1XTTA

Sulfolobus solfataricus uracil phosphoribosyltransferase in complex with uridine 5'-monophosphate (ump)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
215
structure length
215
Chain Sequence
b'PLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEIVEVETPLGVKTKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVIGASRVEVDGKEVPKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable uracil phosphoribosyltransferase
publication title Allosteric Regulation and Communication between Subunits in Uracil Phosphoribosyltransferase from Sulfolobus solfataricus(,)
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 70
structure length 215
sequence length 215
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2004-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xttA00
4M0UA 1UPFA 1ECFA 4M0PA 1OROA 1ZN7A 3OHPA 4RHXA 1A96A 3HVUA 1ECBA 1OPRA 1Y0BA 2EHJA 1NULA 1I0LA 4QYIB 1STOA 3LRTA 1XZ8A 4QYIA 2IGBA 1NONA 3OZFA 5BSKA 4Z1OA 1P19A 4S2UA 1PZMA 1IBSA 4RABA 1QB7A 3QW4B 4P86A 2DY0A 3DMPA 5ESXA 3GGCA 4RANA 1J7JA 4LYYA 1WD5A 3LPNA 4OHCA 5BQPA 4RQBA 4RHUA 5K51A 1ECJA 1QCCA 1R3UA 3N2LA 1A98A 4RQAA 1P18A 1XTVA 1ZN9A 1DQNA 1L1RA 4F8EA 1A97A 1VSTA 1W30A 4RHTA 4RV4A 4M0KA 4X45A 3S5JA 1CJBA 4P84A 3KB8A 1OREA 3O7MA 4LZOA 4P3KA 1TC1A 2P1ZA 1BD3A 1HGXA 1GPH1 3ACCA 1A95A 4WN3A 1FSGA 4P83A 5BRNA 3M3HA 4ZFNA 1G9TA 5JSQA 4P80A 1L1QA 4WMLA 4TWBA 1G9SA 3ACBA 4P82A 1I14A 1QK3A 1XTUA 5BQOA 1ECGA 4JITA 1JLSA 1BD4A 1O5OA 1I0IA 1TC2A 1P17A 4PFQA 1U9YA 3G6WA 1LH0A 1ZN8A 4IJQA 1HMPA 2C4KA 5HKLA 2FXVA 3MBIA 4JLSA 2VFAA 2JBHA 1UFRA 1A3CA 3MJDA 5IPFA 4LZNA 1VCHA 4RAQA 4RAOA 5IAOA 2JI4A 5EUCA 4P81A 1UPUA 3OZGA 4KN6A 3GGJA 4RADA 5E38A 1JLRA 2H08A 3NAGA 1G2QA 2HCRA 3DAHA 1XTTA 4MB6A 1DKUA 2XBUA 2GEBA 3DEZA 1QK4A 2PS1A 2YZKA 2H06A 5JV5A 1D6NA 1ECCA 1XZNA 3H83A 4LYGA 4RACA 2AEEA 4LZAA 1GRVA 1P4AA 2PRZA 2PRYA 1AO0A 3GEPA 3ACDA 5HIAA 1I5EA 2E55A 1A4XA 1YFZA 3EFHA 1DBRA 4PAWA 4X44A 1BZYA 1MZVA 2JKZA 4FYMA 1U9ZA 5KAPA 1DQPA 1QB8A 1V9SA 1Z7GA 2H07A 1I13A 1QCDA 2JKYA 4RHYA 5ESWA 1QK5A 1DKRA 2WNSA 5KAMA 4QRIA 1VDMA 1O57A 1G2PA
chains in the Genus database with same CATH superfamily
2VK8A 1ZKMA 4BQNA 4ZHQF 3OX1A 3OC0A 3H1BA 1MORA 1Z0UA 3U37A 4XCVA 1COWD 4MVJA 4B3JA 2ON6A 1SK8A 5HJ5A 1UIRA 1NY5A 1H69A 3OLCX 4IHJA 1WY5A 1CZUA 2DY1A 1C4OA 2OT3B 3NT4A 2ZRLA 3AO0B 2IDKA 4BZWA 4FM9A 3COJA 1EJ6A 1ODFA 1R0ZA 1YUNA 1N4DA 3C6BA 3NBKA 4N40A 721PA 3ZDYB 5BQPA 1L7QA 2AOWA 3VJLA 4L27A 3KKLA 1ODCA 4ZOQI 3KXPA 4EG1A 2X0JA 2I7XA 4GLFA 1PS0A 3K0FB 3LP5A 5DNEA 4B2YA 4LYFA 5SY4A 2X86A 1GCGA 1Q5PA 2P2CA 4JNKA 1UMDB 4O2RA 1T5BA 3C6QA 2VK2A 3OQMA 2IBSA 2KQUA 4Z51A 4ZMRA 1BRTA 2VP0A 3NJRA 1S5PA 4C87A 1B42A 3O4JA 1NBOA 1RYEA 2K2WA 3KJIA 3O73A 2OV2A 3CLRC 3PXCX 3SHWA 1F8UA 5BV2P 4PTZA 4CLDA 2OV6A 2VTKA 5I4KA 3U09A 1KRWA 1HNNA 2A0WA 4DLKA 3IEUA 1YRBA 1OAOA 3DC2A 2YYSA 3INYA 5LB4A 4AF7A 1VPDA 3MTAA 2EZ9A 3WDMA 4Z7QB 1K6EA 5I45A 3I28A 4D96A 3S8EA 1FTQA 5DU2A 4XVRA 2R1TA 3A1FA 2VHXA 4J2HA 3TLZA 1N36B 4E5MA 1A72A 1N2BA 3WTCA 4IXWA 3AB8A 3NYWA 3FDFA 3NHYA 3I9KA 1R6TA 4DIOA 5A2QA 5CLJA 5K5EA 1PZHA 4LF8B 3HJCA 5FR2A 1BMFA 1UP7A 1R9NA 4ROSA 1RPZA 3VZRA 4BE4A 2O8DA 2WTMA 1EFPB 1GFZA 4JP2A 4L95C 1GUFA 2M1XA 3CLTC 4NYJR 3OQHA 1ONOA 1NQAO 4PXSA 4Q01A 2PUDA 1V41E 4KHZA 2YRFA 2OGUA 3C43A 1KVRA 5C0OE 4P4LA 1E2MA 1M2GA 1VLQA 3GQBB 3LBIA 4PGAA 1GA6A 3TSCA 4DLTA 1PSZA 5HKAA 4JIGA 1LI7A 1D0VA 2AJLI 3T3GA 3A6PC 3CMCO 3OCJA 3S4YA 1ADYA 3PCRB 1VJ0A 5DCWA 3ZDZB 3A9RA 2UZ1B 4J1TA 5TE9A 2PJRA 1FTWA 2B82A 4LJAA 4FCTA 2VI5A 2YV5A 4NV3A 3HL0A 5TJHA 5DLYA 4F5ZA 2YZKA 1J1IA 4J1NA 5CCDA 3CH4B 3SIXA 1RIIA 1FU7A 1M10A 3FSEA 1R12A 4FINA 5TGZA 3WICA 4BNTA 4DQLA 4OM7A 1D09A 1MW8X 3G8YA 3RGWS 3OQIB 2G8NA 4IHAA 1E1RA 4L73A 2FPGA 5TB5A 2XVMA 5CA0F 1FXWA 3OT1A 3P19A 4R83A 3PQEA 1EUCA 4U8HA 4E3ZA 4XVUA 4K3VA 2C7BA 1LSSA 2XQGA 1FDRA 3CRQA 3ZWMA 5FUXA 1PJBA 3CNHA 3V32A 4PQGA 1T8YA 4R7GA 3RNLA 1JA0A 1V7CA 3NBUA 4K9MA 3AF0A 1J06A 4QIHA 3WA6A 4P4SA 1E3JA 3WK4A 5L7WA 3RK4A 3C48A 3EQ6A 3QOWA 2R6DA 1JHXA 1RQRA 3HVUA 4I6JA 1BWPA 3SQDA 3TRHA 4N76A 1TJ3A 2LGJA 1OWPA 1BA3A 3KB2A 3TQOA 3OZWA 1AGNA 1THGA 2W22A 3T12A 1BDIA 4DM3A 3TE7A 1UBOS 4CQJA 3LGSA 2YVUA 1ZSYA 3K2IA 3E53A 1E3TA 4TTRA 3DNMA 3QW4B 5A71A 3WYBA 4YJFB 4NENB 1DG9A 3MCTA 2VH5R 3DMYA 4Q9LA 4DYVA 1XAHA 1ANKA 3OJWA 3NYRA 4KTVE 1YK1A 4Q9HA 4CQMD 2QP4A 3KXIA 4BP1A 1R3UA 2OG1A 3H4TA 3FCEA 3QPCA 4DV2B 1NU8A 5IJZA 5HILA 3ZHUA 1EM8A 1QQBA 2BGLA 3UV7A 3T7RA 4ITRC 1XDDA 1Y3CE 3PB3A 4AKHA 1HTTA 3KXKA 4XGKA 5B58C 1WSBA 1PDOA 1Z5ZA 2XRMA 4OUDA 2FN9A 1U4NA 1SGWA 3JQ8B 4B6EA 5CNJA 5AVSA 2VDMB 1M0WA 2P1ZA 1TFUA 4KX3A 4RS4A 1R8XA 2QTRA 2YWDA 2ODBA 4PSDA 3WL3A 4DJFC 1E5TA 2NU9A 1NFQA 1IM5A 2P4QA 1NVDA 1SUDA 4BU0A 4C2TA 1PJRA 5JBNA 3K72B 1K06A 1E64A 4UNIA 5I7FA 5JSQA 2Z6AA 1ENZA 2E85A 2TECE 4H15A 2YRXA 2P4HX 2QRNA 2XW6A 3MSCA 4CM3A 1IWOA 5EIXA 3ZVNA 1H9AA 2ZBDA 5LQDA 3SYTA 5KPJA 2VSQA 3ETJA 5EGSA 2QE7A 2JC3A 4JLJA 2HIMA 2PSFA 4TN1A 3DZHA 5EEHA 2K87A 3DMDA 3W5VA 2PL3A 2IHTA 2DHDA 3A6EA 3PD7A 1GGVA 3CB4A 3HPRA 2PO7A 3DULA 3HGQA 2HHAA 3H65A 3VBCA 3SYRA 3U7QA 2NZXA 3NBFA 3DBOB 5BNFA 3GUVA 2JBHA 4BMDA 1Z2EA 3U3ZA 4HNQA 3UJ3X 1NJ5A 3VR4A 2JLYA 2FDRA 1HTBA 4RKWA 3Q7IA 4ZVNA 3E22B 2ODEA 5EUCA 2YOHA 4BLPA 5HOEA 3L9XA 1QP0A 1BJKA 1HPLA 4OP1A 3D7MA 1YRQA 2COUA 3U1TA 4D5GA 4E11A 4HGZA 2FR8A 3QUAA 5BXYA 1H2WA 3OMLA 4A8HA 3OEHD 4OMUA 4B4UA 4LY6A 1NVXQ 4PLTA 4JN6B 4EZEA 4K26A 4RF2A 2A2ZA 1LBHA 1X14A 4PIVA 3O82A 3EOZA 3VJRA 4IX1A 3L6OO 5T57A 4I4TF 4P7GA 1UODA 4BOYA 1QF6A 1X1TA 3QMVA 2CCGA 4RXUA 1VKRA 2HYIC 5F4ZA 2Z8YM 3NR2A 3GK3A 3OQ1A 1U8FO 3I4FA 1P5RA 3NJ8A 3AESB 3C3XA 1EVQA 2JBAB 3QG5A 3CYFA 5EXDA 3W2GA 5CD9A 4XYBA 5AK4A 1IXSB 1OUMA 1T1EA 4EECA 2ZUFA 2WNSA 1G6Q1 4DR4B 4URZR 3HHPA 3QP9A 4NEHB 1O6BA 4M0UA 2UYCA 3RRJA 4KLCA 1V2GA 3UFBA 4M8LA 5KTNA 1YD7A 4M8KA 3I8OA 4A8TA 3C3PA 4O5AA 2CMGA 1ZI6A 1YCDA 1L4NA 4QDXA 5A04A 2BSQA 1KY3A 2CLLB 3SQWA 5A0FA 3AOEC 3HO8A 5FNZA 1DG3A 4TGLA 5AUQA 5K4AA 3L7YA 5FWNA 1JLKA 1Z0IA 2FEXA 2JH3A 4R1MA 4F5YA 2C7PA 1NXOA 1VP3A 1WHTA 4K6KA 2BYTA 2YWGA 2ECQA 2HBZA 1T5DX 1V8ZA 3IUNA 2XMGA 3A1DA 4C0XA 4L78A 1Q91A 1ZXXA 1XEXB 2R6R1 2WIAA 2VSNA 3O8NA 4OMCA 4GOOD 2H8GA 4RZUA 5EJ2A 1N6KA 1M8JA 1MPTA 2WT8A 3MW8A 5ALGA 3SNHA 4CODB 1DC3A 3C1AA 4R9UC 3ORHA 1BQ3A 4G1UC 3MTBA 1CJTC 2RFLA 2X5JO 4RK5A 5DM0A 3BZUA 3X1DA 3BEDA 1VJTA 2C9MA 5D51S 2W8ZA 2H3EA 1NBAA 1U2DA 4TLLB 1QCZA 3PXBA 3F67A 4OK6A 1T4CA 2G76A 5KNLA 4M55A 3GF4A 1E9EA 1SRQA 2LCIA 1OC4A 1ZRNA 4LKRA 1R0CA 3WGYA 4MRSA 4D3FA 5AVWA 5JECA 3JVIA 5CX1A 4L9AA 2HY7A 4RZHA 2I76A 4HSEA 1BROA 4CJXA 5E1BA 1XXLA 3PEFA 3PD0A 4CKZA 4EA9A 3QU7A 2QQ5A 1KDOA 1SAYA 4P0PB 2BI4A 3DL2A 3R7WA 3EISA 3HABA 3UYLA 2ST1A 5J4VA 4Y2YA 1DV1A 1T25A 4RWZA 1CF2O 5HFNA 1QGUA 1TQ6A 2CCJA 3QVWA 3A4LA 3DDWA 3IHLA 4H59A 3SYMA 2IW1A 1VM6A 2PU5A 3HDJA 2UAGA 4OHKA 4UU0A 3A3KA 4ZT4A 5GP1A 1IZ8A 5KDLA 3TRDA 2C96A 2CUKA 4B7UA 4XVCA 2OY0A 4KSBA 1O87A 2M6RA 2VLIA 1XTKA 3GR6A 3UG7A 4IZOA 3PJDA 2WU1A 2IBTA 3M4ZA 5KYUA 2X22A 4ADSG 3HHEA 2EKQA 4BFUA 1SCNE 3RC8A 2VSXA 2ZIZA 1BIFA 5IDWA 4B0OA 4BYMA 5E0OA 1W85B 4JV5B 2ZB4A 3FOWA 5T5QA 1HLDA 1QLJA 2X5KO 2Y4NA 2H2AA 3N6RA 4JVOA 3P0EA 4C0AC 3N87A 5COAA 1VMEA 3UVEA 2QTFA 1YTUA 1YJQA 2P2LA 3F8SA 1A69A 1XTSA 4MLZA 5F2OA 1V5IA 1QH0A 4XFJA 2BMVA 2DFKB 3Q9NA 3NI2A 2OHVA 5CLHA 2HPVA 3PFFA 4OHXA 2PLNA 3RADC 1J5EB 2PYZA 2ZCJA 3I9V1 1E4YA 2DKNA 3HZOA 3O9VA 2P2SA 4PRYA 3HYSA 3GJ4A 3FZNA 3MZ0A 3SIWA 3UXMA 4DV3B 4GBED 2FUNB 2BGUA 2DFLA 4KLNA 3N0VA 3TF5A 1JJVA 1KIMA 4O4IA 5KX5A 4HTFA 3KZVA 2P77A 4X1YA 1A2BA 1HM5A 1W5BA 2QZ4A 4YUWA 5CB0A 1G7CA 1V1JA 2BGRA 5FF9A 4TRJA 3B3JA 3SIRA 2IP1A 1KS9A 4GZ5A 5A7HA 5ALZA 4IOMA 3MC1A 1ZD4A 3SIPA 1Y33E 3KPVA 3U4MA 1DFGA 1AQ6A 4DA8A 1U2RA 1AXRA 1E4EA 1U28A 4BQPA 2ZB2A 4RY9A 4HMOA 2WKPA 4JT8A 3FCOA 3UANA 1HO3A 5LZ7A 1M9NA 3IXMA 4NZNA 2ZROA 1RT9A 4G0MA 1KO4A 3GLVA 2H65A 3RKRA 3RS2A 4C4TA 4ZAWA 5TXGA 3V8PA 2AFHB 2BMDA 3VQTA 3PTLA 2J33A 1E9FA 1RWMA 1CJVC 4X6XA 3F5FA 5K6TA 2VXOA 2Q3MA 2G09A 1Z0JA 1NBEA 1A7AA 1N5JA 2H5IA 4DT1A 4EYGA 5AVTA 3PT5A 2BW0A 2ZZMA 1IBKB 1ZHOA 1M6WA 1SC9A 3HJHA 3SN6A 1MZPA 1IHYA 5INTA 2OLKA 1GEGA 1S7GA 4NSNA 6CHYA 1Y7TA 3EGIA 2I4MA 4H18A 4ZO7A 1RWXA 3BWBA 1GUYA 2DUJA 2RGNC 2DUNA 4ALLA 3CT4A 2XUZA 5D01A 1B8UA 3QKSA 3DTTA 3B9BA 1TE2A 1ZHHA 1U4OA 5DX0A 5B12A 1L0BA 4I9HA 2Y1OA 3OQJA 3WGZA 1RJWA 5BW8A 2XF2A 3A4VA 2IK8A 2QMOA 3N74A 4CGYA 5LMCA 2YY7A 1A95A 2IPLA 2GT1A 4RV5A 4MR7B 3THWA 3Q8LA 4WHMA 1UAGA 5AWFC 3EBLA 2JGKA 1YAJA 3D81A 3H1TA 4RSMA 4D42A 4LDNA 3AKEA 3NONA 2ORVA 2WZQA 1FRFS 2OMEA 2Z4SA 3DEJA 3I30X 3ZY2A 4E4RA 2I1VB 2Z56A 3W4JA 3KC2A 3DE6X 4HGYA 4DA7A 2GNAA 4XX0A 2CEAA 5DWDA 1U8ZA 4AS1A 1LLCA 3RC3A 1BH6A 3GBSA 4WFIA 6LDHA 1U7XA 4NARA 1D0SA 2X23A 4Q3CA 5BN3B 1AOXA 3DXFA 3RDPA 3A7DA 4MHTA 1AKEA 2H2HA 1A77A 2C4KA 4KWTA 3I5MA 4YP5A 4QO8A 2IY7A 1RWOA 3P9KA 4PYOA 3TSZA 2C5EA 4RVSA 1UMKA 2YIJA 5TS2A 5LP6B 2YDXA 3PUKA 5EXTA 2WZDA 1RAIA 2MJLA 1C9MA 3BGVA 1IL0A 2ZRPA 5I4CA 3FBWA 4CCYA 4FT2A 4K9SA 4DM7A 4RQUA 4WLNA 5E9JA 2DQ4A 3UZUA 3Q3CA 2XNHA 4IVNA 1LPMA 3C85A 4PX9A 4HZUA 3JD1A 4LHWA 2AW5A 4CTNA 5K3CA 2P3OA 3EFBA 3MYYA 3RYHB 1ZH2A 5FLYA 1HI9A 1EDBA 2ZULA 4FDAA 1UEJA 3IELA 1HZZC 1DJPA 3EFEA 5JMTA 4LZAA 2ZRQA 5DI3B 1Q0SA 3DQQA 2OPHA 4LF7B 4LDRA 4MDFA 2C9YA 5TT0A 1B2RA 2EC5A 4COKA 1OFUA 1G6KA 2WYUA 3NETA 4XB6B 4HFRA 2WIDA 2BMFA 4LOLA 5CDHA 1Z8FA 3FUXA 3DZFA 3QVGA 2IEBA 3D7SA 3TLBA 4ZHQA 4KGXA 1RPAA 3VVBA 2LPMA 3E0XA 3TS1A 5IUJC 3NNNA 221PA 3D4PA 1RR6A 4WTOA 1Z6YA 1ACLA 1Y5IA 3QPVA 2GXSA 4NYJQ 3TQCA 1JZTA 2FW8A 4H6PA 1EWQA 1DTSA 1XK6A 5FWYA 5ENDA 1LLFA 1DB3A 1SCIA 2XEDA 4QQKA 2PHZA 2OXEA 3IOCA 1RBQA 3S6JA 2W6MA 1MF7A 4JVLA 3NCHA 4C29A 5BMVB 3ECSA 3KKKA 4EX6A 2MCFA 1NMEA 2WPNA 4V38A 2GEDA 4MQ6A 4X7RA 5BUQA 4MEBA 3OD1A 4XIJA 3NAZA 3RBXA 2G6TA 1TF2A 2RAUA 2XSZA 3KT3A 2RGEA 5B4VA 1JXMA 1C4WA 1M3SA 3FM9A 4LY3A 1Q50A 3DVLA 5EE9A 1AN0A 1KU0A 1TKAA 1WLSA 3DOOA 4BO4A 1FX1A 3T8YA 3TDMA 4HNAB 1Z18A 4UZFA 3FUVA 5JZ9A 5F1YA 2MYPA 1NQ5A 4IS2A 2QL5A 2A4MA 3AUSA 3PCXA 4CL2A 3Q9LA 3RE1A 3ZU6A 3HFSA 2OP1A 4EY6A 2YQ5A 4CV2A 1L5RA 1E0KA 3K8QA 5JXHA 1T9HA 1F3OA 5E2BA 5HZGA 2XI4A 3VHQA 1TT5B 3O83A 4PHFA 1A9ZA 3FSRA 3K6RA 1ADJA 4V0KA 4H3VA 3JQFA 5CFNA 3WGOA 4DLVA 2J85A 4BLOA 2RIPA 4WK4B 1UWCA 5M29A 3RYCA 4Q1DA 5GY7A 4MQUA 3PBKA 3HDHA 5FOWA 3P0FA 5BNIA 4AWAA 4FZVA 3ZXIA 1EX1A 2RHOA 4QHSA 2XXBA 4M6WA 1J4AA 1REQA 1TW3A 1K5DA 3L5OA 1COWA 3EPRA 3BFXA 4PO9A 2Y99A 4Q9AA 5C51B 5BYKA 4GLLA 2H17A 4HAUA 1Y63A 5I7HA 4V0SA 1OLXA 4UUBA 3PC6A 3AEZA 5A6SA 1N8SA 2WTNA 2IH2A 1XNRB 1SKYE 3EQ8A 4HPWA 2B98A 3UT5A 1MGOA 1PR6A 3AEKA 1KJZA 1CG6A 2AR9A 4NMLA 4HRAA 2YFHA 4KMMA 4D4KA 2P2DA 3BJRA 1PFQA 1PQUA 2C4HA 3BMQB 2CXTA 3CV3A 1IY1A 4B31A 2BTQB 2XLCA 1VB3A 1X8XA 3HJFA 3DMTA 3HXLA 4WH0A 4I5EA 1GNPA 3SHVA 1JQAA 1J8YF 3QKRB 1XNHA 1T5OA 1VMAA 1PNRA 2YYZA 4PS0A 4QC2A 4X97A 4XGNA 1SCDA 4PY2A 5G1NA 4IWYA 4B6QA 1IK4A 4D02A 4GI7A 2HBRA 3JWIA 4MVJP 1GZ6A 4L4XA 1XT6A 3UICA 4IMRA 3DGEC 3LY9A 4FKZA 3K4PA 4M0MA 2CKMA 3K20A 3R3UA 2AYZA 3TNJA 3HFGA 1EQ2A 2AI3A 4F5DA 1XP8A 5EJMA 1CT9A 1DEXA 2GESA 4ZT7A 3TG8A 3ZDCA 2P9GA 1KYXA 3UH0A 3NCTA 4MUHA 3JYLA 5CX4A 4X8MA 2VSFA 4HSGA 5J2UB 4KDCA 4TTTS 5I47A 4YRCA 3R7DA 4HP8A 3CNQS 4Z4FA 2YHIB 2H07A 3PX3A 4OFWA 3WLQA 5KC9A 2BHRA 2AWOA 3O1HB 3OO1A 2YHBA 3L77A 4AZSA 3N0TA 3WGHA 2E49A 2ANBA 3L4BA 3CBQA 1SXGA 2B7CA 3J80A 1KBQA 4OQDA 4B6OA 4RCZA 1GJRA 1Q84A 2B34A 4UW9A 1QANA 2A6PA 1J2TA 2CWDA 2H9IA 2YVQA 3NGMA 1NX9A 3H11B 2V6IA 1N78A 3WLAA 3JYHA 3RYIA 1N3LA 2PT7A 1J8QA 3Q3EA 4EI7A 2ZVQX 1NA5A 4O0MA 4CKYA 1QV6A 2XZOA 2XB2A 3RODA 1SVSA 5EGNA 2POQX 2JGDA 2Q5IA 1IG0A 1JIUA 1E7MA 3OIVA 4F86A 1BYIA 2VQFB 2HU5A 1T5HX 4U5QA 1DXYA 2OHHA 1IVYA 3HUEA 5DPMA 4BEBA 4ZWNA 2G08A 3ZCPA 5JO0A 2FEKA 3TMAA 4IIEA 2ZB7A 1P6XA 3FLBA 3ZBQA 2A8YA 1G5PA 1Z2CA 2CZQA 2ZOSA 1MDBA 3OZBA 1EVEA 2CWWA 2WW8A 3AY0A 3D6UA 2PZBA 4LSWA 4RVDA 1FJ2A 4GOLD 1IQRA 2IYFA 2Y1XA 4KDEA 1WKCA 4D4MA 3EX7C 2VH1A 3PF8A 2J87A 2BKEA 1L9KA 2X42A 4XYLA 4N7BA 4Y1RB 5IJXA 2UXBB 3L8FA 4MXDA 2ADMA 5AR1A 1TC1A 4N3BA 4CLOA 2X19A 3I4LA 5CIQA 4W5QA 4G2NA 3FOZA 5IULC 1C3OA 3H99A 4IRXA 3V5NA 1TUBA 2VA9A 2PFSA 3N6XA 4Y7CA 3WLSA 3NTXA 5K8VA 3WISA 3V6MA 1GKLA 1KJNA 5IT5A 1OXKB 1DEAA 1DWUA 3Q87B 3K0CC 1OF1A 3K73O 1W0JA 3UJCA 2WB2A 2EFDB 4R2WA 4DZTA 1UBNA 2Z9BA 3ENKA 1B7GO 5H59A 3G9QA 3RVKA 5DTEA 3G2KA 1RLJA 3BCUA 1SOAA 3MMSA 1I14A 4V0RA 1N2XA 5AHKA 2O2JA 3DVQX 1BD4A 2Z1NA 2C04A 2HJSA 3ZK9A 1SY7A 4PHGA 1KH1A 4GG1A 2BE9A 4G5YA 2HCTA 3DTVB 1RNLA 5BSUA 2B20A 3RS9A 4CQMA 2PUAA 2X1LA 1QRAA 5GINE 5E6RB 1L4LA 1G5RA 1LC3A 3OSZA 3ZQ6A 2XUFA 2ZDGA 2WIFA 1NVVR 4IIFA 2EWVA 1V0JA 1KOLA 3MT9A 1WU8A 4KCGA 2FCAA 4R54A 5EHQA 2JAWA 4RJTA 2VL7A 3GA0A 3L7AA 5ITZA 3T1HB 1YGYA 3OUZA 2YJ6A 2FB9A 3RIXA 4D0NA 4YUYA 1WF6A 2H85A 1YV9A 2I6TA 2C8VA 4I4TA 3SEZA 4EOGA 5F9MA 2OCBA 3ZHXA 3UGTA 2ZRGA 2D3TA 4IUCS 5CIWA 4XE5A 4EYSA 2X2FA 2JFNA 4K03A 4FS3A 4UU7A 1CB0A 2WQZA 1UBCA 3UJAA 2AD5A 1ZO8A 2WMYA 5K0FA 2H9YA 1EP9A 1RHUA 3F7OA 4E4YA 3O21A 4QHTA 1X70A 4ATNA 1DBRA 4CM5A 4TXJA 2QI9F 4UCWA 3QYAA 4ZAZA 2ZSIA 2X3FA 3ONFA 2IF2A 5KAPA 3PFKA 2VJDA 4NPCA 2HB6A 1ZC4A 2FX2A 4YRIA 1O57A 5T4HA 5L45A 3DAGA 4JB3A 3CVVA 1DLIA 5C1DA 1K8RA 2AZXA 1KZ9A 1HH4A 1WJGA 1MQAA 4HGPA 4U2CA 1AD2A 1HORA 2YKGA 2AX3A 1J24A 2R1VB 4HR7A 4DY6A 2ZW9A 2BCEA 1D1SA 4PZEA 1Z25A 2BZ1A 3DV0B 3GUHA 1HBJA 4M1OA 1ZMOA 5ALLA 1A0OA 1SK9A 1K2WA 3HYTA 4GRIA 3PQDA 1UZAA 4GNRA 1PGQA 4QUDA 4YQYA 4XA8A 3UJHA 4CT4B 2GAFA 2VNHA 1ZH0A 3P0JA 5MGBA 3PUXA 3TLEA 1NIPA 1V3TA 2GNOA 4KPUA 5JJIA 1JDZA 5TQJA 1GSAA 3OEHA 5KBYA 2HDOA 2DYKA 3EGWA 3OWOA 1GPDG 4P7KA 5HA5A 4WBNB 5JHHB 1MABB 2W6ID 4M0CA 1PUJA 4NVRA 4OTZA 2XUDA 4N8SA 5CW2A 3ZE9A 4YPVA 1JFFB 1DQNA 4P8RA 4QJBA 5JD4A 1KORA 1YNSA 2HO5A 3C3WA 3DKVA 4GC5A 3PFNA 4I50A 1KI6A 3ELDA 5ECGC 2ZBPA 1YQ9A 2BFEB 3JAKA 3FNBA 4PLFA 4DQDA 4OFBA 3HXPA 3PYLA 2N42A 5LJIA 5TIIA 3PFWO 5E6SA 2B0JA 1Z0FA 1Z2PX 1GG5A 2XVYA 4FFSA 1Q7CA 1J0BA 3QTBA 4HGQA 4RMJA 5AJXA 5KHAA 5CK5A 2YXEA 1W48A 2BEWA 3LHFA 3MMPA 4B4VA 2C9OA 4RL4A 5F9FA 2Q8QA 2PXXA 4KXFB 3ZU4A 1ZGHA 1MB9A 2H3HA 4LRUA 2PLRA 3QXCA 3AR9A 1CQPA 3PGKA 2FDCA 5FIUA 2JAQA 1QONA 2R68A 5EPEA 3C41J 1FFEA 2WTUA 4E32A 1U7HA 1XKQA 2XAAA 2GXQA 4HXYA 4X1IA 4EUFA 4RVUA 2L2QA 3ZPXA 1O94C 3W5BA 1QGAA 1JA9A 4JA0A 2ZIUB 2SCUB 1QTQA 4K9KA 2XYHA 1LU9A 3AYZB 4REQA 1B41A 2Q50A 1SMKA 2LIVA 4XEUA 5IARA 3RS3A 5TQVA 3IEIA 2IE8A 3P71T 3X1MA 5EMHA 4MUGA 3UHPA 2YJTD 5AMXA 1HOTA 2QLLA 1SBHA 1QKIA 4NNPA 4LWOA 1IHXA 3TW6A 4YUZA 4KO2S 2MYTA 4J0IA 3DVRX 4BMOB 1N32B 2DQSA 5IHXA 3I6MA 1I5RA 2OV4A 3QG1A 4JAVC 4M7PA 1AIPA 2IYXA 2W0MA 1JTEA 2PAAA 4L72A 1GYQA 5K01A 2YVLA 2OFXA 3FNHA 4QZVA 1M6VA 3AR4A 1D4OA 3IUBA 3FNGA 3TR5A 3BTUA 1H66A 1U3DA 1FB5A 1KERA 2OXRA 5D6OA 3AVVA 3PQ7A 5KTOA 1PP4A 1RJ9B 4Y1EA 1C0EA 3WS7A 1CDZA 3X3HA 4KR9A 1GT91 1R9MA 2O1XA 4QPPA 1TJYA 5JS6A 4GZ6A 5TARA 1E1NA 1XKLA 2K2QB 3GJ6A 3M6FA 3STVA 1KQOA 3MCZA 4EH1A 1T6NA 3VTAA 3ZTYA 3RARA 1E6LA 3LH5A 4IP0A 4EG8A 4LMAA 1BXZA 2ZJ2A 5FRDA 4M9ZA 4B9EA 3ENZA 2JIDA 2NVUB 2WSYB 3QPWA 4DCVA 2JIZD 1XLVA 3AT1A 2B9VA 4K9OA 3BE5A 3EAGA 2Q0HA 4BXOA 2I4OA 2PO5A 4WY2A 9LDTA 3N5CA 2FFJA 2OVFA 4F84A 3WLMA 4QU5A 2AUMA 1E9AA 3MUNA 1NW4A 1Y7IA 2PCLA 5FOVA 3ZXYA 4A2PA 1WMSA 4LHEA 3ZBTA 1S2GA 1STOA 2W58A 2QYOA 3QWFA 4C78A 1EHIA 3CMMA 3AF1A 4JUFA 4TZ6A 1W44A 2W2PA 4AG6A 1IM2A 5BXQC 2IYRA 1D2HA 1W9MA 1W2HA 4WBXC 4HEHA 3DBLA 1OX4A 4QDKA 5DBIA 2GAIA 3FMVA 4ZXFA 1F06A 3T4EA 3TGWA 4EKYA 4NJMA 3UJNA 4DDHA 2I6XA 4GWKA 3A4IA 5IK2D 1Z73A 4C01A 3PA8A 4GM1A 5HTOA 5KJ6A 3EIEA 1A98A 2IS4A 2Q7XA 2IH4A 4LKOA 4FC7A 2J3IA 3TTYA 2R5WA 4I9UA 1SHJA 4RD4A 4L9SA 1USUA 4U2BA 3V2GA 4BEVA 2IE0A 1TU0A 1KJ8A 3NATA 1T8TA 4Z3DA 3UWDA 2IYPA 3EH2A 4P84A 4Z0NA 3H4MA 5DXJA 4DMHA 3W4IA 4DTIA 1KIFA 4GMKA 3UCXA 1PR2A 5DWQA 4C7BA 4IR7A 1IZ0A 4I2VA 2PKCA 5SZIA 3PGA1 4QSMA 1RYNA 4YLEA 3IEVA 1D2NA 4GX1A 2PS9A 4ND5A 3G2PA 4XVQA 2VJLA 5K0TA 3CXRA 4LPSA 2ADOA 3C3CA 4PFSA 3JQQA 4AZ3B 1JG2A 4Z86A 4V02A 3VX3A 4P82A 4FFNA 1M2JA 4GSKA 2O2GA 3N7AA 2PX8A 2QRJA 4P54A 1FSPA 1TMYA 4MS4B 4KITB 1TM7E 3L84A 1X0VA 3VPCA 1JJAA 3LUJA 4H16A 3LLSA 2VTBA 4UDNA 2YV3A 4QGSA 3V8QA 1YKGA 4H9GA 4EPRA 1M8GA 2Y9PB 2RHTA 5JYEA 3IMEA 4JROA 3LS2A 4U7PB 3K4HA 4US1R 2NZJA 2ZBRA 5EJ8A 2IYOA 1YFJA 1GDTA 5IVDA 2P3SA 2XDYA 1UBSB 2JIBA 4RPKA 5F2EA 3PWKA 4V0LA 1BU8A 4Y2TA 4G8JA 5LP6F 5CDFA 4Q9KA 3INRA 3FUWA 3BUSA 5FOTA 1EGHA 2ZIXB 2Q1TA 3HCDA 3ORYA 1FS6A 2VQSA 4KQHA 5TVKA 3WQHA 2GB4A 1YBHA 1M2FA 2IHKA 3TO5A 7ABPA 4KWEA 1ZA1A 1ZNXA 5MN5A 1AXGA 1EFVA 1JEYA 2ABWA 5IASA 2ZR9A 1I6KA 1E2HA 4P4TA 5CDFE 5H4GA 4CG3A 5JUWA 3AIOA 3L49A 4P7FA 5DYIA 5EXEA 1CZRA 3DCYA 3QI7A 1NKTA 4L51A 4Y8VA 4ZA2A 3FAKA 2O9JA 3TEFA 5JTTA 3KQWA 3HGTA 3W8EA 2AD1A 2XBMA 3PC2A 1DZIA 4C20A 2ZPUA 4YDRA 5L3QB 1DKPA 4IMPA 1NV9A 2R9VA 4N6NA 2F9LA 2H57A 1GR1A 2PUHA 3SQOA 4MUNA 2V5VA 4Z3KA 2ZXUA 2DETA 4FPXA 1HLPA 3RVQA 3TD6A 2PSEA 2DOKA 1Y0BA 3AI7A 4X6LA 1C1YA 4GICA 4BZPA 2F3SA 3PR2B 4BX8A 1ONPA 4PAOA 4CMCA 1YZUA 1JDUA 5AKZA 2IWRA 1U3VA 2QW1A 3C8MA 4S2UA 4HQ0A 1UKVY 4NG5A 3PEEA 4JMPA 4NATA 3NDBB 1OA1A 5C4MA 5BMVF 3TQIA 4BDTA 4CMEA 4PQYA 4UDXX 2VPXA 4WK6A 3MAJA 2D5LA 1QYVA 3RV4A 4OHYA 1BXRB 1ORTA 1Q0UA 4KFSA 2D1RA 3NM6B 4HDSA 1J8MF 1X15A 3SSAA 4NCJA 1H94A 2R48A 3IUYA 3K0FA 4R1PA 4C7VA 5IKEA 3C8ZA 3DWFA 2E4AA 3G0DA 1S2MA 4Z7OB 3CEHA 4F4JA 2HJWA 1UMDA 3E3LA 4MRMB 5F3RA 5DNCA 4LF5B 4UTRA 3BERA 1I4OA 3NGXA 1QE5A 1LZLA 3KPUA 4NAVA 4O4HA 3TW0A 4QSHA 4P3OA 1RLIA 2Z57A 5JRZA 3HO1A 1MAAA 1J9EA 5HYVA 1TJ4A 4PLGA 5IT9A 4OHFA 2EF0A 2H4WA 1GAWA 3ECCA 4F04A 1YBFA 1O9HA 4GM0A 1YRYE 4N8EA 4DPKA 2V8OA 4E94A 3C3MA 1ZONA 3SOPA 3ZHBA 2V7GA 4HO1X 4JB2A 2WWFA 4OXIA 4CLEA 5HKOA 2OLEA 3QVUA 3EY9A 1VHDA 3LGAA 4G0QA 1GP2A 1XAJA 2PU7A 5I9TA 1EXMA 1F38A 3MXTA 1ETUA 4R81A 1DGQA 4IKPA 1SHZA 2PGIA 1AT1A 4LJ4A 1LQTA 5JSHA 4F93B 1VCNA 2QXUA 2WIBA 2ZWIA 3NC4A 5JI2E 5LU9A 3HK2A 2NSHA 1GA1A 1TLTA 2IYLD 4JQSA 2UU9B 1J1UA 4V0OA 5IBCA 2OGZA 4ZMBA 1G20B 1QYWA 2XADA 4EIWA 1NZJA 1G8HA 1YZFA 5CNIA 1EZZA 1ZD9A 4POOA 5MDHA 1BE1A 1Q20A 2FRXA 2X5NA 3WI7A 2NV2B 3R5HA 2P6OA 1K6JA 2R60A 2IYNA 2IXBA 3O2NA 4EATA 4MS1B 3OLQA 2HJHA 4CLRB 1EVYA 3OICA 1ZEJA 3GQBA 3ZZTA 4DWJA 2H1SA 2CXNA 1RDFA 1HZJA 2IUTA 5KSZA 1SM4A 5T7BA 4YCBA 5H3HA 2UUCB 3IODA 1RXEA 4OQNA 2UZ1A 1B0ZA 1C9NA 1NBWB 1QG4A 2W2TA 2XBUA 4L4UA 4C3OB 5K8CA 4TYNA 3QBJA 4W5HA 1H6AA 1RXCA 3HU2A 3DA8A 1MB2A 3LIIA 3ZDAA 4HQOA 2Z6UA 3E9CA 3FF4A 3H9QA 1PAUA 3B7WA 2AMYA 3RFXA 1ZFNA 3UOGA 2JFZA 3GFOA 4UD6A 4UU8A 5EKDA 4XFKA 4GQAA 4XDYA 5LYJB 5T3UA 5FO0A 4LW8A 1W0KD 2CEKA 2P8SA 3WO1A 3R6DA 4X61A 5FWAA 1F3LA 3KYIB 5A9RA 1KMHB 3ND7A 2FUEA 3S68A 4AZTA 4GKJB 2C9DA 1D1PA 1M6EX 2J09A 3E61A 4QPZA 2JJ2D 5BV7A 2PX0A 3EWIA 1O97C 2R6HA 3KSAC 4GKBA 1TU4A 1CW2B 3VNSA 1ZITA 1SBZA 5BW6B 3QK7A 4HWGA 2LW7A 5JDIC 5DVZA 1NVVQ 4XR4A 1RYZA 2Z95A 1KY4A 2R5FA 3PC8A 2OL4A 3PA6A 3RLIA 1SC6A 3EG5A 3PJFA 2DTEA 3SLRA 2WWWA 1P2GA 1J8FA 3D3EA 4B3IA 4Q4AB 3QVKA 3HN2A 3S2YA 4F9GA 4C06A 2UUPA 3DTVD 4YRJA 4D9EA 4JI7B 1NJ1A 4KNWA 4A36A 2C03A 2W71A 3NEPX 5GV8A 4AT1A 1J5XA 1KHHA 2A0YA 3R5XA 2QSJA 3IBCA 4KXLA 4MIKA 2PKYX 3VR2D 3LCUA 1U90A 2BGIA 4UCFA 4QG7A 5JH7B 3I01A 4PRKA 3LP8A 3CSDA 3W6OA 3FYUA 3OLZA 5TJ9A 1DVRA 1PNVA 5FL3A 2EFCB 1C0KA 3ZH2A 1M6HA 1UBUS 3UUFA 4KR6A 4B09A 3MRTA 4G5GA 4CDRA 2HRDA 1NRIA 3L4KA 3ZWWA 3QU2A 4YMGA 3EVEA 5MN6A 1AMUA 3D3WB 3O4FA 3LRXA 2O2ZA 4MYTA 4OP2A 4U4AA 1RAEA 1IIRA 2OR3A 2QENA 4IJ5A 4I6EA 1H93A 2O23A 1T5IA 3GDWA 5BVHA 4Q4CA 4NIMA 1YI1A 2JLSA 2RHJA 5KCMA 4DEXA 3DEIA 1PV2A 2E3JA 3LW7A 4OF4A 4ZAXA 4GU5A 5HPYB 3CRVA 2WBLC 4UEKA 4WZBB 3G7UA 4A1OA 3R7SA 4JYAB 4V24A 4UREA 3OCVA 5KQRA 1O5OA 3JATB 4RL6A 1ONBA 1UKYA 4GYKA 2VT6A 3ZWKA 4A0SA 5D3MA 3MJHA 4J1TC 4MKXA 2Y3IA 1YZVA 3WGKA 3MFQA 2GCOA 2P9ZA 1TX4B 1Z3IX 3KBBA 2GXUA 4FE3A 5H1YA 4BBJA 3A27A 2G1AA 2VDVE 1Z4OA 3IMCA 1LQ2A 3RU3A 3ILHA 3AGQA 1PV1A 3E22A 3NX4A 1N1DA 4G25A 4XLZA 3CH7A 2V59A 4DANA 4LOJA 4YRGA 2A58A 4AICA 1AQLA 4FN5A 2Z8XA 4E4TA 3U81A 3U80A 2O3UA 2HU8A 1TGVA 3ILSA 4J7XA 3S2IA 2Y1FA 3EJ6A 2XWSA 2HWXA 2WZBA 1CUGA 5DT2A 3ERCA 3BKWA 1M2WA 4AULA 3S27A 1AM4D 1Y8CA 2P2YA 3B70A 4G86A 4P4NA 2REOA 5DK6A 2G5GX 3I34X 3CGGA 3TIFA 4OH7A 4J4BA 3G49A 2C2BA 1ADBA 1KXZA 1W5EA 4RKRA 5AUNB 3IUJA 2VT3A 4G1BA 3FFXA 5K0BA 4NC9A 1KJJA 1A9XA 3AESA 4ERNA 2BLNA 1JYEA 2JBAA 2QP3A 3HKCB 3HZRA 5HE8A 1G3RA 1AO3A 3QEBZ 2H4XA 2ZRIA 3PYMA 4KFUA 4V03A 4BN5A 5FPPA 1G4HA 1ID1A 3WGLA 5E1DA 4B5LA 4DV5B 2ZIFA 4WEOA 1BX0A 3PLAE 3FLEA 4RVGA 1F4VA 2IUFA 1P5FA 3LHDA 2GCIA 4MW0A 3TLJA 4URVR 3GLFA 1F2UA 4EB8A 3NEAA 1R4MA 3RUEA 4ZYVA 1J33A 1M1NA 4BNDB 2OEPA 1RJFA 1NRWA 3NO4A 3DJFA 1AKNA 3GGCA 4ND2A 4KKXB 4ZXPA 3T5DA 2C8KA 4UTZA 3C8DA 3SZGA 3O93A 4RE6A 3M4JA 3A4NA 1XEXA 3KWMA 3A06A 3GLFE 3D6AA 3F5QA 1IRIA 2XIJA 3ONEA 5EIBD 2PZLA 2YZMA 3F9IA 4TL8A 4CIDA 1IMOA 1MH1A 3ZBPA 2Z43A 3VPGA 3KD3A 4B9AA 4ALJA 4BMXA 3C5EA 1JKJB 2R47A 1EP2B 1NTRA 3AZQA 2X4DA 2HUPA 2IFTA 5MN4A 3V8MA 4BQFA 1Q7BA 4WBNF 2M2IA 1KI7A 3B60A 1Z28A 3MWGA 1XGKA 4WOBA 2A1TR 2DHRA 2G88A 2WJWA 2VDKB 3VH4A 5JAPA 2AIRA 5G02A 4IH9A 4P9NA 5J5VA 1ZIDA 5E2AA 1JVNA 3FDZB 3KL4A 4WFQA 4KXQA 4RLFA 1QHHA 1MO2A 3T9FA 3VYSB 3PUWA 5IDXA 3V33A 5DV9A 2GWHA 1VYHA 2XDQB 4ZT3A 1EA7A 4IF4A 3PJGA 3D3JA 1XF1A 3ICCA 1OI2A 5T4FA 4A82A 1F1BA 3ZW8A 4LCBA 2UUAB 3T7TA 5HIIA 1J6UA 1Z8HA 4J0CA 3A2NA 3LQRA 3OOHA 3VC7A 2OZPA 4YCDA 4MAAA 3GUYA 3SCZA 4JSYA 2P4EA 4PG4A 2ODPA 4PLCA 1BW9A 1E3WB 4QYSA 1KE1A 3ZE8A 4CIBA 5AOBA 2Q5OA 4V3CA 4WZZA 4KO3S 1E9VA 1EJBA 1YVEI 1IQUA 1CQIB 1IEWA 2ETXA 2V55B 4Z0PA 2H0QA 4N0DA 4F6LA 4RNCA 1DJNA 1ONNA 2C2WA 2ZDQA 3OF3A 2W6IA 2X1MA 3TRKA 4R8LA 3TX6A 4KFRA 5LLSA 4FOPA 3EPHA 3HSKA 5IWCA 5K6AA 4C4SA 5EWLB 1OU4A 2G5PA 4CIWA 1HRKA 1S8NA 5DNDA 1W85A 1P0IA 1PR3A 3F5DA 4R2IA 4WKCA 4IDFA 4S3MA 5BSEA 1EIWA 2Q4RA 1HDOA 4EJMA 1KPIA 3DCIA 3I32A 3HB4X 4NDZA 5TV2A 4D0LB 1AH2A 4JXZA 4TXMA 3C3YA 5DJ5A 1O5IA 5BT8A 4YV0A 4EARA 3MUOA 3VI3B 3IO5A 1UBMS 2BH9A 2BUAA 1FK8A 1QX4A 5ECDA 3QMWA 4E31A 2EBFX 4CCSA 1CWUA 2IX9A 4C1BA 1YS6A 2XVXA 2KPOA 2JL1A 3LWBA 5IKXA 4QWMA 5CXXA 1HYQA 4JEMA 4XH9B 5CRIA 2JLRA 1AQUA 1E96A 2XKBA 4X66B 2PJUA 2O57A 2CL5A 2AJDA 1BVUA 3N58A 4JLUA 1IUKA 3H8VA 3IA7A 4M21A 3E6AA 5H5JA 5ALTA 5LNK6 1QP4A 1PR5A 3H2IA 5ER9A 1XYVA 1WZCA 5CFQA 3LUHA 4X91A 4ZOAA 1MEEA 2AQIA 4UQOA 4BMYA 1VG1A 3QOYA 2QMQA 2W2LD 1ECBA 3AVOA 2DBRA 4QYIB 2IX3A 2ZRHA 4DCGA 1ACJA 1W46A 3TAHA 4OD0A 2WV9A 1RHRA 2JGNA 1ULSA 4JJ7A 2F8TA 2QVGA 1FNCA 3JS5A 1I7NA 2IEIA 2R79A 3B9RA 4P33A 2Z2JA 4X1KB 1LWNA 3N0RA 1PS8A 1B3RA 5ESXA 3RVRA 3V4VB 4ARSA 5L3ZA 4MQFB 3KFVA 3SG0A 1YK0A 4LF4B 2AFHA 1Z16A 3PSHA 3G88A 3BD9A 1E63A 3PQ2A 3T3HA 3UK7A 4DXHA 2PA0A 4ZI2A 1WM1A 1W35A 5GOZA 3UMCA 1RZ3A 1FA9A 1QZUA 1ZN9A 3AK4A 2I6UA 2QHXA 3AETA 5C8YB 5K4HA 4FWTA 4W9NA 3FMGA 1Z82A 2ZUDA 3CCBA 3ZCXA 4BNUA 1ZMBA 1RC1A 1KRHA 2Q45A 3EOBI 4LE1A 2FEPA 1LRJA 4R8MA 1T43A 2NSJA 1DJQA 3VJMA 1KU6A 3ESDA 1IAQA 3WJ2A 2AFHE 4C88A 2IS1A 4BN4A 3V1NA 3INNA 2FW7A 2NU6A 4DMUB 3B5EA 4Y6QA 4YAEA 1BD3A 2R7MA 3EY4A 1L4UA 3HMKA 3BJMA 1A7KA 3KKEA 1IWPB 4MWDA 5KTRA 5A5DA 4OK5A 5DX8A 2VYFA 3TAUA 2ZTMA 3CCCA 1ZVJA 1U0EA 1V9LA 1Z7EA 1IDOA 1MB4A 2JIZA 2Q28A 3L43A 3QVLA 4FGWA 4PANA 4W63A 4EG4A 2DP4E 3F1KA 3SEQA 3WWEA 1PVOA 1KYZA 1OIVA 2DWOA 2ZQ5A 1GXSB 3PQCA 4E2FA 3BMCA 1P1CA 2C5HA 3H3JA 4DDUA 5AM5A 1TIKA 2CZCA 4E15A 5FUMA 1JEEA 1U5BB 1E2KA 1A4UA 1TT7A 1VXOA 4B44A 1NNLA 1VGRA 2F8SA 1BEZA 2YFQA 1EDDA 4HWTA 1R37A 3HYLA 1YRWA 2R6JA 4G4IA 4MLPA 2X8BA 1F9EA 1KK0A 4WVLA 4GC9A 2XWJI 4LHSA 1M2OB 1R0KA 3WLPA 4BQQA 2W6NA 3KSRA 1EFHA 3AW8A 1UJ2A 4PR0A 3AG6A 5BN3A 1NUHA 2OBYA 2H16A 5IK2A 4B4DA 2GBCA 1U6JA 1G5IA 2DMRA 2Q6VA 5KSOA 1DC4A 1SD1A 3D1LA 3VR6H 5LXTB 1Z35A 5I8ZA 3B51X 3CWQA 3DZBA 4AJHA 4FXOA 2X3UA 4YTEA 3F98A 4E5UA 3NHPA 3RS0A 4AZ0A 1NMXA 3ZU2A 2AJCA 4ENQA 2GBGA 4DDTA 1SVNA 3D8SA 5FBLB 1J21A 4KQ1A 2XNJA 1IM8A 1FJGB 4L5AA 4Q93A 1FNBA 1UPXA 1XZMA 2X58A 3VU9B 3RFCA 4KVFA 5FB3A 5L7TA 1ISSA 4UBOA 3BF7A 3OEED 4GEGA 4DIKA 4LV8B 4C9BA 2G4CA 4KQIA 2JIMA 4TWRA 2CFIA 3MG9A 1FU8A 1OPXA 4A4DA 2RMKA 5EQDA 5B6JA 2QUKA 2O7RA 3UG6A 4GE3A 4Z99A 1I30A 3E7FA 3IEPA 3P97A 4YJHB 4X62B 2BZ0A 4HAIA 3WOVA 1GZDA 3QOXA 2F1OA 4JELA 1FRNA 4BUZA 4RD6A 5HRUA 4F3TA 3EFHA 13PKA 1CLUA 3QVOA 1GTZA 1TYAE 2Y2UA 4WFJA 3KSBC 2ZWAA 2EWWA 3ZHCA 3UJDA 2X7XA 4LBWA 3S5UA 1XU9A 1C3VA 3IKLA 1FYEA 1D9ZA 4ID3A 4KE8A 5IAGA 1OZAA 1E2LA 4Y0VA 3SAJA 1N1MA 3SS7X 2NUAB 3PNSA 3RT1A 4ECEA 2AT1A 3E1SA 4I08A 5KHLB 4RGQA 2ZTHA 4EP1A 2NPIA 1T9DA 2X9NA 1WBDA 1TL7C 5IX8A 1DARA 3KZKA 3WO0A 4GEKA 1RRKA 2BHTA 4PO3X 2NSDA 1U7ZA 1U0FA 4NZ9A 4B80A 3MHTA 1Q3TA 2O3SA 2LTAA 3MA0A 4X8HA 5GAJA 5BMVA 1HSOA 2ATVA 2EJTA 4KVGA 2PDAA 4RV9A 3UF0A 1XZHA 5HGXA 1TEHA 4FBLA 5HBRA 1QBKC 4UUQA 2KBEA 4GLOA 1QNLA 1YONA 1AZWA 4HJRA 4JLAA 2DUUA 2F4NA 1ZKDA 1WV0A 3N2LA 1CR2A 3G2NA 3PZRA 2OZEA 2X0RA 1PI3A 1BRMA 1CE8B 4FB5A 5IKMA 2OCIA 2RH9B 4LWZA 1L5GB 2IOQA 3A1TA 4P4UA 2QN1A 5B1YA 2XTZA 3SHFA 3WJ1A 1UBEA 1QCYA 2RGYA 4X3PA 3OIWA 3IXQA 1VKZA 4EHAA 5CBPB 2F3UA 4GPIB 4I5FA 4JLPA 4ZT5A 3GCXA 3FX2A 4O29A 1TT5A 2OKCA 3P52A 5F3DA 1NOJA 2DECA 3DSRA 4FGUA 2EX1A 5E7QA 5B58T 1TVCA 2FUG6 4OJQA 3TTVA 3YASA 3WQBA 2WD9A 2C4VA 3X2EA 3QITA 1MFZA 3KT8A 5LB2A 1M54A 2HN9A 2HSDA 3MS4A 1L5SA 3PNLA 1PHPA 4IV5A 4MCHA 1ZSNA 2BM9A 1D7OA 5JNRA 2Z5GA 3NHKA 4UEJA 3UHJA 3ZGNA 1Z6AA 5JADA 1RPNA 4KUEA 5IG2A 2C5AA 3N9IA 2JFOA 1T1GA 4CF7A 5J4HA 4OYRA 1V37A 2PKQP 3HDVA 1D4AA 1MVNA 1D2CA 3WRXA 4EL0A 1SG6A 4TQGA 3ZYZA 3ZD9A 1RXUA 4GX2A 1TM4E 3NOOA 1ZZEA 2NXCA 1FNMA 3GFRA 3KALA 4OHWA 3EXHC 2EW1A 5TMDA 5JFOA 3DYVA 3EZNA 1VLJA 3BMQA 3H7AA 1CVLA 3IQZA 3KWLA 4HLUC 1LVHA 5LOVB 3ESZA 3ZWCA 3EGOA 3D0KA 2B4RO 4RAQA 3KJGA 5IAOA 2X4GA 2BM8A 5FI0B 3H18A 3TQRA 4KYTA 4J7AA 5L3RA 4ZVMA 1Z0SA 5IC6A 3LUPA 4LY9A 3PKZA 3R3JA 4CLHA 4TV9B 1WUHS 1PGOA 1HT0A 4P3XA 3ITDA 1NT4A 1UK8A 2JK0A 4J16C 4FHFA 4X85A 5EJFA 5F64A 4G4SP 1HL3A 4TMYA 3IEMA 5J3JA 1U9IC 1J2UA 2Y8EA 1P6QA 2P41A 2XGMA 1QKKA 1KO7A 2VCHA 2B1RA 4BJ3A 5KVAA 1AZLA 1GLGA 1PJ2A 2I78A 3T4XA 1M2NA 1J5PA 1TI7A 2XJ9A 1E61A 4S35A 3W5IA 5JSFA 1SCQA 1VIVA 4TMWA 3JVVA 3S99A 4AYWA 4O0LA 4JLNA 5J2UA 1MZVA 3DDOA 2B99A 3AUJB 4MUEA 5JDCC 1SC1A 3W5HA 1N7HA 1AUVA 1J0XO 2OBXA 3AR6A 1FUEA 3G0BA 4L4RA 4L76A 1NUQA 2YHIA 3OZVA 4NF2A 2XA1A 4XGIA 1CYDA 1G5HA 5ECYA 1NR5A 1ORRA 1W4ZA 1C9KA 2RK4A 5LYJF 3G0IA 4REOA 3DT9A 4X20A 2GBIA 2JDID 2O0JA 1ZD3A 3TD2A 3S2FA 3FMIA 1GNLA 1YZGA 1PDWA 2RC6A 4E46A 1RAHA 4EUHA 4ZEXA 4NZOA 4MEJA 1XJWA 4XPZA 2QN6A 1NXPA 1YR9A 2FEWB 3D4NA 3H11A 3R6WA 5EP3A 4WKBA 3OZFA 1M72A 3ADOA 4U7HA 5FJJA 4H3SA 4ML3A 1Y8QB 3VPSA 4RU1A 3D4IA 3K0HA 4B40A 3WV4A 4PZYA 3NYIA 1H2BA 2GPWA 1FTNA 1WUIS 3MTQA 4GH5A 3IOBA 5CH5A 5WRFA 2J5RA 3PI6A 4INJA 1GKYA 3P9YA 1FLAA 4OJNA 2HC9A 2I3AA 2JIOA 4LV6A 4R9VA 3GY0A 4A10A 1IWBB 1G60A 3AVWA 1H6CA 2ZJ7A 4YPFA 3W3AD 2D7CA 3GLGA 1CCWA 1RM4A 2O5RA 2QR3A 4LXQA 5GVRA 1LFAA 3EXIB 4PTLA 4AJOA 3RUAA 4FCWA 1O6CA 2JGAA 4RF3A 4KUHA 3TEJA 3ABQB 3PNYA 4INOA 4HTAA 5DTMA 4JSRA 3VH1A 4RGYA 4JBYA 3KSUA 1W73A 3RU7A 4CETA 2VQDA 3KHTA 1SEPA 2DE0X 5HRCA 4Y1RA 1OXUA 2H0AA 4ZD6A 3ROTA 2GYWA 2OCXA 2A3NA 1SC4A 2ZSEA 1W0KA 4PZZA 1UL1X 3TRFA 2CK3D 5JH7F 1PLJA 2NN3C 1XYGA 2F1IA 1WQ4A 1D9XA 3DBVO 3MCVA 5AJYA 3FI0A 3JYOA 3S28A 4AJ4A 3GLGE 1TKBA 2IKQA 5EWMB 3BREA 1JG1A 1FVFA 2WWHA 1EE9A 1R50A 3JPWA 2QU7A 4P80A 2JJ2A 2V03A 2QU8A 1E62A 3DV2A 3Q2IA 1UDAA 1R5OA 2R7AA 2Y1CA 4NBLA 3R3WA 4MW9A 1Y4DE 1TM3E 4JYMA 2II6A 1K08A 2WAMA 3TPFA 2QUIA 5DCUA 1DWOA 5HF8A 4OI1A 3SEFA 3PE6A 3WLEA 4DLPA 2ZT6A 1FS5A 1QBGA 2FSVA 2HSGA 1S4QA 2A35A 4UAVA 3FNEA 3WSWA 4HLDA 1PWEA 2I80A 3E9ZA 2J5XA 3FPEA 4ICIA 4IIHA 5JXJA 1DRWA 2HK9A 3P2JA 4U2GA 1TU3A 3QENA 4RH3A 4Z8YA 1CBUA 1JE0A 1KARA 1OZGA 2IEDA 3GFSA 1YJBA 1KMIY 1Z6QA 1XEWY 3AC0A 4LQCA 4Q6WA 1PWZA 5CNMA 1JHDA 1UFRA 3ROEA 5M34A 1TCUA 2W4IA 3DTVA 1RAAA 5K20A 2H7CA 4P93A 3OIDA 4TXNA 3WFZA 4B79A 3OFKA 1OH8A 3T9BA 1IZZA 3VR2A 4C0SA 1ZK4A 3FG9A 1S1MA 1NJGA 1PJLA 2PUBA 2QBYB 1YDEA 4CTJA 2H1OA 1OLUA 1TTPB 4L0QA 4OIFA 3RF7A 4XUEA 3IBSA 3KKPA 2O2SA 1UPAA 3BIOA 3CLRD 3CINA 3GWGA 4OBBA 4IMIB 4D9NA 1U6IA 1ZOSA 3ANTA 1YDHA 1UDWA 1XE3A 3EVNA 1RKVA 4LDZA 3KDAA 3RC2A 2I8LA 4EX7A 2DBQA 3KJNA 2GJ4A 1RI3A 2C88A 2REBA 1GZ3A 2HK8A 1I5EA 1E77A 4JL6A 3RB8A 1S96A 1VE1A 3DM9B 3URMA 1BZYA 4B32A 4AAYA 5JAMA 2GPYA 1X6VA 3K9QO 3CRRA 2I03A 2J46A 3VMMA 6Q21A 5F35A 2H8KA 4JYBA 3GMSA 5C7OO 2X9QA 2ATCA 2RBKA 5DOVA 5EP2A 3A3PA 3Q5GA 3REQA 2ZVDA 1L4MA 1PBNA 3CLTD 3QQ5A 4LJ9A 2C7OA 3E0QA 4YS6A 1V11B 3B53X 4MQMA 3HY4A 4LN1A 5EIFA 1KFKB 4B8YA 5I9LA 1FFXB 2NO4A 4EUNA 4BO8A 3SXPA 1DXHA 4PG5A 2JCYA 1W88B 1Z2DA 2I6QA 3OIUA 4YN3A 3R7AA 3LTEA 1M73E 2QTVA 3KSZO 4EJSB 2GBLC 4RABA 4EWLA 2CN1A 2XTNA 1S2LA 1ORDA 1XZEA 3QYJA 4P86A 2CNWD 2LDBA 4Q15A 5IM4A 2PKEA 3BWDD 3I9OA 3Q3IA 1UP4A 1QG0A 1VSUA 4IICA 3E3AA 1AHPA 1JJFA 3JTEA 3WK9A 4C0WA 4MKRA 4BV8A 1JG4A 3SE0A 1UBFA 1OA0A 5P21A 4GDMA 4FZRA 1MABA 3VNAA 4EW6A 5HZHA 3ZE0B 4A6EA 4UM9B 5JNTA 4BWGA 3IBFA 1HKHA 1VSTA 5FBKA 4RHTA 2EHDA 3DLPX 1L8XA 3CLSC 1R7RA 4JL8A 4MO9A 3CVOA 4C4OA 5KEIA 3D2AA 2GD6A 4GYYA 2OD2A 3DVAB 3L1JA 5C35A 1DC7A 3V4PB 3ZJ4A 5DGCA 3BD6A 2PY6A 1H2YA 3UY4A 1MOSA 3RVNA 4Z4IA 5SZKB 2I3DA 1XR3A 4R8RA 4ZCRA 2RGWA 3NVKI 3AF3A 1P45A 2YZ2A 4LWQA 4E7OA 4CQNA 3HO6A 3HCBA 3KOMA 4ZV4A 1Y7LA 2PNJA 4L28A 4M53A 1KDTA 1WSWA 4EB6B 4Y2HA 2FMFA 2O0LA 4MUJA 1CUHA 3TMYA 2DERA 1I3NA 3GPCA 4H08A 3IPXA 1UK6A 2FP4A 4M1MA 2Z09A 4JMLA 1EWKA 5ERGB 2C58A 3DG9A 1JLLA 2O8DB 1AKVA 2V3VA 3UWPA 1K5GA 1E9CA 3HU5A 1T9KA 4CM1A 3OPVA 4BRWA 2SCUA 4OBWA 5HWSA 4UBNA 2IC5A 3WMWA 1HFKA 2O5VA 3T9EA 3TZQA 5KMGB 1I6LA 4J3NA 1QGYA 3VR0A 1HQKA 3N39C 4YFVA 4IIDA 2QRVB 1UOPA 1GV0A 3RSGA 2VHCA 1DPGA 2IHYA 3P20A 3MPUA 5BR4A 4HMPA 5KI6A 4IFEA 2IWHA 3NM4A 1UKBA 4XRRA 3HXQA 4EGAA 1NTOA 2GPJA 5BO5A 3KXDA 1NXTA 4PVCA 5KU7A 1Q0TA 1OILA 2PGXA 2QYTA 3KS9A 3RUCA 3GGGA 2YXNA 3ZV7A 5KVSA 1A5AB 4ND8A 3QWAA 1IZYA 2QM3A 4R3NA 1AQIA 2RAFA 4MYSA 3U3JA 4D0SA 3OZ7A 2NIPA 3PPIA 2PRZA 1RJ9A 1KPHA 1GPUA 5D1HA 3CBGA 5FTNA 4I19A 4MP8A 5ICEA 2WP0A 4H7EA 1FNDA 3BIJA 2ZIGA 1PX2A 2EP5A 4O1IA 3RROA 5BPHA 1P9WA 4KV9A 3M7IA 3TTWA 2NNLD 3DDSA 3CW2A 3GU3A 2EF1A 5IUNC 2Q6KA 4U9UA 1Z06A 3B7PA 1P7PA 3SX4A 1LK0A 1FCJA 2JARA 5BQ3A 3G2IA 4NRDA 2NVUA 2Y1DA 4A9AA 4EQZA 1R4NB 4I36A 3LM8A 4D8VA 4NYMQ 3ZJTA 2ZRJA 3Q7PA 4O2AB 5IDQA 1I3CA 4MZDA 2CDRA 3TLMA 1P9NA 3P0HA 4BVJA 3UATA 4OLJA 4ZTBA 4WY5A 1R1DA 2HF7A 1IULA 5B4TA 4WXEA 3KD2A 3SJ7A 4K6CA 3JWHA 3L7JA 3T6KA 1Z63A 4HAVA 1JF8A 1XCLA 2GH1A 3IAFA 1ULZA 4MV5A 3GGSA 1OXTA 4R8VA 1JV2B 1VMKA 4JC8A 1FX0B 3MOSA 2XVZA 4UJ3A 4FYKA 1WXHA 1LXCA 1RHQA 1PJ4A 2FWNA 3AY7A 2NUTB 3D1JA 1DXQA 3KLNA 4LYYA 4X41A 4ZV9A 1LDMA 5FQNA 1RLMA 5P8WA 4JI5B 3WWDA 1A5BB 5JJCA 3RAPR 1BHSA 3LA8A 5AI0A 1P2BA 5JYDA 1YA6A 2WNIA 2YYAA 3F74A 4ZCLA 3FOFC 2YXDA 4FYWA 4KR3A 3WBBA 1V39A 5D84A 1AU9A 4WNAB 2QG6A 3T95A 1I2ZA 4FK8A 3HA7A 3GLHB 3UJ6A 2A9QA 5FPYA 4RKQA 3E05A 3FH0A 1NW8A 4IXNA 5DMHA 1X87A 3VZDA 4G0XA 4IFTA 5AKIA 4PHTA 1R18A 4YMLA 2YY5A 5C8YF 2HMWA 1EGVB 5HM6A 2VZEA 3THXB 2H7VA 4L02A 1M0TA 4A8PA 2QX9A 4NCIA 3NRCA 2YJ5A 1QWSA 4JI4B 4IGEA 1U3FA 2C2MA 1YVUA 2CHEA 5F5XA 1JU4A 3CZ4A 3INTA 4KAJA 4TYMA 5JLJA 1XZFA 1NF3A 3KLMX 3ELBA 1FYFA 5BYBA 4DLRA 1SR8A 2AMVA 1TJ5A 4JT4A 4E21A 5IABA 3TOSA 2F90A 4R2XA 4GOJA 3T35A 1PE0A 1US8A 2W2LA 3KYCB 3V1UA 3ZXSA 5LL6P 5K8UA 2FPUA 4BZQA 3KCNA 4HGNA 4UNPA 1UH5A 4LDQA 1PEDA 4Y2RA 3GT0A 4UUMA 1F8XA 2LKCA 1V3VA 4RLHA 1ZUNA 2VDQB 4R1NA 4L57A 5BWCA 5A1JA 1SXJB 1J1ZA 4HDMB 3LBHA 1X92A 3E58A 2VAPA 3L4EA 3PI7A 3EBPA 3IDOA 4G07A 4PZUA 4Q66C 1YVRA 5IVIA 1RE1A 4EZIA 3PHHA 1YHNA 3GCZA 4J75A 3MS7A 3U7HB 4OMDA 4RPHA 1XZCA 1KVQA 4FXPA 4PPFA 4G0VA 3GGJA 4KPYA 3TXAA 3WK7A 5LXTF 4AO7A 3OHMA 3TOCA 3NGLA 5AI5A 5LDGA 4LTDA 4EG5A 1G19A 2BFNA 4KEAA 5EZYB 3MLAA 2BP7B 1SU6A 5K0SA 1QS0A 1PZGA 2RGGA 3THOA 3I0MA 4KAXA 3BMXA 3MHPA 4CMHA 3H6KA 1Z29A 4K88A 4PQFA 2NV0A 2VZ0A 4D9BA 1PWHA 1CZHA 2D0IA 1SUEA 2DLNA 4EFKA 2UVPB 2IIVA 2Q4DA 1GQRA 3R41A 4Q3DA 1VTKA 1W29A 2BWJA 3L05A 4PSCA 4E12A 5AXCA 4LHVA 2C1XA 5I5EA 5AI8A 4FP9A 3DM5A 4CFYA 4GRAA 3HB1A 5CURA 2C1EA 2WK1A 3FLMA 3VGJA 4Q5IA 2VJQA 2ID4A 4R98A 3VR3A 4DARA 5L3QA 3EGCA 2DT8A 4OJYA 3WNQA 4DXDA 4Q1EA 1ZN7A 4BB6A 1RRMA 2AR7A 3FCUB 4IIGA 3B9QA 1I0LA 2XY4A 3QVJA 4N5HX 2GZDA 4KXUA 1FUIA 5IH3A 1VYTA 4MNTA 2HLNA 1P62B 4BVHA 5JEDA 4QQRA 2RGUA 2H4ZA 2FVYA 2ZB3A 4E6PA 3QKWA 3IE0A 4JI6B 5HMLA 5HUJA 3CKKA 4D92A 4AIRA 5JPIA 4PSKA 2PFGA 5DNVA 3W04A 3K1YA 4JUCA 2NUBA 4PLWA 1GKIA 3MILA 3OEEA 5LZ5A 4ARAA 4BPRA 3E82A 3VAYA 4REMA 5HFJA 5JCJD 3S1AB 3OPYI 1V4VA 5M7EA 3Q2KA 3A6HA 3GZTB 3TNDA 2OCLA 1JDPA 1U1DA 3ASZA 3DF9A 3LQQA 4MRMA 3LSTA 2VT7A 1L5LA 3KETA 1SD5A 2O1WA 2AJTA 2R6FA 1PGPA 4D8UA 5JPDA 2Y0PA 4LCEA 3ENNA 1EZ1A 1LY1A 4TMTA 1C7QA 3M9WA 1XMSA 1N57A 1IC6A 1EX9A 3HUTA 5K0GA 4ZI7B 3R5SA 1ODLA 4FZ5A 2P7HA 1Z7BA 2YX1A 3B82A 1U0NA 1UBHS 2BY4A 2AZDA 2JCVA 1N2IA 2DF8A 2DX7A 1TK2A 2F3TA 1VL1A 2FPSA 3A28A 1ISMA 2JD2A 4YT5A 4XM0A 3TN7A 3DE0X 3JD4A 2HF2A 4DNQA 4DZZA 1K97A 2P6RA 1GG2A 3SR4A 5AW9A 4UE6A 2ECFA 1Q77A 4DLYA 5LVAA 3TR0A 1T13A 1RP1A 2CXSA 3LE8A 4CG1A 1Y5MA 5B6PA 1MAHA 5BQOA 3R9IA 3TH5A 1AKQA 1USIA 4C0QC 1Y8AA 2J6BA 1YDFA 1T9GR 4L5JA 5JNWA 2RKBA 4KPEC 1C7EA 1KVTA 3GJRA 3PUIA 1WOYA 3TCNA 2OCGA 3CPEA 2BBTA 2CF5A 3AM4A 3D8RA 3TLYA 1KC1A 3SP1A 4KQJA 1DMSA 3VZPA 1TUIA 1I4LD 2FRDA 2GUGA 4MZXA 2GNPA 3VO8A 3WKCA 2Q1XA 1BCSB 1LDNA 2HHJA 3TB4A 3ZWPA 9MHTA 1ZM3A 4D97A 4CLRA 4XGRA 3RUIA 4C6TA 1N6LA 2LXNA 5AO9A 3IKMB 1NASA 4HS4A 1JA1A 5LOVF 2NQ8A 5JJLA 5EC8A 2A9JA 4A1FA 4J43A 2PPLA 3EVCA 3IYLW 4X3CA 4EY4A 2B5VA 1PIWA 2IKSA 1U04A 1DWQA 5BYJA 4NG4A 4CQLA 4UJ5A 2G5TA 1MHPA 3H7IA 3EVFA 3VZBA 4L5YA 3VR5D 3IHTA 4X5OA 4H31A 5JC1A 1OGIA 4H7KA 4TV9F 1XZNA 2VJBA 1WO8A 2Z8YA 3Q6MA 1Y3AA 5AI4A 3LY8A 3IPAA 3T9AA 2H54A 3VSAA 4AUMA 2OBNA 3BA6A 2XXJA 5U1PA 5DP2A 4KWIA 4TYWA 4IKEA 4JBXA 3CFYA 3EG9A 4JVMA 4DNOA 2HWUA 4GUAA 3DOEA 4AJJA 2I22A 5JS7A 2VRBA 3ZGZA 4CKEB 2H4HA 3DO6A 4JI1B 3LRPA 2UZAA 3HXOA 5EHNA 1BMDA 3CZQA 4OB6A 3AHIA 3E9DA 3JZIA 4BIIA 4BLSA 1VE7A 4OJKA 4UTOA 4JI8B 1YZLA 5CEJA 4TV8B 4U9HS 3RJ5A 1J39A 1YQDA 4FSDA 1DEKA 5KTTA 4AJNA 2HYDA 1L8QA 2YYYA 4Z49A 1YMUA 1Y42X 1XUOA 1AGPA 1MP0A 3C3BA 5CB8A 2P1DA 1T35A 3DLAA 3NU1A 5FDFA 1ZYUA 3BGOS 5CAEA 3Q9SA 4QEKA 1IU9A 4QOSA 1CS4C 1VL0A 4BVFA 2DPXA 4LRSB 4CKCB 1WLYA 2Z4RA 2P68A 3OJCA 4UCXA 1P8JA 1QQAA 1RI4A 421PA 2VDPB 2YWRA 1QHYA 4Q4AA 2I2BA 2I4TA 3MQ4A 4O59O 4YP6A 3MTGA 1QVVA 4LNUB 2ORIA 4OB8A 2AZ4A 2XITA 1MA0A 2BFWA 3H5AA 3LOUA 3QVVA 4FZ3A 4JEIA 4K9LA 4NCHA 4P92A 2QAIA 5F21A 1H1DA 3X2FA 3JW8A 1CPYA 4UFPA 1I9CA 1PYGA 4RV4A 3U3XA 1I5OA 3NHSA 4D9JA 3CUEF 2JRLA 3GDHA 3MGCA 4NK5A 3M6WA 4R41A 1PG5A 1XBTA 2XCLA 1T5LA 1YCGA 3ER8A 2VHQA 3U0BA 1KEZA 2DWQA 3DFIA 4EHFA 3L8ZA 1FFAA 1UINA 1WXIA 1KC3A 1Y37A 1PT7A 2RHRA 1BS2A 2WIJA 3I92A 3TQQA 1KJWA 4ENVA 2UZ4A 1J0CA 1H0HA 2G40A 1KH2A 1PYOA 1O08A 1S9DA 1IIBA 4BO1A 2YUIA 4KQEA 3HDYA 3D3WA 1YRLA 2VH2A 3WBKA 1NE2A 1XCMA 2JDIA 3DONA 2BMJA 2WLSA 4L7VA 4DIDA 3D3KA 4D99A 2JEYA 1O95C 1VLZA 1AMNA 5I7AA 1KFBB 1N0HA 2AMLA 2VNSA 4MLDA 2GJAA 2Z83A 4MA4A 3SC2B 3AQ4A 1JX6A 4P31A 3VKHA 4O25A 5B1EA 3V42A 1QOZA 1PFVA 3FNQA 4EKEA 4WESA 3QJGA 1OZ0A 3VHLB 4I5IA 1C7IA 1P4JA 5DF1A 3CF6R 4GECA 5DNUA 1HMPA 2NSLA 4DMGA 5I5GA 1MIOA 2XCUA 2NSYA 4G5QA 4JENA 5EAIA 3ER6A 4AYXA 1JPNA 4FLMA 3A31A 4HJXA 4U3JB 4U2DA 5I51A 1OXBB 1KQPA 2R66A 3EWNA 1LLUA 1P77A 3BH6A 4KO1S 4PXAA 5J5CA 2GTIA 4MX8A 4YBRA 4B35A 5AM2A 1S3SA 1KXJA 1RMQA 3HH8A 1B26A 2IU6A 3VOBA 3O47A 3VC2A 3BTOA 2R1ZA 4MV0A 2NXEA 4NTZA 3A70A 4QOHA 2VJOA 4IG9A 5AW2A 5IJ9B 2ZRKA 2OAQ1 2YINC 3TIIA 1T0UA 2ESRA 4S1TA 3RSFA 4UDYX 1DCTA 2HMYB 2ZYSA 3V46A 4RMHA 4UM9D 4KIWA 1EBBA 3V7NA 4X9XA 1LV8A 1RD4A 2OXIA 2F7SA 2C7QA 1ZA2A 1YDWA 3W8RA 2ZDHA 3LDFA 2X7HA 3MWYW 4F96A 3G2HA 4BO2A 3MTDA 4MUMA 1KDYA 2AI2A 3BCSA 3P9NA 3W1EA 2WMDA 5T8KA 1OLSA 4K86A 4QFMA 3CT6A 3IVXA 3C98A 1FE8A 1I3MA 3HKCA 2RBEA 1DC6A 3N76A 3TZCA 1NJ6A 1ZJYA 2CXRA 2PGOA 1N8TA 2DCUA 5F5NA 5AXDA 3FTPA 3I76A 4MUBA 4ZIRA 4PNPA 2RH8A 4J7CA 4ZO9A 4J0DA 4X90A 3S2ZA 1Q1QA 2A7QA 2TMKA 1GQQA 1SHLA 4UM5A 3GJ7A 4ZAYA 1KY2A 3W2TA 4EEZA 2OA0A 5EQJB 4GD3Q 2GAJA 1NR1A 2EJCA 2IQIA 4BU1A 4OQXA 1W2GA 3L8DA 4DADA 2IU0A 1GZSA 4K6FA 5HOQA 2ERCA 4ZHSA 5CYPA 2MOKA 3V9PA 1NRXA 1Q7RA 3ADBA 3VZSA 2BR4A 1LD3A 2WSIA 3V1LA 3P9RA 4BVKA 1J0EA 3PENA 5B57C 4MGZR 3AP1A 4AL4A 4CTOA 3MLEA 5CP8A 1XTRA 5EFOA 1JKJA 1A9QA 3DZJA 1IZ9A 1G21A 5B7GA 1XLWA 2HV8A 4L8WB 4Z9XA 2QL9A 2XYQA 1CR6A 2HA7A 3L0IB 3LCMA 2JFQA 4LJYA 4LF6B 3DDHA 1GOTA 3OKCA 1VYVA 5K8LA 2WWGA 1TYDE 4NI5A 2VXYA 3OEWA 4JBWA 3HYNA 4DAOA 1P7ZA 1BFUA 1SWWA 4RFVA 4RX1A 3FTFA 2OFWA 4NBWA 1R10A 2CLHB 2GUWA 3IESA 4DR1B 4R2HA 2NP7A 3TZ6A 1SUWA 3UEOA 1QIJA 1V3UA 2VF8A 4JC4A 4ZQGA 3FMOB 3NT2A 2E4ZA 5A5GA 5DMXA 3JWEA 3C8UA 3GDOA 1O3YA 3K2EA 3KAPA 1WX1A 2I71A 2V3WA 4L0MA 1LJLA 4K1XA 1TO6A 1UJ6A 2FPOA 4AFNA 2ZXEA 2CNWA 4IQGA 5GV7A 1V9CA 1E3WA 4EK9A 3KHKA 4DA6A 5A4MS 1LH0A 2QXYA 3U3MA 5EMLA 3U9TA 2CUTA 2JH8A 5CG2A 2RB4A 1CQIA 1MMFB 4HVAA 1XMIA 2CLCX 2NZ2A 4JK3A 1NP7A 1Z6TA 4BFCA 2H31A 4LBYA 4Y18A 3VVMA 3UB3A 3W7VA 2XYGA 5KNCH 2FKNA 3HB7A 1BE6A 1ZK3A 1VMDA 3LOPA 4URUR 5F52A 3T5AA 2QA5A 1I94B 1XA3A 2J6HA 2R6GA 3AHJA 2UYHA 4NL4H 2ZPAA 3OZTA 5JXIA 5KTMA 3UN1A 3KJFA 3W8DA 4GDFA 1NXWA 1PK9A 1YO6A 1DAKA 1NOIA 3DAHA 3CS3A 3HKEB 4EJ2A 3R8CA 1C0PA 3O4HA 3FJ1A 2ZTSA 1TQ2A 3VFDA 1XK7A 4IIUA 4PPQA 4Q3EA 2P8JA 1E99A 4IHJB 4KRGA 2CL6X 3WYFA 1DJOA 1GNRA 2J3KA 4QNNA 5FORA 4BKQA 1DOZA 5AHOA 2TMGA 3VPDA 3K0BA 4RKEA 3CW9A 4XIGS 4CUKA 2ZJ5A 3OU6A 4AS3A 1VKHA 4CEIA 3FPAA 4OYHA 1RJGA 2NVOA 4RNDB 1JU3A 2OCYC 1GZ4A 2G9VA 5JNUA 3ROFA 1GARA 1YI0A 5L4LA 2HMAA 3SR3A 5JMPA 2I2CA 1R5BA 4OH1A 2BDTA 3A6GA 5CTJA 1VIAA 2XLBA 2EP7A 2YHSA 2YWCA 3ZJUA 4A6DA 1DX9A 2FW6A 3PKIA 4ZT2A 5D3ZA 3M5CA 1ZX1A 4EW2A 2JFGA 4EHBA 3ZTTA 4LRYA 4Y67A 2A1UA 3TVDA 4IEEA 4B83A 2XE8A 4EMUA 2JGLA 3EXG1 2IYSA 4RTSA 2IBMA 1BN7A 2Q2QA 4HC4A 4QYIA 4I8XA 3LK7A 4O2AF 3TSOA 5A5EA 1DX4A 1Y9JA 3GFQA 2VC2B 4HNGA 1KK3A 4MQBA 3FZEA 4QDOA 2EKLA 2VAWA 4RGBA 3UXHA 1OTXA 1ZL2A 3H5OA 1H2ZA 3N2KA 3PEVA 4WXMA 2YCBA 4X1KA 5I7UA 2IY9A 1J20A 1TUEA 1AUPA 5IANA 4XOUA 3V1KA 2I65A 1VA5A 5KYXB 3T5TA 2WE8A 2D0OB 3QE9Y 4YPOA 1DCMA 2WHYA 4YQFA 3RLFA 5C8YA 2CFSA 1TPYA 1B76A 3B3QA 4HLCA 2OBMA 1NATA 1QIDA 1BEEA 1RS0A 3TOZA 3ZUGA 5LZ2A 1T9CA 3NBZC 2NAFA 2I2FA 2ZE6A 4H0NA 3CWZA 2EARA 5KWIA 1L5VA 3TTUA 4UBIA 1N9ZA 1Q1ZA 1RRGA 3C1UA 3CNNA 4JZKA 4MQLA 3ZU3A 2AA3A 4FEAA 4JWKA 2X6QA 2XNSA 3CEJA 2BFDB 3PGMA 4BO7A 1MDFA 3BGIA 4R51A 5D3KA 3U48A 5K8TA 4ZU1X 4JJKA 5CB4A 4NV1A 3LX6A 4PYLA 2OORC 4EAQA 3HKDB 3LGXA 4LOIA 1YR6A 4GSYA 3E2PA 3N7TA 4G0ZA 5K03A 2Z08A 1AZSC 2XX3A 4RJJA 3BHMA 1GXSA 2HPZA 4RW0A 2FFBA 4D44A 5AI9A 4DPMA 3PL5A 1RZVA 2B4AA 2OK8A 3U7GA 2CKDA 3O4GA 2DHCA 1P1BA 1NSYA 2VJCA 4IVRA 3EK2A 4PS1A 3HVIA 3G89A 3G6WA 1M2OA 4PO1A 1G1MA 2FPGB 5B3KA 5ER6A 4ZTZB 1PVVA 1X42A 3QE4A 4TZKA 5CT4A 3R5FA 1DELA 1PG0A 1JW9B 2FEAA 3DHYA 4E0BA 1VBNA 1ZVVA 3QPBA 4H60A 3LHIA 1EX7A 1SC3A 1J42A 1VZ2A 3IVRA 1W0CA 3MRSA 4ZN6A 2EWMA 3QFCA 4HNHA 2GILA 3MGGA 4H3HB 4I6GA 3UMRA 1MXHA 2V4ZA 2H11A 4ZOLB 4TYYA 2J0EA 3QXSA 3VU9A 4KYIB 4W4TA 1JDJA 4QXOA 5CYGA 1RKQA 1TZKA 3WYNA 4RQTA 3ICQB 3GLQA 2GK3A 2C42A 5DXAA 2H06A 1NVBA 1RMTA 2XMPA 4ZVPA 2ZYVX 3H0EA 3CX6A 1U1IA 3WHLA 3KZMA 5DEIA 5EZYF 2AV6A 3MNFA 4PWZA 4NONA 2Z0MA 3GFPA 5ICFA 1K8XB 3C5CA 4S24A 1JXAA 1JB9A 1KMMA 4G4GA 2G71A 1PL0A 1W25A 3MINB 1XDGA 4NK4A 4F8JA 2ZJ6A 3JX9A 1W49A 1KF0A 1XVTA 1YQUA 3HUUA 4HEJA 3UHAA 1O94D 3AOEA 1JAZA 5FTLA 2XWQA 4HHEA 2GEJA 2IY8A 3VZCA 3C97A 4JEUA 2NUAA 1F8YA 3LYAA 2E48A 5AQEA 2RARA 4OUDB 5JFGA 3RC7A 2YN2A 1FNSA 3NDIA 3O8QB 4HQRA 3EN0A 3HY6A 3LUCA 2H2DA 2QTZA 2IGTA 4GPAA 4WZAA 3IL2A 1MFPA 2NU9B 2J7PD 2PMKA 1UWKA 1CJSA 1T8PA 2UYYA 2QM7A 2WIGA 1EUDB 3I45A 4LHYA 4RIGA 5HBGA 2GCGA 1XD2B 5IMBA 4B8WA 4CTKA 2REQB 3LOQA 4UVDA 3K6SA 3KKQA 3AHEA 3K35A 3HGMA 4F3YA 1HUQA 1P3JA 1SVLA 2WKSA 5EESA 2I55A 2XF8A 4OI0A 3EUFA 3MGBA 2QDKA 4WASA 1XDWA 3AUUA 3GFFA 3W6UA 4D6PA 5IZ4A 5IT0A 1I6MA 3Q2OA 4H77A 4WZAE 5A5VA 4XUDA 4JJFA 2ZEJA 3DEFA 5PNTA 5IP5A 2X6TA 4OU4A 2H1IA 1ZEMA 2RGDA 3AV3A 1U7UA 2XMZA 3G85A 2A92A 3B12A 4Q7MB 1RYFA 4KMSA 3DNPA 4OHBA 3AGPA 5CA1B 5CUQA 1W75A 4GLJA 4PRZA 3U7QB 5CBPA 1EK6A 5I8WA 3R3YA 4MPDA 3PE4A 1KTVA 4IFBA 1ICEA 2GK6A 3M9LA 4N48A 1WSAA 4BLQA 4QGFA 1XRSB 5FD8A 4RKFA 3HA3A 2ZP1A 5C9ZA 2VP6A 4JLWA 5DDIP 4ZQHA 3VR6D 2GOYA 1M2KA 1QUEA 4N39A 4KP7A 1OTHA 1QYDA 1RADA 4BGVA 1L1QA 5FWXB 1K8QA 2QSUA 2VP9A 2GM5A 1AC5A 1EGQA 1F9AA 3DPSA 4ZI7F 1HSZA 2R8YA 4LWPA 1ND6A 2FPPA 2Q27A 1NUTA 2J0SA 1C2TA 3AILA 3EUWA 4DCNA 2WF6A 1LTQA 5GZ3A 5K6RA 5C53B 2X41A 1F4PA 1U8UA 1XRMA 2CVZA 2DKFA 1Y1TA 1ADCA 3CRNA 3A8TA 4B74A 3FPLA 1V5EA 1YJCA 3K70C 2PZKA 3RSOA 4IHQA 4X95A 1P17A 5HK8A 3DHNA 3I1IA 2PGLA 3ND9A 5C7IO 2H4YA 3BEOA 1GQFA 4NYIQ 5ENZA 2V54A 1C0LA 1WMAA 1YQGA 2FFQA 3LC1O 5B3LA 1KKLA 1LPOA 1E9SA 3CVYA 2G82A 1MVOA 5ALWA 5E8RA 5JCJA 4ZGGA 3OE5A 4KE7A 4AY5A 2C4NA 4HB4A 4RORA 3W6PA 5F3WB 4V39A 3O94A 1ZCAA 2JIPA