4RY0A

Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
287
structure length
287
Chain Sequence
MADLIAIITPAHDNPFFKAEAVGAEAKAKELGYETLVMTHDDDANKQSEMIDTAIGRGAKAIILDNAGADASVAAVKKAKDAGIPSFLIDREINATGVAVAQIVSNNYQGAQLGAQEFVKLMGEKGNYVELVGKESDTNAGIRSQGYHDVIDDYPEMKSVAKQSANWSQTEAYSKMETILQANPDIKGVISGNDTMAMGAIAALQAAGRKDVIVVGFDGSNDVRDSIKSGGIKATVLQPAYAQAQLAVEQADAYIKNKTTPKEEKQLMDCVLINADNAGKLETFALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ribose ABC transporter, substrate-binding protein
publication title Crystal Structure of Ribose Transporter Solute Binding Protein from Rhizobium Etly, Target Efi-511357
rcsb
source organism Rhizobium etli cfn 42
molecule tags Transport protein
total genus 121
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2014-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ry0A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ry0A01
4KFCA 3TB6A 2WY2D 5BQ3A 2WJAA 3KKEA 5DLEA 5FWYA 1W9HA 2HSGA 3LUDA 2FMHA 4QYWA 5KQGA 3KSMA 3KLOA 1NXPA 4QPJC 2W42A 2NZVG 4MLCA 4F06A 4KQCA 5CHYA 1PEYA 1QNLA 1FFSA 2H0AA 1TM2A 4G0OA 3H6GA 4G0ZA 1U8TA 5IC5A 4W5RA 2FSPA 1EWKA 2FKAA 1PHRA 4RXMA 1KMIY 3VNAA 3HSYA 1A2OA 3A0UA 3Q7RA 1BVHA 2GX6A 1JFTA 2RGYA 5CNIA 1LJLA 3GWGA 3NHMA 2FEWB 7ABPA 4RK1A 1RPJA 3KG2A 2E4YA 1QQAA 1DCMA 1SD5A 3T8YA 3T38A 1QP0A 2FVYA 1CHNA 2NZUG 3H6HA 4IILA 1OXKB 3JVIA 4MPTA 4MS4B 1QO0D 1KGSA 2MYNA 4PICA 9ABPA 5IUJC 2QV0A 2OQRA 1YTUA 1CYEA 1SRRA 3HV2A 4Z4HA 6CHYA 4S05A 3NBMA 3H5TA 3H5LA 1JDNA 5DKFA 2ZWMA 3FFXA 1MIHA 3QLVC 4WUTA 1GUDA 2PUBA 2M1ZA 4KPYA 1SXGA 2FQYA 5GQSA 3IP5A 4Y9TA 2LIVA 1Z12A 1Z13A 1ZY2A 2IKSA 4DN6A 1MAVA 1QQBA 3QEMA 4YP9A 4RK7A 4ETMA 3E3MA 4EY3A 4MQEB 5BR1A 5EWJB 4NCBA 3HEBA 4IGAA 1XHEA 1BAPA 3DBIA 1TVMA 5IUKC 2R4QA 3N0XA 2R25B 3N8IA 2IYNA 3H1EA 4E7OA 2R48A 1QO0A 1RXEA 4GNRA 4MYRA 3JPWA 2FQWA 3M9WA 3RVJA 2NUBA 2FW0A 3EDCA 4KQ9A 4ML3A 3GBPA 4JASB 4B09A 5FWXB 4RK6A 3NNNA 4KREA 4G0PA 3N0WA 2JCGA 4Z4GA 1JFSA 1JBEA 3BBLA 3DGEC 2L18A 2QR3A 2IDMA 4KZKA 5ED4A 1DJMA 1K66A 3HUUA 1AB6A 2GI4A 4N03A 2VK2A 3LUGA 2OENG 1GCAA 3O1IC 3QLUC 1YIOA 4Z99A 1H9CA 2YHBA 4EYKA 1USIA 3CS3A 3SNKA 3ROFA 2PUAA 4KK3A 2QSJA 2TMYA 3RVNA 2J48A 1E6MA 1JYFA 3F7NA 1M5TA 3EODA 3C6QA 3FGZA 3QK7A 5TPWA 3MM4A 3JS5A 4MR9B 3P9YA 4PZ0A 1PUXA 2DRIA 3CFYA 1Z2DA 4HNSA 2E4ZA 1DG9A 4WT7A 3QEKA 4WXEA 4MR8A 3GA5A 2CHEA 2LP4Y 3DLBA 2O20A 1P2FA 3URMA 3D8UA 3SQNA 3H5IA 4EUKA 1FFWA 1K68A 4YLEA 1ZITA 1ZVVA 5B3JA 2M98A 2PUEA 3ROTA 4YRZA 3SG0A 1RXIA 5TQ0B 3CRNA 4FB4A 4W5NA 2E4UA 2MYTA 3CNBA 3TX6A 1DBWA 3HK2A 1M5UA 1Z16A 1ZHHA 2JB9A 3O21A 4O1HA 4F12A 4RKRA 3RVLA 5KQLA 4E7PA 4YCSA 1ZGGA 3HZHA 3OQNA 4YO7A 1A0OA 3RVQA 1BDJA 5JNTA 3Q7TA 1FFGA 4MQEA 5CNKA 1E2BA 1IIBA 4IF4A 4YWHA 4PE5B 2HQOA 2JK1A 5D2CA 1TJYA 2HJ9A 4H3KB 4P98A 2A9OA 5FBHA 3RVSA 1UDRA 2NT3A 5IUNC 4H60A 1U0SY 3H5WA 3LOPA 1ISSA 1P6QA 2B4AA 1U2QA 4FE4A 4Q6BA 1M2FA 3CLKA 4LRQA 2VUHB 1QKKA 4EYGA 4RS3A 3Q15C 5FWXA 1Z18A 3OM1A 4UHKA 1P8AA 2JVJA 3Q9SA 5C5CA 1DZ3A 5KWSA 4NCAA 4MGEA 2FMFA 3IP6A 4MR7B 1EWVA 3GT7A 3QELA 1USKA 3JPYA 3O1HB 1RNLA 3EQZA 4RWEA 5JNSA 2AYXA 3ILHA 3GL9A 1GCGA 5GOTA 4G0YA 2FLKA 2FMIA 3LUHA 4RZSA 4KNYA 2F8TA 3H75A 2Q5CA 3SM9A 3K9CA 3HCWA 1E6KA 3FMVA 4G86A 1ABFA 4G0QA 1ABEA 1NXOA 1BDIA 4MS3B 3O1JC 1A04A 4EVSA 1QP4A 3OMXA 1Z26A 1NXXA 4HNRA 4DQDA 3L49A 4IMIB 3DZDA 2WWVD 1SXHA 8ABPA 4Z9AA 1QP7A 1BA2A 5JS1A 4MS1A 2JVIA 3F6CA 1U2PA 1W25A 2ID7A 4OATA 5EWMB 4LDAA 1OXBB 1JFVA 4Z4EA 3HXMA 1E6LA 3KCNA 4EYOA 3LKBA 1NXTA 3O2SB 1JH9A 2I6FA 1RZRD 2LUOA 3OLYA 2PUGA 1D2AA 4Q6WA 1CEYA 4FE7A 4IMJB 4LX8A 4HYEA 2WB4A 2FMKA 2FLWA 1J56A 4ZMSA 4XARA 5KQMA 2IOYA 1ZESA 4GPAA 4ETNA 3FDFA 3LTEA 1XHFA 2IPAB 5EWLA 5T3YA 1YK1A 3G85A 4ETIA 1VLZA 4S04A 1U04A 3HDVA 3OLZA 3VNBA 3HJFA 4MRMB 3K4HA 3H5OA 4JP1A 4RK0A 3I5AA 5TE9A 2AYZA 2FXIA 4OLAA 2HQRA 5IBQA 4M88A 3N0RA 1BDHA 2NT4A 4ZJPA 3KJXA 1XWWA 3MQ4A 2KYRA 4KK4A 4OBBA 4RY9A 3CKMA 3LUAA 2VUIB 4EYQA 3DGFC 3SAJA 4OLBA 3IPAA 1ISRA 1I3CA 4JB0A 5TPZD 2GWRA 2JRLA 3CZ5A 2H3HA 1EHCA 3H1GA 3JY6A 5DCLA 5BRAA 2ZAYA 1YMVA 5T7BA 1MB3A 1DC7A 4YR7A 2FEKA 2P9HA 1DRJA 2F8SA 1JL3A 2GBPA 5KI6A 4PEVA 1LJUA 3UKJA 1EAYA 1DRKA 4EGSA 4Z4CA 1FQWA 3H1FA 4NICA 1LBIA 5DTEA 4KV7A 2QVCA 3O75A 5IX8A 2A9RA 1DBQA 5FBKA 3GRCA 4MS4A 3LKVA 4G0MA 3NNDA 4RY8A 2FN8A 5CNMA 4Z4IA 1Z15A 3KS9A 3OLWA 3Q41A 1NY5A 2L19A 5KC8A 5TQJA 4MLDA 2MYPA 5EWMA 4N0QA 1DCKA 3OLXA 2PJUA 3W9SA 3GBVA 3Q7SA 3QLTA 4D6YA 3BREA 3R0JA 1C4WA 3LUCA 4OTZA 1URPA 4WZZA 4N76A 3JTEA 3L6UA 3IDOA 2QZJA 4W5QA 4RXUA 1SXIA 4QYMA 1M2EA 1YMUA 3I45A 3KYIB 4OG2A 3RVMA 3KYJB 4DADA 2PUFA 2GKGA 3RVOA 3A0RB 1ZAYA 2PLNA 3HUTA 5KQPA 5EWJA 4XASA 1JF8A 5JNWA 2WJWA 3M6MD 4F3TA 6ABPA 2E4XA 3OLVA 5IEBA 2QW1A 5JNRA 1PEAA 2L17A 3T6KA 3MA0A 3NNSA 4NV3A 2R47A 1YK0A 3QLVA 3OO1A 3LUKA 5KC9A 2V0NA 3QEMB 3UK0A 3M9XA 3C3WA 3O74A 4H3HB 3N53A 1DC8A 3FFWA 3QX8A 4Q7EA 3HVRA 4O1IA 3C3KA 4W5OA 2LBPA 3CTPA 3MF4A 4MAAA 2PL1A 2FTKE 3UUGA 3RH0A 1Z2EA 4LZLA 3F6PA 2JBAB 3CHYA 3G1WA 3TD9A 2JVKA 4RK4A 5HM6A 4Z0NA 4N41A 3A10A 1NTRA 1JHZA 5JNVA 1ZH2A 4L4UA 2RJNA 3CZCA 5DGCA 3EULA 1KRXA 2PUDA 4YGXB 4MR9A 3SY8A 1ZN2A 4XLTA 4JA2A 1GUBA 3S99A 1NXSA 3RVPA 3ILYA 3LUFA 4XXHA 5B3JC 5E3JA 3TO5A 3C97A 1MVOA 5CNJA 3EQ2A 2PKXA 1L5YA 1D5WA 4ZYLA 3CU5A 4LE1A 3O2QB 3QLUA 2PMCA 5TPWB 4N47A 1ZH4A 3IP7A 3IPCA 4D74A 4TN5A 2B1JA 5TQ0A 5JNUA 1HEYA 2MSLA 4MQFB 4P1ZA 5I4CA 3RVRA 3B2NA 3NHZA 4PYRA 1JX6A 4EVQA 4MR8B 4QICA 2XDYA 5C5EA 1EWTA 3H5VA 4JOQA 1PNTA 4RDCA 4TMYA 5BRJA 2MSWA 1F51E 2QXYA 2ID9A 1VKRA 1YVUA 1JDPA 1NATA 2QU7A 3CG4A 2HQBA 3MIZA 5F64A 4YV7A 1LK0A 1DP4A 1Y1LA 4KRFA 3KHTA 1YS7A 5TQ2B 4G0XA 4ZPJA 2QVGA 2HPHA 2PAFA 1Z25A 2PUCA 3HM9A 3F73A 4RU1A 3OQOA 2L2QA 4F11A 1GLGA 1C0EA 1USGA 5HSGA 3RQIA 1FSPA 1ZDMA 3OM0A 1P6UA 1VPWA 2RDMA 4EVRA 4F8JA 3KLNA 1RZRA 2LPMA 4WXMA 4HNQA 2MYUA 4MR7A 4N0PA 5FWYB 2BGGA 3GV0A 4W5TA 4IRXA 1KRWA 2PL9A 1YS6A 1QMPA 3A3KA 5JS2A 1R8JA 2JBAA 4TLLB 3KTOA 4RV5A 4Z4FA 3HDGA 3HO1A 2N9UA 2A9PA 3E61A 3N75A 4KVFA 5HQJA 1ZGZA 4TLMB 2A9QA 3OO0A 4JAVC 4Z9BA 3DLHA 3LMKA 1MB0A 2VYCA 4XAQA 2IPLA 2P4UA 3JVDA 2CWDA 3MYYA 4NQRA 5ABPA 4MS3A 1DCFA 1L5ZA 4YS6A 1TLFA 3QELB 3EGCA 3CG0A 3EJWA 4O5AA 2IPNA 3OMWA 3QX9A 3BRSA 3BILA 4RXTA 5HKOA 2MSKA 1D1QA 1JYEA 1B00A 2X7XA 4UHJA 4WWHA 4KMRA 2WRZA 2FQXA 2RJOA 3LUJA 2FN9A 3HS3A 4RK5A 3RVKA 5TPZA 3OQMA 2YHAA 3N6VA 1T34A 1NXVA 4LE0A 2CD7A 1JWLA 4L85A 4LE2A 3EAFA 1PNRA 1QPZA 4LDZA 4MQFA 1NXWA 4ZMRA 3I42A 4RSMA 4JB2A 1JLKA 1D4ZA 3O2JA 1DBPA 2FEPA 1VRVA 4MS1B 2PE5A 1TMYA 3FFTA 5IULC 3TMYA 4MRMA 3MMNA 5PNTA 1Z17A 4RY0A 2E4VA 3I09A 1WETA 3BRQA 4XFKA 1S8NA 3T95A 3C3MA 2WMYA 1EFAA 1F4VA 2CHFA 2E4WA 1D1PA 4D6XA 1APBA 1LBHA 3GYBA 5TQ2A 4G97A 4CBVA 5EWLB 2IPMA 3LFTA 3IP9A 5IEJA 1AB5A 4RKQA 3D02A
chains in the Genus database with same CATH superfamily
1Q12A 2AOUB 3Q85A 1D8TA 1DXQA 3FA2A 1G64A 2VXCA 4B83A 1T2VA 1RYYA 3ZTTA 2EZ9A 5AVVA 3K0SA 4LXGA 4QYWA 5DFAA 2NVUB 1IXYA 2QXTA 1N5DA 3TKAA 1O5IA 3ENZA 2G09A 5AI8A 3UC5A 3S2YA 1KMHA 2DETA 4QZVA 2HF7A 4RIEA 3RARA 2I4MA 2X0DA 4R3NA 3HYCA 4GZ5A 1IATA 2IEGA 3LXRA 3WB1A 1WMFA 4RFVA 1C2TA 4CF5A 3ZWAA 4CKWA 1VHJA 2GM5A 1FRNA 4Z9XA 3MSXA 2EBUA 3UK7A 4BWYA 4ZEVA 3C7AA 2D8MA 5T6BA 1AO0A 2WSSD 3MD0A 3TTTA 4YROA 3HMQA 3NIWA 2ZIZA 3TLMA 3U9SA 1OCEA 1WCIA 3GAZA 3ET4A 3M3HA 2RGYA 4Q12A 5IJ9B 1R0WA 3HPQA 4NCKA 5CJJA 2FEWB 1VI5A 4M1EA 1G5TA 3GDGA 7ABPA 3W8DA 3AW8A 4FYIA 4IIBA 4P86A 3WZ2A 4D8VA 5F3WB 4R8MA 4FEAA 3H2SA 2V97A 3RC7A 3KT0A 1RTKA 4PZCA 2VHJA 4ZAFA 1I3OA 2NZUG 1PQ4A 4FNOA 1TAUA 3I83A 3EZLA 3FHOA 2K4MA 3GRFA 3TRFA 1VMEA 1SUEA 2Z2XA 4EAQA 1BYIA 4M49A 4BNWA 1HNWB 2MYNA 1W46A 4NWIA 1DOAA 1XZBA 1H2ZA 1Z4QA 2IEYA 3LO8A 4KLRA 4TT3A 1KJIA 5I8PA 5JHHB 1O89A 1F8YA 2XV1A 4C3OB 1UANA 3OD5A 1EWRA 3AV3A 2YHIB 3PR3A 5JJCA 3NHKA 4AKTA 1EGHA 7AT1A 1TI7A 4JBXA 4WOBA 5L3SB 1QQ7A 3FFXA 1QE5A 4JKOA 4ND3A 3U5TA 3TIIA 4HKTA 1GUFA 3SEZA 3E81A 1U4OA 1GL6A 2NADA 4TV9A 2MR5A 2HNBA 2GN1A 2WQZA 5FI5A 3OTOB 4JR0A 3Q8MA 4U02A 2I2BA 3BFXA 4DN6A 4EW6A 5KTSA 1QQBA 2BSQA 5KVAA 3PR1A 2WKQA 2RK3A 2X76A 1PL7A 5I9TA 5MN6A 1FRZA 1RLJA 1LTHR 3H5AA 3HEBA 5IYZF 1CRWG 4Q02A 4GRIA 4RKWA 3H97A 2AOUA 1JJFA 2I0FA 5SZJA 2A8YA 4XM1A 4A6PA 3RPEA 1U0HC 1D3AA 2ZJ2A 4M76B 3N8IA 2NVUA 5LQDA 4DR6B 3NWEA 4XB2A 3SR4A 4G89A 4RPIA 4GKVA 4R9NA 1I4EB 4L5AA 4C6TA 2X5XA 2XJ4A 4EG3A 3HXOA 1JU9A 2G67A 2HMAA 2NN3C 3AF2A 2D4HA 2JPDA 4KI0A 4ML3A 4B09A 1DMRA 1T0JB 3BRWA 4RYLA 4S1NA 5E7QA 3T3IA 2ACKA 3FMIA 3W6ZA 3N0WA 1WZ2A 4LZAA 3KYBA 4UU0A 2HMUA 4HOYA 3BAZA 1G6KA 2I4NA 5AKKA 2VK2A 3BMNB 4NZZA 2A0YA 3UWDA 1SC1A 3DVAB 4UVEA 5TLSA 4HWTA 5IJ9A 3UJPA 1E9FA 2C5FA 4R8KA 2AFIB 4OQZA 4Q16A 1E2KA 1FTQA 2PUWA 4JGBA 4NBLA 2D5LA 4PQGA 2RHGB 3LXXA 1RWQA 2W6NA 3P2KA 5ITZB 4FU0A 5LYYA 2BM0A 1H94A 3JS5A 3O3NB 1QYXA 5U4QA 2GZRA 4PLCA 3U3RA 2AHOA 1PUXA 1QOQB 3FF4A 5E2AA 2I9KA 2EXXA 2WJGA 1Q15A 2IELA 4WRRA 1NGSA 4POAA 4MR8A 4KBGA 5EUQB 2PZ8A 2CUTA 3PFKA 1E7RA 1QF9A 1OSNA 2CB0A 2A88A 2PRSA 2XSZD 3FNGA 3WGNA 1TJ4A 2YHIA 1N7IA 2J85A 3Q3EA 4OPMA 3SHFA 5L3SA 3PEFA 3UJ6A 4PCAA 3SG0A 1LBEA 3FTNA 3BK7A 2X7JA 1QH9A 1DBWA 1G3UA 1QYRA 5DBHX 4HLCA 3U9TA 1OB5A 3GJXC 2E3JA 4TXNA 4NJEA 1GPMA 1K1EA 1HRKA 4YCSA 1QG4A 2QLNA 3EFOA 1GGEA 1LLFA 1OPRA 3WGHA 1AHPA 3WA7A 3B3AA 4QYTA 2VWPA 1HXHA 1K8RA 4XTRA 4ER0A 3COYA 2X1HA 1UKBA 2JLCA 3ETLA 3K0AA 4I66A 3V7WA 3O7WA 3FD8A 5H83A 2C61A 3DQZA 4IF4A 1QYDA 1F8FA 2KBFA 1PR0A 4TPKA 5IUNC 5BW5A 2NT3A 4TLCA 4HWPA 4BFZA 1XMIA 5BSUA 4ZZ0A 4RIGA 5K6AC 1HE2A 1Q7EA 4RZUA 1QH0A 4I19A 4KQ1A 1YNOA 1A82A 1MW9X 3H6KA 5EQDA 4EYGA 3QU5A 3L4BC 4PYNA 3T3GA 4FI3F 3WNZA 1C7ZA 3FYHA 3H42B 1PK7A 4AYTA 5E6RA 3V8VA 1UBLS 1Y7PA 2C8JA 1FTYA 2XVYA 3X1KA 2FMFA 4YEDA 4RNDB 2PL3A 2FSHA 3JPYA 4FUQA 1RNLA 1QH1B 3GNTA 2X4GA 4TLDA 1G3QA 5EIBC 1FDSA 4DQUA 4TTPA 2FUG6 121PA 2CFCA 1ZOSA 3U4HA 5F4ZA 2NPFA 2P4SA 3BH6A 2Q8NA 2WQ6A 3QP9A 1A8SA 4G86A 2I1QA 2WU3A 2IGBA 4EDFA 3HACA 4A8PA 2CF6A 4CQMD 4IP0A 2ZR8A 4Y6OA 1QFJA 1YC2A 1FDRA 1Z26A 2C5EA 3DSRA 4HNRA 8ABPA 5KSYA 1WW8A 1EHYA 5CG2A 4IVNA 1H5NA 1TUBB 4HGQA 4HLQB 3L2OB 1R66A 1BGWA 1JFVA 2HSJA 3U6BA 2Q1UA 4R51A 3CJRA 3M5WA 3W90A 1UOOA 3BC1A 2DERA 1NM5A 2QD4A 5K03A 2A94A 1QPBA 1XCLA 2FMKA 1CETA 1HE8B 3EZNA 2H2IA 2WOOA 3IQZA 4FE3A 1HT2E 2G1KA 3IILA 2IODA 3BRCA 1YRYE 4TLEA 4E12A 2Z6VA 1WTCA 1I9CA 1C3OA 1LTKA 4ZOLF 5KJEA 3TINA 3G85A 4ETIA 3AC0A 5K45A 1K2WA 3M5DA 3VNBA 5KNDH 4G65A 2QRVB 4JU8A 4ROSA 1CS0B 2OZLB 5FBLB 4DBVO 4YMLA 4D9IA 3FSGD 4M53A 4CEJB 3OCWA 2JZCA 2F1HA 4U5QA 1X7XB 1T1JA 3CISA 1QIDA 2EQ5A 3QXXA 4KYVA 1R0XA 1A4IA 3HN6A 5G4LA 5KYXB 2VUIB 3OZ7A 4HVAA 3DXFA 3PNMA 1F4LA 4GOND 2GHIA 3G2JA 4JB0A 4DLPA 4RHEA 5JWHA 2NU6A 2BD0A 1EHCA 4NBKA 1YOVA 4K9MA 5AM5A 4YRRA 1YBHA 4TL6A 3JAMA 2ZAYA 1NZDA 2EKPA 3B82A 2IY7A 3PHBE 3ZK7A 4BMPB 2V7QA 4P4TA 3FI0A 1U7TA 4JWKA 1JBQA 3RC2A 2QL7A 1UP7A 3Q3CA 1JIXA 1WBDA 1F7VA 2IDKA 2ZRLA 5KO2A 3KV3O 4FGZA 2X41A 3UKJA 4BJ6A 3RD5A 1N0HA 2CJFA 2Q6LA 3E9YA 3PIRA 3AJ8A 4DANA 1RSZA 3ZS9A 5BUCA 3O8OB 2IPOA 1J0BA 1MO4A 4EG0A 4IOJA 4JOSA 2YS6A 1AO3A 3RS9A 3N0TA 1GUZA 1U2DC 1R9JA 5EQFA 1L7AA 2WF6A 4I55B 1UMDA 4DR1B 3IAM1 3NIBA 2BEKA 4AROA 4L8VA 3GRCA 4NCNA 4RCVA 4CT0A 4OM7A 4CLRB 4D3SA 2HHLA 3KS9A 5CBPA 4OYRA 2XHEA 5DHAA 2AS0A 2EATA 2CC2A 1C9MA 4RF2A 3RQSA 3OJXA 3VNQA 5K20A 2ZJ0A 3AHDA 2WYHA 2D1TA 5JCPA 1TEXA 2PWZA 3KU4A 4FLFA 3C43A 3GBVA 2PZJA 3GLHE 3C6YA 3OP1A 3Q7SA 3BREA 3VPBA 4ZGWA 1UAYA 2WTMA 5KS2A 5ETJA 4WLEA 2Q3DA 3AR5A 2OM2A 2VQ3A 4IS2A 1BH2A 4KQ2A 4B5KA 4E2XA 1L1QA 4W5QA 3A2KA 2F2TA 3G0CA 4HEA6 5EFZA 1XRMA 2QIOA 1YMUA 3B52X 3I45A 1SKUA 5I48A 1KI9A 4FOSA 1SZCA 5CXSA 4Q03A 4BBAA 5DMHA 2Q4EA 1OH5A 3WQSB 3QBEA 2QRVA 3D4IA 3DYIA 3HMKA 2WIFA 2XYHA 2AMVA 2PHZA 1T2CA 3JD2A 3NTRA 1E5VA 4QXMA 1ATZA 5EZ6B 3OLVA 3S1AA 3QVGA 1QDLB 4I1RA 2IXEA 3I0MA 5BT9A 1OLXA 5DI9A 3MB8A 3AGQA 1JG7A 3D7MA 3UH0A 1XKLA 1UKCA 4IHJA 2AG0A 4OB7A 4XCXA 3S70A 2Z1MA 3VOAA 3O0DA 4UBMA 1WW2A 5HG0A 4OMUA 3IR7A 4JI6B 3LUKA 5ITVA 2GM3A 3TL2A 3KQOA 1R6XA 1KJNA 3O74A 3F5MA 4YJKA 1NDQA 1NR5A 2JLSA 5LFAA 3FFWA 3JASA 3FTEA 1WY5A 2VT2A 4HNGA 4DNOA 2EC5A 3B7GA 4W5OA 4TX1A 3HVHA 3WLQA 3URKA 5HDQA 2FTKE 2NQ8A 3G7UA 4F85A 3NYQA 4IH9A 1Z2EA 2P1DA 1Y7LA 2E5WA 4IRMA 1I1HA 2BTOA 3FFAA 4L28A 1WIWA 3SF8A 4AQYB 3AP3A 1TJ3A 3FTPA 1C8KA 3HNOA 3L0BA 3R5HA 4LI3X 1VA5A 4LRTB 4TS4A 2JVKA 4B32A 4BNKA 1P29A 1WF3A 3FOFC 1UZNA 3KJQA 3O8OA 2GR9A 1M0SA 2O8DB 3T7IA 4H4EA 1ZH2A 3K8ZA 10MHA 1Z4MA 3TB4A 4C2BA 2DT8A 4I55A 4OV6B 2CXRA 4G36A 4LWZA 1A50B 2AWOA 1XXHA 5FYDA 4K9QA 1MO2A 2O3SA 2GEJA 1M1ZA 2YQ5A 4FTWA 2WHPB 1IG0A 4IO0A 3S44A 3SFTA 3QW2A 2Z1DA 4G0UA 4NXMB 5E3JA 3BDAA 3GJTA 3TCXB 2FEOA 2XUJA 2GCIA 3P0HA 4K6OA 1Y89A 1TMGE 2CJPA 4UMEA 4I36A 1LPSA 1WHTB 1Z6XA 2H51A 5TPWB 3V8PA 3BB1A 4LXIA 3ZGOA 4JHXA 5HF5A 4CNBA 3TUZC 5A9SB 1H8HA 3OIUA 4NP6A 4ATNA 3MD9A 3HKCB 4PSUA 4AB1A 5HCNA 3D7SA 4BVFA 2P6PA 2HT6A 1P60A 2W83A 2VDNB 5EXDA 1QVZA 1FMCA 2LDBA 3GVHA 4RDCA 1KEVA 1PK8A 1SM4A 2JH8A 3CW8X 5AWFC 3I73A 4MNTA 4XVUA 3SHQA 5F7JA 4MKHA 1LX7A 4BKPA 3FYSA 3EXEB 2UYGA 2DH5A 3VVBA 2DFTA 3P5SA 1EUYA 5C1DA 3WK5A 2MINA 2VHEA 4Y9DA 4F5ZA 4H1VA 3STHA 3MILA 1HYBA 3TM5A 2PVCA 4MUYA 4B8ZA 4JU9A 5HJ5A 2X58A 4QXAA 4KNVA 3ABSB 4YASA 3U3DA 3PQ6A 1IWBB 2FU5C 3AVPA 3DV2A 5ALHA 3RRMA 4WE3A 3WQHA 4J0GA 4BNYA 5JFTA 4DA8A 4ZVSA 1N5JA 3K53A 4C04A 5DI3A 4YPVA 2ZZNA 3I37X 2V3CC 1GNQA 1J25A 4PZ9A 1P7VA 3AUFA 1N2JA 1X86B 1EM8B 1H6DA 4PZEA 1ADCA 1SVUA 1YS6A 5C34B 1QMPA 3QMMA 4EKYA 2W6OA 1MJNA 3NBXX 2FSSA 1GAXA 3PFHA 4PZUA 4P3OA 4JT2A 1UC8A 2C2WA 1RXVA 3FCEA 3CUTA 3H1TA 4FHZA 2WJ3A 2QRUA 3A3NA 5HIMA 4D9HA 1ZGZA 4DE5A 1ES9A 3EARA 1GGMA 3IALA 4CR6A 2P4UA 2CL0X 1BFUA 5K8CA 4XGIA 1BWQA 3LQYA 3C7TA 4OI1A 4EI2A 1X9HA 2HRDA 4BLOA 4GLOA 5LN1A 3GELA 5E1OA 1EFLA 3OZDA 1X7HA 2GA9A 4M21A 3SS8A 1Z3CA 1ZOIA 3R3JA 4A26A 5KNDD 3KE8A 1MHTA 3EXG2 2RJOA 5JY6A 3KZVA 2BMEA 2QVLA 2OO5C 4MYHA 4LF6B 1TM1E 1FLAA 2IHJA 3NW9A 1LPBB 3E1SA 3CLVA 4UXIA 3H2YA 3K7EA 1TU0A 2YVAA 2I76A 3HBAA 2QVXX 4HDCA 5K0SA 1PNRA 3NOQA 3HJAA 3AUJB 3TOSA 3WGVA 4OK6A 3T5CA 4ZYXA 5K2OA 3GH3A 4OXYA 1OJLA 2I6UA 1U8YA 5A9TA 3AW9A 3UXHA 2P2LA 1JLKA 1QE3A 3K1TA 3PC4A 1XZ8A 1ORHA 1SELA 1DAFA 4RH1A 4TVOA 1IY9A 3PQ7A 2NZ8A 3C5VA 4YK7A 3SX4A 1BYUA 5IBCA 2BFFA 2FYTA 3CEAA 1LQ2A 3GMSA 2Q5EA 4QTTB 5ALQA 2PSEA 2B0JA 4DCTA 3EXEA 2DFPA 3ZS8A 5TF0A 1WV0A 3PGJA 5JRDS 4RMIA 5AVRA 4PG8A 5EJAA 3UHAA 2RHWA 2EJVA 2JHGA 1E94E 1SJ9A 4XUCA 1P74A 4FFMA 5BSEA 1E0DA 3VZRA 1FW6A 4Z8YA 3DE1X 4MV7A 5GIPE 3JXEA 4WLNA 3ZD8A 3ZN2A 1CQJA 1DV2A 1ZWLA 1ZD3A 2FSGA 3QWAA 3TUJC 4HGYA 4XI9A 4YT2A 3ACDA 4QRDA 4EFKA 1HDIA 2HB6A 5ECYA 1J0CA 3L92A 4FYKA 1FQJA 3EY4A 4LZJA 2JA2A 4N6OA 4N7RA 4OLHA 2HMSA 1AGNA 1O97C 2JFXA 3KKEA 4PWYA 1EM8A 2PLRA 1EVEA 1WXHA 1VM6A 2HK9A 2HSGA 2NU9A 4G41A 4MUFA 4O2AA 2QRPA 4C07A 4Y9RA 1NXPA 1WRBA 2XOKD 2Z04A 3GGGA 5MF6A 2O7VA 4O3MA 1KPGA 2ZBQA 3Q4GA 1JAZA 1FLNA 1T36B 1O58A 4ANFA 4D97A 1VHLA 5C37A 3OLQA 1UF9A 1YV9A 3LOUA 3OE1A 1TM2A 5B1IA 5JY1A 3FJYA 5LQJA 4WNIA 5BY2A 1CCWA 2QA5A 3KXLA 3MTGA 5J4LA 2BBOA 3CRMA 4PFQA 3H0CA 1N2HA 2PEZA 3WK6A 6AT1A 5KDOA 3LQKA 2ILVA 3Q7RA 1SVKA 4QQRA 4ARSA 3U4QA 1JFTA 3QUCA 4B31A 4WLVA 1WUKS 3QY9A 5AK6A 3V4LA 2IDZA 3USCS 4ZYUA 5AVXA 4IUDS 5AHRA 2HCRA 1RPJA 4G37A 5JECA 3HR7A 1Q1NA 5AK4A 1O0SA 4R3WA 1J20A 4TS3A 5LL6P 1FQKA 4JNCA 4YP0A 5EKUA 1QTIA 3X1JA 3OETA 1VI2A 5GWXA 3KSAC 3VZBA 2OGSA 2QPLA 2OK7A 4KLAA 1XZGA 1XVVA 4C0XA 1TK9A 3FGOA 5BN5A 4IXWA 1PNQA 4IZ6A 4LV6A 2IZ5A 4ZU1X 4ZU3A 1ZXBA 2BGWA 4S05A 1X13A 4Z1OA 1N5LA 1RXCA 3H5TA 2BGMA 3B60A 3KR1A 3KP1A 3F9CA 5CDYA 3WWOA 1LRLA 2C98A 4F3KA 1BWRA 4GR9A 4R1NA 3K1ZA 4Z9FA 1QFSA 2F62A 4MPJA 2G17A 5JI2E 1XMXA 2WHEA 2ZSDA 4R84A 1HLFA 3MAGA 4EBFA 1VIDA 1WXQA 3LZ6A 3NPMA 4IG4A 1XQXA 5BMVA 1ODIA 3COSA 3IT1A 5KSPA 4JUDX 2CFOA 2WR8A 4MRRA 4O25A 4PBTA 3HYTA 4IV8A 4P7GA 2ON6A 3ZVRA 3MCZA 3QEMA 3CSDA 1AIPA 2OFOA 1SBIA 3P52A 3NVKI 2ZIXB 4EYSA 1EJ0A 1HE3A 1KZ7B 4PS1A 5T8KA 5KSOA 5A6SA 2CV1A 1LLDA 2TMDA 3SYLA 2Y0EA 1YH3A 2RH5A 1AXRA 1CF2O 3KDSE 1R8XA 4BUCA 3H7AA 1PE0A 1RAGA 3NTOA 4H18A 4F86A 1QE0A 3S2IA 1EFRD 1JG4A 1JHAA 4G1VA 1E96A 2FW0A 2ZAMA 3RBZA 5E9AA 4EQZA 2PH5A 3IR5A 2XUPA 4F4JA 2BKXA 2P62A 3GLRA 1OZAA 2QTGA 1G6OA 1SN7A 3QJ5A 1G7CA 4A0SA 5BNWA 2IS2A 3WWZA 4CQNA 2AXQA 4M1QA 2V7GA 1WG8A 3CE6A 3V2IA 3TTVA 4LA4A 3L01A 2ZYAA 1R8QA 3IPXA 3NT4A 1JR6A 2HZBA 3IS3A 3WI7A 1M0EA 2CUZA 2AXNA 4KOAA 3OZAA 1E7QA 1V39A 1DT5A 1ISMA 1UBCA 1NC3A 1NIJA 3AEXA 1FXWF 4M60A 1CEQA 1DAGA 1CE8A 2CMGA 4CT5A 4KMSA 1ODFA 2HXSA 4WJKB 5DGIA 3LPDA 2OLEA 1U0FA 1E1NA 2GJ8A 2ZAOA 2QENA 4IJ6A 4WA8A 5H0IA 1O94D 4O2LA 1HTTA 2ZUTA 1GTVA 4YJ2A 5IVDA 2ZSAA 2D5AA 1XZFA 4HD8A 4QPPA 1BQEA 1QK4A 1RTTA 1JHPA 3AUKA 3QEKA 4L0QA 4WXEA 5JAOA 3I6IA 1AUPA 2CHEA 2R8XA 3AESA 3FWNA 3K2IA 4NE9A 5EJ2A 2DR2A 4XM0A 3DLBA 4PSKA 4IZIA 4HJXA 3IKMB 2P9ZA 4EUKA 2H9AA 2VPXA 3R3YA 4MUKA 5K8IA 2FHPA 1ZITA 3DWEX 5IRCD 1PJAA 5JASA 2J9FB 2QBYB 2V7BA 1YQTA 5HGXA 3EFBA 5FWNA 2G0TA 2JGDB 1POXA 3KSUA 1WVMA 2X42A 3QV2A 4MB0A 3MS7A 1Y6JA 1IPHA 2PGIA 4NATA 1M6WA 1DEKA 2H1RA 3JATB 5AM2A 2ZIXA 3NI2A 3CUEF 3CH4B 3PHLA 4O4JB 5CNKA 4CL3A 1RHKA 1XEFA 2QT9A 2WFAA 1U8UA 4F2WA 3GMDA 4PE5B 1S2MA 1ZXXA 1DAMA 4NBWA 1TJYA 3MTDA 5AVZA 2A9OA 2XXJA 2E1RA 1U0SY 2PT7A 4M55A 3WSVA 1GCUA 4JELA 5DBEX 3LOPA 3LVBA 4XWKA 2HHHB 2P2SA 3QUQA 3EEYA 3P9CA 2HU7A 1Z2PX 2ZDHA 4QVIA 1DRVA 3NHAA 1XTJA 3UUFA 4JYZA 1NTOA 2IXFA 4RQBA 1Z18A 2RHMA 1F5SA 2QMYA 3C7KA 1D0VA 3HYLA 2ZREA 3QE2A 3U80A 4CM3A 2FMTA 2LZ0A 2QK4A 5EINA 4BASA 2GA8A 3L8MA 3IP6A 3HL4A 2QAGA 5DZSA 4QNMA 4JEHA 4CCSA 5DTIA 3JRWA 1ZLYA 2UVQA 3C1AA 1Z74A 4EW3A 4OJKA 5B6IA 5B7QA 2ZTSA 3BD8A 5IFLA 1NN3A 2II6A 2PA0A 4P35A 2FLKA 1UPBA 2HMTA 1ZN8A 1II8A 3KVYA 4QPCA 2G7MC 1MQAA 1VJRA 5AJWA 1VI6A 1U02A 2XE6A 3X1XA 2PWPA 4QGGA 3ZI0A 4B4WA 1U98A 4UBNA 2J5RA 1U0EA 3SZLA 3NVDA 4L2IB 2OHFA 3IPLA 4MS3B 2B83A 3WC4A 3P9NA 1NXXA 2G9VA 4H6PA 4DQDA 3VTZA 3F7TA 1E1RD 4Z9AA 4EA9A 5JS1A 1S6YA 2X6RA 4H59A 4KE9A 4F9TA 3EPLA 3MHTA 2DWQA 3X44A 4MWSA 4KI7A 3PJRA 1XU9A 1E6LA 2ODWA 4TSRA 4LGYA 2JAQA 4OQYA 4YRPA 3BMQA 1QNFA 3OCUA 3LDFA 3O7MA 3G89A 1HYQA 1YHYA 3LVRE 4DZZA 1QLHA 5ALPA 5MFPA 3RWBA 2QBYA 4B82A 1BMFA 4EEZA 2F3PA 3F3SA 1WXIA 2JGDA 3BE8A 3I01A 3PQCA 4ENPA 1JUDA 2P3OA 3LTEA 1NAHA 5K0CA 3ESXA 3BDVA 3OIFA 4LEIA 4PG7A 1KXZA 4DUPA 1MG5A 5KAMA 1YK1A 3ZIUA 3FZQA 4BEJA 3B1ZA 5EC8A 2WZCA 2JC3A 4J7XA 4ZT7A 1XA0A 2AFHE 3JATA 3K4HA 4MVYA 4QNRA 5ULLA 3QMPA 5JROA 3WBJA 5IBQA 4FFRA 1M1UA 3QIAA 2R751 1KTIA 5I51A 3AB3A 1K08A 4CUKA 2VA9A 1TYAE 2P4EA 3ANYB 3CRZA 3N7UA 1YT5A 3W8RA 1PVVA 4CWAA 1WDLA 2BN4A 2X14A 3JYLA 3P8ZA 4G01B 4QX6A 4GQIA 5EPOA 2GPAA 4AD8A 2FRDA 4F60A 4XVRA 4HV4A 1A1VA 4JDUA 2HDOA 1YRBA 4DVGA 3F4LA 4BLPA 1B6RA 4OIFA 5TV2A 2ZYWX 3CVVA 3GLHB 4BUZA 4LGCA 1Q0LA 4Y2GA 3TSWA 5BRAA 3SZRA 4KXVA 3EBPA 4LNUB 1DWPA 2VPWA 4KP7A 5AJUA 4OHPA 2WT9A 4A4DA 2XOEA 2Z09A 3F8SA 4FSXA 3K92A 4OAOA 4G8DA 4UUQA 5D85A 3V42A 4Q1AA 4X91A 3T9AA 1TT5B 2F59A 2HADA 3NDPA 4O5OA 3LFUA 5FI0B 2OV8A 3X2EA 3C8MA 3GUVA 3EVZA 3RRXA 5CCDA 3V4PB 3CX3A 4W5WA 5TSDA 4S35A 1SOMA 3WKDA 1SEVA 1M1YE 1AK9A 2OGUA 2DKFA 4X6UA 4MV4A 1KYQA 1N2SA 4NU8X 3UPDA 4YAUA 3E7FA 4OXQA 3WX0A 4IQFA 5WRFA 4AG3A 2FPLA 3WTCA 3DZCA 3HBMA 2Q3EA 4QOFA 5UKDA 2O1XA 3ECSA 2RIRA 3DO8A 3HBLA 4HXFB 1GAQA 1N8SA 3DH0A 1ZJYA 2X22A 4MKRA 2ZB3A 1NM5C 1YRAA 2I3GA 2XUZA 3JD1A 2HUPA 3PXBA 3USZA 1RRGA 2Z2YA 5TQJA 4CDNA 4GQAA 1OYYA 1SURA 2JAUA 1IY0A 1V8FA 1DIRA 2F9MA 3B2QA 3MLBA 4H1HA 2X1LA 4MAFA 4P4NA 1A7AA 3HJNA 3LH5A 4P4SB 5KOYA 1G5HA 1XU4A 4I6GA 5A1TA 5LU8A 4CV1A 4B6QA 2Q2QA 1UPFA 1I33A 1PDOA 4Q4LA 2X3FA 1UIRA 1BFKA 2EIXA 1FC0A 4WSOA 4FW8A 3QXSA 4ER3A 1DKPA 2G71A 2FUG1 2VNAA 2CK3A 2QTBA 3EZ9A 2P9CA 3LGAA 4BE9A 5EWJA 1I13A 3F6BX 1G2PA 3ERCA 2W90A 4HY3A 1XFAA 3T9DA 2OCYC 2XB9A 2GPWA 1R0ZA 3KWLA 1PEAA 1RZVA 2EKQA 4CFZA 5JSZB 5C9ZA 2YX1A 2AUTA 1P1KA 1QRDA 3LIIA 1SK8A 3OZFA 1TJPB 3D5TA 3BWCA 4AJ1A 1LU9A 3PL1A 4AMZA 3QMVA 4PPQA 4ASUA 1ESZA 3ORHA 3V6MA 3GLHA 1G21B 1U2ZA 1QRAA 2VSOA 4Q7EA 3VJMA 1X7ZB 4QEDA 1CY0A 4WLOA 4LNUA 2HRQA 3HA2A 4M0UA 2PGAA 3VYUB 2WG0A 5KOHA 5TR9A 4LMBA 3AI1A 1TX4B 3DLIA 4HTFA 3F6PA 2RAPA 3COPA 3ZU6A 5A3RA 2NZ2A 3UMJA 1WUTA 4H4CA 3DEIA 3HWX1 4GEKA 1FTWA 5K2MA 1UP6A 1QFYA 2QV7A 5BQPA 3IJEB 1EIWA 5IHPA 5JNVA 3IO5A 2PLFA 3AHEA 2Q5JA 4MUJA 2FWIA 4R1TA 1LB1B 5DGCA 4Z1MA 1YZQA 3PNLA 2HMYB 3SY8A 5BVHA 1J70A 4I6EA 2OVBA 4BQPA 4ENTA 3HWRA 4QU8A 1AHIA 3KKQA 3O82A 5DW3A 1WNTA 1L4MA 2DTEA 4FB5A 1DUIA 2CXPA 1XNRB 4KH0A 4HCJA 5D5PA 4GMGA 4E5YA 3KYDB 3ZCQA 4HDRB 3PGMA 3O2QB 1NUQA 1RJ9B 1V5GA 3Q6IA 4PCVA 4A8JC 5EJ5A 1WR8A 3VX4A 1YQUA 2F3QA 2VBGA 5LIPA 2HWXA 4Q4JB 3R9XA 5IJWA 4RGBA 2I1VB 2EJCA 4LYEA 3WLPA 4K03A 2GNPA 4LKRA 4EY4A 2XDYA 4BNIA 2XRYA 1XL1A 1KETA 4TMYA 2H3EA 5CLQA 4HQ0A 5DYNA 4D0NA 1N5IA 1H9BA 4RGQA 1Y9EA 4JEIA 1QIMA 3LHSA 2DC1A 4U5XA 1CUZA 5BN1A 2R7KA 1F51E 2PY6A 1T1IA 2YNMD 5DHSA 1VRWA 4BATA 2VG8A 1LWNA 4Q1BA 1M6VB 1Y1LA 3RHFA 1DWOA 3OEYA 4P31A 3W6NA 1IXSB 4E4TA 2QVGA 3OOJA 1DLIA 1SBQA 2P4HX 1AQIA 3N2KA 4WVFA 1IDOA 3UJHA 5ALFA 1NUUA 1VL1A 4MZXA 4FZRA 3QJYA 4I4TA 4N48A 3MT9A 4HEQA 1USGA 4ARZB 5EHXA 1JHUA 3VPGA 2FWRA 1LPAB 1P6UA 2ZRNA 3O73A 3OZXA 4JVMA 4ZVPA 3RNLA 3H17A 4FSDA 3RT9A 3CWZA 5KYWB 1X7ZA 4GBGA 4XFJA 3QUBA 4LSGA 5EXTA 5CB4F 4CIBA 3EK2A 4HEHA 4NH4A 5H68A 4MEBA 4URHA 4HEA1 3L0SA 1CR2A 2WVGA 3K6JA 4BBPA 4DPLA 3BCSA 1T1RA 2XT6A 4TLLB 1TTPB 1X1DA 3HDGA 1ULTA 3U7IA 1JVBA 1K3TA 4TXHA 4JAVC 5IBRA 4LPSA 5ENDA 5C4IA 421PA 3FOBA 4MAMA 2CWDA 3WLOA 4H7FA 3H2HA 4R2MA 3ZE0B 5K0BA 1DCFA 4HN4B 3ZGVA 5KNBH 4WKNA 2F00A 2CT8A 5KTTA 1E20A 3CW2A 4CEIA 2PAAA 2X7XA 2XCIA 4U7WA 4OHKA 5F52A 2AN1A 2Y4OA 4KX3A 4KN5A 3ROQA 3UYLA 4AF8A 3LUJA 3TPZA 2A1UB 4CN9A 1HI9A 3KYDA 1K3FA 3OQMA 2WZBA 4HDRA 2C83A 2VJDA 3THXB 5FAXA 3AVWA 4EKDA 2H52A 2V6FA 3M49A 1ND6A 2PZLA 4BZQA 1T13A 1CEEA 3EAFA 3AT1A 5CA1B 2IIQA 4OP1A 4Q4JA 1A8PA 1XQ9A 2ZUDA 5A4JA 2BELA 3EE6A 5LDGA 3DAPA 1KAOA 1U0NA 4C21A 3M4ZA 4NG5A 2LIPA 1AKWA 1RM3A 4BO2A 2PE5A 4C7OA 3TMYA 3DMDA 1JIJA 3PWZA 3AEQB 1PI3A 1PBTA 2I29A 2XYPA 2VPQA 1M9NA 2BGNA 4TN1A 3A1TA 2A6PA 3K9LA 3EMBA 4G6ZA 1HC7A 2JI6A 1UCFA 4CIXA 4QOEA 1DEAA 1D6SA 4D6XA 2FX2A 1CD5A 4XIIA 4F56A 1N6HA 4IDQA 1UWCA 4CETA 5C1IA 4D8XA 1OT5A 1IBCA 3EGXB 4EATA 1JQ5A 1KO1A 3DOIA 4M3NA 2WIKA 4M98A 3LQQA 5G40A 3FFBA 1V95A 1GSAA 3L8GA 2NSYA 1HH4A 2ZRHA 3NKFA 1E9DA 1JP7A 1R3DA 3P7MA 3S8YA 4YJFB 1PVOA 1ISIA 3GROA 5C7IO 3ON5A 3DR3A 3GUZA 1E2QA 1LBSA 5CBKA 1NU6A 2OV6A 3D59A 2C0PA 2Q1TA 5DNAA 1Y48E 2GEKA 1KVUA 3FWKA 4TWBA 4K0KB 1SWVA 1T8YA 2C9ZA 4CTNA 5IZCA 3VFDA 1FFSA 2OD2A 4NYJR 2HZ7A 1WCYA 1JDVA 2O2IA 3PXXA 1D9XA 4ND1A 5BYBA 1QC5A 3V4SA 5I6DA 1VB3A 2P6RA 2QVZX 3T7SA 5KX5F 3NETA 3DOEA 3T7TA 3ZV3A 2JCYA 3Q9NA 4I6JA 2ZTHA 1IZ9A 3GEGA 3M6UA 3QG5A 4BXOB 4P2GA 3F6RA 4IEFB 2FHSA 5JCJD 3DMRA 4P08A 5THXA 3CMMA 1AUQA 5IWCA 2CN1A 1C3VA 1N5OX 4MDYA 1LV7A 2J09A 3W06A 1J90A 4KWIA 1ZIXA 4Q3EA 3MJVA 1QZUA 2A7QA 4ZXPA 4B6OA 2OMEA 9ABPA 4NU5A 5CCEA 2VDUE 4OSEA 1E6CA 2PEYA 1CYEA 3PD0A 3FLMA 3ICPA 6CHYA 1AA9A 1TGVA 3BRWD 2HLDA 5LP6B 1AKEA 1V9CA 4D41A 5DKFA 1VJ5A 2CZCA 1RYBA 2C8LA 1D04A 1JAXA 3KXKA 2GAFA 4UNRA 1YSCA 3X0DA 4KHZA 1FW8A 3OA0A 4JOCA 2PUBA 4U6NA 3Q10A 2IUYA 3K0HA 4U7PB 1HMPA 4K9KA 2Q99A 5EERA 1LV8A 5ENVA 3SK0A 5EMLA 3QU9A 1JXAA 3JQAB 1P6XA 3DTNA 1RFLA 1PLLA 2WUDA 4DHEA 5ALMA 4A91A 4BFCA 3Q7PA 4WI1A 4XOIA 2N42A 3H9QA 3K6SA 2KW5A 3G2OA 5IVKA 4AJIA 1KY3A 5BR1A 1TCVA 1TIBA 3DMYA 3DBIA 3Q11A 5JYBA 2R25B 4UTPA 3I6YA 4AJ2A 1E2NA 2IYFA 4YJFA 1VLMA 1OI7A 4CV2A 4XWWA 1WXXA 2R48A 2WOJA 5B55A 3QY0A 4BN0A 4HZIA 2D3WA 2Z9DA 4LVUA 1PIWA 3QKRB 4C03A 4RK6A 5JXIA 4KREA 3JAKA 1PJSA 2JCGA 4TWIA 2ERXA 3V33A 3RYHA 3MJEA 3NM6B 4US2R 1E4EA 1XLVA 2IP1A 1N8TA 2O8CA 4A1OA 2GT1A 1FRQA 1X1CA 2GI4A 4CMJA 3BN3A 1V6CA 2QRQA 3I1FA 3NYWA 4DMKA 3W1EA 1Z5WA 1YFKA 4Z99A 3IRVA 2VJQA 3ICOA 4G5YA 2RGRA 3V8QA 2B5WA 3WL4A 5KTKA 1YI1A 1E6MA 1L4GA 1QFXA 2W7TA 2EZ4A 1ZD8A 4AMVA 1USVA 7MHTA 3G8CA 1GUAA 4W4TA 5EFOA 4C0KA 3VHXB 5LZ8A 2VQFB 1KDRA 2OC4A 3QFHA 4W63A 4ZCTA 3AF4A 3B70A 3L6CA 4ITVA 3ZWXA 1ADGA 3DBVO 2GPJA 3OZBA 4LF7B 2JW5A 5F2EA 4W1QA 2MSEB 4BLTA 5JD6A 2ZJFA 4R1PA 1KH1A 1C8LA 2O20A 2BL4A 3DEYX 4FYHA 3D8UA 1DO2A 4CIYA 5LM3A 4I50B 2WK1A 4TQ9A 4EFMA 1K68A 3B6IA 2C0CA 4DMLA 4QOHA 2PUEA 5I7HA 5SICE 5JH7B 1G5RA 3LCUA 3EVDA 4XQ9A 2H18A 4BZPA 5AVSA 2LVBA 1HURA 1U8EA 2R85A 2XDAA 3HN2A 1DQSA 2VJMB 4H31A 1LQTA 5JMPA 4KIWA 1TKAA 2C4UA 5T8KC 1HWYA 3GLFE 1ZGGA 4R7ZA 3W8FA 3C3BA 5BURA 2WM9B 2OK8A 2QTVB 3P2MA 3QBJA 5DHRA 3T9CA 2IEIA 2OCBA 1CZRA 3JZMA 2NYUA 4JFAA 4Q00A 1PD1A 5BXYA 1XJCA 3B1YA 1KDOA 2VJNA 2APJA 3D8RA 2HQOA 2VHVA 3IKLA 4K9SA 4BVGA 1LY1A 3CVXA 1KR2A 5CFLA 5C52B 2EW1A 4MITA 4RULA 4AQ7A 3A2MA 3AF0A 1P1FA 1XTSA 3F5SA 5D1NA 4G4SP 2B4AA 2CXXA 1TFRA 1B1AA 3OEWA 4WUVA 5EXEA 3WYDA 4CL8A 4PG4A 3EF3A 3CNLA 1SR8A 4AJHA 5LDDC 2HI0A 3GB9A 5H9VA 5M7EA 1TIKA 1KVSA 1U3FA 3KZXA 3QKRA 3UEOA 1C0LA 1P8AA 5E7IA 3K20A 3EC2A 4ZA2A 4R83A 2ECFA 2VEDA 3OKPA 4RVGA 3EA5A 1USKA 2JKZA 4N40A 2RHLA 3SHVA 2VF5X 4XE5A 4CIVA 1VJCA 5H7XA 5JNSA 2P6NA 3KFXA 3QLEA 3R3HA 1J8VA 4WD3A 1ZOLA 1TZBA 2KWIA 4KUHA 4LC9A 4OJMX 3COJA 4KNYA 2ZRAA 5AJTA 3FAZA 3K9CA 3VOTA 1O7JA 2NGRA 4KGVA 2NVWA 3SX0A 4U3JA 4BEVA 1PFQA 1LDGA 2CNOA 2ZIUB 2HBQA 4GHWA 4Q9KA 4YLYA 5IYZA 4JL5A 3DWGA 3L7CA 5B12A 4CT4B 3FRIA 2BMVA 4OQQA 3IOCA 3ZHTA 3ZZUA 4FD2A 3NHUA 2JBWA 5ALUA 3UVEA 5LMCA 1F2VA 5EP3A 2Q4OA 5EZ5A 3FPFA 1J5PA 4OATA 2QTTA 3O90A 4QM6A 1J2RA 4R40A 1RHMA 3KCNA 1NMYA 1HEUA 2HCJB 5DM2A 4BY9E 4I50A 3RSQA 2I6FA 2J5BA 2IRWA 3OLYA 2PV7A 1HQKA 1WSWA 2BC9A 1YB5A 2VJOA 1TYDE 4E2ZA 1XZMA 4KMMA 2VDJA 3CO0S 5IJXA 5JH7A 2UXBB 1CDEA 3WLFA 4LCBA 3CCCA 1Z5ZA 2J5KA 3I04A 4OF4A 1NONA 1YQDA 1BROA 4R7TA 4K6FA 2O8BB 3LRTA 4AO8A 1XRQA 2RGNC 3WYBA 3LT4A 1KAHA 3HHEA 1NASA 4BNXA 1PSDA 1R3UA 3C3AA 2W58A 2QTVA 4JP1A 4R16A 1U2GA 2VA8A 4RHUA 4OLAA 1DLJA 3BIJA 4BVHA 1EUDA 1T15A 2YICA 3ACBA 4UMDA 1I01A 2BGUA 3LX6A 2NT4A 1RAAA 3D8BA 9MHTA 3HBFA 4XYBA 3GJ4A 1Z4NA 3JVEA 3KJFA 4QLOA 3ZX5A 1XQWA 4YWJA 3LUAA 2VRCA 3TTYA 3A3PA 3BJIC 1SC3A 2ESRA 3NGXA 3P32A 5JVDB 3RYIA 4TSFA 2YIDA 1AS2A 1ULSA 3VBEA 5B1EA 1JIKA 4KO2S 1BHSA 4PIVA 4A6DA 2QZPA 5I9MA 4G3XA 1T5OA 5LDHA 1PU2A 1RHJA 2Q9BA 1Y82A 1ZI6A 3LWBA 3R76A 4NNPA 1TRKA 2J9YB 5H5JA 2FZKA 3IHLA 3NUQA 4JJ4A 1ZIYA 3ICVA 1WS6A 4JYMA 4MIYA 3KEQA 4UVGA 1JEOA 2GPNA 1XN4A 3NT5A 1OA1A 2PZAA 3ML1A 5TMEA 1BG6A 4CI0B 1B23P 2PN1A 3CNNA 2BFEA 3R7WA 2P2ZA 2AFHA 2XGGA 5NLLA 2C4MA 3EGVA 1KEPA 4KV7A 3RWMB 2HV8A 2Y0BA 5DCYA 2YV4A 4UCXA 2PMDA 5E1MA 3TLBA 5CXXA 4B85A 2PKQO 4E11A 5BV7A 4FGJA 3P9PA 4GUDA 4L22A 4LJRA 4PHTA 1XA3A 2W2XA 4BNJA 2F3UA 3I3OA 2HEGA 4MS4A 1YZ3A 3LKVA 5CYPA 5D84A 5EZYB 4UTZA 5LQSA 5L3VA 5DULA 5IZ4A 1GDTA 2CE7A 1Z06A 1RRCA 3V2HA 3VMFA 5AESA 5HZGA 3K9FC 3KV1A 5J23A 2ZYGA 3DFMA 1CY6A 1ZD5A 4RABA 1YQWA 2VJYA 1CRZA 1FVFA 2C2ZA 1RXSA 5FQOA 3GEBA 5E4JA 1F4PA 3OKAA 3QXCA 2X7HA 1QJCA 3IBCA 4JJ8A 4MRVA 2WMOB 2DPYA 2XCTB 4EG7A 1ZH8A 4HQOA 1MJFA 2J08A 3EA0A 3TAHA 2ZQYA 1S2OA 2FRVA 2R7AA 4OU5A 3QXGA 4RXUA 2Y1GA 3EZ2A 2X8AA 1FLVA 3QE0A 2TS1A 4WW0A 1ZS9A 4DRYA 1FP7A 1Y3FE 2ZE8A 1IVNA 4I3GA 5HQTA 1TZ2A 5JAMA 4BE4A 3T5AA 3U48A 4HHEA 4GGPA 2QD2A 3DUWA 1M1YA 4DILA 4DLVA 2C31A 3WWCA 2FFBA 1KERA 4DUGD 1U9ZA 2IC5A 1V5FA 4XASA 4B47A 4ZAGA 4BEBA 1HMYA 2J32A 3QBTA 3SF0A 3ST7A 3IOEA 2I3DA 2Q6KA 2VP0A 3K4PA 2B0CA 5F5LA 4D3XA 2IYZA 1JPJA 4E03A 5SYAA 1EA5A 3MA0A 4OSPA 4GR4A 2WF9A 3GOHA 5LOVF 4DCOA 3EIXA 3PEYA 1QU3A 2LD4A 1ADBA 1T8UA 2VP2A 2ZQZA 3SP1A 4V2UA 5A2GA 1GN9A 5AJYA 6LDHA 2ONKA 1A5AB 1I3MA 1HTWA 2NZWA 1U9CA 1KR5A 2O5VA 2QTFA 3G2PA 3JTMA 5I9BA 4BKMA 4ZHQF 5HUJA 2EFEB 4DV5B 3UWPA 1B93A 4JQYA 1XO1A 4AUEA 4WASA 2P69A 2J5QA 4NAVA 5C18A 4UASA 2SBTA 1KL7A 4FQ5A 2QDKA 3RH0A 5F98A 5G3ZA 4NG4A 1MX5A 4B4DA 4L08A 1DKLA 3KO8A 5HE9A 3RLIA 4PYJA 4MVWA 1CQXA 3OF5A 1TNDA 5IS2A 4BX9A 1U7XA 2FPGA 2B5OA 3JQCA 4DLLA 4NCJA 2HD4A 5L6MB 2RJNA 4ZV7A 1E2UA 3EULA 1EDDA 3OD1A 2HBYA 4LMPA 4QU5A 4QXRA 2AZXA 3PI7A 1TEVA 1G8PA 1RYEA 5IN5A 4JA2A 1GAJA 3VSAA 2GAIA 1BZYA 3DOCA 3EZFA 5HF6A 3VHQA 4B4VA 5KPDA 2Z0MA 1W5AA 1SQ0A 4B0PA 1ZVMA 2XTNA 4J1SA 4Y1FA 1MVOA 2WFZA 4IWXA 1XZPA 4YUYA 2A1TR 3SGLA 2PKXA 1FJ2A 2RAUA 1XKTA 4LXTA 2PRYA 3NOXA 2HU2A 5KMGB 4PU0A 1P0CA 3E82A 1AKYA 4I5FA 1Z29A 4N47A 1Z2CA 2EDCA 4BUJA 5C1BA 2H7VA 2IIVA 1GGVA 5AQEA 3IB3A 3QHPA 4F1JA 1O95D 1VJ0A 2O06A 4N1AA 1P1RA 3QXHA 2AI2A 3HO8A 4JJAA 1EVKA 5IDWA 5LNK6 2CYCA 1U3VA 3B2NA 1XUOA 4ZD6A 3VC7A 1ZM4A 2P5SA 3PWKA 4A2QA 1LCIA 1E66A 2QM8A 4MQLA 2O4CA 1I5OA 4WFKA 1X70A 5ILQA 5ERGB 1Y9AA 3CKYA 3L8ZA 4IOLA 3NBAA 1EBUA 2ZI6A 3JSAA 3QYJA 4IDGA 4RMHA 5EXSA 3AVOA 3E1KA 4J1TA 3SM3A 2MSWA 2REQB 4XLLA 2B6HA 3THYA 5EJFA 4GE3A 1AGXA 3MINB 3CPSA 3ZR4B 3GLVA 3MIZA 4NKRA 1DO8A 1DP4A 5J5AA 2G0AA 5K01A 4W1RA 3NC0C 4V03A 2IH4A 1ENZA 1RQLA 2AEMA 2HPHA 1F9AA 1Q2XA 4K2AA 4ZEMA 1F2UB 4FS8A 4QASA 2WLSA 1H3FA 4RU1A 3G2QA 3SEFA 4EJ6A 2P9FA 3EMKA 4F11A 1FSPA 2HLPA 1NUAA 4YAFA 3E15A 3GEEA 3FVRA 3JD0A 1IOZA 2MYUA 4GXTA 2A5LA 3T41A 1IOVA 4NYIQ 4W5TA 4COKA 1CFZA 1W5FA 2BGGA 3TFOA 2PL9A 2XKBA 3AXSA 3D3NA 4YRSA 4NEHB 3N58A 1KAEA 3G8YA 4NS4A 1QVVA 1QZ3A 5CLFA 2CBZA 3AIOA 4MKZA 2DCMA 3EEIA 3AHHA 3I9V6 1TQDA 3IBGA 4AO7A 4Z4FA 1KH3A 5ALNA 4TL7A 3BL8A 3GFOA 4KWHA 1KOGA 4FC6A 4JLSA 4ZANA 5A71A 2VHUA 3WY9A 2PS1A 4LWPA 1MB0A 2ZRKA 4CDRA 4ZGBA 2RC6A 3ZQKA 5JAPA 1YR2A 1DBSA 1NPTO 2GHTA 2O2EA 1L7NA 4J0EA 4YS6A 3TKYA 5AXCA 4EABA 4IF6A 1OASA 2J33A 1R6DA 2DQZA 3ZLTA 1D1QA 1TYZA 2IBTA 2C99A 1J2TA 2FN9A 1QAOA 2FMUA 3QVSA 2B25A 5GINE 5D3ZA 2D5IA 2GESA 4C0JA 4LE2A 4W8HA 1U8FO 1PFGA 3BX1A 3FKQA 5DIFA 4MULA 2Q7OE 3RRBA 3NT2A 3JQEA 1RJFA 1AE1A 4ZMRA 3T0IA 3TI9A 5HWSA 2KLBA 1MA0A 1XP5A 2JLZA 1IONA 5EEGA 2FEPA 1S1CA 2YN4A 1CRLA 4CCAA 1GVNB 1YQGA 3DOFA 1WMEA 4OX9B 3PSAA 3NG1A 4MRMA 1JR3A 4WXHA 4EJ2A 2AQ8A 5M34A 3L84A 3ADKA 2VT3A 3CZPA 4BVJA 3FKSA 3WWEA 2REQA 5DW0A 4II3A 3VH2A 3VGJA 2YBEA 2AN9A 5AKXA 4F7DA 3MINA 2ZYUX 2HUNA 2YFQA 1E79A 3EFEA 2E4WA 3AUSA 4WVLA 1ZGBA 1GYPA 2HCFA 1H22A 3EXHB 2ZB7A 4BB5A 5A5DA 1U4SA 1DIHA 2JH9A 1JJIA 3A6ZA 3OICA 1OZ0A 3E5MA 3UAXA 1CWUA 3MTBA 1LZLA 1PSWA 1WB6A 3V3TA 2H1SA 3N05A 1UOPA 4U9IS 3B78A 3BICA 1QRSA 4CE6A 1ZEMA 4Y0NA 2VUUA 3AXTA 5L9AA 2G9UA 3PLAE 3OTIA 3IAUA 2XB2A 2XMCA 2P9QA 3UMYA 3EN0A 1VXRA 4LIPD 1OV6A 1K8ZB 1E8DA 5ANRB 1GT91 2Q0HA 5EIOA 3FZGA 4JVSB 3EG9B 1JKFA 2YZKA 3A9RA 5EJGA 4WX2B 5GADl 1W76A 1QIIA 3H5NA 1CP3A 1L7XA 4KAFA 5DM4A 3SX2A 4QU0A 1QZZA 3D3JA 3FYUB 5FTMA 1OTXA 2EERA 3NALA 2WF7A 5JD5A 4FQ7A 3MCAA 3MCVA 4GM0A 2LTAA 3F4BA 3O83A 1ZR4A 2V4MA 4MYUA 5JVDF 1XFDA 3A0UA 5AK5A 2BM9A 2QUIA 1MMFB 2FPIA 5HFAA 5KU7A 5J2TB 4F3TA 2OILA 3PYMA 4GX0A 1YJXA 3A6GA 2WWYA 1GKLA 1MB9A 1WMAA 1A9RA 3RG8A 1WUIS 1Z37A 3WP1B 1JDBB 1SD5A 4ON9A 1DPFA 1NMXA 1SIBE 3PFFA 4FFNA 3ZHRA 3GXOA 4DGSA 2CJWB 2C5LA 4ZT2A 3V8NA 1MH9A 1QH8B 1SQSA 2NXJA 2B7CA 3OPQA 3H2JA 1VIMA 1YBFA 2G77B 5AT1A 2C4HA 3TMAA 2X0RA 3MXOA 3SLRA 1SVSA 4IX1A 1IN4A 1XRRA 1DL5A 2OQRA 5EI5A 5TDHA 1XCJA 5E2BA 5IFKA 1Y1RA 1JLLA 2DULA 3Q8LA 5B53A 1H4VB 1C14A 1OBVA 4HXGA 2ZG6A 2BVNA 4QBTA 5EYPA 2HJGA 1CIPA 4Y2UA 3OJOA 2X9QA 3GCGA 4R0VA 3RHTA 1TM7E 2H1FA 3RR2A 3D3KA 4J43A 4KWTA 2FQYA 1NDHA 4MGZR 4TV8B 4IDEA 2Y1CA 3IVRA 3EXHA 5HE8A 4DIBA 2C59A 4G5FA 3WTBA 2VDQB 2P9JA 2WPDD 4JZYA 5B30A 3E3MA 1L5HA 2HY7A 2HWYA 1SUSA 1ZL0A 2G36A 3RIGA 4E5VA 1U6JA 5AVUA 4OHUA 3HUEA 1EXMA 2D8AA 1EPUA 5E8RA 2V7UA 4YXWD 3N0XA 1GITA 13PKA 2P2GA 1QF6A 4Q4CA 5IKOA 4DDKA 1U0LA 4EHLA 1QB7A 2V96A 1XG5A 3R3XA 3JPWA 5DYYA 1OYVA 2ZBPA 3ITNA 3KPJA 3TZCA 3VR3A 4D96A 3EDCA 2QMQA 2BBTA 5H3CA 5BSVA 4RTKA 2GD2A 4JROA 3KLPX 2QYOA 4OBEA 2C97A 1XLTA 2GD0A 3ESCA 4RPGA 4OYHA 2OQIA 3PB3A 4UVHA 5FTKA 1JHRA 5B4VA 3MLAA 4HK4A 4IJQA 5DNUA 3IVAA 5B2EA 1ECBA 1TD1A 4FWBA 4DNPA 4EYKA 3IQGX 5J2TA 4BAGA 2Y77A 2FW1A 1NMSA 3R41A 1LK5A 1YOBA 4LK3A 2PWAA 4O4IB 4BP3A 1UXHA 3C7DB 4NMMA 4QIHA 3JRNA 3DB1A 3IUPA 3ZHYA 3TLYA 4BCCA 1BE8A 3R0ZA 4HP8A 4DXAA 1ZBQA 3VR2D 4EA6A 2FZGA 2Z98A 4XYGA 1J24A 3FOWA 3NAQA 4QYIB 3VU9A 3IEXA 4E3ZA 3RUEA 1PNVA 2VBFA 1JT9A 3QYPA 1N3BA 4L8FA 4ZI5A 4MHTA 4S1VA 1BN6A 4H6WA 4IUYA 4MRPA 3SKXA 2DFVA 2XUGA 3EJ6A 3FOCA 3IBSA 2ECQA 3IEIA 3TIGA 1WDKA 1I7LA 5LP1A 1PL0A 4A15A 1JNXX 4JCOA 1FIUA 1EB8A 1LX6A 5CXQA 4KXMA 3ECAA 3AP1A 4G84A 4D4GA 1QWOA 4X63A 4HS4A 4G4JA 3LYAA 1OWPA 1EUZA 3MBKA 1I0IA 4AXXA 5HS4A 2IXGA 1B41A 4TYPA 5EJ8A 3TL3A 4QTYA 2LR0A 4F12A 3W5AA 1VJ1A 2AXPA 4DSUA 4N12A 1D2MA 1EXWA 1TK2A 3N2IA 5DTMA 5C0OE 3RU9A 3HABA 3V4RA 1DPGA 4IIJB 4U7TB 5JNTA 3O8CA 4AO6A 2IZ0A 3ANNA 1ZQ1A 4EHFA 2GUWA 3TE6A 4W7SA 2QGFA 2XUKA 4WOCA 2IY8A 1O0BA 2MT9A 2HF9A 4CODB 4DMHA 4ILKA 2CVHA 4LNHA 2I7XA 4EARA 1CJKC 3DF9A 3WJ7A 1GNLA 3VDMA 4F6RB 3UBTA 3L0IB 1DADA 3CLKA 3OTQA 4UUAA 4RS3A 4KIGA 1L2TA 2YJ6A 3ZWOA 4K7JA 5K0TA 1KZ1A 3QSYA 1JKXA 4UDXX 1XBTA 4F4DA 2IYSA 3AZQA 1QSGA 3CRRA 3MS4A 1FFDA 3H7IA 2JDID 1VG8A 4S0ZA 4G85A 4JXJA 2C03A 3CX7A 4G23A 3TKLA 2X0NA 4YMUA 3GLFA 3IEUA 1QYCA 3RK1A 2ZCUA 2KB0A 3THSA 5C8VA 4XEHA 3RFFA 1MQ8B 3I76A 5F2NA 3CY6A 3T3DA 2NUTB 3A4MA 3AL0C 1FA9A 1SEPA 4DFDA 2MMCA 3NP7A 1NX6A 3RRFA 4EKIA 2VRBA 4H35A 4UEJA 5NULA 1JLMA 4DR5B 1NYLA 4C3VA 1NQUA 2WMNB 5DX8A 5K0EA 3HKEB 2ETXA 2ROQA 4UBLA 3PDJA 5E0OA 1JFFB 3PZRA 1FSGA 4D45A 1UDCA 2QTWB 4DVJA 4DYHA 1U2PA 1J33A 2NWQA 3SDZA 3VZSA 3LZDA 6PFKA 4LDAA 3UWSA 1KYIA 4IBOA 5JZVA 1SXJE 1ITZA 4PAMA 4XSVA 3LKBA 1O08A 4RJJA 1VBFA 4B7CA 4Q6WA 5FD8A 3TTXA 1XNQB 3OEEA 3LCVB 1I9GA 2PD4A 1VE9A 2WB4A 4I4CA 3W3ZB 3FB1A 3LWDA 3OPYB 4O2BB 1RAEA 4J3NA 3G2LA 3WKEA 4CLOB 1UJ5A 1Z4LA 4C2UA 2HRCA 4Q48A 4B6GA 2AJDA 1YO6A 4ZAXA 4CKBA 2CSUA 2W6MA 1V8BA 2B35A 3KKZA 3TJRA 5JJ5A 1FXWA 2UYQA 2Q5OA 4K6CA 4YRFA 4IO1A 1K8XB 4CG0A 4JJZA 1NLFA 3D7NA 3KELA 2HA7A 5JW6A 3LNCA 4M0PA 4UQOA 5CVVA 1L8XA 4KK4A 3SKYA 2GXAA 3KOYA 4RY9A 1EK1A 3NS7A 2Z8ZA 5ELLA 3ZZ0A 5KNLA 2EG9A 3C87A 1HZZA 2Y0PA 2X19A 3LCRA 3PQ3A 1UM8A 3WVNA 2O0JA 1KFBB 2O52A 1XNJA 3OE5A 4EHIA 1UXJA 3CZ5A 3NTXA 4DRZA 4E31A 2XMBA 1FTSA 1TO2E 3AUUA 3C6ZA 2XA2A 3K71B 5ILOA 3N3BC 2HIMA 2OMKA 3D8NA 4MSUA 5I3CA 2BMDA 3K96A 5FAKA 1DC7A 4KR7A 1W85A 4JENA 4JZKA 3SDBA 3ZI4A 5KI6A 2QX8A 3JV7A 1Y5MA 1KI4A 3V7YA 5FOXA 5DJ5A 5EE0A 4RJTA 4IKEA 2XNHA 3IVMA 3TQRA 1HK7A 3QOYA 4D4HA 5F1YA 5SY4A 2GEDA 2GCNA 2V6GA 5FH9A 3MTIA 4BRWA 4E09A 5KYYB 2R8YA 4NCXA 2OXTA 4DLYA 4LY0A 1E5QA 1W0KD 3GLGE 2DY1A 3ANSA 1NBOA 3VNSA 3NNDA 4Q82A 2ZULA 1Z15A 3WL6A 3CB2A 3EBLA 1JFFA 1B6GA 1NY5A 1L4NA 3U3JA 3KVRA 1MG0A 3O8BA 4KQKA 4BYMA 4G63A 4RD0A 1EFVA 1G20B 3RHZA 2F67A 2P1ZA 3BB3A 4NI5A 2R62A 4M1MA 1N2BA 2NPIA 2WM3A 1NFQA 2EGHA 4XUDA 1BCRA 3DUFA 3IVCA 3LT1A 3SFZA 3DXYA 1NWHA 1B14A 4RM2A 1C4WA 4EB6B 3TG2A 1DGQA 2WV7A 1FNDA 1PHPA 4K1LA 3MUFA 3AINA 3NEYA 3OPYA 4B46A 4CLOA 4FOLA 4EFNA 1QV9A 3CEJA 1BS2A 4RH3A 3ZY4A 2IBMA 3RV4A 3A0RB 4GAEA 3TDMA 3PTAA 2JJ8A 2XMQA 2YZNA 3O4FA 4DARA 1Q16A 5HBGA 1JLHA 1RADA 1FMTA 1SAYA 3BHIA 4F2HA 2PJDA 1YE3A 3FCSB 4MPPA 4EY8A 2OHXA 4DIEA 3PXEA 5DP2A 5K5EA 1X1AA 3E7DA 4CU5A 1MLDA 1EFDN 2G88A 1N9GB 2JI8A 4NV3A 1YS9A 3IUSA 3NVAA 4R81A 3F78A 4XJTA 3CLRD 1P3DA 5LYJA 5LD2B 3QQPA 2YNMC 1J1IA 2FGKA 1VOTA 1W87A 4DCSA 3MLEA 4TLAA 2NXCA 4YCBA 5KEIA 1Q95A 1PT6A 4LJSA 4B17A 3PDCA 5D5QA 1Q91A 2NYAA 3SKVA 2O5EA 3JWPA 1RWKA 1EK2A 4YYZA 2HPZA 2HRRA 3P2EA 1XR3A 5AO9A 3EIWA 1OIXA 3TQOA 3ZQ4A 2NTVA 2GK3A 5EIFA 2C94A 2IDJA 2IYOA 5CT9A 5B57C 2N1MA 5JEEA 5JZSA 4FR2A 2WUWE 3OQIB 3HDQA 3R3UA 2R9VA 3OPXA 1WUJS 2IXAA 1H2HA 3EW9A 4JUIA 4YPOA 1W4CA 1I4OA 3T5PA 4B73A 3DVRX 1A9ZA 1KI6B 2YZ2A 4KW7A 1KRXA 2YMLA 3DCYA 4MR9A 5KYYA 4EG5A 4N0MA 1IULA 2OCDA 1XLUA 2YH2A 3FWPA 3PIIA 2EJBA 2JIDA 2YZGA 1DUSA 2IHBA 1NXQA 2ZK7A 4LOHA 5BSKA 4ZC1A 3ZVMA 1OAKA 2G8LA 1VB5A 2B61A 3DVQX 4BO3A 1JA0A 4L3OA 2RD2A 2QB5A 4FI3C 521PA 3ZW7A 3F49S 2J7PD 5A5FA 1J5EB 3H3JA 2CVPA 4EP1A 2BCEA 1IAQA 1G20A 2PKRA 1M6EX 3GAMA 3MWEB 4P3XA 3T4EA 3I9OA 3FVVA 4Z4QA 1IZYA 2OVFA 2DFKB 2O57A 1JQJC 2VO1A 2AG8A 4ZTBA 5C8YF 4BFUA 5INTA 1A8QA 4M83A 1WXGA 1SKBA 2G5TA 1I0LA 3ITEA 2JCVA 1JSXA 5DGHA 5I4CA 1YASA 1YR1A 3LWNA 3KUCA 4PZDA 1PUJA 1AQYA 2CFSA 3B3JA 2E5FA 3D2CA 2UYCA 3FGNA 3I01M 1TKRA 3C74A 1U90A 1EWTA 2VDOB 1WMSA 4TZTA 3AUYA 4U0KA 3VR6A 2XEXA 3DAHA 1U81A 3L7IA 3R9WA 4OK3A 1HKHA 1O54A 2YUTA 3PT5A 5AVJA 2AGVA 5IVHA 3R3VA 1NRXA 4UU8A 1VKRA 5HZMA 4UE6A 1UMBA 4L3VA 5ELXA 1WDWB 2VN8A 3ESYA 2PVSA 2IHYA 3UMSA 4BMDA 3KHTA 1RAIA 4PIMA 1QGOA 2IU4A 4OFBA 2C9MA 4LNAA 2BJWA 1WEKA 3QKTA 2CNDA 4OMCA 4EGCB 2V3VA 2UKDA 5A6VA 1QIHA 1KGDA 3BZWA 3KM0A 3WHPA 1C3JA 5HRUA 3P4XA 4FGSA 4MRSA 2OAEA 2QI9C 4RF3A 3CN7A 3L5OA 2CDCA 3VPSA 3IMGA 4NJMB 4Y6QA 2A5YB 1YBVA 4FGLA 2AN4A 2I6GA 4PHHA 3VYSB 4IIJF 2AOVA 2PRIA 1NUPA 5AR1A 2FPKA 2PFGA 4YMWA 1BJRE 1F8XA 5IK2D 5A4MS 3OQIA 4P81A 1EIZA 2AIRA 2WNHA 2PFSA 4CLDA 1C29B 4TKUA 4W6QA 4K86A 1NVVQ 5FL3A 1O96B 4KIUA 5F33A 3SCZA 2PQ0A 3JWEA 3GDWA 1L4KA 2TMKA 2SKCA 1FNSA 2WAMA 1TLFA 2F43B 3BERA 3Q9LA 2R6AA 4LY3A 4E94A 1UQTA 1XGKA 4LZNA 3DZBA 5BNIA 5IN4A 4XGNA 5JCOA 2NU8B 3BILA 5B6JA 1JYEA 3WK9A 1KSJA 4H0CA 4P5DA 4WWHA 4AS3A 3KHUA 4EH1A 1NOJA 3W5JA 5L4NA 5TPZA 2YHAA 2GPBA 3I4FA 3IELA 2YQ4A 2GBLA 4TTRA 1LS1A 2OHHA 2CD7A 3MWEA 1V11A 4MV8A 4OHCA 5JWRA 5LKAA 3BGOS 4WK0B 5AH0A 3SIWA 2FP4A 4L6IA 4LGMA 3HB9A 2VAMA 3INGA 3O8QB 4ZT3A 1GT6A 5HUQA 4RHTA 2Q3HA 1ZUIA 4QU9A 2UZ1A 1PFUA 1XPRA 1X7DA 1WUHS 1UJBA 3GVXA 1HV8A 5FFMA 1F6BA 2BKLA 2I1LA 4CG1A 1SRQA 4GKJB 4FHGA 2YJNA 3QVKA 3U39A 1KFJB 3V4VB 5F7OA 1UMKA 2JAWA 4KQEA 1VCHA 1T4CA 1VJDA 5JZMA 4XFKA 2R8PA 3T95A 5DBIA 3I2FA 3ZE2B 3OWHA 1E7WA 4ZQIA 3SVLA 1LPPA 1JKJB 4IXDA 4J29A 4ZVUA 1TYEB 3U26A 3A6FA 1ZNQO 1ZMXA 4NU6A 4RZ3A 3UM9A 5JAHA 1TYCA 4J3JA 2D74A 3B38A 5EQJB 1GL9B 3AR3A 5GJVC 2O5CA 4IYRA 3PC8C 1FDUA 4P34A 5DNDA 4O2BF 5ER6A 4HZUB 1L4LA 1H1DA 2H1OA 1IM8A 5TS3A 1IRIA 2F1IA 4XIGS 4BGEA 1P7WA 4NJMA 2QROA 2XAAA 1O87A 3FIJA 4XDYA 5GM1A 2OE2A 3ROKA 4QO7A 1SUPA 4B7AA 5BW8A 5I9IA 2NMVA 2CE2X 4MUHA 2VKQA 4Y2YA 3FXAA 1P62B 4MLCA 3FVTA 3C6MA 2AMFA 1YAJA 2W2MA 1T9ZA 4XJSA 5GV8A 1OXSC 5TX7A 1G8FA 3LP6A 5CHYA 1V3UA 3X1ZA 1ZINA 3CIFA 2YCLA 4MVJP 3U44B 3PEVA 3TW8B 2GN4A 3Q8KA 3C4QA 3WJ1A 4KIJA 4IHAA 4ZOQI 1SOAA 3DLTA 1GZDA 5JU6A 3B12A 1T26A 4CMBA 1P0IA 4RVNA 3DR5A 4LXUA 5CRIA 2YRXA 3ZDRA 3RF7A 2F43A 1HLGA 4AN4A 3NHMA 3RSSA 3BHMA 4AS1A 1GKYA 4FX2A 5JZOA 1ESDA 3SVZA 3L05A 2H1VA 4EHHA 4K6GA 4EUSA 2JFOA 3T38A 4OJNA 4HDNA 3DE4X 1Y63A 4FJ2A 1E92A 4HQKA 1XTVA 2H2GA 3A31A 4QTUB 2J9GA 1SA0B 1DOHA 2BHLA 2WJIA 2DHQA 3AFIA 1HDOA 1UWLA 3O8QA 3RFVA 5CB4A 3O31A 1ISJA 3DWFA 3VVMA 2AKYA 2C82A 2Z8YA 4RAOA 1WD7A 1GGNA 2F9LA 4FFOA 2ZVPX 2WFLB 3I9V1 3KLBA 4TUYF 5LA6F 4E5KA 3UMGA 2PX0A 1SUAA 5LIRA 3RU2A 2C92A 4RZQA 3CZMA 4P5EA 4B48A 1MIHA 1RQXA 1WM1A 4JQOA 4X8LA 1ZN7A 4I3HA 2IZZA 2XT0A 3WO1A 3U31A 3WZMA 3F0TA 2ZVJA 3IP5A 4MVJF 2YZ7A 4GP7A 4RACA 5HFJA 3K0KA 2QL6A 4EM6A 5A2QA 1ZY2A 4RL4A 2HF2A 3KXIA 4DLWA 1P9OA 2FZEA 2OY0A 3AGPA 4PYMA 5C8XA 4NCBA 3L1JA 4KPUB 3Q12A 3JQDA 3O4JA 1A5BB 2BEVB 3MUOA 3LVQE 4HZUA 3HJTA 2X9VA 3IOBA 2OHIA 4KXLA 2PSSA 5LZ5A 4GLJA 5J3JA 4AIIA 3H1EA 3ZE8A 1O03A 1WQ1R 4DV7B 1HQDA 1ZM9A 1RXEA 3MT8A 1SPBS 2Z30A 2O2GA 2KQUA 2FWJA 5JRZA 3P0IA 3GBPA 1VSTA 4ALIA 2W70A 4RHYA 2R1VB 3O8DA 3DMTA 4QWMA 2M32A 4CLXA 3VPFA 1ISGA 2L18A 3Q3HA 3LI2A 1K66A 4PGHA 4X1KA 3A8TA 3OBBA 3V8MA 5FOWA 3FBWA 1F0YA 3A06A 3IKJA 4J16C 5FPQA 4AY6A 3JQAD 3S1SA 3CS3A 1ORWA 3U17A 2TMYA 4BPBA 3KUUA 3CXUA 1JYFA 2VWHA 4HDQB 4P33A 2RGUA 3N8NA 5CDUA 5BN3A 1ZRMA 2WD9A 1T6YA 3MM4A 1J00A 5A4KA 3B48A 1WULS 2GEBA 4R2IA 4W7IA 2ODEA 3H18A 3JR7A 4HNSA 1KHTA 1SA0A 4Q7JB 1C81A 1CT9A 4JX9A 4PFSA 4RIIA 4V0ME 2ZJ5A 3FF1A 4HC4A 4UM9D 2WU8A 2XMSA 3E5HA 4BGIA 2NO9A 1SUWA 2PMWB 3DZGA 3HKBB 3C16C 2V9ZA 3I4LA 4MCJA 4D5GA 4DS3A 1GQYA 5BV1A 1CUSA 2ZGVA 3I1JA 4CG2A 2A33A 4B34A 1QS0B 1KY2A 1QDUA 4GU5A 3N2ZB 1T29A 4G25A 5JSFA 4YBRA 4RSRA 2IS4A 1ODKA 2JIOA 3KQPA 4WQMA 1U0JA 3WYNA 1FUIA 1FFHA 1M5UA 3LZCA 3RC9A 5KX5A 1Z73A 4UQPA 4OHFA 3WLHA 1PDWA 4N6GA 1GR1A 2LV8A 5IAEA 1EWQA 2XD9A 4DA0A 3WZLA 5DNYB 2VAWA 1TO6A 5EKSA 2GRJA 2VQ6A 1GCOA 4KPUA 3RUCA 1WD5A 4Y6RA 3WMGA 4NAUA 4OQNA 3TNDA 2AMYA 3KWFA 5FUXA 4BJ3A 4JLNA 3SYKA 2BEUB 2PZMA 2G6TA 1UDRA 1HOTA 2WIDA 3OOSA 1VKZA 3REGA 1F8UA 2Y1OA 1D2HA 2BCGY 2Y0CA 3ZBUA 4C3ZA 3PJEA 3U37A 2WYWA 1QFZA 2ZS8A 2ZBDA 4JLPA 1L4YA 2PGJA 2B98A 2FFHA 3HJHA 5C5CA 1PW5A 3MUEA 4HSGA 4MR7B 3IULA 2FSVC 3QKUA 5JDIC 1EESA 5KYGA 2WLTA 2FOLA 4PYKA 5DYTA 3EXAA 3UAVA 4PZAA 3M4JA 2QVBA 4AUKA 1L5WA 4DW8A 2PH3A 4EHKA 4EFDA 4HQNA 1TKBA 5EPEA 3TGLA 1DXOA 1I14A 1RI4A 4G5RA 2W2TA 4GBED 3GLIE 4IPTA 3HWSA 5M29A 2PMFA 1K98A 2ONZA 4NLLA 5JPDA 1NBIA 1G2QA 4BC1A 2XXAA 1O4WA 1E6KA 1SIUA 4YQFA 1XKXA 4B7XA 2RGCA 4IQ8A 2YYAA 2IEDA 1H4TA 1AC5A 1T0IA 3JYPA 4I4LA 5LQKA 1BDIA 4GDMA 1CUAA 1U80A 4Q24A 1WV1A 3L0OA 1SBTA 4N3GA 4NTZA 4QPDA 5B64A 1ZVJA 3M6FA 5AM1A 3TZQA 1L9XA 1GKKA 3ZKWB 1K6IA 5HUHA 1KC3A 4ENVA 2V4UA 1BXGB 2GN8A 3W5VA 5DCUA 4EMTA 1QS0A 4IIFA 5DN6D 2FLWA 2PZFA 3IJPA 2I5PO 2IHZA 1P81A 4I8IA 2IOYA 4P2BA 3FDFA 4E07A 4R1OA 1Z6YA 3OTGA 1BEEA 1AXGA 2Q50A 4OHMA 1GZ6A 2Z95A 3HJFA 4PWZA 2IHTA 2CLEB 1MW8X 2C1XA 1CB0A 3TECE 3E5NA 2C95A 2C9OA 4BKQA 1XDSA 1V3TA 2GETA 1CK4A 4GR5A 5JSHA 1GZ3A 2CCGA 4UHCA 4WESA 3O8NA 1V7PC 1XWWA 3KKPA 1U9YA 1QLJA 1SUIA 2BEUA 3NX4A 1NN5A 1N25A 2ZI7A 2JIZA 1N36B 2OORA 2L42A 1F17A