1W5SA 4R2MA 3S29A 2PS3A 3DBHB 1P73A 3EZ2A 2NU7B 4Q01A 1PR6A 1D2MA 4DIBA 4EX7A 1QLWA 2Q3LA 1RRPA 4JZKA 3U4MA 1OFGA 4HEA1 3RS9A 2MTBA 3LXXA 3W2HA 1U0SY 2JFHA 2FP4A 4V39A 1NJSA 4L51A 2HSDA 4NCJA 4O4JF 5I3ZA 2BFEA 3MUFA 2OBBA 5DISB 3TVDA 1V16A 4LDQA 4RK1A 4QU0A 1ZUWA 4S12A 4HQRA 1X7XA 3JQAB 5D3KA 2K5UA 2HPZA 3RABA 4OSEA 4N03A 1CUGA 3HL0A 4URYR 2B78A 1I4EB 1ZAKA 4C0WA 4U3JB 3R9KA 1ORIA 1I10A 3I32A 4QJ5A 5JSUA 4Y2HA 3WMWA 2BFFA 3AEQB 4PVCA 4PZCA 5JD4A 1G8JA 1A9YA 4HNVA 1ZSVA 3TL2A 3WX0A 4RXMA 1NLMA 4ZTZB 4FDMA 2RAVA 1W8IA 2VJMA 3WS7A 1CWUA 2PK3A 3D3NA 3DWGA 5DHAA 1JBEA 3BHJA 5DBIA 5K6RA 5HCIA 1TAGA 5IARA 2NPFA 1QIFA 1CNEA 1D2AA 2VK1A 4V0OA 1NWHA 4TKLA 5G0WA 5AM5A 2VYVA 4R0VA 3OBIA 2WVHA 1UAAA 4LCEA 4EUHA 5KJCA 2P6PA 4JGGA 4IQGA 2FGJA 5LR6A 1GVHA 3A6JA 2AUTA 1F7VA 5JRZA 3R7DA 2JBHA 3HLKA 3S2GA 4X62B 3F7NA 1E66A 1POXA 5FUBA 4CG1A 6Q21A 1YFKA 1Y42X 2V6BA 1T4CA 2JARA 3TOVA 3CSUA 1Z2OX 4AJHA 4BNVA 2O3RA 3KZVA 1G60A 2ABWA 2DECA 1N2HA 1KTVA 2KS6A 1T4GA 4PGFA 4JJ4A 1T2NA 4WDRA 3VX4A 4HTFB 2D06A 4BMDA 4EA9A 3UMYA 3VQTA 4R2LA 2J3LA 5FTJA 4F84A 5HQ3B 1QXSA 1VLLA 3FCUB 3BMOA 1XAGA 2BBOA 2LIVA 3D0QA 4XW2A 3OHSX 1AHIA 1LW6E 4CTJA 2Y0PA 2NXWA 4DLRA 1NMYA 1K7CA 3V8EA 3QGMA 1YJBA 2A35A 3FPEA 1CF2O 1OZFA 4B32A 2FMHA 4C0HA 4M9QA 3E82A 5E6UA 1PLJA 1UBGA 1UODA 2WU4A 5J9FA 3G13A 4D45A 3GT4A 3N2YA 2IH5A 3P52A 2GPAA 4BAGA 2CVHA 3RV3A 2VJQA 3QYFA 4QNNA 1E2QA 4ZRMA 3UMCA 4M86A 5IWCA 3NVKI 1A5TA 1RKQA 2J32A 4ZAVA 1ABBA 2LNDA 4LQDA 4KITB 4H2DA 1LFDB 4JEMA 5J2TA 2GN9A 4TTAA 5AKIA 5UKDA 4AW9A 1T1EA 4DV5B 2D74A 1I4DD 1KPGA 4P3PA 4YRKA 1G5IA 1LWNA 2R2AA 4JMLA 2F9MA 1RPNA 1W59A 4LQCA 4MRRA 4CMKA 1OC2A 4EAQA 4NXNB 5EMKA 4BX3A 4BMCA 3D81A 3G1UA 4FC7A 1T0IA 4P4TA 2PZAA 3IOYA 3KKNA 3CJRA 3FFBA 5DNAA 3B9BA 5JWHA 1E79D 2IXEA 3FVWA 4HSEA 2GCIA 3THOA 3B3FA 2VNKA 4BLRA 2IHNA 1AZSC 1XDUA 3QFSA 1R0YA 2WG1A 3JCZA 4JUCA 4WXHA 3JTMA 2R68A 1XLTC 2VP2A 3QXHA 3VKVA 3MFYA 8OHMA 1KS2A 3KKZA 2ST1A 2O0MA 4NY1A 5LIPA 4Q9LA 2H08A 3ZGYA 3CVYA 4PYLA 1G8PA 3OKCA 2A0UA 4DIFA 2QIOA 4YQYA 4HEJA 3VC1A 4KE6A 3KEOA 2OYSA 3BDVA 2HJSA 1SHTX 2QJWA 1RQXA 4BNUA 4WXPA 4UNIA 4OGGA 3WBBA 2EEPA 3ZH9B 1SQSA 4B7ZA 3KQTA 1E94E 5E6SB 4EY4A 4YJFB 3T5AA 4CEIA 3DZCA 1PEYA 2I91A 1P1CA 2X7JA 4IJUA 4QRHA 4DUZB 3LWBA 5JD3A 1PHRA 2ZR0A 1QQTA 3GCXA 3I4FA 1GYRA 3NAMA 3LPNA 3LC2O 4HXYA 1V6SA 2YJTD 2AFIA 3JVDA 4H4EA 1ZIDA 3AEXA 1QQBA 1PT8A 1JSRA 4F2WA 4S1VA 1TGYA 2GEVA 3LZ6A 2BMAA 5G1NA 3AR9A 3MLBA 5GZ6A 2ZRKA 1FC0A 5EKUA 1JAZA 4Q48A 3WLOA 5FRDA 3ZS8A 4EYOA 4TZTA 4YRQA 1SCAA 5JR3A 4ZMSA 3FDZB 2DFNA 3FTNA 3TOZA 3WA6A 2JIBA 2CLMB 2R85A 3EGDB 3GGDA 4LRQA 3G9QA 3PFIA 4PYNA 4PQYA 2JDIA 4XQEA 2QVXX 1PL8A 4MVJA 2WWHA 4Q00A 1FDRA 5AIAA 5WRFA 4M1YA 1IRIA 2WG0A 4ER6A 2POCA 3RC2A 5DTIA 3RRXA 5JVDA 4GEKA 4ZARA 4UNPA 2NNLD 3B7GA 1TMYA 1W2GA 4WCFA 2A9JA 1A5ZA 1GCIA 1L7EA 1F3LA 3KSRA 3QVLA 4LJ6A 5ED0A 3WZ2A 1PFUA 3IKVA 2UUBB 1L4MA 1EKXA 1A8UA 1VJ5A 2E6UX 2IYQA 1MZVA 4N82A 2PTHA 1Y8RA 1SBNE 4Z5XA 3C1UA 1H3EA 2GXUA 4HJRA 4CETA 2B1GA 1K8ZB 3S70A 4RIFA 3IIMA 1XCBA 5DTQA 1CY8A 2KX7A 1W96A 2CE2X 3MD0A 4UCWA 2VSNA 1CF9A 3JQRA 2X0FA 3B6ZA 2P9TA 3RH0A 4BFYA 5BWLA 4ZHQB 1B93A 1XQ1A 3P2JA 3H6GA 3P8ZA 5A2QA 1GEGA 1YDEA 2QGNA 4MICA 3H05A 1F48A 1SG6A 3TPFA 3TZKA 3T9DA 5HW0A 1XRNA 3OAAA 4A6EA 4RETA 1E2EA 2OM2A 4L8LA 1FSPA 2FSUA 1GKLA 5DXAA 2PRSA 3TZLA 1LDMA 3EZFA 5MDHA 5T8KC 1KQNA 1I7SB 1I51A 4JLSA 5B2ZA 3ZE2B 3L4KA 2D0DA 3IBYA 2WK1A 3IRUA 3ESXA 4HDRA 3ONDA 4LK3A 4OBEA 2NU9A 1E1MA 4NOMA 2Q5EA 1R74A 3AM1A 1SXHA 2AOVA 2ZVDA 3AB8A 4M9ZA 3NR2A 3WRYA 4ALLA 4ARBA 3ZCSA 3WV4A 2KLHA 1RQ7A 3IDQA 3B82A 2XCIA 4FIDA 2R48A 4LNAA 2W0MA 5CEFA 2ZIAA 4BWVA 5A2GA 1PZFA 2G67A 2PWPA 3LDUA 4DBLC 2DRIA 2FUG1 2OZLA 5T4BA 4YQFA 2GRJA 1P1IA 2P69A 1E69A 2Z0MA 4NLLA 2OZVA 3TDKA 1YFZA 3LIIA 3WGQA 1F7UA 4GOKA 5JCOA 1U98A 4C0KA 4ZQGA 4MVJH 1XI2A 5FF9A 5HRUA 2IITA 2YC4C 3RR2A 4REQB 2BHNA 1B26A 2QX4A 3OP4A 3K0CA 4L6AA 5EJ8A 1XALA 2HSEA 3HEBA 4FN5A 4HEHA 1PJ2A 1P4HA 3TSAA 1P1BA 4Q7MB 4AECA 1P0FA 4G0WA 4TM8A 1H22A 1MXHA 2WABA 1LEHA 1JR3A 4KSBA 4ZPJA 3G6WA 5JDCC 4DBVO 1QVWA 2IU4A 1GTZA 2IIBA 4ZRDA 4OVKA 4GM1A 3TLZA 1TEHA 1PN3A 2OV8A 4WFQA 2G1PA 3OC6A 3KTDA 1U3GA 2WFZA 3N58A 3TTVA 4P53A 2O23A 4D80A 2Q6LA 2WQ6A 2JD1A 1QRTA 3DLIA 3PLRA 3IA2A 5DT2A 3RRFA 2ID7A 3GLFA 2VHCA 3GA5A 1JB9A 3Q5GA 1OIVA 5I8ZA 5AHWA 2IUUA 1FA9A 3BWDD 3WAKA 4DY6A 3J7AC 1QRDA 3DNFA 1TK9A 3L1JA 4KW7A 5IJ9B 3SS7X 1YS2X 2XT6A 3GFOA 3R5FA 1MIHA 4KR2A 3DZKA 3ZNQA 5KTSA 1CY4A 3L05A 4XR4A 2BHRA 3VZRA 4GOXA 1LF5A 2GPYA 3G8BA 3L5KA 3O95A 3I52A 3QWFA 1E5DA 1KYYA 3PC2A 4F92B 2W70A 3ZYCA 4AWXA 3FLEA 2RK4A 1EBFA 4CM9D 3H17A 2GCEA 3COPA 2OO3A 2IW1A 1WQ1R 5B55A 1N2EA 2BTOA 4K0RA 4QDUA 2OXFA 4R31A 1L5HA 2EEZA 3U3MA 4NZPA 3WFJA 3V1LA 4PG8A 3WBKA 2O5RA 1JHAA 2VT6A 4R8LA 3KQYA 5AI9A 4QD3A 1IN6A 2PZJA 4AJ2A 3R9IA 5ADHA 4R16A 5EJAA 5IT4A 2ES4A 2ANCA 4LHSA 3DVQX 1C7RA 1I1NA 2DSNA 1EMDA 2WF9A 4Q4CA 5KNBH 4I5FA 5FORA 1S2IA 3A1CA 3MTQA 3UJCA 4XYLA 1G5HA 5DHPA 5CXUA 3SAJA 3S7TA 4N65A 2Q4RA 4WK4B 3TTTA 4HBZA 3TVYA 3ZR4B 1O8CA 2DPMA 3HY6A 3VO9A 4CV2A 4G26A 1K2WA 4KXMA 3PQ8A 1KJIA 1SB9A 5JAPA 3BMNB 3DVRX 3GDOA 4DDWA 1M7BA 4KE9A 3I2YX 2VPTA 3DC7A 4PQGA 4RTOA 5JJBA 2AFHB 5KHLB 1DWQA 2FPOA 3L0PA 3LGSA 4J8PA 5AD1A 2Y66A 4US0R 5EJIA 1RI4A 3WL8A 3IEXA 3PR1A 3ESQA 2OCDA 3ICOA 1FFHA 1EFTA 2E4VA 3P32A 4JB0A 4RHTA 2NQTA 2DLCX 3KDPA 1H9BA 1RXVA 4OHFA 1Q6ZA 3JQAD 2JIPA 3ZG6A 4IJWA 1IEQA 2C94A 3K9BA 1KMQA 2AFVA 1UJMA 3FNIA 3E7FA 4L50A 3ZKWA 4D8WA 2VCYA 2VZ8A 1WVMA 4CUJA 3A3OA 3K6SA 3AEUB 5CLJA 3HDTA 5JFOA 1D1QA 2JAUA 1OT3A 4OBBA 1TLLA 2NYUA 4QZVA 3F6EX 5L3VA 3LLSA 3DMPA 2IP1A 4HLNA 1MJFA 3DDWA 2O7VA 3ZY4A 3VR6D 4BP8A 3FOCA 3IAFA 3LC0A 3QE3A 3T3NA 2NADA 1X7WB 1OGJA 3A6PC 2OHGA 5ICMA 4BV9A 5LMUB 4YMWA 5E9QA 1YIDA 2I3GA 4FOSA 4F4IA 1BKYA 2DBRA 4D56A 3GH1A 4X45A 3FUXA 1EB8A 1GQSA 1H6AA 3QVUA 3R7AA 1T2VA 3CUWA 1DKQA 2ZRHA 1OA1A 2DWQA 3A4VA 3KLOA 4MWSA 1JDJA 2ZTUA 4XUDA 3UV7A 4EJSB 4JI4B 3CEMA 2GZRA 3L1VA 4BO6A 4TWBA 3KD2A 2GN8A 2Q2WA 3B8EA 1EFVB 4QUBA 1ND6A 3GEGA 4MVWA 3HR7A 1KMNA 4X97A 3WYBA 1FW6A 1PK8A 1SQ0A 1WW3A 4XDYA 2J5XA 3OTWA 2AUMA 3PL5A 2A8YA 2WFMA 1M6WA 3LGXA 3QEJA 4U6SA 4R05A 2RHLA 2HRRA 5I8PA 5HILA 4BYGA 2LDBA 4E1AA 2ZZNA 3JQ9C 2ZYDA 4YYZA 4EPVA 4DQDA 3IV7A 2QZJA 1Q0QA 2Y4NA 1PSWA 5JAZA 3HA2A 3K4QA 1QHSA 3F9IA 3E1GA 3HM9A 1ISJA 2ZYGA 3PDHA 1W4RA 4X3CA 4DGSA 3TLYA 2HN9A 3DDUA 2MYUA 2C1ZA 2M1ZA 3IS3A 1RSZA 1WIWA 4YMTA 2PUFA 2FKNA 2R1UA 4N7MA 5CLQA 3UT5A 3VOAA 4ANFA 4CDRA 4EVQA 3NXSA 3L49A 3BERA 3RYIA 4GU5A 1NUTA 5JFGA 2P9FA 4FWIB 1ZMBA 1YQDA 3G9ZA 4U7FA 1W93A 3OZGA 4FZ5A 3EOBI 3TQQA 3WFIA 4I0WB 4C4YA 4DMLA 3D7KA 3ETHA 3BWXA 4KSYA 1TJ5A 4AJLA 3JYQA 1U4NA 4OJQA 1L7OA 3F6SA 4TTRA 4NRDA 4FX5A 4BQRA 1C30B 5EMNA 1E61A 5LWQA 2IXDA 3WICA 3ISJA 4UM9B 1C3OA 1V3UA 2FJPA 2MT9A 4JKIA 1I3MA 3ROEA 3WGHA 1O8BA 1Y3BE 2L2QA 5CR9A 5LKAA 3DMRA 4W5NA 3PVCA 1JQ5A 4GPZA 1WMBA 1ABFA 5CIWA 1JYFA 2C9OA 4LYYA 3VU1A 1KFKB 2DWPA 2FFHA 1NVDA 3A36A 3A9TA 1E2LA 3EUEA 3R0VA 4IEIA 4NICA 4XFKA 1C4OA 2XDWA 5JW6A 5A0VA 2QA5A 2Y68A 4I55A 3NJRA 3CE6A 4ND1A 1P2TA 3U3DA 4E03A 2ZUDA 3PJGA 1GN9A 2ECQA 4O33A 3WA7A 4G0MA 1FZQA 3AF4A 3OZTA 1GGEA 3D7MA 4QTYA 2EL7A 1MO3A 1HQYE 1TB4A 1UBUS 4RVDA 5JNTA 2NVUB 3QRWA 3HJNA 5THXA 3UPDA 5L3ZA 2C4WA 4F06A 4AY2A 2FSPA 5DXFA 3EVCA 3HYCA 4LRYA 4E5VA 2AI1A 2VHWA 2OCBA 3AJ9A 4W5WA 4ZVRA 3IE1A 1EWTA 3GJYA 3AZPA 1X87A 4PYIA 1C81A 5FQOA 5JH7B 3H5LA 1BJRE 1N4AA 3AKCA 3H1BA 1P33A 4J0CA 1EUDB 4U6QA 4G1EB 2O0JA 1E3SA 4YDRA 4AKEA 3PUVA 3K6SB 1OH5A 5CA1A 3B1JA 4DQLA 3RVNA 3STYA 2RGEA 2WJGA 2XKKA 3CVUA 2P79A 1AY0A 5DN6D 2CEKA 5LQDA 3TIIA 2CFRA 2R6HA 3SC2A 1EX9A 3HJTA 4M3NA 5D5PA 2C4VA 4GZMA 4M0PA 4RGVA 4R1UA 1J97A 1GRNA 5EJFA 5CK4A 3IIKA 1DX6A 4A16A 3ADBA 3EPHA 3PJFA 3D0RA 4WT7A 5DCLA 2PRIA 1G3RA 1TI7A 3FI0A 4J2HA 4UTXA 4F2GA 1HEIA 2VG8A 4G85A 2CLHB 4JYAB 1M2HA 3K2EA 2YJ5A 2YZ2A 4PLFA 1H1LB 2DTXA 2J0UA 4OB8A 4UQOA 1NE2A 1OFUA 1QM5A 1ZY2A 3PGLA 3S1LA 3UWDA 4CODB 5HJEA 3ZU3A 1NUUA 1AQJA 3NWJA 4I5IA 5IJ0B 2L42A 4JSRA 4MQEA 2I2BA 2XJ9A 3DR5A 4QVKA 4I9NA 3PYMA 3D8RA 2C7RA 2C2XA 3AP1A 4QAQA 1D2EA 3IE2A 2NPOA 2X42A 4RM3A 2P7HA 5HJ5A 5HYVA 2BMJA 4DCOA 1HL7A 3OQIB 4YXFA 4FW9A 2AE1A 1LSOA 3L0IB 3PEYA 1LQ2A 4DMUB 1EWYA 1TZCA 2I78A 2V8OA 3LHSA 3MRTA 2FRDA 3QVGA 3KOMA 4PBRA 4EI7A 2PUHA 3THYB 3VZSA 5DYWA 1AKQA 4D96A 5KC8A 1YRAA 1PW7A 2YJGA 3QMMA 4JJ7A 3WYCA 3I28A 2H18A 1F6DA 2W6PA 3B1XA 1LK0A 1NIJA 1QV9A 3RAJA 3VHRA 3LQYA 4LHVA 3NAQA 4MI6A 1QDUA 1ZONA 3IEPA 5B3AA 4Q7QA 3IIIA 3O8QB 5J43A 2X7XA 4XDHA 1Y1TA 1SUIA 2VDUE 1ESDA 3BL8A 4MKFA 1XA0A 3SOPA 3WIVA 5JRDS 1TRHA 3GGOA 4W9NA 3OCWA 2VP4A 2G83A 4MVJI 2FN8A 1JVNA 3EGOA 2R1VA 4I1VA 3UAWA 1BFKA 4Q3CA 5JTUA 2R0QC 1NX6A 4WLEA 4CQLA 4FHCA 1OLXA 2C2OA 1RLMA 1NIPA 1IUKA 1XNGA 4S0XA 4XVHA 2Q0QA 1EFAA 3EE6A 1IATA 4LJ9A 1T5TA 3N59A 1YZTA 4TS3A 1XRSB 3A26A 3IQFA 5E1BA 3O2JA 1CR4A 4DREA 5CFNA 1E1KA 3HYTA 1P5RA 5DGXA 1K88A 3AWIA 1W36C 1FNBA 4B2PA 3G2MA 4MGYR 1L4EA 3UGQA 1M1ZA 1JDSA 2PGXA 4X7PA 4BMSA 4V1CA 1JLMA 1ORDA 2H9AA 2WFAA 3IO5A 5FWYA 3RB8A 3F9RA 2FPUA 1VE5A 2PIAA 4JDPA 2VQFB 2X58A 3LX8A 2V1XA 4I4CA 4CTOA 4C7VA 4UOZA 3VV3A 4MS1A 5ALHA 1Y1LA 1QCZA 3ZWQA 3HUDA 4KOAA 4WW0A 4YPOA 5HR5A 3K1YA 3DDOA 1YNSA 3M6XA 4FD2A 2GBIA 5HQJA 4X8HA 4B6JA 3NBFA 2B5OA 3A58B 5AKHA 1WUHS 2NU8B 1ML3A 3BWYA 2PO7A 2RGBA 3X2SA 2ALJA 1NDUA 1C14A 1EVQA 1XZQA 3G0OA 4O4LB 1J2RA 3RT9A 2BP7A 4PAMA 1TAQA 5EIWA 2D3WA 4GMXA 4KRXA 2MCFA 3L6RA 4N8DA 5EMMA 4C4XA 2YXDA 2YYZA 3ZDZB 1E7RA 3QA3E 4OHXA 5IBQA 3Q7IA 4NF2A 5JNVA 2P3QA 1O0CA 3D6NB 1N2CA 2EHDA 2EBFX 1UJ2A 5TB5A 3V8RA 2CE7A 1ZJZA 2ZM6B 2C9ZA 2YNMC 3VOTA 3T8YA 5J2UB 3GRZA 4C5BA 2Y6VA 4QU9A 1WM1A 5BN5A 4WFJA 4HDQB 1G19A 2A1UA 1XZLA 3FUTA 2PYDA 1GCGA 4YREA 2I1WA 2P41A 4GOJA 4KEAA 5EY5B 1VA4A 4TV9F 3AF5A 4HT3B 4MUGA 5COAA 1VJDA 4IUYA 1Z82A 5E6RB 2QM7A 4DVJA 4EI8A 4GMFA 2ID9A 5E7QA 3VOSA 1Y9JA 2JLUA 2REQA 4NYIQ 3D2AA 4DCGA 3PQFA 1AV6A 1A5BB 1YE3A 3KB8A 4QAJA 3FB4A 1EAMA 2VJPA 3NEAA 4G5OA 4TV8F 4UAUA 1YFLA 1RAHA 2ZB3A 3WKDA 3PHHA 4RHFA 4RELA 2BSQA 1LY1A 2HCJB 3AI3A 3BC1A 2AWNA 3D2LA 1QR6A 3E3LA 5EINA 5FJIA 4EHAA 5J4YA 5KQGA 1QG2A 2OG2A 4TYNA 1JW9B 4RFSB 3ML1A 1V37A 3VZDA 5I5GA 5JEEA 2VF8A 2R65A 5KAMA 1G59A 1YDMA 1Q17A 4G23A 1T9ZA 4DLXA 3M0EA 2I9KA 1IK6A 1ATIA 1VGQA 3WLIA 1PDVA 2GK7A 3BREA 4WX2B 1N2BA 3DZHA 3BWVA 4H0NA 8LDHA 2HRQA 3HKCA 4QGBA 3U7QB 2W4MA 1ZOOA 4A8JB 5IH7A 3I34X 2HPHA 3QQPA 2EZ8A 2DKNA 1SKBA 1ULBA 4HNHA 4KLZA 4BVFA 1T9BA 4XSHA 3GLIB 1QIGA 3GOQA 4CUKA 5CM8B 2FWJA 5CPFA 2VRCA 1KYTA 1GFZA 4L4SA 1E3IA 3TD2A 2SNIE 5HNKA 1NF9A 1XA3A 4KVAA 4JI7B 4QBKA 3EASA 4F4FA 1GZ7A 2WTBA 4L5AA 1AT1A 2WI8A 3KRTA 1WEHA 2VDWA 3LKZA 4OXQA 3UNXA 5JYBA 1KO5A 3KSZO 4MR8A 4QDTA 2XR1A 1A96A 1U2EA 4OKNA 2AXPA 1J8MF 3MJCA 1I1HA 3CXRA 5I9IA 1WXFA 3K92A 2YWCA 4M7WA 4YAWA 4UOEA 3FPLA 3LL7A 3KOWA 3LUKA 1EESA 2IXFA 3EA4A 4B3GA 3OE1A 1Q3TA 4OQYA 3S68A 4NPHA 1I2CA 1A7AA 3U62A 1KOGA 4W6ZA 3K70C 3ZD9A 4CLXA 5CCEA 1MXFA 3QFCA 4GS5A 4ZAZA 5JS7A 4KQGA 2XH8A 3H4VA 2WB2A 1JYEA 1E77A 3E3NA 4LV8B 3MS7A 4M87A 2IS2A 4P35A 4QYMA 3OCVA 3VC2A 5JSYA 1CTQA 1I4OA 1K8RA 1M76A 4K6KA 4V0SA 1KETA 3HVIA 1JG1A 4P4SB 4RABA 4BFCA 3VKGA 3F97A 2VQ6A 4BMYA 3WDMA 2IS4A 1QGDA 2JG3A 1ZVMA 1SOWA 5JE8A 2X3YA 3IUSA 1Q0SA 4ESHA 4YMIA 1A72A 2UXDB 2GYVA 1QVAA 1CUIA 5D86A 4EHBA 3FUWA 2ZPAA 3IQWA 1AO3A 3ZY2A 3VVCA 1W94A 3AYXB 2IEZA 3PQ7A 4X7RA 3DJYA 5AVXA 4XQ9A 3KALA 1D03A 1RZ3A 4LXTA 1YB1A 2WM8A 3KZMA 2B4TO 3AR8A 1UCFA 4QYWA 1P9LA 2HMYB 5TPZD 1IDN1 2FX3A 2PSEA 4NHEA 1QK4A 3W5SA 3WWYA 1K4YA 1DTEA 2VP9A 3S2UA 2JIZA 1E92A 3LVRE 5CB4A 2Z8XA 2ZT8A 4IJ6A 4QOJA 4LF7B 1R8YA 3EFHA 3AUKA 3MRVA 2FW9A 1R4ZA 4WERA 2Y77A 3DHYA 5IC6A 2QMQA 4L76A 1SCJA 1NF3A 2SKDA 4L8YA 3RNLA 4A27A 1ZCZA 2IQ5A 2XOKA 3DONA 5ER6A 3SHOA 2BRUA 3SX0A 3VH1A 1OOEA 2JEOA 1RFGE 5HMLA 3WRYC 4BWYA 2NW6A 4BMOB 2ZM5A 1G3IA 2OV6A 1FTNA 1IJEA 2P3SA 3D6TB 1T34A 4L16A 3SYLA 2FSSA 1V71A 3F7TA 3QPBA 4JJKA 4RQTA 3GCWA 4AF7A 3U5TA 4MV0A 4TN1A 2WU8A 3NC0C 5BQ5A 1GQYA 2FK8A 3DBVO 5KNCD 4LSGA 4BLVA 3MCVA 2XWPA 1UC4B 2IHZA 3NV9A 1ZN7A 1VKRA 4JP1A 1JKJB 5JCOC 1O77A 5C8VA 4PQEA 1MA3A 1JLLB 5ELLA 5AW9A 1S8AA 2BFOA 4JYPA 4H1UA 4HLQB 4UM9D 4ZI7B 3M4NA 2Y92A 3COYA 3NTXA 4R8RA 4ITUA 4JCOA 3WLJA 3A9SA 5A04A 1Y3IA 4HUJA 4DLLA 1LLFA 3BCRA 3V6LA 2XXAA 1A95A 1E2KA 1TA0A 1MIOA 1Z62A 2RBGA 2OB2A 4L4XA 1N77A 2VQ3A 4H0CA 1RABA 3KL2A 3OIDA 2GM5A 4C5AA 2Z9BA 4Q3EA 2OHJA 5C8YA 1F60A 5BMVA 5I7FA 2QN3A 2VAWA 4IPTA 3CC8A 3CH5A 3RSFA 4AMBA 1EK6A 2EKPA 2YIMA 4A0QA 4BKOA 1GAQA 4UTVA 2BMDA 2B4AA 1PFKA 4JGIA 4UFPA 4DABA 2V7BA 5TMPA 3QTTA 3R9XB 5DMHA 4FFDA 1PWEA 1YJAA 2E4YA 1V96A 4P2BA 4ZZ3A 1ZI6A 1E5QA 1SK8A 2B83A 3FTPA 3OMXA 4GQIA 1K4MA 3ZY3A 1VHQA 1FDWA 3RS3A 4FE4A 1J1UA 5T6BA 4K86A 3IC5A 2PRKA 5K1ZA 1JPJA 2PUCA 4UAVA 3DEAA 1XZEA 2C59A 4PW0A 4L72A 3VJRA 3ZVKA 1R0SA 1EVYA 2C8JA 2W7TA 3HYSA 4UQLA 3IX7A 3FBGA 1EUCA 2ZCVA 3JWGA 2CJWB 1K8QA 3CZ5A 3K1AB 5DV9A 3VPSA 4AWAA 4RJIA 1JAIA 1SUAA 3HLYA 3LJKA 2VP5A 4MCAA 2GRAA 3JYHA 2WZCA 3P9KA 3DGFC 1Y6GA 4D4GA 2UUAB 3IVXA 4OAPA 2ZYHA 4H0FA 1YDFA 2GKSA 3DEYX 3IP8A 3QMPA 3BYZA 4CV0A 1XMPA 2JGKA 1X3SA 1D8TA 5BVGA 5CDTA 3W1VA 2ZBRA 2XV1A 4J16A 3Q2IA 4EENA 3EZ7A 5JSQA 1Q3HA 4JFRA 2O8CA 1JHZA 1WBJB 3TKLA 4F1JA 1VYVA 4QL3A 4YI5A 1C4XA 4A5OA 2VZEA 4J1TA 3SVTA 1NOIA 1YR6A 3KVNA 2GBLA 3DQPA 3TD6A 1TYDE 1ZUD1 5ITZA 2SCUB 1HEYA 5JHHB 4DR4B 2AZMA 1TMKA 4AKTA 3JWPA 4C6TB 1IUNA 2HNAA 4DC9A 3EF0A 4U6NA 1RRVA 3MW8A 3OM8A 3HKDB 9MHTA 2CVPA 2H7VA 2WWWA 4B46A 3E9YA 4PG7A 1KWGA 4ZKDA 5GADl 1UPUA 1TVCA 2AA3A 3M83A 4LIPD 2VBIA 4UTNA 2OXEA 2XEDA 5F64A 5CFLA 4PHHA 5AHRA 5C2JB 4R5MA 1J90A 1RM3A 1V7PC 4J0GA 1T8UA 4Z8XA 1EPUA 2CDRA 2PS0A 1CJVC 5FV7A 4BQNA 1RAFA 3U44A 1CYDA 1JT2A 2D1SA 3TLXA 2CB0A 3E58A 4LF5B 1QZTA 1DIHA 3DKKA 4AZSA 1B2RA 3ESAA 3PFWO 3WGGA 4JWTA 4B43A 1C7JA 1X7YB 4K6OA 4QQNA 5LQSA 2WVAA 1EWVA 3AFIA 4GRIA 1DFIA 1HOTA 4TUYB 2VWPA 3PGKA 5LC1A 4A92A 2PL9A 5C18A 1S4MA 3FPSA 1KSHA 3LIPA 5P21A 2M6KA 1MVNA 4PPNA 4GMGA 4UUQA 2IYXA 2BBSA 4D97A 3FNHA 2F00A 4HQOA 1O54A 3I45A 5FUVA 2EZTA 1UP6A 4ZOLA 1P7PA 1W7AA 2ZIWB 5EI5A 2H5JA 4Y2JA 2FFQA 4ZI3A 2LBPA 4EZIA 1AB6A 3LX4A 2C7BA 4XGKA 2ISSD 5AW0A 1DXQA 3TOCA 5JC8A 4WY2A 2Q6IA 3NHUA 5IS2A 4DIEA 4IL5A 1ID1A 3QSGA 3AVPA 4I14A 4QYIB 5EXXA 5U9CA 3EPRA 3IFSA 4F11A 3B13B 2ZIXB 3JAWA 4XEUA 4INAA 2Y2VA 1KYZA 4UZFA 2DMRA 3DLAA 3VU3A 4FCVA 2FMFA 2XGGA 4UTZA 3RVPA 3R41A 3SWWA 2GKOA 3NEJA 1W49A 3FA2A 1I5OA 2IPOA 2WSSD 1JSZA 3EUAA 1DE0A 1WW8A 2DUJA 3GEDA 3FOZA 1YC5A 2O0HA 2JAOA 1NURA 4GLBA 2QLNA 4NMLA 5C5CA 1RAAA 2C1EA 3T54A 1EVZA 3CN7A 5BYJA 1D9XA 2X8LA 2XRMA 1FU7A 4KPFC 1QB8A 2GD0A 2ACWA 2N1BA 3OA0A 4H7IA 1NJ5A 4MV8A 1NN5A 1UJNA 4RJLA 4UEKA 4OHWA 5B58C 4MP8A 2X41A 4MYCA 2WAMA 3WDLA 4ADSG 1Z4QA 4RUKA 2PAFA 4B9EA 3DYVA 1SD1A 2HSZA 1JJIA 1Q91A 4DDKA 2HADA 1AD2A 5B3LA 3OLVA 5KOJA 1OJLA 4DC1A 2DTDA 1RIFA 5JQGA 1DX4A 1NJ8A 3VR2A 3WXMA 2YOFA 1D2HA 4KDFA 5K3FB 4C22A 4NL4H 5G0TA 4EY5A 5KYKA 2FMIA 2UUOA 3TLMA 4UHCA 1KDTA 5HUJA 3V3TA 4II2A 3ZU2A 4CR7A 2J5QA 2P78A 1ZD9A 4EEKA 2ZSEA 1T4DA 4J2TA 4GLJA 4B6RA 3IEKA 821PA 1AKVA 4M6WA 2AW5A 2YQ4A 4IO1A 5CLIA 3WIUA 2EJVA 2F7SA 5CEEA 4V1CI 5K2OA 3DLPX 4IMJB 1KERA 4JB8A 4DV2B 3C85A 4B3CA 1PSZA 2BGNA 3ADPA 4PFKA 4D8YA 4QUHA 2OCLA 1NMSA 1A69A 1XRLA 3H2ZA 4HZIA 4NR0A 1P2GA 3A1WA 1JSXA 4DM3A 2WA2A 4CKYA 4H6WA 4Z9YA 5LZ7A 4WUVA 1RBQA 1F3OA 1P18A 3IB6A 3KEQA 3QNUA 1I7QB 2D1FA 3LG2A 1CYEA 2OV2A 4G5XA 3TLGB 2PZFA 1QYWA 5H0IA 2XMGA 1YB6A 1NTRA 1U9YA 2EBWA 4P7FA 1PFGA 3L7LA 2N47A 4WAUA 3SHVA 4BAZA 2YXEA 2ID4A 3LK6A 4PWYA 5DKFA 4F5WA 5FOQA 3UMFA 1H2WA 3HCWA 3TPCA 1YAHA 1I7PA 4JNCA 1JU4A 3DTNA 4MRNA 5D6OA 3C7AA 5ALSA 3COZA 4OOEA 3ZHUA 4NZYA 4H1VA 3DYBA 2FDRA 1UBTS 5HKAA 3UUFA 1J33A 3GEPA 1NU8A 1P2VA 3OJOA 4RZXA 2DHCA 3IV9A 2XVZA 2GAJA 2EJBA 2XXBA 4MWEA 1IUOA 2WP8J 5K09A 3R0QA 3HXOA 3REQA 4X1YA 2P6UA 2QU8A 1YULA 4W9RA 1LH0A 5IAAA 3UW1A 2B1IA 2VZ9A 1QGZA 2BOVA 4I1IA 3WWPA 3FVTA 3IQIX 1EU1A 3WQBA 3ED1A 2O8DB 4CKEB 2UVPA 1VSTA 1US8B 3D6FA 3R74A 3KPJA 2HDOA 3H9UA 2RARA 2IYRA 3WI7A 4P4LA 4RD0A 2PUBA 2C9MA 1EI9A 4HF7A 4KKXB 4JA0A 5DASA 3VZBA 1CQXA 3PXCX 3T7IA 1R6VA 3OIUA 5L8VA 4N0PA 4XGNA 4O3FA 5A6SA 3DE0X 1U81A 1E7MA 1CHNA 3UFXA 4BE4A 1U1FA 2PMFA 2TMKA 1VHWA 4F21A 1KOJA 1WUIS 1R9NA 1UM8A 1PV4A 3OTOB 4J2OA 4U2DA 4N47A 1E5LA 4EFMA 3IL2A 1A2QA 4AN4A 3HEMA 2BI4A 3EXAA 5JEDA 5DDIP 2VWGA 2A9VA 3IJPA 5FNVF 1LPBB 1PV1A 4RHYA 4BOYA 3M1AA 2HJRA 3U4DA 1A8PA 2R47A 3OE7A 3RYHB 2EDAA 4LZZA 4KPEC 5IHXA 3WYFA 2FLVA 4N5HX 2AC2A 4IHJF 4HP8A 4OQDA 4RADA 1NFRA 4WV3A 1BHQ1 2HDNB 4UKDA 5DSZA 1XYYA 4BNDA 4AM8A 3JZIA 4OXXA 2X14A 3D4PA 1S8FA 1XD8A 1LX7A 4INOA 3VNBA 4B45A 5ADWA 2EWWA 4ZCTA 2VK2A 3MJHA 1M1XB 3OIGA 3JWIA 4XWYA 2YWGA 1JDNA 2P8JA 3G0BA 2KBEA 4YUXA 3PDCA 4KXNA 4NWIA 5EZSA 1Z2NX 3CEAA 4IDBA 4NCHA 1Q5PA 3T7JA 4W99A 4ENSA 2J0EA 2IIVA 1E79A 3B1KA 4NYJR 4ZC8A 4QUGA 3IYLW 2GRUA 3ADKA 5ARCA 2C3YA 3QF4A 3GGJA 1FIUA 3V8QA 2O07A 4DR5B 2ZRBA 2Z6VA 3GGCA 1OPRA 1NN0A 1EM8A 4CT4B 1RC0A 3OWXA 3X1DA 2R1TB 4WIAA 5FEUA 4HBGA 1SCBA 2G6TA 2J3EA 4LHZA 521PA 3EEFA 4TMVA 5C1IA 3RUHA 3U4CA 3HMKA 3N53A 3ONWA 2N46A 4MR9A 1UKAA 4B7CA 1FRFS 5ALOA 3OZDA 1QRUA 1AH2A 4MKZA 5ALZA 3UTCA 1VBFA 2Q4DA 4QODA 4AYWA 2QUZA 1HZJA 5JCXA 4MJXA 4IHQA 4TS9A 4C1NA 3GLIE 4RJTA 2J6IA 4CQMB 3OFNA 1R6UA 4J6FA 2NUAB 2J9GA 3KV3O 1F38A 1I7NA 4LG1A 2AQHA 1YT5A 1O57A 3PDIA 5G02A 2NNWB 7MDHA 1U63A 1EK1A 1M8PA 2ATIA 4QQKA 4RCVA 1I0ZA 2FZWA 3RQSA 3TKYA 4PYJA 2C00A 4XX0B 3R5XA 2BFDA 3DS8A 5BNZA 2VO1A 3ZGNA 2AS0A 2H6EA 4EIWA 1V7QA 5A4DA 1V3VA 3FR7A 5ECDA 5L95A 5ESDA 1LFAA 2RHBA 4JMPA 4HDKB 1EX1A 4NFSA 5B37A 1C9DB 1K7EB 4GI2A 5FNVB 1G1AA 1QF6A 4PV7A 4MDFA 4BX9A 3BTUA 3FAZA 3SQXA 5DOVA 5LP6A 3PHGA 4DMFA 1PG2A 1H0RA 3MJ4A 1R0WA 1N9KA 1ECGA 2Y27A 3NWEA 4DLNA 1ESMA 3T9FA 3DUFB 5FO1A 3ENQA 5IYZF 4XUGB 4IOLA 2XGJA 4JX8A 2XUOA 2VSQA 2PLNA 4ERNA 2OOKA 4W1PA 2WZDA 3AUTA 5T6MA 3JASA 4HQNA 3GA7A 3A1NA 4PGMA 2B94A 1JHPA 1C8BA 4DPLA 1EE9A 1L6IA 4IICA 5D84A 5C4IA 2ZBUA 4PF1A 1D7OA 4J1SA 5JS8A 4QGGA 2Q0XA 2ZI7A 3TYXA 3T9AA 1Z36A 4ER5A 2VVTA 5E7MA 1RT9A 4DRXA 2HNKA 1LNQA 3OIVA 1XEWX 3D8BA 2R7AA 4HDMB 1OAOA 1VMDA 3BSWA 2QD1A 3NHMA 5HE8A 3NYWA 5FWDA 4OX9B 2X5XA 3MWGA 3TZQA 5JO9A 5I9NA 2NM0A 4MI1A 3WL5A 2VT7A 4EBBA 4HNUA 4A0SA 2BV3A 1HYEA 2VHYA 3KKLA 1JEEA 4UEJA 3RIYA 2ZU0C 2C2ZA 1PJ4A 1ZEJA 5FUMA 2RE8A 4N6NA 2O5EA 4JVSB 2H54A 2CUTA 1ZN8A 1BFUA 4C76A 1SU6A 3PE4A 5BSFA 1G18A 2IDKA 2QM3A 4JXZA 1VPVA 2Q5JA 3MT8A 1GQQA 4DF3A 1HDOA 4HDSA 4KAFA 4TYPA 1TYCA 2D0OB 2Q3DA 1DFHA 3BFPA 4KC0A 4IP0A 1SOUA 4NCIA 1U1IA 3BJMA 3OOWA 1N6OA 4NK4A 3ID6C 3G8AA 1CQIA 2Z6QA 1B4DA 2H51A 1KMCA 1Z6PA 3KJZA 4CM7A 1JBKA 1U7PA 2PKRA 2QSYA 4FJ0A 1MX3A 4ZGWA 1O9BA 3SM9A 3IILA 4FEYA 1O6GA 3FTCA 3BJRA 2ZJ5A 2EP8A 2I65A 4K40A 4HH0A 4I4TA 4KX5A 3ZX5A 1VG1A 3RVSA 1XTBA 3R4VA 4G97A 3OSZA 1BN6A 2DKFA 1P1FA 2Q99A 1FTGA 3CISA 2YH2A 5JYCA 1NP6A 2Z56A 3Q2OA 1K6IA 2DUNA 1CVLA 2C4KA 1KR5A 3P2KA 2DPHA 4B2IA 3NLLA 2H65A 3G2IA 5IAEA 2WD9A 3WRXA 3RHSA 1UEIA 3EDOA 3QH4A 4N48A 2BEJA 1PLKA 3DEJA 2W2TA 1WMFA 5CA0A 2ZE7A 3I23A 1KJYA 3EZLA 1KHTA 4W8GA 3OPNA 2QL6A 2Y93A 2RGNA 2NTYC 4QIHA 1IBMB 2FQ1A 2I7TA 2P9HA 1TTHA 3T7EA 1CR2A 1DVRA 1RKVA 1GEEA 4TMFA 1W0KD 1TKBA 2VR1A 2XQIA 3LX5A 2FH5B 5CNJA 4LE2A 3VYSB 3HDYA 3WSVA 3UJHA 4QXQA 2VNSA 1AKYA 3HCPA 1VI6A 2V8BA 4JBIA 5DLEA 2YX1A 4C7OB 3KSDO 2PGIA 1L1QA 5C8DA 1L7XA 1GXSA 2BEKA 1DBSA 3NHPA 3BX1A 4HAZA 1HZZA 4QRIA 5EG5A 2AOUB 1H2XA 2WD7A 4Q1AA 3DD5A 4MKRA 1GR0A 5I9SA 4Z49A 2OQ2A 1DC5A 2XTJA 3N2NA 3PNLA 1OYWA 1B41A 2RGAA 4WN3A 1U3UA 4R1LA 3TDMA 4BJ3A 4D57A 2XITA 1FFYA 4EHJA 4YUAA 3RODA 4ND4A 3OQMA 3GB9A 2PZ8A 4OHYA 1P31A 2OVBA 4CM9A 1UR5A 3DEZA 4OGFA 2R6AA 1KNXA 4KN5A 3ZH2A 1ZXXA 1P0IA 5HFNA 1WMDA 1M6YA 1U8XX 1RWOA 3D5QA 2PXAA 1O4WA 4WWHA 1TEVA 4CDGA 4C2TA 3J80A 2J4CA 2BRUC 4B09A 3HB1A 5AK5A 1V45E 1GY8A 1JI3A 1UBMS 3RAFC 2QZZA 1XEFA 4CCSA 1FE8A 1XCGB 3I9NA 4D79A 1CY0A 3FDIA 1D1TA 1RXCA 4WGGA 3K72B 4L7QA 4WZAB 1HH4A 2ZROA 3DM5A 4DV7B 2OG1A 3PDUA 3R0XA 1EEXB 2V65A 3U7EB 4ZRNA 3TW8A 1NMEA 3WQQA 5I47A 1U99A 3DBHA 5TRTA 2DETA 1F2TB 1RWQA 1NA5A 3RG8A 1Z6XA 1EZZA 3TZHA 2I2FA 1XJCA 5IM4F 4G65A 2WTUA 3H99A 4K9QA 1XKQA 5ULLA 1QMGA 4DA8A 3NGXA 4WI1A 1C1HA 1DINA 3PUHA 3MTJA 3N87A 4FNOA 4XWOA 4D9JA 2ZBVA 2J09A 1HDXA 4BO4A 1F8XA 1D8AA 4ZQFA 4Q39A 2CL7X 4RTJA 3HS3A 4LISA 4IS2A 3PG5A 1I0IA 1R4NA 1X1TA 3JQAA 3QV2A 3YASA 4G84A 2DHDA 3ESCA 3R7NA 4EKDA 4DMRA 1TUBB 2QRPA 4U3JA 5AXBA 5JCPA 1AKRA 1AGYA 1JEJA 3U6KA 3HBJA 4FBGA 3QYAA 2ZZMA 3AEQA 1KDOA 4QPNA 2VKTA 5LUBA 2OCKA 1LU9A 4UBLA 1U0NA 2PXCA 2BFCB 3DL7A 3IDOA 1KO1A 2VL7A 2QJRA 3K0EA 1MAWA 4E4RA 4BVKA 3ONVA 1PYOA 3IUEA 3ZXIA 1RLTA 4ZIRB 2DLDA 3CUYA 1NYLA 3CRMA 1RQ2A 6REQB 2MYPA 2ZUCA 4RGQA 2GBPA 3RS0A 1TCUA 2HK6A 1ETUA 4HUQB 3T3IA 4QJBA 3HACA 3H8SA 2JGAA 2P2CA 3NAZA 3QKRB 1X80B 2QX7A 3NW9A 5A3VA 1BCSB 1DELA 2DGDA 3B5JA 1IHPA 1C2YA 3EBOA 1E1RD 2Z5FA 3P0FA 5D3QA 2Z9DA 5BORA 3A7EA 1KF0A 2E2WA 2VJOA 3HVHA 2IL1A 4FYJA 1GGJA 3RS8A 2CDCA 3A3YA 2Q9BA 4JJZA 1R9JA 2HOQA 4NOLA 3VNAA 5HM8A 3OECA 4LZPA 4Y9TA 4OI0A 4YJ2B 5F78A 2ZXUA 3Q98A 4J16C 4RTKA 5EPEA 3A31A 2V6JA 4Y6LA 4HQLA 4DXDA 1YTLA 3PC7A 1CE8B 4CM3A 3H3JA 2AHRA 4J1TC 2F3TA 3OZAA 5EUMA 5HKBA 2GBLC 1X7HA 2FFJA 4HXGA 3GNTA 4UPEA 3P26A 3J7TA 3P9YA 3TK1A 4BUZA 5M2QA 3M89A 1VBKA 3O75A 4F9GA 4MS4B 1WF6A 1BMFD 1PFQA 3GEEA 3MCZA 4LXUA 4N9WA 4OKSA 1LC3A 3QUSA 3UJDA 3AH8A 1AUOA 3UHFA 4X95A 3VMFA 2UYCA 3GO4A 1WPRA 2PX0A 1B8NA 4P80A 3CKYA 4BWGA 1ZJYA 3JU3A 3N8IA 3H87A 1VYUA 1N5RA 2QYHA 8MHTA 4Q6WA 4WLUA 4DM4A 1SVSA 3H4IA 4ZEXA 1UM9A 2IV7A 4UVIA 5KYYB 3G8CA 2NV2B 3OKFA 5F76A 2CXQA 2WJVA 2GJ4A 2XWJI 2QXUA 5E4FA 5HK9A 4EHFA 1X6VA 2O5VA 3QTLA 1ZNZA 3AY6A 4II3A 5ISMA 1OYOA 4EHKA 2R86A 5AHKA 1E62A 4N3GA 5HF9A 3P9PA 3IE0A 3UJ9A 3BMCA 4RDCA 2I22A 2Z9CA 4IIYA 4LPSA 5DRYA 1FNCA 4HVAA 3TIGA 3A1TA 4CCYB 3V8VA 4DYVA 2IV3A 1XFDA 1ZJJA 3E81A 1KY4A 2FPWA 1KJNA 4H27A 5FBRB 1IN1A 3RS2A 1FXSA 1T15A 5GM1A 1AX9A 1EHYA 3L7OA 2A2ZA 4A26A 5I48A 2JFOA 3G9TA 4CF6A 1WDKA 1GILA 3EEBA 2VAXA 1T3LA 2VHJA 4IAOA 3VU8A 3ZWNA 4FM9A 4BLOA 2H3HA 3LQ1A 5DH9A 3FNFA 3UKJA 4UU7A 3NHJA 1DXHA 4IYRA 4Q5IA 3BAFA 4BKQA 4E5YA 1Z3CA 2VNHA 4PTLA 4XUEA 5K0CA 3TQIA 1YQEA 2JKVA 3U81A 3KDSE 1MU0A 1RI3A 4AX4A 3DH0A 1NX9A 4P0PB 4Z7QB 4YMSA 5E6SA 3OLQA 1FFCA 1LB1B 4GSLA 4L3WA 4XGIA 3ZQ4A 5DLDA 4M53A 4DM7A 2ZK7A 5FOSA 3RUCA 4RA6B 5KHAA 4OJMX 5CW1A 1V7ZA 4JXKA 2FOLA 5KDLA 1F9AA 3LY8A 2G3YA 3E9DA 1NXTA 3K9NA 1O95D 4RSHA 4QREA 4LYGA 5FPSA 3CXUA 4ZO9A 2AQIA 4ZREA 4V2IA 3T3OA 1ZCJA 2IH4A 1XMVA 2ZQYA 2DE0X 1Y3DE 3O7WA 2W58A 3D0OA 5CGZA 1NQXA 4I50F 3AKDA 3I39X 4DG5A 5DN6A 1G42A 1UK7A 4IIFA 1GQOA 2OK7A 3GAFA 3LTEA 2DXIA 5BSKA 2V96A 3FDZA 2ERYA 3HFSA 1M72A 1U65A 4QLAA 3OICA 4YP1A 2PQ0A 5JY6A 2WPDD 3HB9A 3JD1A 3KYJB 2VA8A 4KO3S 4ARVA 3VC7A 5H3LA 2HWYA 4KODA 5JNWA 4KVGA 1BD3A 1SIBE 2J48A 4XGQA 4L9WA 4EFKA 5EL0A 4BNTA 3DEHA 3GRYA 2I71A 5I4BA 1T9CA 3RS7A 4O2BF 3NJ4A 3P2EA 1F8GA 1BQ3A 2GKGA 3ANMA 5EP1A 1APBA 3KTFA 1NAIA 3IKJA 3BSSA 1YA4A 1KEPA 1NM5A 3GJZA 3MWKA 1MOPA 1HNXB 1A88A 4KE7A 4DZRA 5KQRA 1YASA 4KG7A 2BD0A 5A4FS 5KTPA 3T9BA 5IK2D 2AVDA 3C70A 3EWSA 1H4TA 1ZUHA 3R77A 2XUAA 4ETWA 2IY9A 2RGCA 3VO2A 4CW7A 4A8TA 1QFSA 4BVEA 2PKWA 5TQJA 3V2HA 3MTBA 2QRGA 5DWVA 2ERXA 1VYHA 2IS6A 4YCLA 3JYOA 1ISSA 3HCFA 3R3ZA 2P0AA 1OXVA 5BSWA 3DTVB 3WYGA 3E9NA 3ZWPA 5A71A 3NU1A 4ZHQA 4V0NA 1BWSA 3KELA 4D8VA 5CYGA 1SUSA 1LS1A 1H2HA 3ULKA 2C5FA 2VPQA 2XRFA 3DKRA 4U5QA 1REQB 5DCUA 1PDWA 2VDVE 1L0BA 1Q7BA 3C8MA 3EQZA 3FGOA 3O9MA 2GTPA 1CHDA 4HS4A 4UNNA 2H7CA 1HKHA 5DZSA 2LGJA 2Q5LA 1KI7A 2DPYA 3H9JA 4NJMB 4EKIA 4AKGA 3DW3X 1POWA 2JH9A 3C3EA 2HDWA 3O03A 3BE8A 4QFDA 5C52B 2HJHA 3TAUA 5F98A 1JG3A 3PQDA 1W2WB 1KRHA 4XIYA 4R6XA 2APJA 1U2TA 2GEKA 3GL9A 4V2UA 2P4UA 1TPYA 4KBYA 5DSTA 3AZQA 3REFA 3MMZA 4IQ8A 2FW7A 3H2YA 1GFIA 4L6IA 1GQ2A 2WNSA 1U0OC 1VE3A 1R27A 2XQKA 4KFUA 2A94A 3JSAA 1UEXC 4N40A 3RSSA 1JZQA 1PZGA 1SKYE 4ROTA 2M1XA 5ALWA 1YVEI 3HADA 2IU0A 2YZ7A 4JXJA 3LSTA 1MJGM 1UJBA 2J9YB 5EPOA 3WNDA 3LUGA 1Q0RA 4WE3A 4DS3A 4MWBA 4DW8A 4X94A 4D9KA 1UBKS 5C4GB 3AL2A 4G81A 2R96A 3KSAC 2JCYA 1CCWA 1UK9A 1D4OA 1Z18A 5LXTF 3WGUA 3GEBA 2QLLA 3E5NA 3I30X 4OHVA 3O21A 4QOSA 2XUZA 4D7AA 4IG9A 1H65A 3MJVA 2VT3A 2IEAA 3B51X 4AMUA 4MSUA 3F2VA 1SCIA 3HWSA 3I6IA 4JLOA 5IFLA 5JARA 1CULC 1THZA 4URWR 3PVSA 2BEVB 2J9ZB 5CDSA 1PFWA 3IUJA 4BTVA 2VHUA 5GOZA 2OBMA 5DMXA 1FLDA 4PHTA 2O2XA 4JYBA 4M99A 4JBLA 5AUNB 1A5SB 3KM0A 1G7TA 1EX6A 1RE0A 1XTQA 2AKAB 5NLLA 5FFFA 5GONF 5IT0A 4JLWA