4FMDB

Espg-rab1 complex structure at 3.05 a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
171
structure length
171
Chain Sequence
PEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords EspG protein
publication title Structurally Distinct Bacterial TBC-like GAPs Link Arf GTPase to Rab1 Inactivation to Counteract Host Defenses.
pubmed doi rcsb
source organism Escherichia coli
total genus 54
structure length 171
sequence length 171
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4fmdB00
2GBLA 1PLKA 4EJSA 3NTUA 1BMFA 5JSZA 4CT5A 3K0CC 1TEXA 2FPLA 2VBCA 3T1VA 4A6XA 2QE7D 1VIAA 2VP2A 3FVQA 3PXGA 2IYZA 1SULA 3VR1A 4QC2A 5JCZA 4H1VA 3V4FA 3KFXA 5CB8A 1P9RA 1WB9A 3CONA 1OH8A 5B2ZA 2O8DA 1CIPA 1F2TA 2MMCA 1XPRA 5F3WB 2J0QA 1Q1ZA 3U3OA 2BWJA 3VR3A 2RMKA 2OAQ1 2JASA 2PCLA 2IS6A 2ZE6A 2J0VA 4AYWA 3T5DA 2REOA 3W9YA 1Z6YA 1FMJA 1TADA 4WZAE 3E70C 1AGRA 1XMJA 4M1YA 2QRNA 2DFLA 2VHJA 1DG1G 2WIBA 4Q1DA 4JL5A 2P0EA 3SC3A 1FOEB 1T6NA 4KYIB 1OH6A 1OXSC 5H1YA 1LY1A 4NCNA 2JJ1A 3MWJA 1L4UA 3K9GA 1N6KA 5JEDA 3BIFA 4LGMA 5IDVA 3L0IB 1KDTA 2OSBA 3KQKA 4JSTA 2IWHA 5GJVC 1E2EA 1KHTA 2GETA 2FX3A 2J0UB 3AKDA 1DAIA 4B3GA 4PR0A 3DOFA 3TR0A 4TZ6A 2VO1A 2WWWA 4KSBA 3ICQB 4ITRC 1KDPA 1GRNA 2F3TA 4HSEA 2NPIA 1NVVR 1FL9A 4WA7A 3O8CA 1KI1A 4ZO4A 3SHFA 1V5WA 1G3IA 4L9WA 2FWRA 5TXGA 2WM9B 3K09C 5LBIA 4M22A 2JLVA 4CEHB 1YR6A 4A8JC 1OXTA 1OH5A 2EW1A 2GJKA 1W1WA 3MG9A 4M1MA 2WMOB 2B21A 3VR5A 3RAPR 1P5ZB 3HR8A 3V00A 4UNRA 3B1ZA 3KKMA 3RS3A 1XU4A 4BZQA 2XXAB 3U7FB 3QG1A 1UBFA 2AK3A 1Q1EA 1X8JA 3EW9A 1D9ZA 5GVRA 1U8YA 2HJGA 3PVSA 1F48A 2WJHA 5KHOC 2IF0A 4Q4HA 5AUNB 4LBYA 1DAKA 4YONB 2DFKB 3OAAA 1NBME 1E0SA 4HB0A 2NGRA 4WW0A 1WDTA 4EQ6A 4LHWA 2OUKA 4I1SA 1ZNZA 4JLMA 1G17A 4PAMA 3QIAA 5JMTA 1G20E 2RCNA 1I4TD 4CDGA 2ATXA 1XMVA 2C9CA 5IT5A 4DLWA 3LNCA 3I72A 4A1FA 3RSOA 1RPZA 5C1BA 4KODA 4F92B 4R9UC 1EWQA 5GJBA 1IY0A 2ZITA 2ERXA 2QUZA 3ZS8A 5J40A 3KDSE 3ECCA 3GEIA 5E7MA 3U3MA 5EJEA 4JVSB 3ETLA 3IBYA 2Q3MA 4DCNA 2RHMA 2FMXA 2GILA 1W0JA 3X2SA 1S9HA 3L0PA 3ZQJA 4O0MA 1U99A 2H17A 3UATA 3TMKA 2QGNA 3CW2A 1OIVA 1XEFA 1VKJA 4QHSA 1H65A 4Q47A 3HP1A 1XX6A 4Q1CA 4PC6A 1E79A 4D82A 4DHEA 5EE1A 2ZI3A 2PJRA 1JR3A 1G8GA 4Q02A 2ZI7A 3BJIC 4HATA 4EUNA 4US2R 2ZYWX 3NDPA 4A2QA 2HYIC 3X1YA 4LHZA 3SNHA 3HU3A 3AKYA 1KO7A 5CB6A 1LVGA 2VHQA 5JI3E 2VLIA 3IHWA 4NH0A 5DISB 2FPKA 4M2LA 2WPDD 2DWPA 3BB1A 1DPFA 4PPNA 5J4HA 4A82A 1R5OA 1H8EA 3EG5A 3ND8A 4BQSA 4LWZA 4Q9HA 2GXUA 2GJAA 2RGNC 2RGAA 1E9SA 2WKQA 1KJYA 3UIEA 5FOTA 4TTRA 1WRBA 2ZR7A 1XEWY 4URYR 5HZKA 2G1JA 4MH0R 4HUTA 1IAQA 4D4LA 4R2IA 3EXAA 1GG2A 1T9HA 1GKUB 3NBYC 3BS4A 2QTVB 1LV7A 4B3FX 1RIFA 1YRAA 3KB2A 1E96A 2BCJQ 2XGJA 1FUKA 2A9KA 4DRZA 4UXIA 3T35A 1D8TA 3LO5A 2GXQA 1A82A 5EP1A 3Q72A 3NEYA 4LUCA 1Z0KA 3TIFA 3K0SA 1TUEA 1FTSA 1ZIOA 4BFUA 1E9CA 1J7KA 2JLSA 1N6IA 3QF4A 1H8HA 3QXCA 3VTKA 4KI0A 3SEAA 4LPKA 3RHFA 5KSZA 5CDFA 5EP3A 2GXSA 2OE2A 2QMEA 2ZJ2A 3CB4A 3NEJA 1ZCBA 5FH9A 1G7TA 2A30A 1J99A 4O25A 5IF9A 1Z28A 1XCMA 3LDAA 5DIFA 1XFAA 2LKDA 4Q19A 1ZBDA 1Z47A 2A3RA 4C7OA 4DCSA 4KSCA 2ZRCA 2BCGY 2V6IA 2W6JA 3CO5A 2QSYA 1UADA 2ATVA 1T4GA 3HU2A 4P4SA 4QRHA 2ZU0C 2O8BA 1R0YA 2CL0X 3R8CA 1NIPA 1ZNXA 4TLDA 4CEIB 4RZ2A 1KK2A 1PUJA 4Z8YA 1XMSA 2A7QA 5JWHA 1ZM7A 2O8EB 1W0KD 2X8AA 3T15A 3BFXA 2IYUA 1E0AA 2IA5A 4IDPA 4TLEA 1GVNB 2NO7A 3L8ZA 1JPJA 1W2HA 2QP9X 2GESA 1NJFA 4GDFA 1NRJB 1KGDA 1XP8A 3AF3A 1XCGB 3AP3A 4HAVA 1UEIA 1KI2A 4ZDWA 4QM6A 4CRWB 2MSEB 2HXYA 4KO8A 1PLLA 1T0HB 1OFIA 3L43A 1YE8A 4I4LA 4KLZA 4LY6A 2C8VA 4LHYA 1QG2A 4MYHA 4TT3D 5GJCA 3VKWA 4EPTA 4BPBA 1ODFA 1IM2A 1OPXA 4ZI3A 3FTQA 4AD8A 3OIYA 4BFSA 1OHHA 4D4JA 1BMFD 1E2PA 2H18A 4BFVA 2XSZA 2Q3FA 4KITB 3KXIA 4JKIA 4LJ4A 1E6CA 2AXPA 5JLJA 3GJXC 2VPPA 2Q9BA 5CIWA 3VR4A 2FU5C 4OKSA 3T34A 2YOHA 4IDHA 4L4UA 1SGWA 2HT6A 1XTRA 1NJGA 4TYPA 1JAIA 2GJ9A 1E4YA 1EK0A 1HH4A 1T3LA 1W47A 2JAQA 2OZEA 4MDFA 1DE0A 121PA 2D4HA 2G83A 2G9NA 4W7SA 4Z54A 2P5TB 3B60A 4RKFA 1EFCA 4JBWA 4V0NA 4C0AC 4ARZB 1U8AA 1KI6B 3OZXA 2FFBA 1G16A 1ANKA 3B82A 2RH5A 4RD4A 1Z63A 2GCPA 4Q7JB 3KQUA 5FBQB 3GQBA 2YWGA 2JJ1D 4RFVA 4TT3A 1KMHA 3K0CA 1SVIA 2IYRA 3PUZA 4ERNA 3P26A 4F4JA 3BC1A 2QMHA 2QA5A 3GJ7A 3ZVMA 3CRMA 2CMKA 4IVQA 2F43B 2X2EA 3B85A 3DDCA 1EFHA 2FSFA 2XEXA 2WBLC 2JJ2A 3Q8XB 3IEVA 2J5XA 4LJ7A 2IYYA 2H7VA 1Z6TA 3H4MA 3K0AA 4D4KA 2NZJA 3UMFA 2GJ8A 5CIQA 5H8WA 4JLAA 5J5CA 2EQBA 4TLBA 2DR3A 2LKCA 1Q44A 2JLXA 1G5RA 4MRSA 4F38A 3QPVA 2ANCA 2YC4C 3CF0A 2QG6A 4V0ME 3B2EA 2CL7X 3LV8A 5JSZB 3GEHA 2NMVA 1EFTA 4D26A 4WZBE 3C16C 1VCIA 1QVRA 2ZJAA 1E2IA 3ADBA 4A0GA 2GBLC 3MRSA 3OAAD 1S96A 4Q1AA 4QHTA 1YKSA 1R5BA 3REFA 1TL7C 3LFUA 4LC0A 1F2TB 3PIRA 3Q5DA 4I1VA 5JRJA 1DAHA 3C4JA 3WHLA 1IBRA 1W44A 2J45A 2ZS9A 3CX8A 1MRNA 1LB1B 4LC1A 1EX7A 4U02A 1O3YA 4N3NA 3NXSA 3ZVRA 2G0NA 2W2TA 4A0RA 2IT1A 3LAWA 4XVUA 3CRRA 2ZRDA 1RFLA 3MGCA 4C2TA 1WBBA 2HXSA 2ZSEA 3KTAB 1SKYE 2PJZA 4PPFA 3RRMA 2JLYA 3B1VA 4ZV4A 3SQXA 2QTFA 4D81A 5EP2A 1Z6XA 3THXA 1W0JD 5EXPA 1A2BA 2BDTA 4HAZA 4CEHA 4TMXA 2UVQA 1OKKA 4RVCA 1VTKA 4C0HA 1UKVY 4ZCMA 4QGGA 2V54A 4WAUA 4QBHA 1CR2A 2QT1A 1JEEA 3NHAA 3QPWA 4MGIR 2OFXA 1E79D 5A5GA 4UQOA 2XXAA 1DARA 1JR3D 4PSVA 3CZQA 1Z22A 4QOSA 5DI3B 2BMJA 5L3SA 2DWQA 3RRNA 2DCUA 3VMFA 3D31A 3AEZA 4D0GA 2X77A 1GWNA 4JKYA 1OFUX 1Z0DA 2GRJA 1H8ED 4G1UC 3N70A 1ZP6A 3W90A 3AVTA 2F6RA 2A5JA 4TL9A 4URZR 1Z07A 3GLIB 4OHVA 5TB5A 2VHCA 1CJUC 1Z8FA 2WMNB 1XTQA 4GOJA 4XTRA 5H68A 4R2HA 4FCVA 3EZ9A 1VCNA 4NTZA 1MT0A 4II7A 2P6RA 3DKPA 2ONKA 3ZDQA 1FNNA 3UMRA 2GZHA 1LFDB 1E99A 2A5GA 2R44A 4DLYA 3EPKA 4DXAA 4YC7A 3SS8A 3RRZA 3U4QB 2PMDA 4W5JA 2D2EA 4DUGA 1W49A 3BWDD 1SHZA 2ZJOA 4DEYA 2JLQA 2CLCX 1FNMA 1XJCA 1KKLA 5KSYA 2UZ3A 1ZUIA 4PO9A 4TMVA 2VA8A 3L8YA 4PQYA 1MO5A 3B1XA 2XITA 4G3XA 1NMXA 4GZMA 1G3RA 4JIMA 5TARA 4C0QC 1J90A 1NVWQ 1BOFA 3ZH9B 4PHTA 1ZM2A 4F4CA 5HKKA 4G0NA 5TVKA 4D0LB 2G3YA 4IVPA 2W6JD 4URUR 1VCMA 5HZHA 4B76A 2DFNA 2GVDC 4M9XA 1IHUA 5JFGA 1RW4A 3AB3A 3HDTA 5HE9A 2OO7A 2D7CA 4MITA 1W46A 4ZKEA 2CHVA 2BV3A 2FZ4A 2NO6A 4P0TA 4LBVA 2CHGA 1GKIA 2WKRA 1KJWA 3H1TA 1F2UA 2P6NA 2Q0HA 2VHUA 3N2IA 1S9DA 3K1JA 4TSFA 4OHWA 4BE7B 1Q0UA 3U5ZB 1X1SA 5FTJA 4EKDA 1UFQA 1BYUA 4NYIR 4C0JA 2EWVA 4LV8B 1RRPA 2W83A 3K0EA 5DNYB 4HYYA 4QXAA 5DN6A 3K70D 2MSDB 1R5NA 2J1LA 2A5DA 5J4KA 2HT1A 1OHHD 4FMDF 1UKZA 2YJTD 4DIDA 5JHHB 1W48A 1TQ2A 2VRWA 3SYKA 1JR3E 3P32A 4AWXA 3AUXA 3QSYA 1IJFA 2IWRA 4C9BA 4WXPA 2PT7A 4HB2A 4IKEA 3MCAA 3FFBA 2CLSA 2WJIA 5BYKA 221PA 721PA 2ZM5A 2WWFA 3GD7A 4L8GA 2B8WA 2D2FA 3O8BA 2QENA 1E2QA 2RKOA 4RD3A 2AFHE 3MSXA 6Q21A 1EWRA 4JYBA 1NN0A 2ZXUA 3QNUA 4G5SA 1E1QA 1KJZA 2OV2A 1D5CA 5TV2A 4DLXA 5FBVB 1FFHA 3UKDA 2R6AA 4HLUA 4OQMA 3X1ZA 1OE0A 2FSIA 3QVUA 4XWAA 1GDDA 1NI3A 4AKGA 4E5UA 4HI0E 4HAYA 1RJ9B 1E9DA 4CT4B 5DLQC 2JEOA 2REBA 4JT2A 1KK0A 4P3YA 1CEEA 5AJYA 3BD9A 1O87A 2XJ9A 5DYIA 1NLYA 2MSCB 3QEJA 2VL7A 4I99A 2ZJBA 5FFMA 1II8B 3P27A 2IYLD 1TF7A 4QJ4A 2JJ2D 4TN1A 3D7MA 2YNMA 1Z6AA 2C78A 1HURA 4G5GA 2FFHA 3BB4A 2ONJA 4MKIA 3QG5A 2QPTA 3AVQA 1HA3A 4FN5A 4LSGA 3FGNA 3QQ5A 1RC8A 3LW7A 5CDFE 5K8LA 4C4PA 5JCPA 1WMSA 5G3ZA 2IUTA 3IPXA 5HPYB 1RE0A 3QPUA 4MUAA 3RDPA 3PEYA 1N6NA 1SVOA 1CTQA 2Q9AA 2WTUA 1U8ZA 5DH9A 1D9XA 2QY9A 2ZEJA 1K5DA 1K5GA 2V7QA 2WWIA 2JA1A 3PUXA 2QI9C 2IYSA 3FMIA 2HCBA 4PQFA 4NCIA 4ARZA 4B3XA 1JALA 2FG5A 1M34E 1E2DA 1DAMA 5CJ2A 2AK2A 1JXMA 4JL6A 3K70C 1TF2A 2REXB 4H9GA 5CYOA 5TMPA 1SVWA 2ZUBA 2QEQA 1Z2AA 4DSUA 2P65A 3BFVA 4DVGA 3SJZA 3BERA 2ZSBA 3H0KA 3UG6A 4HZIA 1WBDA 1QHSA 1E98A 5CK5A 1U2RA 3IPYA 4Q00A 2JJ8A 4DT1A 1OIWA 1GL9B 1I4LD 2F43A 4Q9JA 3Q7PA 1EFRA 1G8FA 5EE5B 4BFXA 4FIDA 1G3MA 3CWZA 2CCKA 1E2FA 2IHYA 3QKRB 2VF7A 2GXAA 3NWJA 2H1LA 1P2TA 4NP6A 2HCJB 3G5UA 2GEDA 2IS1A 1BKDR 2H57A 4FMCF 4GMDA 2F55A 3DM9B 3U7GA 4EFMA 1ZU5A 2EFDB 1YZTA 1QBKC 4MKFA 4N1AA 3RABA 3W6PA 3NDBB 1OKKD 1RRFA 3HPRA 4ZPXA 4GI7A 1FW6A 1PLJA 3ZD7A 4OI2A 1II9A 5L3RA 1KMQA 1EGAA 2IS2A 3MWYW 1ZM4A 2PEYA 5JJKA 4LJ8A 3W34A 1YR8A 5KNCA 2ZI6A 4PC1A 1BO6A 4ACAA 3NC1C 4IVRA 4DJTA 1DVRA 3N2EA 1ZC4A 3TUIC 3B9QA 1I2MA 2QQEA 3K0AB 2FSHA 3GJ3A 1SVKA 1U0HC 2DPXA 2AKAB 3VAAA 2O8CB 3SZRA 1HYQA 3OE7A 1KI3A 1ZINA 4DDWA 1YR9A 5EXXA 4AG5A 1OXXK 4NU0A 5AJVB 1MABA 3FHCB 1T8TA 3FB4A 4U7DA 1KI8A 2B8TA 3IQWA 2QMOA 3KKQA 4HB4A 4Q7LA 3KKPA 3TQFA 1G41A 1JB1A 3J81k 4NCHA 3ZGXA 1T0JB 1N2CE 2BM0A 3AP2A 3KTAA 4E22A 1XEXB 1YQTA 2OEPA 4Q5IA 3ASZA 1WA5A 2QPOA 4S35A 4PZZA 1MKYA 4OQFA 4DSTA 3PFIA 1VHTA 1YR7A 1M6NA 4WBSA 1YZKA 1UEJA 5LPNA 3BFKA 2ZRJA 1YU9A 3C5CA 4RZUA 3WMFA 1NMYA 4B2PA 2EWWA 2VP9A 2NG1A 3BB3A 3IBGA 2J46A 3MJHA 4Q66C 3WMGA 3T1TA 2VF8A 3LRPA 1CJKC 3I1FA 4DUGD 1ZC3A 4NMMA 2WWHA 2SHKA 1E32A 2EU8A 4M9ZA 4O2LA 5G41A 1E9FA 3ADCA 1A1VA 2IS4A 1XMIA 4MKGA 3P1JA 1OFTA 4LYHA 3OHMA 5DI3A 3SJAA 4LYFA 1CLUA 4M53A 5UKDA 2B92A 4MA4A 4J0QA 3THXB 2CL6X 1BS1A 3PUWA 3I62A 4DB4A 3OIVA 3WYGA 5K8IA 1DELA 5FBLB 1XPOA 2R6FA 2HV8A 3OIUA 4NYMQ 3GLIA 2YHSA 3ZLJA 4LZZA 2GKSA 2EFEB 4P33A 5G53C 1XTIA 4V03A 5IRCD 4EPYA 5EE3A 5DI9A 1G7SA 2ZQ5A 5CYPA 3CNNA 2F9MA 4XOIA 5L3SB 3T12A 4KFUA 3THYA 2XZPA 4YMWA 1KSFX 3C7KA 2ODEA 1UBCA 4ZDKA 1NVXQ 1AJEA 4L9SA 4KJZA 1R0ZA 2ZRNA 4MRNA 4Q9LA 3W8RA 1S3GA 4TSFD 4JLVA 3LXXA 3LX8A 3R7WA 3B13B 1OLOA 4I1UA 5FTMA 3U4QA 4A36A 2ORWA 2WJVA 2KWIA 1KSJA 4A6PA 1G4UR 1S8FA 2V6JA 3L0SA 3VQTA 5DN6D 1NN3A 2RGEA 4BFWA 1QHIA 1GKYA 4LHXA 2Z4SA 2D62A 2CVFA 3FYHA 1DS6A 1ETUA 1R8SA 3KL4A 1C9KA 1Z6GA 4HZUB 4B44A 1R2QA 1KSHA 4HLQB 3BXZA 4EIWA 2ZRLA 1XJQA 2WIAA 2IXFA 5BXQC 2GZAA 1NLZA 3AVOA 3LW8A 2R62A 3SDZA 4FWIB 3QENA 3ASYA 4LJYA 4M1TA 1RRCA 4GFDA 5FL7A 4KAXA 2CXXA 3Q3JB 4NPHA 5LD2B 4A4DA 1N5LA 4Q4LA 4HAUA 2IK8A 5JWRA 3TSOA 2ZRMA 4EFNA 3EIQA 4FW9A 3AF0A 4Y0AA 1VG9B 4A15A 4BASA 2ZREA 3RWMB 1E1QD 5JI2E 2W2XA 4Q1FA 2VH5R 4TWZA 3CPHA 5FOXA 5LD2C 3DKVA 4DZZA 3ADKA 1US8B 1XTKA 1Z06A 3CX7A 4JZKA 2GCOB 1W7AA 2KI5A 4A9AA 1SXJA 3AKCA 4M21A 3AGQA 1MO6A 2R6GA 3MWKA 3WP1B 4QBIA 2OILA 3SJCA 2V9PA 3BOSA 3R8FA 4RFSA 2FJUA 1UKYA 1X3SA 4OQNA 2V1UA 3PITA 2AKYA 2BC9A 2GA8A 1NN5A 2ORIA 2YC2C 1CXZA 1E0KA 2ASEA 2R2AA 3QKTA 4M1KA 4BLTA 3LQQA 1KKMA 2ZR0A 1R8QA 2GWHA 4B43A 1ZUHA 4M4SA 4MRRA 2G6BA 1NF3A 1TX4B 4M8NE 1F2UB 3RNLA 1KO4A 3HYRA 2G88A 5J4VA 5KSOA 1NY6A 4TTPA 4KU4A 2P5SA 1Z83A 3RRYA 3A1WA 4V0OA 3PG5A 4ZDJA 1FPMA 4JLDA 2VHTA 4KLNA 2JDIA 2NO1A 2ZVPX 4B74A 1ZAKA 2YWFA 5JRZA 1FX0B 1ESNA 4AYTA 1NMZA 2CVHA 3R9XA 4B75A 2V7QD 3CZPA 1U98A 1OIXA 1OF1A 1ESMA 1E9AA 1M8PA 2QP4A 3A4NA 4YMSA 4NYJQ 4JBYA 4AC9A 4AI6A 2V55B 2CE7A 3VKGA 3L82B 5E7IA 1DEKA 1RJ9A 1IN5A 2JLRA 5FUYA 3U44B 3AP1A 1KDOA 4JLOA 1MO3A 3TW8B 2OLJA 4ASUA 3UK6A 1GP2A 4AG6A 3QOFA 2WWYA 1II8A 1XZQA 2ZJYA 1CJVC 2IUUA 1EFRD 4MDEA 2QAJA 4U00A 5SZKB 4BECA 4LDJA 1JBKA 1AZTA 1NVVQ 1E9EA 4LJ6A 4DSOA 3ZQ6A 2IEZA 3RC8A 1X86B 1OXUA 1S3SA 1SZPA 2BOVA 3Q5EA 2KJQA 3AKEA 1GM5A 1T3SA 3CIOA 4EDHA 2ZI5A 1R7RA 2QU8A 3U3JA 4JMPA 2VIIA 3IGFA 1G3QA 3IKJA 1HV8A 2KBEA 4HLUC 2ZJZA 3X1DA 3CH5A 1QZXA 1JJVA 3EZFA 2NPFA 1ZCAA 4H1UA 3W3ZB 1GIAA 1G5TA 5K8TA 2QMUA 2GZDA 1U90A 1HE1C 4LJAA 1M7BA 1VG1A 1NKSA 3PEUA 4B48A 5CITA 4WZ6A 1RYFA 2WOJA 1HT1E 2PZFA 4OHZA 1PVOA 3OEHA 1G19A 1OYYA 4GBMA 3M1IA 3JVVA 4IXNA 3OE7D 1TQDA 1XB2A 2AX4A 3KJIA 5ANRB 3SBDA 3TVDA 1B0UA 4D4MA 1G3UA 2IYXA 4QFMA 3SHWA 5A4JA 3TGPA 1AK2A 4IOMA 4GOXA 3NH9A 1SVLA 1XWIA 5H70A 2F1RA 3QKRA 4B2IA 2QPAA 421PA 2CNWA 1WF3A 2BIFA 3CRQA 1DO0A 3SR0A 3THWB 5BW8A 1S4QA 2ZROA 3MUFA 4TZ0A 3B9PA 2W00A 4BLPA 2Q21A 3GJ0A 1XXHA 4FD2A 5FTNA 5HCIA 3KZ1E 5AUPB 4MRPA 3KX2A 2GDJA 5M04A 4DT1B 1QHHB 4POAA 1P6XA 2CDNA 4LRWA 4MYUA 4GP6A 5A0FA 1UF9A 1W4CA 4DLRA 1XZPA 1N3BA 3QJYA 3RYTC 2PT5A 1CR1A 1QHXA 1ZM9A 5JHGB 4YQFA 4MYTA 3M6AA 5HTKA 3TR5A 4NHOA 3H84A 2WSMA 1M7HA 4GP7A 1SQ5A 2WICA 4JS0A 2CBZA 3R9IA 1ZRHA 2R9VA 4XSGA 1HEIA 1KNXA 1E9BA 2O8CA 3GLGA 2KE5A 1UBEA 2PCJA 1KY2A 2IXEA 4W9MC 1GNQA 2AHOA 1FQJA 1GRRA 2CHQA 3E5HA 3LBHA 4ESHA 2NZ8A 2PZEA 3VX4A 4AKEA 1TNDA 2VSXA 1HE8B 3BBPA 3OESA 4P32A 5KOYA 4DCVA 4WVFA 3GFPA 4A0HA 4E09A 5TDHA 3OF5A 1Z29A 3LVQE 1NY5A 5FPYA 4ON9A 2JLUA 4PAOA 5BYJA 4MGKR 1R6BX 1KTVA 1NVUQ 1KI4A 1XEXA 4DLUA 3U60B 2FDCA 3EWSA 1R0XA 4B3DA 1UBGA 1OJLA 2V4ZA 2H16A 2Z83A 3BAFA 3EZ6A 2BMFA 3B8HA 4V0KA 3DM5A 3DHWC 4M9QA 4WXRA 5JJIA 2PBRA 2P6UA 4EFLA 5KO2A 2ZR9A 3FMOB 1MABB 1N5JA 4TL6A 3QVVA 3BH6A 1KI7A 3DMNA 4RD6A 4Q21A 821PA 5CLQA 1JXOA 3GLFB 1E0JA 4GT1A 1YZLA 1AZSC 3R9WA 1UJ2A 1BH2A 1HUQA 3G82C 2UZIR 2ZIAA 4PXAA 3WNDA 4NDZA 4BFYA 1FMLA 1HQYE 1FQKA 4V02A 3EPHA 1UAAA 1AM4D 3TKLA 4NONA 1KNQA 4HDQB 2ODWA 3G0HA 5L3QB 3SE0A 4YMVA 2QORA 5FL7D 2YKGA 2GK6A 3CH4B 3I5YA 3A58B 3NBFA 4WOPA 3AVPA 5FI1B 3F3YA 2GCNA 2Z6VA 2EFCB 1N0VC 4DCUA 5FPKA 2IW3A 2NQ2C 4Q4JA 1W4BA 3A8TA 2MMGA 2D74A 2QM8A 4IEIA 1KDRA 2N42A 2FEOA 3F0TA 1YRBA 4B6FA 4IOKA 2AD5A 4IFBA 4DLZA 2C77A 1BYIA 1CF4A 4YXWA 1LNZA 4LJ9A 2BHRA 3LXRA 4QGAA 4MGYR 3TQCA 4URXR 2QSZA 3GLHA 2EYUA 4Z8XA 1L8QA 4PC7A 3EARA 5FOSA 2O0HA 2D7DA 3CKLA 3QI2A 1D2NA 1XBTA 3THYB 2AXNA 2JLZA 4HZUA 2F9LA 5E7JA 2J3EA 4JJKA 1P4SA 2F1HA 2H8KA 3L2OB 4KVAA 3AF2A 1CBUA 3CF6R 3DZ8A 3CX6A 4TTQA 1K6MA 2ZUDA 3CPJB 3R7WB 3L0OA 1JR6A 5L3VA 5E3HA 4ZIRA 3C14C 1XD8A 2VSFA 3AH8A 2W58A 2VP0A 3ONWA 3CRVA 5FOWA 2JDID 2ZU6A 1H8HD 4L15A 4D0NA 1XD2A 3F5FA 3C5HA 4TL8A 5HE8A 4AURA 1AQUA 3WRYC 2Z43A 1Q22A 2VEDA 2OLKA 3SN6A 3X1XA 3GLIE 1DOAA 4X8HA 2NTYC 4AYXA 1XTJA 3T06B 4KBGA 1RRGA 4US1R 4BUJA 1US8A 3TNFA 2GCOA 1OW3B 3B6EA 3NG1A 2OG2A 1S0UA 2YZ2A 1DBSA 3QKSB 2R6CA 2ZSFA 2RGDA 1JECA 1C4OA 2DYKA 2GJSA 2IC5A 2ZVQX 4ASUD 1JI0A 2QRZA 3SU8A 2X19A 4TYNA 2C95A 2XB4A 3AVVA 3PCRB 1N25A 1KO5A 1KZ7B 4LV5B 3CRW1 4QBFA 3KJHA 1ZW6A 1TU3A 3EA5A 1B23P 4R7ZA 1NNEA 5C18A 4ILEA 4IHQA 2QN6A 3DEFA 3TK1A 1SXJB 5FBWB 5E95A 2W6IA 4HUQA 1QHNA 2RGGA 4QGFA 2CE2X 1D2EA 4FCWA 3DOEA 4RZXA 4RFSB 2HLDA 3RS4A 2GAOA 2OXCA 1FX0A 4Q18A 3SYNA 3FOZA 2WHXA 3A1SA 2E87A 1SXJC 2CK3A 3DVLA 3UG7A 5J4YA 2XSZD 1Y3AA 4P4UA 4DDTA 3CF2A 3W8NA 1GRQA 1NL3A 2W0MA 2GF0A 4OJQA 4CEJA 2WSSA 3OEHD 4PFSA 2VYFA 2IYVA 3DO6A 3ZJYA 3U44A 4PANA 4Q48A 2G0TA 5JZVA 3O47A 1CS4C 3VNUA 4LV6A 2OCYC 3TW4A 4PX9A 4RD2A 2WWGA 4AKHA 3FFAA 3HR7A 2LCFA 1T91A 2AWOA 5EUMA 4DLTA 1YZQA 5EQTA 1SXJE 5TY0A 5GJWC 1UDXA 1VYTA 5LB4A 2ZS7A 4K8OA 4PO1A 1W2GA 2BKEA 4NKRA 1GNRA 3UXMA 4GRAA 1TEVA 2CNWD 1HTWA 2J7PA 4KFTA 3RS7A 8OHMA 5HCNA 1J2JA 1KOFA 4DLVA 1G1MA 4LYJA 4US0R 3NBXX 2PX3A 1PUIA 5EXSA 4ZDIA 2WWXA 4UNPA 3FPAA 2DY1A 1G4AE 3OFNA 3R20A 1COWA 1W5SA 4DC9A 2ERYA 3W3AA 1J70A 2D06A 3FHTA 3HWSA 1ONBA 4BEBA 4ESVA 2HF8A 3CR7A 4D2IA 2Y8EA 3ND9A 2F3RA 1GL7A 2AWNA 4I81A 2W2VA 3CWQA 1L7VC 1KO8A 3CUEF 4ZCIA 2ZJ5A 2PLFA 1N0WA 3FMPB 3LBNA 5AUQA 4PZYA 2YWEA 5JJLA 3PUYA 4UKDA 5JBQA 4G5RA 1IXSB 4DBLC 3VU9A 3KJGA 1CR0A 4B3CA 1Q3TA 2XX3A 2B7BA 5FL3A 1MRSA 5KDLA 4UJ3A 4JVLA 1E2NA 4TYYA 1Z0JA 4G5OA 4C2UA 5LB2A 1IOZA 1ZD9A 1D2MA 1VDZA 2XTZA 3DPUA 4BFZA 2R8RA 3QEOA 1PZNA 3THWA 2A2ZA 4C3ZA 4BGDA 1K8RA 3GPLA 1NSFA 1Q1QA 1VG8A 2VP6A 1WXQA 5FI0B 5FUWA 3TSZA 5AK0A 4Q7MB 4LOAA 3RLFA 4OJKA 5DE3A 3A4MA 3U2QA 1VPLA 1QHHA 4OK6A 4XVRA 3LBIA 3ZVLA 3RANA 3LA6A 4XTCS 5G3YA 1AS0A 1TQ6A 1ZYUA 4DSNA 3O8RA 1LS1A 4C0LA 4M9SA 1CKEA 4E07A 3TUJC 5JS7A 3N5CA 4XWOA 2E9SA 2RGCA 3WY9A 4HLCA 2IYTA 3ZIAA 4Q03A 3I61A 2Z4RA 3WRXC 4WIAA 1Q12A 1OYWA 4BEJA 5AJZA 3PENA 2DHRA 1P61B 1XXHB 1TF5A 4D80A 4DWJA 2ZETA 4KVGA 4BZXA 1E4VA 1MOZA 1U9IC 5BN3A 4A2PA 2ZE8A 5C4MA 4TYWA 2DBYA 4JLNA 4BLSA 1W36B 3NIBA 2KB0A 1W0KA 3C15C 3W5IA 3LWNA 4B34A 4JJZA 5AJWA 3IDQA 1CRQA 3TAUA 3RS2A 1M1YE 3TH5A 3TE6A 1N5KA 2ZANA 2P2LA 5DYGA 5CM9C 4D25A 2BBTA 3SI7A 2QNRA 2IL1A 1ZVQA 4LYAA 1FP6A 4ABYA 2O8FB 3GLGB 1QG4A 3GP8A 1DADA 2QTHA 3PQCA 2R65A 3WP0A 2OCBA 3ICEA 4AY2A 1AIPA 4UXHA 4QGHA 1X6VA 3E2IA 4PZLA 2YINC 4YXWD 4NYIQ 1GILA 2RHDA 5KDOA 3LD9A 4IW3B 3EPJA 1E2LA 2WVJA 3RS0A 4HAWA 4NL4H 1T5LA 1XXHE 3RC3A 3I92A 3GLFA 3MWLA 2FPMA 1JNYA 3QXSA 1D6JA 4DCTA 2NOAA 3ZZTA 3NVAA 1E3MA 2OESA 4RKEA 1N5IA 3CBQA 2ZYTX 4PQRA 2PMKA 2ANBA 2QZ4A 2FGJA 4JBXA 1KO1A 2HYDA 3A36A 4DEXA 4EPWA 1OXVA 3MLEA 5L3QA 1U81A 2OCAA 4A0FA 5BWMA 4OL0A 3PEWA 3GLGE 3KUDA 4P4TA 2OAP1 2ZAMA 2IUSA 4LBWA 5EE9A 1OFHA 4BLOA 4NYJR 3IO5A 4OYHA 3EWAA 1F3OA 1IN8A 2HJVA 4M1WA 2Q6TA 5SZJA 3LLMA 1E1RA 2OFOA 4OI0A 3AF1A 1J8MF 4QBGB 4Q9KA 3MMPA 2A5YB 1NG1A 4C0KA 3P4XA 2ZRBA 5HKKD 2IBMA 1VYUA 4A8JB 4EAQA 2QAGB 3GFTA 4P31A 3U6BA 3W6NA 1MO4A 4IOLA 1TU4A 1DG3A 1GAJA 4TMTA 4KV9A 4GOKA 4Q4JB 5HR5A 3BK7A 4GL2A 1IN7A 2I4IA 1E2GA 3TLXA 4KBFA 4JLBA 3TRFA 2FOLA 1FZQA 2QAGC 4PAQA 1P2UA 4C30A 5IHPA 1OV4A 4BLRA 2FN4A 1G21E 1JPNA 3BRWD 2W6ID 4M0LA 1I4DD 5KNDA 3H2YA 5F98A 1E2MA 3B1WA 1VCOA 4XJXA 3GLHB 2HLDD 4YLGA 5FPTA 4XVQA 1FUUA 3PR1A 4LK2A 3GJ5A 4BRWA 1N6OA 3UWOA 1KK1A 3VHXA 2BBWA 1GSIA 4C0SA 5JWOA 4PPGA 3HPQA 2CK3D 5F2EA 4Q9IA 1Q57A 1XDBA 3HU1A 2XB2A 5BN5A 3KQNA 2J59A 1Q20A 4B71A 4K81B 4YDHB 1CU1A 5BQ5A 1A4RA 2AFIE 2WSSD 3NC0C 3QKSA 4ZIRB 2QBYB 2C96A 1UM8A 1X1RA 4AIIA 4JYCA 1G7CA 1TAGA 1Z2CA 3CNOA 1XD2B 5C46F 2RB4A 3ZYCA 3W5JA 1E2HA 5SZIA 3LY5A 4ZCLA 1II0A 3UWKA 4NBSA 2IXGA 1MH1A 1E9RA 4YMTA 2FE4A 1JEDA 3GLHE 2ZS8A 1N6PA 1N6LA 3HYTA 5D3QA 1FP7A 2J7PD 2BM1A 2PEZA 4KHZA 5F9HA 2ZYVX 2VTKA 4TYQA 3SFZA 4DDVA 1Z0FA 3C41J 3CM0A 5ELXA 2WOOA 4OHXA 1F6BA 1NKTA 3ZZUA 3B5JA 4BZPA 4O3MA 4JT4A 2H92A 3OFND 3A1TA 1COWD 5CJPA 5AUOB 4EPVA 5B64A 3EX7C 2N46A 2GAAA 2CJWB 1AGPA 1R4AA 4JLPA 3SOPA 2FZLA 4U5XA 3D3QA 5AR1A 3P4YA 1E69A 1T3HA 1G18A 4EPXA 2YYZA 2FEMA 3LH5A 3FKSA 3VR2A 4PHGA 4CYMA 2FH5B 2L0XA 4HUQB 2B6HA 2O0KA 3TJZA 4BFTA 2F7SA 3KQLA 2J0SA 3QXHA 4HB3A 3AQ4A 3RSLA 4Q01A 4YMUA 1ZIPA 1DTSA 2ODBA 2BEJA 5EXTA 3V4RA 2WAYA 5CK4A 1IXZA 3BGWA 2JATA 2OT3B 2ZSDA 4XD7A 1QRAA 1W4AA 2F1JA 3U7EB 2OBNA 1M7GA 3DMDA 4IDQA 4LJ5A 4BRUA 4PSAA 4S2EA 2GEUA 4I1OA 1GUAA 2FNAA 4RCYA 4CEJB 1XPUA 4FCTA 2ZJ8A 1GFIA 1U94A 1PV4A 3IIJA 3AVXA 2ZRHA 1P3JA 3W6OA 1IN6A 3BH0A 2V1XA 1N6HA 4RY2A 2NO9A 5FTKA 4JVMA 4KFRA 5IK2A 4Z1MA 4F93B 1OT3A 4M1SA 1NP6A 2YWHA 3B78A 5KNBA 3QBTA 5LDDC 3IEUA 3A1VA 5JS8A 1M2OB 3EC1A 4OBEA 1QHYA 2QROA 3GJ8A 3GJ4A 2C2HA 1NIJA 3ZIAD 4FI3C 4Z51A 3TVTA 1I2DA 1L2TA 4F4IA 1DO2A 2VQSA 3I73A 1C1YA 1CJMA 2BVNA 1KAGA 4JLJA 2BBSA 4B35A 1EFUA 1G9XA 1TMKA 4NCJA 2FA9A 1UKEA 1ZNWA 2EFGA 3H86A 3KKNA 2Q9CA 5SZHB 5L8VA 5B58C 5DHFA 3PV0A 1KZGB 4A92A 2V3CC 2JIZA 4PHFA 4TMKA 3D8BA 1XCPA 1P9NA 4HDOB 3IILA 1MV5A 1Z08A 1JQLB 2ZTSA 3A4LA 4YDSA 2ZI9A 3KXKA 1QF9A 3EIHA 3FDIA 2H5EA 1SKQA 1ZJ6A 1G5PA 1VIYA 4NE2A 1AQYA 1EX6A 3Q7QA 3VU9B 1A5TA 3OIWA 4LCBA 5DHAA 4DLSA 4ACBA 2WV9A 1G64A 1U0LA 2C9YA 1J8YF 1KI9A 2Q3HA 1CR4A 5KDDA 1R0WA 1WCV1 4K46A 4F7WA 3EA0A 3B1YA 1L4YA 1U9IA 2CCGA 3K53A 4RD1A 2XTNA 4N0EA 5D3MA 4B32A 3EAQA 1NSTA 1NG9A 1E2KA 2PH1A 1RKBA 2ZUCA 2GTPA 3EZ2A 3JZMA 4PC2A 3OEEA 4TMZA 3B7GA 1G8YA 3U7HB 1IY1A 2NO0A 2CLDX 2AL7A 2N1BA 3IIKA 3NHBA 4KYUA 2ORVA 4MUBA 4RCZA 2ZSAA 3HJNA 1IN4A 3IQXA 4LHVA 5FUVA 2ODNA 2QM7A 4BLQA 2VP5A 2XNDA 2EVWX 2J7KA 4IOJA 4QG7A 1P73A 3K0FB 3T1QA 3TUZC 3K8YA 4RD0A 2XOKA 1P9WA 1OH7A 1P7CA 2FSGA 3S1AA 3SJBA 2O8FA 3U6KA 1E1RD 3AVUA 1P2SA 4URVR 4UJ5A 2Z5FA 3RS5A 3A6PC 3V9PA 3AUYA 3AF4A 3ZS9A 3KJEA 3MAAC 4Q4AB 3ADDA 5E4FA 1W4RA 3M4YA 4L16A 2GHIA 2C5LA 2G1KA 2KSQA 2VP4A 2ZRIA 3NBZC 4FXPA 4Q7KA 5DO9A 1OSNA 1X8KA 5KU1A 1F5NA 5KPJA 4GPTA 621PA 4JVNA 2DB3A 3QE0A 1IONA 4R71A 3VFDA 3VR6A 3CLVA 5C2JB 5AWFC 1P75A 1JJ7A 2ZYUX 2C98A 1G7RA 2WZQA 2XZOA 3REGA 3FWYA 1XRJA 3LX5A 2K5UA 1SKYB 4DIEA 4G01B 3T5GA 4EJSB 2FF7A 4ZKDA 3A37A 4TL7A 3LLUA 2LWIA 4GZLA 1RZ3A 4Q1BA 2G77B 1FTNA 3KKOA 1U0JA 3UANA 4D6PA 4DKXA 2HUPA 2ZE7A 3QBVA 4G5QA 3JZAA 1NN1A 1WQ1R 1XF9A 3I5XA 3F8TA 4EJSC 2XZLA 1SHKA 4X8OA 4MGZR 1TTTA 2ZRAA 1XTSA 4OHYA 4CIDA 2O8DB 3D6TB 3TBKA 4BWYA 4O2RA 3GMTA 2YVUA 3QXXA 1SVSA 2ZE5A 4UNSA 1AKEA 1Q3HA 2RAPA 1IXRC 1UDWA 3T1OA 1P60A 2J0UA 1NBMA 4MRVA 1IJEA 3NKVA 3K09A 4PO8A 3SBEA 1S2MA 2FGKA 4OQXA 4A8JA 2QAGA 4V0LA 3GFOA 1ELOA 3UPUA 2C9OA 4UXJA 3KB1A 4FMDB 2YOFA 3VNVA 1CP2A 4C0BA 3ZD6A 4TLCA 2WJJA 1WE2A 2EYQA 5CLLA 2TMKA 2X2FA 1VHLA 1XNJA 4GNKA 4Q1EA 1GZSA 2AD1A 4AK9A 1GITA 3CNLA 1Q1BA 3GLFE 4NCKA 3AV0B 3GCGA 5FBRB 3PUVA 1SXJD 3PJRA 2KBFA 3ZVNA 5KYKA 3U3KA 2WAXA 5AJXA 2OXRA 1GNPA 3AVYA 2XTMA 4Y0VA 4DDUA 5DGXA 3U3RA 1G291 2QE7A 4OQLA 1P2VA 2NIPA 2A78A 3I8XA 4LX0A 2VSOA 1GOTA 1YVDA 4W5HA 2GF9A 1AN0A 2OHFA 4ZI2A 2WJGA 1ZD1A 2XAUA 2ZRPA 3THOA 1N6RA 1WP9A 4TLAA 3EC2A 5B30A 2BJWA 1ZMXA 3K9LA 1XEWX 1Z5ZA 1ZUNB 4FWTA 3FKSD 3EIEA 4E03A 3AVWA 3P20A 2QBYA 2RGXA 1EXMA 2P3SA 3DL0A 3LQRA 3MFYA 1EESA 1LF5A 4B6EA 1P72A 2RGBA 1VMAA 3KXLA 3PEVA 3VKHA 5J47A 1JAHA 4IDNA 1S1CA 2E1RA 2UKDA 4Q4HB 1LW7A 2I1QA 3KUCA 2C04A 2BMDA 5KTYA 4XWKA 3UMSA 1V43A 4XD7D 4EQ6B 4CGZA 3K9HA 5GADl 4IEEA 2ZRGA 1CULC 3M0EA 5KUTA 4IFEA 3I32A 2HF9A 3MJRA 1TUIA 2OFWA 1A7JA 2PX0A 3AM1A 4A2WA 5J4LA 1RVDA 5C4GB 2PL3A 2AN9A 3I8SA 2RGNA 2C99A 4LI0A 1MR3F 2I1VB 5IK2D 5K8UA 4Z1MD 2X1VA 3QKUA 2YV5A 2IHBA 5EE0A 4F91B 4UNQA 1RYHA 2CJWA 3E1SA 3WYAA 3SYLA 2OBMA 2ZRKA 4R98A 3RVBA 3EASA 1E2JA 3WNCA 1A2KC 5P21A 1Z3IX 1VECA 1KK3A 1ZNYA 4L5BA 5FUXA 5GVSA 1SVMA 2BMEA 3BORA 5FPSA 5KPDA 1QHGA 4M1OA 1GL6A 3I3SR 4MKHA 5FR1A 1CJTC 4TQ9A 1YHNA 1TPZA 5EUQB 5FOUA 1YZNA 1DAEA 1ZM3A 2QT0A 3GJ6A 1NLFA 2PLRA 5JEEA 1VYVA 2FFQA 2HEIA 4AKIA 3TAHA 2JIZD 1CRPA 3I4LA 1Z0AA 3VHLB 2V8OA 3NH6A 3WBKA 2DWOA 4B2LA 4FMCB 4CVNA 3IUYA 3K9NA 2ZRFA 2OCPA 1LTQA 3GEEA 3KFVA 2BJVA 1JQJC 5EZ6B 3WBJA 1YZUA 1W5TA 3FE2A 4B33A 5KSPA 2HDNB 1UPTA 5EZ5A 1S1MA 4QNMA 4PHHA 4X8LA 3Q9LA 2IYQA 1T8UA 1OB5A 1QVAA 4LPSA 1GTVA 2OBLA 3QXJA 3DZDA 4FINA 4KFSA 2PZGA 1EG7A 4PPQA 1Z0IA 5DSZA 2F1IA 1DAGA 1IQPA 1YJ5A 2BKUA 1G6OA 2EFHB 2IYWA 2O0JA 4JLKA 4JSYA 3T61A 4HLDA 4UNNA 3FMFA 1BIFA 2IX3A 3OEED 3QF4B 2GEVA 1ZD8A 2WJYA 1PJRA 3A1UA 3WYFA 1ZU4A 4RJLA 4CW7A 3KQHA 4QL3A 1N0UA 2JCSA 3SFVA 1R10A 1LF0A 5B57C 2J41A 4QM7A 2O5VA 2WPDA 3EPLA 1W36D 2O8EA 4KXFB 1AKYA 2QL6A 3BE4A 4MYCA 521PA 3FKQA 4KCGA 2ECKA 2XNDD 2BBOA 2GK7A 4C7OB 4W5WA 5FPHA 3VX3A 4OI1A 3QUSA 2OM2A 2XOKD 3IIMA 4URWR 4QKQA 3WNBA 3WHKA 2IEYA 2FFAA 3IHLA 4JL8A 4NYMR 3CR8A 5FOVA 2QQ0A 3C8UA 4P4SB 4PSKA 2J87A 1HT2E 2O8BB 4IJMA 3CPEA 1G8HA 1AA9A 4IDOA 1OB2A 5FR2A 4IXMA 2CCJA 2AR7A 1Y63A 2P67A 3O8DA 3ZZ0A 2J9RA 4XSHA 4OK5A 3FHOA 2ZPTX 1HQCA 1KIMA 1QDEA 1AS3A 4XH9B 2FV8A 3RWOA 1XD9A 1G6HA 1Q21A 4IRUB 2BEKA 1TQ4A 4MQBA 3LVRE 5BN4A 4CF7A 4OI4A 1KYIA 1F60A 2GVZC 4CEIA 2CEAA 1AS2A 4HEJA 1DAFA 2W0SA 4OK3A 3EZ7A 4HAXA 3WXMA 3K70B 4HDCA 3U61B 3JVUA 4QNRA 2O52A 4B3BA 1XJ0A 2JGNA 3QY0A 4RSGA 4GSYA 4N0DA 2GNOA 1P62B 1T5IA 5FTLA 4PTLA 2ZAOA 4CZ2A 2JLWA 4LBZA 2C03A 3TSWA 1KI6A 4GMXA 1KSGA 4QJ3A 4PC3A 4EPRA 3K0FA 1KY3A 3X1WA 3BH7A 1G8PA 1X8LA 5CM8B 2QP3A 4V0MA 5D3MB 4B47A 4FMBB 4NZYA 4TMWA 1VG0B 4X8MA 1LS6A 1YZGA 1E94E 2R6DA 4Q4AA 4TQUS 1NBMD 2A5FA 5EP4A 3MD0A 2IF2A 2WKPA 3SQWA 1IY2A 2YOGA 2Z0MA 2ZI4A 4XIGS 2XJ4A 4TQAA 2B7CA 5G40A 4RZ3A 3IO3A 3S1AB 3QF7A 4QJ5A 2DFTA 2D3WA 5F9FA 1W36C 1KMHB 4B73A 4QHYA 3WMEA 2XNSA 1HY3A 5JECA 2I3BA 4DB2A 1KAOA 3AGPA 1M74A 3Q85A 2QGZA
chains in the Genus database with same CATH superfamily
4EHIA 4ZTZB 1PLKA 1CJBA 5YASA 1YJCA 4EJSA 2JHPA 3QY9A 1YB6A 2E6UX 1VLVA 3HCFA 3ZOKA 2HQRA 4F46A 2VK4A 5FO1A 1E7SA 1O97D 2G9QA 2YDXA 1DI0A 3ER9A 1LZKA 2GF2A 5C5DA 5CYFA 2XGSA 1Z73A 2FPLA 1CW2B 3JWPA 4J16C 4K2AA 4MUXA 3K73O 3T1VA 1P7PA 3V4SA 3GGPA 1SIOA 2H1VA 1IZ8A 3INRA 1VIAA 4FEAA 1FX1A 4H3SA 5J1SB 4G25A 1SULA 1SBZA 1RTTA 3GXOA 1WKCA 1YQWA 1NVBA 3EDOA 2R00C 4GGMX 5TEVA 1VA4A 1F2TA 1P77A 2HDWA 2MMCA 2I4NA 4M36A 2VYCA 4QDZA 4RELA 3VR3A 3PIIA 3ESCA 4Q24A 5B1EA 3KV1A 1Y5LA 2A57A 2OAQ1 3TZCA 2JASA 4H6XA 4RQUA 4ZAXA 2RGRA 2AVDA 3OI7A 3DG9A 4L7VA 2PS3A 1ZRNA 2DUJA 4KPUB 3LPNA 3T5DA 4G41A 4ZQCB 3UJAA 4EKEA 3R3VA 1Z6YA 3NWOA 3AB7A 5AKXA 5KAMA 4K7JA 4WZAE 4O4JB 4M1YA 2DFLA 5CCDA 1J1ZA 3JPWA 3SC3A 3MF4A 3ZCSA 4KYIB 1T6NA 3M6UA 5KJFA 1GQFA 3OX1A 4D9BA 2VQFB 2JJ1A 5HOEA 3STVA 3HVKA 3UAOA 1N6KA 2A4KA 1BCRB 3FWPA 3BIFA 4RV5A 1U9ZA 3E58A 4YN3A 3KQKA 4JSTA 4IRXA 2ZBRA 3DMRA 3Q10A 2GETA 3HCBA 1O54A 2MINA 2QRMA 4ZOBA 2HF7A 3L40A 1TM4E 5ALUA 5IMBA 3TR0A 2C2BA 4TZ6A 3LS2A 1ZVJA 4RJ2A 2R8BA 4HYQA 5EZQA 5B37A 4DY6A 2J3HA 3HV0A 3ICQB 4DV5B 1J5XA 1GRNA 1KDPA 2GM9A 2ABWA 3JU3A 1J5PA 4CLDA 1V5WA 4L9WA 4PRZA 3TEFA 2JIRA 2QK4A 1MAAA 5DF1A 5HTOA 2H1OA 5LBIA 4MCAA 4JC5A 3DOCA 4JAVC 4ZQHA 1LJ8A 1OXTA 2V7GA 5C37A 5HS6A 2YFKA 1K27A 5JG7A 4CIWA 3T5PA 1ZUNA 1ADGA 2BN4A 2ENWA 3C24A 5F7XA 3BAZA 1VKRA 2VF5X 3U3ZA 3V42A 4UNRA 3HR8A 3BE6A 2PRZA 4C22A 4PYIA 3SCZA 3U7FB 1SRQA 2XHZA 2YZGA 3EW9A 1D9ZA 5A5VA 4N3CA 4A26A 2HJGA 4EHHA 4UU1A 3R5TA 1DAKA 5IKOA 2ZUTA 2AN4A 4Q3BA 2HXGA 4WNYA 2H52A 4C3VA 2ZWIA 4BAGA 1NE2A 4Y2VA 1B8NA 1ZNZA 2EZ8A 3D0RA 4JLMA 3WIDA 4PAMA 2M6SA 5HILA 3WJ2A 13PKA 1MJGA 1A8UA 2CXTA 1KY4A 2BMAA 2X40A 3CZCA 3IDAA 5BURA 5IXSA 4CIBA 2WJPA 4TWRA 4DV0B 5K5EA 1ENZA 1QGOA 1XRLA 3OUZA 2E4YA 4E88A 5LZ9A 3EY4A 3RYIB 4RTKA 4G37A 1UMBA 4DQXA 2WU1A 2FRVA 4A1FA 2XQFA 4Q0MA 1P18A 1X94A 1ZK4A 4WADA 5AT1A 3WKCA 1RPZA 1EWQA 2ZSIA 4W99A 1SCKA 1V5FA 1XZCA 5KOIA 1M0SA 2EFYA 1RXIA 2G9UA 5J40A 2KPOA 2CNLA 2I4RA 3ETLA 3IBYA 3GZ4A 2B4QA 3BL6A 1ZSYA 4DQ0A 5EJFA 1R4ZA 2XI4A 2GN8A 2TS1A 4ZCPA 1UANA 3KJNA 4Q93A 1QK5A 1CB7A 3CSUA 4QHSA 2JVJA 2O1WA 2H51A 5FUQA 1AMOA 1BXZA 3HP1A 1XX6A 2HA6A 4OB7A 4N76A 4Q1CA 4PC6A 2ESRA 5EE1A 5J9FA 2ZI3A 1C3VA 1V48A 3G9ZA 3ZX5A 2PJRA 2IZZA 3JQEA 4AJEA 4Q4DA 2ZYWX 4LJKA 1IG3A 2V7UA 4TX1A 4G0QA 4U4AA 2DECA 4MO9A 2VHQA 2UU9B 4XDYA 3VJLA 5LDGA 5ECWA 2JGLA 3MGGA 5DISB 2FPKA 1O89A 4PLGA 4LHSA 3VPHA 5C31A 1DPFA 1M6HA 1A4UA 4JITA 1P9LA 2Y76A 3UTCA 1H8EA 2ZBEA 3N87A 4A82A 4DGSA 5KYWB 1UT5A 3DF7A 4EUKA 3ZJ4A 3EZGA 1IZ7A 2WD9A 3DNMA 4XLLA 2RGNC 3WYCA 5EIXA 3OZAA 5DNEA 3B3FA 3UIEA 1ZXLA 1DWQA 1WRBA 1ISMA 2ZR7A 3QP9A 5BOSA 4K9OA 3HZOA 2G1JA 1J21A 2ZQYA 3L4JA 2Q27A 4K28A 4PVDA 3VNQA 1U7OA 1DUIA 2O06A 1GKUB 1HEYA 1A2OA 1CY6A 2YVQA 2ZYRA 3BS4A 1GXSB 3WTCA 1FLAA 3KDPA 3FHLA 2XDQB 1RIFA 3PU6A 1YRAA 1Y8AA 3DAGA 1J9ZA 1QTIA 1ZCJA 3KB2A 5DRYA 5DT9A 2XGJA 1E3TA 1BXRB 2PR2A 3IODA 3EXHC 4G4IA 2DFPA 2J48A 3JQFC 4HR7A 1D8TA 4OJMX 5E9WA 1NF2A 3RRBA 3T35A 1O94A 1ETHA 1A82A 1ISPA 1XA3A 1YBFA 2H1SA 3AHCA 2PUCA 5EP1A 3VH1A 4PSUA 2H3EA 1JIXA 5K4GA 3ZGVA 2TSYB 2HK8A 1Z0KA 2PWPA 4LUCA 4E4TA 5KCZA 5B2FA 4JB2A 2JCYA 3VTKA 3QXCA 1H8HA 2VKQA 5JTTA 3SEAA 1GZVA 1BRTA 4K6OA 1ZISA 5AW6A 5FEUA 5D85A 1GLNA 1TMOA 1EVQA 3AOEA 3I2FA 3O8QB 5TS3A 4BN5A 3AONB 3COSA 1TZBA 1AHIA 1E64A 1V8DA 1ZCBA 1LX6A 3C6ZA 4QUIA 3AZQA 4O25A 5IF9A 3ND7A 1XCMA 3NBMA 5DIFA 5LQDA 4CG3A 4ZO6A 1PZHA 1SC4A 4O59O 2D2VA 1BGVA 4C2BA 3M34A 4CR7A 3BCHA 1RWOA 1W93A 2BCGY 3E9YA 2W6JA 1Y82A 5JROA 3W06A 5ED0A 4MWDA 2C3UA 1FYWA 1NOJA 4EUEA 1KEWA 1R0YA 2CL0X 4YUXA 1Z5VA 5LXTF 2BMWA 1Q0QA 2YBEA 2PRJA 3H9JA 5AW0A 4OH1A 5IFLA 5JWHA 1Y8ZA 1YHYA 2VUUA 3NTRA 4XYBA 1XZJA 4D98A 4LYGA 4WA8A 3IHTA 2PT9A 5B4VA 4TV9A 4ZMBA 1GVNB 1QS0B 2QP9X 4R41A 1NJFA 1SFRA 1PFVA 2GO1A 5DMXA 5HRUA 1NRJB 1KGDA 3V3TA 1ZIXA 1XCGB 4HAVA 2X41A 1SCJA 3QWAA 4P80A 3GLSA 1SHLA 2MSEB 3M1LA 4HNQA 2PYIA 3K4PA 3P94A 2W6QA 3MWDA 3RU2A 2Q1TA 2BZ0A 1PEKE 1Y3HA 2AQHA 4LY6A 4QVIA 3VKWA 3U1BA 4BPBA 4CCSA 4XXHA 1ODFA 1OPXA 1T4MA 3FTQA 4Q3NA 3IT2A 4D4JA 3CVVA 1BMFD 3IHKA 3TNJA 5BVGA 3N0XA 5BV2P 2AOWA 3DOJA 2B5WA 3IP7A 3MQ2A 5KQSA 1M6WA 2Q3FA 3E1KA 3AM3A 4LJ4A 3QLUA 4M76B 1X7WB 3BG5A 1E6CA 2AXPA 3L46A 4FLEA 1MB3A 3PC8A 3NBUA 1K6IA 4XW2A 2WQ7A 3AJEA 4AJ1A 3TIGA 1JLRA 2JC3A 2Y1XA 5DBIA 1M2KA 3FBTA 5TRTA 1CY8A 3D6VA 2QRPA 1XE3A 2RHRA 3JVDA 3OHSX 4R8LA 4BATA 2WILA 1W47A 1LPNA 1P1HA 1VZ2A 2OZEA 3I28A 2XMDA 1DE0A 4FDTA 4NBNA 2Q0SA 2D4HA 2G9NA 4J1SA 1V4BA 3KALA 4W7SA 4B1FA 2P35A 1HQDA 3B60A 4C7OA 4W9NC 1H2WA 1IAVA 1JH9A 5HEKA 5B3JC 3SM3A 3F2IA 1ZK3A 4LZPA 1XMOB 3H6KA 3B82A 1Z63A 1BSVA 3K0BA 4BNMA 3KQUA 4ZD6A 1YBAA 3JALB 4JBGA 4RFVA 1JIUA 1J5EB 3ZV7A 3EDQA 1SVIA 4J16A 2IYRA 4Y6QA 3P8ZA 4KR2A 3BC1A 3DZGA 5AHXA 1GLVA 1N2CA 4M8IA 3CRMA 4CF6A 1X77A 4NLLA 1KFJB 3WLQA 5EJ2A 3B85A 4BMVA 4BZWA 1VRWA 3IBTA 3JASB 2BGLA 3UGTA 3HP7A 4BX9A 3EVTA 4PCUA 4QPPA 2C3PA 2ZBFA 4ZVPA 5EHXA 1ECPA 2JF0A 1NUQA 4BNUA 3JYLA 1HT0A 3WBFA 4BU1A 2P6PA 3H11B 4D4KA 1B8VA 1PVDA 4GLJA 4ZMRA 3A6GA 5H8WA 1EUQA 1LLCA 1UK8A 2GBIA 2X76A 4QQKA 4WL0A 4BNWA 4BO4A 3QMWA 1R9NA 1T4CA 2A0UA 4HWGA 2CT8A 2DR3A 3O82A 2VPQA 4MUFA 5D1HA 3UUEA 2JLXA 5LQCA 3E7FA 2OWDA 3IPCA 5FQNA 1X7XB 4MJ7A 4ZYZA 1L1RA 2ANCA 3VR5D 3F98A 3IIEA 3B2EA 4UDXX 2I7TA 4V0ME 4DCCA 3IB6A 3KZCA 2QRQA 2YH2A 4M46A 5JSZB 4BY9E 5BUZA 4GYYA 1EFTA 4P8RA 1U6KA 3W1WA 3C16C 3KOOA 4WZZA 1PG5A 1C0IA 2AI1A 2OZKA 3N2ZB 5C8YF 4CIYA 2YX1A 3ADBA 3SLRA 2GBLC 9LDBA 1HZZC 1FEZA 2R8ZA 3S27A 3MGKA 1G6KA 3GAZA 4Q1AA 3V7FA 4KPFC 3FJYA 4GC5A 1TIKA 5ICMA 2DETA 2Q4TA 1LH0A 3Q5DA 2LTAA 3C4JA 1IBRA 1W44A 2ZS9A 4LC1A 2QVZX 4U02A 3JRWA 1O3YA 2QLBA 4AG3A 5DOZA 3IT1A 5IASA 2IT1A 2EF0A 1H66A 2RDMA 6REQB 4JEIA 1CRWG 3WSWA 4XVUA 3LYUA 4Y6LA 3STWA 5CNMA 3D7RA 2ZIXB 1JNXX 1WBBA 1GZHB 2P5YA 2BTOA 2ZSEA 5CTAA 2PJZA 1FDUA 3RRMA 3UW3A 2XXAB 3WGOA 1I1NA 3B1VA 4JK3A 4MI1A 3WE7A 3CNQS 4D81A 2FW7A 4RWEA 4BC0A 2R68A 3UTDA 4TMXA 5CU7A 3NOXA 4HFNA 3AYZB 4RVCA 3PE4A 2IIVA 4DN6A 4ZCMA 3PGKA 3CS3A 1AGNA 2R6HA 5A9RA 1GV0A 3NHAA 4N39A 4F7DA 4K6KA 3PFNA 4MGIR 4CFZA 4D79A 1FYDA 1XWFA 2YWJA 3V4LA 4CKEA 4CDMA 4QU0A 4BKPA 5JTUA 2ADFA 1WXWA 4UASA 5ITVA 1A71A 3D4IA 4PAWA 5AVKA 3WDKA 5DI3B 5L3SA 1W73A 4UATA 4FT2A 1UPBA 4HMPA 4LXTA 4LDZA 3LO8A 4QPCA 4ZMSA 4E4RA 1VE1A 1MAVA 2E85A 3D31A 1T2CA 2NV6A 2OHIA 2PV0A 1ONOA 1GWNA 1QR2A 3PNPA 2IXAA 4R1SA 3W5HA 2GRJA 1NUHA 5LSAA 5ARBA 2GI4A 2VYND 4IGEA 1T3GA 4ABTA 2PTGA 3C3YA 4NENA 3HZZA 2NYRA 4F2WA 2RKWA 3RG2A 2Z2ZA 3FH0A 5D6NA 4I2VA 5TQ2A 4Z4CA 2CMDA 1ZN9A 2ZBDA 2HNBA 1XZFA 5TB5A 3VYVA 2HHLA 2O4CA 1H22A 1K4MA 2VYQA 4MV4A 4ND3A 2WMNB 4JP5A 4GOJA 3KAPA 1X7GA 2DHQA 4CL8A 4J4HA 3KBBA 4DR6B 4R2HA 3SS7X 1DQSA 2ATCA 1UBOS 1C7ZA 2AV6A 1PK7A 4II7A 4A73A 3DKPA 4O4IA 2GR9A 1MCZA 2AOUB 1ECCA 1FNNA 1V1RA 2QM0A 1WB4A 4IMJB 4K03A 5JSYA 4LXGA 1LFDB 4PZ9A 4WE3A 2CN1A 1RXYA 5I7EA 3NHLA 4KPGA 3ZE1B 2CLOB 1JG7A 4YC7A 4GD3Q 1YONA 1V35A 2WZBA 4R5MA 5LA6F 4RPIA 4IIYA 1OILA 3OPXA 1RKVA 3LDHA 4M89A 2PKWA 3M6LA 3A6LA 5KYVA 1NQTA 4YT2A 3Q8LA 1W4LA 1E3EA 1KKLA 3C8DA 1IK4A 1L7EA 1ZUIA 4NZNA 3W7AA 5KSYA 1HT3A 4PO9A 1T43A 2D2IA 3JCZA 3L8YA 1J6UA 4L8YA 4QTZA 3RJTA 2RC5A 3L8HA 4ZO7A 2XITA 1AQIA 1NMXA 4N5IX 2ZUUA 4CTNA 1G63A 1EJ6A 3RGWS 3S2GA 3WBBA 1JHVA 3HLYA 4JIMA 3JX9A 3TLBA 3GI1A 4L5CA 1W34A 3QVXA 2IELA 2BFEB 3HBLA 2VC2B 2PLAA 3HBNA 5ALDA 5TVKA 4D0LB 3PFKA 4DMMA 3T9CA 2IPOA 3EXHA 4CHGA 2BSQA 4PRLA 1DEHA 1MJHA 1V8BA 1RBYA 4FHFA 2JFOA 2P30A 3AB3A 3JYHA 2IBTA 3FDZB 3GLQA 3HRIA 2FLWA 2D54A 4RZIA 3SF0A 3FAZA 1S5PA 3Q6MA 1FNBA 2ZYDA 5JYDA 1IPFA 4ZKEA 2AQ8A 2XLCA 3AF5A 2PWYA 3MA0A 1N8KA 3BTSA 4LMRA 4F3TA 2BV3A 2DMRA 5A5DA 4ALIA 2DGDA 4LBVA 1M2NA 2WP0A 2AOTB 1Y6RA 3I2YX 2EDCA 1YI1A 1MB9A 4YJFB 5TPZD 1G0NA 5A6VA 4ZVUA 4UPDA 1X1SA 1WM1A 3H65A 1NDQA 1XMPA 4HWTA 1BYUA 4LYDA 3ICOA 4C0JA 4YRKA 1LUAA 2PKRA 2NACA 5I6DA 1D4OA 3SMQA 2A14A 2O7VA 5KOJB 1C4KA 2WLSA 2XMSA 3HDYA 5DN6A 2QYHA 2MSDB 5T3UA 3TQHA 4YPVA 1T2EA 3C4QA 2A5DA 3WWOA 4OXNA 4FMDF 4KNWA 3NHWA 3K9FC 2XGOA 2VRWA 3PRYA 1JR3E 2FUEA 2PLWA 1IJFA 2WE8A 4UUAA 1D0IA 1RQNA 2XHEA 3BHMA 3H8SA 3R0JA 1HFJA 1YDFA 2PT7A 2Q3JA 2V8BA 1OTYA 3RG8A 3VR4D 3U5TA 2WJIA 3EGVA 2WG0A 1NBAA 1EU1A 2JHAA 2ZM5A 2WWFA 3A6EA 2LIPA 3GD7A 1NU6A 5JASA 1GZ6A 2DT5A 5BQOA 3R7NA 2CXRA 2AC2A 2OUIA 2RKOA 3DOIA 3UICA 5FT9A 1V39A 1QYCA 4NZ9A 4JYBA 3T3OA 5LZ4A 2XOXA 5EKUA 3R9XB 3F67A 4G5SA 3ZIDA 2OV2A 3QU4A 4DLXA 2FVXA 5FBVB 4QOJA 2QYTA 3FCXA 4HGYA 2AMVA 2R6AA 4HLUA 4ARAA 1VSVA 2TMYA 1OE0A 1UJCA 4XWAA 5M34A 5BSTA 4CT4B 1E9DA 5DLQC 1DRJA 5KIAA 3JSAA 1AHNA 2QD5A 1NPYA 3VU3A 5FFFA 4RLQA 4ZK2A 1F7VA 2WTBA 1KFKB 4J0DA 2WU0A 3IB3A 2HMTA 4MS4B 4QEZA 1DRWA 1M2VA 2PT6A 1Y1KE 3ZKAA 5HZMA 2Q5FA 4OGFA 1C9DB 2BONA 1T5OA 1KAMA 2BE7A 3HV2A 4QJ4A 2NADA 2CL5A 4EGJA 3AVXA 2GTHA 1P4JA 2OCGA 3L4BC 2YNMA 4JIGA 2P2DA 1OREA 4G5GA 3SEZA 4ND8B 3WOHA 4UFOA 1IM5A 1HA3A 4Q15A 4AMZA 1ZD2P 1CUHA 2YIJA 3D9QX 4GOLD 4ZVQA 4C4PA 5K8LA 2GSDA 1C3EA 2IYAA 5ALZA 2IUTA 3QBJA 1RE0A 5HS4A 4FZ3A 1QB7A 3ODPA 4N47A 3RVSA 1SVOA 1GCIA 1PYDA 2AUTA 1S2LA 4BV8A 5DH9A 1D9XA 4RHXA 1K5DA 2V7QA 3AWDA 3PHBE 4U2CA 2MT9A 3ZWVA 2HUNA 1WVIA 1ATZA 2J31A 2ETXA 2HFJA 2BR5A 2HCBA 4NCIA 5EIBC 3V1NA 2F3QA 1JALA 4ARZA 3KSZO 1M34E 1E2DA 1DAMA 1GV1A 1YCFA 4HD8A 3LU1A 1K98A 1RQ7A 1TF2A 2REXB 5CYOA 3TJMA 3AINA 4D9JA 4YUWA 5TMPA 3OQIB 5IVKA 3FNFA 1EVEA 1YGPA 2CXPA 3AIIA 5FOQA 4RBNA 3SJZA 1MHTA 1FYEA 1AB5A 3I30X 5TQ0A 2ZSBA 4FFOA 1THGA 3F78A 1U0EA 4GKVA 5CFMA 4WN3A 3WL6A 5FWXA 1L4NA 1U2RA 1AKUA 2PNJA 1XU9A 2HSZA 3Q87B 2B7LA 5F12A 5JDCA 1EINA 5A03A 3VJRA 2F43A 3IRVA 4IDCA 4HEHA 1U8UA 8AT1A 5IX8A 3TD9A 1RMYA 1MEJA 5I7HA 5JYEA 4RVSA 1G2QA 1NLMA 2BFBA 2B98A 3QKRB 3NWJA 3G2KA 1FDTA 1UXHA 3UPTA 2B1RA 2Z3VA 3VGJA 1E1CA 3SC4A 4EKGA 1BKDR 5K9ZA 3WAJA 4E15A 1RAAA 2XLBA 4EFMA 3FA2A 1PBNA 5THXA 3NDBB 1UXIA 1RRFA 3HPRA 4V0RA 4ZPXA 4QDKA 4NIMA 3CG0A 4TPKA 1FW6A 3ZD7A 1C1HA 4FHZA 1OR8A 1QE3A 3H3FA 1X2EA 1KMQA 1R0CA 4Z7JA 2XT9A 2IS2A 2ILVA 4MIKA 2PEYA 3D4PA 1YR8A 2DE0X 5KNCA 1I10A 1PK8A 1BO6A 4BEVA 2C58A 3O9ZA 4ER6A 1A69A 3FB1A 3PHCA 4OHMA 3N2EA 3PTZA 3TUIC 3C6YA 3UW1A 5LQNA 3UWDA 2QQEA 3I9V6 3K0AB 3GJ3A 5ALSA 2DPXA 1KVTA 2R5FA 3ZE7A 5ESRA 2PZJA 4MAMA 1HYQA 1KI3A 1XRQA 2IEGA 1OU0A 3AHDA 3CW9A 3OFJA 3RV4A 3HNRA 1ESDA 2ZUSA 5AW7A 3L8FA 4G8DA 5DHQA 2FW1A 1Y98A 4M88A 2CXHA 4AG5A 3M49A 5AJVB 5JAMA 2I29A 2Z8YA 3FHCB 3AI7A 5GM2A 2YYYA 3FB4A 3KV3O 4LTNA 4REMA 3AU8A 2B8TA 3I0NA 3IBSA 4JQOA 5BSVA 4DV2B 3TX6A 2FXIA 3K7EA 1ZEMA 1HM5A 1Y5MA 2H9YA 3FD8A 3VC7A 5I7RA 2JKZA 3WLLA 2D5CA 3VSCA 5HQTA 2NUTA 4FB4A 5IHXA 1RZRA 4QPJC 2ZG6A 3SAJA 2E18A 2ZWVA 1U8TA 3IVGA 5EZYB 2BFMA 4ZEOA 5A6SA 2ZCUA 4DSTA 4OQFA 3NP9A 1CEQA 4RXUA 4BVAA 2ZYAA 4MW5A 1DRUA 1YZKA 2IY7A 1UEJA 1GPBA 1BCSA 1H6BA 4WBSA 2PX6A 2WHPB 5LPNA 1QPZA 1X92A 1YU9A 4RZUA 4IPTA 4FEGA 4RQTA 3N53A 1LJUA 2W22A 1KS2A 3HDHA 3JQ8A 3GNSA 4GBED 2J46A 3MJHA 4P98A 5ALFA 3WMGA 3LRPA 3HVIA 1CJKC 5DK4A 4DUGD 1ZC3A 1E32A 2EU8A 5G41A 3ADCA 1A1VA 2QSUA 3ELBA 4AJ4A 1XMIA 4JP8A 4MKGA 3P1JA 1SR8A 4YROA 4RK5A 3SJAA 3TWOA 5KKCA 2FEPA 1U3FA 3UQZA 1RSZA 2IU4A 1NFFA 3DMGA 3V32A 2QVGA 2QE6A 4J0QA 5TIIA 2CL6X 3IL2A 4LRSB 3G79A 2B35A 1C7RA 3RVJA 4B17A 4R0NA 5FBLB 2R6FA 3C5VA 3TMAA 2RI6A 1JU4A 5ENDA 4B2YA 3AL2A 3JRNA 2ZIZA 3ZLJA 1FDRA 4K3UA 2EFEB 4LZZA 2CC2A 1SQ6A 2BYTA 5A4FS 2ORYA 2WHYA 5EE3A 3CW8X 3B5IA 7YASA 5I5EA 3Q2IA 2ZQ5A 4RF3A 4F4FA 1I5RA 1OGIA 3PLRA 3T12A 1BD4A 4TVBA 4CNQA 4H27A 4B82A 4QUJA 5GINE 3KT0A 4Y2TA 1KSFX 4BQIA 3ZGLA 3ABIA 3G6WA 3BHIA 2X8JB 3PXCX 1BJRE 2OHGA 3BD6A 1NVXQ 4ZAVA 4ZDKA 4Z0HO 4L9SA 3V2IA 3WRYA 3MJVA 3H0EA 2ZWPA 3RFXA 5IT5A 4RPLA 1UH5A 4Q9LA 3MBOA 4JLVA 3LT1A 3LXXA 4KQEA 2ZBPA 4YIHA 5AOBA 3PDIB 3SYLA 3TINA 2O57A 5ITZB 4WK4B 2DH6A 2JEYA 1ZNQO 4QBKA 3SLKA 3MJCA 5LXTB 4FILA 1DJMA 4ZAZA 3WGIA 1Q7BA 2WU4A 1NN3A 1B2LA 1WZEA 1QHIA 1GKYA 4LHXA 1ZHOA 2PWAA 1WR8A 4HKTA 2GD2A 3KL4A 3OA0A 1CX9B 2I3GA 5F21A 4HLQB 3BXZA 3LUPA 4PYJA 2IXFA 3CF4A 3KYIB 5E6UA 3O92A 2R62A 5C4IA 3R7FA 4FWIB 3P9RA 3R7LA 1HWYA 3IMKA 3GY0A 1PL7A 3WWPA 2BHLA 3HZHA 1X1DA 2R7AA 4CIVA 4DQKA 1RRCA 4U2FA 2B4YA 3IQEA 1ABFA 4MYRA 4D46A 1PTJC 2IRWA 1N5LA 1ADYA 2AQIA 1NA5A 1NUUA 1YZVA 3DR3A 4Q4LA 1AKRA 4RAQA 5MN4A 2AKEA 1UBNA 1N1EA 1QIJA 4FW9A 4UBMA 4Y0AA 1VSBA 4BDTA 1J56A 3F4LA 4TKLA 3T7RA 4EW6A 2VWQA 1E1QD 2PZLA 4W63A 5HQ3A 5A06A 1Z68A 1V3VA 2NPOA 4P2BA 1KZYC 3COPA 4DA9A 1DEXA 2BEWB 5LD2C 2H9AA 5DSZA 1XTKA 4JZKA 2GCOB 2JD2A 2QQGA 4WPGA 4A9AA 4MNTA 1LA2A 3KYBA 4OMCA 1PTKA 4H3VA 4YJ2F 1MO6A 4LAFA 3T7TA 5C7LO 2G08A 2D0OB 2R1TA 2V9PA 2DBRA 4AQDA 1B16A 1ONNA 2XCIA 3RIHA 1X3SA 4Y9SA 1TD9A 2G76A 3D4LA 4Z7QB 2AKYA 2BC9A 1NN5A 1FNDA 3KEOA 2ZJ3A 1CXZA 2ASEA 2OHOA 5ELLA 1Q7TA 2G4LA 3ZWBA 4HNSA 4L2IB 4Q3AA 5HQJA 5BQ3A 1T25A 3DH0A 3CLUC 1J8DA 4PZ0A 1NF3A 4JU8A 4JENA 1KO4A 2PD4A 3HYRA 1CNEA 5EYPB 5EMMA 4ZVSA 2OXIA 3HFGA 1EDEA 3H3JA 4AZ0B 4CF3A 2AW3A 1NY6A 3EEBA 4YV1A 3VO2A 3JQDA 1Z83A 4ZDJA 5JCOC 2A92A 3PG5A 4MQ5A 1FPMA 4RVNA 4JLDA 1KETA 2VHTA 3WGKA 5B3LA 2ZDGA 4ZAWA 3HMQA 5HKOA 3FYTA 1XQYA 5JRZA 2BISA 2J0EA 4PSCA 1M5RA 1ESNA 5E4JA 1YACA 4AYTA 1LZLA 4IX1A 4RH1A 1R6AA 2CVHA 2HADA 3FRIA 2DULA 3HXKA 4LSMA 3F6YA 4AWBA 1M10A 1OF1A 1TAHA 1X80A 2C7BA 2C8JA 3UV7A 2CFRA 4JVOA 2LP4Y 2PX5A 4NYJQ 1RM0A 1BROA 4N5NA 2WDPA 4W4TA 5E7IA 1JR4A 4BPRA 1DEKA 2VNHA 5IC6A 4DM4A 2JIOA 2ZWOA 4R69A 1VI5A 1IWOA 2NNLD 2V98A 4MQFA 2PIDA 2IGTA 2UVPB 1DC6A 1KDOA 1RC0A 1T0UA 3BYZA 4EYOA 4RMGA 4FQ7A 5DBFA 5DLPA 1E18A 1X8XA 3IAEA 4W6ZA 1IULA 3NETA 3ID6C 1KORA 2P79A 1PT8A 1F17A 2ZJYA 2DLDA 3ZGOA 2CLIB 3DEAA 5K0FA 3GDOA 1AMNA 4P53A 5F78A 4M7RA 2QAJA 2VRCD 2QOEA 4GE3A 1N5MA 2YFHA 4RETA 4BECA 3RS8A 2DHEA 4FFRA 1GR1A 1S8AA 3HCEA 3LGSA 4LJ6A 2H06A 2C2WA 3IJRA 3LGAA 3RC8A 1RI2A 4F72A 2AE1A 4YECA 1T3SA 3CIOA 4EDHA 1GM5A 2QU8A 5H3HA 3TVYA 3SC2A 1LQ2A 3U3JA 2HWYA 2I91A 1L5YA 1XCJA 2VIIA 2ZWAA 3NIDB 3OPYB 4GX1A 5K0SA 5THQA 2JGDA 2ZJZA 3X1DA 4UBIA 4NMWA 2ZRQA 3EZFA 5K3DA 3L9WA 5FPPA 5K8TA 2PUDA 2QMUA 1TLTA 1WVMA 4WXMA 4REOA 3V6LA 3H4TA 4B6OA 4EYSA 1P5RA 4LJAA 4Z1OA 1M7BA 2V7EA 3FZQA 3GIDA 3KJQA 4P9NA 4B48A 2GAFA 2XWPA 3AZOA 2PZFA 4RMIA 1Q1AA 2VDUE 2Y0DA 1BJTA 2V6GA 5AVXA 4LFAB 3DZBA 5DWDA 3QFFA 3P9XA 3TTWA 1W85A 2Q45A 2FPGB 3PD7A 4Z9FA 4R6XA 1VJ1A 5AM4A 4W5TA 2RHGB 3OQBA 3AM5A 3KJIA 5CNIA 4QECA 5ANRB 4UTNA 4RSRA 3WLPA 1I80A 3RHZA 3CMMA 1BEUB 2NUPB 2V0NA 5J5VA 4NE7A 3TGPA 1AK2A 1TZKA 1SK8A 4Q6WA 3IJEB 1NFQA 1E3JA 5H70A 4F3KA 4IDAA 3TI7A 2ZW9A 4TKUA 1GAEO 3U9SA 421PA 1DWPA 4J0KA 1V11A 1DO0A 1WULS 4UTXA 3VPXA 5BW8A 3THRA 2I1WA 3QX7A 3V1LA 3DL7A 5LIRA 2ZROA 3GPCA 2BH2A 4N41A 1FYVA 3OM1A 2B8NA 1PI3A 1XXHA 2EEZA 2JGIA 4BMCA 2GDJA 3FPFA 4K2HA 3T5BA 1A5SB 4MYUA 2CDNA 2OOKA 1EE1A 5T4HA 1RYEA 5IWAB 1LJLA 3E6AA 1UF9A 1W4CA 1UJ5A 3D59A 3CNHA 3QJYA 4DQVA 2XCQA 2NVOA 5B4TA 1QHXA 1YCDA 1OQAA 2X15A 2V3VA 5IM5A 1SBIA 1OFGA 1IXKA 5HTKA 4IUDS 4HVCA 3FETA 1M7HA 1JHYA 1C9YA 2VJAA 1VHQA 4H0CA 4U7WA 5BW4A 5AVZA 3TZKA 1SXGA 2UDPA 2X3FA 1HEIA 1SHJA 1KNXA 1E9BA 3B1JA 4QEDA 4XSGA 5BORA 3DS8A 4W8HA 1KY2A 4D6XA 5B12A 2I55A 3I3OA 1JT9A 3FNEA 4F2HA 3H99A 2XQJA 3E5HA 4GG1A 3SKXA 3HN2A 1VL2A 2NZ8A 1OLSA 2P2SA 2QMQA 4UD6A 3HCNA 2HWWA 5ILQA 1TNDA 2VSXA 2Z5LA 3DTNA 4P32A 4NXNB 5IBRA 4E09A 1JEYA 4B3JA 1P2GA 3HEAA 3K71B 5KX5A 3LVQE 5FPYA 1JDJA 1VJCA 2JLUA 4PAOA 2YCBA 4V24A 3KKKA 1TQHA 1R6BX 3CUUA 3BEDA 5IN5A 2OZLB 1KTVA 5ECYA 1KI4A 1NZDA 1QYVA 4CCYA 2FDCA 2FY8A 3OF3A 4EGSA 3EZ6A 4XR4A 3PC7A 4MPRA 3OFVA 3HXOA 2BMFA 2NV0A 1UBHS 3O4IA 1PR9A 2Z9DA 1YH3A 1RPJA 4M9QA 5JJIA 1CY1A 3SZUA 4BC1A 4EFLA 4DS3A 3FMOB 4RDIA 4EG8A 1V7QA 1CUDA 2BE9A 3O38A 1NYRA 3CSSA 1F0YA 1T29A 1WSAA 3MCTA 3ABRB 4Q21A 3HACA 4BKMA 1JXOA 5C7OO 3GLFB 4ZT6A 2HRRA 1J24A 3QTTA 3MRXA 3LM8A 4U0JA 2UZIR 1TLLA 4M1QA 3S81A 5ALKA 5KJ6A 4V02A 4Q39A 3O8OA 2VTBB 2J3QA 1VLMA 5AM2A 1DC8A 1GEGA 2CZQA 2EV9A 1MHPA 4TT8A 4B8YA 1NVMB 2ODWA 2BRUC 2FB9A 1C4XA 3PP8A 2Q7XA 3SE0A 3TZLA 1ZSVA 2BH9A 5FKJA 2YKGA 3CA8A 5FL7D 1P91A 3KWLA 3CH4B 4IH9A 3I5YA 1GUDA 3DEHA 1RJWA 3EH1A 3EYAA 3ILXA 3LA8A 3PXXA 4KX5A 4LQLA 4DCUA 2PO5A 2IW3A 1JHRA 2NQ2C 2R48A 2AFIA 2YN2A 3MS4A 4Q4JA 3LFHA 4KR9A 2Y0CA 2QM8A 4IEIA 2N42A 3EBPA 2FEOA 2QRJA 3K6KA 3WQQA 5AKZA 2FG6C 1O7JA 2AD5A 4H15A 4GHWA 2FWAA 4RHUA 1NVKA 4XFDA 1MB4A 1MFZA 4AVYA 4DLZA 1BYIA 2J3LA 3W5VA 4EBBA 4RVHA 4A8HA 4CETA 2HGSA 4LJ9A 4QGAA 2X5OA 4B8ZA 5DNCA 1ZK2A 3GNQA 4ZOLF 2KX7A 3BWXA 4AF7A 4EZEA 1KYZA 5LP6A 2UVDA 3QVGA 4QO8A 3GLHA 4KQ2A 4QVGA 1VE9A 5CT8A 1Y8QB 2V5UA 4GPAA 3RARA 4WBNA 1E5QA 3EARA 3PI7A 4RPCA 1EFVA 4WESA 3OZFA 2D7DA 1SN7A 5HW0A 3GELA 1ZK0A 2AXNA 1PUXA 2G28A 2P9TA 1Z82A 3PCTA 4HZUA 2Y93A 1JPUA 2OOSA 3TD2A 5JNWA 1P4SA 4CMAA 2D7JA 2XF8A 2F1HA 3MWEA 3L2OB 3Q7EA 4KVAA 4O2RA 1CBUA 4TWBA 3CX6A 4TTQA 1W76A 1FTWA 1K6MA 4QUAA 3L0OA 5F9MA 2QD2A 2VT7A 4NPAA 4CQMD 3C14C 4IIFA 3AH8A 2XVXA 1L0BA 2Q5JA 3EDCA 4M0EA 1Z33A 3HKDA 1TGYA 1NV9A 4GXQA 4C2AA 3UJNA 1PWZA 3CJTA 3F5FA 1RAIA 3EQ7A 5HE8A 2HK6A 1IE3A 1AQUA 2C97A 3OQOA 4IJKA 2R47A 3C5EA 3VHXB 5CDGA 3SN6A 2FMKA 2WT9A 1XALA 2YTZA 1DQRA 3PPIA 2VNJA 4Y6SA 4W1RA 4RTRA 4AYXA 1FVOA 4KE7A 5JALA 2V9ZA 3KU1A 3CNEA 4KBGA 1RRGA 3P5BA 4GWKA 4MKZA 2RJOA 4WEQA 4CDRA 1NXSA 2PKCA 4IRMA 1US8A 4D8XA 2I6QA 3G2OA 4FZVA 3P45A 4IUCS 2HREA 1TOAA 2O6HA 3F96A 4YJKA 1VFNA 5LBUA 4ALLA 1R0LA 4ZYYA 5FBZA 1QC5A 5G4KB 1GAWA 2ZSFA 1K06A 2QL9A 1C4OA 2Q50A 3EBLA 4D4IA 1D4FA 4KXVA 3DEJA 3J80A 3TF5A 4FK8A 1FSSA 2PGJA 2QRZA 1V8PA 3F6CA 2C95A 2A0WA 4IWNA 4JFAA 4PZUA 2FMTA 1KYVA 1OGJA 3PYMA 2SKEA 4KQ9A 4D3YA 5JCOA 4EG3A 3P0HA 1LDBA 5F2KA 2C0CA 4R7ZA 3UM9A 2O1XA 4ILEA 3EZXA 1K8ZB 1QIHA 3IVMA 1U8EA 3UQYS 1R3UA 2A0FA 1IRXA 2VYVD 1SXJB 2YMQA 2FPSA 4IIJF 4WUVA 2CVQA 3EF1A 4HUQA 1EI9A 1D2EA 3JYNA 1A8QA 1RWMA 1Y9AA 3CUWA 4LQDA 2DX7A 2XWSA 5BNFA 4V3BA 1V7CA 1OVMA 2XUOA 2IIQA 3ILSA 3SYNA 4JXKA 3RYHA 5CCEA 2QZSA 1APBA