4FMDB

Espg-rab1 complex structure at 3.05 a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
171
structure length
171
Chain Sequence
PEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EspG protein
publication title Structurally Distinct Bacterial TBC-like GAPs Link Arf GTPase to Rab1 Inactivation to Counteract Host Defenses.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 54
structure length 171
sequence length 171
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4fmdB00
3PEUA 1G7CA 4GPTA 4V0LA 2A5JA 5AUPB 1E9EA 3HJNA 4HLQB 4NHOA 4TLAA 2R6FA 1S1MA 4DC9A 3A1VA 2XITA 4PC6A 2HV8A 3ZVNA 1S3GA 1Z0IA 2BMDA 2BWJA 3BB4A 1U9IC 3O8BA 2P6RA 3SBEA 1OW3B 2Q9CA 4V0ME 2YWGA 4MKFA 5JMTA 1N6LA 3RHFA 2G6BA 5AJVB 3KFXA 1VG0B 2F1IA 3QY0A 1T3LA 4DZZA 3CWQA 4UNQA 2ZE6A 4C4PA 1I4LD 1U8YA 2BKUA 4KFSA 3T1OA 4BZXA 1E9DA 1H8HA 2ZUCA 4JT4A 2GK6A 3A1WA 2OT3B 3F5FA 1VG1A 3H84A 3FMOB 4KU4A 2P3SA 4A1FA 3LA6A 1OSNA 2ZJ8A 3QKSA 2XJ9A 3RVBA 5TDHA 1TQDA 1KO4A 5G40A 3TJZA 2FWRA 4LJ8A 1NVVR 1EG7A 5L3VA 2O8FB 1UADA 1XMSA 2OFWA 2VYFA 2NO0A 1N5IA 3KB2A 3SI7A 3CIOA 1CP2A 3T1VA 4M8NE 4CVNA 1FNMA 1COWD 1E2GA 1Z22A 3MSXA 5DO9A 5TVKA 1SVWA 1GL9B 4MYUA 3NHAA 1AZTA 2QPOA 4EPWA 4LJYA 3THWB 1E0JA 2O0KA 2QRNA 3ADBA 2CLSA 3R8FA 1VYVA 3A1TA 3OF5A 2GCPA 1T8UA 2P6NA 3T34A 4G1UC 1I2DA 3KQNA 1E94E 1WDTA 1S9DA 3RRZA 2J45A 2VO1A 2ZJZA 4G5RA 4DSUA 1O3YA 4V03A 4US1R 5AK0A 1N25A 4D0NA 3KFVA 3U2QA 2QM8A 4TTRA 3VU9B 3WRYC 4F4IA 1BMFA 1IY0A 4XD7D 4LHVA 4Q1BA 1OF1A 1IOZA 4XH9B 2ONJA 3V9PA 4BFVA 4CEHA 1U94A 1VMAA 2I1VB 5CITA 1W0JD 3AQ4A 3V00A 1W47A 2OEPA 2J87A 3FKSD 3H0KA 4DT1B 1G64A 2C78A 1NF3A 2EWVA 4D80A 3U44B 2PEYA 2SHKA 2FPLA 2ATXA 3ASZA 3SQWA 4QJ5A 4LGMA 3GLHA 3NBFA 2DFNA 5BN4A 2VRWA 2RCNA 2EFGA 4M1OA 4D0GA 4KFRA 4GFDA 2VSFA 3W3AA 1XPUA 2JDIA 2J0QA 4K8OA 1AQYA 3IBGA 1QHGA 1VHTA 2ZRBA 1WB9A 4RKEA 4QBGB 4Q1CA 1S8FA 1UKEA 3B9QA 3KQHA 1IAQA 1HEIA 2JIZA 3FHOA 4OQNA 2CE7A 3T06B 3UK6A 3QIAA 3FHCB 3HPQA 421PA 3Q5EA 3VR2A 1N6KA 1XCPA 4R2HA 4C9BA 2Z0MA 3SC3A 2FEOA 1ZAKA 2P5SA 3RS7A 3N70A 4WA7A 2F1HA 2VH5R 2EFDB 1W46A 4Q48A 1XTKA 1XZQA 5JSZB 1G9XA 2AWOA 1M74A 3FE2A 2ZXUA 4YMVA 3GQBA 1NBMD 3P26A 1ZIPA 4C3ZA 3LQQA 2P0EA 1D6JA 2E1RA 3CBQA 1HH4A 5IK2A 4TSFD 1HQCA 2ERYA 3D6TB 4HUQB 3QPVA 4JSYA 2FN4A 1G3IA 3RRYA 1VCOA 1YZGA 3LXXA 3MFYA 1ODFA 1F5NA 3DPUA 1N6PA 2REXB 5L3QA 1UEIA 1TF5A 4PR0A 4TMTA 4YXWD 2IYXA 2BBWA 4TL7A 5EQTA 1JJ7A 2D74A 4AG5A 1U98A 3GEIA 3PCRB 3CR8A 2B8WA 1KK0A 2J46A 4P0TA 2XB2A 1GM5A 5DH9A 4ARZA 4X8HA 1ZM9A 4G3XA 2J0VA 3Q9LA 2R65A 3ZZTA 5HPYB 4NCIA 3CRRA 4QGAA 2ZRDA 1XEXA 4Q00A 4AKIA 3IBYA 5TV2A 1HUQA 3CRW1 4BPBA 3VNUA 5FL7D 1E4YA 3BH6A 2JJ1A 4PPGA 5C4MA 1JR3E 2JEOA 2H1LA 1S4QA 3O47A 4EPXA 1QHIA 1SXJD 2FZ4A 3OAAA 1GOTA 2WWGA 3WMGA 1KY2A 3WY9A 5EZ5A 2IXGA 2DBYA 1E2PA 2B7BA 1GILA 5BYKA 2HCJB 2R62A 2FPMA 4IFBA 4AG6A 4Q7JB 3ONWA 4URWR 3SS8A 1GWNA 2WSMA 1Q1EA 1UBEA 2QY9A 4CEIB 1Q12A 2VF7A 4P3YA 4NKRA 5TARA 3DM9B 2UKDA 2R6DA 4LYJA 2MSCB 4A9AA 2NMVA 4EFMA 3AVUA 2OCBA 3SHWA 3W8RA 2WJIA 4PPQA 1SVKA 4L8GA 1P4SA 2BHRA 4JLAA 4PO1A 2W6IA 5EXXA 1SGWA 1G5PA 4FMDB 2J3EA 1F2UA 4TMZA 1W36B 2ZTSA 2PLFA 4JS0A 2ZRMA 2JLXA 2P2LA 1ZD8A 3DL0A 3CPEA 3SHFA 5KNBA 2JA1A 2CLDX 5E95A 4B2LA 1GDDA 2C99A 3P1JA 4DRZA 4BASA 5FUYA 3CPJB 1NBME 4RZXA 3CNNA 5J4HA 2DY1A 4Y0VA 1ZVQA 4BFYA 1RVDA 1DS6A 3LDAA 3HP1A 2IA5A 2V1UA 2QM7A 1I4TD 3ZVRA 1IN7A 1XJCA 2QPAA 4Q9IA 3GLGB 1XXHE 2AL7A 3X1ZA 1FNNA 3GJ5A 4US0R 1JEEA 1U2RA 1XD9A 5GADl 2Z83A 4AWXA 1YKSA 4M9XA 1FL9A 1Z0FA 2IYUA 2VHCA 4X8OA 4MKIA 1PLLA 1YR7A 5E4FA 3TK1A 1FTSA 2VSXA 1RKBA 4HZIA 3K0AA 1P72A 1BH2A 1N0VC 1E9CA 3P4YA 3Q8XB 2GZHA 4JYCA 4JBXA 2ZS7A 2QE7A 1G4UR 5SZJA 3MAAC 4DBLC 2ODWA 2FF7A 4QHTA 1OT3A 4DLVA 2BMEA 1XZPA 1DADA 2GCOB 3TAHA 4F92B 3UXMA 4EPTA 1ZJ6A 4BLTA 5A4JA 5E7MA 5AUQA 1OFHA 5HCNA 5JECA 2GAAA 3SYNA 3QPWA 1FX0B 3EX7C 3THXA 1J8YF 5J40A 2CL7X 3AF2A 3EPHA 2OZEA 2AD5A 5H8WA 1K6MA 4LBVA 3R8CA 2B21A 4TQ9A 4LJ5A 3VHLB 4K46A 2A2ZA 4V0NA 5TB5A 3W5JA 1CR2A 5K8UA 4J0QA 1IJFA 3ZDQA 3W6NA 1OH5A 3VTKA 2J59A 1B23P 1P5ZB 1ZCAA 2ZVQX 2ZRIA 1Z47A 3AF1A 3AP3A 5HZKA 2HXSA 5DIFA 2G88A 2O0JA 4ON9A 3LO5A 1U0JA 3ZIAA 4B43A 4TMKA 2NZJA 3EIEA 3J81k 3PUYA 4OK3A 3NTUA 3IPYA 2P67A 4TLBA 3W3ZB 1W5SA 4D0LB 2QRZA 1CS4C 2ZU0C 2BM1A 5DI3A 4RZ3A 4ZPXA 3EZ9A 5DGXA 4TL8A 2CCJA 4M9ZA 1E4VA 1EFCA 3BAFA 1Z28A 1Q1ZA 4AKHA 2OV2A 2Z6VA 3R9IA 1ZW6A 2O5VA 3TQCA 2X1VA 2I1QA 2WAXA 2CVFA 5GVRA 3EASA 4MKGA 4E22A 4ASUA 4UJ5A 2D4HA 3GEEA 3K0FB 3WBKA 2W2TA 3GJ0A 5JWOA 4Q5IA 4OI1A 3G5UA 1HYQA 1W4BA 3EZFA 3X2SA 1R7RA 1N6NA 2FMXA 3X1WA 1LY1A 3GJ7A 4LV6A 1G21E 2QG6A 3CUEF 1DO2A 1Y63A 3KTAB 3BBPA 2NGRA 4HZUB 2FFBA 5CK5A 2D2FA 1VCMA 3B6EA 4MH0R 4IDOA 3B7GA 4JKIA 3BFKA 4NCNA 2XTZA 4NONA 4LRWA 3QPUA 2G1JA 1LB1B 1E79D 3SJCA 3LRPA 2GTPA 4KJZA 4TLDA 1S2MA 3AVVA 3QXCA 1C4OA 2BBTA 2IBMA 2CXXA 3SNHA 3QEOA 4DSTA 4PXAA 4A15A 4X8MA 4BFUA 4EQ6B 2WBLC 4Q1DA 3CRQA 3CLVA 4L9SA 3U4QA 1J7KA 1BKDR 4A2QA 1UBGA 1KK2A 3QOFA 2JLZA 3LVQE 3U6KA 1XFAA 1Z63A 4JZKA 2W0SA 4UQOA 3GCGA 4NU0A 1ELOA 1II8B 1N5LA 3AB3A 1XD2B 4HDQB 3NBXX 1NVWQ 4GOJA 4D82A 4EJSA 1AKYA 4I1SA 1TADA 5EXTA 3OE7A 1RYFA 3AF4A 5KNDA 1LTQA 1UEJA 3TLXA 1MO6A 4IDNA 3SBDA 4NTZA 4Q4JB 5BQ5A 3LFUA 2AD1A 3MWJA 1FUKA 4LYFA 1JQLB 1A2BA 2DFLA 1GZSA 3K09C 2IYVA 3D31A 3T1QA 4MGIR 2CK3D 3R7WB 2VHTA 2GJ9A 2YVUA 3RDPA 121PA 4TL6A 3OHMA 1OH8A 4TN1A 1ZYUA 4PAQA 3TSOA 1NY5A 2CMKA 2HT1A 4L5BA 4W5WA 3C8UA 3HU3A 3GJXC 1E69A 1EFRA 5FI0B 1P9NA 4KSBA 4CYMA 3KXLA 3ZZ0A 3KQKA 4MRVA 3K70C 4TZ0A 1XEWY 2JGNA 2V9PA 2J0UB 1N6OA 3B8HA 4LPSA 3KQUA 5BN5A 1IN4A 1E2EA 3OEEA 4NBSA 1VDZA 3L8ZA 2C9YA 4I81A 5FTJA 1CRPA 3UWKA 4FWTA 2H17A 4ZI2A 3C5HA 1XXHB 1MOZA 1E2KA 2QMUA 4BZPA 4JIMA 1YR9A 2QT1A 2H8KA 1KJZA 3IUYA 4IXMA 5LD2C 2JLYA 4NCHA 2PJRA 5G3YA 3BS4A 3TMKA 2QP9X 2ZI6A 1G8HA 1CRQA 2FEMA 2FU5C 2IWRA 4Z1MD 1Z08A 2CCGA 1K5DA 3MWYW 1P7CA 3GLFE 1TNDA 1VYUA 4R7ZA 4LI0A 3NEYA 4ZKDA 2O8BB 2PZFA 2ZRFA 1M7HA 4KFTA 5CJPA 2OCYC 1P6XA 4C2UA 2F3TA 1CU1A 4PAOA 1E3MA 4IKEA 4BFZA 3AP1A 1XCMA 3B13B 2QTFA 2XNDA 3RANA 3E2IA 1T5LA 5FUVA 1W0KA 5FOUA 4WZ6A 5IF9A 4NYMQ 1KAOA 1SXJB 3M4YA 2RHMA 1ZD9A 2ERXA 1W2GA 4Q66C 1JPNA 5B64A 2PX0A 2JLQA 1E96A 1DAHA 1XB2A 3BRWD 1T91A 3F0TA 4II7A 3BB1A 4B3BA 4L16A 1KNQA 5FR1A 2O8EB 1CR1A 1XTSA 4A2PA 1NG9A 2E9SA 4KVGA 5EE9A 4KLZA 4AD8A 2HT6A 3TUIC 4ZCMA 3WBJA 5C1BA 4PQRA 2EVWX 2PEZA 1S1CA 4YQFA 2A30A 1Z83A 4HB4A 1AN0A 1E1QD 1XNJA 4FMCB 2ZE5A 1Z5ZA 4LK2A 4GMXA 3AUXA 2FA9A 2XSZA 4NYIR 1G8GA 5UKDA 1CJKC 1GKUB 3SQXA 2J41A 3KKOA 2PCJA 2NIPA 2J7PD 2QTHA 4A4DA 2AFIE 1XPRA 2RGEA 5BW8A 3AH8A 5F98A 2HLDD 3LX8A 1ANKA 4EPYA 4ZIRA 4A0FA 2RB4A 4S2EA 3VKWA 1CJTC 3AV0B 4EJSC 2GKSA 5L3SA 3MG9A 3F8TA 3AKYA 3Q7QA 1WF3A 4LV5B 1Z6XA 1X3SA 2ZJ2A 1Z2CA 4FIDA 4AYWA 4OYHA 3QENA 2QTVB 4XVUA 4DDVA 3GPLA 1KO1A 1ZM7A 4KBGA 3B5JA 2UVQA 5HKKA 2ZRAA 1HE1C 2GK7A 4PHGA 3E70C 1KI6B 4P31A 1JI0A 1GG2A 1XX6A 4OI2A 4V0MA 5CK4A 3PJRA 2FE4A 3TR0A 4BECA 1IXRC 2EWWA 1VG9B 1WQ1R 3GJ6A 1R10A 1BIFA 1QHHA 2IYQA 3ASYA 1P73A 3LLMA 1HT1E 4GOXA 4JLNA 4IVRA 4BRWA 1JEDA 4BFSA 5GJBA 4LBZA 3K9LA 2A3RA 1Z6TA 3RABA 1MO3A 4M53A 3FVQA 1CJVC 4IOJA 4URVR 1W4CA 3FPAA 3M6AA 2J7KA 1VPLA 2VP2A 1E2MA 1J99A 1DAIA 1GKIA 3LW8A 1KDPA 4GI7A 1PLJA 1UDWA 1EFUA 3QVUA 4DCNA 1OXVA 2QSYA 2DHRA 4KI0A 1CEEA 3QXHA 4XSHA 2WJJA 3W5IA 4N3NA 5GJWC 4BWYA 4FI3C 1N0UA 1MKYA 1E2NA 5CIQA 4R9UC 1P2SA 3QQ5A 4FCVA 4C30A 3X1YA 2Q6TA 3K1JA 1WBBA 4W5JA 2Q3FA 3DMNA 1DVRA 1G8YA 4I1OA 3ZQJA 5J4KA 3ZLJA 5AUOB 3HYRA 3CF2A 2VP0A 2G0NA 1TX4B 2QSZA 1JR6A 2NOAA 1G19A 1KO7A 1AQUA 2ZS8A 4HDCA 4Y0AA 1ZCBA 2XZLA 1KMHA 2IYZA 2LWIA 4Q4HB 2GF0A 1TQ2A 3QF4A 4JLPA 2CDNA 4AYXA 4B3XA 1A4RA 4BLSA 2WJHA 5HTKA 4LHYA 3I73A 3CZQA 3GJ3A 3Q85A 2F43A 2GILA 3UANA 3VAAA 4OQMA 2BMFA 3SE0A 4O3MA 4TTQA 5SZIA 2QZ4A 3IO5A 4I1VA 2FJUA 4DB4A 2AK3A 4A92A 3VMFA 1TF7A 1OIXA 1GRRA 5B2ZA 5GJCA 4K81B 1LS6A 2W00A 3KJEA 1JECA 1HT2E 1XEFA 2D62A 3W9YA 4PC7A 4C0BA 3E5HA 4B47A 3H2YA 1ZMXA 1MRSA 1KOFA 1M2OB 2ZS9A 3P4XA 2EYQA 4BGDA 3UPUA 3GLFB 3I32A 1G17A 1ESNA 1LF0A 2QI9C 4M1TA 4EFNA 2NQ2C 4Q1EA 2GRJA 4DVGA 1ZM4A 4KVAA 2VEDA 3EPLA 3NG1A 3CRMA 4MUBA 1YHNA 5CDFE 3OEHD 1XMIA 3KKPA 4RD6A 4EFLA 2J5XA 1MT0A 4PPFA 3U7GA 1CIPA 1Z6AA 2R6CA 2ZU6A 5CYOA 1RJ9B 2ZYVX 2O8CB 5P21A 4QL3A 1EK0A 4F91B 1DG1G 4B3GA 4R98A 5FTMA 3OIVA 4AIIA 5A5GA 1DPFA 3K9NA 1OKKD 1D8TA 1FZQA 2JJ2D 2L0XA 3IQXA 4RD1A 4Q9JA 4QJ3A 2IS4A 4B33A 4EUNA 2ZUBA 3OESA 2RGCA 4RZUA 2Y8EA 3C41J 1X86B 1KZ7B 2ZRCA 3CX6A 4LY6A 1OXXK 3VKHA 2NPIA 3LVRE 3TAUA 1XD8A 3IEUA 4G0NA 4MKHA 4ILEA 3DM5A 2XOKD 4MRPA 1UKYA 2CHQA 1TEXA 5CM9C 2A5DA 1JAIA 3O8CA 4QGFA 4DHEA 5KDLA 4A8JB 1GIAA 1N0WA 1CJUC 3TGPA 1JR3A 1KI8A 4WXRA 4HDOB 2ZSFA 1R2QA 2HXYA 3GLGE 5AJWA 4M1KA 1P2TA 1XDBA 2ZR0A 4HAWA 4RZ2A 3ZJYA 3RC3A 5B30A 2FNAA 4DLZA 1KDRA 1HQYE 1ZUHA 2R44A 5EE0A 3NKVA 4LDJA 4O0MA 2ZJYA 3RS2A 5DN6A 2DCUA 3L0PA 4BRUA 4OL0A 3JZAA 3NH6A 4PC2A 5EP3A 2ZJAA 3B1YA 3GEHA 1UPTA 1WCV1 3LW7A 3VQTA 3GLIB 4QNRA 4JVSB 3U3OA 3LQRA 2LKCA 1H8HD 4LJ9A 4EPVA 2D7DA 4TL9A 3OFNA 3T12A 3TUJC 4L4UA 2G1KA 4TQAA 4ESHA 1DARA 3FMFA 3U3RA 1V5WA 2WM9B 4FCTA 1SQ5A 4TYPA 4XVQA 3I1FA 1QF9A 4ZDIA 1Z0JA 3MD0A 1ZNZA 1NIPA 3K0EA 2JLWA 1KSHA 3GJ4A 6Q21A 4TT3A 3HPRA 2GJ8A 2AX4A 2B6HA 2BC9A 1W5TA 4F7WA 2OBMA 1E2IA 2VQSA 1XXHA 1Q3TA 2V1XA 3C15C 4NE2A 3QKUA 4I1UA 4BUJA 1TF2A 2IL1A 1KO8A 1M8PA 4Q4AB 3UKDA 3KB1A 4DCTA 1UM8A 4BLRA 3RC8A 3KDSE 4KYIB 1W49A 4B2PA 3LBNA 3T5GA 1YZQA 2O52A 4DLRA 1Z6YA 1E9RA 1OB2A 2QL6A 5FH9A 2O8BA 3QXJA 1BMFD 1M7BA 4URZR 3RWMB 4A0GA 1TL7C 1AK2A 4FCWA 3WNBA 5LPNA 3VR5A 1NJFA 1E98A 2CVHA 1IONA 5FBQB 2PCLA 3BJIC 2ZRPA 4IOMA 5G41A 1M6NA 1SVIA 2ZE7A 5SZKB 2I3BA 2Q3HA 2DPXA 1H8EA 4TMWA 2J9RA 2X8AA 3TNFA 4Z8YA 4L15A 3U61B 1J90A 2BJVA 5JJIA 4DEXA 1BO6A 2VL7A 3PIRA 3QEJA 2FH5B 3IIJA 1D2NA 4MYHA 1LFDB 2B7CA 2CNWA 1QDEA 2ZRKA 1F2TB 2HYDA 1NP6A 1OJLA 4H1UA 2JDID 4GSYA 4LPKA 2MSDB 1NNEA 3BOSA 1RE0A 2XTNA 2GWHA 1GP2A 4P4SB 2FPKA 3AP2A 4LHZA 4NYJQ 1XTIA 2BBOA 2VIIA 4HAYA 4A6XA 4OKSA 2WAYA 1VCIA 2JIZD 4PSAA 5DE3A 2QENA 2JATA 3L8YA 4JKYA 5FTLA 3KUDA 2KJQA 4HLDA 4LYHA 2WSSA 2IUSA 1FTNA 2BIFA 1RC8A 4HB3A 4BQSA 2ZRGA 3AVQA 4EKDA 1YZKA 1UBFA 4CZ2A 1D9ZA 4D4MA 1R8SA 1XTJA 2XXAB 1IY2A 1OFTA 4NZYA 4QRHA 1Q22A 1KKLA 4MGKR 3RSOA 1OV4A 3RS5A 4C0KA 1GRQA 5KSZA 4KSCA 1EWRA 1NMXA 1AGPA 3ZS9A 3MUFA 5IK2D 2F9MA 2FG5A 3QKRB 5FOWA 1NVXQ 3PVSA 5JFGA 1F3OA 4QFMA 2OFOA 3NDPA 4D2IA 221PA 1E9AA 1OFIA 1W48A 1KIMA 1IN8A 4OBEA 2YWHA 1NN1A 2C8VA 3UG7A 5FBLB 2IXEA 2GF9A 4RD2A 2PX3A 4GDFA 1NLZA 1ZU4A 3FFAA 5F2EA 1NN5A 4B32A 1KI4A 2BDTA 4WIAA 1YRBA 1R5NA 3CX8A 4AK9A 2P6UA 5JJLA 1FUUA 3A8TA 3UATA 4OHXA 4QM6A 1S9HA 3QNUA 2C98A 4BEJA 2CL0X 2VSOA 4DLTA 2CHGA 2H18A 2JJ1D 1OE0A 4O2RA 3N2EA 4CIDA 4MRNA 5FOTA 4JL5A 2QAJA 3OAAD 1T0JB 3QXSA 3THYB 3BFXA 1E2HA 4KHZA 2UZIR 3CKLA 3KXIA 3KZ1E 1WBDA 4CEJA 2YV5A 4W7SA 4B75A 5D3MB 3SFVA 2VHUA 3N2IA 2DR3A 4PZZA 5FOSA 4XVRA 5FPKA 1U81A 2R8RA 1N6HA 5EE3A 3VFDA 2QAGA 2YZ2A 3MCAA 4LV8B 4HAUA 1JQJC 1YR8A 2F6RA 1P60A 4B3DA 1FQKA 3QJYA 3S1AB 3TE6A 2CJWA 2GA8A 2OXRA 2W6ID 1N6RA 5AJYA 5FTKA 3SDZA 1D2MA 3B1WA 1KDOA 4JL8A 1L4UA 2RGBA 4KV9A 2OO7A 4RFVA 2A7QA 4GP7A 4MRRA 1OHHA 3TBKA 1T8TA 2YJTD 2RGXA 3FTQA 2Q0HA 3PQCA 3QBTA 1SXJE 1VHLA 4JJZA 4EPRA 3U60B 5C2JB 4RD3A 4TLCA 2WWWA 1AS0A 3UMFA 3TQFA 3IILA 3PG5A 4B35A 4ZDJA 4LWZA 4KITB 1YRAA 3EPKA 5F3WB 3HR7A 3I61A 2QBYB 2ORVA 4ABYA 1TMKA 4D26A 4C7OB 4M0LA 3A1UA 4WW0A 3PENA 1P9RA 2GDJA 5ELXA 1G3UA 2YYZA 2ZITA 4TMVA 5ANRB 4IHQA 3P27A 4JLJA 2QMHA 4RFSA 1T6NA 3WNCA 2F1RA 2FFHA 1QG4A 3SEAA 5F9FA 4KLNA 4ACBA 3GD7A 2ZR9A 3MGCA 3ND9A 5KYKA 4D25A 3LX5A 1WP9A 2HF8A 1E99A 5IHPA 3NC0C 1W2HA 3IDQA 1Q3HA 4P4TA 3AKDA 4CW7A 1US8A 5FPSA 1I2MA 4MITA 4B44A 2QE7D 4LJ7A 5FL3A 3DMDA 2ZAOA 1D9XA 2JASA 4OI0A 2LKDA 3MJHA 4QM7A 2EQBA 2XAUA 1SVLA 1G7TA 3TSWA 1JBKA 2GZDA 2V55B 3EIHA 1G18A 2G0TA 2JLRA 4U02A 1CR4A 3HU2A 4OJKA 4D4KA 1UJ2A 2IW3A 1KY3A 2WOOA 3IHWA 4W5HA 3WYFA 2ZSDA 2YHSA 3ZQ6A 5E3HA 4DLWA 2V7QA 5FUXA 3EIQA 3NH9A 1J2JA 5JRZA 3K70D 1RZ3A 4JSTA 3EWAA 1G3QA 2G83A 2XB4A 2ZRNA 2AXPA 4M1WA 3W8NA 4M9SA 1LS1A 3CWZA 2GJSA 2A5YB 2FFQA 1X1RA 2WIAA 1YVDA 2WWIA 5JEDA 2CCKA 1S3SA 1NKSA 4EDHA 4OJQA 3RWOA 4X8LA 1N5KA 3ZIAD 4TYQA 5EXPA 1P2UA 3EW9A 1EFTA 4ZDKA 4E03A 3BD9A 1RFLA 1Z2AA 2OUKA 2OSBA 4YLGA 3AGPA 2VA8A 3WP1B 4POAA 4MYTA 4B3CA 2OILA 2O8FA 1OIVA 4HATA 2ZANA 3QKSB 3PUXA 2H92A 4BFXA 2WPDA 1QG2A 4LC0A 2ZIAA 4PSVA 5LB2A 2ZJOA 1Z0DA 1S0UA 2BBSA 4LJ6A 4ASUD 1RW4A 2O0HA 1WRBA 2OLJA 2W0MA 2X2EA 3K8YA 2HF9A 2PH1A 4HEJA 3THWA 4LUCA 3IQWA 2QAGC 3PUWA 1XPOA 4QHYA 4QBIA 5A0FA 2AWNA 4UNRA 2KE5A 4LHXA 2ZRLA 1U99A 3LV8A 1IHUA 3FYHA 2V6JA 3CM0A 1GITA 4LYAA 3R20A 3B1ZA 3GJ8A 4FMBB 2WOJA 1G8FA 1NRJB 2W6JA 4JBYA 5D3QA 1YZUA 3VU9A 4PHTA 1Q20A 1E0SA 5C4GB 4QC2A 2REBA 4DT1A 4YMTA 2G9NA 2O8DB 3U44A 3HR8A 4CEHB 2E87A 2ZI9A 4C0AC 1NMZA 3WHLA 2R9VA 1IJEA 2IYSA 2EFHB 1MRNA 1KJWA 2UZ3A 4D6PA 1NLYA 1DELA 2K5UA 2BCGY 3CW2A 4GRAA 1JPJA 4NPHA 2ORWA 1NI3A 4NCKA 3FGNA 3GLHB 1BYUA 2N46A 3X1DA 2YINC 4CT5A 1AA9A 2NTYC 2R6GA 2RHDA 4XJXA 2ODEA 1HY3A 3OE7D 2FDCA 1G3MA 2C95A 3DZDA 3TSZA 5B58C 2WZQA 3AVPA 4ZKEA 3REFA 4MUAA 5FTNA 1KSGA 1W1WA 5J4VA 3EZ7A 2EFCB 3FMIA 3DOFA 4B6EA 4BE7B 3C5CA 2XEXA 5KUTA 2TMKA 1YZLA 3MMPA 1FW6A 4IXNA 5JSZA 1XRJA 4XTCS 1OFUX 1OXTA 4FINA 4DWJA 4M4SA 2ODBA 4L9WA 1GUAA 2ZRHA 2WJGA 5BN3A 5JI2E 2F7SA 5FOXA 1DAGA 2ZETA 4HAVA 4NL4H 4R2IA 4XSGA 1IQPA 4BFTA 3QBVA 1EFRD 4HUQA 1QHXA 3I8XA 3NHBA 4GBMA 3AVWA 5IDVA 5KDDA 5FPHA 3Q3JB 1OH7A 5JHGB 4Q21A 1N2CE 2OBLA 3SFZA 3EARA 3KKMA 3OEED 3QXXA 1D2EA 2D7CA 3VKGA 4ZO4A 3KKNA 3U3MA 3L0SA 1FP7A 1IN6A 5L3QB 2AHOA 4US2R 2J1LA 3QUSA 3AM1A 1E1RA 5KSOA 1ZBDA 5C18A 5TMPA 3W6OA 1CR0A 3ZVLA 1T4GA 3H86A 2GEDA 3P32A 3DVLA 3TVTA 1ZNYA 1G7SA 2Z43A 1MR3F 2YWFA 1Q1BA 3IPXA 4Q4LA 2QP3A 4LJ4A 4PANA 3RYTC 1P61B 1CTQA 1G4AE 5FBVB 1PUJA 2OAQ1 1A2KC 3LNCA 1EESA 2XNDD 3G82C 1VG8A 1XEXB 5CDFA 2N42A 1E0AA 4EIWA 1Z29A 2ZSAA 2ZRJA 3CZPA 1DAKA 1W0KD 1T9HA 1E2LA 1DAMA 5KSPA 1QVAA 1RRPA 3NDBB 1ZIOA 1TUIA 2IYYA 3PFIA 2VP6A 3IO3A 4KYUA 3EC2A 2ZE8A 3H4MA 5JWHA 3NC1C 5BWMA 3U5ZB 1LVGA 4KFUA 2NO9A 2WICA 3UMRA 3KL4A 4DCUA 1NVVQ 2P5TB 4W9MC 4CEIA 1NKTA 1KHTA 3OZXA 3CNLA 4U7DA 2ZUDA 3PUZA 3L0OA 3GLIE 1PJRA 1YZNA 5KDOA 1MABB 1L8QA 2V54A 1FOEB 4C0JA 1ZNWA 2BM0A 2FV8A 4JMPA 3BE4A 2QEQA 3C14C 4DXAA 1CULC 3U7HB 1BOFA 3I92A 4OQFA 2DFTA 2XSZD 3VR6A 4NCJA 3E1SA 1Z07A 5DSZA 1F2UB 1Q21A 1JJVA 1NLFA 1P62B 4XIGS 4OHVA 3NBYC 2QORA 4TQUS 1KJYA 4MRSA 3A58B 2VTKA 621PA 1KNXA 3OIWA 1WE2A 4AYTA 3AVOA 4G5SA 4DLSA 2W2XA 4B34A 3THYA 2W58A 3GLGA 5KHOC 4Q18A 2C04A 3BK7A 1SULA 2IX3A 1FFHA 2GZAA 2KB0A 2ZVPX 3C16C 5HKKD 1ZNXA 4M1YA 1TU4A 5G53C 2CBZA 1OXUA 4YMSA 4MA4A 2HUPA 2XTMA 3DHWC 1GSIA 3CF0A 1CXZA 2FZLA 2A78A 3IGFA 3WYGA 1UDXA 2C9CA 4B73A 2OESA 3LBIA 4QBHA 2QPTA 1E2DA 2VP4A 2EYUA 3K53A 3A36A 1CJMA 3D8BA 4Q03A 4Q9LA 1L4YA 2BV3A 4M9QA 1Q57A 2GCOA 2VP9A 5H1YA 3Q5DA 4GMDA 3W90A 2Q3MA 821PA 1KGDA 4HLCA 1KZGB 4P32A 2NO7A 4DUGA 4PHHA 1FX0A 3CONA 1VKJA 2VBCA 4UXHA 5FFMA 4IDQA 4PZYA 1VIYA 2QMEA 5J47A 4P4UA 1OXSC 1ETUA 2AK2A 2IC5A 1J8MF 3SJZA 3B2EA 3ZS8A 1IXZA 2ZSEA 3RSLA 4XOIA 4OHYA 3MWLA 3M1IA 5AWFC 3FDIA 4RVCA 2WV9A 1D5CA 3DOEA 4C0QC 3K70B 2QGZA 2BOVA 4WZAE 3PITA 1FQJA 1E6CA 1W44A 4H1VA 3FOZA 2JLSA 1KKMA 2CL6X 1EGAA 1IY1A 3PUVA 5LD2B 1A7JA 2PT5A 1N5JA 4NYMR 4KBFA 5C46F 2V6IA 3IKJA 1IM2A 3GFPA 3A6PC 2D2EA 4RD4A 3UWOA 3N5CA 4N0DA 3ETLA 3UIEA 1B0UA 1ZUNB 5FOVA 3KXKA 4BZQA 5CM8B 4F4JA 5JLJA 3THOA 3RRMA 1E9FA 1ZC3A 3BIFA 3K0CA 4GZLA 4EAQA 1UKZA 1YJ5A 1GNQA 3CB4A 2EU8A 3CPHA 3TKLA 3K0FA 5HZHA 3M0EA 2KSQA 1COWA 3CNOA 1QBKC 4UNNA 3R9WA 2ODNA 4DDWA 4LBYA 4QNMA 2IWHA 3KTAA 4F38A 4HZUA 4UNPA 1PLKA 1XU4A 2A5FA 1U0HC 2AKYA 2PBRA 4AKEA 2Z5FA 3IHLA 1E2QA 1GL7A 4QBFA 1W36C 1UF9A 1X1SA 2GBLA 4ESVA 2C77A 2VHJA 4LBWA 1W7AA 1AS2A 2H5EA 1AIPA 3QI2A 2HEIA 2WJYA 1FPMA 1G5RA 1RYHA 3DO6A 1EX6A 1KO5A 2BJWA 2D06A 3CX7A 4BLQA 3B60A 4IJMA 4XD7A 1DG3A 3B9PA 4A6PA 1W0JA 4GP6A 4EQ6A 3HU1A 4LC1A 3FKSA 2QQ0A 4A0HA 1YQTA 1BS1A 3QE0A 1KYIA 4QGHA 2RAPA 4IOKA 4ACAA 3ZD6A 1G3RA 4IFEA 5KOYA 1II8A 3U4QB 4FW9A 1XD2A 3LD9A 4PO8A 3O8RA 5DLQC 4OQXA 1KK1A 2RMKA 1L7VC 3I5XA 2DB3A 3QSYA 4DDUA 1KTVA 4EJSB 4Q4JA 1T5IA 1EFHA 3EA0A 5KPJA 1E2JA 5SZHB 4WZBE 3IIKA 5CLQA 5JCPA 5H68A 1G20E 1F6BA 4PX9A 3A37A 3I5YA 2IEZA 4JLDA 3R7WA 3VX3A 1ZU5A 3EA5A 1QHNA 2B8TA 1UBCA 2OHFA 2FX3A 4HYYA 1SVOA 4Q7KA 2WWHA 3A4MA 3SN6A 3AVYA 1MO4A 5J5CA 4Z8XA 5E7JA 1NSTA 3BFVA 1NBMA 3C4JA 4PQYA 3RS3A 4ZDWA 1DBSA 4DIEA 2J0UA 1JR3D 3BXZA 4TSFA 2OLKA 1E2FA 2ZJ5A 4PO9A 5F9HA 5L3RA 2ATVA 3D3QA 1OIWA 3CH4B 1KI2A 4F93B 3QVVA 2NO6A 2EW1A 4YXWA 4AURA 5CB6A 1IBRA 3ND8A 2QNRA 3BERA 1GL6A 1OYWA 1XJQA 1U90A 5JEEA 2GXSA 1WXQA 5FI1B 3A4LA 5CJ2A 2BCJQ 4Q1AA 4DEYA 5DN6D 1HTWA 4PTLA 4IDPA 3KX2A 3TUZC 2XJ4A 1UKVY 5J4YA 2RKOA 4IEEA 1SZPA 1QRAA 2RGNA 5K8LA 4HAZA 4XTRA 1GNPA 4JLKA 3OFND 4JVNA 2OXCA 3K0CC 3P20A 4DKXA 1SHZA 5FL7A 1MH1A 4HB0A 2I4IA 1SHKA 2OG2A 4PPNA 1R6BX 1S96A 2IF2A 1SXJA 1N6IA 2V8OA 2OCAA 5EXSA 2VHQA 1G5TA 3B1VA 4G01B 4HI0E 2IS6A 3WNDA 2AKAB 4HAXA 1NN3A 1R0WA 4N0EA 1T3HA 4IW3B 3TVDA 5EJEA 2ZI5A 1U8ZA 3I4LA 3NVAA 3TRFA 1XCGB 5DYGA 1FMJA 2GETA 3VNVA 4TT3D 2O8EA 2QP4A 3I62A 1QVRA 2GBLC 2RH5A 2V4ZA 2HJGA 4M1MA 4B6FA 3BH7A 1CF4A 3LH5A 4F4CA 2GVDC 1NVUQ 1NSFA 5HCIA 1KSFX 4NP6A 1XWIA 3T15A 1LW7A 3VR4A 4AC9A 3LWNA 1R0ZA 2YOFA 4GNKA 5DYIA 3EZ6A 2BVNA 4QHSA 4ZCLA 2HDNB 4WBSA 1SKQA 4M21A 2QQEA 1E0KA 1F60A 4IEIA 4HSEA 4TLEA 1OH6A 4PZLA 2QU8A 1R5OA 1TUEA 4RY2A 1NJGA 4MYCA 3X1XA 3U7FB 2DWQA 4IVPA 1CLUA 3RRNA 1G16A 2OM2A 4FXPA 1DOAA 1X8KA 5FUWA 1DAEA 1H8ED 1YR6A 4I4LA 3DKPA 1JNYA 4ZIRB 2ZROA 2REOA 4OHZA 2ZI7A 2WMOB 4NH0A 3MJRA 2A9KA 5L3SB 2CNWD 1JB1A 3ICEA 1MV5A 2QA5A 4Q19A 4UNSA 4MDEA 3SJAA 1KI6A 1Z06A 4HB2A 4MQBA 1G41A 1DO0A 4IVQA 4QJ4A 3T1TA 1MABA 3BWDD 5GJVC 1XEWX 3VR3A 3CF6R 1Z6GA 4RKFA 3AKCA 3GFTA 2IUUA 5AJXA 1TTTA 3PEYA 4B71A 3EG5A 1K5GA 1SKYE 2WSSD 2ZYWX 2IT1A 4FMDF 5LB4A 1LF5A 3IIMA 4C0HA 1C1YA 4G5QA 1QHHB 5K8TA 4AY2A 3ADDA 5JRJA 1CBUA 3QG5A 4BLOA 2OAP1 5IRCD 2WWXA 2MMCA 3BORA 3L82B 3F3YA 5LDDC 3GLHE 1VIAA 3NEJA 3LBHA 4OQLA 1G7RA 3ZGXA 1T3SA 1RPZA 2WWFA 3ADKA 2ZPTX 3D7MA 2QN6A 3AEZA 3LY5A 2AR7A 1J70A 1KI1A 3AVTA 1HV8A 4GL2A 2IYWA 1G6OA 1M34E 1HE8B 4D81A 1ONBA 4LOAA 3WMEA 2WKQA 4TTPA 1OYYA 2C96A 5JHHB 5EP4A 1Z8FA 1BYIA 1ESMA 3DEFA 2MSEB 1A82A 3K9HA 3EWSA 1WMSA 2RGNC 2PLRA 1U8AA 3RAPR 1GVNB 2F55A 3WP0A 2ZJBA 5KSYA 2Q9AA 3MWKA 5JBQA 2RGAA 3LLUA 3UMSA 4CGZA 2VLIA 2IK8A 3AVXA 4Q4HA 1AJEA 1M1YE 1SXJC 4B48A 4B3FX 2PZGA 4WOPA 1KI9A 8OHMA 3ICQB 1NMYA 3PEWA 3K09A 4LHWA 4UKDA 1KMHB 5EP2A 5K8IA 2FSIA 3FWYA 5J4LA 2PZEA 3QF4B 1GNRA 4C2TA 3KKQA 3AF0A 1I4DD 3PXGA 4PSKA 5BXQC 5JJKA 1C9KA 3AUYA 2IYLD 2F43B 1HURA 1Z3IX 5EP1A 4LX0A 4Q7LA 4AI6A 4JYBA 4YDSA 3T5DA 5TXGA 4OK5A 4OHWA 2N1BA 2GESA 3K9GA 4TZ6A 3GLFA 3L43A 4CT4B 3HYTA 1G291 3SYLA 1W4RA 4KCGA 1A1VA 3PEVA 5DNYB 4LSGA 4A0RA 2FSHA 2ZAMA 3SJBA 2NG1A 1E79A 2OCPA 2ZSBA 4IDHA 3WRXC 3V4RA 2X19A 4WAUA 4B2IA 3KQLA 1OHHD 4DLYA 1R0XA 5JZVA 2CHVA 1A5TA 2FSGA 2R6AA 1RJ9A 4O2LA 4O25A 4B76A 4RCYA 2IYRA 2O8CA 4XWKA 1EXMA 3CO5A 1VYTA 5AUNB 4C0SA 4NYJR 3VX4A 2DWPA 1KK3A 2NPFA 3W6PA 1PUIA 4MGYR 4NYIQ 5DI9A 2HJVA 1ZD1A 4URUR 2ZREA 3W34A 5AJZA 4JLOA 4NDZA 4Z54A 3DZ8A 5AR1A 2W2VA 1LV7A 4ERNA 4JLBA 2VP5A 2IS1A 3KJGA 1G8PA 2ECKA 2H16A 2JAQA 4GT1A 3RLFA 4FWIB 4DCSA 5HR5A 1KI3A 2QUZA 5JCZA 1Y3AA 4M1SA 1DEKA 1AKEA 521PA 2Z4RA 3DKVA 1K8RA 1UFQA 2IXFA 4N1AA 3JVUA 4TWZA 4V0OA 2CK3A 2GEUA 2HYIC 1FP6A 4RJLA 5FPTA 5HE8A 1N3BA 1GTVA 2XZPA 2QGNA 4UXIA 2V3CC 2IYTA 4A8JA 3SOPA 1TEVA 4URXR 1XMVA 1OLOA 5M04A 1PV4A 1HA3A 4TYYA 1X8JA 2WHXA 4PC1A 1OPXA 1JXOA 2ANCA 2QT0A 2V7QD 2YOHA 2ZR7A 4BEBA 4E07A 5DHAA 4Z51A 2A5GA 2Q9BA 4UXJA 2RGGA 3GP8A 4R71A 4OI4A 4Q02A 2GJKA 3BH0A 2NZ8A 1TU3A 4JLMA 5JI3E 4IRUB 4JLVA 4YDHB 4DSOA 4Z1MA 2ZYUX 2WWYA 2BEKA 2P65A 1JAHA 1R5BA 2G3YA 2QROA 4PC3A 4FD2A 1NY6A 1YE8A 3KJHA 3GLIA 2WMNB 2GXUA 2ZEJA 4D4LA 3Q72A 2GHIA 5JS8A 4TYWA 1ZRHA 1DAFA 3RS4A 1TQ6A 1SKYB 4Q9HA 2OE2A 1PZNA 5EE5B 2G77B 2ZM5A 3IEVA 2OBNA 1P2VA 2YC2C 2YKGA 3BB3A 3SU8A 5IT5A 1M7GA 3H1TA 4GZMA 2C03A 1TQ4A 3AGQA 3GFOA 3I72A 3GMTA 1O87A 2WPDD 4FN5A 4V0KA 4V02A 2HCBA 3RNLA 2FFAA 1QHYA 1X8LA 1T0HB 4H9GA 1Q0UA 4QOSA 5DISB 5TY0A 3O8DA 3ZZUA 2J0SA 1ZC4A 3B78A 2BMJA 2WKRA 3QF7A 3U6BA 5KTYA 5GVSA 1II0A 5JWRA 2ZI3A 1AGRA 4ZCIA 2JJ8A 3NWJA 4JT2A 2VF8A 4PFSA 4Q4AA 1UAAA 3KUCA 1TAGA 1GAJA 2ORIA 5KPDA 2PT7A 5E7IA 4DJTA 5H70A 1PVOA 3LAWA 1VCNA 1KDTA 2IHBA 2ONKA 4I99A 3I8SA 4TYNA 2WTUA 1E1QA 5KU1A 2H57A 2W6JD 3C7KA 3U7EB 3R9XA 2FOLA 2F9LA 4C0LA 3TIFA 1XTQA 3SR0A 1X6VA 1AS3A 1QHSA 2X77A 2ZI4A 4AKGA 2R2AA 4HLUA 3U3JA 1AZSC 5EUQB 4JBWA 4MDFA 2J7PA 5KO2A 2XNSA 2GJAA 3NXSA 2OFXA 2HLDA 5FBRB 1E32A 5CB8A 2XGJA 1XMJA 2GVZC 4LCBA 4U00A 2WVJA 2GCNA 4XWAA 4DCVA 4CF7A 1F2TA 4ZI3A 3NBZC 1Z0AA 5LBIA 3BC1A 2DWOA 3L2OB 2DYKA 2YNMA 3FB4A 5EUMA 1G6HA 4P4SA 3T61A 3TH5A 2X2FA 4WXPA 3K0SA 3CH5A 1MO5A 4DLXA 2C2HA 1NL3A 4PAMA 5B57C 4ARZB 4HUTA 3ECCA 1XBTA 2Q21A 5EZ6B 2ANBA 4TMXA 4QXAA 3A4NA 3B1XA 4U5XA 4FMCF 4JVMA 3B82A 1YZTA 4BFWA 4CDGA 3V4FA 1ZM3A 1QZXA 1VTKA 4A8JC 4A36A 2XXAA 2MMGA 2O8DA 4OK6A 3L0IB 4DLUA 4P33A 2IS2A 5CLLA 3TR5A 4D4JA 2EFEB 3QKRA 4Q01A 3VHXA 4RCZA 3T35A 1P9WA 4KAXA 1R4AA 4KODA 2F3RA 5CIWA 3REGA 2B92A 1NG1A 3VR1A 2D3WA 3HDTA 4ZV4A 3MRSA 1WA5A 1CKEA 2KWIA 4B74A 3MLEA 1E9BA 4IOLA 4WVFA 5DHFA 2FGJA 1II9A 3TW4A 1E1RD 1EWQA 3A1SA 3EC1A 2AFHE 1U9IA 2C5LA 3ZYCA 2NO1A 3CRVA 5FBWB 3WMFA 4DSNA 1V43A 1NN0A 2WJVA 3FKQA 5FR2A 5G3ZA 1RRFA 4UJ3A 3AF3A 4G5GA 1GKYA 4YMWA 5BYJA 1KSJA 3FHTA 3BGWA 4CRWB 2YC4C 2JLUA 4YC7A 2YWEA 2LCFA 2DFKB 2FSFA 2GXQA 2CEAA 1P3JA 1VECA 2F1JA 2GNOA 3ZH9B 2GAOA 1Q44A 1LNZA 4YONB 4MGZR 2VPPA 3U3KA 4KXFB 2QMOA 3FMPB 1IN5A 1P75A 2BKEA 5D3MA 1G1MA 2C9OA 2XZOA 1YU9A 3EAQA 3PR1A 4CEJB 1RIFA 2ASEA 1RRCA 5L8VA 4LJAA 3SYKA 2Z4SA 3EPJA 1GRNA 1Q1QA 1L2TA 3K0AB 2W83A 3S1AA 1GFIA 2JCSA 1KI7A 2QAGB 2YOGA 3ZVMA 4G5OA 2GXAA 5KNCA 2IHYA 4DDTA 1W36D 1DTSA 2ZQ5A 2IUTA 4PHFA 4JJKA 1JXMA 2KI5A 4HLUC 4A82A 1JALA 4Q9KA 4BLPA 1ZINA 2CJWB 5CYPA 2ZYTX 3I3SR 2RGDA 3HWSA 3B85A 3OEHA 4RD0A 3WXMA 3PV0A 3Q7PA 4ITRC 2H7VA 1SVSA 2KBEA 2PL3A 2CE2X 3THXB 3OIYA 2QBYA 4NMMA 3UG6A 4C7OA 4S35A 4JVLA 3ZD7A 2WIBA 1KMQA 4YMUA 3JVVA 4QG7A 2AN9A 1U0LA 4DIDA 4E5UA 2WKPA 4A2WA 3EZ2A 1OB5A 3DDCA 1SVMA 2BEJA 3WYAA 2PJZA 4URYR 3OIUA 4Q7MB 1R0YA 1TPZA 3WHKA 721PA 1XTRA 3LXRA 3G0HA 1OKKA 2PMKA 2JJ2A 4RFSB 4KO8A 3RS0A 4DB2A 1XP8A 3CR7A 1XJ0A 1NIJA 2GEVA 4XWOA 4Q1FA 1DE0A 2FGKA 1AM4D 4Q47A 5JS7A 3ADCA 2KBFA 1XF9A 1ZUIA 2IEYA 1F48A 2XX3A 3NIBA 3QKTA 3QG1A 1US8B 5EE1A 2AXNA 5DI3B 2IF0A 4QGGA 3EXAA 1EX7A 4M2LA 4GOKA 2XOKA 1W4AA 3FFBA 4RSGA 1Z0KA 5HE9A 1FMLA 1ZP6A 2CLCX 3TW8B 4DUGD 3KJIA 3SZRA 4JL6A 4QKQA 4LZZA 4M22A 2JLVA 1KAGA 3JZMA 1H65A 1E9SA 1R8QA 4E09A 3AKEA 1IXSB 1ZM2A 1RRGA 5FPYA 2PMDA 4PQFA
chains in the Genus database with same CATH superfamily
3ZUPA 2W8BA 4GPTA 3TDNA 1KJJA 1E9EA 3HCDA 2J8ZA 4HLQB 4HMPA 4NHOA 3WIEA 3ZVKA 3ZWDA 1DUIA 1OUMA 2RBKA 3SAJA 4B5LA 3A1VA 5EZYF 4ENUA 1SXPA 3ZVNA 4J4BA 4LZJA 1EFLA 2BMDA 3BB4A 1U9IC 2DUUA 3KKKA 3O8BA 3OQVA 4PFJA 5EVCA 1SUBA 1EK2A 2JVKA 2P4UA 5AI9A 3SBEA 1M1UA 1NW3A 4N5IX 3OURA 4J4HA 4RH1A 4UBOA 3PF9A 5JMTA 3RHFA 2MOKA 1AGYA 2Y9PB 2RBEA 1T3LA 2CLMB 3CWQA 4UNQA 1N7IA 5AI5A 4C4PA 5CCBA 4GGPA 4BUCA 4WN3A 2CB9A 2YHUA 1I4LD 1U8YA 2ILTA 2ECOA 4TXNA 3T1OA 4JT4A 3IKTA 2GK6A 2RD2A 3A1WA 3F5FA 2J31A 3A31A 3QW2A 3H84A 4QXOA 1JA0A 2NNLD 1Q7GA 1XLTA 4KU4A 3ST7A 4BVAA 5ISMA 5ECWA 3ANTA 2XJ9A 4NG5A 1FCJA 1TQDA 1VP9A 4FFOA 1UBUS 1UMDB 2BZ1A 4IDAA 3TJZA 3SP1A 4XJVA 1L5NA 4A8HA 5LUAA 2XF2A 5IANA 4P93A 3TO5A 3R0ZA 3DR3A 1FFDA 5CHEA 1AUXA 2WJ6A 4O4IB 5DVZA 1GGKA 3QTTA 2MJLA 4BTVA 4UHFA 3T1VA 3L7OA 1BEUB 1E2GA 4Y2PA 5DO9A 5TQ0B 3OETA 2IPMA 4YAIA 5M34A 1PD1A 5IWCA 3QNMA 3WL8A 5LYJB 4JJ7A 4MTCA 5DWVA 4ALIA 4LJYA 3FHLA 4YX9A 1E0JA 4J2OA 4HQNA 5FPQA 5J5VA 3ADBA 2HA5A 4K1LA 1MVOA 2Y6VA 1B8PA 1AF4A 1VYVA 3A1TA 3FGOA 3JV7A 3OF5A 5IYZF 3R8FA 3K9BA 2X0RA 3RRBA 3DQQA 2HMUA 1E94E 1NXOA 2C8LA 2BUCA 3RRZA 2J45A 3NNNA 1XMQB 3ZHSA 1FU7A 4C7XA 4MSUA 2D1RA 3ZU6A 3LCCA 1QIIA 2B4TO 4CF6A 4AQYB 5CYFA 1JVNA 1W85A 3URMA 4ILKA 4G09A 5CXUA 4PIMA 1B1CA 4N8DA 1ZSYA 4NFYA 1ECBA 3IUBA 4O4LF 3JQ7B 4XH9B 4TPKA 1X8XA 4DLLA 1Q50A 2I1VB 1KQ3A 1SELA 2X9QA 4OM8A 1QC5A 2SBTA 4U8GA 2GFIA 7AT1A 3TYXA 4YJ3A 2HRDA 5HJ5A 1ZK2A 1WX1A 3VU0A 3RJ9A 1VLVA 1WTAA 1GQ2A 2NW6A 5CX1A 4Y1FA 1KH1A 1NXSA 2BHLA 4HNRA 4MVWA 4CV0A 1MLDA 2H7CA 5BN4A 2XAAA 4IGAA 5EHXA 1CE8B 3UAGA 3BMQB 4YFVA 1HDYA 4KQ9A 1G60A 1TO1E 3QHQA 4RKWA 1PKEA 2BHTA 1RLUA 2JFVA 1TCVA 3DL4A 3GCXA 3KNZA 2JDIA 3O8OA 4GFDA 1HR0B 1AB5A 1E5DA 1TK2A 1RQ2A 3IBGA 1QHGA 4BNZA 4C88A 5KYXB 1WB9A 1UJNA 2O2YA 4MMZB 3CLUD 3GAZA 1IAQA 4GMGA 2CE7A 2I8LA 5KI6A 1DUVG 4JVOA 1MX9A 3UK6A 2O3SA 3OZBA 1E6UA 3EIFA 3I0ZA 4E32A 1N6KA 1XCPA 3DC7A 4R2HA 4BQQA 2RGWA 3MN1A 1X87A 5ULLA 1G98A 3N70A 5JANA 2UZ1A 4AJPA 1EDOA 2VDNB 3F98A 4MQFB 2IV7A 2F4VB 3DMFA 3RSQA 5EERA 4OKNA 2GN4A 4H08A 4MS4A 1X9HA 3FE2A 5F5NA 4OLAA 1MHPA 4C3ZA 1DCMA 1HKUA 5BN3B 3GUVA 3OFVA 1E5LA 3ESCA 5F76A 5ED4A 2HV9A 4NRDA 5CT4A 1PFVA 1RQ7A 2ERYA 3D6TB 1ML4A 5HIIA 3QPVA 1Y4AE 2WHQA 2BISA 3EZLA 1L8OA 3QPBA 2CJXA 4P08A 4ZO8A 1NTRA 3UF0A 1F5NA 1UOEA 1N6PA 1UXOA 3DPUA 3H9EO 4QUJA 3F90A 4UU0A 4BFCA 4ZOLA 3OC0A 4XUGB 5KVVA 3OM1A 2IYXA 2BBWA 3EEBA 4HPWA 4TL7A 2OXIA 1DTWA 3NWPA 3SLRA 1H66A 2JNWA 4RH3A 2I6UA 2D74A 2MCFA 3PA8A 1JN0A 4AQDA 3GEIA 3KOWA 1AUVA 2FR1A 2YYSA 3OLCX 3VR0A 5LIPA 2B8WA 3BSFA 1ITZA 4K9DA 4G6ZA 4KIGA 4URHA 4JODA 5DCLA 1WUHS 3T6KA 2AJBA 2I76A 1ZM9A 3VZPA 2Z6AA 1PSZA 2DVMA 4X41A 2BFFA 4YT5A 4AY5A 4H3KB 1OI4A 3ZGLA 1NM5A 4TTIA 3N2ZB 4RWZA 3GJRA 5HPYB 5KNCH 2YXBA 4L76A 2B83A 4QGAA 3RUDA 4PCAA 3WB2A 1TZCA 1PBNA 1BXGB 3OMLA 4R69A 4UCWA 3M6VA 4AKIA 1U7DA 3K20A 4CMGA 2IIQA 1GKKA 1EZZA 1UPFA 1ZW1A 5IBRA 1T9GR 5C4MA 1KOGA 1QQ5A 2JK1A 3BL6A 2I4LA 2WD8A 2FZ4A 4I1YA 1E8MA 1JG2A 4FOPA 1OREA 1Z6QA 3DZJA 5EUCA 1O95A 1Z0ZA 2B7BA 2CDRA 3LCVB 3MVEA 4R1PA 5F2NA 1ZAYA 2HREA 5CU7A 5AOAA 2HCJB 2XQVA 3SYRA 1Q0QA 2MYNA 3K8OE 3BJEA 3LMKA 3Q4GA 5CLGA 3NV9A 2FPMA 1W35A 4IFBA 4AG6A 3JCZA 3IEMA 2HSJA 3ZDYB 2BI4A 3UCXA 2RHLA 3TL6A 1FYEA 5TARA 4P3YA 2ESRA 5K3FA 1FLVA 3DM9B 4LVCA 1UZUA 2AN1A 2UKDA 1BRMA 3W1WA 2OCBA 2RH4A 3CCBA 3FXAA 3SHWA 4PPQA 3FY4A 3SQMA 1QJCA 3RVDA 3M1YA 4BUZA 1P4SA 2ACVA 1CQPA 3JQGB 3K1AA 5I9BA 5IPFA 2JB9A 3D1LA 4WOKA 4KIFA 2Z58A 1W36B 2EF1A 2ZTSA 4TXLA 3P9NA 4R41A 4I5FA 2JLXA 3NRJA 5KNBA 1OU4A 1AQ6A 4O4HB 2IHTA 4KP7A 4B2LA 4YCAA 2C99A 3JWPA 3P1JA 2EGHA 3CPJB 2Q0SA 3K8ZA 2AR9A 3MK31 4H6XA 2EG5A 4P7FA 2I7DA 1Y8RA 1NF8A 5J4HA 2DY1A 2BRUC 3T95A 3BN3A 1MXFA 1QOZA 1SUDA 5H3LA 4HZGA 5ADHA 3ELYA 2E4UA 4ZAVA 4YREA 1LNQA 3INTA 2QM7A 1UZLA 4CN8A 4DF3A 1XKLA 2IPLA 3KSMA 3VYWA 2O54A 3KPUA 2EX0A 1RMYA 1QCDA 4EMBA 5K6AC 4UBJA 4NZMA 3PHLA 4LE0A 3GEBA 3RYFB 4R1SA 1RXEA 2O05A 1FL9A 4QPCA 5JCOC 3CUWA 2WYOA 4MKIA 1INLA 1PLLA 1YR7A 3TI7A 5K5EA 1D03A 1FTSA 1YBHA 1R74A 1S5PA 1U0SY 2GT1A 1KYVA 1X42A 2FUEA 3HGQA 4HPJB 4MV0A 1E9CA 1P9LA 4OHMA 3BRCA 3WFJA 3K6JA 2PUTA 2XOEA 5C7OO 4QFDA 4F4UA 1ZOOA 1YE5A 2ODWA 1OT3A 5I8ZA 1XZPA 4YRBA 3QVGB 2CNLA 5GV8A 4DTIA 4F04A 1HFKA 2V7VA 3DBLA 3H04A 3I0NA 1AKUA 1ZJ6A 1C1DA 1ZSNA 4HEA6 1OFHA 4ND5A 5HCNA 2C5BA 1BKSB 4B7XA 3UKJA 1ZI9A 2E4WA 4NICA 2HPAA 1TJYA 1XYVA 4CLXA 1E3LA 4B31A 4Y98A 2OAEA 1K6MA 1GPBA 1P0PA 1ZEJA 1H2EA 3ORSA 4L08A 4LBVA 1NQTA 1P1IA 3RREA 3AJDA 3UFXA 3QUAA 1TB4A 2IH2A 1WXDA 4LJ5A 4K46A 4KO2S 4CCAA 5ITZA 4J0QA 4CMIA 4EZEA 1EFDN 2I5PO 3OX2A 1MH9A 2DH5A 1B23P 2PLWA 3AF1A 1WQ3A 3CXUA 4MVJF 2DSNA 2RC6A 1L4NA 4LRYA 4ON9A 3NALA 3DUFA 4TMKA 2YIDA 4GLBA 3RBXA 4ZCRA 2CLLB 3FF4A 1F2DA 4ND8B 1LV8A 3PBKA 3ZE1B 1W5SA 2G4LA 2JFUA 2V65A 4FKMA 5K01A 1CS4C 1A3CA 1EUDA 3GOHA 3K96A 3PHIA 3WYDA 1YQUA 4ROSA 5AH0A 4ZAGA 1P0QA 1U7WA 2CCJA 4I6JA 2IXBA 4PZUA 5JADA 3EULA 3RVRA 1BFDA 1Q7CA 1HL3A 1Z28A 3VNSA 4AKHA 2Z6VA 1ZW6A 2O5VA 2P5UA 3G3EA 4MI6A 3LF2A 4G0VA 4R0VA 3I37X 4B85A 1GQRA 2PZKA 4CM6A 2RJNA 4MKGA 2IH4A 1U5AA 3UWDA 4ASUA 3ZJ5A 4D9MA 5IEJA 3SHQA 2F3QA 2W2TA 5JWOA 4OI1A 3GFSA 1C1HA 2HMAA 3FCOA 3EZFA 3OECA 4V0QA 2FMXA 3CT6A 4Y2RA 3LFTA 3CZ9A 1GQOA 3NTXA 3JX9A 4GS5A 3ZQ4A 4EY4A 2QG6A 1NNUA 5F52A 4FR2A 2FVYA 4K6CA 4CKCB 3GT4A 3BBPA 3FLAA 1A9TA 4DYHA 1VMIA 1VLJA 2Q07A 4J1SA 3TX2A 2FN8A 3ZHXA 3TQQA 2Y2VA 2C5AA 2PGDA 3LC7O 2ODAA 4IDOA 3TBHA 4JKIA 3QKWA 3W2GA 3CZ4A 1WDLA 3TM5A 2WKWA 1XN1A 1Z5NA 3QPUA 2UU9B 2G1JA 4UMVA 1LB1B 3FNEA 3U39A 2GTPA 3TTSA 4KJZA 4TLDA 2IVZA 3AUTA 3AU9A 1S2MA 4PGFA 3ZDEA 1C2YA 4DC0A 3TTUA 5L40A 2CXXA 3GFRA 2E4VA 2CEKA 3K5PA 4DANA 4PXAA 2C5EA 2QL9A 3KZOA 2WLSA 2LZ0A 2MWMA 3R6TA 4XX1A 4IXTA 5EQFA 4BFUA 1ZRMA 4F9EA 3CRQA 4L9SA 4I9UA 1J7KA 1BKDR 4A2QA 1J6UA 1GPAA 1KK2A 2R8OA 2ZJ3A 3LVQE 1QGUA 2JGJA 3L6CA 2ROQA 1WUJS 2C9MA 4EGSA 4QOFA 3AB3A 2XZTA 4JWTA 4S0ZA 4U0KA 1W5FA 4CLOA 1P0FA 1AKYA 1RRMA 1TADA 4I1SA 1RYFA 1BCRA 1ENZA 2PBFA 1U4SA 2H52A 1GCGA 2OKGA 3TLXA 3G88A 5KNDA 3NIGB 2QD1A 3IQHX 2VDPB 1N2ZA 1MO6A 4P4NA 2PUEA 3E58A 3I6MA 4L5IA 2HRRA 5DMHA 4F9GA 4GO1A 1EJ0A 5BQ5A 5HQJA 3KOOA 1FUKA 4DJJA 1JQLB 4RS3A 5F77A 2OO3A 2B34A 4ZPJA 1T0PA 4NMHA 1H9CA 1BE6A 1T2VA 3D31A 3KQTA 4IKOA 3U4GA 1LZLA 4ZYUA 1CEQA 4P35A 2VHTA 2YVQA 1RXUA 3GW8A 4YY3B 1X9GA 4Z4QA 2YVUA 2E3JA 4DBVO 1LH0A 1ZX1A 1XK6A 3D7KA 4UATA 4UAGA 3I6BA 1WS6A 2UYQA 3QGMA 1JQ3A 1ZYUA 1W4ZA 4N65A 3PX2A 2HHJA 4JKOA 4KLCA 3ODPA 1NY5A 3H0EA 3EDQA 3JQQA 4MNTA 2DOKA 4L5BA 3SR3A 1KYZA 1E62A 1NZDA 1CNFA 1IUPA 2M32A 4YJ3F 3KXLA 5MGBA 4TV8F 3HSSA 3TNDA 3KQKA 3K70C 2PGNA 1BWRA 2V9PA 4KLAA 3EGDA 4LPSA 3RIHA 1F3LA 1WDWB 1AQJA 3KQUA 3OKPA 4DY4A 4NBSA 2QHXA 2O48X 4AMBA 3I12A 4TV8B 1JX6A 1YD7A 5BRAA 1T5TA 3NKFA 3H9JA 3DTVD 3SE7A 4EG6A 5EHZA 4ZANA 5TS3A 1E2KA 1Z34A 3N2GB 5A7GA 4JIMA 1YR9A 3AHJA 3PQ8A 4D9BA 2PJRA 2PKQO 1D4ZA 1LBEA 3E6AA 4JNCA 4QOHA 2JLYA 4LJSA 4A5SA 3F3MA 3V2GA 2H4WA 2FPGB 1PT6A 3ZCUA 3AQIA 1PWYE 5K1ZA 4K0RA 2YWBA 4UHEA 5DHPA 3ZY5A 3GL9A 1P29A 1JKJA 2I6TA 3GLFE 3I01M 4R7ZA 2CW5A 3OZDA 4LI0A 1EFKA 1XF1A 1U2ZA 1MF7A 3F78A 5EJ9A 2O8BB 3IQFA 4MV9A 4Q12A 2CV1A 2OCYC 1TUBB 2FKNA 1P6XA 4IG9A 1DOZA 4KGZA 4C2UA 2G70A 2AI2A 4FXOA 2XDQA 4JEMA 1NE7A 5AIAA 1XCMA 2FWMX 4CM4A 1MPTA 1ARZA 3RANA 2HA7A 1JSZA 4ZRDA 3QZUA 1P1FA 4PYLA 4UM7A 3ENVA 3OJOA 4G1BA 4MK4A 3SIXA 1F5SA 4RZIA 1SKBA 4I4CA 4UUAA 1KAOA 3HXMA 5GONF 2ZATA 4QT4A 5IUJC 5ICEA 4D7AA 2PUJA 3AUKA 4LNUB 5H3HA 5TEVA 4B9AA 1JPNA 4B3MB 5GONB 2JLQA 1XB2A 2ZCJA 1P5JA 1Y42X 5A9SB 3TPZA 4II7A 4YACA 3BB1A 4PCUA 4ZOLF 4C14A 5FR1A 1KNQA 2O8EB 1USKA 4P9NA 4BVJA 5BWBA 2F1KA 1XZNA 4YQEA 3OA2A 1T35A 2ATEA 4KVGA 4KQHA 5BWCA 5IHXA 4KLZA 5JPDA 1HDZA 1JR4A 2HT6A 4K6KA 4N6GA 3DS8A 3F5DA 3TUIC 3WBJA 4AD8A 5C1BA 5C8YB 4YQFA 3P0RA 3KJFA 1WUYA 5JV5A 1AN0A 2I2FA 4G8BA 1Q1AA 1Z5ZA 1RAEA 3AUXA 2YV3A 5KX5B 4CWAA 1IRXA 3ONFA 1MTOA 4I5GA 4ZVRA 1E66A 1IU9A 5UKDA 4LE1A 3T7AA 3PXBA 5F33A 1TKCA 1YS2X 2C3YA 3G2LA 4H7PA 4R1LA 5D1HA 1TDJA 1EUZA 5AW9A 3W3AH 3S2UA 3WGQA 2XGGA 1PT5A 2J7PD 3AX6A 1GSHA 2AFIE 3R7BA 3I2YX 3WNQA 2RGEA 4YUZA 5BW8A 4BHTA 1NT4A 1JSCA 2HLDD 5F98A 3OCJA 5AJTA 3FNIA 4EPYA 2ADFA 4TRJA 4S2EA 3UT0A 3VKWA 3CEHA 3LZ6A 1AVTA 2XMSA 2Q3DA 2HRQA 3N8NA 4HYQA 3Q7QA 1SEPA 4AMGA 1X3SA 4GOLD 1Z2CA 4AYWA 3DZHA 3PNPA 5K3OA 2E18A 1AV6A 4XVUA 1XQ1A 3RTCA 2QU7A 5JAOA 1E5QA 1J2RA 3B5JA 2X13A 3I2KA 1CZLA 1Z12A 1IL0A 4MR8A 5K20A 2SECE 2GD2A 3QUBA 1KI6B 3PWZA 4P31A 1UK6A 1GG2A 1XX6A 2P9ZA 2XR1A 2ZB2A 7REQB 3PJRA 5GQSA 3H8SA 4R8SA 2R00C 3CU5A 3EVBA 1WQ1R 2CWWA 3GG9A 4UTZA 3DOHA 1JHQA 1P73A 2OB1A 2ORED 4DE5A 1KJ8A 1ZONA 4CIVA 5LZ4A 1HT1E 3AMVA 3JPYA 4D41A 2GH1A 1VBNA 4JQZA 4ZVVA 4ZZ3A 3DPIA 4LBZA 4WMLA 2OGSA 1W1IA 2GKGA 3GD5A 2ZYRA 3GO4A 4FZ3A 4I50A 1O96B 3M4XA 4G0OA 5AMXA 2CVPA 4URVR 1DXOA 3M6AA 1ZHFA 2IY8A 1Y81A 2J7KA 2VP2A 3PT5A 5L7YA 2WF7A 2QSUA 2UAGA 1L3IA 4PBTA 4CXMA 4OYRA 1PLJA 1XVIA 2BR4A 2QDXA 3GROA 1EFUA 4MJ3A 1P7PA 4E21A 4K9RA 5KIAA 1OXVA 2RK3A 3QKIA 4PG4A 4KI0A 5FULA 4E15A 2Q4TA 3H5AA 2MINA 4FNOA 3TW6A 1OZGA 4FI3C 1ESEA 4BB5A 2VDRB 5CIQA 1V8PA 1YB1A 5KTRA 4R9UC 4H60A 4Q6WA 1P2SA 4NY1A 2JZCA 1MB3A 2OC4A 3AR6A 3X1YA 1GTRA 3BZBA 3I1YA 1E2UA 2Q3FA 4EATA 1G8YA 1RCTE 1BTOA 1QGZA 2OYSA 1E3SA 1GVHA 2JCBA 3IUNA 5AUOB 4ZWNA 4MA5A 5KMGB 2RAUA 2ZIWB 2WM3A 3AIMA 3AHEA 2VDWA 4QXRA 4BU1A 2NOAA 1LDGA 3BEOA 5K2OA 1Y8QB 4CUJA 1ZCBA 5D84A 1I2ZA 4NZZA 2IYZA 2H4ZA 3KO8A 4MVJI 2GN8A 1TQ2A 4JLPA 3MWDB 1H3NA 4GGOA 5BWNA 3UHOA 4OATA 3BVPA 5CXQA 2WJHA 1ZICA 4FFDA 3CZQA 3ZC3A 4B7CA 1S2IA 3W06A 4JR0A 2QN2A 1J0DA 3R3ZA 3UANA 4MLCA 4BWGA 2VWGA 4OQMA 2BMFA 4Y30A 3L18A 5SZIA 4NENA 1ZGCA 1JKMA 1QXSA 2NUPB 3OCZA 4M8SA 3K9FC 1N8SA 1LBSA 3I9LA 3VMFA 2JHAA 4L9AA 3R6DA 3DVAB 1H1LA 1KKUA 1C9JA 1LS6A 3K94A 4CM8B 4L8VA 1XEFA 3W9YA 3U31A 2ODTX 2V7XA 1V1RB 1MPXA 4C0BA 4DIMA 1ISRA 4KDRA 1EMDA 1GGJA 3H2YA 4EKIA 2ZS9A 5JD6A 1UQTA 2VBGA 1PSWA 2GCIA 3I32A 2Z6UA 2WV7A 3NPMA 1BFUA 4HDRB 1U2QA 2HAEA 1L7NA 3C3CA 2NQ2C 4M1TA 5I4KA 1P7WA 3A0RB 1MAVA 2WTBA 3NGXA 3OICA 4EKEA 1NUAA 2JGKA 4H17A 4KVAA 4R7GA 1C0PA 1SHLA 4IMPA 2FAXA 4BQFA 3CRMA 3RNOA 2WYHA 2VYNA 4TTJA 1IZ8A 3PQ7A 4QREA 5CLFA 3EGEA 4MUIA 3T1NA 4EFLA 3DWIA 5IU6A 3THSA 3HL0A 1LRLA 4S1OA 3SVZA 4C7BA 5CYOA 2MSWA 4Y2SA 3E22B 4E5MA 3VPSA 3Q0TA 1R9GA 4ZYTA 3QU5A 3GVCA 2A5LA 3W5AA 3HKCB 4GX0A 3GZTB 2SICE 1Y6QA 3YASA 5JPCA 2O6LA 5FTMA 1TTTA 2D00A 4HEQA 4XAQA 2OHGA 1DPFA 4I2VA 3K9NA 3A1CA 1OGYA 3P45A 2CGEA 1D8TA 1FZQA 1HKHA 2FW9A 2JJ2D 5D8DA 4DQVA 4N8SA 4NBWA 4O8CA 1M2NA 1E3EA 3WTBA 2PUFA 4EUNA 1WZCA 4GI3A 4EARA 1SD1A 5CCEA 1BGWA 1XTVA 3A9TA 4L9RA 1X0XA 1RLMA 2Y8EA 2VZEA 3Q3GE 1LX7A 1ULHA 3LT5A 3M33A 4X7RA 5ALLA 2H1HA 1KZ7B 2MIIA 1Z74A 2BGMA 5C8DA 3G2MA 1W8IA 4Z3OA 3PJEA 4LY6A 1OXXK 2NV6A 1KZ9A 3VKHA 3ZBQA 1HZJA 2HN9A 2M1XA 4FT2A 4MX8A 2VQDA 1UBMS 4OBBA 2V97A 1YOVB 2PQ2A 2XOKD 3DHYA 2JI9A 3N07A 1B26A 1PR9A 1O4WA 1TEXA 3IR7A 4HX9A 2A5DA 4BBZA 4AX4A 3GT7A 1TQHA 4DHEA 4B9EA 5C3UA 4GQBA 3FG9A 4KE9A 1GIAA 1AHIA 1SB8A 1CJUC 1RAHA 4KOAA 3I9MA 3L1HA 5AKLA 5E2AA 1OWPA 4HWRA 4JXJA 1ISFA 3C3XA 1DEOA 1YRHA 1ZN8A 1R2QA 1ZFNA 2ZR8A 2ZSFA 5ALKA 1N4AA 3BQNB 3LF1A 1ML3A 4AF8A 1Y7HA 1B6RA 4LXXA 4M1KA 4Z4FA 1DWOA 1AXGA 3KALA 4ZQHA 1TYZA 4G0UA 1SIWA 2OZKA 4BRZA 3WMRA 1GQYA 2FNAA 3GUZA 4L2IA 1FFBA 2PTHA 5EE0A 3M3DA 3W4JA 1V96A 1I13A 3PRKE 1O1YA 3D3WA 4PRYA 2ZJYA 1HZZC 5DN6A 2DCUA 4EITA 3ASUA 3L0PA 4OL0A 4OQ4A 3BDVA 4BRUA 3IBTA 3PGXA 4IDCA 1A4UA 4PC2A 4XEUA 4WCFB 3GEHA 2RGRA 2V0GA 1NU6A 4I4NA 1LDEA 1X7XA 3LOPA 3GLIB 4QNRA 4DG5A 3E7FA 2X86A 2QX8A 2PUAA 1MB9A 2LKCA 3LQRA 4LJ9A 3VDMA 5L53A 1Q5PA 3JYNA 4TL9A 1J00A 1JFTA 4HRAA 4KRGA 2QUKA 1LPBB 1Z4QA 3A7DA 3LS2A 3QU7A 1MB4A 1PGNA 2W2NA 4J94A 2R79A 1ONSA 1MOQA 2G1KA 5AKGA 3FMFA 4BLVA 4RDXA 3OPQA 1DQRA 4AROA 1QGED 4Y1GA 2GDZA 4M0DA 2HRZA 1C80A 3ZQKA 3WA6A 3PPYA 3E3AA 1QF9A 3FGZA 1KVTA 6NULA 3MD0A 1ZNZA 1NIPA 2X9VA 4YAKA 5KYYB 5FI5A 2B1QA 2YBDA 3JQPA 4R1TA 4R9NA 3REQA 4DNOA 4HQRA 2AOUA 5EY5B 1IOWA 4LKOA 3ONVA 2XCTB 1O89A 2BC9A 3EDOA 3WK4A 1E2IA 2VQSA 3KSBC 2HLPA 3IHKA 3ETNA 4I1UA 3OTHA 3C2QA 2VCYA 1GKLA 4BNKA 1P5FA 2BW0A 3D5QA 4Q4AB 4XPIB 3KB1A 3UKDA 4QLOA 1WB5A 1CUSA 3T5CA 1T1EA 3I2FA 1JDBB 5E4YA 5F1OA 4KYIB 1W49A 1L0BA 1NYLA 3EGIA 4GWKA 2ZCVA 1R0BA 4L4XA 4X1YB 4A1OA 3CLSD 5EJGA 1PZHA 1Z6YA 4DV3B 1OB2A 1GTJ1 3QXGA 1PS9A 2QL6A 3HJFA 4ZVTA 2W48A 1M7BA 4URZR 3RWMB 4A0GA 2JL1A 3O3CA 2CT8A 5BURA 3OLWA 3ZDBA 1Y7TA 1NJFA 3K5WA 1ZMTA 5D5PA 1IBCA 2CVHA 2DHQA 4IOMA 3R40A 4QUIA 5SZKB 3KVOA 1HXHA 3KD3A 4OA5A 2MR6A 4HD8A 2X0KA 3FOCA 3S68A 1H8EA 3PNQA 2X8AA 1EP9A 3TNFA 3NR2A 2EQ5A 1J90A 2Y1WA 3LP6A 3E9MA 1VLMA 2PO7A 1EA5A 1BMDA 5JS1A 1LFDB 1L7DA 4CPDA 4D8VA 1OFGA 4IJUA 4GECA 3RJTA 2DWUA 2IOFA 1F2TB 2BEWA 4H1UA 1JHZA 3WIOA 1SQ6A 2JDID 4L1KA 5C52B 1H3FA 2WTEA 4PQGA 2VP3A 3ESQA 4KQXA 2TMGA 5GZ1A 4KQ1A 3OG9A 3RC7A 4OKSA 3WGKA 3WX0A 4Q16A 1VCIA 2IDJA 2DBVO 2GNAA 3PQFA 1Y4DE 4NNPA 5FBKA 1XJWA 2OG1A 4FFBB 3MELA 1N4DA 2B2XA 4JKYA 1KJIA 5BUCA 2HL6A 4OXYA 2WSSA 1KOJA 4HB3A 2BP7A 2ZRGA 5GAJA 2QX9A 1N8TA 1C4WA 2WP0A 1TOAA 3M6MD 1R8SA 1GYRA 1OFTA 2GCGA 5EXEA 4BNIA 5DP2A 3OQNA 2GZSA 3PFWO 5A2GA 3KETA 1BU5A 4MGKR 2BUBA 1IZ0A 3RTGA 4CEHA 1SNYA 1HYHA 1SM4A 2WMYA 1ES9A 4LMAA 4X60A 4C0KA 1EWRA 1NMXA 5ECGC 4DCMA 3DG9A 3HRIA 2FG5A 5EEGA 1I36A 2PUHA 2H2IA 4LOKA 4LECA 4QFMA 1UT8A 4XLLA 3COWA 3FYTA 1P2BA 4Y7CA 1AKRA 1E9AA 2GM4A 2PFGA 1B15A 1OFIA 2X7JA 4YR9A 1FP4B 4IYRA 2BF4A 2RJOA 4B09A 1KWGA 1QQ7A 1I3MA 3W7BA 1R50A 2YXNA 2ZVDA 3BL5A 1RP1A 3T9EA 5HP4A 1M0TA 2C8VA 1TVCA 4RENA 3CUSA 5FBLB 5K0FA 4GDFA 1NLZA 1QIFA 1ZU4A 5BPHA 4Y2HA 4M89A 4CLRA 3B52X 3NHKA 3UMYA 3NM6B 5IAAA 4ZT4A 1KI4A 2BDTA 2KLBA 3C1TA 1P0MA 5FNVB 3TX6A 4DR2B 4YK7A 1K6XA 1CP3A 4QDJA 3A2NA 1FUUA 4IQ0A 4BIIA 1SR8A 4P5DA 4QYTA 2OVBA 3E8XA 3UATA 3N39C 1T2EA 2PMBA 3U4CA 2AUTA 5FV7A 2C98A 4UDNA 3GWGA 4DLTA 1XWWA 3UUEA 1NV9A 1PT8A 2H18A 2CFRA 4JP3A 4D42A 1AF7A 4O2RA 4D3DA 5DF1A 2FX2A 4O2BB 5DBEX 2JH3A 1ULAA 3DL2A 2HU8A 3FNQA 3WMWA 1LPAB 3PFKA 1O95D 1U80A 1Z62A 2UZIR 4HWOA 3SZOA 3ROXA 3KXIA 3M34A 2QZJA 3R6WA 3VC2A 5I7HA 3GEMA 2I9PA 4J1TA 2VHUA 3RRXA 4C29A 2EV9A 2XMPA 2TRSB 3N2IA 2RARA 4TS4A 4XVRA 6AT1A 1Z2OX 1WHTB 1N6HA 3GJSA 4M86A 2HIGA 3K3PA 4HUQA 5EE3A 4RO0A 5ALZA 1QYVA 2HQBA 1RI5A 2QAGA 3MCAA 4K9OA 4GR5A 4LV8B 1L7PA 2Q3LA 1NQOA 4QUDA 1YR8A 3KC2A 4RTNA 4J7AA 2CXHA 2F6RA 1FQKA 4WZBB 5CA1F 3QJYA 2G5GX 3S1AB 2CJWA 1EWYA 5HVNA 2OXRA 2BEUA 1N6RA 3FSGA 5G4KB 4LN1A 3U7RA 5CA1B 2IOQA 4MRRA 5FFNA 1Q0LA 2HA6A 2YJTD 3PQCA 2BZGA 3QBTA 4MWZA 4QQKA 1VHLA 5KNBD 1MAUA 1LDMA 1QKKA 2QVBA 2E89A 3KM0A 2WWWA 4TLCA 3TQIA 1NXTA 4C4AA 4UD6A 4W8GA 4LWZA 4ZDJA 1EJBA 1YRAA 3Q6IA 3HR7A 3NBUA 3O38A 3VKVA 3I61A 2WM2A 4DABA 4OIMA 2F62A 1A7UA 4C7OB 4M0LA 5DU2A 3A1UA 3HA2A 1PGJA 3PENA 4YO7A 5LQMA 2HSZA 1G3UA 2B20A 1AHPA 5ANRB 3ZDRA 2HA0A 3BGIA 1RAAA 4RFSA 2P27A 3KLNA 4ZK6A 3VHRA 3MUOA 2FPSA 4TTAA 4WUTA 3CLRD 3CLTC 4LZOA 4RPJA 3HJBA 1RQRA 4YBZA 3SEAA 4KLNA 2QD3A 2X2PA 3G0DA 4F3RA 4CMEA 4R8RA 3PFCA 5K6RA 1QR2A 1YS1X 3N6XA 2W98A 4P7GA 5JYEA 2XA2A 4P4TA 3WSWA 3L06A 2RHGB 1US8A 3CLHA 3EVFA 3EISA 2D13A 3EB9A 4U63A 5CD1A 3OZVA 1ETHA 1Z88A 3GK3A 3R3VA 4QUBA 1FEZA 2Q3BA 1F8YA 2XY4A 3AB8A 3DMDA 3ID6C 4QPPA 7ABPA 1GARA 2LKDA 2DQYA 4E14A 3OOHA 1LC0A 1V4VA 2GPTA 3PSAA 2PV7A 1JBKA 1WEKA 3OC6A 4X5OA 3T5PA 4HO1X 4JLUA 4B7ZA 2CFOA 1K7YA 4BJ3A 3F6EX 5ALSA 4BNGA 2UXCB 1SA0A 2HIAA 4R5MA 4I1IA 2QRGA 4L27A 3HU2A 4OJKA 1UJ2A 2IW3A 2WOOA 4W5HA 5KYWB 4NAVA 4EWLA 2RHCA 4TV9A 5FUXA 4DLWA 2B5OA 1YMQA 3EIQA 3PKJA 1NPYA 1LPNA 1M2HA 2XGMA 4JSTA 4O1HA 3GDHA 2PHZA 3DFIA 2R6JA 3EWAA 1ACJA 2XB4A 2ZRNA 3OPYA 4FGUA 4ZYVA 2X0IA 4M1WA 5DBFA 1XDDA 2BSQA 1CUZA 1GPKA 1LS1A 3CWZA 5E8RA 1Y3HA 4YUAA 4YQZA 2A5YB 2FFQA 1X1RA 2A1UB 5JEDA 5DCWA 1GUFA 2Q5IA 2MTBA 3SNKA 4H0FA 4O2AA 1H4TA 2BFOA 2ZSIA 1R0LA 4AUKA 4MYDA 4B79A 2YFQA 3KYCB 5LBUA 1EB8A 4AO7A 1SC3A 5EFOA 1EFTA 4UC0A 2CSXA 2RI6A 5EMMA 1EPUA 3PDWA 2HA3A 1SC9A 1TVKB 1Z2AA 1PGPA 2CUNA 2GFHA 2OSBA 2OUKA 2JKVA 2PWPA 4J3JA 3WP1B 4UHBA 3ZTYA 4POAA 1IUKA 3NOXA 1AKMA 1PG5A 1RMQA 3I83A 5AM0A 5G1OA 4B3CA 4BS9A 1JG1A 1IBSA 1TO2E 1VE1A 2ZRQA 3PDIA 3QKSB 3PUXA 3O8QB 2VAVA 4KKXB 4GYYA 5LP6C 4FILA 3SGLA 3WYBA 3F9RA 4YT2A 5JNRA 3KR2A 2FPIB 4NPAA 5HKAA 1LGYA 4MQEA 4QU5A 1Y5MA 3AI3A 3E35A 1CWUA 2ZIAA 4GGMX 4LC0A 1DJOA 4MV6A 4XWTA 5DDIP 3EDRA 2ZBPA 3LWZA 4KXWA 5ITSA 4G8CA 4MW2A 1UWCA 4E2YA 4JROA 4ASUD 3CTPA 2SKEA 2XT0A 4E0BA 2BD0A 2FZWA 2X2EA 3IAS6 3K8YA 2O2IA 2QUIA 2OLEA 1KETA 4JP8A 4GQAA 4ER6A 2PA3A 3PUWA 4LQDA 1XPOA 3N8GA 1H5NA 3IUPA 3C6KA 2KE5A 1P8JA 2PSFA 4PLPA 3QVJA 3SVTA 2P9EA 1I7DA 3GGGA 5CGZA 5EMHA 4BNNA 4ENQA 1T15A 4KRYA 4K0KB 4LYAA 1QP7A 4R16A 3QLVA 4GX5A 2W6JA 4LHEA 1KQNA 1YZUA 3EIOA 4TN5A 3DBRA 3VTFA 2PL5A 2VPZA 3AHHA 3KUXA 4PHTA 3JR3A 5T6MA 4QUAA 4X85A 3URKA 1XZDA 2W4QA 3E0XA 3QBJA 3T9FA 3TFQA 1XCOA 3HR8A 3OCCA 4RPIA 4UCXA 3IPRA 1NMZA 1WZNA 3D6VA 2XUKA 3W2HA 1L5WA 5DW0A 5F64A 3N9IA 1FRNA 3MT7A 1IN1A 3JASB 1N8NA 1MRNA 4ALMA 4LQ4A 1DQSA 3D7NA 3HCCA 3UAXA 3PJDA 1NLYA 2C7GA 1OLSA 1JPVA 4D6PA 1PO7A 2IZ1A 2Q46A 5U1PA 4ZK2A 1NI3A 1OTHA 3S70A 2R7KA 3G2JA 5BSFA 5TGTA 3IEPA 2NTYC 2R6GA 1KEKA 3NUQA 1J9EA 1C3JA 3T9DA 1DGQA 2E4XA 5KNDD 2G9VA 2I2DA 1AZWA 2XBLA 1JS1X 1I3NA 1MQSA 3DZDA 3PF8A 1EWKA 1WLSA 2GTHA 2HWWA 2WZQA 3AVPA 5IP5A 4EEKA 3REFA 1BH6A 3ZNPA 4U9IS 1KSGA 4UUMA 5I48A 2O2ZA 3JVDA 5J4VA 4G86A 4U6SA 2BI8A 3DOFA 1RLJA 3GG2A 1A8UA 2ODQA 3IMKA 5A71A 1PTJC 3T3PB 4XZ3A 5KUTA 3N8IA 3C1AA 5JZOA 4UREA 1QTNA 4JDUA 3FZQA 4ZT6A 3STHA 5FDFA 3G9QA 4KGVA 4R2XA 2A0YA 3JTEA 4CFZA 3BWCA 3CUKA 3G8DA 4G4SO 2WJGA 3DE6X 5FOXA 3KLPX 2P69A 4PF1A 3TEJA 4XSGA 3LO8A 3LUBA 1Z5VA 3UC9A 1ZL2A 3ZW7A 1Z37A 3NHBA 1A77A 3AVWA 5FPHA 3GCZA 3Q3JB 5DNAA 4Q21A 2X0EA 4CKXA 4M9CA 2IEGA 3BREA 3N53A 2OO5C 4MHSA 5IC5A 2FWJA 2GLXA 4YP1A 4AJ9A 1C41A