4FMDB

Espg-rab1 complex structure at 3.05 a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
171
structure length
171
Chain Sequence
b'PEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EspG protein
publication title Structurally Distinct Bacterial TBC-like GAPs Link Arf GTPase to Rab1 Inactivation to Counteract Host Defenses.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 54
structure length 171
sequence length 171
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4fmdB00
2RAPA 3ZGXA 2J0UA 3UATA 5KSZA 1XTRA 3KTAA 4G5QA 4LOAA 2D06A 1ZD8A 1N6LA 4LYJA 5F2EA 4CVNA 2QZ4A 3QOFA 2HLDD 5CLLA 1X8LA 3FHOA 3WYFA 4R98A 2GA8A 5C4MA 3GFOA 3D8BA 3M4YA 2OCYC 3C5HA 3TAHA 3KDSE 4KLNA 4AWXA 5DSZA 5A0FA 4B6FA 2BM0A 5HE8A 4E09A 2B6HA 1XD9A 1QRAA 1E2DA 4P0TA 1TQ6A 5HCIA 3NDPA 5EP2A 3T34A 5DI9A 4TZ6A 5E7JA 2VPPA 1QG2A 5EXSA 2IC5A 1TMKA 2W6JD 3O8BA 4DT1A 1FUUA 4DSOA 4DZZA 1JEEA 1N0VC 1NVWQ 4URZR 1U8ZA 721PA 4WOPA 4C0QC 2FN4A 2YOGA 3M0EA 4P32A 3RWOA 1ZM4A 2HCBA 2F1RA 4EFNA 1EG7A 4KVAA 1GSIA 1ZNXA 4L9WA 3KQUA 1Z22A 3HJNA 3FE2A 3B8HA 2CCKA 2EFEB 4QM6A 1BOFA 4P4UA 3A37A 2DWQA 4US0R 1T91A 1KSHA 4QGGA 3WHLA 1GVNB 3THWB 3ADBA 2P3SA 2ZRJA 3RSOA 3GLHE 2C99A 2QAGA 4NHOA 1RE0A 1EWQA 4LY6A 3EIHA 2ZE5A 4PSAA 1AQYA 3V4FA 4B44A 2OLKA 4NP6A 3T1QA 1Q44A 3ICQB 3PJRA 3MWLA 2X8AA 1EFTA 3FDIA 4E5UA 1BIFA 4C30A 3AH8A 4NYIQ 3BOSA 1Z6YA 3T1VA 4IDPA 5HKKA 1GILA 4ZIRA 3CWZA 1FTSA 3HP1A 4TL8A 2D3WA 5EP4A 2NOAA 3AVPA 2CBZA 4BLOA 3B9PA 3K9HA 4JYBA 1II0A 4XSHA 2JEOA 1L4YA 2J0UB 4TWZA 1T8UA 4U02A 3KTAB 2R6GA 3PUYA 4BFVA 4ZKDA 1YJ5A 4TL7A 4JLKA 2XJ4A 4B3FX 2V9PA 4QJ5A 3F5FA 1XCGB 3KKMA 1CIPA 2ZI6A 2ERYA 3K70C 1RC8A 2YOHA 1GP2A 1DEKA 2R9VA 2X77A 1W1WA 5DISB 3SE0A 1AS2A 5LB4A 4LBYA 5DHAA 1DAHA 1KI6A 5EJEA 3MWKA 5JJIA 4M1WA 3RS2A 3RYTC 2QTHA 4D25A 1W2GA 4R2IA 1ZNWA 4EPYA 4L15A 1Q21A 3AGPA 2XXAA 1DO0A 1Q57A 2GKSA 3K0FB 4NCHA 3GJ6A 4Y0VA 3X1ZA 4JMPA 3TJZA 3UMSA 2JLVA 1QHGA 4M1TA 5J4LA 1M74A 5FOXA 2QMEA 3NEYA 1R8QA 1OIVA 4CEJB 3QY0A 3P32A 1G5TA 3BIFA 1TQ2A 2ZROA 1W36C 1N3BA 4OQXA 5K8UA 3MCAA 4KFUA 5FPYA 2Z5FA 1PLJA 5AJZA 1UBFA 2NO7A 1T8TA 4HDQB 3DPUA 1EFUA 2J45A 4KITB 2QAGB 5A5GA 4TYQA 1KKLA 3IQXA 1YRAA 2CL0X 1Q1BA 2VHUA 3LV8A 3GEIA 4TMTA 3TVDA 4AURA 1G19A 3IIJA 5FBWB 2QL6A 3GMTA 4NBSA 2K5UA 2QMHA 2ZSDA 1PUIA 2HEIA 3B9QA 1M8PA 3K09A 2W2VA 3C15C 4WAUA 4EPVA 1MO5A 4A6PA 3U3OA 3R8CA 4F4JA 3X1YA 4ZI2A 2PJZA 3U6BA 3IIKA 1OKKA 4TSFD 2VH5R 3WP0A 3PUVA 1T4GA 3MLEA 1BS1A 2YOFA 1F6BA 4FXPA 1KMHA 2J46A 1RVDA 2PH1A 1GL9B 1F2UB 2CNWD 2QP3A 2ZI9A 4DUGD 5KOYA 3RRYA 5J4HA 3CRW1 1QHYA 4WBSA 4X8MA 3HU2A 2NGRA 3LAWA 5BN4A 2IYVA 4BWYA 2Q3FA 2XB4A 1FQJA 4Q7LA 2W58A 1E9AA 1ESNA 2OCBA 4PO9A 4YDHB 2CMKA 3SC3A 1A5TA 2GCNA 4KXFB 4B74A 5JMTA 4TQUS 1NRJB 2O0JA 3KX2A 1D5CA 1L4UA 1OE0A 5K8LA 4IFEA 2GF9A 2XOKA 1W49A 2IBMA 2JCSA 3VR2A 3F0TA 3EA0A 3QXXA 1ESMA 1C1YA 4NYMQ 4OJQA 2REXB 3VQTA 4RD3A 1E9BA 4BFSA 3EA5A 3H2YA 4A4DA 3EARA 4A0RA 5JI3E 3L0PA 4WZAE 3DL0A 3AV0B 2NO6A 1E4YA 1SULA 2ZYWX 2DFTA 2WWGA 2AFHE 3H86A 3ND9A 5EE1A 2ANCA 4JT2A 1N6HA 1NBME 1VECA 1UADA 1VTKA 3MAAC 4TLAA 4AKEA 2CK3A 5CYPA 4PHGA 1XD2A 5SZJA 2AN9A 1AK2A 2C9YA 5BWMA 2F9LA 4AKGA 1OH7A 2WSMA 1KY2A 1JR3E 1M7BA 1E6CA 2JLRA 1BMFD 1FPMA 1KGDA 3BH0A 3T12A 3HPRA 4FMDB 3RHFA 3V4RA 1RZ3A 4DIEA 1AJEA 2VHCA 3H84A 4HLUC 2XZLA 5DN6D 4A82A 4GNKA 2QPAA 2HV8A 2CVFA 2IYWA 1AKYA 1E9SA 5IHPA 2PCJA 3A1TA 4HLQB 4II7A 5C46F 3ASYA 3ZVMA 5J40A 3L82B 1GRNA 1XF9A 1R6BX 2ZR0A 2WBLC 1MOZA 4YC7A 3C5CA 4DJTA 4Q9KA 1KI9A 2R6CA 1N6OA 3EW9A 3X1WA 1QF9A 2CXXA 1T6NA 1S0UA 3WNBA 4M2LA 4NCJA 3TR0A 4TN1A 1FP7A 2RGCA 1OSNA 2ZUBA 3ADCA 2ATXA 2ZRLA 1XEXA 3QF4A 4HDCA 4Q9LA 5DYIA 4DDUA 1R0YA 2PEZA 3ZZ0A 4AKHA 1BO6A 1WRBA 4XWKA 3GCGA 4HDOB 3PFIA 3BB1A 1T3LA 4Z1MD 1QVAA 1KHTA 4D4JA 2YWFA 2ZRFA 2J0VA 2VEDA 4JLNA 4PHFA 4POAA 1WDTA 121PA 2VF7A 5B57C 1KDOA 4PC3A 4GMXA 3VHLB 1J90A 5D3MA 4FMCF 5LPNA 3VKGA 1Y3AA 2AFIE 2JJ1A 3LW8A 1DARA 1Z08A 2OBNA 4KFSA 1O3YA 5JEEA 4I1VA 1J70A 2ERXA 3U3JA 2OO7A 4B2IA 2FNAA 4A1FA 4IEEA 4N3NA 1NJFA 3LH5A 4TLDA 4AD8A 1P7CA 2GCOA 2JLYA 5CM8B 1OFIA 2IS2A 5FOVA 4HYYA 5CIWA 2IYQA 4IFBA 3I32A 4XVQA 1SKQA 1E79D 4F7WA 4RSGA 3NBFA 3AVXA 4RCYA 4ESVA 2A78A 2F43A 3NWJA 1WMSA 1EFHA 4JYCA 1IY2A 3NG1A 1NLFA 2IYZA 2VIIA 4EPRA 1XD8A 1KSGA 1E1RD 3O47A 1F60A 2VHQA 4KI0A 4Q7KA 1QHHA 5FOTA 2OG2A 1MRNA 4QNRA 1TL7C 2NO1A 3NEJA 3CO5A 2R2AA 4JBYA 4OK3A 1ZVQA 2EWVA 1I4DD 3FWYA 3QSYA 2H16A 3R9WA 1EFCA 1T9HA 2PLFA 2XNSA 4MA4A 1CP2A 4Q5IA 1JAHA 1V5WA 2X19A 2IYYA 3CF2A 2WAXA 3K1JA 1P2TA 1W0KA 4QFMA 3WNDA 2XGJA 4Q1EA 3OFNA 4CW7A 1QHIA 6Q21A 5KHOC 1B0UA 4KODA 1KJWA 5CM9C 1GNRA 5HTKA 5FUVA 2IUUA 5KNBA 1XP8A 4KYIB 1J99A 1KI8A 4OBEA 4C0SA 5TV2A 3AF2A 1F2TA 1DO2A 1VHTA 1WP9A 2QG6A 3SHFA 4B75A 1LF0A 2ODEA 3A8TA 4MRVA 3SQWA 3U60B 5AJWA 2ODBA 5KSYA 3I8SA 2OT3B 1FX0A 3K9NA 5JECA 2WV9A 2DY1A 3U4QA 2FPKA 2ZM5A 4HB0A 4M1MA 2FWRA 1OPXA 1TEXA 5CK5A 4GP6A 3VX3A 1W48A 3EX7C 4DDVA 2FJUA 3LX5A 2ZR7A 3TH5A 3REGA 2GCOB 4V0KA 2IX3A 3ICEA 2ATVA 3TUIC 5CYOA 3DDCA 1NP6A 3AVQA 2DR3A 3C14C 2WKPA 1RYFA 2YZ2A 2F1HA 2X2FA 1QG4A 2Q3HA 4OHWA 1MR3F 4R9UC 3HR7A 5J4KA 3DM5A 3B1VA 1H8HD 1U9IC 3KL4A 2Y8EA 3NH6A 4LJ5A 4NYJQ 2B21A 4FD2A 4JZKA 1DPFA 1EESA 2BDTA 3UMRA 4KFRA 4XJXA 3QF7A 3W5JA 1VHLA 4JL6A 1US8A 1R5BA 3BD9A 1K8RA 3R9XA 1SVWA 2XTMA 3RS3A 2V7QD 2Z43A 2IYRA 5JFGA 3ZZUA 4FWTA 4MGYR 2VO1A 3VX4A 1XEWX 1XBTA 3LLMA 2Z4RA 4B48A 1TU3A 4ZO4A 5HR5A 3T06B 5LD2C 1KZ7B 1VG1A 1IJFA 4Q7MB 3C41J 4RFSA 3SNHA 4YMVA 5F9HA 1XXHA 4Q18A 2ZIAA 3CPHA 1M34E 1E2IA 2DYKA 5BW8A 1R0ZA 3B1XA 4TL9A 4JIMA 4Q19A 4GDFA 4I99A 3ZS9A 2XTNA 3VTKA 4L9SA 1SQ5A 1L2TA 4IDNA 1SVIA 3NH9A 1KY3A 1MT0A 1OXXK 3RNLA 3RRNA 4F92B 1OB5A 4BRUA 2NIPA 1OFTA 3TSOA 1OH8A 1GG2A 4IVQA 2YC4C 4EQ6A 1P60A 3V9PA 1DBSA 1U98A 1D9XA 1ZIPA 2BV3A 3T5GA 1F2TB 1H8EA 4JLAA 3ZZTA 1DAEA 1RRGA 3UG7A 1CJKC 4EUNA 5FTLA 3QG5A 5L3VA 1P2SA 3TLXA 4QHYA 1FX0B 2GF0A 1L7VC 2HJVA 4LHWA 1WCV1 1ZINA 4P4TA 4BLTA 2CJWA 4BUJA 1KI2A 4DDTA 2RMKA 4A8JC 2CCJA 3VU9A 1XPUA 2O8CA 1W7AA 4A0HA 3V00A 2BEJA 3GJ7A 4PO1A 5FTKA 5FBRB 4DB4A 5JS8A 3LLUA 5EP3A 2YKGA 1S8FA 5SZKB 2FH5B 2C77A 3KQNA 3HPQA 1D9ZA 2ZJAA 4PC6A 2FG5A 4DCUA 1HTWA 1KI3A 1MABA 4UNQA 4EDHA 1IONA 3THXA 1FP6A 1UDWA 2JASA 1SVLA 1KO7A 1W5SA 3NC1C 2QQ0A 3S1AA 3SJAA 1U99A 2QE7A 4B3DA 1Z07A 2VP0A 2ZRHA 4F4CA 3NHBA 4MKIA 4Z8XA 1YZUA 4PR0A 1ELOA 1E9CA 4N0EA 2ZRPA 3THYA 1E4VA 1VYTA 1N0UA 3JVUA 1XEWY 1US8B 3UPUA 4MYHA 2GBLC 4ASUA 2WIAA 3CX7A 2OXCA 4BZXA 4BEBA 4ZCLA 4TLCA 4QGHA 3CIOA 2J7PD 5J4YA 4HAUA 2ZJ2A 1SXJD 2LWIA 4G0NA 4F4IA 4KU4A 3L0OA 2H92A 2OCAA 5C1BA 1LS6A 2HUPA 2VLIA 2VP9A 1XXHB 3GJ4A 1V43A 4LJAA 4D0GA 2RGXA 3K0AA 1GKYA 3TNFA 4AG5A 4V03A 3EPLA 3DKVA 4K46A 3SBDA 2ZAMA 4G5RA 1Z6GA 2WZQA 4NCNA 3FKSA 5KPJA 5ELXA 1J8YF 4PAOA 5DYGA 4D0NA 2ZS9A 4G3XA 1COWA 4EQ6B 4QKQA 3KJGA 1WF3A 4UNSA 1CR4A 1KO4A 2O52A 3AVWA 1X1SA 4JLOA 1K6MA 2G1JA 3QKRB 4Q01A 2DB3A 2FEMA 5BN5A 4BLPA 2AD1A 1E9FA 2BMFA 2H57A 1CR2A 4D2IA 1CJVC 2JAQA 2YHSA 3CNLA 3MWJA 4BEJA 1ZAKA 2SHKA 1S3SA 4HLUA 4Q00A 4EJSC 1BYUA 4HB4A 1ZD1A 1H65A 3I92A 1LY1A 1MH1A 4MKGA 4BLQA 3FKQA 1G41A 1MV5A 2FE4A 2ORIA 2IYLD 1XPOA 1KDPA 3TRFA 4PPGA 1HT1E 1KYIA 3ZDQA 4NZYA 1E2JA 2AHOA 3GEHA 4PHTA 1GNPA 2XSZA 1Q3HA 3LXRA 3RANA 4QHSA 3S1AB 4K8OA 4TL6A 3AF4A 4ESHA 1GM5A 2PL3A 2REBA 3WNCA 1KMQA 2NTYC 5AUNB 5JHHB 2GAOA 3FFBA 3N5CA 2QP9X 3BH7A 5TARA 5GJCA 2A30A 2ZPTX 1U90A 5HE9A 1I2MA 1Z47A 4V0MA 2XJ9A 4LX0A 1BKDR 1ZNYA 3TBKA 2H18A 4W5WA 4U00A 3TK1A 4TYPA 3CONA 1A2KC 3C8UA 1Z0FA 2VHTA 3TIFA 4LC1A 3ZQ6A 1P73A 2D2FA 3QXHA 1G7RA 4D6PA 1FL9A 1IBRA 2PMKA 4JSYA 4YLGA 4PAMA 4PQYA 1OKKD 4B2LA 1OHHA 4M53A 2FPMA 3P4XA 2WMNB 2ZITA 1UDXA 3DHWC 4QHTA 3UXMA 1YZNA 3ZVNA 5G3YA 2GTPA 1HY3A 2R8RA 1UEIA 4B47A 3SYNA 2ZVPX 4WVFA 5CK4A 4W9MC 3NDBB 1TX4B 2A5DA 4PFSA 1U0LA 2AX4A 4B2PA 2D74A 4GP7A 4AYTA 1G3RA 3Q85A 4S2EA 1E9DA 2IYUA 4HZUB 2R6DA 1I2DA 1ZU5A 2MSEB 1E9EA 1CJMA 4N0DA 4PSVA 3TQFA 1CBUA 5L3SB 1N6KA 5DO9A 3HR8A 1F5NA 2L0XA 1D6JA 3K0CC 4FCVA 1G8FA 3K0FA 3KB2A 1NMZA 5JCPA 5E7MA 2C5LA 3GLFB 4B35A 4CEJA 3D31A 4Q9HA 2FOLA 2BBTA 2JJ8A 3CH4B 5K8IA 5C4GB 2BMDA 2UKDA 1G6OA 1NLZA 4QBGB 2W0MA 1XTJA 1YZKA 3CRRA 2C8VA 2A5GA 2FZLA 3HWSA 4LI0A 4PZLA 4BFUA 3CPJB 1QZXA 1A7JA 2H5EA 2J87A 1FNNA 2RGNC 4MUBA 4KJZA 2F3TA 3BGWA 3C7KA 4MKHA 4J0QA 2GXQA 2OILA 5EQTA 4LJ9A 2CK3D 2ZR9A 4QL3A 4BFXA 2BOVA 4TMKA 3UMFA 1UBGA 3GJ5A 2GK6A 3EPKA 4LGMA 5EE9A 3VHXA 2IHYA 3FHTA 2ODWA 4BGDA 5DE3A 1R0WA 3TSZA 1IN5A 1GL7A 2GK7A 1R4AA 3I3SR 3NXSA 1Q1QA 2FGKA 3AP2A 4TTPA 4LHZA 3B60A 4OL0A 3T1TA 2CLCX 1WBBA 2F9MA 3B7GA 4RKEA 2ZRIA 2ZREA 1UBEA 2QY9A 3QPWA 3L0IB 1EX6A 4WIAA 4OI4A 3OEHA 1RJ9A 2H7VA 4HAWA 1ZC4A 4PC7A 1F2UA 4M22A 2V54A 3FYHA 4IHQA 1WXQA 2WOOA 3M1IA 2OSBA 1Y63A 3AKDA 5CB6A 1NY6A 2W0SA 5M04A 3CH5A 3KUCA 2ONJA 4YXWD 1C9KA 3OF5A 1IAQA 1VKJA 1KK1A 3W3ZB 3VFDA 2V1UA 2DCUA 2GVDC 2VBCA 2ZI4A 4JBWA 1Q3TA 2JIZA 1YRBA 1E2QA 1NMXA 1U9IA 2A5FA 4ZPXA 3VAAA 3OIWA 3WMGA 3RC8A 1D2MA 3WP1B 2JJ2D 2WSSA 2BEKA 4MQBA 4EPXA 2JJ1D 4UXIA 1T5LA 2V3CC 4B3GA 4O25A 2E87A 1YR8A 2WWFA 4QBHA 3U7FB 1FW6A 2ZE7A 2IS6A 2RH5A 3LRPA 3IPYA 2ZYUX 4RJLA 3KJIA 4ERNA 2A3RA 5AUPB 2V6JA 2CVHA 5F98A 4M9SA 5AUQA 2N46A 2BIFA 3X1XA 1NKSA 3AP1A 4EFLA 2VSFA 4AIIA 5GVRA 1SVSA 4RZUA 1AS0A 5GJVC 4AI6A 5CDFE 1K5GA 2O8EB 2F1IA 3AKEA 4JBXA 4Q1CA 3JZMA 4O0MA 2CEAA 3ZIAA 1CLUA 4I81A 1NLYA 1XX6A 3RS0A 3QPUA 5B2ZA 5IDVA 4Q1BA 5EXXA 3RRZA 5TVKA 3U5ZB 4TQ9A 5FL3A 2GJAA 4G1UC 3SDZA 3B85A 4IVPA 4KBGA 4A2QA 4A0GA 3FB4A 3LDAA 3ZD7A 4PQFA 4QJ4A 3QE0A 4QM7A 1E9RA 3UK6A 2H17A 3IDQA 3KKQA 4LV8B 4DLTA 4Q21A 2Q3MA 4D4LA 4DCNA 1SXJB 1OYWA 2ZSEA 4V0OA 5K8TA 1RJ9B 2EFHB 1XXHE 1N0WA 4A8JA 1E98A 4RD4A 4Q1AA 2XZOA 3UIEA 1DG1G 3TUZC 2BJWA 3GP8A 4TTQA 5FTMA 1JNYA 2WKRA 3WBJA 1G20E 2VF8A 2EYQA 2RGDA 2Z83A 4LRWA 1PV4A 2EU8A 4XH9B 3OAAA 1IY1A 1W0KD 2GILA 4TQAA 5KDLA 2WWHA 1M7HA 4FCWA 3OFND 4JVNA 1EFRA 3SR0A 4D4MA 2C98A 1JXOA 2IUSA 1MRSA 4HAVA 3RSLA 3FMOB 4GL2A 5J5CA 4CDGA 3RS5A 3A58B 3QVUA 1UM8A 2IK8A 2Z6VA 4RCZA 2V4ZA 1XJCA 4CGZA 1R8SA 2FEOA 4MYUA 1OXTA 1WE2A 2OAQ1 2ZSFA 2NG1A 3BRWD 4MH0R 2GBLA 1JALA 4NONA 3P1JA 1GOTA 3A4MA 5H1YA 5FBVB 2O8FB 4D0LB 2LKCA 2PT5A 1BYIA 4GZMA 1FQKA 3IKJA 4Q9JA 4C0BA 4CZ2A 1ZM3A 4LHXA 2HYIC 3RS4A 3OEEA 4US2R 1E2PA 1JB1A 3FMPB 1D2EA 4E07A 5LD2B 1OH5A 3KJHA 1BH2A 2W6JA 4NPHA 2NPIA 3SOPA 4BFYA 2EW1A 1G3QA 1UEJA 2QNRA 4A36A 1LW7A 3U3KA 4MRNA 2ZRGA 2XITA 4A2PA 2R6AA 4LSGA 2I4IA 4Q4LA 2OHFA 1RIFA 1UKYA 5FPKA 1OH6A 3QXCA 1HYQA 4NYIR 1QHSA 3QNUA 4BASA 5JRZA 4D82A 2BBWA 1NNEA 4LYAA 1M7GA 2JDID 2B8WA 3LFUA 5TXGA 1DELA 2P6UA 4IDOA 1KO5A 5BQ5A 4E22A 3DOFA 4UJ3A 1M6NA 4UKDA 3TSWA 2DPXA 3AKYA 3K70D 4M9XA 4PPNA 2ZUCA 4R7ZA 5JWRA 4A8JB 4C0KA 5FPHA 4ZCIA 3LO5A 5HPYB 3AVYA 2EVWX 2REOA 3ZYCA 1ODFA 1DG3A 1P3JA 4V02A 2VP2A 2HDNB 1NIJA 2GVZC 4L5BA 1GL6A 1J2JA 2WTUA 3BORA 2PMDA 4JVMA 2C2HA 5GADl 2EWWA 2HT6A 3T5DA 1HA3A 2AR7A 1XCMA 1AZTA 1XEFA 2O8BB 3T1OA 1HH4A 4MGKR 2ORWA 2IYSA 2NQ2C 1KJYA 4MYTA 1CKEA 3OE7D 1W36D 2DFLA 4LK2A 2EYUA 2I3BA 4LHVA 4DLYA 4MITA 1KZGB 2JATA 5FFMA 4LJ6A 1QBKC 5DNYB 3CW2A 3AF1A 1KAOA 1TADA 4IOJA 5JSZB 4PSKA 4C4PA 1AN0A 2WPDA 1XMSA 2IS4A 4MUAA 3CF0A 4UNRA 1QHNA 3SHWA 1G4AE 3NKVA 5FOSA 4JVLA 3LQQA 3GLFE 4HI0E 2HF9A 4P33A 5EZ5A 2R65A 4BRWA 1KKMA 1IM2A 4QOSA 3QBTA 4L16A 4M1KA 4ARZB 3TGPA 4TYNA 1P72A 3I4LA 3EPHA 1N2CE 2FFBA 1N5JA 2ZRMA 1G4UR 2B7CA 4HEJA 3QEOA 4YMUA 1NBMD 4GOKA 2J3EA 4V0NA 4PZZA 3NIBA 1I4LD 4I1UA 3SBEA 4DEYA 1RW4A 3OZXA 1CJTC 1S9HA 3BS4A 4XVRA 1NSFA 1JR3D 5CLQA 5FTNA 1DAGA 1JJVA 1ZCBA 2ZRAA 3UG6A 2FU5C 5IK2A 2KSQA 5BYKA 4RZ3A 5IRCD 1CJUC 1W4BA 2VSOA 3PENA 3RLFA 3TE6A 1KTVA 2I1QA 2BKEA 4TMXA 4US1R 1SVKA 2PZFA 4V0ME 3CNNA 3B1WA 2Q21A 5KSPA 4N1AA 5C2JB 1YE8A 4G5SA 2W6ID 4IEIA 5FOWA 3CZPA 1N5KA 3SYKA 2VP6A 4DSTA 1ZM2A 2QI9C 4LUCA 4RD0A 1XTIA 1G3IA 1P75A 3E1SA 4LV6A 4DCVA 1AGRA 1G8PA 1N6PA 1JBKA 1GKUB 2CDNA 2WJHA 2WVJA 4EAQA 3IBYA 1SVOA 4EJSB 3LA6A 4TSFA 1M1YE 3CBQA 1CXZA 4WW0A 3E70C 5GJWC 5BYJA 4BQSA 2G0TA 1NVVQ 4FMBB 1YQTA 4BZQA 4A9AA 4LZZA 4CEIB 3GLGA 2HF8A 1Z6AA 2DFKB 4NYMR 3FKSD 5JWHA 4ZV4A 2IEZA 4LBWA 1HEIA 2RGNA 1VYUA 1Z83A 2CNWA 2RGAA 4DUGA 1COWD 4Q66C 3QI2A 4GOJA 2ZEJA 5CJ2A 3BE4A 4PX9A 1XDBA 1SXJC 3RWMB 3EASA 2WAYA 5AJXA 1YZTA 3PEWA 3GPLA 1FTNA 3FFAA 1R5NA 221PA 3GJ0A 1Z3IX 1RPZA 2XX3A 3TQCA 3GJXC 4PPFA 3QIAA 4U7DA 5CB8A 3IQWA 2OLJA 2X1VA 4K81B 3U44B 1UFQA 2WIBA 3QEJA 3CM0A 3BH6A 4OKSA 3T15A 3SI7A 4MDFA 2G83A 2JLQA 4OI2A 3K53A 3ZLJA 3B82A 1E2NA 2RB4A 2IEYA 2W83A 3MD0A 1OW3B 4ON9A 4GZLA 2GXSA 4L4UA 3L2OB 3AM1A 5CDFA 4BE7B 2PX3A 3A1UA 4DXAA 1NG1A 1X3SA 4O3MA 2G0NA 3QKSB 1U2RA 2QQEA 1A82A 1ZRHA 2EFDB 2OXRA 4CRWB 3IO5A 2FX3A 2QBYB 1D2NA 1OF1A 1X6VA 2R6FA 3A4NA 1GWNA 1E2MA 1VCOA 3N2EA 4UNPA 2FSGA 1RKBA 4Q02A 3A6PC 1BMFA 1TUEA 3KXKA 3MJRA 2J1LA 3U6KA 1HQYE 4C7OA 1II8B 4NL4H 2UZ3A 3ONWA 1X8JA 1G3UA 4U5XA 3T61A 5DN6A 2MSDB 1DAMA 1E94E 1KSFX 1VCMA 2GXUA 1GTVA 5FL7D 5IT5A 1AM4D 3FMIA 4OQMA 5G3ZA 2WM9B 2XNDA 2BBSA 2PBRA 3GFPA 4M21A 3U61B 5FR1A 4XWAA 1XMVA 1JXMA 4O2LA 2I1VB 4RZ2A 1OHHD 4X8OA 2FFAA 1N6RA 4GPTA 1P62B 2G6BA 2ZSBA 3GLGB 4F38A 1S2MA 2XTZA 1E0AA 3SFZA 2IS1A 2GNOA 4ZDWA 4DSUA 1E3MA 3Q8XB 4UXJA 3IBGA 4Q1FA 3GLIB 2H1LA 2QMOA 3K0SA 1F48A 3QKRA 4AYXA 3U3RA 1KDRA 1P5ZB 3QENA 1G3MA 3DZDA 3CZQA 1NKTA 1GFIA 2WJIA 5L3QB 1VG8A 1HT2E 3RABA 2WHXA 3K09C 1O87A 3CRQA 4M4SA 2FPLA 2OZEA 3ZQJA 3WYGA 2W2XA 2IUTA 3F3YA 3BK7A 4B32A 4UJ5A 4HUQB 2C95A 2RHMA 5E7IA 5JZVA 4Y0AA 2ZI5A 3WRXC 1G17A 4FIDA 5GVSA 1UKVY 2FF7A 1WB9A 1DTSA 2ZVQX 3T35A 4EKDA 1W0JA 5FR2A 3DKPA 2NMVA 5GJBA 2ZE8A 5DGXA 1NN3A 1QHXA 4H1VA 4DLUA 4AK9A 4WXRA 1CTQA 1ZBDA 3ZS8A 1CS4C 1R10A 3EZ2A 4L8GA 2CLSA 3THOA 1DOAA 2ZTSA 3SS8A 1E79A 3W6PA 4EIWA 2QGZA 2NPFA 3B1YA 4JVSB 4TT3A 2YWHA 3KFXA 2ZUDA 5E95A 2QENA 4QXAA 4CF7A 3IHWA 4C7OB 2O5VA 1J8MF 1G8GA 1WQ1R 2GEDA 4KCGA 4NE2A 3NBZC 5JRJA 3DEFA 4FMCB 1ZU4A 2FV8A 1E1RA 3BERA 3C16C 4DLVA 1CR0A 3LBNA 1NVVR 3QPVA 821PA 3CF6R 3X1DA 3I1FA 5G53C 3IILA 5HKKD 4M9ZA 2ODNA 2BKUA 4PZYA 4P4SB 5KTYA 1E0KA 3OEHD 4C9BA 2XZPA 3PUXA 4NMMA 4KVGA 4GMDA 1FUKA 4Q7JB 1NI3A 4PC1A 4DB2A 2A5YB 1KSJA 2BCJQ 5TDHA 2OESA 1A1VA 5EUQB 3SZRA 1D8TA 4HZUA 2BC9A 1IN4A 4HZIA 3CX8A 5H8WA 2J0SA 1G7CA 1KDTA 2BHRA 3WHKA 5L3SA 3I5XA 2ZJ5A 3TR5A 4B33A 2DWPA 2JIZD 2ECKA 4ACAA 3VKHA 2ZXUA 3ZVLA 1P61B 3CNOA 3AKCA 4B3XA 3GLFA 3BFVA 1JEDA 2FGJA 3KJEA 1P2VA 1T3SA 4I4LA 1HUQA 2ZRNA 2JLUA 4NYJR 4B76A 3ADKA 3QXSA 2Q9BA 4LJ7A 2FMXA 1CULC 1JI0A 1G5RA 1TF7A 3OIVA 1Z0KA 1IN6A 4FWIB 2FSHA 1ZMXA 4HB2A 4YDSA 1YU9A 4URUR 1KAGA 2IWHA 2P67A 3LQRA 4G5OA 4OK6A 3PQCA 4B73A 1CRQA 3H1TA 1EWRA 2VP5A 1UKEA 2WWWA 3REFA 4PO8A 1E1QA 1E99A 3SYLA 1E2FA 1ZCAA 3GD7A 3IEUA 4JL5A 2JLWA 4UXHA 2JGNA 3QVVA 1MO4A 3H0KA 4LCBA 4Q4HA 3UKDA 1H8HA 2J5XA 3K9GA 4IW3B 5CJPA 2E9SA 3KFVA 3LNCA 5TMPA 3FTQA 1W4RA 1U0HC 1ANKA 3QJYA 3CX6A 3BFXA 2KJQA 1YZLA 3LY5A 4JLBA 3R7WA 4LPKA 5AWFC 2WOJA 4IXMA 5KNCA 4I1SA 4R2HA 2V7QA 2ZJBA 2PEYA 1C4OA 3LVRE 1TU4A 3Q9LA 1QDEA 4YMTA 1P6XA 3RAPR 3FOZA 4XD7A 2W00A 5AJYA 2IXEA 2W2TA 1KK3A 3ECCA 3AEZA 3ND8A 1E0SA 4DLZA 1NY5A 2N42A 3AVOA 1SGWA 1KI7A 5HZKA 2P5TB 3MJHA 3AF0A 1LB1B 2HXSA 2IW3A 5C18A 4HAZA 3NBYC 1EK0A 5HZHA 5EXTA 4TTRA 1EFRD 3B1ZA 4DIDA 4TLBA 2IYXA 3EZ6A 1ZP6A 3EIQA 1JQLB 4FMDF 2YC2C 3A1SA 1P4SA 3TW4A 4ZKEA 3W8RA 4ITRC 1EXMA 4Q4AB 2FSIA 2XOKD 1G6HA 1TAGA 2OFXA 4MGZR 1L8QA 2QPTA 1JQJC 2QSZA 4YMWA 1UF9A 1G18A 2IF2A 2CHQA 4DWJA 3W6OA 3ZVRA 3HU1A 2IWRA 4B43A 2YNMA 4BECA 1KIMA 2OV2A 1XPRA 1SKYB 3AVUA 3TKLA 3OEED 3GJ3A 1KNXA 2XAUA 4ZI3A 1E2HA 2FDCA 5AR1A 1P9RA 3OHMA 2BJVA 2J41A 3WMEA 2O8DB 3LBHA 3L43A 3K0EA 1S4QA 5FI1B 2CE2X 4B71A 2O8EA 3X2SA 3NBXX 3SJCA 4KO8A 1IQPA 1G21E 3QQ5A 4RFVA 4R71A 5FH9A 2B8TA 4D4KA 4Q4HB 2HT1A 5DIFA 1GIAA 2DFNA 1KNQA 3NVAA 3PUZA 1VG9B 3B5JA 1VCIA 3U2QA 4B3BA 1HQCA 4TYWA 1UAAA 4X8LA 1FFHA 1AS3A 1EX7A 1Z2AA 3B2EA 4GRAA 3U3MA 3R7WB 1OXSC 2GJ9A 4BLSA 4IKEA 1VPLA 3Q5DA 3LW7A 2J7PA 3B6EA 4HB3A 4XIGS 1LV7A 1NMYA 2GESA 1G7SA 1SXJA 5P21A 3R8FA 3CRMA 2A9KA 1SHKA 2VP4A 2YJTD 3VR3A 5JWOA 3WBKA 4MGIR 1R5OA 5B58C 4XTCS 4Q03A 4DBLC 1NN1A 1IN8A 3EC1A 2JLSA 1OIWA 3NHAA 3KXLA 1XWIA 4PC2A 2YV5A 2IXGA 4F91B 3PR1A 1ZNZA 2ZS8A 4UQOA 3GLGE 1R2QA 2AKAB 4NKRA 1J7KA 2WKQA 2J7KA 2AWOA 1XJ0A 4MDEA 3CKLA 1XZPA 3GLIE 2DBYA 2KI5A 3W90A 4BFZA 1UKZA 5EZ6B 4A2WA 4LHYA 4PQRA 1G8HA 2RHDA 3QXJA 2O8FA 2RKOA 3P4YA 2GETA 4Q9IA 4OQLA 5EE3A 1OLOA 2D2EA 1Z0JA 4JKYA 4RY2A 1TQDA 3DO6A 3R9IA 2P6NA 2N1BA 2WPDD 4M8NE 4LBZA 2C9OA 2Q9AA 4S35A 2QRNA 1DAIA 4OHYA 1ZD9A 1DAKA 5JCZA 2ZETA 4TMWA 3G0HA 2OEPA 2FZ4A 2EQBA 1PZNA 4QJ3A 3AVVA 3I61A 2WWXA 3OIYA 2GZAA 4M1SA 4DT1B 1DVRA 5DI3A 2G77B 1GUAA 3KQHA 2ZYTX 3ADDA 2IXFA 1KOFA 1IN7A 4EFMA 4GT1A 2NZ8A 3D7MA 1JECA 2AXNA 3Q3JB 5UKDA 2ANBA 4BFWA 2GHIA 2XB2A 1PLKA 1XU4A 1AQUA 1W5TA 4DCTA 2Z0MA 1E2GA 1P9WA 4EPTA 2NZJA 3A1VA 2PX0A 3QKTA 5IK2D 4OJKA 2GEVA 4KYUA 2JLZA 3CR7A 3U7HB 1KO8A 3W6NA 1E69A 1T3HA 3PV0A 3Q72A 3TMKA 2GJSA 4JLPA 1KK2A 3UANA 2J59A 3I5YA 3W5IA 621PA 5JS7A 3IPXA 3KXIA 5KNDA 3U7GA 1OFUX 4C3ZA 4ZCMA 1T0JB 2ONKA 5FPTA 5AK0A 1DE0A 1OXVA 2HYDA 1XTQA 3IIMA 4YONB 5JEDA 1Z28A 1WA5A 2CHGA 3AP3A 3W9YA 4LJ8A 4DVGA 2AD5A 2G88A 2O8BA 4ZIRB 1YKSA 1AZSC 1N5LA 4X8HA 4DLRA 4KLZA 1GNQA 2WJGA 4RD2A 1NN0A 2MMGA 2B92A 3CLVA 4M9QA 2ZRDA 1Z8FA 4XVUA 4RVCA 2ZU0C 3O8CA 4OHZA 2QN6A 2HLDA 3A1WA 5CITA 1UJ2A 2X2EA 4MYCA 3VR5A 2KBEA 3EPJA 3IEVA 3KB1A 4JSTA 5JSZA 4OHVA 4M1OA 1IXZA 1Z29A 4IXNA 4JLVA 5FOUA 1YZGA 4A15A 2AK3A 2JA1A 2QU8A 1MO6A 2PZGA 4GFDA 1PLLA 1XCPA 2O0HA 3AB3A 3HYRA 1ZUIA 4ARZA 5JLJA 1KI6B 3WRYC 1FZQA 1G7TA 1S3GA 3BAFA 2HJGA 2KB0A 2XXAB 2WWIA 3Q7QA 1S96A 1GITA 5EUMA 1G291 5DI3B 3WMFA 1YR7A 2GZDA 2QPOA 4GBMA 1Z2CA 1Z6TA 5KDOA 4LDJA 3FHCB 1S1CA 1OV4A 2VL7A 3VKWA 2ZSAA 3JVVA 1LS1A 3SJZA 3CRVA 3TW8B 4TZ0A 2OCPA 2IA5A 4QBIA 1OB2A 4F93B 4FINA 4WA7A 2R44A 2F7SA 3IHLA 1ETUA 4XTRA 1S1MA 4PANA 1U81A 1W2HA 1Q1EA 2V1XA 1SVMA 3PUWA 1AA9A 2YINC 3B13B 2ZJ8A 2C9CA 4URYR 3SJBA 4RD6A 4AC9A 4D26A 2QRZA 4C0HA 1LFDB 2F55A 2GZHA 2HCJB 3VR1A 1EGAA 5KU1A 2BMJA 4EJSA 4NH0A 3SN6A 1W4CA 5J47A 2WWYA 4LYFA 2Q0HA 1M2OB 4BFTA 2QMUA 1ZM9A 2VQSA 3MWYW 2XNDD 2AL7A 4RD1A 2PT7A 4CEIA 2QROA 4NCIA 2ZAOA 2QUZA 2WMOB 2G9NA 2VSXA 3MSXA 1NIPA 2QM7A 4P3YA 2B7BA 1IOZA 4Q4JA 2XEXA 5H70A 2AXPA 1KMHB 4Q1DA 4XSGA 2RGBA 1DS6A 1TEVA 3MRSA 2Q6TA 2QTFA 1H8ED 1R7RA 1TPZA 1W47A 4YXWA 4H1UA 1ZC3A 1YZQA 1RRPA 3RS7A 5F9FA 1GZSA 1OJLA 2ZI7A 3A36A 1T5IA 4QNMA 1LVGA 4Z8YA 4ACBA 1IHUA 1XNJA 5L8VA 4W5HA 3ASZA 3DMDA 4D81A 4IOMA 1KI1A 3IGFA 3DVLA 3KKPA 3U44A 5KPDA 3P27A 1NN5A 3LD9A 1FMLA 1I4TD 2IL1A 3A4LA 2JJ2A 4JLDA 3RRMA 3MFYA 1IJEA 1N6IA 3MMPA 4D80A 2GDJA 3AQ4A 5G41A 3I8XA 4FCTA 1OYYA 3VR6A 1RYHA 4DLXA 5FI0B 4I1OA 1YHNA 4NCKA 4QRHA 4ABYA 3IUYA 1SKYE 4C2UA 1QVRA 3BJIC 3EZ7A 3W34A 1W0JD 3QKSA 1PVOA 4Z54A 4KSBA 4UNNA 8OHMA 3LWNA 1K5DA 2OE2A 2QE7D 2G3YA 4IOKA 1N5IA 4JJZA 4LJ4A 1XMJA 3TUJC 2DWOA 2G1KA 2KE5A 2ZI3A 3FMFA 2QBYA 3HDTA 2AK2A 1FOEB 4PXAA 2PCLA 3FGNA 3M6AA 1E32A 3PXGA 4AYWA 3J81k 4ASUD 1U0JA 1XD2B 5AJVB 2FA9A 4AG6A 1VG0B 3U7EB 3GEEA 1ZUNB 2D7DA 1GAJA 3GLHA 3KUDA 1II8A 4TT3D 1U8YA 3QKUA 1Z5ZA 2ZU6A 3OESA 3RVBA 1XTSA 2CHVA 4GSYA 3K0CA 1A2BA 5EE5B 4BZPA 3CPEA 4H9GA 1RRFA 1VYVA 4JLMA 1TQ4A 4W7SA 5DH9A 3O8DA 4HUTA 4QC2A 5KYKA 3LXXA 2EFGA 4B3CA 3FVQA 2ORVA 4LC0A 1YR6A 3EWAA 5JJKA 1G16A 1ZUHA 4HSEA 4IRUB 1GRQA 1R0XA 1LNZA 1TF5A 1XJQA 1ZIOA 3AVTA 4NTZA 3G5UA 3NTUA 3QBVA 2OAP1 3LVQE 2D7CA 2UVQA 1Z0IA 4Q4JB 5A4JA 2JLXA 1E0JA 3O8RA 1NL3A 1W4AA 5H68A 3GLIA 1JAIA 2MMCA 2Q9CA 2TMKA 1W46A 2WJJA 2J9RA 3EC2A 3NC0C 1PUJA 2QAGC 5BN3A 1XEXB 3QF4B 3L8ZA 3GFTA 2H8KA 5KUTA 2ZQ5A 4DCSA 2WICA 3E5HA 4V0LA 1HE1C 2P0EA 5SZHB 3VNUA 5JJLA 5L3QA 5HCNA 1Q0UA 4PAQA 5AUOB 1Q22A 1CU1A 1VIYA 2ASEA 3HYTA 2BBOA 3ZD6A 3SU8A 4HUQA 3E2IA 4GOXA 1CEEA 1CF4A 4G5GA 5D3MB 2CCGA 4OK5A 1OXUA 5KDDA 3EXAA 4PTLA 4CT5A 4KSCA 4XOIA 2VA8A 2GEUA 4CYMA 3SFVA 1UBCA 4MRPA 4MRRA 1N6NA 4QGAA 2BWJA 1U94A 3DMNA 5E4FA 4TMZA 1NF3A 2XSZD 4JL8A 2RCNA 2QORA 1IXRC 3B78A 2F6RA 4HATA 1OFHA 3K9LA 3EIEA 2ZANA 1Z6XA 4LJYA 1E2KA 3CUEF 1Z63A 3QUSA 1W44A 1S9DA 1IY0A 4ZDIA 2C78A 1E1QD 5FUYA 1E2LA 2QT0A 4M1YA 3EWSA 2A5JA 3EZ9A 2CE7A 5LDDC 2IYTA 1NSTA 3GLHB 3P20A 1LF5A 4IOLA 5DHFA 2Z4SA 2IT1A 4OHXA 4E03A 5B30A 3KQLA 2YWEA 2F43B 5KO2A 2PJRA 1E96A 5JBQA 2JDIA 2A7QA 4JS0A 3WXMA 1CRPA 1SXJE 3PEVA 3N2IA 4YMSA 5FUXA 3RDPA 4DKXA 2PZEA 2ZRKA 1QHHB 1X8KA 3L8YA 3PVSA 4ILEA 4KBFA 4P4SA 1NJGA 4TMVA 3UWKA 4Q48A 3ZJYA 4XD7D 4BLRA 4HLCA 2HXYA 2A2ZA 3F8TA 5DLQC 1G1MA 1YVDA 4NDZA 1P9NA 1X1RA 2P5SA 1KJZA 4IJMA 2BMEA 1VDZA 3Q5EA 1IXSB 3GJ8A 3RC3A 1T0HB 3I73A 4DC9A 1JPJA 1N25A 3FPAA 1FMJA 5SZIA 1Z0AA 1XRJA 1DAFA 4MKFA 2OUKA 2QA5A 1TF2A 4BPBA 2P65A 4Z1MA 1TNDA 2AWNA 4XWOA 4G01B 2CL7X 1JR6A 3PIRA 1VCNA 5CIQA 2D4HA 2NO9A 1UPTA 4WZBE 5EE0A 4URVR 2GWHA 4RZXA 3OE7A 4OQNA 1G5PA 4PPQA 3DOEA 5JHGB 2DHRA 2FFHA 2GAAA 5L3RA 3AGQA 3CB4A 3KKNA 1II9A 4ZDJA 1GKIA 2IF0A 3EG5A 4CIDA 2ZYVX 3D6TB 3TVTA 1NVXQ 2O0KA 1Z06A 4TYYA 4AKIA 2FSFA 4CEHA 1G9XA 2QGNA 1G8YA 2QAJA 3I72A 2QTVB 3PITA 4GI7A 3U4QB 3PCRB 2GXAA 2VHJA 4LWZA 4TLEA 3VR4A 2AKYA 1OIXA 4JKIA 2F1JA 5LB2A 4FN5A 4O2RA 5J4VA 3BWDD 3QG1A 4HAYA 2OFOA 2P2LA 5D3QA 1NBMA 1GRRA 3BFKA 3PG5A 5E3HA 4M0LA 4QG7A 3W8NA 3H4MA 1ZW6A 3WY9A 2E1RA 4LV5B 3GQBA 1JR3A 5EP1A 1XTKA 1Z0DA 2BVNA 2C04A 4KV9A 5TY0A 1SHZA 3R20A 4C0AC 1RRCA 2NO0A 5BXQC 4FI3C 1KI4A 3BXZA 3DM9B 1HURA 1ZYUA 4DLSA 1MO3A 1U8AA 1XFAA 2C96A 4C0JA 4KAXA 4DEXA 1DADA 5KSOA 3KQKA 2V8OA 2WJVA 3BB4A 3LX8A 5FBQB 4Z51A 3EZFA 3P26A 2P6RA 4C2TA 2W6IA 4Q47A 3OIUA 2OBLA 2MSCB 3K70B 5IF9A 2RGEA 5LBIA 1E2EA 1G64A 3D3QA 5FBLB 2YYZA 3SEAA 2OM2A 1TTTA 4KFTA 4RFSB 1ZM7A 2ZS7A 2J0QA 1LTQA 3EAQA 3AUYA 1JJ7A 3PEYA 4JLJA 1Q20A 3N70A 4IDHA 4W5JA 2ZJYA 2ZJZA 1SZPA 2GJKA 5ANRB 3AUXA 2GJ8A 1RFLA 5FPSA 2V6IA 4LPSA 4Q4AA 4B34A 4DHEA 1WBDA 3MG9A 2PLRA 3UWOA 4LBVA 4CT4B 1AKEA 1W36B 3AF3A 4OI1A 4IVRA 2WSSD 3KKOA 1MKYA 5FTJA 2C03A 1XZQA 2GCPA 3CR8A 3L0SA 2OBMA 2CL6X 4C0LA 4EPWA 1KO1A 3IO3A 4A92A 3BB3A 2GRJA 4CEHB 1A4RA 2CJWB 4A0FA 3DZ8A 1JPNA 2BCGY 4WZ6A 2VRWA 4HAXA 3JZAA 2O8CB 2QP4A 2ZE6A 3VU9B 4RKFA 1KK0A 3KZ1E 421PA 5B64A 2ZJOA 1B23P 2YVUA 5G40A 2VYFA 2O8DA 3I62A 2OFWA 1X86B 3VMFA 5EXPA 1Q1ZA 1GDDA 1ZJ6A 3G82C 3MGCA 1HV8A 4A6XA 4NU0A 4B6EA 1CR1A 1HE8B 1AGPA 1VIAA 1F3OA 1MABB 1PJRA 2ZRCA 521PA 3THXB 4URWR 4AY2A 4WXPA 2WJYA 3ZIAD 4JT4A 4P31A 2QEQA 4ZDKA 2QM8A 2LKDA 2QT1A 3SQXA 4YQFA 1P2UA 4KHZA 2VTKA 1FNMA 1NVUQ 3THWA 1NG9A 4MRSA 3Q7PA 3THYB 4OYHA 4QBFA 4PHHA 4HLDA 1OT3A 1VMAA 1TUIA 3LBIA 2V55B 3PEUA 1XMIA 4URXR 3WYAA 2BM1A 1XB2A 4LYHA 2IHBA 3C4JA 5FUWA 3ETLA 4JJKA 2ZRBA 1Q12A 2QSYA 3TAUA 5JI2E 5F3WB 2EFCB 2CLDX 4OQFA 5FL7A 1ONBA 4FW9A 2KWIA 3VNVA 3ZH9B 2R62A 2F3RA 2KBFA 3OAAD 2RGGA 4DLWA 2UZIR 4DDWA 2YWGA 3BC1A 1AIPA 2FFQA 3K0AB 3K8YA 2D62A 3HU3A 4DRZA 3W3AA 3BBPA 4IDQA 4QGFA 1YR9A 4DSNA 3CWQA 5TB5A 4OI0A 2LCFA 3MUFA
chains in the Genus database with same CATH superfamily
1NJSA 1V1RA 4LVCA 4BN0A 3ABZA 1XTRA 4G5QA 4GOOD 1VXOA 4LYJA 1CNMA 1YCHA 3L93A 3QOFA 1DCFA 1G63A 4BVHA 2HO4A 1X8LA 3WYFA 5J2UA 3D7LA 1G5QA 3IQDB 5A4DA 1UPCA 5ESRA 3C5HA 3EWNA 1Y4DE 2EZUA 3IPRA 3QWIA 2ROQA 3TAHA 5A0FA 4UTZA 4FSXA 3A32A 4AKSA 3WIUA 4E09A 4I46A 4EGCB 1XD9A 3L4BA 1E2DA 1LFAA 3F71A 4G0MA 4P0TA 1HYGA 1AUQA 4TZ6A 1TZMA 5E7JA 2XGGA 3FCSB 2IC5A 4FZVA 4E2XA 3EQZA 1TECE 1VSQA 1V95A 3DZIA 3I5AA 4DT1A 5BSEA 1H0HA 1RXSA 1FUUA 1X1QA 4NJEB 4DSOA 1CETA 1N0VC 1L4KA 1GADO 1DI0A 1HDIA 1HT3A 1YT5A 2EKPA 3TIXB 1O03A 1Y3BE 3NR2A 3PCTA 1KAEA 1NW3A 2FN4A 3H9EO 4LSMA 721PA 4U7WA 1KR2A 3AT1A 3F6SA 5EJMA 4BE9A 4EFNA 2E4ZA 1GSIA 4NH4A 2O8VA 2PUCA 3P19A 4LGCA 2QXYA 2EBHX 5ALRA 1Z22A 3KE8A 4WDRA 1NXTA 4P4UA 2PRSA 2Y9MB 4MQ6A 4ND4A 4US0R 3E9DA 1T91A 1KSHA 3P0EA 4GPBA 3IFSA 1QWSA 4YJFB 3WHLA 4CV1A 1KWKA 2PBFA 4K05A 3A6EA 5AYVA 3ZBPA 2ZRJA 2NUAA 2Z8YM 3GLHE 1MEEA 4C22A 1FRVA 2QAGA 4NHOA 4BB9A 1EWQA 2DMRA 3LHFA 4K28A 4LY6A 3E81A 5JQGA 3U19A 2ZE5A 4PSAA 2D2IA 1TPYA 1TMYA 1AQYA 2HF7A 3L7CA 1BRMA 1G55A 2L18A 4QQRA 3W06A 1KJ8A 1YHZA 1E7RA 2V5VA 3V4FA 4L27A 1FP2A 2PHZA 5D85A 4B44A 4BKQA 1IULA 1FP1D 4E21A 2PU5A 2R6HA 4G1CA 1R8YA 4PPYA 2VI5A 3FDIA 4WH0A 5ILGA 1BIFA 3K7EA 4M1QA 4R9NA 1Q91A 2FG7C 2WE7A 4E2ZA 2C3OA 3Q6NA 3AH8A 5K01A 2AZXA 1PJTA 5SYAA 1I0IA 1Z6YA 3BOSA 5IXYA 1M34A 2IEGA 1GILA 2B30A 3ZHUA 4CMBA 2HXGA 4ZIRA 3CWZA 3K6SB 1GR0A 5LUAA 3MPOA 4EF5A 1YR1A 3HP1A 3T54A 2D3WA 3PFNA 5JXWA 3AVPA 4BMSA 2IELA 3PD0A 1M1YB 3GGSA 3D4OA 4JYBA 4ARBA 4G25A 1QR6A 4XSHA 2JEOA 3H13A 1Z26A 1SPXA 1A7KA 1B00A 1ZY2A 4TWZA 3VUFA 3LLCA 1T8UA 2H1OA 4JASB 1YJ5A 4J0GA 2JD1A 4B3FX 2V9PA 1OAKA 4IQGA 5EPOA 4A03A 1XCGB 1CIPA 2R68A 1DEKA 3UT5A 2FUEA 1VM6A 1KP2A 4BNFA 2OC4A 1FFWA 1MDFA 4HQRA 3UPUA 2C8JA 4CM6A 2BL4A 2C7PA 1KI6A 3VPBA 4ZJZA 3MWKA 4FYHA 5E6UA 3UFXB 3AIKA 1GPAA 4GWGA 4IUYA 2FZKA 3IKVA 3AGPA 1PWZA 2GKSA 4Y0VA 4RK7A 3GJ6A 3EULA 3IALA 1JFLA 3OETA 5LDGA 3REQB 3RV4A 5LQMA 3C3KA 4BMNA 2I4RA 1QHGA 3I28A 5J4LA 5FOXA 2QMEA 2Z57A 3OF2A 4IRXA 1OIVA 1OX4B 1N7HA 1RI3A 1D4ZA 3ILVA 4KQ6A 1G5TA 1UPAA 1FSZA 2C58A 4R8VA 1JAYA 1OI3A 4C1NA 4CFSA 2MR5A 3RYCB 4BIIA 4LEIA 4QO8A 3ZC3A 1L4EA 1PWHA 4LGVA 3EGVA 5FWXA 1HI9A 3HABA 4GUAA 3V4PB 3RCBA 1N3BA 4IQ4A 3PE3A 4Y6LA 2JH8A 3JASB 3I2YX 1U3UA 3WL5A 2Z5FA 2EP7A 2QQGA 1KOGA 2WJWA 3ELBA 1UDAA 4YIHA 4INPA 2I99A 4FM9A 1RI4A 1JHXA 3O8LA 2J45A 4QTXA 5IC5A 2FFRA 3WLLA 4LGYA 2Z2XA 5A5GA 3L4JA 2J3LA 1CG6A 1D09A 1I3OA 2NO4A 3LV8A 3GEIA 1O0SA 4TMTA 4MJXA 5EUBA 2RD2A 2AS0A 4FK8A 2I9PA 2QL6A 3GMTA 2VSQA 4IV5A 3B9QA 4TROA 2QRPA 3M2TA 3WLFA 5AW3A 1XZAA 4WAUA 3R6LA 1CUHA 1LJLA 2XRFA 3R8CA 3X1YA 3UUFA 1TZJA 5JFOA 1N57A 1OKKA 2RHOA 3IIKA 3N87A 4WFJA 3WP0A 4HAIA 1T4GA 3MLEA 1AMUA 1BS1A 1ZEJA 3CZMA 4HEA1 3OCJA 2C2YA 4X6LA 4MZXA 4DARA 3D81A 4NATA 2BGLA 2J46A 2RJNA 1U9YA 1DKMA 2PH1A 3QELA 3HSSA 3AONB 4KO3S 4LISA 4LWQA 4UEOA 5K3EA 2CNWD 2QP3A 3AK4A 3LRTA 4V39A 5FNVF 5ULLA 2IUEA 3KSMA 1JHRA 4M8IA 4XGKA 3FOEC 1IEWA 3BA1A 3ILHA 3HU2A 5BN4A 2J4FA 3H11A 2IYVA 2Q3FA 4C4RA 3FR8A 1BEUB 3DP7A 3Q3IA 1Z5WA 3G8BA 3X44A 4CMEC 1RM0A 1PX0A 1GUBA 2YIMA 2CMKA 5A62A 4BO2A 5IFKA 1IJKA 1UH5A 4BMDA 2Q9UA 4ARIA 1UMBA 2B6NA 2HNKA 3HKEB 4TQUS 3SIPA 3WLKX 3I3OA 1D5CA 4R1OA 1OE0A 3PPVA 3R09A 2GF9A 4QUIA 1RYDA 2H9IA 5AKJA 5EEGA 2JCSA 2VYCA 1U2ZA 5KJFA 3F0TA 3EA0A 4NYMQ 1C1YA 3PSAA 3SXJA 3K31A 3LSYA 1E9BA 4OLAA 1Z4QA 5BUCA 5JI3E 4A0RA 1NR1A 4J8PA 4WZAE 1TD1A 2P1DA 4BQQA 5BXYA 4G09A 4MWBA 1YIOA 2R8EA 2CN1A 2ZYWX 3LDHA 3TTTA 2WWGA 1NATA 1WR8A 3H86A 4MO2A 5JSUA 3KELA 2P5YA 3ND9A 1PD1A 4JT2A 1NBME 1G60A 1HFWA 3OZCA 4HPXB 4TLAA 1OBHA 5CYPA 1GNTA 1RR6A 3VR5H 1XD2A 1NVTA 2WLSA 1A7UA 4U5QA 4EMUA 7REQB 4AKGA 2CXHA 2JVKA 3H83A 4J2TA 2Y0EA 1A5BB 1K6JA 4FFDA 1NUPA 4YK7A 3VO9A 3NHSA 4B3MB 2GN0A 3NCTA 3TM4A 4FMDB 3RHFA 1RZ3A 1RXYA 3B3GA 1W8DA 2M6RA 3KLBA 3M5PA 3CKMA 1LSSA 4A82A 5HDBB 2XKAA 4GEGA 4GNKA 3ROEA 5JAIA 1B16A 1BFKA 1UIMA 1PV2A 5J1SB 3ZVMA 1GRNA 1RJFA 1XN1A 2PSDA 4PCVA 5ICFA 1YR3A 2CGEA 2YJGA 2JC3A 3A6GA 4UEKA 4AJEA 4M55A 3EW9A 1UQTA 4L5IA 3TQTA 3OEYA 1IDOA 1T6NA 1S0UA 3VOSA 2GVNA 1KVRA 3IKLA 1V47A 5HJ2A 4LYGA 3TR0A 1EP3B 1FP7A 1YDMA 2RI6A 1OSNA 2HWUA 1E3QA 3IVRA 5IZCA 3A6DA 1LPAB 2QTLA 3IC5A 3QF4A 4HDCA 1E3IA 4EG6A 1R0YA 4DA6A 5D87A 1LC0A 4JWTA 4DNFA 5K1ZA 3IDFA 4AKHA 1ZD5A 3AYXB 4HDOB 4ML3A 2BTEA 1RWVA 1WD7A 2GM3A 3G7SA 4F3TA 1QVAA 1KHTA 2Q99A 5CIYA 2QOEA 5DASA 5H0IA 3RG2A 4DMCA 4QNNA 3KZCA 4WACA 4JLNA 4PHFA 5KAMA 4AJIA 4POAA 1WDTA 2DM6A 1DEXA 2VF7A 4BNIA 2GO7A 3UCEA 2OZVA 2DUUA 4FMCF 4M98A 4LAFA 2XMDA 2JJ1A 5I7FA 5JNWA 5LQUA 5CA1F 4JP2A 5JEEA 2J5BA 4I1VA 3U3ZA 3U3JA 2VATA 3D8HA 4ICIA 3AY6A 3OKPA 4ZO8A 3NC4A 3AI1A 3ILSA 5IH7A 1NJ5A 2ISCA 1GQQA 1MH9A 1NNLA 2D5BA 2Q1YA 3EVNA 4WCFC 3RH0A 4DSAA 1J56A 3QQPA 3WX0A 3H7AA 5ISMA 1RXVA 2QVLA 1DBWA 3DFUA 4TLDA 4YI5A 4YYEA 1N8KA 2KMLA 3AUUA 3VR4D 1B8OA 3GDFA 1SC6A 5CM8B 4EM6A 2ZRQA 3EQ9A 1VSUA 5FHQA 3GUYA 4R2XA 1KVTA 1JX6A 3SJ7A 3WLSA 1ZESA 2IYQA 1EDZA 4IH4A 4LDQA 1CZNA 3I32A 4IFBA 3ROMA 3WGMA 3IDSA 1DB3A 4BO1A 4Q6WA 4IAOA 2VPXA 3A04A 1K66A 1WUJS 1P1KA 4LCEA 3L6CA 4RCYA 1XRRA 4ESVA 4Z9XA 3R8XA 1AGXA 2FSVA 2V7GA 2DHEA 4LIPD 3TLJA 3JYQA 3Q12A 4DJJA 4KGZA 5CFNA 1Y3HA 1XE3A 4K6HA 4X1KB 1F60A 4IIUA 5DXJA 4L4ZA 2VHQA 3NXKA 1GCAA 4OIMA 2GM9A 4Y3UA 5P8WA 3T5CA 1QHHA 3G2QA 3HNPA 4UDYX 2PKXA 2WB2A 1QH8B 3SYMA 1LRKA 4Y6QA 3PPWA 4GPD1 4QNRA 3NEJA 3OA2A 2ZXUA 4K1LA 3E53A 2H16A 3EBLA 4E31A 3NV9A 1YQDA 1Y8CA 2NV6A 2XECA 2X9VA 4J0FA 3KVVA 4Q5IA 4PG4A 1F9EA 5CGQB 4F2PA 1H4TA 1Z2PX 3CF2A 2BSQA 4KK4A 1W0KA 4FYYA 4RTOA 2GM4A 2DP4E 5B6JA 5MN4A 2INGX 3DNMA 4JI5B 4C5CA 3V2IA 2NACA 4R1PA 1ZH8A 1J24A 4DLKA 4NMHA 4RMGA 3KALA 2Q7OE 1B0UA 4XGRA 4KODA 5CM9C 4JUCA 1T1GA 3SZMA 3ZU6A 2JGIA 2ZPUA 4O3FA 5FUVA 4MS3B 5HIIA 1KH3A 4PG6A 1E3WA 3UV6A 4CMHA 1XP8A 5DJ5A 2VRNA 4GUDA 4OBEA 4B8WA 4CKEB 3AF2A 1YA8A 1F2TA 1HSOA 1PV1A 1VHTA 2QG6A 5IAKA 1YUBA 1B1CA 3FFTA 1U2DA 3EXEB 1I7SB 4MUKA 2ODBA 4O4LF 1BG6A 3VVLA 1B6TA 3K9NA 4DTCA 3C2QA 4F71A 5JANA 4KUEA 1J00A 2UVPB 2YIJA 4UEWA 4C7MA 2IE0A 2WV9A 2DY1A 1TQHA 2BFOA 2ZM5A 3LQ2A 4M1MA 1QV9A 2CB9A 1G8SA 4DDHA 4YLEA 4MWDA 4P7BA 1W48A 4LDPA 2R60A 1O0CA 1QO0A 3K71B 2PGLA 3TH5A 2G1PA 2GCOB 3O8NA 2IX3A 4FNGA 3H17A 1P4AA 2B1QA 2H4HA 3BMOA 3LRXA 2L2QA 3DONA 4U7GA 1M72A 3AVQA 3TTUA 3C14C 1I51A 2RHGB 4ZTZB 4HNGA 4S1PA 3Q15C 2V5UA 3SEFA 1E5TA 2BR5A 4HRVA 1WNTA 4OHWA 3GF4A 4YJ2F 5J4KA 1L5HA 3DM5A 3B1VA 3NH6A 5D00A 2DQYA 2BONA 3O8QB 1C1XA 1DPFA 3SDBA 1LK7A 4ZKDA 3IMCA 3EXIA 1K75A 3P0RA 5EIEA 1P0FA 4QQKA 2A0KA 4JI7B 1AKUA 3DT8A 4GWKA 1SVWA 3G7NA 2AG6A 2V7QD 3KOYA 5ERYA 4WY5A 4WTOA 3DE1X 2AJBA 3WOVA 3HSYA 5BSTA 1XBTA 4KR7A 3FYTA 3Q6IA 3FROA 2MR6A 1WHTB 2E82A 2Z4RA 4IMRA 2MSKA 1FDIA 1TU3A 4ZO4A 4Z9BA 2G72A 4B48A 1IUNA 1FS4A 4F3RA 2HU8A 4REOA 1Y1PA 1VG1A 2OCXA 1GD1O 3ER9A 1Y33E 4PXYA 4QUJA 1FTYA 1NF2A 4CTKA 4BPRA 3SNHA 1U1GA 3HI4A 4TLLB 3EVAA 1M34E 4JNCA 4AJOA 1JEOA 2DYKA 1N7IA 1W0CA 8ADHA 3NAQA 3JWHA 4KI7A 5DFAA 1SQ5A 5FX2A 5DV9A 3OPYI 3UAGA 5F76A 1XZDA 1SVIA 4FE4A 3WSTA 5IMSA 1OB5A 3RRNA 1JVNA 3DVAB 2X1HA 3Q7SA 4R2JA 2NIPA 1OFTA 1OH8A 5ALWA 4HRYA 4IVQA 3UJ9A 1TGVA 2PJUA 3PXXA 3V9PA 4ZREA 3ZHCA 4LZPA 2I4NA 2D0IA 2PD4A 3D3KA 3KJFA 4MVJE 1PL0A 4A91A 1H8EA 4MUFA 4G2NA 1DAEA 3UG7A 4EUNA 1U0SY 2ADMA 3GVCA 1MVNA 2WTEA 4YVFA 4JXKA 5TMDA 1P2SA 1WTAA 2NADA 1NI5A 2QD5A 2GF0A 2QN3A 2HJVA 1WCV1 2MSNA 3FUTA 1KI2A 1I1NA 3EVBA 3ISVA 4R8MA 5I4CA 2P35A 4DOMA 4CCAA 4L22A 3V00A 1W7AA 3CMCO 4PO1A 5FTKA 5BO5A 1TEHA 1JEQA 1XT6A 1UZLA 3LLUA 2NYAA 1VIMA 1FNBA 4ZEVA 4QVIA 5DEIA 5IJ9A 4M87A 2C77A 4AJ4A 4D9BA 5BYBA 2VJAA 2V7VA 1DX6A 4J3NA 2PXCA 3FPEA 1BDJA 1DMSA 4HNSA 1HTWA 1MABA 3CUWA 4UNQA 1GQSA 2FW1A 2JASA 1EUYA 4YJHB 1KO7A 1HDGO 3RV3A 2YVLA 1JIIA 2QQ0A 2WJ4A 4AWAA 4BRZA 4X65B 4Z0HO 3HGTA 4IJKA 5HMLA 3ZTYA 1DO8A 3Q7IA 3ZHSA 1TXGA 4F4CA 4CE6A 3NHBA 2I7VA 1YZUA 5LVAA 2AB0A 1E9CA 3SICE 1PFVA 2QLMA 4HDRA 4IIGA 5CVVA 1L7RA 1MF7A 4MYHA 1EE9A 4BEBA 2CLHB 3CUYA 3AMVA 4BZXA 5GV8A 3S2YA 4H18A 4L95C 3P52A 4HAUA 4E5KA 1SXJD 4B09A 2HHLA 5LOVF 3AR4A 1TOAA 3FTFA 4YAJA 3EUEA 3L0OA 2AOUB 4ZEXA 2PS9A 3P9QA 3HCNA 2H92A 4N8SA 4F3NA 2TMDA 1LS6A 1F6DA 2HUPA 2Q07A 4PO3X 4BMPB 5A03A 1F8FA 1WEHA 3ZHQA 1JG1A 2QL5A 1V43A 3GFQA 1EVKA 2JIDA 2QLFA 1QVZA 4OSPA 4B6OA 5C53B 3K0AA 4D8TA 3BQNB 1JSCA 3WDMA 3WTBA 1K2VN 4ZVPA 4ZOLF 4EJFA 4G0ZA 2M1XA 4K46A 3Q8MA 3DHVA 1P1RA 1YS2X 4GSLA 2AG5A 2NZXA 2ZAMA 4G5RA 4GH5A 4JA0A 4WNYA 3SHVA 2XDAA 1VJDA 5ALPA 3AO0B 1SBCA 1O8CA 4G3XA 5JCJD 4K9MA 4MCJA 4EQ6B 3OX1A 2JZNA 4JDPA 1EDBA 4QKQA 3SGLA 4C7JA 3AHCA 4LQ4A 3KJGA 2JANA 4P82A 4YH1A 3PC6A 2D8MA 3S2UA 3TBFA 3WGZA 4ZJPA 4B87A 4UNSA 3E05A 5AW4A 3AVWA 2IV2X 3WNQA 1WXEA 2A5LA 2UYGA 2GUWA 3AM4A 2QX6A 4P54A 4UM5A 5CT4A 1IN1A 3LFTA 3QKRB 4JLUA 2DB3A 4UHBA 4DNOA 1XKTA 1WSBA 1ZN9A 4P81A 1U04A 2YWJA 3CNLA 4YDRA 3ISJA 4B31A 1MVLA 4BEJA 4ETWA 1ZAKA 5KB3A 3HUTA 1S3SA 2BN4A 2J67A 1REQB 1BMTA 1EBBA 3FKQA 3S2SA 4BB0A 4BVGA 2CMDA 1URPA 1JLLB 2FE4A 5KWEA 2ORIA 2IYLD 3BFPA 4UCFA 3BSYA 3ZDQA 2CUNA 4A7PA 1N2ZA 3CJTA 4L72A 1KU0A 1S8AA 4PHTA 1A8QA 2QX8A 1W85B 3RANA 3S1AB 3AZQA 3BT7A 4K8OA 4TL6A 3AF4A 3DZCA 4DL9A 1GM5A 4X00A 2PL3A 1KMQA 2V96A 1Y89A 3MBKA 1X1AA 1XCBA 2C4KA 2GAOA 3O4GA 3MS2A 3IBSA 2NVUA 4HDMA 4TQGA 3E4CA 2DTDA 2ZWPA 3BH7A 4MPDA 2H1SA 4YJ3F 3ZCSA 3OZTA 4N65A 5CPBA 2GRAA 5EERA 4AN4A 4W5RA 1I2MA 1Z47A 1DT3A 2BM9A 4V0MA 5KX5A 4M9RA 3UUEA 1XTZA 1ECPA 4RV9A 3TIGA 1YCFA 4E3ZA 2H18A 1R0KA 2G5TA 4M6WB 3ZWKA 3TMYA 1KIFA 2IUYA 4BL5A 1SKUA 4U00A 4EMBA 2GEKA 5KVQA 2GHTA 1IZ8A 2CNDA 4P3PA 2J3JA 1A9OA 2E6KA 5COBA 4NZ9A 1ESCA 2JAXA 4GRDA 5LKRA 3DTVB 3EE6A 4NU6A 1J0CA 4E5SA 2WUGA 1IEQA 2PSFA 4QSMA 3QJGA 2YJ3A 1H9CA 4PAMA 3JAWA 4E88A 5IZ4A 4AQ7A 1V9CA 4ND3A 1OHHA 3U7IA 3JCZA 3P4XA 2DJ5A 1A9XA 3DHWC 1D4OA 1DJNA 3ND6A 3QPAA 4KAFA 2FWIA 1W25A 2NU8A 1X3LA 2V6FA 5G3YA 1KYTA 3WVNA 1HY3A 2Q3LA 3ULKA 4B47A 5CK4A 4WGFA 3VC3A 2OGSA 2A5DA 3IMFA 4PFSA 5KYUA 3OKAA 5EJ7A 2JPDA 4HS4A 5LFAA 4TVOA 1O0BA 3I9FA 1G3RA 2M98A 3LQ4A 5AM3A 1Y8RB 4HZUB 1GARA 4L9AA 2J5KA 5FF9A 3WZLA 5H9WA 3GRRA 4DIUA 1CBUA 5L3SB 1S2NA 3L84A 3BQMB 5AM0A 2HADA 1FLVA 3HR8A 2PVPA 4AN0A 4D5EA 1ZD3A 4FZ5A 2L0XA 1GYRA 2O4CA 1CIVA 1ZFNA 3P9KA 4KK3A 3MAJA 1QIDA 2VHYA 4UBJA 2AJDA 3F3SA 1NMZA 2G1AA 3Q3HA 2ZJ1A 1Q15A 4FFWA 1U7WA 4OU4A 5E7MA 4BO4A 1RAIA 5JTTA 2AMLA 2PMFA 3H6GA 4PS0A 1GZ5A 3NWEA 2OA0A 3DLHA 5KYGA 2JJ8A 3CH4B 1ZKDA 3IAEA 1R4NB 4H6PA 4WJLA 5K8IA 1W5BA 2BMDA 1VFPA 3BN3A 1JZTA 3G6WA 5K8VA 3IUBA 3ORSA 3GH3A 2OPBA 3KYDB 1W19A 4OHRA 4WOKA 3CPJB 4M8SA 5KKAA 4P5DA 1XEAA 1GXSA 2J87A 3CSUA 4LW8A 1JHZA 2VSNA 5KQSA 4MKHA 1O94A 3BTVA 4IXTA 4J0QA 5BNWA 2GXQA 3WQBA 3ORYA 5EQTA 4BNYA 5LYYA 2IZ7A 3SIRA 2DWCA 5EHNA 3EPKA 4LGMA 5CW2A 2O7NA 2AEMA 2IHYA 4FR2A 3FHTA 4TXJA 3ZV3A 1SCNE 2DULA 3C4VA 1QAQA 3IOCA 3L07A 3OF3A 2P3OA 3QX7A 1MGOA 2C7BA 4AY5A 1L1RA 3JZIA 3G0BA 5ES3A 4JJGA 3CVVA 3P2EA 1T4CA 2GK7A 4JI1B 1DKLA 1I1HA 4X7RA 1X0XA 1XDSA 3JQ9C 3B7PA 4OL0A 3GO4A 3K6RA 4TX1A 3GPCA 4KQ1A 4HH3C 4RKRA 3B7GA 4R9SA 1FJ2A 1Y8QB 2AMYA 3A1DA 3GL9A 4IHAA 1CUGA 3QPWA 4RKEA 2Y0BA 1EX6A 1KQNA 4YAKA 3LZ6A 4J4BA 3RJMA 5I7SA 3UNXA 1RJ9A 1TUGA 1CS0A 4Z99A 1KY5A 4TS1A 4BC0A 5H4GA 3GNTA 3JWJA 3E6AA 4WCFB 4P9NA 2B20A 4F2HA 1ORVA 4IWXA 4OAQA 3M1IA 4HGNA 2OSBA 1Y63A 3ZV4A 3AILA 3G2PA 3ZE9A 1QRRA 3T7TA 2ZB3A 3CH5A 3KUCA 1EFPB 5M04A 4L0CA 3O9VA 1IYZA 1C9KA 2HMUA 3WRWA 3DXZA 1DXHA 3FPKA 3QKWA 3RIGA 1D2RA 1VKJA 4Z2YA 3AFMA 4ZI7A 5L6MB 2R1TA 2FN3A 1E62A 1EE1A 3U49A 3A14A 5LNK6 4K5QA 4E5DA 4NQRA 1H2HA 3TQQA 3KK0A 2VBCA 5F3RA 1JVBA 2ZI4A 4PG5A 1T8YA 1F0PA 4RSRA 2RARA 1E2QA 2A5FA 1ONNA 3KQQA 2R8YA 1GU0A 1JFRA 1XTBA 4RQUA 4GL4A 3E9MA 3RS8A 4CN8A 4LNUB 1U3VA 2ON6A 3D2LA 2HCFA 1IZ9A 2WSSA 2X3FA 2X5OA 3E7DA 4MQBA 3OLCX 2J4DA 4KXWA 5CPFA 2Y0PA 4EPXA 1KEEA 2E1PA 2E87A 4WJKB 2R5FA 3LXMA 3HEAA 5BSUA 4YRKA 2ZCJA 4BO8A 4Z53A 4Y9SA 1AE1A 1JLSA 1TO2E 1NF8A 2W2KB 1FW6A 1SUPA 1W75A 2QIOA 4MW7A 3L7BA 2J3IA 1T5HX 5FQOA 3Q3GE 3QV2A 4TVBA 2VYNA 4I3HA 3SE7A 3IPYA 1RAGA 1CDDA 4JU9A 4TV9B 3C1AA 4ERNA 5AUPB 5JBNA 4D02A 5EWLB 2UYYA 2WUFA 1FTGA 2BIFA 2YN2A 1Q2UA 1A8IA 4G5FA 2NZVG 3BA6A 3AP1A 1A2QA 1U65A 4BVBA 1EINA 1AS0A 3RC1A 4KHPB 4BC1A 4W7IA 3ZI4A 5FEMA 5JW6A 4Q1CA 4BQIA 1CUVA 4F11A 1W6UA 1VE6A 1QH9A 1XLWA 3MB5A 2CEAA 4O0MA 1CLUA 2YHAA 2G63A 2I7DA 3CC8A 3DL4A 1KOLA 2PTGA 4FT2A 1T0PA 4Q1BA 3MINB 1BDIA 2IEDA 2DUJA 3RRZA 3U5ZB 4TQ9A 1DTWB 1GRVA 2OHHA 2YHIB 3N0VA 2GJAA 1FVFA 3B12A 4G1UC 1DUIA 3UAXA 1YDWA 4ER6A 3IUNA 3W2FA 4P6VF 5I6DA 3BWCA 4IVPA 2HA5A 4M46A 1PN3A 2HM7A 4KBGA 4UE3S 4Z0NA 4MUYA 4AUNA 1P1JA 3IQZA 4QJ4A 4OQEA 4H4CA 1E9RA 3BCHA 1TYBE 2H17A 2WM2A 1XOIA 3N7TA 2B4KA 1LPSA 2X9QA 4KH1A 3V80A 5J23A 2UXCB 4CIBA 1NYTA 4HGPA 3OX4A 2Q8QA 5EXEA 2JAHA 2E7ZA 3D7NA 1E98A 4FFVA 4IQ8A 4RD4A 3TYXA 1V7QA 1VJ0A 1MOQA 3KVOA 4ZO9A 5FTMA 3WBJA 2VF8A 1YDFA 2EYQA 2RGDA 2Z83A 1FYXA 2C2MA 2EU8A 3JQGA 4XH9B 2J30A 4ZQHA 4ER5A 1H23A 1I1OA 3E18A 5D7NA 3TL6A 2BLNA 4RUKA 1E1MA 1L8OA 3PHGA 4JVNA 2GQ0A 3PYMA 1NRWA 1EFRA 1B74A 3FDXA 5C7IO 2C2WA 3KKEA 2Z3WA 4UBOA 2AE2A 2N47A 2YJ5A 2VTBB 2IEIA 4J2OA 3RSLA 2P9TA 2OY0A 2HI0A 4UUPA 1EK2A 2VH2A 4RPLA 2CXUA 4QPDA 2XUDA 2P1ZA 1JE1A 1RQGA 1V5GA 4P8RA 5AVJA 5IT9A 5DM70 3D1VA 2BEVA 2X86A 1XJCA 4RCZA 4WEQA 2FPPB 4YBRA 1IVNA 1J09A 4JU8A 4HFRA 3ROZA 4Z7QB 4RVNA 2I2DA 3JWEA 3OOJA 1QPGA 4N7MA 4MH0R 4ZZ1A 1V5EA 2GBLA 5I8PA 1GOTA 3A4MA 5FBVB 2R1VB 2I7CA 4UMEA 4FW8A 5CB0A 2G82A 3ZKAA 3EH1A 1LI5A 1NUSA 4Q4DA 2YDYA 3IKJA 3OZRA 3PSHA 2LBPA 4PRKA 4Q9JA 4CZ2A 1UBLS 4F5WA 3L0CA 3C24A 3RT9A 3RKUA 1PFQA 3KJHA 1W5AA 1P8AA 3QUTA 3F9RA 4XASA 5CH3A 4BFYA 3N2NA 3H4TA 1IZ7A 4A36A 1XC7A 4O4IA 1UWCA 3U3KA 5EJ9A 4MRNA 4ZZ2A 1GGEA 1E1CB 1V4VA 3H6KA 1X8XA 1YB5A 3V7NA 2Q2QA 4Q4LA 4EEXA 3MJSA 2ZZMA 1ZJZA 4D9IA 1OH6A 2X6RA 4ZARA 4RY9A 2O4UX 1WL8A 4PZCA 1T24A 4M7OA 4NYIR 2Q1TA 4FOSA 4C6SA 5JRZA 4JUDX 4TTTS 1N2EA 1RWPA 1M7GA 1YJQA 2WG0A 4LXHA 2B8WA 2MYPA 3LFUA 3AC0A 2QZJA 1HLPA 3SHOA 2P6UA 4IXWA 3ILYA 3K4PA 1DSSG 1KO5A 2GHRA 1P5JA 2NSHA 4IDOA 2I8LA 4Z4CA 5C34B 4UKDA 2H59A 1T2CA 2DPXA 3EQ2A 4XUGB 1Y7HA 3IJPA 3LTNC 2YUIA 1XKQA 2QRVB 2NWQA 2R6ZA 5K3FA 4KR9A 1JSLA 2DH6A 2EVWX 3GNLA 3KR2A 1XA3A 2REOA 5FD8A 4B4VA 2FMUA 3MJVA 4ENPA 1T2DA 3EZNA 4PN3A 3BF7A 1YQUA 3BE8A 5IYZB 2YHUA 3R2JA 3QVGA 2HDNB 1RRMA 3P97A 1XRMA 2GVZC 1J2JA 2LCIA 3BORA 1KA9H 1OLSB 2PRYA 2PMDA 4TT8A 2C2HA 5BSFA 2HT6A 3D8UA 1K89A 3OTWA 1HA3A 5A9SA 2F1OA 1XMXA 3T1OA 5ICCA 4MGKR 3DFIA 4CQLB 2NQ2C 4U2KA 1V35A 2C97A 4JB3A 1Q0SA 5KSWB 5JCOA 3PTAA 1CKEA 4PYMA 1W36D 2BGNA 2DFLA 4LK2A 4TTSA 2I3BA 4LHVA 2QL9A 1T0BA 3G49A 4DLYA 4Y2XA 2OD7A 1KZGB 3OZIA 5FFMA 4LJ6A 1G98A 5DNYB 4KWTA 3WDKA 3SQLA 4MI3A 3CW2A 2QAIA 3IOMA 2PGIA 2YJ4A 2QL7A 4ZZ3A 1LPNA 4XB1A 4G8CA 1XMSA 3A9TA 2IS4A 3KM0A 3HP4A 1I2AA 2W5UA 1G4HA 3OFJA 2R0QC 4JWKA 3Q0IA 2HF9A 4P33A 4BLUA 2YFKA 5EZ5A 5B4VA 1MTZA 4C6TB 1IM2A 4QOSA 3CEMA 3QBTA 2BKLA 3D0KA 4MPPA 2HJSA 3I4LA 1RYMA 3LHSA 5FFFA 3RVOA 2NXNA 3OJFA 1ZH6A 2BZ0A 3KPUA 4ROSA 1G4UR 2EZ8A 3BIWA 4ZHQB 3QEOA 1C50A 2JKVA 4HTAA 2BTQA 2W7TA 4UTXA 4F12A 5F21A 5FV4A 2XB9A 5M5BA 3KQPA 4AZ3B 3EGWA 2B1RA 1EXWA 4I4NA 2JAWA 3OZXA 3N07A 4ZOBA 4U2GA 1NZDA 3OT1B 1GGMA 1Q0LA 2VCEA 3UOWA 3S44A 3ZJ5A 4ER0A 4QZVA 3HUFA 2XUHA 1MEOA 2CDBA 1P39A 3TOCA 1DUVG 1PJBA 4L0DA 5IK2A 1PG2A 4RZ3A 3ESYA 3JYNA 1VXRA 1J0XO 5J5VA 4DRXA 4EKGA 3PENA 3TE6A 1KTVA 1K8YB 2I1QA 4FDLA 3WK9A 5JZSA 1EZ4A 4V0ME 1UBTS 5B7GA 5BOSA 3G9ZA 4CM3A 2WD7A 3B1WA 3KS9A 4CG0A 3PNMA 2EGGA 1J9GA 2W6ID 3I4FA 4K9LA 2VP6A 5ALUA 2OFFA 1ZM2A 3FGOA 3NYQA 4HAOA 3VPHA 5FUMA 4CM5A 1XTUA 1K3TA 1G8PA 3HI6A 1JBKA 2NVBA 4EAQA 2IU4A 4F85A 1AGNA 1SUAA 2X0NA 2C8LA 5IW8A 3LA6A 2Y1EA 4U3JA 3V1NA 1ZUWA 3AHJA 2IEBA 2IP1A 3T4EA 4EUSA 1T1SA 2CYBA 2GARA 3CLTC 1ZAYA 1J8VA 1YQTA 3EJWA 4FMPA 4XGQA 5HUQA 3KOZA 2HF8A 5A3VA 3AF5A 2ZXFA 3FKSD 1ODCA 5GM2A 4BCDA 4LBWA 4ZV4A 4JP3A 2PDAA 1TGYA 1WS6A 5CXXA 2HHCA 3TSAA 2Q5LA 2QUIA 3FIUA 4Q66C 3CO0S 3QI2A 3D2BA 1RQ7A 2ZEJA 1FCJA 3R5HA 3LYAA 1AZWA 2A88A 4PX9A 5DKFA 1GPDG 3AL3A 4XPIB 3A3OA 2OP1A 1P17A 1PUXA 5F4ZA 2M1ZA 1YZTA 1CD5A 3WAGA 3PEWA 1FTNA 3BKWA 3A2NA 3GJ0A 1JXQA 1HM5A 1KMCA 1Z3IX 2CNBA 4NFHA 4LE0A 4DJ5X 2JH3A 4WINA 1EFVB 4PPFA 3TQCA 5ALXA 4ALJA 2BEUB 5A7GA 1MAAA 1PJQA 3CA8A 3IQWA 4DTIA 2OLJA 4U7DA 4H7PA 2R00A 3QEJA 3H1EA 4OKSA 2AOTB 2CXQA 4I50B 3T15A 2G83A 3LCJA 5IKOA 3TRJA 4OI2A 3K53A 4QICA 5EJGA 2W70A 3LKVA 3TNLA 3MD0A 3PNSA 4W8GA 1X1DA 2AG0A 3IQEA 2GXSA 1VL8A 5K2OA 3J81A 3UK2A 5CDFA 4D9NA 2HWXA 2PX3A 1TDJA 1QGUB 4OUKX 5KNBH 1DCKA 1NRXA 3QKSB 1EB9A 2AZTA 1A82A 1G21B 3HLYA 3WIVA 4RTRA 3IO5A 3AX6A 1FXWF 4D92A 1NDHA 3EAFA 3T94A 1OF1A 2R6FA 3ZWVA 2XHEA 5D01A 4AF7A 1GWNA 1NVBA 1VCOA 3N2EA 3OPYB 4MYSA 2FSGA 1V1MB 4WASA 2AMFA 3A6PC 1TUEA 1Z16A 2V7XA 3BBLA 1Y0BA 1M75A 3DQPA 2V3WA 1W96A 4ZT3A 2WFMA 2V5AA 1LLUA 4XI9A 5DN6A 1KY4A 2PGOA 4Y2PA 5KIAA 4EY5A 2OM6A 4NE9A 4IG4A 5FL7D 3HB4X 1MX3A 1P0MA 1PNQA 4H7EA 1F3LA 4EHKA 1BW9B 3GFPA 2APJA 1BVUA 2XVAA 2YUTA 4ND8A 4C88A 2QRJA 2JGJA 3DXFA 1MHTA 1DWOA 1U0OC 3BCUA 4P3XA 1X70A 4YRTA 4XWWA 2BMWA 4IDAA 2FFAA 1P62B 2ZSBA 1SBIA 1QIJA 4FFLA 4ER7A 3ET4A 3WWEA 4YRDA 1E0AA 2QYOA 3H9GA 2ZULA 3SFZA 3ZHBA 2IS1A 1OD6A 2GNOA 1OQAA 3CVWA 1VA4A 3DKKA 3FAKA 4L3VA 1R0RE 2VT2A 3Q8XB 4UXJA 2J0EA 4ZOEA 1CJCA 2ZUUA 3F6RA 5DLYA 3WZ2A 3K0SA 3RIXA 1ZGCA 4V24A 1H1LA 3DDWA 2QLNA 4WLNA 4HH4A 3PUKA 4UTVA 1UZNA 3CZQA 4G4SP 4J7CA 2WJIA 5EN4A 4QUHA 3JZFA 1HT2E 3KE9A 3CRQA 3P9SA 4HYEA 2PFKA 1PGPA 2OZEA 2XA1A 4YGXB 3ZWXA 4ZYWA 1EUCB 4LWOA 4B32A 3JTEA 1NULA 3V4SA 4C43A 5D5QA 1O6FA 3KQSA 3QU5A 1YRHA 2VWQA 1I24A 4I55B 4DLLA 4ZYTA 5FR2A 3KJQA 3DKPA 3A25A 1I14A 3QGMA 1KVQA 4GRIA 1NN3A 2NPOA 3K3PA 4H1VA 4HGZA 4R41A 5DGXA 4AK9A 1PZGA 2VG8A 1QGZA 3JD3A 3CVYA 3ZS8A 1GTMA 4C2AA 1R10A 4L8GA 5EWJB 2JK1A 2RG7A 4H1TA 2P2DA 3H2JA 3BWBA 3O3NB 2P79A 3L77A 4QU0A 1DQYA 1RLTA 1LWOA 4JJ7A