4CMBA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 94
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmbA00
3IKTA 1GYQA 1YL7A 1QYVA 3GHYA 5FI3A 2GGSA 3DTYA 1WW8A 3PPIA 1IULA 1HL3A 4BO8A 1EFLA 2WYWA 4FOSA 1DIGA 4ZRNA 5IAAA 1ADGA 4IMPA 2JJYA 5JBIA 5COAA 3FNFA 3VOSA 3AY6A 1GYRA 4L0QA 3TZCA 3HFGA 5U9CA 3E6AA 1ZZEA 3F5QA 1R4NB 1V6AA 4DYVA 1Z6ZA 3GNQA 3HN2A 5DBGA 3VPSA 5TSDA 4FW8A 2OUIA 4HNHA 3VPHA 4BMVA 3C1AA 3GOHA 2Q50A 1D1TA 2J3HA 2WE8A 4CMBA 3TL2A 4CV0A 2W2LD 4R3NA 4YRBA 3PIIA 2E37A 3FPLA 1Q7GA 1DHTA 2OMEA 5JLAA 3WMWA 4ZGWA 5A9RA 1BDBA 3KEOA 4KOAA 1WDMA 4YRDA 3VH4A 1PJ4A 3ZNPA 4D79A 2BGMA 4WCFC 2JFHA 4L74A 4UAGA 5G0SA 3HN7A 2QG4A 1ZK0A 4IQ8A 2QRKA 4R4JA 1EVYA 3GVXA 3TPCA 4DRYA 6LDHA 1ISGA 3RJ9A 4CMCA 4EEZA 2PKQO 4DC0A 4GKVA 1U7TA 2IODA 3UHAA 1ENZA 1V35A 5KVCA 4TRMA 3EHEA 3GMDA 5AXCA 4YJDA 2FZWA 3G3EA 3IIEA 3RKUA 3W8DA 5KOIA 1VM6A 1YXMA 1PQWA 3N7UA 3NJ4A 3ZW8A 4D7AA 1HE2A 2JCXA 3C85A 1J0XO 3WOHA 1UDCA 4QFDA 5FF9A 3ZHZA 4DPMA 1WP4A 1R4MB 4HFNA 1B0AA 1NHWA 4Y8VA 3L6DA 1BXZA 2OFPA 4MVJA 4ZD6A 4E2ZA 4R41A 1PR9A 2VZ9A 1M67A 2OGUA 3MTGA 4IDEA 1DRVA 2V65A 4EITA 1GDHA 3HNPA 2XXBA 3L6EA 1UAGA 1ISMA 1ML3A 4NI5A 3QE3A 1MXHA 1PJ3A 1UXGA 1XU9A 3M1AA 4NBVA 3LQFA 5LC1A 4PLVA 1R4MA 1Z74A 5T8KC 4I9NA 1PQPA 5KCZA 4C7JA 5JYEA 5KJFA 2NVWA 2AQ8A 3HQ4O 4H3VA 3UAGA 4KP7A 4CMGA 3Q2KA 3SLGA 3EZYA 2WDZA 2EG9A 4XQCA 4F6CA 1Y9AA 2D5AA 1EDZA 3RBXA 4XYMA 4DYDA 3M1LA 3OMLA 1R12A 2FOIA 1T2FA 3PZRA 5B37A 4CL3A 5EESA 3MWEB 1OC2A 4WEOA 1U5AA 1R15A 2HK9A 2FPGA 4Q3EA 5A3JA 2PFGA 1YQXA 4R16A 1CJCA 3EZLA 1Q0HA 4MINA 1YKFA 1ZW1A 4W4TA 3WDSA 2PY6A 2BF7A 4QUKA 2G17A 5H82A 5I9NA 1OZAA 2JAHA 1BXGA 2AEFA 4HUJA 4IDDA 4KQXA 4RZHA 3OHSX 1TA4A 1QLJA 3V1YA 1N7GA 2HRZA 3EY4A 3TSCA 3MOGA 5IXSA 3KHUA 3BMNA 1E77A 3H9QA 4LK3A 3R0IA 3EYWA 4TQGA 1DFIA 1VE9A 3NTOA 1ZCJA 2DFDA 3GVIA 2PD4A 5A4DA 4B3HA 2GSDA 4CLOA 1U2GA 1A4IA 3W1VA 2B83A 1LDNA 3DBLB 4OKNA 2D3TA 4DBVO 1U3WA 2ZB4A 2O2SA 3CMMA 2EGGA 1H2HA 2HMSA 4RF3A 4FFRA 2PLAA 2BGKA 4JXKA 3NAQA 4TRRA 1A7AA 4ESOA 2YY7A 2B0JA 1LEHA 3JQ6A 7MDHA 1YQDA 2WSBA 3CEAA 4KDFA 2P9EA 1K5HA 2AE2A 3IOYA 4FFNA 3JYPA 2GRAA 2WE7A 5T5QA 1UZLA 1DIRA 1JTVA 4OM8A 5TQVA 3WIEA 1HEUA 1D7OA 2OL4A 4ZVVA 1EE9A 3NDRA 1X15A 4AJNA 4BO5A 1ID1A 4PLPA 5F5LA 1CYDA 2YZ7A 4FFLA 1AUPA 4IDBA 4MIEA 1T2DA 1E3SA 1E7YA 2QIOA 1W6UA 1VJ1A 1H6CA 3C3XA 1N9GA 1B8PA 3JD1A 3KYCA 3MTJA 1I33A 3P2OA 1I3KA 4HADA 2FZEA 5ADHA 3A06A 3CZRA 5TRTA 2C7VA 2VHZA 4RQTA 1PZGA 1H0KA 4WOJA 3T7CA 3B20A 2CVQA 1PGJA 3LK7A 3ASUA 3S8MA 2CUKA 2F00A 1ZEMA 3SVTA 3HSKA 1TI7A 2HDHA 2X0JA 4YTEA 1HETA 2FRDA 2RHRA 4A27A 5A5FA 1ISFA 3HB4X 1I36A 4BKRA 5CDGA 3R3JA 5K6AC 1Q7CA 1RM4A 3A9WA 5GY7A 4CLDA 4WNIA 3E5MA 5F21A 4I8XA 2YV1A 3F46A 3E9MA 4XCVA 3IS3A 4QTZA 1NFRA 1FDWA 4PVCA 2BFMA 1T1RA 3W4IA 2J3JA 3WICA 5A9SB 4BUCA 4NBUA 3I1JA 2ZTLA 1Y8RA 4M89A 4RPLA 3WBBA 1AXEA 4PG7A 1CF2O 3QVTA 3HHPA 4MVJM 3ZWVA 1LTHR 3JQ9C 1JN0A 4CMIB 5FWNA 2R2GA 4KZPA 2H9IA 1XGKA 4Z6KA 2DKNA 5CP8A 2IEDA 4XB2A 3AW9A 5JDIC 2J5QA 4IM7A 3RCBA 4XQEA 1ENPA 1X7HA 4RORA 1PJSA 1GPJA 4E33A 4R5MA 4IDAA 3NTQA 4MJLA 3GUYA 3GN1A 4ND3A 5JY1A 1GV1A 3FHLA 3K92A 1X1TA 3RUIA 3WLFA 1KIFA 3NT4A 3I9NA 1ZK4A 2Q1WA 2X0NA 3RBVA 4B8WA 1EBFA 4PZEA 3LLSA 3GZNB 1E1MA 1VSUA 2VHWA 5A04A 2PK3A 4ALLA 1GCUA 5LDHA 4YJFB 3KLMX 3DQPA 3T7EA 4C7KA 1NQAO 1QYDA 4Z9FA 5IFLA 3CIFA 4ILKA 1EUDA 4CLRB 4PCVA 4R1SA 1PJQA 4G81A 5EQDA 1YBVA 3DDNA 1R37A 5C7IO 5JC8A 2E48A 1O5IA 4D42A 3JQAB 3WXBA 5EINA 4BNTA 1B8UA 5JDIA 3IKVA 3N74A 1Q7BA 1HRDA 4UVGA 1NM5A 4J7CA 5ITVA 1DDOA 3GPDG 1I0ZA 3NV9A 4TRNA 1RYEA 5TT0A 2QQ5A 2V6MA 1CQJA 2WYVA 4GVXA 4WASA 4CUZA 1P0CA 1OMOA 1UXKA 2D8AA 4ZQBA 1WWKA 4J2HA 4W7IA 3PHLA 4FFMA 3DBHB 3NX4A 2Y66A 5IDQA 3OIDA 4L4XA 2D2IA 4O6VA 3OM9A 3KOUA 4FPXA 1FDVA 2VUTA 1YDWA 5B4VA 2UV8A 4Y9DA 4DVJA 3VVCA 1WPQA 4DWVA 4ZQEA 4NHEA 3PJDA 1YS4A 3OQ1A 1DIHA 1PWZA 3GLQA 1ULSA 3AUTA 2VT2A 1R0LA 1CRWG 2ZQYA 3KYDB 2ZK7A 3ANMA 3I23A 4ZA2A 4NR0A 3GGPA 2NQ8A 4JNKA 4X54A 4PLGA 1YJ8A 4DL9A 1N9GB 4PLWA 4R3WA 2C59A 4J0FA 3RQSA 2O3RA 1DIBA 3O9ZA 2GZ3A 4BO6A 1YB1A 3WTBA 5ES3A 4KQWA 3JYOA 2POQX 3BMOA 1YL6A 4WGGA 1JVBA 4BV9A 1PGQA 3WGTA 3FF4A 2CSUA 1I32A 4XIYA 1NPTO 5C7LO 1SCUA 2Y68A 4S1VA 3S2FA 2IZ0A 3P5SA 1Q1NA 4UEJA 1GADO 2DBRA 1PTJA 1B7GO 3JSAA 5ICMA 3DAGA 2UYYA 1UR5A 4ZU3A 1B3RA 2DTEA 3GG9A 4B3JA 1N5DA 3M6IA 1YBAA 1YVEI 3K5PA 3KSDO 3V2HA 4YYZA 3NT5A 1P1FA 4M49A 5GZ3A 1DEHA 1DC4A 3INGA 3FNHA 3ICCA 4RPHA 5JS6A 2NNLD 2HSDA 2YV3A 1XDWA 2HRBA 4J4TA 4WEQA 1PJCA 2ZCVA 2PZMA 3OJ0A 3ON5A 3I9LA 2XAAA 3S2GA 4AJ2A 1LUAA 3V2GA 4CLHA 3JQGB 3QJ5A 3T4XA 4P8RA 4UREA 2H6EA 1NFFA 4YT4A 5I7FA 2JD1A 5JDCC 2O3UA 1V3TA 4BGVA 4OXKA 3L4SO 2VWPA 4NU5A 3HZZA 3JYQA 4P4NA 1M66A 3ZV5A 1P45A 1V9LA 1YBMA 5AYVA 3I3OA 2O2YA 1Y8QB 1M6WA 3TZHA 3WR5A 1DC3A 1OBFO 4RVUA 3F9IA 4YT2A 2AG5A 2EW8A 5ENVA 1XLTA 3H3JA 3ITDA 4RV9A 3V1UA 1NWCA 1QXSA 3X2EA 2W2LA 3QWBA 4Q39A 4CMHA 2XOXA 5AXBA 1VC2A 1ONNA 3HUDA 4WE3A 3RKRA 4ND4A 5DT9A 4XDZA 3O4RA 2EJVA 1GFSA 4DBZA 5EPOA 1IYZA 3DFUA 4BL5A 1U2DA 4DPLA 2P9GA 3GDFA 3LT0A 3TWOA 1LSSA 1TEHA 4NZ9A 4NK4A 3UGKA 1RM3A 3CSDA 1DIAA 2SCUA 4GL4A 1DHRA 4GGOA 2CD9A 1PZFA 2PKRA 4FS3A 1F17A 2RAFA 4ALKA 3LZ6A 1L7EA 1Y5MA 4CQMA 1J6UA 3F6YA 4XX0A 5DP2A 4MPDA 1MG5A 4ZHSA 5JMPA 5IN5A 3DXFA 2NSDA 4D46A 1SPXA 3GNSA 4Q9NA 4B4VA 4CV1A 4WLEA 4XGKA 3D4PA 3UCEA 4R69A 3SX2A 5A3VA 2BHLA 4ALNA 2FPPA 1EFKA 3IJPA 1HE3A 1NVGA 3ENNA 3JQ9A 3F1LA 2DPHA 4NJMA 2HK8A 1B3BA 3P2YA 8ADHA 2P5UA 3INRA 4I08A 4BNGA 4CR8A 1XQ1A 1YE3A 3TDKA 2ZB3A 4CUJA 1FDSA 3ZN2A 1ZXBA 4F46A 2BKAA 1PGNA 2YDYA 3G0OA 5TJHA 1UAYA 4CMEC 1QLHA 4D0SA 1C1XB 3HJAA 1UDAA 4A03A 3HG7A 4D45A 2RHCA 2EP5A 3C1TA 4PG6A 1W4ZA 2X0IA 1SB9A 2ZB7A 1O6ZA 2Y1CA 2OBYA 3DBVO 4RGBA 4BB5A 3PHHA 1KEVA 2DUWA 2I76A 1ARZA 1G6KA 5IG2A 3C7DB 4D43A 1UDBA 3ZWXA 2TMDA 4IDGA 2YJZA 4WOKA 3TOZA 5ILGA 5JPIA 4MIOA 4NMHA 4B8ZA 1QRRA 2VNSA 5KJEA 4NIMA 1ADFA 4Z9YA 4RDIA 4JBIA 5IDWA 1GUFA 1WNTA 1F8FA 4RVFA 3GVPA 1F14A 4FGSA 4HV4A 4L8VA 1KEWA 2HCTA 4XQGA 2FR8A 4AJJA 5JAMA 4RJTA 2CMDA 1SB8A 4GPD1 4O1MA 3HDYA 3TZQA 4K6FA 3ANLA 4G65A 4XEHA 4UUOA 3PHIA 3BMCB 4QO8A 2P68A 4GGPA 1RM0A 5G0VA 2WD7B 1WZEA 4FJ1A 1OC4A 4CMIA 1B8VA 3KBOA 3PDUA 4R1TA 1A9YA 2OO5A 5G2OA 4GVLA 3G49A 1GEEA 2TMGA 3OP4A 1LRJA 4A0SA 5A9SA 4WCFA 1V0JA 4D3DA 4IZIA 1QORA 1TB4A 5CG1A 3BMCA 2EW2A 1P1HA 3CE6A 4IBOA 3B1JA 4IIUA 5JC1A 5G4KB 2HMVA 3CZMA 1HF3A 3E9NA 4BKQA 3ZW9A 4IJWA 5L53A 4BGUA 1YL5A 2FPIA 4BOYA 2ZCUA 1GQQA 3RFXA 4ZRMA 3LC1O 3BTSA 4BO2A 4B3IA 4QXMA 1F8GA 4ZQFA 4MVJE 3E5RA 3UW3A 4FB5A 3SEFA 4OOFA 3WS7A 3VAZA 5BSFA 2UAGA 3G1UA 2EWMA 3VPFA 1VL6A 2Z1MA 4J7XA 5C37A 1PGPA 4RVHA 5TIIA 3H5NA 3GN2A 3PJFA 4MOWA 3WTCA 3Q0EA 4N7RA 4KTVE 1BHSA 4CM6A 1X13A 1NQTA 1HZJA 4CMKA 1K3TA 1ZJZA 3M2PA 4J90A 3UN1A 6ADHA 3K2BA 2OOSA 5B4TA 4E13A 3EC7A 4CM4A 5CPBA 5L4SA 1SNYA 1B14A 4U0KA 2DTXA 1EDOA 3Q9NA 4J0EA 3VDRA 3ZWWA 2I5PO 1FXSA 4L75A 4N5MA 2Q49A 1RKXA 1EVJA 1XEAA 1DLIA 4TKMA 4WLFA 3JD4A 4IQ0A 1NAHA 1JQBA 4B79A 2JHFA 3QW2A 5IZCA 3TFOA 1ISIA 1FF9A 1X0XA 1VI2A 3EGOA 1QYCA 2O4UX 5JXWA 2VZ8A 4R5HA 3I9OA 4A10A 5JO9A 3F47A 1T2CA 3BMQB 3DBLA 5JNLA 5L9AA 1LRLA 2JFFA 3WMXA 1PX0A 3OBBA 3IL2A 5KVQA 2YUTA 4AJHA 3JCZA 4FQ8A 1LDEA 3BYZA 4WUVA 3GRPA 3WWYA 2RCYA 4CQMD 2EGHA 4FOOA 2Q45A 1H6AA 3ZWMA 1UZNA 3LC2O 4RF5A 4CM5A 4CM8B 3GH3A 4E5KA 3WGYA 4LSWA 3PZBA 4DGSA 4U8GA 1E7RA 2C5AA 3LSYA 2JKVA 1QG6A 3HB5X 3DAFA 5KKCA 5L40A 1C14A 1H93A 2NQTA 5ILOA 1VJ0A 1FMCA 3ROPA 1ENOA 1EE2A 5L7YA 2AE1A 1D8AA 4QO7A 4HNGA 5I7SA 3DAPA 1SC6A 3ICPA 3JQ8B 3PWKA 1V3VA 3AY7A 4HFMA 5DF1A 2NV6A 1P3DA 1T24A 2JD2A 1LLDA 4XWYA 4YAJA 4J4BA 1PR3A 3ZWYA 5HS6A 4Q3DA 1LDMA 2E6UX 4IINA 3BTOA 1N7HA 4U5QA 5FFFA 2PZLA 1NXQA 1WDKA 1E3WA 1DAPA 1C3VA 2B37A 1B2LA 3VH1A 1EK6A 5MGBA 4BO7A 2DUUA 4YJFA 4CPDA 3TRIA 3NEPX 1MX3A 2VN8A 4M8SA 2PGJA 4PG5A 2GNAA 4INAA 2W2KA 1QP8A 2C0CA 4OKIA 2VYNA 2B4QA 1YH3A 4Z3KA 5KJCA 4IUYA 1W0CA 1E3LA 2J5KA 1YRLA 2PA3A 1AHHA 4JP2A 1WAMA 3JQAA 1P1KA 2QRLA 1J4AA 1OOEA 5KKAA 4JLWA 1JKFA 4OAQA 1DLJA 4BNVA 2VYVD 4A2CA 4GX0A 1C0KA 4L4SA 1NPYA 2CVOA 3RUEA 2RH4A 4YACA 2PZJA 4WJZA 4EUHA 3DOOA 3IQDB 5HA5A 3LT4A 1HDYA 3DOJA 3PLRA 4BNMA 3RWBA 1SEVA 4Z0TA 1MGOA 2RIRA 4LRSB 2VWHA 3JQBC 2I99A 4N54A 3GEMA 4OQYA 4YRAA 1H94A 2Q46A 3AFNA 3PDJA 5JAZA 2DAPA 1RYDA 3I4FA 4E4YA 4OJNA 1KY4A 3ADPA 4NK5A 3WLEA 3LVFO 3F1KA 4LSMA 4E30A 3DZKA 3E82A 1EK5A 5L7WA 3K9QO 2W98A 1X7GA 4B4WA 1TXGA 1Y8QA 2YQ4A 3AI2A 2ZATA 3V2UA 4BB6A 3UOGA 3VZPA 4YVFA 1HDRA 1OAAA 2RH8A 4MVJP 4H16A 3TN7A 1LU9A 4JJGA 3FNGA 3W4KA 3SC6A 1E1KA 4NQZA 1TVEA 1X7DA 3MEQA 1HTBA 4II2A 2CNBA 5GZ6A 1VSVA 1YOVB 1EUZA 3DC2A 3KRTA 4UEKA 2Q1TA 1GUZA 2X58A 2ZIZA 4Z9XA 1GL3A 5JE8A 3GVCA 1LDBA 2DU8A 2HJSA 4QQRA 1Z73A 1KVQA 2C07A 4EJMA 3BHJA 4F45A 3PFWO 4ID9A 1F0YA 3VTZA 3WSWA 3OIGA 4IJKA 1IZ0A 3JQFC 4BKOA 1VPDA 1JKJA 5CDTA 3GVHA 4BO0A 4YAGA 4TRJA 1YONA 4DA9A 1HDXA 3NRCA 1I01A 2A4KA 2EJWA 4K26A 5CEJA 2WJPA 3H2ZA 3ZV4A 2VYND 3BHIA 3LT2A 4B4OA 1DB3A 3LF2A 2VWGA 4UVDA 1MC4A 1GCOA 3V1TC 3L07A 9LDBA 3PWZA 1U1IA 3DMYA 3WQQA 1PL6A 3VKUA 1CIVA 1NNUA 1G0NA 5DNAA 4XRGA 1SOWA 3KM0A 3PK0A 1HZZA 1GAEO 1P33A 4XYEA 2GZ2A 2Y0CA 3UCXA 2A9FA 4TVOA 4CM7A 2PV7A 2W8ZA 3D0OA 3HDQA 4TZTA 4I9HA 2P4QA 4MVJG 4XGIA 3GRKA 1C0PA 4PRKA 4J9VA 4R9RA 4O63O 2YFHA 4EUEA 5JFOA 2X86A 2YHUA 1A72A 5KNLA 4HXYA 2B35A 3M2TA 5CDYA 3KYBA 2VQ3A 2Y1DA 4CMJA 4AJPA 3FWNA 4GH5A 3RUCA 3WYEA 4R68A 1MG0A 5KJ1A 1KC3A 2HMWA 1SZJG 1BW9B 1E0DA 3B1FA 3FTPA 4PRLA 1LRKA 3ZU2A 1E1LA 3D4NA 4A73A 1CETA 2HMTA 3OF2A 4Y67A 2NTJA 2NVUB 3MJSA 3ZU4A 2UUPA 3VC7A 4BNIA 2X7HA 1EVZA 3IP1A 2VCYA 3CKYA 5TT1A 3AJRA 1DSSG 4E32A 2V6BA 3DZBA 4R01A 1Z7EA 2E4AA 2X9VA 3GNTA 3PYLA 4BO1A 3DZFA 4JJIA 1U4SA 2C54A 4AJ4A 2DC1A 1ZH8A 2AHRA 4ALMA 2VHXA 4JBHA 1KEPA 2O3SA 2YHIB 5JAQA 2JL1A 1LDGA 2YDXA 3O8QB 4K1LA 3IP3A 1MA0A 5DBIA 1N1GA 5G0WA 3V8BA 4W9NA 1ORRA 1JLLA 3NT2A 3ZWOA 1NVTA 4PGFA 1ZJYA 3WQRA 5F5NA 5G4KA 4PZDA 1Q0LA 1R4NA 4J1QA 1A27A 3KTDA 2A35A 1KVRA 1HT0A 2G82A 4J1SA 4WCDA 3S2EA 4Z3DA 3U4CA 3ASVA 3KVOA 4RLSA 4DLBA 4GMFA 1XYGA 2WM3A 4J7UA 3KB6A 3OA2A 4I1IA 5FEUA 1QR6A 3U4IA 3H3FA 4BIIA 1N8KA 4XYLA 1WZIA 4BNKA 5DBFA 2D4AA 1PJ2A 3PTZA 4YAIA 3QY9A 3KZVA 4O59O 3CUKA 3K30A 1HE4A 1G0OA 3X2FA 1XWFA 4HY3A 2P2SA 3SC4A 2DVMA 4YEDA 5TF4A 4BNYA 1Z82A 4IMRA 3WNQA 4E31A 4CL8A 2X5JO 1H9AA 2C82A 1R16A 3H65A 2J5RA 2ZTVA 1BWSA 1LSUA 4CLOB 3JQ7A 4DIFA 3DHEA 3WJ7A 3UICA 1ZK3A 3NGLA 5CEFA 4CJXA 1A7KA 1PZHA 2ZTUA 2Q99A 1V3UA 3MJCA 3NTRA 2ET6A 2XXJA 1TT5B 3K96A 4OHUA 2X4GA 3GR6A 3H2SA 1H5QA 4O0LA 4EZBA 4Y6RA 3L0DA 4N5NA 3PEFA 2IXAA 4XD2A 4B7UA 1QMGA 1B16A 1YO6A 4YJGB 1CERA 2Z1NA 1HDCA 2ZTMA 2HO5A 4IXWA 1E6EA 1EQ2A 2A92A 1K6XA 4ITUA 2HK7A 2IXBA 3PIDA 4BMSA 4Q3BA 3RC7A 3ST7A 1EBUA 1K6IA 4E2WA 1LLCA 4ZJUA 2G5CA 5G4LA 2H1SA 3GDOA 4DPKA 4XDYA 5COQA 1U8FO 5K9ZA 4RO0A 5TJ9A 4XR9A 4LW8A 2YQ5A 3AFMA 1I30A 3FBTA 4ND1A 3U9LA 4E6PA 1HYGA 2BFPA 4AICA 4MP8A 3SXPA 3JQDA 2Y99A 2ZYAA 5IF3A 4GSKA 3VPXA 4F6LA 3KXDA 4QT0A 1LX6A 2QZZA 4FCCA 2Y1OA 4I5FA 3PI7A 3LLVA 4BS9A 1GU7A 4FBGA 3TNLA 2B4RO 2B69A 4CM4B 4HX5A 3OECA 3U4HA 2AXQA 3ETDA 3U0BA 3WJAA 4RQUA 1VJTA 2V7PA 4W9NC 1HDOA 4LN1A 2J3IA 3EK2A 3FNEA 1I2CA 4NJOA 1PS8A 3DFZA 4KWHA 2IZ1A 1UJMA 3WGIA 4PG8A 3QIVA 4YJHA 3RC9A 1DFGA 2DTDA 3WX0A 5I8WA 2NVBA 3FI9A 1S6YA 4NDNE 3CMCO 3WFJA 1Y81A 1KVTA 1I8TA 3WB9A 3ETEA 5ENDA 5L51A 2J6IA 4WK6A 1PJTA 1E5QA 2VRCD 3NYWA 1S7CA 1ENYA 1O8CA 2GERA 4XKJA 2EKQA 3I9KA 3TZ6A 4U0JA 1KBZA 4UVHA 4IS3A 3H9GA 3GGOA 5TGDA 5EMHA 4EGFA 1ONOA 4MKZA 4BNNA 3L4BC 3RVDA 3KYDA 2D1YA 4S3MA 1XQ6A 2JAPA 3ROKA 1H2BA 2GPTA 1T25A 4LVCA 4PZCA 3ZI0A 4AVYA 3VKVA 1ZKMA 2C7GA 3ZWAA 4FFPA 4IDFA 4DMMA 4E21A 3K8ZA 4OGWA 3DONA 3JYNA 4WLOA 4BNUA 3OSUA 1EMDA 2FHSA 3ONEA 4GWKA 5IN4A 2FR1A 1GQ2A 1PGOA 3ABIA 3MOIA 2VUSA 1XHLA 5AXDA 3QWFA 5ER6A 2BRUA 2P5YA 1T2EA 4OMUA 1N2SA 4WLUA 1IHXA 3GMSA 2PTGA 1MB4A 2E49A 5IDXA 2ZJ1A 2X5OA 2BI7A 2FR0A 1LC3A 5KVVA 1NYTA 3JQ8A 4EYEA 1P1IA 1HSOA 1GD1O 1BRMA 1CQIA 3ZWNA 3PHGA 2DLDA 2IYPA 3UH1A 2PD3A 1U5CA 4NG5A 3ZU3A 2ZYGA 2QX7A 3ETGA 4LCEA 5CFZA 3JQGA 3DBHA 1ZK1A 4J1TA 1NX6A 1C0IA 2P91A 3T4EA 3C7AA 4AG3A 4Y98A 4U6SA 1PEDA 1WMBA 3R6DA 2VUUA 3H9UA 4W7HA 5EL0A 4GBJA 1UP6A 3UUWA 4EDFA 2Y0DA 2IYOA 3SJ7A 5DDIP 1XG5A 1RJWA 2UVDA 1PJLA 3WWZA 4E2YA 2FP4A 4ZICA 3EW7A 4LRTB 3ZV6A 4OXYA 2Q4EA 2NU8A 4GMGA 4DQVA 3DEYX 3UCFA 4PFJA 4G2NA 4BQPA 2GYYA 2YHIA 4RZIA 4GAEA 1EQUA 2Q4BA 4QEDA 4TWRA 3QSGA 3H4VA 4KDEA 4KUEA 1R66A 3NDIA 3O26A 2W4QA 3LF1A 3Q6IA 3G79A 1BG6A 2WEKA 3WNVA 3GF4A 3MJTA 1YB5A 4DIOA 4CM9D 3DHNA 4FD3A 2Q3EA 4JQCA 2PH5A 1A5ZA 1E7MA 4D0RA 4OOEA 3BMOB 4WLNA 3OEYA 3PQDA 4DIBA 4RCVA 1MLDA 2WTBA 1H9BA 4GKBA 4Q3NA 4AJEA 1NP3A 3LC7O 1VL0A 1HKUA 1BW9A 4M54A 1U4OA 3A4VA 5CDUA 2IEBA 2GN6A 1X1EA 3R1IA 1LLUA 3BA1A 3KSZO 4JBGA 3VH2A 1P74A 3L77A 4JX8A 3UKOA 4WNCA 1RPNA 3LDHA 4RF2A 1GYPA 2WWRA 5AOVA 3OJFA 2GCGA 1VLLA 3D64A 1D1SA 1GQYA 1E1NA 1VKNA 1AGNA 1O9BA 4E0BA 5MDHA 3ZCXA 3STHA 2OHXA 3CTMA 3DZGA 2GASA 5EERA 2VTEA 3DOCA 3RUAA 3WQSB 3DWFA 4K28A 1BXGB 1F12A 1MP0A 3QHAA 2OXIA 3WFIA 2BFAA 1UZMA 3A14A 1EEHA 3ADOA 4FGWA 2HAEA 1U9JA 2NADA 4XQ9A 2PD6A 2PR2A 1E5LA 1YJQA 5TC4A 4CODB 2W2KB 2EP7A 2C29D 1TT5A 5DOZA 5T57A 4PVDA 3Q11A 4P38A 3JQEA 4A7PA 4EW6A 1RWBA 4E5NA 1AXGA 2B4TO 4YB8A 1GR0A 1FDUA 4J91A 2X1HA 3ZWBA 3QVWA 2B36A 3KO8A 4XYBA 1C1DB 1P1RA 2DPGA 2O3JA 4PLFA 1R0KA 5JMWA 5DCUA 4NU6A 3WIDA 1KC1A 2QYSA 2Y1FA 1HDGO 3JV7A 4BO9A 1HXHA 2JCYA 4OSOA 3ULKA 4WECA 3D3WA 3MCVA 1Y5RA 3RU9A 5CDSA 2FN7A 4E12A 2YYYA 3PHJA 5F1PA 4AJLA 3VH3A 1GEGA 4GX5A 1IZ9A 1W73A 4QECA 4F3YA 1DRWA 3E03A 5KIAA 4UVEA 1C0LA 2CF5A 2HU2A 4YCAA 1DJNA 3JQAD 4ZN6A 1KYQA 4U6QA 1C1DA 3RBZA 1FK8A 3QVSA 3AUSA 4CMEA 4AJ1A 4B7CA 1PL8A 3IMFA 3JD3A 1M6HA 2EERA 3S1LA 2ZYDA 4IQGA 4FC6A 1I3NA 2BD0A 3KYCB 3U3XA 5DP1A 2YW9A 4II3A 2GZ1A 4FR5A 3DHYA 1GTMA 4CUKA 3DO5A 4GX2A 3EDMA 4JN6B 4EEXA 2CF6A 1XIVA 5C7OO 5U4QA 1P1JA 3GY0A 4K9DA 1U28A 3AU8A 1YOVA 2QW8A 3QVXA 1N92A 2FMUA 4YJHB 1TT7A 1E7WA 3GHHA 1LSOA 2GN8A 1Y8RB 4KUGA 3D5TA 3I9MA 1KY5A 1YWGO 3D3EA 3I9JA 4CM9A 3B70A 4URFA 2CZCA 3OH8A 4PLCA 1D3AA 4M1QA 4UEOA 3B1KA 4J3FA 5L4NA 3GEGA 1QKIA 3COSA 2AA3A 2B5VA 4IXTA 3FSRA 1E3JA 3U49A 2X8LA 3PGJA 3EUWA 1B15A 1JDJA 4DXHA 2I67A 1LQUA 2IRWA 3GDGA 1A71A 1ZIDA 3PRJA 3OIFA 4RDHA 3K73O 2J8ZA 3VZRA 4ND5A 1PSDA 2GR9A 3H5RA 2C2XA 3U5TA 1T2AA 3AK4A 4U7WA 4ALJA 4AJKA 3JQBA 4D3FA 1KEUA 1E3IA 3VDQA 3DZIA 3SLKA 3H9JA 1K2WA 1T4DA 4J4HA 3DBRA 4L9RA 3JQCA 1O0SA 4AL4A 2R00C 3PWSA 4MVJD 3AM3A 1DC6A 1ZUD1 3ONDA 3WSVA 5JY6A 3LYLA 4YT8A 3G17A 1GY8A 1HSZA 2BELA 1ZMOA 4MIYA 5CEEA 3RFTA 1E7SA 4CLXA 5L45A 3ZH2A 3I6IA 1K0UA 3BXXA 1I2BA 3I52A 4J16A 4OL9A 1T4BA 4E3ZA 4AFNA 2GUGA 2AEJA 3NJ8A 1PWXA 1WVGA 2Z5LA 3LU1A 4WPGA 2DFVA 5IDYA 1I10A 3CH6A 1UXIA 2DQ4A 3TJRA 3ZNNA 4NFHA 3DL2A 3BIOA 3GG2A 3RI3A 1P44A 2C20A 4I5DA 4RL6A 5EQFA 3KV3O 3AY3A 4CV2A 1UUFA 4MP3A 1HYHA 1DFHA 3BMQA 2RBEA 1I3MA 1QSGA 1MV8A 3JQ7B 2GN9A 3GPIA 1U7HA 3AOEA 3C24A 1B26A 4YAKA 3NGXA 1QYWA 3KEQA 4CQMB 3DZHA 2GD1O 1SBYA 4FC7A 2HJRA 3DMTA 1ZEJA 4R1UA 3U4DA 5G0UA 3GAFA 4R9SA 4DMLA 3QLJA 5B12A 3UF0A 1DPGA 4ROSA 2B5WA 2GN4A 1NVMB 3OA0A 4LMRA 4JP3A 4BNHA 2OP0A 3Q9UA 5TNXA 2F1KA 1E7QA 1JWAB 1ONPA 5L95A 1RM5A 5HS4A 4AJOA 3PYMA 3K2EA 4MKRA 3RIHA 4BMNA 3RUFA 1HLDA 2VYVA 2AW5A 3INTA 3W8EA 4BNWA 1JAXA 1GZ4A 1NAIA 3FBGA 5HRUA 3GFGA 3FR8A 1ZXLA 2G76A 1M75A 3H6KA 3BAZA 3WYCA 4P4LA 1E6UA 1M2WA 2CY0A 4YBZA 3ROMA 4YQYA 3FN4A 3Q2IA 2X9GA 1R0SA 5T64A 7ADHA 1X14A 4H15A 1ZVMA 3GUCA 1JAYA 5J23A 4EI2A 4CR6A 5G0TA 1UXHA 4Y6SA 5F3RA 1OI7A 2PGDA 1HE5A 5T8KA 1CEQA 4MDHA 5T67A 1VKOA 5IXYA 2EHDA 4N5LA 1J49A 4IDCA 4J6FA 3VPGA 3AUUA 4XIJA 3GT0A 4D44A 4M87A 4JIGA 1U3VA 4RPKA 3L9WA 2PZKA 4WCFB 1K89A 2GDZA 1Y6JA 3JTMA 4L73A 1QYXA 2CFCA 1GPDG 3P7MA 3E8XA 4G5HA 2EEZA 1NASA 1BMDA 4CM8A 2DBZA 4Z0HO 3WG9A 3IJRA 4PLHA 5FI5A 3JD2A 1UP7A 2VRCA 1T26A 4I9UA 1OFGA 3ENKA 3QWHA 1PS9A 1Y9EA 3OJLA 4NNJA 3GC6A 3PP8A 4GQAA 4BO4A 4EUFA 1LQTA 2JHGA 3WBFA 1VL8A 5JSFA 1DJQA 4HFJA 2XPCA 1DC5A 4MO2A 3IAHA 4IJVA 4IJUA 4BQRA 2DBVO 2YV2A 1LI4A 2OP1A 4DQXA 1V8BA 1UH5A 2LDBA 5ER9A 4BNFA 3HADA 3PJGA 3ORFA 3H7AA 5HM8A 1FJHA 5CHEA 3RJ5A 1LA2A 3PQEA 4XJTA 3MJ4A 4J49A 3VZQA 3G1TA 4EBFA 5JCJA 1D4FA 3PXXA 4KMSA 4RLHA 1I2ZA 2UUOA 4J43A 4YT5A 2FSSA 5A02A 1CDOA 1M76A 2FSVA 4KUHA 3JYLA 2C2YA 2H63A 2VRBA 1QV7A 4J9UE 2ILTA 1ZMTA 1JW9B 1Z45A 2QZ9A 4ND2A 5L7TA 5JO0A 4I5EA 2NLOA 2CDAA 3GZ4A 1NTOA 4BGEA 2Q1UA 5CAEA 1ZSVA 4IY1A 5HBRA 3RC1A 1XCBA 1SO8A 3QWAA 1JKIA 4GLLA 4N18A 4YA6A 5EIOA 1PZEA 4YWJA 5BNIA 3HE3A 3AWDA 4BKPA 3RU7A 2BLLA 2IE0A 4GSLA 1PQUA 3ZDFA 5A1TA 3O38A 5LDGA 3PQFA 2EF1A 3GA0A 4TVBA 3L6OO 3UXYA 3PVZA 4NJMB 1LXCA 2UDPA 1LNQA 1ZSNA 1XKQA 4H7PA 4M55A 4MVJH 3OETA 5LCXA 3RFVA 1AN9A 3HWRA 2O7SA 5I8ZA 4XR4A 2X6TA 5A5EA 3I83A 1BVRA 4JJFA 3RSHA 2CDBA 4NPCA 3AU9A 3WGHA 4LMPA 4KTTE 1H6BA 1EUCA 2D0IA 4NBRA 1FDTA 2DBQA 5JAIA 1NQ5A 1KVSA 3FTNA 2CDCA 4GI2A 3DB2A 3NKLA 5THQA 2EV9A 3I4CA 5I7EA 2H5LA 2EKPA 2BFOA 3JD0A 3W8FA 2O23A 1YGYA 3DZJA 4RVDA 3H9EO 2NM0A 4W82A 3DBRB 4FDAA 4XYGA 3ZV3A 2WMDA 4MKXA 1C1XA 3R3SA 3RC2A 3Q3CA 5IJZA 1P0FA 1MUUA 3BMNB 3MZ0A 4XRRA 2NWQA 5A03A 3CINA 1BSVA 4YQZA 2X5KO 4I5GA 1IUKA 3C8MA 1PL7A 4LISA 2W90A 5AQ1A 3DR3A 3ZGYA 3V5NA 2NUAA 1PS0A 2OORA 3ZWPA 1TLTA 2AEMA 4BGIA 5GZ1A 1AHIA 2DM6A 5IZ4A 4Y6PA 1AE1A 3A1NA 1LLQA 3UVEA 1MFPA 1WMAA 4TROA 2Q2WA 1L7DA 8LDHA 2NTVA 4OXNA 1XA0A 3OFSA 4J2OA 3U09A 4LCJA 5KJ6A 4FJ2A 2VWQA 5DZSA 1YB4A 3E18A 2Q1SA 3H5AA 1NQOA 2AQKA 4WLVA 2EKLA 3VTFA 3GGGA 5CPFA 2NU7A 3DTTA 1IY8A 3W6ZA 3FR7A 4CQLA 1GZ6A 1XU7A 3F5SA 4RPJA 3ZHBA 1K6JA 5I7VA 3L9XA 1I3LA 1EZ4A 4DC1A 3ZZNA 3VHRA 4ZQHA 4DTIA 4HWKA 1UP4A 3F4BA 4HBGA 3ZNOA 2I6TA 2IZZA 2VHYA 3S2IA 3HDJA 4PG4A 1JWBB 3D3WB 1ISHA 5HTOA 3Q1LA 4RF4A 4W6ZA 5DCYA 2AQHA 9LDTA 2QYTA 2BMAA 4E5MA 3D5QA 5DCWA 1XSEA 2AQIA 2G1UA 3WGZA 5TLSA 3BTUA 1I5RA 1NBOA 1U8XX 3AI3A 1R6DA 3EAGA 4K6CA 2E82A 3MJVA 1DRUA 2I66A 4FIZA 1DAOA 4CM1A 2Z95A 5BT9A 4IGFA 1IPEA 5BR7A 5A05A 4BHTA 1PU2A 4YR9A 1DOHA 3D7LA 5B1YA 1ZBQA 2R00A 3DMTC 3ONFA 4TSKA 1CWUA 5BNFA 4TZKA 1O95A 2I9PA 1MXFA 2Y1EA 1WLYA 4P4GA 4NFYA 3FD8A 1MFZA 3IC5A 2I65A 1E3WB 3JQFA 3OICA 5CG2A 3IUPA 4IIVA 2GLXA 5EJ2A 1LC0A 2ZKLA 3FPCA 4R54A 4UUPA 4FN4A 4RVSA 4Q3CA 1ZSYA 4R51A 4HKTA 3U62A 4R1NA 3KLPX 4BNZA 4IZHA 2NTNA 3ZHYA 5BSGA 2ZQZA 2PKQP 1L1FA 2EIHA 2X0RA 4BNLA 3TQHA 2OBNA 1Q2XA 5HWSA 1BDMA 2O48X 2Y05A 5JCXA 1VRWA 4CMAA 3GAZA 3W4JA 4B7XA 1GUYA 3OJOA 1IB6A 4YDRA 1Y7TA 2GF2A 3S55A 1P9LA 2P9CA 1XR3A 3OJEA 4P22A 3F3SA 2O7QA 4KWIA 3CXRA 1JU9A 1NHGA 4QSMA 2VNAA 4TMFA 2R6JA 4XB1A 5A06A 1I24A 2O3TA 1IHYA 3L4BA 1KS9A 4JROA 3FWZA 4PLTA 4OH1A 1H6DA 3IUSA 2YFQA 4D3SA 3ANNA 4LVUA 3K6JA 4A26A 2BH9A 3SJUA 4CM3A 5U1PA 3AOGA 5K6AA 4PN3A 4UUNA 3I6QA 1UXJA 5F1OA 2AMFA 3PJEA 4OO3A 1KETA 5B4UA 2O3QA 1ADCA 5BSEA 4LGVA 2G0TA 3PYXA 2VOJA 1ADBA 4MVJI 4UUMA 4AJIA 4J1NA 4IGEA 1HLPA 2LDXA 2V6FA 5GMOA 1U3UA 4NFSA 3EMKA 4CR7A 4O5OA 2AG8A 3GZNA 1ZO8A 1LSJA 3VZSA 2I3GA 5C5IA 2C5EA 2HQ1A 2GO1A 4E5YA 1BTOA 1A9ZA 3N58A 1IOLA 5DULA 3TZKA 2Q2QA 1SMKA 1SAYA 2V6GA 3VVBA 2Q2VA 3P19A 1J5PA 2D5CA 5T6BA 2VZ0A 2HMUA 3AI1A 5I9MA 2HLPA 2NU9A 2I3AA 4OYRA 4BV8A 5TS3A 4NH4A 1NPDA 3GFBA 1IPFA 5BQFA 1DBVO 4Q3AA 3F4LA 5I9LA 3HDHA 1ZK2A 3ITKA 4XA8A 3RAJA 5COBA 4DUPA 4MVJF 1BXKA 1ZFNA 1Z75A 4PIVA 2J3KA 5ICSA 4JK3A 2OZPA 3E48A 4YPOA 4CQLB 4ONEA 4L76A 2PGLA 4XGNA 3TF5A 4GWGA 2IDZA 5FYDA 1IL0A 2HUNA 1Z7BA 4EJ0A 4FJ0A 3FCOA 4UVIA 2D59A 4QFCA 5H81A 3QVOA 5F1KA 2VTDA 3TL3A 2ZB8A 3BZUA 2VOEA 3PGXA 4DLAA 3O8QA 1KVUA 4PLZA 3O03A 5ITWA 4NBTA 2EXXA 2NU6A 4YXFA 3AOEC 2WD7A 3D4OA 1A4UA 4NBWA 4RVGA 5AVOA 1ZNQO 1N1EA 4XJSA 3KUXA 3TOXA 5JCJD 3HFSA 3LT1A 3RD5A 3QV1A 3WGQA 1BVUA 3B6ZA 4HFRA 4CLEA 3AM4A 2CVZA 3GQVA 3W6UA 1ISJA 3WGOA 2O4CA 1IE3A 4FFOA 2QHXA 3SBOA 5THKA 2ZJ0A 1NR1A 3MWDB 3QWIA 4CLRA 1SOVA 3FRJA 4OIMA 2HKIA 2PH3A 3PLNA 3QRWA 5JDCA 1E92A 4M86A 3ZNQA 4B4UA 5KVSA 2BI8A 1MC5A 4BVAA 4E2XA 1WDLA 3GEDA 3UFXA 2JCVA 4OQZA 5K0ZA 4CV3A 3E9QA 3ZU5A 3AM5A 5A9TA 2QRJA 2A94A 4QX6A 1YQGA 2JD0A 2NVUA 1XELA 1W8DA 1DO8A 1LDYA 4GLOA 2VT3A 5L4LA 1U3TA 2PNFA 3PFFA 4IPTA 1PIWA 1Q0QA 1O94A 2VHVA 5DN9A 4FSHA 4OSPA 2DT5A 1JVSA 1ULUA 3EVTA 3K31A 1PJBA 5BNTA 3NUGA 4YAEA 2WYUA 1BGVA 3KSUA 5JYDA 4RPGA 2FWMX 2XF8A 3RASA 2FY8A 2O50A 2X23A 1F06A 4EJ6A 2Y93A 1HYEA 1JA9A 3IDSA 1WXDA 3D1LA 3GK3A 3ZHXA 1HDZA 4BO3A 3RUDA 5KWEA 3OEWA 5DOVA 4MP6A 3BTVA 1YDEA 3ROQA 2X22A 2WD8A 3BHMA 3NDJA 1NWHA 5BSHA 2PWZA 3QP9A 4GX1A 1T1SA 4W99A 4ALIA 3OQBA 3QQPA 4PLYA 5EN4A 5H83A 4DQUA 1NR7A 2JFGA 1DXYA 4YJGA 3H8VA 2BGLA 1GZ3A 1P77A 3CPSA 4Z0PA 4XZ3A 1E6WA 1NFQA 2P4HX 1O89A 4BNXA 3I5MA 5KTKA 3WYBA 2Y67A 4UULA 2X9NA 3E1KA 3RROA 4DLLA 1Y1PA 4BNJA 4DREA 4IS2A 1LBEA 3C7CB 2Y0EA 4JCOA 4JGBA 3MJEA 1LJ8A 4BKUA 1X0VA 1KERA 5AXAA 4D41A 1QV6A 4ZQGA 3A28A 3WGGA 1SEPA 5IZCC 3EVNA 3ZWCA 4E5PA 4L4RA 4A5OA 1GV0A 1P31A 2Y1GA 5C3MA 3QA9A 4C4OA 1EVIA 3TFQA 3RUHA 1E3EA 5L3ZA 1HWYA 4TKLA 5TX7A 4WKGA 3OQ6A 3KETA 3C1OA 3AUAA 1KOLA 5JW6A 4HP8A 2NACA 1G1AA
chains in the Genus database with same CATH superfamily
3IKTA 2CKDA 2E4VA 1K8RA 3U3ZA 1T0BA 3AIOA 5DYNA 5F77A 1YZUA 5HUQA 1QYVA 4R05A 2IYTA 5L8VA 2WHEA 1WB9A 1L7AA 1JNYA 5A4IS 2GGSA 3FGZA 3UMYA 2JZNA 1WW8A 1X3SA 1FU4A 1OH6A 1IULA 1DWPA 1HL3A 4P58A 2XA2A 4BO8A 4C6HA 1K5DA 2ZUCA 3E58A 1J2TA 3GWGA 4FOSA 4QE3A 4ZRNA 2AKEA 2J0SA 1ADGA 1U28C 2JJYA 5D87A 5J4YA 3WP0A 1IZYA 2B7CA 2WYOA 3ZKAA 4TV8F 4L0QA 1GYRA 2N1BA 3HP7A 1FE8A 3GFRA 1UBHS 3DEKA 4ENTA 3E6AA 5E7IA 1FYXA 1P80A 1STOA 2VI5A 4L4YA 4U1RA 1Y4UA 5EMKA 4MYHA 5KMGB 4B8YA 3HN2A 1GZ7A 4FW8A 1KJQA 4N12A 2ZIXB 2PCLA 4P31A 4TUYA 4US2R 1NRIA 2LCFA 4EWLA 3VPHA 1CY2A 2R8EA 4QDTA 3MTBA 3I04A 4KU4A 2Q50A 4F2HA 1WPGA 2QV7A 3JXEA 4CMBA 3TL2A 2E4ZA 4BJ6A 4NCHA 4IG9A 2BN4A 5JSUA 2FG5A 1Q7GA 3WMWA 5JLAA 4ER7A 3U7GA 2XE6A 4KOAA 4LIPD 3TG2A 2AJ8A 3G0BA 4GQBA 3ZNPA 3KG2A 4D79A 4WCFC 2JFHA 1JFLA 1GSHA 4XVHA 1GPNA 3UMVA 4MUKA 3ZQ6A 3SLRA 1BMFD 1I3CA 1E64A 3QBDA 1ISGA 1F0KA 3NASA 4MV0A 3KR2A 1XD2A 4CMCA 2ZJFA 2PKQO 5WRFA 1HV8A 2Q4RA 5BQPA 3RE1A 2OLEA 1UEJA 2WJ3A 3BL5A 3GMDA 4QQFA 2FZWA 3IIEA 4MLPA 4JKOA 1U8UA 4RGVA 3N7UA 5KNDD 1HE2A 2DCMA 4J3NA 4MUXA 4RFVA 5FF9A 4ZFNA 3ZHZA 2IV3A 3KQQA 4E7OA 2BV3A 4W5HA 1R4MB 1JR4A 4ZAVA 5G41A 3L6DA 3WLHA 1BXZA 2GLTA 4DG9A 3SIWA 3R5SA 1FTNA 1GZUA 1TTHA 2W6NA 3OY7A 1WHSA 4QYIA 3R8CA 4A4DA 1PYOA 5C5EA 1E89A 4KGVA 3ZTWA 3O9VA 3OX4A 4E2ZA 2F1OA 4R41A 3KAPA 1GKUB 4HG2A 2VZ9A 2CXRA 1CJVC 1M67A 2CE2X 4S1TA 2OGUA 2BBSA 4D80A 1ZUHA 4IDEA 1DRVA 2JFXA 4IJMA 3S6JA 4A0FA 1L5HA 4C0SA 1BCRB 4J0HA 3G5MA 4U2CA 1SXQA 4IHJB 4LBZA 1ISMA 4EHAA 4KGXA 2TYSB 3QE3A 1J21A 3C45A 3IEXA 3DJYA 3Q2OA 2F43A 5IF9A 5JJBA 1JBQA 2ZCJA 1AHPA 1FJXA 1PX2A 4LYDA 4GLBA 3HP4A 3NC0C 4H6PA 1VMDA 4BMCA 2CLLB 5BVHB 4BXOB 3JZIA 3WY9A 2M6SA 1O95C 5IKPA 3T3NA 3AVOA 4UMEA 2WDZA 3WNZA 4DOMA 1U3FA 4FI3F 4WTOA 5J63A 4Z4QA 4F6CA 2WA1A 3LI2A 2VJAA 4YHBA 5EVCA 3RBXA 1E98A 4DYDA 1O8BA 2OZKA 4KN6A 4BAZA 3RYHA 2WIFA 3I28A 1RAGA 3V97A 2C8KA 5BYKA 5LQAA 3DPIA 2YMMA 4OHPA 5LYJF 4WEOA 5DHQA 2H1WA 2WWYA 4R2KA 1YDMA 4OP3A 4ZV9A 5C4IA 3ZZTA 2JHAA 2WNHA 1TD9A 3ENZA 3EZLA 1Q0HA 1NN0A 4R16A 4W4TA 1QFJA 4G24A 3WDSA 2EBUA 2G9VA 3T0IA 1O94D 2UZAA 3JQRA 5H82A 4MW5A 1HE8B 4TX1A 1OKKA 4HUJA 1XRSB 4MIKA 1C9DB 2YN0A 4XIGS 1OA0A 3KQYA 4EHBA 2D1QA 1N2IA 1TA4A 5BUZA 1MH1A 1L4YA 2Z8YA 3NALA 2QLJA 4TL6A 4BPRA 4PHTA 4EKGA 4TYMA 5HYVA 3EUFA 2Z30A 4LK3A 2OV3A 2XVMA 4TQGA 1VE9A 4DLZA 1NLZA 2DFDA 2IEZA 5A6SB 2XGOA 4JNCA 4US0R 5ECWA 3EGXB 4Q4HB 5A4DA 1BKDR 3OUUA 5H68A 4HEQA 2XT0A 5G1PA 1JDZA 2B83A 3X3HA 4ASUD 1C50A 1ULBA 2D3TA 2P5TB 2GCOA 2ZE7A 3JAKB 5CNMA 3RRNA 4ZO7A 1R0ZA 4C78A 3CMMA 2BDUA 1QO7A 3CW8X 3DDUA 1SVMA 4QWWA 1XV5A 4RU1A 3EGWA 4WV3A 1WHTA 3MW8A 4FFRA 5K0CA 5IT9A 4JXKA 3NAQA 2WQZA 1JEJA 3IAEA 2YY7A 4RZUA 3TGWA 4I3GA 3FKSD 1S7GA 4BCBA 3KB2A 3TZBA 4BP8A 2IP2A 3GRUA 3OZRA 4XTRA 4V1CI 2IP1A 2QB5A 1K5HA 4NX2A 2F4NA 2WE7A 3NU1A 5HOEA 4BLTA 2OC9A 1WVIA 3EPRA 1JTVA 1P61B 2IITA 2XOKD 4GL2A 1HEUA 1D7OA 1ZD4A 4MTLA 3TJZA 1QP0A 4NYMR 3O1HB 3RC3A 1IHPA 1X15A 3RS5A 3VYUB 4JFAA 1O97D 5F7JA 4BO5A 4GP7A 5EJ7A 1XDSA 3MUFA 3WQBA 1W6UA 2QIOA 1AH2A 5FTLA 1KO1A 1N9GA 2BZGA 3GJ5A 4MAAA 2JANA 3Q88A 3IA2A 3A4IA 3PFBA 2FZEA 4RY0A 3A06A 5K2MA 4EVIA 5ADHA 2HTEA 4G97A 5F7ZA 4YRFA 4A8JA 1C3XA 4Q7EA 5ENZA 1PZGA 1H0KA 3Q15C 2H4XA 3F8TA 3LT5A 2VCEA 4HXFB 1PGJA 3U7HB 1ZD9A 4IWNA 3RNLA 2GOYA 3SVTA 3C8UA 4A27A 1TI7A 5K3CA 4MB2A 2FRDA 2KWIA 2RHRA 4KX5A 1E58A 1ISFA 3BS4A 4GWLA 3EY9A 4R2HA 5CDGA 2P9QA 1Q7CA 1DX9A 3A9WA 4KO8A 2WJYA 1JU3A 3H05A 3JWEA 3WAGA 4LWQA 2BRUC 1GPYA 1W96A 4KXNA 4CLDA 3NM4A 5KNDH 2ZXEA 3Q5GA 1J9ZA 2WBLC 3E5MA 1XRJA 4I8XA 2R6GA 1F4LA 1WE2A 4QUGA 3HV0A 1FLNA 3RJMA 4DDWA 4TQAA 3IS3A 4QTZA 4JB0A 3STTA 5HKKD 3HBMA 4F7DA 2J45A 3ML1A 4NPHA 3CJTA 1GKIA 3J81A 3WB0A 4EY7A 2J3JA 3WICA 4BUCA 5JSZA 1V16A 3ZWDA 1HNZB 4OYLA 1EWYA 3BJRA 3WBBA 2C3PA 4PG7A 2I8CA 2JLSA 1CCWA 3LGXA 4LZLA 5A71A 1QDLB 4R8RA 3TBFA 4CMIB 3WZMA 1SHTX 2FSHA 1XGKA 2HJ9A 3AR7A 4KZPA 1NUSA 4PAQA 5CP8A 5F35A 5HR5A 3OKPA 1CF9A 2IELA 3OLXA 4GGMX 4DR6B 1S2DA 1IXZA 4QICA 4CEIA 2BGJA 1ENPA 2HPAA 2QROA 4RORA 3ZI7A 1GPJA 2NXWA 4E33A 3MILA 4FGLA 4IDAA 1FJGB 4KODA 4W1RA 5CCXA 2O8EB 4QSHA 3LY8A 1K7EB 4RXMA 3FHLA 4UOEA 4R1LA 1EFRD 1X1TA 3W77A 3FNQA 3PPYA 4BLUA 4FYKA 3KWMA 4G1EB 1ZK4A 1XTTA 4B1FA 5E3HA 4B8WA 521PA 3LLSA 1RNLA 5A04A 5LDHA 1GCUA 1S2MA 2OCPA 2RC5A 4IVQA 4UM9D 1A9XA 3T7EA 3MTEA 1NQAO 4Z9FA 4M1WA 1QF6A 3WKDA 3ONVA 1VJDA 1IVNA 3B7GA 3GQBB 4R1SA 4OJYA 4C7BA 1YBVA 1AS3A 5JC8A 2BPOA 1VJGA 1OYVA 1TW2A 2HXGA 2CL0X 1PKEA 2RKWA 4D42A 1DXHA 1IBLB 5IAGA 1B8UA 4DC9A 5JEEA 3VR4H 3IKVA 2IHVA 1Q7BA 1HFKA 4F2PA 1NM5A 1F7UA 1XHEA 2G40A 1I0ZA 4X8OA 2Q8PA 4TRNA 4KFUA 2JBWA 3B7PA 3SXUB 3OE4A 1CQJA 2WYVA 3DT6A 4R7TA 5BSMA 4BWVA 2QJFA 4PR0A 1OMOA 4ZEWA 4DHWA 4QLBA 2D8AA 2NV2B 1LD3A 1WWKA 4YP1A 5KWJA 1DWOA 1M1UA 2PLRA 2Z83A 4B3MB 3PHLA 4FFMA 4OX9B 4REMA 1FFBA 4RHTA 3SNHA 3MXOA 4KH0A 4EPRA 2Y66A 4CTJA 3OIDA 4L4XA 1LGYA 3T5DA 4O6VA 1MVOA 3E7DA 5ITZB 2I6GA 1QH9A 1FDVA 2VUTA 3RRMA 5EIEA 5CLFA 4FUQA 4DLWA 3V80A 5B4VA 2YWBA 3N0XA 3W5DA 4FDVA 4DMFA 5K0LA 4A3SA 4CKCB 4NV3A 3ZEIA 5KSWB 1M2NA 4IIFA 4O4HF 5A4KA 1FLAA 2C4NA 3TSYA 4ZQEA 1YCGA 4L6CA 2PL5A 4UMVA 1NI5A 4KQEA 1BYUA 4N39A 1EXNA 3UG6A 2UZ1A 3AUTA 3PENA 2B99A 2VT2A 1R0LA 3T9AA 3KYDB 2ZK7A 2OZVA 3ANMA 5ULLA 1D04A 1W5FA 3RK0A 1Z22A 3C4QA 2C97A 4TTTS 4ZEMA 5CIYA 3PR1A 4NR0A 3WC4A 2G67A 3C8DA 1NLYA 2KQUA 2XWBF 4JCCA 2ZJ8A 4MR8A 2B7LA 4DA6A 1YJ8A 1UDXA 3NW9A 4PLWA 1P6XA 4DL9A 5KHLB 3UMGA 2GARA 3Q6NA 3P32A 4G5QA 3WYAA 4ZK2A 4C05A 2BFNA 2IH4A 3OZTA 2FN9A 1NX9A 3C7TA 1FX1A 2CLKB 4EFMA 1QGED 1QM5A 3JYOA 1USWA 2POQX 1C4XA 3NBXX 1Y9DA 5JASA 1KRXA 4JX9A 4PS1A 5KX5B 4X1IA 2VVTA 5L3RA 3FF4A 4RTSA 1L4BA 5D6NA 4WBNA 3FMFA 1XWWA 2NO5A 2IZ0A 3O91A 4UEJA 5EI5A 2VA8A 2DBRA 1MC1A 4L4UA 1PTJA 4BDTA 3W2GA 5KB3A 2OXEA 2QAGB 2QX4A 3BF8A 4Y9RA 1T1JA 4CG3A 3D0RA 4HLDA 2BFCA 3DV0B 4DV7B 2OCGA 2DTEA 1M6YA 3DDCA 4JQYA 5ADVA 2H2FA 2XMSA 2Z9DA 4HWRA 4LY0A 3GG9A 3ROGA 1MDFA 3PU6A 3QFHA 1ESDA 2XQIA 5TQJA 4DLSA 5A0VA 2HY7A 1N5DA 3IPYA 3K5PA 4XI9A 4YYZA 3NT5A 1P1FA 3L7NA 4QNMA 3B51X 2H1FA 3LX8A 3U2QA 4ARIA 3WL6A 4K2AA 4IQFA 1YQTA 1DC4A 4RLFA 2IT1A 1PR2A 3FNHA 3ICCA 3INGA 4RPHA 4GECA 1IZ8A 2Y6UA 3F71A 2X41A 4QUAA 5LM3A 3DT8A 5BW8A 1OH5A 1FSGA 1Z4JA 2JC3A 5BSTA 1GNLA 2PZMA 2COUA 2MYNA 1VKZA 2A5FA 4LSZA 2I3DA 3HMQA 2YOHA 1T9GR 2GHRA 4WESA 3S2GA 3SHQA 4EDHA 3JQGB 3QJ5A 3ZX4A 1AUXA 1TD1A 1TZBA 1Y9JA 2H6EA 2Z2JA 4L5CA 3VM6A 4IP0A 1NFFA 2WQ7A 3GO4A 4YT4A 1FZQA 5LKRA 3ICQB 1KEEA 3GMTA 3I6YA 1LY1A 3FOWA 5JDCC 3CCCA 5CH3A 4BGVA 1W7AA 3E7PA 4FHCA 5AW5A 4NU5A 1Q6ZA 5AJWA 2C57A 1JHYA 2VP0A 3RK4A 1Y89A 2IH5A 1C30A 2J48A 2YXLA 2AOXA 1JLSA 3ED5A 4ZVMA 5AYVA 2OWDA 2O2YA 4NF2A 5EKDA 3TZHA 2AC2A 1E2JA 1PQ4A 1IIBA 1M34B 1OBFO 1YS7A 2Q7XA 4MO9A 3WR5A 1JH9A 1ZWLA 4ZOLF 2EW8A 3DVAB 4RV9A 1W5SA 2IF0A 3H3JA 3ITDA 4RTPA 1TAUA 2W2LA 4CMHA 3GX1A 1I80A 4Q39A 3O90A 4FMCB 3HUDA 4L7QA 3PB3A 4RV4A 4DM4A 1VPTA 3O4RA 1GFSA 3DFUA 4LXHA 5CT8A 3AONB 4EHFA 1YCFA 1Y3FE 3FFTA 2CNNA 2AYZA 2P9GA 4ARAA 4KK4A 1I4DD 1V1MA 3V55A 1B8OA 3V4PB 1TEHA 1VBFA 4QU8A 1S8FA 3G2PA 4ZCMA 1VDMA 1DIAA 3LDAA 4D82A 4H7JA 2CD9A 5D51S 5FV4A 1M5RA 1P3Y1 1PZFA 3Q8MA 3UKDA 2QMUA 1Y5MA 4FUTA 3MRVA 2YRFA 2BAGA 4M38A 3F6YA 1USUA 3N76A 4XX0A 4K9SA 5DP2A 3TMKA 1XQWA 5CM9C 1MB3A 1MG5A 2ZI5A 1I9CA 2D8MA 3L0YA 1DCKA 1M2EA 1ESEA 5DTJA 3GNSA 4TSFA 1ULAA 2CCGA 5BW6B 3D4PA 1C2TA 1RLOA 3EIWA 1AMOA 4HQFA 4QQNA 3DS8A 3RJZA 1UODA 3IE2A 4JT8A 3VKWA 2HWKA 3SX2A 4ALNA 4F0JA 2JLWA 3MS7A 1JI0A 1G4AE 3NTUA 3JQ9A 4H3HB 4IQ4A 1QU3A 1G4UR 3F1LA 5AD1A 1S4QA 3OJWA 2QI9F 3USCS 1ZICA 4NJMA 2HK8A 4FT4A 3E4CA 3KR0A 1EXDA 2P5UA 2N9UA 4Z7OB 3INRA 4I08A 1YS6A 1ONSA 2IUEA 2QTAA 3E5HA 1KIAA 2WICA 4C3VA 1JTFA 3RRBA 2ZB3A 5JATA 3TUZC 1GZSA 2VH1A 3LVQE 3ZN2A 4QJ3A 5AJVB 4MYSA 4F46A 5LJLA 4ERNA 3N5KA 2YDYA 2D06A 3G0OA 4JBWA 3COPA 5TJHA 4B3SB 3AGPA 2W5UA 1LVHA 1C1XB 3M9LA 3HJAA 1UDAA 2XZDA 3IB3A 4GBGA 1US8B 2HCRA 5H59A 2P1ZA 3S28A 5T4HA 3B2NA 3ZK9A 5BMVF 1R0CA 3CBQA 3AR8A 4NBKA 4KK3A 2MIIA 1TC2A 4MVXA 4L78A 2X0IA 4L02A 3OT1A 2X19A 3W0LB 2G28A 2OBYA 4TKUB 3TLJA 1UT5A 2FSIA 4M46A 1KEVA 5DSTA 4AKTA 1G6KA 3VTAA 2N75A 5JD5A 4XCQA 3W5IA 4B85A 5IULC 1JHZA 2WP8J 4IDGA 5HFNA 3QU4A 3TOZA 1CUJA 4X97A 2P2NA 4MIOA 1VGRA 4O4LB 4NMHA 5AHRA 1QRRA 2VNSA 4DKXA 5CFRA 2P27A 5JD4A 4NIMA 5BV2P 1MVLA 4V03A 4PN7A 1GUFA 3P9IA 5JNVA 4GHWA 1F8FA 1ZAYA 4QXQA 3QHQA 2HLDA 2FF5A 1KOJA 5HP4A 3COVA 1W4CA 3HKEB 2R1TA 3WO1A 3B3QA 4L5IA 3HDYA 2HQOA 1KOFA 3ACDA 2HXYA 3ANLA 5K51A 3TE7A 2ZWMA 1JQAA 1E2GA 2R97A 3C3MA 3BMCB 1UK9A 3TB4A 4EPWA 5BXQC 3L40A 2BFBA 4MS1A 3M1YA 2O07A 1WZEA 1E1RD 2XD4A 4FJ1A 1D03A 2MCFA 2XCRB 5CA0B 4UBKA 2Y77A 2B2CA 2BFDB 2VSOA 2FSVC 1R5OA 2D2XA 2AR9A 1DBRA 2GVZC 3HYLA 3W5SA 2JLAA 1A9YA 1YZ3A 2OO5A 4DLVA 5G2OA 2PJDA 5LLSA 3PDCA 5FJIA 3G49A 1IMJA 1GEEA 1XZAA 1CZOA 2WHRA 3R7FA 4P5PA 1IJBA 3QTTA 3TGPA 1J25A 4DSAA 4LZOA 1X19A 2XJ4A 2TRSB 2YMLA 4PAMA 1FPMA 1EXVA 3V48A 4D3DA 3L82B 3UEOA 3I5YA 5CG1A 4N0QA 1Y4AE 4MYUA 2BGNA 4KXYA 3CE6A 1RQRA 4IBOA 4IIUA 4W5RA 3F3YA 4X3OA 5LVAA 1AGXA 4MJ3A 4BKQA 3ZW9A 5L53A 1E2QA 1VLJA 3E1GA 4DCPA 4MLCA 3MCZA 2EBFX 3CCBA 1U8EA 2PUWA 4JYPA 3LC1O 5KHOC 5JROA 5HQ3A 4BTVA 2PFKA 3TQTA 3AP1A 3JARB 3T1NA 1NJSA 2W6ZA 3F9RA 3OTQA 4LXUA 4EF6A 1CR6A 3MGGA 2PKYX 4S2EA 5DTIA 3NHJA 1AN0A 1OBVA 4DABA 2XUKA 3UA4A 4DSUA 3YASA 4JC4A 2WFZA 3FOCA 1KK0A 3UJ3X 2Z1MA 5LL6P 2R8XA 3KXKA 1PGPA 5BPHA 2J5BA 3HLYA 2BBWA 1AM4D 1QGYA 1LKZA 5BURA 3ROEA 1KK3A 3S44A 4KTVE 4MKHA 3BJMA 2IV7A 5CFNA 1RYMA 5EJ9A 4Q1EA 5CYOA 1ORTA 4B84A 4NCAA 3UN1A 3HXOA 2OOSA 1ZM2A 1Z7YA 3N07A 3EC7A 2O1SA 4MWOA 1YRBA 3DC7A 2WWHA 4WESB 1B14A 1IUPA 1GZDA 1Z28A 1JXOA 2CGEA 1L7VC 2EFCB 2GD2A 2I5PO 2IUFA 4HUQB 4MW7A 4FEYA 2PRIA 1EVJA 2Q5JA 3QPDA 4Z0NA 4BX3A 2XVYA 1MDBA 3JD4A 4MA0A 3I5AA 4A8HA 1X77A 1JQBA 3OD5A 4FP9A 4IRMA 1D6NA 4R9NA 4KG7A 1T0JB 1V6CA 4H1VA 5EIBD 3ZCPA 5KNCH 4O2AA 1XVLA 3EGOA 3QBEA 5K8TA 3UKJA 4TVKA 3N2GB 2X3UA 3GYGA 3T3OA 1G21A 3CLTC 5KU7A 4WD3A 1XKLA 2HK6A 3WYFA 3QLUC 3EXHC 1H1DA 1IOVA 1T9GS 2EZ9A 1DXOA 3DBLA 4EQ6A 2CZGA 1U8YA 1W0KD 2C8JA 1JZQA 3QKTA 3VR6H 5L9AA 5B1DA 1ULHA 2Q5FA 1FP4A 1GJRA 5FWAA 3RYFA 3QF7A 3E9DA 3EYAA 3HWX1 4R9UC 4B9AA 2RCYA 3QYPA 2EOAA 1BU5A 2A1UA 2EGHA 2JJ2A 3D3NA 3A9VA 5AO9A 3QYJA 1UZNA 1G8JA 4PHGA 4CM5A 4FKZA 1EX1A 2VDMB 4CM8B 2WK1A 3EGXA 3HVJA 4G6ZA 1CY6A 2ZJ6A 4Q4HA 1U3GA 3TQOA 2Z6VA 1E7RA 2DJ5A 3HB5X 1E6CA 2V7WA 1N1MA 3UB2A 3WHPA 4EY3A 2VC2B 1C14A 1H93A 1GRCA 5ILOA 3P2EA 1YVPA 1FQOA 1RLUA 3GV0A 3H1FA 4N65A 3ROPA 2ENUA 1JNXX 1CUDA 1DJPA 1EFPA 4REOA 4GDFA 4C0WA 2AE1A 4MK4A 3LUDA 3PVCA 1VTKA 3SDBA 2II6A 2PMFA 3JX9A 3K0BA 1MO3A 1P3DA 3EFEA 1CNMA 2VRNA 4XWYA 4YAJA 1CR2A 2BSXA 2X2OA 5I7UA 1Y7PA 4Q3DA 4H7IA 4IINA 3N05A 3BTOA 3EXG1 3DYVA 2WDPA 2J3DA 3LW8A 3A25A 4FZJA 4RIIA 5FBRB 1O54A 2XUDA 1OFTA 1WDKA 1AB5A 4LV6A 4NBSA 5B7NA 2R1VA 1DAPA 5L4SA 3Q9SA 4WZAB 1V8FA 3QPCA 1VLVA 1EK6A 4YRPA 4Z7NB 1P7VA 3TLXA 3TRIA 3NEPX 3VDRA 1L5OA 2VN8A 3X1JA 2PGJA 3ROTA 4PG5A 2ACEA 2GNAA 1KGDA 3RFUA 5C1PA 1O6BA 1R0RE 2VYNA 3K8YA 4Z3KA 1OGYA 4NNOA 3VR1A 1XVUA 1W0CA 3EG9A 1E3LA 3H9BA 1YRLA 5IASA 3EVGA 1AHHA 1BE1A 3EUEA 3M6FA 2H11A 4I1SA 4JP2A 1Q3TA 4QYWA 5C51B 2H1LA 1P1KA 1OV6A 1J4AA 2GX6A 2DLCX 1XCLA 5DLEA 2RCNA 4Q16A 4OAQA 5JCOC 3THWB 5KWSA 2VYVD 3W9BA 4B2YA 5CCBA 4Q1DA 3T1VA 1QTQA 2EKDA 2WSSA 3RUEA 2RH4A 5DTRA 2ORIA 4F1JA 4PGAA 1N5OX 1QANA 4WJZA 3I4LA 3OIYA 2BMVA 3IQDB 2AFIE 3OPNA 4DJFC 1WCWA 3SYLA 4CT5A 4XIIA 4LF5B 2R96A 3F6SA 3ZPXA 4Z0TA 2V96A 5CCEA 3MD0A 5L3SA 4LRSB 4ZU1X 2VWHA 1OX5A 1CUFA 2I99A 3GEMA 3OZVA 5AKEA 2W6PA 5CX1A 2GZSA 4AZTA 1RQ2A 3K7EA 5JAZA 1F1BA 4E4YA 2QX8A 4OJNA 3E53A 1OUMA 2YXPX 2J6HA 5K0EA 2HJVA 3CH7A 5TPZD 3O21A 1XROA 3WLEA 2Q8NA 4BZZA 4E30A 3E82A 1YA4A 1EK5A 3B52X 3K9QO 4BRUA 3M82A 1N5RA 1H4TA 2W98A 3GCZA 1X7GA 4J0CA 4Y2YA 3KEFA 3QV2A 4MPJA 1TXGA 1Y8QA 2YQ4A 1E94E 3M6XA 3QM1A 4PAGA 4NEQA 2I4TA 1Q1QA 3AEQA 3M6UA 3V2UA 1RT9A 2ZBEA 3PVSA 4ZAFA 1OAAA 2RH8A 3G0IA 4WK4B 5D3MB 4JI3B 4E11A 1WDWB 4QUDA 5TXGA 1CG6A 1ZMXA 3W4KA 2A2ZA 2AN1A 3QVJA 3EIHA 5AK3A 3PI6A 3SC6A 3UO8B 3VMMA 1ZVJA 2GH1A 3I32A 1H1LA 1N2GA 1TVEA 2FPOA 1X7DA 4FHZA 4YQEA 2D2EA 1QGUB 4PONA 5EE9A 4ERXA 3OLYA 2ZE5A 1N0WA 1ZH6A 1Y1RA 2F3UA 3DC2A 4TLCA 4F5EA 1K4KA 5HHTA 2DHEA 3HKCB 1EWVA 1GUZA 2DY1A 1X1AA 3A37A 4N1AA 1GZHB 3L8HA 1RQGA 5IAKA 2DR2A 2VF7A 3GVCA 4O33A 1SVLA 3K0KA 4LY6A 5BQ5A 4Q82A 2HJSA 5T4FA 1Z73A 3AVYA 1R0BA 3M4XA 2IPLA 4EJMA 3K71B 3VTZA 3WSWA 3O8RA 1G6OA 1WJGA 2OV2A 4Q3OA 3E2IA 3JQFC 3L92A 3WHKA 1TF2A 4BKOA 1JKJA 4U5XA 3FAKA 5CDTA 3UYLA 4YAGA 4NCIA 5E4YA 1JFVA 4B40A 3X1WA 1E4OA 1HDXA 4PBRA 5ALIA 2EJWA 2GBLC 3D2BA 4K26A 3H2ZA 2VYND 3BHIA 4J3JA 2JIRA 3QTLA 1P4HA 4UVDA 4M7PA 4M6WB 2HM7A 2QRNA 1T35A 2XSZD 4XARA 1MAVA 4X7RA 3WQQA 4B5LA 1N5LA 3VKUA 4DG5A 2AMJA 1FUEA 1G0NA 1NNUA 3UC9A 1SOWA 4OFZA 3KM0A 1COWA 1B76A 1GAEO 1P33A 3W7VA 2GZ2A 2Y0CA 3GD7A 5DT2A 4IKEA 4YRQA 4ZXPA 1NVVQ 3QPWA 4RESA 3E3LA 5J47A 2PJRA 5CR9A 3HUFA 4YRIA 4G4SP 5FOWA 4O63O 1TUBB 4EUEA 5JFOA 2GPYA 3HBLA 2YHUA 1A72A 2AVDA 3KVYA 2Q2OA 3BGIA 4UAVA 3KYBA 5CDYA 2RB4A 3TPZA 4ZTZB 2PUCA 2BUCA 4GH5A 2VNKA 5DWQA 2AFIB 4O2AB 1Z68A 2IF2A 4MMXB 1H8EA 2ZT6A 4B3FX 1Z3IX 5KJ1A 1EG2A 1KC3A 1L7MA 1SZJG 4YP6A 2FLVA 4KQHA 1USGA 1UJNA 5HNKA 4LF8B 2ODQA 4XX1A 4K0RA 4YJ2F 4PRLA 4QTUB 3RVRA 3D4NA 3GT3A 2HMTA 1BS1A 3PV0A 4Q9JA 4Q7JB 2NTJA 3QUBA 3VR4D 3K70C 4X5OA 4MB6A 2FW8A 2IEIA 1BA2A 5DHUA 4UAJA 4P35A 4BNIA 1XPRA 3E8MA 3TTVA 4B82A 4V39A 2ZWOA 4JV5B 4GI7A 1FZTA 3RS4A 4UBNA 3CKYA 4EG6A 1T1GA 4ZMBA 2F6RA 4GS5A 2NSLA 3KYIB 4LWOA 1XE3A 3VKFA 4KWTA 3KJZA 4DV2B 3IUYA 2H1IA 4I1UA 2PBZA 4XQ0A 5F4ZA 1PJZA 2KS6A 1YMUA 1UF9A 4HRYA 2EF0A 1OB2A 1RWNA 2OQIA 4L3VA 2BEWB 4QNNA 3C2QA 2B3TA 4L0MA 5E6SB 4BC1A 5IKXA 1GRVA 3MLEA 5FBZA 2AHRA 3NHLA 1EXWA 2YJ4A 3NHUA 4JBHA 1BYIA 5BWNA 2O3SA 2YHIB 2GKOA 4FLFA 4EL0A 5DXJA 4Z7QB 1T6ZA 1LDGA 3N86A 3SIRA 2GPSA 4CTNA 4J1TC 4PYJA 4K1LA 4NL4H 1Z6TA 3BRWD 2J31A 2GSWA 1K6EA 2NO9A 5DBIA 1N1GA 2E7ZA 5AW4A 3GRCA 4N01A 3RSQA 3EIXA 2BSAA 1MORA 3ES9A 5BN4B 3MBKA 1ZJYA 5ADWA 3ER6A 3RYCA 2Q1XA 1P7PA 1Q0LA 4Q15A 5SZIA 1R4NA 1SVIA 1VJ5A 3DUFA 4J1QA 3TSZA 2G82A 4WCDA 4J1SA 1AKQA 4MJXA 1AQUA 3LCUA 5BVGA 4I1PA 2FPIB 3AVTA 4RD3A 2PIDA 2ZPAA 4Q47A 4WFQA 4PZZA 5AI0A 4B83A 4GP6A 1KZ4A 1V8OA 4I3FA 1XYGA 3HJHA 3NOXA 4IYJA 4OH7A 1UZUA 3OA2A 3SOPA 2P9HA 2ZVPX 3ABQB 5JXGA 4GKKB 1WZIA 4BNKA 3LPCA 3VSAA 1XMIA 1QB7A 3TX2A 1RXSA 4YAIA 2A88A 1KSHA 3KQHA 4GR4A 1L5LA 3P97A 4PX2A 2C94A 5EXEA 3TW8A 3TRJA 1G0OA 1BE0A 1OPRA 3FMPB 4QRHA 3PGA1 2P2SA 1XCMA 1W88A 2M2IA 2PGAA 3CV3A 4ISBA 4RJ2A 4BNYA 3SKVA 2FX2A 4OMDA 4E4TA 5HVNA 3G59A 4C0BA 4ZI7B 3CF4A 3N59A 2OZEA 3UTCA 4LMAA 1FX0B 4JEHA 5CB4B 4O5AA 1LSUA 4CLOB 1VI5A 2FB9A 3EEQA 3B53X 3WV5A 3I2IA 3DHEA 3EVAA 2O2EA 4Z4EA 3CRMA 2WB4A 1H8ED 1YQWA 2V7XA 3E2MA 3KSRA 3PD1A 4N6NA 4NMLA 4WZ6A 2Q99A 5D3ZA 3C41J 2AN9A 3KAKA 5BWCA 2R68A 3R3YA 4FNGA 3T6KA 2C0PA 2XXJA 3MCWA 1KKLA 1XAIA 5LUAA 1TT5B 4BVLA 3U44B 2ICAA 1TA0A 2RGRA 1ZU5A 3GGSA 2X4GA 5F23A 3H2SA 1XCOA 3TO5A 4N5NA 4PNPA 4BQFA 3MA0A 3PC3A 3KUDA 1YO6A 3EZXA 1JEAA 4JLOA 3H7IA 1N2XA 1YUMA 1MJFA 2GFIA 1HDCA 4YRTA 3TD2A 2FPKA 2LV8A 2HO5A 3AKEA 3B9PA 3R23A 2YWXA 3DTNA 2XNCA 3O4HA 3PJRA 3JRNA 2QVYX 3IYLW 1IDN1 3MF4A 5DIZA 5JISA 3T3GA 4BLVA 3Q98A 3AR3A 4XVCA 4JENA 1K6IA 5IYZB 3V3KA 2IL1A 3UENA 3W3AA 1FNNA 4ZK6A 2H1SA 3OPYI 4JVSB 2XB9A 3MMNA 5COQA 1U8FO 1SD1A 1V8DA 4RO0A 4NYIR 1D2AA 4LW8A 3AFMA 2HGZA 1ESNA 1NVDA 1L5QA 1Z06A 3FBTA 3LBHA 4JBLA 4ND1A 3UH0A 1X1SA 4JP8A 4RK4A 4MROA 4MP8A 3DMHA 1J1IA 3EGVA 3FYUC 3JQDA 1TJ5A 5BMOA 3KXDA 9GPBA 2ZUSA 3N9IA 4KB5A 2AG6A 4L9AA 2QZZA 3KPVA 3AYZB 1P17A 1XLVA 1UBMS 3OURA 3PGLA 4BMYA 4BS9A 1TZ2A 3HUEA 1YQUA 3TNLA 3IXQA 3RYHB 1YZGA 4C6TB 4ECEA 5JS8A 2OZLA 3BE8A 2XMRA 3U4HA 4KGZA 2AXQA 1KKUA 3U0BA 1OHHD 1TO1E 2JLUA 3UUEA 2PL9A 2QRZA 2R7NA 1VJTA 4W9NC 4BZWA 3MYRA 5A5GA 2XUOA 3TRKA 4F4UA 1RBMA 3I9V6 3PUYA 4KC0A 4NJOA 1PS8A 3GP3A 1AS0A 1YZNA 2OHFA 2IZ1A 3MLAA 4KWHA 3IVMA 3U81A 4OQQA 1R3UA 3FB1A 4AN0A 3H5VA 2C8LA 4GSYA 5HJ2A 2AV6A 2MSKA 1R6XA 2VSFA 3WX0A 3NUZA 3U4QB 1K0FA 5ILQA 5HDQA 1DBQA 3O3NB 2ODEA 1Y81A 3R7NA 4TSFD 1YF3A 1GTL1 2OESA 1A2QA 2PQ0A 4EMUA 2QU8A 1PJTA 3NYWA 4FZ3A 3ZJTA 1O8CA 2EC5A 2J09A 4G41A 2ZI7A 4FGKA 4MVCA 4S1OA 2W6JD 1E1CA 1N4AA 3IQGX 2JH8A 4U2GA 3ANXA 4IS3A 4U4AA 1GXSA 5TGDA 4B35A 3MCAA 4DB2A 4HEJA 2BISA 1GCGA 4MKZA 2B5OA 2L0XA 1YRQA 3WOVA 4BQSA 1I7DA 3L4BC 1BXRA 2IEYA 1XPUA 3THYA 1H8HD 4RMIA 2D1YA 2X6RA 3MTIA 1H2BA 2H52A 4MUEA 4FYYA 3DWIA 3VKVA 3F78A 3ZLBA 2C7GA 4HDMB 4MV8A 4IDFA 4OQLA 4DMMA 1MV5A 3MD9A 2ZP1A 3SE7A 3JYNA 2HV8A 1S2LA 4MQBA 4WLOA 1XJQA 2Q21A 2FUNB 4GWKA 1G64A 2W2MA 3IH5A 4E08A 3M9WA 2YFYA 4CGZA 5LQJA 4JEMA 3O83A 3O8OB 1TM4E 3MWLA 4BJ5A 3I12A 2ETVA 4H3SA 5ER6A 2P5YA 1VG9B 1NI4B 2W2XA 1RXWA 3VR3D 2WSIA 3F96A 1RTKA 1N2SA 1RC8A 1O1YA 3SYTA 1REQA 2JI8A 2HDNB 1Z4IA 1MB4A 2E49A 2RIPA 1J2YA 2XH8A 3G85A 2FP4B 2KLBA 5DTQA 5LU9A 1W36B 2BI7A 2FR0A 5IKOA 2NO7A 2GA9A 3OU2A 3CEJA 2ORVA 2AVNA 3GPLA 5P21A 5DIFA 1NMQA 3H1AA 1L0BA 3PHGA 5AMXA 2AI2A 2QRPA 4HEA1 1LJUA 4HDQB 2ZYGA 2EEPA 3ETGA 3UATA 3ZU3A 3DBHA 1UPUA 4EENA 1UBNA 3S1SA 3UWDA 1QQTA 1V1RB 2P91A 3DCNA 5K0JA 1NF9A 3OZSA 3C39A 4U6SA 5EL0A 4O2RA 4XPIB 2RHOA 5DGTA 4GBJA 1XG5A 2PZ8A 2CLIB 3T5AA 1FA9A 3EW7A 4MR9A 5KOYA 3L5OA 4TMZA 3IURA 4EP1A 1ZW6A 1JIIA 3P0RA 3HJUA 2NU8A 4C0LA 2E5LB 3AF1A 3UCFA 3OHMA 3U7RA 1JEEA 5E0KB 1QO0D 1OLSB 4BQPA 5B3JC 4X1KB 1W0KA 3SQLA 4HPJB 1KAOA 3VR0A 4IJ5A 1UPTA 2CLFB 2GYYA 2P6UA 4ND8B 4RZIA 4UM5A 2RBKA 5AK0A 5EC8A 2PS1A 5EP2A 3CPHA 4ER6A 1DAKA 4QEDA 1L6IA 2BM1A 1CRLA 2P1DA 3UJ9A 4B44A 5LD2B 4KUEA 2OORC 3LKBA 5AHXA 1A5TA 2PVPA 3O26A 3Q6IA 4EY5A 1XZGA 3G79A 1BG6A 3R7BA 5B53A 2BBTA 3VO9A 3KVNA 2QLFA 3E22A 3JVUA 4UHEA 5JZSA 1X3LA 1NMZA 2O8NA 5DI3A 4PBTA 1YB5A 1AB6A 1IWOA 2XTZA 2JIOA 4DLKA 3OVMA 5ES4B 1U2GC 4MQLA 2R8PA 1E7MA 1WXFA 4D0RA 8ABPA 5D2CA 3BMOB 4K6CA 5K8CA 3GLIA 1OZGA 3OEYA 1C29B 1W6RA 1H9BA 3VR6A 3N5CA 1TPYA 1XRPA 3L41A 1FOEB 3RDPA 1WUYA 4I3HA 4Y7DA 1DDIA 3DGEC 5C5CA 1LVUA 3BD8A 3L7CA 2GVDC 1BW9A 1CDDA 3TR5A 1ND6A 2AOUA 3CVVA 1VPVA 4ED9A 2XA9A 3Q8KA 3CF2A 1X1EA 1GAWA 1AQIA 1U9CA 3UK0A 4U2FA 6NULA 5K6TA 2FDRA 4TUYF 3FLEA 4JBGA 4JZKA 1CVIA 4R8KA 3L77A 4JX8A 1E2LA 1T29A 2FDXA 1P2TA 3LDHA 4WNCA 3E7FA 4N7BA 5AUPB 1VLLA 4B9EA 3PQ2A 4DIKA 3D64A 2IEGA 5B55A 2X0FA 1CYEA 1Z5OA 1O9BA 1P2GA 4LYHA 4L16A 1KSGA 3UYKA 3STHA 2OHXA 4F3CA 3WQSB 2GASA 2VTEA 2BJHA 3CN9A 3DOCA 4J0GA 5IEJA 4O2BA 1BXGB 1MP0A 4LGMA 2OXIA 4IDPA 2RGNC 2BFAA 5EXPA 2O8BA 3OFNA 5JNWA 3L7BA 2PZEA 4ZPJA 1EEHA 2V6IA 4ZO8A 5REQA 3ADOA 4FGWA 3CVOA 2HAEA 4B33A 1BX3A 3SQXA 2AD1A 2WT4A 4IOLA 3OM8A 3E8SA 3DZCA 5AHKA 2HSGA 3NEYA 4CODB 5LOVB 4GRAA 4JELA 2EP7A 3KTFA 4ZOLB 2VATA 3Q11A 4EKNB 3WLOA 2AX3A 4A7PA 2F64A 1DEXA 1IN6A 4WKBA 1RYHA 1SBHA 2XCIA 3LLUA 3BFJA 4WXYB 1XZJA 2R1VB 1RKUA 3OO0A 2A33A 4FBMA 3AX6A 4AMGA 1M1XB 1Y4ZA 1YR3A 2G0AA 2X1HA 4TZ0A 3ZWBA 1XYVA 2EG5A 4XWGA 1P1RA 5AJZA 4PLFA 4HXEB 4ZI3A 5DCUA 3MRSA 2GCNA 3I0ZA 4MSUA 4TYWA 3PFGA 4GNKA 5K0SA 3D8NA 2Y1FA 1HDGO 4YP7A 3IAAA 1NDQA 4IUCS 1G1MA 2YYZA 4WVFA 4XW2A 4BO9A 2DGDA 3DVLA 4YI5A 3DM9B 3TLGA 4CFYA 2DT8A 1VMIA 2WIBA 4FQ5A 4WECA 5CYFA 4GOKA 1KYWA 3RAFC 5K3EA 3PHJA 3QBTA 7ABPA 4AJLA 1QQ7A 4GX5A 4FILA 5EE0A 4I4NA 1T3GA