4RY0A

Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
287
structure length
287
Chain Sequence
b'MADLIAIITPAHDNPFFKAEAVGAEAKAKELGYETLVMTHDDDANKQSEMIDTAIGRGAKAIILDNAGADASVAAVKKAKDAGIPSFLIDREINATGVAVAQIVSNNYQGAQLGAQEFVKLMGEKGNYVELVGKESDTNAGIRSQGYHDVIDDYPEMKSVAKQSANWSQTEAYSKMETILQANPDIKGVISGNDTMAMGAIAALQAAGRKDVIVVGFDGSNDVRDSIKSGGIKATVLQPAYAQAQLAVEQADAYIKNKTTPKEEKQLMDCVLINADNAGKLETFALT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ribose ABC transporter, substrate-binding protein
publication title Crystal Structure of Ribose Transporter Solute Binding Protein from Rhizobium Etly, Target Efi-511357
rcsb
source organism Rhizobium etli cfn 42
molecule tags Transport protein
total genus 121
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2014-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ry0A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ry0A01
5CNMA 4Z0NA 5FBHA 4Z9BA 1IIBA 4RY9A 1EWTA 4F12A 1CEYA 3LUHA 5DLEA 2OENG 1JDNA 3SQNA 4EGSA 1NY5A 3HDVA 4IILA 2KYRA 3QLVA 4YV7A 3SNKA 2L17A 4MRMA 5IEBA 5TQJA 3HEBA 3CZCA 1LBIA 3IPAA 1F4VA 4W5QA 1ISSA 2OQRA 2PUGA 1DG9A 1QP0A 2NT4A 1JH9A 1C0EA 4JASB 2ZAYA 3H1EA 1D5WA 3NHMA 3QEMB 3JVDA 3BREA 1DP4A 1YMUA 2FQYA 4G0MA 3QLUA 3IP5A 3QELA 3HCWA 2DRIA 5DKFA 4EY3A 3KYIB 2PUEA 3B2NA 3HUTA 5I4CA 1EWKA 2IDMA 3KSMA 4CBVA 4HNQA 1QKKA 2NUBA 1NXPA 3FFTA 4HNSA 4LDZA 3VNAA 1ZAYA 2MYTA 2FVYA 4EVSA 3F6CA 3RVOA 4Z4EA 4RK6A 3HSYA 2FQXA 5FBKA 3EQZA 3S99A 1Z26A 5B3JA 3RVQA 1JDPA 3H6GA 1MAVA 1P2FA 3N0RA 5EWMA 3QLTA 3MYYA 4NICA 5TQ2A 1E6LA 3DLBA 5KWSA 5BRJA 4XASA 2NT3A 3OQOA 3GA5A 3JPYA 3O74A 5C5EA 4Z4FA 4KVFA 4G0PA 2MYPA 3I42A 4RKQA 1YK0A 4MR9B 3CRNA 3D02A 3JPWA 2WB4A 2LIVA 4MYRA 4PICA 2A9OA 1ZGGA 3TB6A 1QMPA 3HJFA 1QO0A 1M2EA 4IMJB 2QW1A 3SG0A 3URMA 3EQ2A 4KK3A 2FEWB 2H3HA 2RGYA 3GRCA 4MQFA 1D1PA 4O1HA 2R4QA 4L85A 1SD5A 1TLFA 4MLDA 1E6KA 4W5OA 3HZHA 3CG4A 4WXMA 3IDOA 2IKSA 2QVCA 3A0RB 4LE2A 4LDAA 3LFTA 5IX8A 3OLYA 1P6UA 3H6HA 2A9RA 3ILHA 7ABPA 3LUAA 4IF4A 5JS2A 4FE7A 4ZJPA 4OBBA 2E4WA 3SY8A 2CHEA 1RXIA 4S05A 4XFKA 3O2JA 1MVOA 2NZUG 3O75A 1Z17A 3T38A 4MPTA 3RVNA 3QX8A 5PNTA 5KQPA 3N0XA 3QK7A 2VYCA 2W42A 4MLCA 1ZVVA 1Z2EA 3BRSA 1D2AA 4OATA 5JNVA 2JVKA 3C3MA 3EGCA 1DCKA 4MRMB 4XAQA 5KQMA 3CLKA 1GLGA 1M5TA 2JVJA 4XARA 5KQLA 4MS3A 2IPMA 8ABPA 3DGEC 1NXVA 1Y1LA 3L6UA 3OLWA 1SXHA 1YVUA 4ZYLA 3QELB 3E3MA 1ZHHA 2BGGA 1ZH2A 4O5AA 1J56A 3I5AA 5KI6A 3C3WA 4RS3A 4DN6A 4GPAA 2P9HA 4JOQA 1TMYA 2A9PA 1JYFA 1QQBA 3O1JC 1SRRA 2FLWA 4YWHA 3LUGA 3VNBA 4NQRA 2V0NA 3H5IA 4QYMA 5HSGA 4OLAA 2ID9A 1LJUA 4RK5A 2JVIA 5EWLA 4MS1A 1A2OA 4HYEA 2PL9A 2WJAA 1P6QA 5TQ2B 2HJ9A 4YLEA 2LPMA 2NZVG 4LZLA 3F73A 1T34A 1XWWA 3P9YA 4S04A 3Q41A 4TMYA 3OO0A 1DRJA 4WT7A 1Z15A 3LUJA 3IPCA 4MGEA 1U2PA 3DLHA 3O1HB 2FMKA 3BRQA 4RU1A 4G97A 3H5TA 5TPWA 1I3CA 3F7NA 3LUCA 4RY0A 4EYGA 5TPZD 2JCGA 2QV0A 4N76A 4MQFB 3HO1A 4F11A 1NATA 2CD7A 2CWDA 5CNKA 4E7PA 4RWEA 2QXYA 1QPZA 2PAFA 1Z2DA 2YHAA 3D8UA 3KYJB 3ROTA 2E4VA 3RVSA 3RVPA 4L4UA 1QQAA 1EHCA 4F8JA 2FSPA 1FFGA 3I45A 4JP1A 1QP4A 3CHYA 3OO1A 1ISRA 1DCFA 4Y9TA 2CHFA 3RVJA 4YP9A 2L18A 2FLKA 3F6PA 4RXTA 2WWVD 4KNYA 4KZKA 1R8JA 4EYQA 4KV7A 5GOTA 1QO0D 1APBA 1NTRA 2QVGA 2FMFA 5TPZA 2LUOA 4IRXA 5JNTA 3N75A 4P98A 5CNJA 2R48A 4KFCA 2PLNA 1ZGZA 3OLZA 3KLNA 5DCLA 2WRZA 3A10A 4MR8A 3TD9A 2FKAA 3IP6A 4MS3B 3NNDA 4QYWA 1KGSA 4RDCA 3NBMA 1BDHA 2FEPA 4DADA 3OQMA 2YHBA 1SXIA 1RZRA 1PEAA 4Z4HA 2E4YA 1TVMA 3LUKA 5FWYA 2F8TA 2PL1A 4F06A 4JA2A 4QICA 3EJWA 4JAVC 3BBLA 2VUHB 4PE5B 3H5VA 1JL3A 4KPYA 1RXEA 2FXIA 3M9XA 3C6QA 3KTOA 2MSKA 3HXMA 3O2SB 1GUDA 1A0OA 3Q9SA 2FN9A 4LX8A 2E4ZA 3HV2A 4RK4A 4XLTA 2R47A 5DTEA 2HQBA 5EWLB 4MS1B 2B4AA 2HQOA 1VPWA 4MR7B 4RXUA 5D2CA 3UUGA 4XXHA 4MQEA 1URPA 5BQ3A 2O20A 4ETNA 4YS6A 3OQNA 4NCBA 1U2QA 2XDYA 2A9QA 2FEKA 3N6VA 3OLVA 4RSMA 4EVQA 1H9CA 5HKOA 2VK2A 4RK0A 1JBEA 4ML3A 4KQ9A 5KC9A 2FTKE 1JF8A 3GYBA 1Z25A 3C3KA 3DGFC 1TM2A 1NXSA 4LRQA 4KREA 5TPWB 1FFWA 3KCNA 4MS4A 1E2BA 3QEMA 3K9CA 3N8IA 1OXKB 5BRAA 3KJXA 3RVKA 1DBPA 2X7XA 5ABPA 1ZH4A 1BAPA 3DZDA 1FQWA 4ZMRA 2HSGA 4D6XA 1RPJA 2HPHA 1M2FA 5EWJA 1XHEA 3RH0A 3HVRA 2IPAB 2ZWMA 1DC7A 3OMXA 4Z9AA 2L19A 5GQSA 3T95A 1K68A 2RJOA 3FDFA 3HDGA 4NV3A 4RV5A 3EDCA 5HQJA 2WJWA 5FWXA 5IUKC 4IMIB 1U0SY 1JYEA 5JNRA 3H5WA 3QLVC 3H1GA 4G0QA 4ZMSA 3L49A 3OLXA 4RKRA 3OMWA 4H60A 2GX6A 9ABPA 3MQ4A 1XHFA 2GI4A 2IYNA 1JFSA 3BILA 1MB0A 4RK7A 4Z99A 4E7OA 1DRKA 3QLUC 4MR8B 2JK1A 1CHNA 4Z4IA 5EWMB 4W5NA 1DC8A 2QSJA 1F51E 4IGAA 1RNLA 3TMYA 3K4HA 1S8NA 1LK0A 2QZJA 5FWYB 3JY6A 3H5OA 3FGZA 3KLOA 5F64A 2R25B 3QX9A 1ZESA 1YS6A 3R0JA 2VUIB 2TMYA 1DZ3A 4Z4CA 4YO7A 1A04A 2M98A 4Q6WA 3MA0A 4Z4GA 4LE1A 1BA2A 3N0WA 4ZPJA 5B3JC 5KC8A 3LKVA 2WY2D 2AYXA 5DGCA 1GUBA 1NXWA 4G86A 5JNSA 1DCMA 5BR1A 3H5LA 5CNIA 4DQDA 3MM4A 4N47A 4FE4A 4YGXB 1KRWA 3Q7TA 3CS3A 1JLKA 3RVRA 1RZRD 3JS5A 3OM1A 4NCAA 5JNUA 2H0AA 1AB6A 1P8AA 4WZZA 1LBHA 4OG2A 4W5RA 4JB0A 2FQWA 4Q7EA 4HNRA 1M5UA 4M88A 3A3KA 5IBQA 2PUBA 5T7BA 2QU7A 3O21A 1YS7A 3CNBA 1ZITA 1EWVA 1PHRA 1YMVA 3HS3A 4MS4B 3ROFA 1GCAA 1ZY2A 1NXTA 4RK1A 1CYEA 4YCSA 1PUXA 4TN5A 3EULA 1OXBB 4N0PA 4N03A 2I6FA 2JBAA 4UHJA 5EWJB 3NNNA 2GBPA 3EAFA 4UHKA 6CHYA 2GKGA 4G0XA 3IP9A 4G0YA 3DBIA 4WWHA 1EFAA 3KS9A 5FWXB 2PJUA 3OM0A 3GBVA 3JVIA 4N0QA 4RY8A 1LJLA 4TLMB 1YK1A 1GCGA 2IPLA 3H1FA 3EODA 1QP7A 3Q15C 5ED4A 3H75A 3LMKA 3CFYA 2RDMA 1JFTA 1Z13A 4LE0A 4RZSA 5IULC 1JWLA 1W9HA 3FFWA 3HUUA 5HM6A 2LP4Y 2QR3A 3T8YA 4YR7A 1ABFA 2N9UA 3GBPA 3A0UA 1KRXA 4Q6BA 2MYNA 3LOPA 3GT7A 3CZ5A 2AYZA 3GV0A 4JB2A 5TQ0A 5CHYA 1E6MA 4EUKA 2MSLA 2GWRA 2L2QA 2WMYA 3KHTA 4EYKA 2PUDA 2FN8A 4OLBA 1FSPA 3LUFA 1ZDMA 2J48A 2ID7A 1D4ZA 3N53A 2E4XA 3CTPA 5IUNC 4GNRA 1QNLA 2LBPA 3RVLA 4YRZA 3M9WA 1BDJA 3CG0A 4G0ZA 1VKRA 3W9SA 2E4UA 3E61A 2PKXA 4ETIA 3UK0A 4WUTA 1ZN2A 6ABPA 4PEVA 1JHZA 1MB3A 3SAJA 1L5ZA 1VLZA 2FMIA 4N41A 3M6MD 1WETA 3C97A 1C4WA 1BDIA 3HM9A 1DBWA 4H3KB 3LKBA 3QEKA 5IEJA 4D74A 5KQGA 2PUFA 2Q5CA 2JRLA 1MIHA 3FFXA 3HK2A 1AB5A 2IPNA 3UKJA 3CU5A 4MAAA 4P1ZA 5TE9A 1B00A 3I09A 3O2QB 2PMCA 3TX6A 2PUAA 1USKA 1W25A 2FW0A 1K66A 1D1QA 1FFSA 4TLLB 2MYUA 1Z18A 1Z12A 4PYRA 1NXOA 1ABEA 4KQCA 4QPJC 1U04A 1EAYA 4B09A 3G85A 4WXEA 4KRFA 2B1JA 1BVHA 1VRVA 2PE5A 3LTEA 1SXGA 3MF4A 4O1IA 1PNTA 3Q7SA 4ETMA 5IUJC 1TJYA 4KMRA 3FMVA 4W5TA 5T3YA 2JBAB 3RVMA 4MR9A 4EVRA 3MMNA 3NNSA 2MSWA 2RJNA 1USGA 3GWGA 4PZ0A 4F3TA 3IP7A 2P4UA 2PUCA 4RXMA 1U8TA 3NHZA 4FB4A 1JX6A 4KK4A 5JNWA 1PNRA 4D6YA 3MIZA 3CKMA 2FMHA 1YIOA 1HEYA 1UDRA 3KG2A 5E3JA 4EYOA 2IOYA 2M1ZA 3KKEA 3RQIA 1DBQA 1KMIY 3G1WA 4G0OA 2JB9A 4H3HB 4MR7A 1DJMA 1USIA 4OTZA 1Z16A 3GL9A 3SM9A 2F8SA 5JS1A 2HQRA 1YTUA 3JTEA 1JFVA 3TO5A 4MQEB 5C5CA 3LUDA 5IC5A 3ILYA 3O1IC 1L5YA 3Q7RA 5TQ0B 1NXXA 1PEYA 3T6KA
chains in the Genus database with same CATH superfamily
3UA3A 3A4LA 4M83A 3IA2A 2ACEA 2FMUA 1Q6YA 3L8CA 3MWLA 1O5TA 5U4QA 3BMQA 4S1PA 1G5RA 4YV7A 2DVMA 2E5FA 4MRMA 3SNKA 5A7GA 3UCFA 4O2LA 1Z63A 1XFAA 3EGDA 3L92A 1F4VA 4EJ0A 4QM7A 4JASB 4PSCA 2VJNA 1C2YA 1DP4A 1WM1A 4L7QA 1KSGA 2WWFA 4R54A 1ZD9A 5CT4A 1P29A 5K6RA 1XVUA 1ZA2A 1EGAA 4PFQA 2LV8A 2IDKA 3WRYC 2WTXA 1UR5A 3NHRA 5DFAA 2XITA 2Z5VA 2Q5EA 4HXEB 1II8B 3AFOA 1BJKA 1Y5MA 4WZAE 5K6AC 2QRQA 3H83A 4HL6A 1H23A 1MRNA 4FDUA 4HNQA 1XL1A 4J7CA 4OF4A 2D6FA 3Q6NA 2QXTA 5LA6B 3M6FA 1PFGA 5I7RA 3B8HA 3CKYA 2FQXA 3D0RA 3HSYA 3R5XA 4XVHA 2JHPA 3NOVA 4PNHA 4AJ1A 3MZ0A 1DWOA 4DFDA 2BTEA 5HGJA 4P80A 4JJ7A 3WMWA 1KSHA 4O4JB 2Z2YA 5AW2A 2J5QA 3DV9A 4KIGA 2IUTA 1JNXX 3OY2A 4M1EA 5DLYA 4B83A 5FTKA 5KTSA 5CIYA 2G80A 3GP8A 3D2BA 5DWQA 2B25A 2Z83A 1KOFA 4YMWA 5KMGB 5KVCA 1ECJA 1V8OA 1QGAA 1RRVA 1UPFA 2DWQA 3OIFA 1SBTA 2OG1A 3B6EA 4OD0A 2DECA 4QYIB 4K9SA 3V9AA 4B45A 4KL8S 2HLHA 4KVAA 5E8JA 3W8NA 1L5VA 2ZJAA 2D8MA 4C3ZA 1UKBA 2RSLA 1Z34A 3DO8A 2FPGB 5FPPA 4JQOA 1KORA 1AD2A 4QXRA 2P3LA 421PA 4YP6A 3PLRA 4TWZA 1BC5A 3C6MA 3ZQJA 1QTRA 3W3AH 2E0IA 1E6KA 5CM8B 5LXTF 5CX1A 1JHRA 1SOWA 1WG8A 2CF6A 1GPBA 4I55F 3S1AA 5TXGA 1QS0A 2WK1A 1TEZA 3KV3O 2ZROA 1P6UA 4NBWA 1C9MA 1NVMB 3WK4A 5EJ4A 1EE2A 3GJ4A 2YWXA 3LQKA 1FFAA 1YZ3A 1Z3CA 2WT8A 3OIUA 4GQBA 4LVCA 1RXIA 1ZWKA 4C88A 2HRRA 2G4LA 3BEDA 3KD3A 3M3PA 1YVPA 1TAHA 4PV7A 4K26A 2OFWA 2E48A 3N0XA 4U2EA 2DWCA 1RAGA 3X2EA 4PYQA 5IFKA 2WUGA 5BN1A 2ATXA 4GOXA 4N5IX 2PA3A 5LQMA 5KKCA 3BE6A 1MW8X 3GEGA 2F59A 1RMYA 2X1HA 1MAUA 3I5YA 1SXJC 3EDRA 4ABYA 3OSZA 4KBYA 3AFNA 3QKWA 4XOIA 2JC3A 3ME5A 1DL5A 1ZN7A 2JVJA 1J07A 3N2KB 2Y27A 1DJQA 3L06A 1PG0A 1W85B 4HBGA 4LOAA 8ABPA 3PHCA 3T0FA 1EESA 4IUCS 2M32A 4I2VA 1WY5A 1IUPA 2IHTA 1K1EA 2JCBA 2OZKA 3FGPA 2CMHA 4KAJA 4L0CA 2W93A 4B6EA 2BJWA 2ERCA 4ZYLA 3TSYA 3VAYA 1E61A 2J31A 3IURA 2GERA 1DC5A 1J56A 2QP3A 3SHVA 2SBTA 4HNHA 3IULA 1SBCA 2XVXA 2MCFA 4CCYB 2EOAA 2WPDD 3X1JA 3EWSA 1T35A 1IOZA 5JC8A 3S7ZA 4P93A 2GAFA 4M0EA 1KI2A 5EHIA 1TPZA 3HXLA 1MQ9A 1BWRA 1ZGHA 4RFSB 4NQRA 4KI0A 1JT9A 3IAM1 4V0QA 2Q3DA 2YWEA 3NTRA 5JAZA 1LJUA 2XUDA 4GOMD 1BYUA 1XZDA 4OX9Y 1QGUB 2A5JA 2QJOA 4J75A 5E1MA 4CVNA 4TMFA 4FB5A 5KAMA 2NO0A 4TM8A 3HRIA 5EMLA 5BSVA 5JNLA 4RELA 3MCZA 2A1UB 1Z8DA 2P8JA 3AV0B 4RHTA 4HT3B 4EHNA 1GPH1 3TAHA 1BW9B 1VJDA 3F4LA 2AKYA 2J1LA 4KBFA 3OO0A 4NU8X 1JPJA 2IGBA 4NV1A 4OB6A 1MXFA 1KZGB 5BWOA 2XDQA 4I1UA 1AH2A 4YIKA 1WS6A 4MMXB 1W49A 3GJTA 5FPKA 2RHDA 3F7NA 1XMPA 3L05A 2DTXA 3PQ5A 4NNJA 1PBTA 3DTVD 3K0AB 4C6HA 2BHLA 2EBFX 4ALJA 1NBIA 1B2RA 4KOAA 5J23A 5CNKA 1ZIOA 5BVGA 1YR9A 4M6WB 3FPAA 4RWEA 4J16C 1PR5A 1ONNA 1FYXA 3R40A 3S81A 3OHMA 1ZZGA 2YFHA 2OK8A 3FF1A 2PH7A 5L4SA 4E31A 2CK3A 2E4VA 1U7DA 1QQAA 1KFKB 4HWTA 2J3LA 4URUR 3WLTA 3USZA 3W9UA 3PFIA 1KARA 2GNOA 2UAGA 2XIQA 2ZP1A 3IVXA 2VTBB 1U81A 3AHGA 3MOSA 1CF9A 1PP4A 4M9ZA 2FWRA 2DKFA 5LVAA 1JLLB 1GN9A 4PLVA 1JQEA 1X39A 3G9XA 4PZLA 5ARDA 1Q0TA 3CMMA 3W6OA 1XT6A 4MEAA 1GTRA 2EWMA 4U1RA 4HYTA 3FNIA 3QOXA 4R4JA 2ECQA 4PPFA 2AKAB 1T5LA 3QFTA 3U0VA 2A5YB 2B98A 2ZB4A 5K4AA 3DBLB 3KQNA 1G9XA 2IK8A 3CQ9A 1L3IA 1QQ7A 4Y6QA 3ZBTA 3UB4A 4DCUA 1XRPA 4X45A 3VJRA 2JGEA 2C4KA 4M54A 5I51A 3OQMA 1QR2A 2RHLA 4A0GA 3L6BA 1V96A 1N5JA 3CT4A 4OJMX 3BMNB 5DGXA 3UAOA 4LJ6A 2OUKA 2WJJA 4JA2A 4QICA 5B1DA 4DCOA 4GGPA 4BKQA 3IDSA 3L4JA 3MQ2A 1W4RA 3GB9A 2C88A 3C6QA 4MV9A 4DIOA 5BV1A 3CV3A 3GT4A 3K5IA 1B41A 2JF0A 2JI9A 4ASUA 3EPPA 4QIHA 3PZRA 1VKHA 4R40A 4RLSA 1VCMA 3G2OA 3Q9SA 3D5EA 4XLTA 1T2VA 2CYCA 1HT3A 2ZBUA 4J2OA 4M60A 2XQIA 4OXNA 2HQOA 3E22B 4P54A 1A82A 5D2CA 2D5BA 3JQ9C 3G0HA 5BV8A 4J43A 3CY6A 4Z7NB 3IL2A 4AF7A 3ADDA 1QF6A 2FFRA 1PE0A 2B83A 5JROA 3KFLA 1GRVA 2IHJA 4ZQEA 4LY9A 5LQSA 3LDUA 2F8LA 2Q7DA 1JKJB 3ANSA 2CDRA 5LBTA 5TPWB 1GA1A 3NM4A 3BMQB 3I30X 2G9ZA 3TYXA 4U2DA 2Q5QA 2OOSA 2PFGA 3EGDB 4IQGA 2EX4A 4V0LA 3N8IA 2QRGA 3EZXA 5BRAA 4NLLA 3IIEA 1AUQA 2OFFA 3FTQA 4FMDB 3SHTA 3IPYA 4DXAA 2I9PA 2ZSKA 3MTDA 3KXPA 2R8XA 4B6QA 4MV4A 1F17A 2IPAB 3HKBA 4CI9A 5KTYA 3AGPA 4OQMA 3IQFA 1YBMA 5KTTA 3Q8LA 3SJAA 1YC2A 2NO4A 2QPLA 4QWMA 5AJTA 2Z3ZA 4GBMA 5D6NA 4J3NA 2Q0XA 4TXJA 2O4CA 2WFZA 3IKLA 4DSTA 3S3TA 2H2WA 4MRPA 1L7NA 3RU7A 2VKTA 3TO5A 3BK1A 4X92A 4A0QA 1XPUA 3R9WA 4D57A 2GX6A 2M6RA 3TG8A 1NZDA 2HMAA 4K3UA 5AHOA 3PGJA 3GJSA 3SQXA 3IVCA 3PENA 3BILA 4EKDA 1DRKA 4U9HS 4ZVVA 4HSEA 1ONBA 2WNSA 3H2YA 3KOYA 4HZUB 1Z47A 1REQB 2GNAA 3TIXB 4AW9A 1JQKA 5FP0A 4JC0A 3EVGA 1PEDA 3KT8A 1O6ZA 2EFDB 2R5NA 3TMYA 1GQYA 3GZ4A 3QP9A 1RQPA 4PYLA 4XWAA 3ZCTA 1AZLA 3N1UA 2KW5A 1Y3AA 1AO3A 2GO7A 4GWKA 4DVGA 3CEMA 3O47A 2P1ZA 3MWYW 1UC4B 2J7KA 2B4TO 4JJIA 5FD8A 3CNNA 3SP1A 1N0UA 4QJBA 4KPEC 2DJIA 4DMFA 1K3UB 4MH0R 1F6BA 4Z4GA 1TO1E 3I2GA 3K1ZA 1BA2A 4RD3A 2J08A 2ATIA 3TZEA 4A7PA 4HGYA 4C07A 1UL1X 5KC8A 5TVGA 5L9AA 3G2KA 4BB6A 2IHUA 2YV3A 4ZT5A 4DV3B 1RRFA 3H5LA 5CX1B 4YN3A 2ONZA 4Y2RA 3ZKWA 4ZO6A 4FE4A 1N25A 2BV3A 4YRKA 2ZUCA 4RPKA 1LRKA 1OWOA 2PXXA 4JT4A 3CS3A 2X0RA 1WV1A 5HOEA 1NT4A 4RTJA 3P0FA 5AHRA 621PA 3MRXA 4ZHQF 4EM6A 3GRVA 4P4GA 1P8AA 4KTTE 6REQA 3RYHB 1RWBA 2I1WA 2EAUA 1B15A 3AJ9A 3TPFA 3ZWYA 5JSFA 3TKYA 1ZLXA 3F46A 3MBIA 1JEEA 4OHOA 1E2FA 2GEFA 1M6NA 3MTEA 2WICA 2ADMA 3CX4A 3KETA 3MPUA 1THGA 3EH1A 3R7AA 3B5IA 1C3EA 2HT6A 1YR8A 1Z0UA 3P9PA 1CIPA 1NW8A 4HNUA 2AOVA 2F43B 5GWXA 4G81A 3ZE9A 3U62A 3EULA 8ADHA 1HQKA 3CUTA 3CWZA 5HXAA 1WF6A 4UHJA 3ZIDA 5JMWA 1CZNA 1W30A 2QRLA 1XU9A 3LG2A 4J9UE 1ORTA 5CCBA 1YGYA 4DARA 1JGTA 2JGJA 1DXHA 3ELWA 3IP9A 4NBRA 4QQKA 2IVFA 1G66A 2D5CA 2FN4A 2IE0A 2ORWA 3ETJA 4A36A 4PZCA 2CXNA 4QATA 4HTAA 1IONA 3ZDCA 2PFKA 3H1FA 2CDAA 2CL5A 2OXRA 4GICA 4BY9E 4NF2A 1JFTA 3AHCA 2N1MA 2ZTUA 3D3WB 4FHEA 2OHOA 4B0OA 4RZSA 4E2FA 2H1RA 1JWLA 4UPVA 1FFCA 4RENA 3T61A 5C8DA 4JLJA 2VSNA 3RU3A 5JSKA 1ABFA 1ISMA 1PJCA 4B33A 2ZYTX 1PFKA 4ZRDA 1Z7BA 4ND4A 1ZICA 2G1JA 2GTPA 2QG6A 2NVBA 2X8JB 2YHSA 4R3UC 3WWOA 3EUFA 1DZIA 1RWWA 1PD1A 1U2TA 3F2VA 3I04M 4FJ2A 4LHYA 4RYDA 3T3EA 3EGOA 3RJ5A 4MPDA 1AC5A 4X66B 4N0EA 5BWBA 2F67A 2PY6A 4X91A 3LUBA 5IZCA 3PS9A 4BIIA 3OY7A 3CLRC 5CDGA 1SEVA 2E4XA 3UK7A 1R6UA 4K9QA 5IUNC 1KYWA 1SC3A 1L8OA 2XYGA 5DEIA 3T9DA 4B5LA 4RKEA 3RRNA 3AX6A 3KEOA 5F12A 4ZOAA 2BM0A 4OFBA 1GDHA 3OWOA 5BVGB 3GQVA 4Q1DA 1EFRD 2FMIA 3GP3A 1R8YA 2GQ0A 1TUGA 2A57A 4F5WA 3QE9Y 2QM7A 1KFCB 5IEJA 1JJAA 1USVA 1IB6A 3WNCA 1KYXA 4IG9A 1M0WA 1EE9A 2I1VB 4Y30A 5EPEA 1W36D 2ES4A 5TE9A 4E70A 4LXHA 3ICCA 1FRFS 3IUEA 3MCWA 3TQFA 5CA0F 2HHHB 4ITUA 1BMTA 1HL7A 4FINA 2Z56A 1D1QA 2O8NA 5F78A 4TKMA 2VWPA 3ZE7A 1MAAA 1JAHA 2WSSD 2Z2KA 1KO8A 3N7UA 1YS1X 4K6KA 3KXDA 2I54A 2YVUA 1U04A 1A5ZA 3GVCA 4QPJC 3SIWA 4H08A 4E15A 1NLZA 3OE5A 2PE5A 3RS0A 1B8PA 1BVHA 2BBOA 3KV1A 4XD7A 5CB4F 2CCKA 4M2LA 2I8CA 2FR8A 1X1CA 4D97A 2PSSA 3FMVA 2JFXA 4UARA 2QUBA 4C20A 2P9YA 1HYHA 3I8OA 1UDCA 2LIPA 3V1YA 4B5KA 3GRZA 2ZU6A 1BYIA 2Z95A 3BYZA 2EGUA 4L4YA 2CJWA 2YL2A 1A9ZA 4WFQA 5ALUA 1RPTA 3QXJA 3UKDA 2C8JA 2NZJA 5B3KA 1CFZA 2M9MA 3ITNA 3OCVA 2QRHA 4GM4A 3C5CA 2QN8A 3KR1A 3BL8A 821PA 5J4LA 1YA6A 4XVQA 4RJJA 3OPYA 5A4FS 3ZZUA 1O94A 1P3DA 4QFDA 2R2GA 1YJ8A 1KMIY 3RWMB 3BB3A 5AOCA 5I7HA 2UU9B 4PZEA 4JR2A 3PVCA 4MVJF 3P9RA 1L3CA 2NZYA 4C0JA 4DR6B 3TM4A 3NHJA 4IIDA 5M5BA 4FEGA 3L0ZA 2HQRA 4J0EA 3VTFA 5L6MB 1I33A 3NAQA 5E9JA 5B2EA 2XMBA 5IKMA 2AR7A 3MLEA 4KXUA 2ZI6A 1U7OA 3ILYA 1GWNA 3BCRA 2XUIA 5C52B 5JALA 1DOHA 1V7ZA 5JH7A 1E0JA 4UEKA 4UBMA 3A9TA 1CEYA 1PR3A 1YCHA 3RC9A 1FYDA 2QLLA 3KQMA 3ROQA 1Q83A 1FPQA 2J8ZA 3IOEA 5AIBA 3W90A 4ENVA 3U39A 1NRWA 1KO4A 3DOCA 2PWYA 3N8GA 4KX5A 2DFNA 4JITA 1Q95A 4JY7A 1X86B 2R1ZA 2H2DA 4IVRA 4KFRA 4AJ2A 4F4JA 1NKVA 3IDQA 3LLSA 3MJVA 4GI2A 3ZW7A 1ESDA 1BEUB 1E7WA 1UMKA 3H1EA 1CVLA 3W1WA 3P9XA 4BASA 4EHKA 3JSXA 3L1KA 1X74A 4U7TB 5AI0A 3T41A 1H2HA 4CQLA 2O5RA 3Q3IA 4TYPA 4MV0A 1X7WB 1PQUA 1IATA 2JFUA 4ZT2A 1T0UA 2V59A 2Y0PA 2JASA 3DR3A 3KAJA 3M81A 4C3UA 1Q14A 2C9ZA 5FL7A 3HKBB 2F9MA 2ODBA 3I6BA 1PQ4A 1YKSA 4KDCA 3OD1A 5HX7A 3TSCA 4OMCA 2ZRJA 1NP6A 2NUBA 4J0GA 1I7PA 2DY0A 3DWIA 4WA8A 1RWVA 2PRSA 1V1MB 1E6WA 4J2TA 1PL7A 1QCCA 3OJEA 2IEZA 1QB7A 3EQ7A 3OM9A 1NFRA 1VGQA 4BEBA 3EQZA 3T99A 3ZHZA 5BNWA 4C6SA 2HA3A 3UG7A 2BYTA 2HLDA 3QWBA 1N2BA 3EK2A 3O9ZA 4RO0A 1MAVA 4XB1A 1NE7A 3ZXYA 2BLLA 4NICA 4CU2A 1QFXA 2B61A 5TQ2A 2JHGA 1AGNA 1TIPA 4BNLA 4I5IA 2WLTA 3DLBA 3JQFC 1EHYA 3RUIA 3OQOA 1WEKA 4L8GA 4F96A 4X7BA 4UATA 3C2QA 2YVLA 3AFMA 3KWLA 1AK2A 4B40A 1XJ5A 2JG3A 2BT4A 1MABB 1XEXA 3HY3A 2R6GA 3HMKA 3KEQA 1SUFA 4AKSA 2B7LA 1R2QA 1QO0A 3EZ2A 3QA9A 1K92A 3MTJA 1BNCA 4M1ZA 2H1VA 2P9QA 1ELOA 4BJ5A 3AEYA 1ZD3A 3F3SA 3LVRE 2B4KA 2RI1A 3WRXC 2OMKA 4L85A 4F8EA 3C98A 2WZQA 2I2BA 3DG9A 1KK0A 4ZOBA 4Q4AA 2PSEA 1TJ4A 5H70A 4OBEA 1ATZA 3K1AA 4DS3A 3OLYA 3FBGA 5BUQA 3S2IA 3SSMA 2QTZA 1PT6A 2Y8EA 2A9RA 3SX2A 3ZKWB 4FQ8A 1V7QA 3L0DA 4IF4A 4CG2A 1ISFA 5CIQA 4C2UA 4N9WA 4HGQA 3WFJA 3WQBA 1XTQA 1BHJA 3F96A 3HJAA 4GMDA 5BV0A 3VYUB 4QOHA 1VSTA 2O8CA 1VHTA 5M3BA 1Y4UA 1TCCA 1C50A 4AJOA 3ZW9A 5KIAA 2QTVA 2OSBA 3VR5D 3F5MA 1JU9A 2LWIA 5CDFE 4QX6A 4HUQB 2C2MA 2CKMA 3T3OA 3DHEA 2FI1A 3LPDA 2Q8QA 3INRA 3QI2A 1L7VC 3RE1A 4CUJA 3EIWA 1W44A 4TSFD 2BFAA 4N8SA 1HORA 2PLFA 2KI5A 3DP7A 4E1VA 4BOYA 2WVJA 3KZNA 2J3JA 2PDAA 3KQYA 4JJGA 2Q4TA 3V1NA 1NC3A 1CU1A 1JR3E 1MIOA 2W71A 3I0NA 4XJSA 5KJ1A 2DBQA 5D1HA 2X2EA 1CUAA 4H35A 1ZH2A 4E21A 1XVTA 5JAMA 4GPAA 5AXAA 2PBLA 2QD5A 3PHIA 1RMTA 3LVFO 4W9NC 2WD7B 2XLCA 4DG8A 3EQ9A 5AI4A 3IV9A 2A5FA 2KWIA 1WXQA 1U0HC 2Y1LA 1Z4JA 2RD2A 2A9JA 3OSUA 1BE6A 1GNRA 4BO4A 1P4GA 1V7CA 2VDMB 2P4QA 3BXFA 3FKJA 4EO4A 1KRXA 4PRZA 5JXIA 3P8ZA 1FU4A 5KVVA 1Y63A 4BZZA 4EB3A 5CLFA 2I6XA 5DBEX 5K2OA 2E2WA 1FNMA 3QYJA 4I9FA 3TIGA 5K7SA 1NU8A 2NTJA 4XFJA 2AE1A 1AX9A 2I4MA 1P1HA 1OPRA 5C1DA 5ALNA 3BM5A 5JDIC 1DRJA 2LGJA 4U00A 4WT7A 4DGQA 3H9UA 1EWRA 3IPCA 1LS6A 2HSDA 4YJDA 1QIKA 3BRQA 5C81A 3HI6A 2Q9AA 2RH4A 2GA8A 5HIIA 4CLDA 4YRNA 1YZGA 1QGOA 3GA7A 3NWPA 1EINA 2PJDA 4ND8A 1IBRA 4OUDA 2QV0A 5EMHA 5TPZD 3ZXSA 4P3XA 5JYCA 5HDBB 4ZQFA 3B1ZA 4RCVA 3GLGE 3C6XA 3CBQA 1EIZA 3NUQA 4QEKA 3PUIA 4XQ9A 1QPZA 3ICEA 1I6MA 2A3RA 2I2DA 2R86A 1U9ZA 4G56A 4IYRA 4L8LA 4LHVA 4N3BA 4MPPA 2WU1A 3KYCA 1WUYA 5ITSA 4JP1A 5EIBD 1AO0A 3CF4A 3RVJA 1CR4A 2FW7A 2V6IA 3G9UA 4NULA 4FVTA 4H18A 4DB2A 1R7RA 2DC1A 2BEJA 3W7VA 4ARZA 4TVSA 4MINA 1EK1A 1Y6JA 2B8JA 4A23A 3WO1A 3W5IA 2FZ5A 1W76A 3PUXA 1PQPA 1U0TA 2CLLB 2FWPA 4KR9A 2FW8A 4OHXA 4TWRA 4FYIA 4BNKA 2H1FA 2QGNA 3L7BA 3OLZA 4AZVA 2FR1A 2WRZA 2PK3A 2ASEA 1NVVQ 2C3PA 1Z2CA 3DAHA 3VR6D 2QQ5A 4TQ9A 4V2UA 4A9AA 5C8VA 5A62A 2WUEA 3IDFA 3IT1A 4XQGA 2YHBA 4RAQA 3I53A 2E4YA 3LFUA 4K9DA 2JKYA 3GMIA 3TVDA 4TL9A 1SVLA 2FHPA 4LXUA 4HRXA 2A67A 3FPBA 1MXHA 1V0JA 2CJWB 2KBFA 4L78A 2Y68A 5D00A 1RXEA 3UK2A 4AWAA 1JSXA 1UKCA 2ZTSA 1WUJS 4OM8A 1NQXA 1NULA 4PYOA 2AX4A 2H17A 2PX4A 2V8BA 1NJGA 3JQBC 3OEHA 4ILKA 2AD5A 5AVUA 4DMKA 2IITA 3HUFA 3G2PA 2Y4NA 3GLHB 2ZQ5A 3B3JA 3KZKA 3PIDA 4G0VA 1Q7EA 1LWOA 4MWTA 1MO2A 1ULSA 3P27A 4C87A 2WB2A 4NVRA 1SKBA 1PW5A 4PR3A 4KOEC 3D54D 3LBYA 4AY5A 2E37A 4ETWA 1QANA 3BWMA 4FN4A 3A6EA 1CS0A 3ZNQA 3NFYA 4NCBA 1G5HA 1E3QA 2IQIA 3CUEF 2B94A 3JAWB 5EMNA 5DW3A 2NYVA 1QOZA 2GN4A 4YQFA 1IQ0A 3AR5A 5JH7B 1Q91A 3C3KA 2O0KA 4BMZA 1K7SN 3ZJYA 5DYWA 3BZBA 3G59A 4CEIA 2QX8A 2PT7A 2EW8A 1UIRA 2JFQA 1BOFA 2X23A 3NS7A 1QBGA 4QPPA 1RLIA 4S24A 3UJ8A 3V48A 3V1LA 3WB0A 4BQFA 1J09A 3D6AA 3F6SA 2YN0A 3NU1A 4KAAA 4KVGA 4DCCA 1YACA 1QVAA 4PONA 3IOBA 5I45A 1CB7A 1GL9B 1C3LA 4UASA 3WNZA 4LY3A 3L4KA 1TW3A 4MDFA 4HGZA 2EQBA 4BNYA 1VJRA 4POAA 2HSGA 4ZMRA 3HKEB 3BTVA 4PZAA 2N3ZA 3DO5A 1ZCZA 5ILQA 1YZTA 4CKBA 2IZ5A 5IF9A 2AN5A 4MVCA 1IPHA 1DEOA 4MRAA 3WLIA 3PFKA 2HW8A 2AG6A 2CW5A 1WB9A 2XMDA 1Y5NA 5BSRA 1B3BA 2Q49A 2BMJA 3E9MA 4OHBA 1EXDA 4NYJQ 1G7SA 1V3QE 4EGAA 4FSHA 3HCPA 5IFLA 2ZRNA 3JD4A 4MW6A 2ID8A 4PRKA 3OLXA 3UK1A 5B12A 1UJ4A 1W2HA 4MZXA 2VXYA 2W2LD 3IEVA 3WZ2A 2H54A 4FYJA 4Z99A 3ZI4A 3ENQA 5CA1F 1EK2A 4HDSA 3KDAA 4IIEA 3GFQA 3ZHBA 1WWKA 1HT1E 1Q0ZA 4YJ3F 3QE3A 1TKCA 3IAXA 1G7TA 3Q5DA 4CNQA 5HGXA 3WY9A 3IXMA 1E18A 2H2GA 4FCCA 1A27A 3Q6MA 3VKUA 1B8OA 4HN2A 3WOHA 4DUPA 2V6MA 2HRCA 5GONA 1SQSA 2IOHA 2BD0A 3HVJA 3TRDA 1H3FA 1QGZA 2A0YA 4XWOA 1XEXB 2VUIB 3AUJB 3VO1A 5T4BA 2D74A 4TMZA 3VZBA 4YPOA 3SVLA 1VQ1A 2DBYA 4LE1A 3G9ZA 3WHLA 4GPZA 4M86A 3NG1A 3G7SA 2VTEA 1C3JA 3MERA 4TQAA 4X84A 1NOIA 1RJWA 3GLRA 2P77A 4X8HA 4Q4AB 2GJSA 2IYTA 2C5SA 2DBVO 3K1AB 4E5YA 3TL3A 2PXAA 3IP8A 4G1FA 3DT6A 5BRNA 2IEDA 2I4TA 2SICE 3LCCA 4K6HA 3W8DA 3R6DA 1OILA 1NKSA 2OCXA 1J39A 4LZZA 3GIWA 3LLCA 4TRMA 5KCMA 4XUEA 1MUUA 4AIIA 4QQRA 4U2GA 4YV0A 1C4KA 1ZD4A 2ZYHA 3MMPA 4F38A 2O8CB 1EX6A 3H11B 5D3MB 1N9GB 4D82A 2OK7A 3FWKA 1ZPDA 2QTVB 3LHDA 5T6BA 3FPCA 1KR2A 3AZQA 2N42A 4B9EA 1O03A 2HU5A 4D42A 2HK6A 1GZUA 1EWVA 4L51A 1O77A 1VCNA 1FFXB 3RWOA 4ZYXA 4GG1A 3DE7X 1E1DA 3ITEA 3MXOA 2CLMB 4TVKA 2C2XA 5C7YA 2C04A 2GPSA 1AGPA 3QSGA 4GD3Q 2HEIA 4CL3A 5LZ2A 5DHQA 4FFDA 2FP4A 7YASA 5BSGA 1MIOB 3IJPA 1Q16A 3HLKA 4QHSA 1WZIA 5IJ9A 1FIUA 1Z8FA 2AL7A 3FNFA 3GROA 2H8KA 1IEVA 3GBVA 1C4OA 1WABA 3RYCA 3UWOA 3IC5A 1Z5PA 3UTCA 1TT7A 1D6NA 2FWBA 3HB0A 5DN6D 1RLUA 1LJ8A 1V4VA 3OZBA 2NSHA 4GYYA 4HWSA 1QUEA 3BE5A 3TQQA 3O92A 4L75A 3HUUA 1Z8NA 3NC0C 4LG1A 4DSAA 4ZMBA 5HM6A 4J3FA 5DLQC 1JPUA 2M6KA 2XRYA 2ALJA 2XH8A 4EG1A 2J4FA 1RLMA 1THTA 1GR0A 3CVOA 4DRXB 2FOIA 3G9QA 1MJGA 2B35A 1HE1C 3RHFA 2ZIZA 3F5DA 2ZYUX 3U19A 2GN1A 5CHYA 4O08A 2OXIA 4QFCA 1T1EA 4BQPA 2P0YA 4FK8A 4ARVA 4CKCA 3PUJA 4URHA 1Z5VA 1WX1A 4ZDIA 5TGTA 3G89A 3WLNA 4BX8A 3VYTB 3GN1A 2HHAA 4XQCA 3TTTA 5FEUA 1LBTA 3PRHA 2O5CA 1GRNA 1VHLA 3K35A 4R05A 3O0TA 4ZOLB 3HWWA 4IOKA 3ZY3A 1V25A 4YJGB 3HBNA 3ONNA 4GMGA 3TLMA 3F6RA 1T2DA 2P9GA 2OUIA 1U8ZA 3PX3A 4TT8A 2ZR9A 3C97A 2Q9CA 4KR2A 3CF0A 4ZI2A 1IY8A 1HG0A 3U7EB 3WSVA 2XNDA 5JS6A 2F1OA 1MIHA 3BMXA 1FNDA 1LX6A 3FFXA 4Q05A 4HCJA 1I2DA 4F60A 1AZSC 3ZDAA 5FXMA 1YRHA 1QHYA 1EXWA 3JZFA 5FNVA 1A9XA 2VDVE 3WYNA 4AI6A 2ZIUB 3ANMA 3TX6A 1OZ0A 2F3UA 2GWHA 2FZVA 4IFEA 5DHTA 1VMDA 4M7OA 3VDXA 3ICPA 3B1WA 5EMMA 4DB4A 1CP3A 2H4XA 3B78A 1WSAA 3MILA 1AQYA 1EAYA 4F5YA 5FTJA 3W79A 3EXEB 3SMQA 4KRFA 3FLEA 2YXNA 3AC0A 1N7GA 2B0CA 3LTEA 4PHFA 4TTJA 4WCDA 5ALKA 1CZUA 2EEPA 1UM9B 3SPXA 3IH5A 1BMFD 1PW7A 1ZIDA 3FSGD 4AZSA 4BV8A 4W5TA 4NZNA 3P4UA 5YASA 1LK7A 2CMGA 5T3YA 4I19A 2VHEA 1JEAA 2BELA 3EWIA 1X8KA 3MMNA 5DT9A 1CCWA 1AKNA 3SR3A 5JZSA 2HHCA 5A4JA 1JG7A 3O7WA 3FHOA 5CBPA 1N1DA 1ZOPA 3H2KA 5TJ9A 4ZCMA 3NHZA 2DH6A 2G0TA 2OCBA 5MN4A 1E79D 3AWDA 1M1UA 1E77A 5M04A 3CJQA 4EQ6A 5DDIP 1L5RA 4GPTA 5TMEA 3VYRB 3SSOA 4QXQA 2AN4A 4DT1B 2J07A 5KVAA 1EUQA 1MG5A 2VPQA 4MLPA 2R6DA 1G8FA 1PZFA 4ZQHA 3S8MA 3DMNA 2ZULA 4HLNA 4XPIA 1Q3TA 3GLTA 3IB6A 1EQUA 2ZUBA 2Q5JA 2B2NA 3NO4A 4WLNA 4TWBA 1O54A 5I8PA 3AF5A 3OJFA 2CXQA 1CS0B 3LY9A 3W4KA 1WR8A 5KINB 1L5YA 1A1SA 1CETA 5A3SA 1GUZA 5H9VA 2B1QA 1T1GA 3GH1A 3MRTA 2REQA 4WNAB 4AJLA 4YQEA 1ZR2A 4F12A 2XCQA 4AECA 2QA5A 4QM6A 5BVHA 2H6EA 3RQSA 4B84A 1B7GO 1RQ7A 3HLYA 1XD9A 1N2XA 1Z36A 3LT0A 3C24A 4Y9RA 2BJVA 3HEBA 4QHYA 3OPNA 1KFBB 4IIUA 4F5EA 1HRKA 1XTTA 1PYGA 1WO8A 3VU9B 4QZVA 3HDJA 4NR0A 1PGPA 1V1JA 5IH7A 4V1CB 1OASA 1FTSA 3HYCA 3FM9A 3B7WA 3D64A 2CNDA 5FORA 4BV9A 3THYA 3AVYA 3WGHA 2WF7A 1Z08A 4GR5A 1Q19A 3NP7A 4XYMA 5EJIA 1AA6A 2IH4A 3CO0S 2PUEA 2C2BA 4Q7MB 3L7YA 3VYWA 1M3SA 13PKA 1MOZA 4IDCA 2PLRA 4I3HA 3W8EA 4D9CA 1HR0B 5JCJA 4CKBB 5CT5A 1ZSVA 7MDHA 1OSNA 2EIXA 2REBA 3NJ4A 1P0MA 4KQ6A 4OJTA 3GYGA 3JR3A 3SQDA 3TB4A 4BBAA 2CLOB 4M7RA 4EJ6A 3FYUC 5J2TB 5HQJA 2NU9B 1UDBA 2FVYA 3D8BA 2GEKA 3OFKA 3F6CA 3WGTA 4LFBB 3C3XA 2ZYSA 1BD3A 1OLSB 1R74A 2J9ZB 3FLAA 1EJBA 1KP2A 2Y0BA 1UQRA 3I2JA 4G8CA 4IJUA 4MVJM 4PGFA 4CIXA 4RA9A 1P2UA 3KHKA 4TLCA 1TM4E 5ALLA 3RIMA 4CE6A 1R0KA 3L4SO 2DUMA 4YXWD 2YYAA 4TRRA 2ZBRA 4OK5A 4EZIA 2VP2A 2UUBB 4IXDA 2FRVA 3EC1A 4HDSB 4XASA 3LX4A 3O74A 1T8RA 2RHOA 4ICIA 3R3HA 4H4DA 4WCFA 1R88A 2PKEA 3HPQA 4EJ2A 1KEPA 2J5KA 3D02A 2HSZA 1DMRA 1TECE 3MJRA 4R0NA 2WB4A 1SQGA 3TW4A 4PICA 1ULZA 5AW6A 2R8OA 4EHBA 5LNK6 5MGBA 4F8YA 3ZOZA 4UTRA 2Q6KA 4XIFA 5GONB 3CR3C 1J23A 4H0CA 4L9SA 5AVJA 1ES9A 3CVJA 3LRTA 2DFDA 3I3OA 3EA5A 4JFAA 3V2HA 4IM7A 5FLYA 1BXGB 5FUXA 1SD5A 3LPLA 4DRZA 4FS3A 1YB7A 3GD5A 4PG4A 2P62A 1H5QA 2BFEB 4TUYA 3LK6A 2GKSA 1Y8RB 2IKSA 4ZYUA 1CF2O 4LDAA 1M2NA 2C9BA 1YJAA 4I5GA 1O8BA 4EGQA 5C46F 4W7HA 4C04A 1J7KA 4LA4A 2AXNA 3P9CA 4MUFA 1U7XA 5ALVA 3CX8A 5KOHA 3QOFA 1JAXA 4XB6B 4N0DA 4HDMA 2R8ZA 2AC2A 1RKQA 1X7YA 4M1OA 5ALJA 4P0QB 4YJ2A 1SWWA 1UBJS 1YE3A 2IDJA 3D2AA 4KCGA 4Y6LA 1R6AA 1YMQA 2AFHB 2FUG1 3ONFA 4MPTA 2FZWA 4O4HA 4S1OA 2VAWA 1NV8A 3BFJA 1C1DA 4ZEVA 1I3MA 4L8YA 1FMFA 5JD5A 1YIAA 1XNHA 3VJKA 2ZTLA 4ZU1X 1R37A 2WM3A 1YHZA 5KUTA 3RBXA 5KNBH 1ZVVA 2HR1A 1D2AA 1RYYA 3WKEA 1DCKA 2GEBA 4OP1A 4B82A 1GNVA 3CLKA 4A4DA 2FZKA 2ZUTA 3O03A 3RVDA 2GXQA 2WE7A 3VDRA 5L3RA 3ZY5A 3LNTA 3DMYA 4V39A 1SG0A 1XA3A 3L43A 4E5DA 5BWMA 1Y1LA 3GCXA 2MSDB 4AJJA 4FGWA 4Y7CA 4JP3A 1E1CA 1F8GA 1PYOA 4JP8A 4C3OB 2LCFA 4WERA 4O5AA 1K5GA 4Z9XA 3C3WA 5LZ9A 4JI2B 3DEAA 1PZHA 2MHCA 1WDTA 3BMOA 3GZNA 3IESA 2PRYA 1I4OA 4R8SA 1XLWA 3RYIA 3WGQA 2NV6A 2VJMA 4F3KA 3W8FA 1ZCJA 5EIEA 16PKA 4L08A 1R0WA 4Y2UA 2KE5A 5ITZB 3RYCB 4I0WB 3MAGA 1LH0A 2CDCA 2I34A 2VDQB 3QKRA 4LW8A 3ESBA 3Q5GA 2C3YA 1A2OA 1VRCA 4TMXA 4E13A 2VZLA 4C4YA 2GF2A 4YP0A 4G9BA 1P6QA 4AO8A 4AZ3A 4KFSA 2QZZA 5F76A 3AVUA 2B8TA 2C1ZA 1Y0BA 2WU4A 2WSLA 3U40A 1SK9A 1NNI1 2E89A 3GPCA 1U9IC 5E4TA 3OEED 3Q41A 3KXIA 3NBZC 4ZICA 1E2JA 3RJTA 3ADCA 2VK8A 4MDHA 4R1QA 1U2PA 4HC4A 1AS3A 3C6BA 2AG8A 3ZE6A 4QECA 5JBQA 2FMKA 4FCWA 5HOQA 1ZJWA 1Z88A 2QIPA 3JW8A 4CKCB 3SI7A 3MBOA 1SIOA 2OAEA 1HBJA 5EPOA 2AXPA 1CZRA 5FJJA 1O95A 2CD7A 2W6IA 4J90A 2BDTA 3RS5A 2A1IA 2Q2OA 1FQJA 1O97C 3U09A 1NVWQ 4MVJD 3WK8A 4ZN6A 4KMSA 2O1SA 2P41A 4KO3S 5GADl 1DRWA 1NOJA 3LW8A 3VH4A 4CQMA 3VR3D 2VRWA 4Z7OB 3PKIA 3CRQA 1MNQA 1MO5A 2CUTA 3BDAA 3Q3GE 5A06A 2Z57A 3Q98A 3LNCA 2P5UA 2JIRA 3VMMA 4AMZA 1PUIA 3T5BA 5K01A 1XMXA 5C5IA 2ZUEA 2BBWA 1LPNA 4E0BA 3GEIA 1T3SA 7REQA 3H8VA 1E5VA 3C39A 1NVKA 4Q48A 3CINA 3WL6A 5IT5A 3DXYA 2ISCA 4FMCF 4GLBA 1TCVA 1N6IA 3LGSA 1KJ8A 1QG2A 3U31A 3A9VA 2ONYA 4XLLA 3ZQ6A 1RRGA 5C3MA 4JODA 1U1FA 3K31A 1H93A 1MEEA 1Z0AA 2JIBA 1G6KA 4DDMA 2FPPA 2Q6VA 1F5NA 4MTLA 3IQWA 4OI1A 3T0GA 4F85A 3QQ5A 1N0HA 1RZRA 1PK7A 2QD4A 3GX1A 5JWOA 2DQ4A 2G07A 4LV8B 4RFLA 3AI3A 1PR9A 2K2QB 4RM3A 4X6LA 5IKPA 5J4VA 1ZEJA 3EJWA 1LVUA 3LUPA 1S2LA 4N6OA 1D0SA 4LYAA 4OCZA 4P33A 4K88A 3DHNA 4NYIQ 5DSXA 4O2AA 4UPDA 4F4FA 5GZ1A 3UMJA 3BF7A 2SHKA 3QKTA 2JBHA 4IIVA 1OZAA 1M66A 4W1RA 4EQ6B 1F38A 3O2SB 2FN9A 1EP2B 2QENA 3HV2A 4LTNA 1UKYA 1VJCA 2JD1A 3DBHB 4G1EB 1XYGA 3LX8A 2F7SA 5JYEA 2ZETA 3BKWA 4WY5A 2QQGA 2WAAA 1JEJA 4EG5A 2PGDA 2V96A 5B5SA 2NGRA 2BKLA 1O6FA 1ARZA 4XPIB 1OB2A 1XZFA 3A6PC 1TZMA 3AJRA 2XT0A 3WL7A 1KL7A 4HVLA 1T8UA 4LNUA 5DT2A 4ZCQA 4FD3A 1Z3IX 2FFAA 2UYOA 4RK0A 1ADCA 2ZTHA 4KQ9A 4G5HA 4LS3A 3FDZA 3PPWA 2R1VA 3KK0A 1MFZA 1SD2A 2CEAA 3CZQA 3GYBA 3HJCA 3JWPA 3TLGA 4MRRA 4D0SA 4BP8A 3GLFA 2NU6B 4BNUA 3BTUA 1VKJA 1D1TA 1GVNB 3IIKA 4ZT4A 5LZ8A 4A73A 1WXWA 1NJ2A 2A0WA 1RACA 5EP1A 5LQNA 1KH2A 4LF4B 4BLUA 2P3QA 5LWHA 4E11A 3QVUA 2AG1A 5J2UB 3GEPA 4LZNA 1DT3A 5LYYA 3A2MA 3GCZA 3EASA 3W8RA 4ZU3A 1V6CA 1L5SA 4M1KA 3MGKA 3DLTA 4TZ0A 5E1OA 3M1IA 4DTIA 4WAUA 1BXRA 5BN5A 2CHVA 5ENZA 1UANA 1NN3A 2CC2A 2L19A 1GKLA 2QRNA 3LDFA 2A86A 4GZMA 1M1YA 5FOSA 2E6UX 4A8JA 4ENUA 2XE6A 3LZDA 4E2XA 4Y6OA 2EBHX 2SKDA 2XQGA 3D6NB 4KNVA 5DXAA 2GZAA 1Y81A 1MPTA 2CUNA 2G82A 2TS1A 3H1GA 4HQRA 4MMZB 4ZVMA 3SSNA 2EKLA 2B6NA 1GFWA 1LSJA 4GS5A 3R3XA 3OMWA 3LHKA 2WINI 1TB4A 2AR0A 2VJDA 2ZZKA 1HL3A 1AXGA 1GL7A 3F1LA 3HXTA 1GZDA 4IJQA 4TT3D 2GI4A 3ZEIA 1TAGA 1KJZA 3IQEA 1I4EB 1P1JA 4P36A 1SA0A 1ZGBA 2BEUB 4LGMA 4R0VA 5AM4A 3SE0A 4DUGA 5HRAA 2HPVA 3A7EA 3DVSX 4KQ2A 2ROQA 3DMHA 4GMKA 4R01A 3KE9A 1ORVA 4LYGA 3TG2A 1NUAA 3PGLA 1U90A 1HNXB 4KWTA 3LKDA 1CUZA 1XA4A 2NSJA 3KJNA 2QZJA 4G8JA 4WCFB 3TLJA 3COZA 4EJSA 2GM9A 2ZVDA 4JR1A 4J7AA 1ULUA 3K71B 2ZRLA 5TNXA 3WMEA 2IFTA 4P9NA 4GLFA 5G02A 1JIKA 3PXEA 4ZDJA 2OFOA 1EFPB 4HB0A 2HMWA 1HDXA 1XQXA 2AYXA 2B1GA 3IKJA 5IM4A 2AOTA 3WZLA 4RGYA 1OKKA 4B6RA 4HPJB 4PTYA 2NNWB 4P7JA 3RUAA 5HJ2A 4DQDA 3QNMA 1QHSA 4N47A 5IJ0B 3VR2A 5SYMA 2D3WA 1I51A 1U4SA 3H8JA 3QMMA 5EJ2A 4Y18A 4QDZA 4BFVA 2YJZA 4AXXA 4FHDA 1X9GA 2BJHA 1EB8A 1OHHD 1T6NA 2HWWA 2J6CA 1YJBA 1EFKA 3EGVA 1R4ZA 3JS5A 4HDAA 3RW9A 4NCAA 4YJ2B 2HIAA 1XI2A 4BCCA 4WZZA 3KZMA 1IN4A 3R3VA 4O4HB 1P91A 1W93A 2QTBA 4LFCB 1C1DB 4PN3A 4Q7EA 4HNRA 1T4CB 3A3KA 1L5GB 2BDEA 4DLVA 4Z5XA 3TH5A 3O3MB 3FR8A 1O6CA 5DW0A 3PQEA 5DWVA 3MMZA 3HACA 4R7ZA 3PFGA 2VFAA 1XQWA 2G76A 1GCAA 1P5RA 3IS3A 1F2DA 1NY6A 4PXSA 5A02A 3CW8X 4Q18A 5TSDA 1CYEA 3AF0A 4MUMA 4HMQA 1NVVR 1OVMA 5A5DA 5T67A 1DINA 3AR7A 1RWKA 1NHWA 3ODPA 1RBYA 2I2AA 2J6IA 5EWJB 4ZV9A 1H8HD 1YZLA 1Y1KE 1E1CB 3L0BA 3OF3A 1XAGA 4FFVA 2IW3A 1PRYA 2BGMA 1K4YA 2A0XA 2D4HA 3N2GA 3O82A 3OAAA 2R2AA 5EUQB 3DBIA 1VL0A 5A5EA 4DV4B 2EC5A 1PLKA 2R8YA 2CD9A 4OYLA 3U3JA 2HIGA 4B79A 4D9NA 2XXJA 3GZNB 3M1AA 4RPLA 2Z8XA 5JCOA 5B53A 5F2NA 4XTRA 1VI5A 2EBWA 4TQUS 5F7OA 2RDMA 1GJRA 1JR3D 3K09A 2HRBA 3I9FA 2B8EA 4O6VA 2P5YA 1W9HA 4OHUA 3HA2A 4P6VF 1MORA 3KWJA 5REQA 1FE8A 3U13A 4C6RA 4YR7A 4IYJA 1HNWB 3FH0A 4QO8A 4LAFA 3DC2A 2NWQA 3RROA 3ZJVA 1RXUA 3PCXA 4LX0A 5BNIA 4G4GA 1KEVA 2OHXA 4HFMA 3CNQS 5DK6A 2NIPA 3D6FA 2IY7A 2WTEA 3UTDA 4TMVA 1R3DA 2CJFA 2FW1A 3UHJA 4TYYA 3SEFA 4C05A 4MW4A 1YKGA 1ZDMA 3WMGA 3VKGA 5BSTA 1D4ZA 1WY7A 3DAYA 2B82A 4DOMA 5JEEA 4C7BA 1XPJA 3MUNA 4YCNA 2OYRA 2GJ4A 3EYWA 4Q01A 1ZK0A 4LC9A 1A5AB 1NUUA 3E61A 4I7EA 4ZVRA 2CBGA 1QKJA 4A26A 4ZTUB 1WQ1R 2PUHA 4NENB 2E6KA 1GADO 4M1SA 1F3OA 2PZGA 4DQKA 3ZBPA 1E63A 4GVXA 4R6WA 1BROA 1Z4IA 2HK9A 3CH6A 4QUDA 1X1EA 3HEMA 2VHCA 5FL3A 5EMKA 4GZLA 2XIJA 3IE1A 1PN3A 3KVRA 3EISA 4MHSA 1OTXA 1S9HA 1E9CA 3V8NA 1HM5A 4TV9F 2YOFA 5DCYA 4NE9A 7REQB 1LFDB 4FUQA 4OGLA 5DSZA 4B7UA 2HV9A 4LJLA 1NONA 1ZI6A 2OD9A 1RWNA 3S6JA 3A7DA 5K2MA 4YI3A 4D45A 2OZPA 3UY4A 1V5EA 2P5SA 1SZPA 4JU8A 1AKWA 2D2FA 2PZKA 3F5QA 3PF9A 3OFJA 4KQCA 4PY2A 3RCBA 4BWVA 4JZYA 1C81A 3G85A 1O9HA 4WXEA 1WUKS 4Y6PA 5DI9A 3UANA 2H51A 4CYMA 5IAEA 4TXLA 2G36A 1SXGA 3FLBA 3WDKA 1ESCA 3NM6B 1BU5A 5I9NA 2B2XA 1T9ZA 1DC3A 1NLYA 1S2IA 1WKCA 3KBBA 3ZG6A 3IV7A 4ETMA 1AMNA 3BSFA 2ISSD 1WMSA 1S3SA 3IQZA 1FRVA 1Y42X 2IEGA 3RSHA 5IANA 3NXKA 3PCTA 5A9TA 5EKXA 1SVSA 2C2GA 3WI7A 5TS2A 4GGMX 3G1TA 3BBPA 4LCBA 4ROTA 2FWIA 1IIRA 1ZQ1A 2IHZA 2YC2C 3QZUA 4E5PA 3U4QB 2IXAA 4D6YA 1IDOA 2J33A 2V8OA 3DWEX 2QN9A 3U44B 3K32A 2VZ0A 3N2EA 4H3SA 1QJCA 3WKBA 2QMHA 1AQIA 4F4DA 2PSJA 3HXPA 1NE2A 2ZJ2A 4CF3A 4Q7KA 3HYSA 4GLJA 4B7CA 4EMUA 2HZBA 1UJ6A 2PX0A 4H3HB 4QTTB 3TNJA 3TUJC 4AC9A 4UNSA 5L53A 1I7NA 2WFLA 5D51S 1RYMA 4BECA 5JISA 3VZPA 1P77A 4HP8A 3F98A 1EVQA 1Z6ZA 4MWOA 4X24A 3RV4A 4DCTA 4D9GA 1T9BA 1DV1A 1WIWA 5CX4A 4CM4A 3RLFA 1PWYE 2PRJA 4MV8A 4A27A 1D1SA 4Q19A 4EYGA 5IHPA 4TGLA 4X7PA 4CMGA 4JVOA 4NYMQ 1S7CA 1IPEA 1XU7A 2OENG 3GEDA 2EBUA 4KB5A 5DLEA 4ND3A 5FNZA 1GGFA 4FDMA 1H69A 4IILA 4YWJA 5CYPA 3TLGB 4C5BA 3FSEA 3K09C 4FFNA 4UNNA 1LW6E 2DJ5A 4BO9A 2J0UA 5JVDF 2YQ5A 4EA6A 2J7PD 3RS2A 2XF2A 2ODPA 1PWZA 1XIVA 2WJYA 4MCAA 2HA2A 4YAOA 5EKSA 3SMVA 1M6VB 1D6MA 4B7ZA 5LYJB 4GM0A 4DXDA 4GMHA 3QXCA 1VPTA 1XQ1A 1XMSA 1W52X 4GOOD 4ZAZA 4Q00A 1DC6A 1LQ2A 3WR5A 4PCAA 3WA6A 4P3YA 5DKFA 4ZARA 4ZZ1A 4HR7A 3L04A 1H2EA 3LOUA 3O84A 4G65A 4AK9A 1BXRB 3QPAA 4DIMA 3AEZA 4TMWA 5FOVA 1Z6PA 5KWEA 4ALIA 4NZ9A 1IZYA 4D5GA 3ZD9A 1M1YB 2YUIA 4OLHA 3AKDA 1G8HA 1E60A 4ZEWA 3MN1A 5A6SA 1QUFA 5ALDA 3FNGA 4ZAYA 3G7NA 4RK6A 3RIXA 1QYDA 4OJQA 3ZCRA 1FYFA 2UV8A 4YRQA 5FBKA 4CF4A 1Z5ZA 4MYDA 1Z26A 2AVNA 5EJ5A 3DQQA 1VSUA 3LFHA 2DWPA 5EERA 1K89A 2F4NA 2B36A 1OMOA 1JJ7A 1LC3A 1VE5A 2CVOA 3PDIA 1C3XA 3R6TA 1UEXC 1RI3A 4AURA 1VJTA 1XEWY 4HEJA 4O63O 3R5JA 4QARA 2A2ZA 4Q1BA 1EZZA 3CF2A 1YA8A 4KGXA 4GUDA 2EV9A 2G08A 4I50A 4LOKA 2PYIA 4PAGA 4QSHA 4QG7A 1YZQA 3UHPA 4B34A 5CVVA 2HJGA 4KC0A 1SHZA 5GGYA 3G0CA 2DY1A 2I66A 4H17A 1QMPA 3HJFA 3BJEA 1KSFX 2CUKA 3O9VA 2OD2A 3H4VA 4C0KA 5KSOA 1L2TA 4KK3A 2WJVA 4MQFA 1D1PA 1M2WA 1XZ8A 3FHLA 4PGAA 4ZA2A 4BFYA 4PZPA 1RZ3A 1VPDA 2YY6A 5DNVA 5F5LA 4M0DA 3TEJA 5KEIA 3UB3A 3IDOA 3RFUA 3WK7A 5CYGA 1XTZA 4DCJA 4WNYA 2O23A 1Q11A 3ZDRA 2B78A 1KO1A 2A1TR 2BFOA 2ET6A 3O2NA 1EFVB 3THSA 4RTSA 4TRJA 1UEIA 1NU6A 2O2CA 3B9RA 4OBBA 4UHEA 4AUEA 1MVOA 1NSFA 3GLIB 2NPIA 3WWZA 1GPNA 5AP9A 4HLUA 3GRRA 1XF1A 3RVNA 3U4HA 4OHYA 1MOQA 1LY1A 1QIDA 2G9RA 5JHHB 2VYCA 3DCIA 4V0SA 4YRLA 1RWQA 4N18A 1MQ8B 2GOYA 4JLVA 3TGWA 3TSOA 3ZWMA 5DNUA 3ELDA 1XG5A 4AMUA 1FP6A 2Y92A 4IXTA 1R0YA 4KNWA 2AXEA 4DKXA 1FUIA 4DCMA 3IQDB 4XRGA 1JQLB 1USWA 4C14A 2W58A 1IWOA 3LAWA 2PZAA 1V2HE 4ANFA 3V7YA 4OK6A 1JAYA 2OHVA 4F45A 3I28A 4LDNA 1NMXA 4P4TA 1JSLA 3FUUA 2F6RA 2BMDA 2PZLA 4P0PB 4U3JA 2PH5A 3T7SA 2VAMA 1WVGA 4X41A 3I5AA 4KR3A 3K8OE 4AKIA 1Y5IA 2CNWA 2VHQA 2AW3A 3ZHVA 2PT5A 2G77B 1P3JA 2MR6A 4LMRA 2A9PA 1MX9A 2RH9B 2VYVD 1R0LA 3ZHQA 1SRRA 1A77A 1NVBA 1ODTC 3ABSB 4I99A 4CF6A 1PTJA 2H07A 4I46A 4B73A 2HPAA 4HNTA 3IIMA 2Z6UA 5DYGA 2R5WA 5EWLA 1QYWA 2JFZA 1G5FA 2ORIA 2BGRA 5JC1A 2I4OA 2GBLC 5REQB 2VS1A 1X15A 1K3TA 2W37A 2YWHA 3EGXB 3MJCA 4BCBA 3TIIA 4DNXA 3WDSA 3F73A 2J9YB 4N39A 5LQJA 2XXAB 2VAPA 3P9YA 3NUZA 1GKKA 5ERGB 1B26A 1NFFA 4FFMA 3CC8A 4AU1A 5AK6A 4I4TA 1CQWA 2BFDA 4JMLA 5A2GA 2OBXA 3PWTA 2HA7A 3AV3A 3KZ1E 1RW4A 1QU3A 4RU1A 5H83A 3MJDA 1MDFA 2YOGA 1L7PA 2VDRB 5AOAA 3OQ6A 3RGGA 3V42A 5FOTA 4F11A 2PH3A 2ZPUA 2HDOA 4LYFA 2GCOA 1DAGA 4GI1A 4PBTA 4WKNA 3S40A 3QV2A 4YHHB 1QDUA 3ITDA 2FOLA 2YHAA 4EWLA 1SVKA 1CRWG 2GYUA 4YO8A 2O2SA 3DFKA 3PWSA 4AM8A 2Z6QA 3Q3JB 4L4UA 4MAFA 4J76A 2WTMA 4H4CA 2GUWA 2YRFA 3ORRA 1OAAA 4WESA 4YCBA 2X8LA 2PUWA 1C8KA 3CX3A 5KZMB 1DCFA 3PRKE 3U4IA 4YAGA 3JQGB 2PYDA 4C0LA 4E3WA 1GTL1 4BNXA 3KBOA 2Q50A 5K0BA 5ES4B 4YJHA 1AUVA 4I1OA 2NX2A 3IUNA 3N74A 4CLOB 2FSSA 3NI2A 4NZYA 4US0R 4IS3A 1UKAA 3JQ7B 4GKBA 2AS0A 2HJWA 4Q3CA 1J06A 4XIYA 3E4DA 3NDBB 4L28A 2BGNA 1EA5A 1ZGZA 5AQ1A 3CH7A 4MWGA 2ZSEA 2D7JA 1OTYA 6GPBA 4MW2A 1UH5A 3T52A 4DEVA 1R0XA 1VJGA 4JUCA 4DJJA 1FZQA 4Q4HB 1MDBA 1S7GA 1XQVA 1SXIA 1CY6A 1XCOA 2QRUA 4YMTA 2MT9A 3AUXA 1NG1A 1TVMA 2O9JA 2XNKA 4Q12A 3KZOA 1NNUA 3PBKA 1V3VA 3ZE2B 5KREA 1Y8CA 5I7OA 2NYRA 5LLDA 3WWYA 1O3YA 3B7GA 5KNCA 1JL3A 3T3NA 4YGYA 3WYDA 4UEQA 3KZVA 2FXIA 4Z1MD 2JIZA 4REOA 3AT1A 1ZIYA 3MTIA 1KEKA 5JSUA 2YWGA 3PC4A 4N82A 3FZEA 1IC6A 2JFBA 4X60A 2CYAA 3ED1A 1F6WA 2A4KA 2RGNA 3W77A 4C0BA 3HXMA 3L0CA 4X63A 2R47A 1TGVA 4MYUA 4GX5A 3S55A 1Z5NA 1RFGE 2PKQO 4YFVA 4V0NA 1Y33E 3LXMA 1DIBA 4FFBA 5ER9A 1SULA 1E5QA 2YV4A 1NZJA 4DNOA 4PAQA 4IAOA 5GVRA 3C1TA 3UGJA 3E4CA 4QULA 4WLFA 3QLEA 4WACA 5K0ZA 1ILEA 1J0BA 2XMSA 4R1LA 5L4NA 1P60A 5BYBA 1M1NB 4K40A 4CM4B 3TUZC 1JI3A 2GCNA 4KWCA 3TBFA 3OCUA 1Z7EA 8AT1A 5CXQA 1T0BA 2GHQA 1A69A 2DMRA 4XEUA 1TM2A 4QEDA 1SUIA 3W2FA 3D31A 5T4EA 3ROZA 3R77A 1B6TA 3O4IA 2C54A 3TQTA 3M2PA 4AY4A 3JWGA 2QN3A 3CLRD 4CL0A 3ESQA 2IWHA 3KSAC 4M0LA 1OXKB 3BGIA 3GFVA 4WHMA 3LSTA 2X7XA 5AM0A 3DA8A 1J24A 5IARA 3D4OA 3ZQ4A 1PUJA 3AHJA 6AT1A 4YECA 4POOA 2X6QA 4O2BB 1H2ZA 1SG6A 1PDWA 1XCBA 1YFZA 4FN5A 4N01A 3ZU2A 1AHIA 2X8WA 2HI0A 2DPGA 4M0MA 4NCKA 3WB1A 4E5UA 1E2PA 4I14A 1PR4A 2PTHA 1C1XA 5IXSA 3K5HA 1T5IA 4PZYA 4KR7A 3NLLA 3Q7QA 3QVMA 4MUJA 1M8JA 3DOIA 3GARA 1ODSA 4CI0B 3WGKA 1OXUA 2TMGA 5A6SB 4YLYA 4ZI7F 1E2HA 4LV5B 1U31A 4RKWA 1W4LA 3S2SA 3MUFA 1GXSA 1NX6A 4IHKA 4EY7A 2ZM5A 5J3JA 1C9YA 5SZHB 4Q02A 2QLNA 2X8BA 2AJLI 3BK7A 5KOJA 1KMHB 4DUZB 2JLAA 3UWSA 4EHAA 2C4MA 1HFJA 1TEHA 2TYSB 3QLUC 4Z4IA 1U2GC 1NMEA 2QSJA 3T7AA 1EVLA 5CGQB 4BN0A 3HH8A 3STTA 1FMLA 3BCSA 2CVPA 1T24A 2X3UA 3KQPA 5IYZF 5K0SA 4I50B 2HO5A 3TLCA 1OA0A 3UMYA 1KEWA 1N0WA 2C5AA 3D3JA 5BWNA 1F3LA 3WGZA 1Z82A 1EFTA 3CE6A 2AMVA 2YJ5A 4ZVSA 2OLKA 3LWDA 2FF5A 2V3WA 2ABWA 1HLDA 2DR0A 4RL6A 4REQA 3MT8A 1WXFA 2XE4A 2HWUA 1YF3A 2QTRA 1I9GA 5G53C 4MKZA 4NARA 2BMEA 3Q2OA 3KOZA 2BW0A 1PHPA 2LD4A 4N8DA 1SU8A 1YB1A 5K0FA 3QVTA 4UXJA 2GZ2A 1Y1PA 4MARA 3ZKAA 1ZZEA 2HA6A 5E6SB 4HWKA 5ILOA 4YPVA 2H0AA 3G0OA 3RIGA 5FA5A 1NGSA 1EQAA 2ZSBA 4TTAA 1KC3A 4DJ5X 3FVQA 5IK2A 2Q8PA 5CB8A 3ZVKA 3JVEA 4KX3A 1VL8A 1E3IA 4UU0A 2KLHA 2F3SA 4JLOA 2X15A 1DJOA 1ZITA 2Q3CA 1AN9A 4DBZA 3CB4A 3JVVA 5DASA 4DY6A 1U2SA 3W5DA 2GCIA 3EFOB 1AUOA 1R4MB 1E4EB 2BH9A 5K3SA 2XJ9A 1T2AA 1W4ZA 2WWIA 2NUPB 4X8OA 4YREA 4A2QA 3E48A 3KR0A 4V0OA 5T57A 4UHKA 4MW7A 3HCNA 3TKLA 4N3AA 2NU7A 4CIYA 4EB8A 3KQLA 2WSIA 3Q0TA 1QH8B 3FOWA 3NEJA 4XUGB 4ZVUA 3MD9A 3N8DA 5FAXA 5IKEA 4PS1A 3NKVA 1FRZA 1XCMA 1KYVA 2W48A 3CM0A 1SPXA 4PCLA 1JB1A 2YKGA 4RW0A 2XUQA 4LYYA 1YZKA 2C7BA 1ZVKA 2IPXA 4BFZA 4RVNA 3T8YA 1CUCA 4G9GA 3OCZA 3ZK9A 4ZDWA 4RVOA 3R7NA 2EXXA 3T7KA 2VF8A 2A0UA 2VG8A 2GR9A 1WZNA 4OQZA 4X1KA 3SQMA 4M1TA 1TI7A 4HPWA 2WYWA 3P2KA 2JEYA 2VDUE 2B3DA 1ZKDA 2UZ1B 1JILA 221PA 5E9QA 4AX4A 2C00A 3K0BA 1M75A 4RKFA 3SS9X 3WLHA 3LCJA 4OI4A 3I12A 1RPAA 3ZXUB 2Z9DA 4I4TB 1P18A 2UZ4A 1FUUA 3LUFA 4QOSA 3RSQA 3RRFA 5K5EA 5BMOA 1FSPA 2ID7A 1QYRA 4Y2YA 1E0DA 2OGWA 2PGAA 3NC4A 3CTPA 3UXHA 1FYWA 4GF5A 2G83A 1A2KC 2LBPA 2X4IA 4Q4LA 2AX3A 3T15A 3QPWA 1M34A 1CULC 4BC1A 1OA1A 2IEAA 2DPYA 1Z68A 2RCNA 4LDPA 4KN8A 1L7BA 4UDOA 3H4MA 1YHNA 1VLZA 3HJTA 4AUMA 1W87A 1QNFA 3I1FA 2W6NA 1IXZA 1OAOC 1DKUA 1WXDA 4ARAA 3ZZNA 1U2ZA 1CX9B 4V0KA 3RF6A 4LN1A 3MQFA 4UCWA 4G5QA 5JANA 1FB5A 1IG0A 3GO4A 5IVIA 2ZPAA 4V3CA 5T3UA 5ESDA 4D41A 2RHHA 2V7BA 2YMLA 3OPXA 3HJRA 4LF9B 2V1UA 3BERA 1I0ZA 3TLAA 3PUVA 5IDVA 3FCCA 1QHHB 2WTAA 3DH0A 2PEYA 3G23A 4BS9A 4M0CA 1Z18A 1CT9A 1E2QA 1Z12A 1V48A 3ECSA 4PXAA 4IJKA 1LSUA 2Q5LA 4Q9LA 4ZI5A 4HV4A 3PX2A 1C8VB 4R2LA 1LI4A 3D6VA 2I2CA 5ALMA 2CDBA 4JLKA 3GLFE 2HUNA 4HH1A 1E5LA 1EG2A 2QV7A 1N5KA 4R41A 5EP4A 1IHUA 5C1OA 3L3BA 4XVUA 4OGGA 1YR2A 1CQIA 3L02A 2K5UA 2G70A 1QFSA 4LXQA 4MR9A 2GCGA 2BE9A 1B0PA 4CMIA 3HWSA 2GKOA 1WXXA 1OGYA 4N4AA 2QT9A 4CDNA 2PUCA 1U9CA 4AZTA 1FW8A 3GLQA 1EEHA 3QITA 3QVOA 4UMEA 3KWFA 1SC9A 4WK0B 1DCTA 5LMNB 2EJTA 3N8HA 2PL3A 4EYOA 2I65A 4O4LB 4DMHA 1IWBB 1M1YE 4YEDA 2ZT7A 1H2YA 3DAPA 3KYBA 2UKDA 3K8YA 3LXUX 2QBYA 2IU4A 3JQ6A 5BMVA 1JP7A 2A7QA 2JB9A 2XI4A 1MJNA 1NQAO 3A1EA 2I03A 4FNAA 4LY0A 1UOOA 4BZPA 4BFTA 1WQ3A 1Y7PA 1OZHA 4LYEA 4RJIA 4WASA 4JUBA 4NFYA 1YV9A 4F1WA 4BUCA 2W6QA 5U4XA 3AOEC 4D4KA 2GJ9A 4Y8VA 4C4XA 3IEMA 1EG7A 1V16A 3EN0A 3N87A 2B5OA 5FL7D 1NXXA 2V5VA 4NH4A 4OFXA 4D99A 5C7OO 4OMFG 1DTWB 5MDHA 2O4UX 4WJLA 3FNQA 1YFJA 3OX3A 4HAWA 4V0MA 1DDIA 1JHQA 3GDWA 4O2AF 2BGJA 2DPLA 3U80A 3R8CA 2L17A 2O54A 3BJIC 4XD2A 4TV8F 3WJ2A 3I2FA 1QH1A 4OXYA 2O8EA 1D09A 1OI7A 1STOA 2PVCA 3MT7A 3DLCA 5LBIA 3SBXA 3U3DA 1X1SA 1ZW6A 3A4VA 2GAIA 2GFQA 1SCNE 2XUPA 3H9GA 4QBHA 4CG0A 1P1CA 1F2TA 3AEQA 3FETA 3QWFA 4TKZA 4X44A 5DU2A 4M9SA 3QUTA 1O6GA 4EY3A 4X3CA 3IAAA 3WXBA 3OCYA 3ODGA 4F9FA 3BD6A 5AH0A 1YZNA 1XXHA 1MAWA 4ZK2A 1BO6A 1R18A 1XZJA 1LPBB 3V4PB 2XD4A 3QQPA 1EKXA 3NTXA 3BIFA 3GGGA 3Q3EA 1C1XB 1ISGA 3K70B 1KVTA 5BW8A 3PPXA 2O2YA 2PUVA 2ZBGA 4KODA 2RIPA 3DTVA 2PZEA 4YMUA 4BNDA 3LX5A 4G3XA 2V9ZA 3N5CA 1ZYUA 5F77A 1GPDG 3FOEC 4IHJB 2GFIA 3FCXA 3P71T 3UMGA 4CEHB 1GXSB 5L7YA 3F7MA 4WBNB 1LEHA 2C7RA 1FBTA 1T36B 2HCJB 2HU8A 3QLTA 1I10A 4IS2A 4MVJI 5BV7A 1L4NA 4ITRC 4NFLA 4WOJA 2QMZA 3AETA 3DUWA 3IEIA 3QVWA 4L16A 3DOFA 1Q7BA 4LRWA 3SHQA 5HRUA 3LBHA 2EKPA 4DF3A 5THQA 3CRVA 3V2UA 2VATA 1VGRA 2D59A 1WHTB 3P2YA 4GOLD 4CMBA 4J1TC 3D3QA 3I23A 2PSHA 3R41A 5B2FA 3P0HA 1XELA 2GN2A 1PJ2A 3AB7A 1QG4A 4A6DA 1IFXA 1WPRA 2VDPB 3AM1A 1CR6A 2AUNA 5KDLA 5DVZA 4NONA 2PR2A 3KOMA 1RBQA 3DZBA 3RRXA 3W04A 2GLTA 2GK4A 1VE7A 1PFYA 5HVNA 2GK3A 4P38A 3A4YA 3EXHC 3QSYA 4M21A 1IXYA 3ORFA 2DR3A 1HFKA 2DHDA 3LD9A 3HQ4O 1U3VA 4REQB 3F71A 1T6XA 1RFLA 1FQKA 1QP8A 2G0AA 5H7XA 5A4MS 1FP7A 3E18A 4KQXA 4L27A 1A8QA 3ANNA 3GHHA 1TD9A 8GPBA 4IEEA 4ZVNA 1VKOA 4IGFA 4AIRA 3GPBA 2NTEA 3FPJA 3SHOA 4PIVA 4ZJZA 2QR5A 2GAOA 5DV9A 3V1UA 3CLTC 5FBVB 3PR1A 3BJRA 1TE2A 2IVZA 4UZSA 1QHFA 3ZCQA 3NBFA 3HBLA 1JPVA 3EG5A 3QJ5A 4D02A 1GSAA 3VOTA 1T8WA 3JQEA 4XAQA 1X1AA 4CMEA 3NBUA 5E8RA 5C37A 4LHZA 4DSZA 3MT0A 4MS3A 4ZCRA 2XUGA 4FMDF 1XMJA 3DGEC 4HYYA 2RGAA 3T5CA 4BUZA 2FMTA 4YVFA 1UEJA 2PX5A 5TT0A 1TTHA 2FCRA 1K2WA 2I6SA 4BQIA 2V45A 5DISB 3TXAA 2PT9A 1IUNA 3GEBA 5JZ9A 1Q0QA 4TVBA 3QU4A 1VXRA 1SVOA 3H99A 1O96A 4KXFB 4TWIA 1NI4A 4JOQA 1A5TA 5IMBA 2GLXA 3ISTA 4G5FA 3SF0A 1OH5A 5ALXA 5HDQA 5EJEA 5JYBA 5BSHA 3OOSA 1VE9A 5KWVA 4OQEA 3ZD8A 5IABA 3MLBA 1IEXA 4FDAA 4CLHA 3IQIX 4WLVA 1GV0A 1WSWA 3O3OB 2IH2A 2H9AA 3ZEAA 3NQ41 2QRVB 4FONA 2QF7A 3H8SA 4PS0A 3WJ7A 1NF2A 1Z2PX 2PU7A 4G23A 1MLDA 4GWLA 3L8EA 4M1YA 4OL9A 4WGGA 3U4CA 2WT9A 4QVKA 1J70A 2LPMA 3QPDA 4X97A 1LRJA 1OLXB 3FMOB 4MO9A 4PCVA 4N7MA 5DX8A 1G5PA 3TQSA 2EFEB 3PIIA 2GN6A 3PP8A 4Z0HO 5ED0A 3PHHA 5KYXA 3RKSA 3MBKA 4ZRNA 3NC1C 2CEKA 2NLOA 1WCWA 4NYMR 1KJIA 3I39X 5CLIA 4IVPA 1YXMA 2ZJZA 4HATA 3UFXB 4Q37A 4W6QA 4DBLE 5A5GA 4URVR 2OEPA 3GIDA 1MH9A 4II7A 4R5HA 1M2OA 3Q0EA 1T3LA 1TYEB 1RYZA 2PMFA 2WJ3A 3WXMA 1M34B 1OI4A 2LXNA 3AKCA 2BFBB 2R6AA 2X76A 3D8UA 3IO5A 3UAWA 4EHIA 2Z58A 2DPXA 1T8SA 4JJEA 4QD3A 5K8UA 4NH0A 4CWAA 4XVCA 1EHCA 3PQ8A 4JLPA 5BSFA 1V7PC 1W94A 3EZGA 3OP4A 1YVDA 1DNPA 1K5DA 5EHNA 3TAXA 1E1RA 2CLSA 2ZT5A 3JVUA 2QORA 3PRJA 4PC1A 3B89A 2FLKA 3SCZA 5K6TA 4XWWA 4HMOA 2Q1SA 1GIAA 4RETA 1IN6A 2Q0HA 1TTPB 5DTIA 3VU3A 1S2GA 1APBA 1ICIA 4RHUA 3VBCA 4G26A 3PNQA 4CMAA 2ZE8A 5G2OA 1W96A 3BQNB 3ZHXA 3D81A 4HDKB 2JA1A 2Q1WA 3TCNA 2GCPA 1IXKA 5C0OE 3NNDA 3ABIA 4DG9A 1V1RA 3RSSA 1NPYA 3U3XA 5L51A 4Z4HA 5DHSA 4DLTA 3PF8A 3LCVB 1SQ6A 1LZLA 4QTXA 2ZWVA 1ZH0A 5TEWA 1A50B 2WF5A 1KA9H 3PFFA 2VP3A 3SQLA 3VOSA 3H5VA 4DZTA 1NLMA 1RYDA 4ZKDA 3L1JA 1YR3A 2NU8A 1G8YA 4HO1X 4MWEA 4EENA 1TYAE 3WGGA 3A25A 4B8ZA 1U8FO 4IMPA 2GXAA 3KTOA 3X1YA 2O0MA 4MQUA 1JWAB 3RM3A 2Z4SA 1CR1A 1XFDA 1FUYB 3E7XA 3FN4A 2D3TA 4MYCA 1Z5GA 1OX4A 2P4SA 4HNAB 4LWQA 4MS1B 3SFZA 3ZH9B 5BMVB 3EZNA 4BP3A 4K28A 1MJGM 5J40A 4XXHA 5BSWA 3RAEC 2G8LA 4F46A 5BYKA 3KCQA 3P2EA 2AK3A 4QC2A 1RP1A 2W43A 2AZMA 1GZHB 3KALA 4X1IA 3KTDA 4RSMA 3ZY6A 2WIJA 4PW0A 4MB0A 1WUIS 2EZUA 4UBKA 2FTKE 2QEQA 4PLPA 4MKRA 4PLFA 2QT0A 1JF8A 1OIXA 2WKWA 2WFMA 4OHVA 4Y67A 4Y98A 5GMOA 2BR4A 1KIMA 3CR7A 1FRQA 3QU7A 4WLUA 4KXXA 2CNOA 1JR6A 4GRAA 1QBKC 1V8DA 3E3AA 4MI3A 5J5AA 3UJAA 4DR3B 1F0KA 2VJPA 5C7IO 1NKTA 5JSQA 1QH1B 1H6DA 4KSBA 1KJWA 4HOYA 5AW5A 1Z5OA 3ULKA 4IRUB 4NWIA 2H0QA 2A14A 3PPYA 1N7JA 2W2TA 1LDMA