4CMBA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 94
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmbA00
4W9NA 3FR7A 4KMSA 4I9UA 3IUSA 1Z74A 4J1NA 4O63O 1YQDA 3BMOA 3H5RA 2YQ4A 2ZB4A 5DDIP 4IQGA 1P1FA 3GVCA 1PJ2A 3DBHA 4DQXA 4P4NA 1K89A 3NTQA 3WFJA 5GMOA 5BQFA 1Q7BA 4W7HA 5JFOA 1H6DA 3LZ6A 3W8EA 4DPKA 1R0KA 1T24A 3HN7A 4XGKA 1PQUA 3I3OA 3ASUA 3NUGA 1JQBA 3UOGA 6LDHA 2CUKA 1NR1A 1UZMA 3OA0A 2BMAA 5LCXA 1OMOA 5AXDA 1NTOA 1H2BA 1L7DA 5IN4A 3PIIA 4R5MA 3GN2A 1ZW1A 2J5RA 3DTYA 4R54A 4OXKA 3VZSA 5DCYA 1HDGO 1LJ8A 1ML3A 3FWZA 1P74A 1PEDA 4Q3BA 1M6HA 3F47A 3O4RA 1H6AA 2AHRA 3NV9A 4HADA 4HFJA 2NU8A 3IP1A 2Y0CA 5CDSA 4FJ0A 4FQ8A 5G0WA 4BKQA 3W6ZA 1UXJA 3WGTA 4UAGA 2X5OA 1LC0A 1XEAA 4YPOA 1QRRA 3BTVA 1E1LA 2WEKA 1X7HA 2EJVA 4LK3A 5TC4A 3I4FA 4CLOB 1BMDA 3RUAA 2GF2A 3CINA 2G1UA 1Y8QB 4TRRA 5EL0A 3AU9A 4JN6B 4AJNA 5IFLA 4X54A 5KCZA 1KOLA 4RO0A 3ROPA 4EEXA 4CUJA 2G76A 2CF6A 3VHRA 5JCXA 2AG8A 1LLDA 1E3EA 4UEKA 5MDHA 2HRBA 4HP8A 4MOWA 1J5PA 5KKAA 1DC6A 2C29D 2DC1A 2C2YA 1FXSA 5JC8A 3INGA 4QEDA 3WYCA 4ZHSA 5AXCA 4CL3A 4TWRA 4W4TA 4NBUA 4DPMA 3HSKA 1N5DA 2CY0A 1U2GA 1ZFNA 3C7AA 1DIHA 3I1JA 1B26A 2EERA 1O5IA 2DBQA 5T64A 5TJ9A 3PI7A 1HWYA 2I6TA 1YL7A 2C2XA 1QP8A 4AJ2A 3FNGA 3NGLA 3RJ5A 4RVHA 2BI8A 1GYPA 3Q3CA 3V2GA 1ISMA 3F5SA 3QSGA 1MV8A 3D3EA 5G0VA 3ZWVA 1DIGA 3JQAB 1NXQA 4HV4A 2C5AA 3ZU3A 1PZGA 2HQ1A 2P2SA 4MVJH 4RV9A 1ISFA 1X1TA 4CMHA 4E13A 2X9VA 4QSMA 4NR0A 1LLQA 4R3NA 4YJHB 2P68A 3L6OO 4FFMA 4I5DA 1NWCA 3VH1A 4EJ0A 4HKTA 4WE3A 3CEAA 3ROMA 3GH3A 3FNFA 2VRCA 3DZGA 2BH9A 1IPEA 1SB9A 3GN1A 3QLJA 4WCDA 3UXYA 4FIZA 1DAPA 1XKQA 1PJCA 4E12A 4RPLA 2ZTMA 3OQBA 5T5QA 3P5SA 2PD6A 3UICA 3M6IA 5IZCC 4RVUA 3E9QA 2EGHA 2Q2QA 2OGUA 5G0TA 1DIBA 1E3WB 1MB4A 2ZB8A 5H81A 4I1IA 5CDYA 1DXYA 2IZ1A 2VCYA 3UVEA 5HTOA 3E82A 3O8QB 4OSOA 3PZBA 2G82A 2ZATA 1PL6A 2UUPA 5A03A 4BKUA 3DWFA 1JWAB 2C0CA 4CLDA 4IDBA 5CPBA 5ILOA 2OORA 4PG5A 4JBGA 5TS3A 3W8DA 2Y99A 1E7WA 4JJIA 4ND5A 1B16A 1I01A 1XHLA 3HUDA 3JQBA 4UREA 3DFZA 4XCVA 4XIYA 1ZZEA 4Q3EA 1PGJA 4KZPA 2Q4EA 3IKVA 4CV1A 2WYUA 2ZB3A 3KXDA 5JNLA 2B35A 5C3MA 3UW3A 1ONOA 4CM3A 3RKUA 1RJWA 3E18A 3B1JA 3O03A 3P19A 1X0XA 4FCCA 3RUIA 3STHA 4B8ZA 4IZIA 3RUHA 4K6CA 2NV6A 2ZTUA 2DAPA 4O59O 4U8GA 4EJMA 1WLYA 2Z5LA 3MJSA 3ZHXA 2FSVA 1BVUA 4UVDA 2ZK7A 3UCXA 3PYMA 1WZIA 4CLRB 1WDLA 2J3KA 4J91A 1HDRA 4E31A 2EF1A 2Y0DA 5JY1A 4D3SA 2V6GA 2AQHA 1LDGA 4JK3A 5ITWA 4CR7A 4Q9NA 5JBIA 4H16A 1UDBA 3QHAA 5AVOA 4A27A 4YR9A 3L9XA 4J1SA 4E2ZA 3AUAA 4IY1A 3BA1A 2EV9A 3A06A 3H3JA 1R4MB 1OZAA 5U9CA 4C4OA 1YB5A 3E03A 4IQ8A 1N9GB 4XYLA 2FR8A 4NFYA 4R41A 1V6AA 5FF9A 2O3QA 1P0FA 2X0NA 4E32A 3F4LA 2I67A 5JPIA 5FWNA 1T2FA 3JD4A 3H9GA 2O23A 3ETGA 3ZV3A 1DFIA 4DQVA 3P2YA 2O3RA 4M1QA 4RPJA 4YQZA 5H83A 1UJMA 3VOSA 3GRKA 5CG1A 4YAGA 3TZ6A 4URFA 1NAIA 1U3UA 2B37A 1U8FO 5AXAA 4PG4A 5DBGA 4ZRMA 1T2EA 1EE2A 2QYTA 5BR7A 4KP7A 2VRCD 3WGYA 1U3TA 3GZNB 2Q49A 1IZ9A 4ZA2A 5TRTA 2YHUA 3LT2A 1E7QA 3TZKA 4B4VA 1ENZA 2ZCUA 5TJHA 4R1TA 2CF5A 3H9EO 2BFOA 5T8KA 3H9UA 3PJDA 5JE8A 5L7TA 1PWXA 3JQ8B 1CETA 5C5IA 6ADHA 1TT5A 3E5MA 5KOIA 3OA2A 1O8CA 3EDMA 4RLSA 4BGVA 5IDYA 1YH3A 4Q3DA 3Q2KA 4DC0A 2ZB7A 1J49A 4PZCA 1M66A 2JAHA 4D3DA 1SEVA 4LVCA 4Q39A 3C1TA 5HA5A 2VHYA 4ALLA 3INRA 3D4PA 4QFDA 4DMMA 2NNLD 1U1IA 4KUGA 1XCBA 3Q6IA 4JROA 2GERA 1EVIA 1V35A 1B8PA 3NJ4A 1M67A 3FI9A 3MEQA 4CMEA 1FJHA 4WCFB 2AE1A 5CHEA 3Q1LA 3PZRA 3BMCB 2ET6A 3EC7A 2HJSA 1ZBQA 1TXGA 3WNVA 2GPTA 2ZIZA 4NQZA 3ZWNA 5JW6A 1EQ2A 3CMMA 5L4NA 2CMDA 1Y1PA 3QQPA 4IS2A 5CPFA 1R12A 3V1TC 4J2HA 1U8XX 1CQJA 5EN4A 1DLIA 4EGFA 4CM1A 5B4UA 2PKQP 2O4UX 3GUCA 1NQOA 2BI7A 1YS4A 4B8WA 3PQDA 1MA0A 1E5LA 3S2IA 4EEZA 1D3AA 1EVJA 4Y9DA 3O26A 3W6UA 4FJ1A 1ZEJA 2X5JO 4CM8B 5A9SB 4RJTA 1Z82A 1RM0A 1Y6JA 4BNTA 3ANMA 4XR9A 1NFRA 1R6DA 1YE3A 3RC9A 2ZYAA 1UZLA 3WMWA 2E82A 3VPHA 3RUCA 2Z95A 3PHGA 3DOOA 3OH8A 5FI3A 5JAQA 3WOHA 3GG9A 4PFJA 4DRYA 2H9IA 4NU5A 5TIIA 1AUPA 1IY8A 3C1OA 1E1KA 4KQWA 3C7DB 5ENDA 4WJZA 1PJBA 4W9NC 5I9MA 3WBFA 5DP1A 4A26A 5IXYA 4WEOA 4MKRA 3DTTA 1OC4A 4IM7A 4RVGA 2W90A 2VHZA 2FN7A 5BSGA 1FDVA 1PGOA 3AOGA 5BSFA 4DREA 5A3VA 1N7GA 3A1NA 3KTDA 2CDCA 1AXEA 3K5PA 1V9LA 4NK5A 4K28A 4OQYA 1ZK2A 4DMLA 1PIWA 4J2OA 4BO4A 1H0KA 3IDSA 2VHVA 4HNGA 3KYDB 3I9LA 2YDXA 5IN5A 1LEHA 1DJNA 1SOVA 5I7FA 3GDGA 2PWZA 2VRBA 2DU8A 2YHIA 3NJ8A 3KZVA 7MDHA 1VKOA 3LVFO 4BNGA 3OQ1A 2XOXA 1DEHA 4OOFA 3X2FA 1I3KA 1DIRA 1NP3A 2O2SA 1K6IA 1NFFA 3OIGA 1LDYA 1B15A 1Y5MA 3HDQA 1BXZA 3O38A 1EMDA 4D3FA 3R3JA 1EUCA 3VH2A 2Y1OA 4WK6A 1EK6A 3S2FA 1DDOA 4DLBA 1D1TA 3AY7A 2HSDA 3VVBA 1JVBA 2FMUA 4MVJP 2D4AA 4JJGA 4NK4A 5F1PA 1IUKA 4RF3A 5KVSA 1YRLA 4TZKA 3FRJA 1C0LA 4WOKA 2O2YA 4PLWA 2OBYA 1XG5A 4OSPA 4FR5A 4ID9A 1CWUA 1XDWA 2PV7A 4IPTA 2XXJA 2ZCVA 3KHUA 4R5HA 1DSSG 3BAZA 3N7UA 4M55A 1MUUA 4BIIA 1VRWA 2FPGA 4I9HA 4BO5A 5KJ1A 4BV8A 5DZSA 3ZW8A 5IZ4A 1R4NB 1G1AA 1DC5A 3QVSA 4XYGA 7ADHA 1YJ8A 4PRKA 3RUDA 1QG6A 3PGXA 3E8XA 5DF1A 2HKIA 2A35A 2JCYA 1HZJA 4WLNA 4QX6A 3U9LA 1WMAA 1EZ4A 5EQDA 4ITUA 3WXBA 1NPYA 3WS7A 1ADFA 4E5MA 3KETA 5A5FA 3EZLA 4M49A 1GUYA 1GQYA 3WB9A 1K5HA 1PGPA 1PTJA 3DEYX 1I3LA 3QIVA 1GL3A 2YZ7A 3RC1A 1SNYA 1PZHA 4NJMB 4WGGA 5TGDA 1EEHA 2BGMA 3CKYA 2GASA 4CMGA 1FDSA 3KEQA 1KERA 1I36A 1DHRA 1JU9A 1R37A 1U7TA 5ES3A 4LRSB 1X15A 1X0VA 2HMWA 4JCOA 4XQ9A 4EBFA 1K6JA 3ON5A 2P91A 3H5AA 1SOWA 4DC1A 3PYLA 1KVQA 5B12A 1HRDA 4GSKA 1E3IA 4GMFA 3BIOA 3DXFA 4I5GA 1VL6A 4D43A 3TL3A 5FFFA 3PLRA 4BO0A 4HY3A 4YJFA 1KVSA 4LCEA 3GMDA 4I08A 1ADBA 1PZFA 5JO9A 5A05A 2Q50A 1LBEA 3GVPA 3WJ7A 1N1GA 3Q2IA 2E49A 2RIRA 2FPPA 3LF2A 3SC4A 1KBZA 1A9ZA 1W4ZA 2FZWA 4ILKA 1T1RA 1OI7A 3KOUA 2B0JA 4R9RA 2QIOA 4CUZA 3I83A 2IXAA 3JQBC 1SCUA 3LC2O 1TT7A 4L0QA 2GZ2A 5BNFA 3ZU5A 1M2WA 5EJ2A 4UEOA 5G4KA 1R16A 1VJ0A 3DBVO 1KIFA 5LC1A 1LI4A 4KUEA 1GV1A 1A71A 5B1YA 3SXPA 3ZHZA 4DYVA 1P31A 4HFMA 2FWMX 3WGQA 4BOYA 1DLJA 1G0NA 4QO7A 4MVJF 3TDKA 2AQIA 4B7XA 4BNZA 1PS0A 3EK2A 2PFGA 1KVRA 2JHGA 5GZ1A 2JD1A 1HLPA 1KS9A 2QW8A 1VPDA 2NU9A 3CE6A 3SX2A 4B3JA 3FNEA 4GX0A 5JDIA 4YACA 2YJZA 2P4HX 2EW8A 2Y67A 3IS3A 4EUHA 3ZU2A 3CZMA 3VDRA 4TVOA 2EIHA 2IRWA 4ND3A 3T7CA 3LLVA 5JDCA 4K6FA 1NR7A 5KWEA 4H7PA 1Q2XA 2PGDA 3GPDG 1GPDG 2GN8A 3VZQA 4HUJA 5A06A 1A7KA 2Q1SA 3RQSA 4XIJA 2UDPA 3GY0A 5A9TA 5JY6A 1PGQA 4AJ4A 2IEBA 2PH5A 4HFRA 4FS3A 4JXKA 1GU7A 1HE3A 4M87A 3ORFA 3JYLA 4MIOA 4QECA 1O6ZA 3ZWYA 4PN3A 2PLAA 1X7GA 4R01A 4ND4A 2JCXA 4BKOA 4CM7A 1P1HA 3HZZA 5B4VA 1OC2A 2DFVA 3C85A 4XDZA 2EKPA 4O5OA 3ST7A 1P45A 1JAXA 3G3EA 2X7HA 1E1NA 1IB6A 3AJRA 4NDNE 4CV2A 4RVSA 4B3IA 3SEFA 3JD3A 1HKUA 2VHWA 3JSAA 3W8FA 4D0RA 4RPGA 1D1SA 3ZWOA 3Q9NA 4AG3A 4GWGA 1DRUA 1LLUA 2CNBA 2RHRA 3LT1A 2DKNA 1SBYA 1X13A 1PU2A 3WICA 3AY3A 5LDHA 5T8KC 4OL9A 1T2AA 4EZBA 1WDKA 1DRWA 1PX0A 3DHNA 5K0ZA 1KY4A 4R4JA 3PWZA 1YJQA 1K0UA 4E2WA 1U28A 2NM0A 3PVZA 5L7WA 1PR3A 1XELA 4R1NA 3PDJA 3RU7A 2AMFA 3IMFA 4P4GA 1LUAA 4CM4B 2Q4BA 3IUPA 4BQPA 3ZGYA 3PHLA 4D45A 1Y8RA 2LDXA 3ZNQA 4IGFA 4BS9A 1ORRA 1BXGB 3PFFA 4J1QA 1WW8A 1OFGA 5FYDA 4EI2A 1XGKA 1EDZA 4XZ3A 2W98A 8LDHA 1EBFA 2QRKA 1HYEA 4BO9A 3DBRB 5L4SA 4GVLA 2VN8A 2B5WA 1PZEA 3OM9A 1SB8A 4J9VA 3KYCA 1BW9A 5BT9A 4YB8A 1VI2A 3WG9A 4J3FA 2DT5A 2H63A 2BFMA 2ZYDA 1NPDA 3KBOA 4E2XA 5F1OA 2X5KO 4XD2A 2W4QA 1C0KA 4CJXA 3UHAA 2VWHA 4AJHA 3E9MA 3NT5A 4K26A 4GQAA 2NSDA 4NIMA 4CMCA 2WD8A 3ENNA 2I99A 2W2KA 1YVEI 4HX5A 1RM4A 2BELA 3GHHA 3DMTA 4RDHA 4DIBA 4GLOA 4U0JA 4R69A 3RC2A 3SC6A 5L53A 1ZMOA 3SJ7A 3G17A 3OETA 9LDBA 3FR8A 1BWSA 3ZWPA 1Z7EA 3P7MA 4LMRA 1ZXBA 2PH3A 4N18A 4BNNA 1NYTA 1ZK0A 4NFSA 3SLKA 4CMBA 3ONFA 1WVGA 1YBVA 5K6AA 4CUKA 1EBUA 1N1EA 3D5QA 1E1MA 3RBZA 4RVDA 1HT0A 3TPCA 3BTOA 4IINA 3D3WA 5LDGA 3FTPA 3ZV6A 1ZVMA 3PDUA 3VDQA 3ENKA 4MP3A 2YY7A 3G1UA 3ZWXA 3OFSA 1LRJA 1L1FA 1NAHA 3AM5A 3RROA 2YDYA 1PWZA 1B3BA 4UEJA 3D5TA 1YB4A 4IZHA 2EJWA 4L4RA 1ZSYA 1EFKA 1DAOA 3TFQA 3GC6A 4CQLA 3Q11A 4PLZA 2Y1GA 4Z9FA 3H2SA 3P2OA 1C1DB 4PLTA 5L95A 3MCVA 4YRAA 2HUNA 2DBVO 2D3TA 2VTDA 3F1KA 3RUEA 1CF2O 4UULA 4EUEA 3MWDB 4CQMA 5A9RA 1C3VA 2QZZA 3VAZA 1LDMA 3LSYA 3X2EA 1E0DA 1C1XB 1I0ZA 1N2SA 4TRNA 2VNSA 4RCVA 5C7OO 4OO3A 1WP4A 2J5QA 3BHIA 4J43A 3E1KA 3I5MA 3TZQA 3C1AA 4DWVA 4AFNA 2PGJA 5F5LA 2DTEA 3WBBA 1CERA 2Z1NA 3JTMA 5AYVA 1YOVA 1YQXA 3PHHA 3D0OA 4O1MA 4FPXA 4CMJA 3E48A 5C37A 2GN4A 2Q99A 1ZJZA 4D7AA 3HFSA 1I24A 1JTVA 4Y6SA 3ZNNA 2QX7A 3JQ6A 3SBOA 3LQFA 5F3RA 1I33A 3FTNA 4N7RA 4BNUA 3I23A 4YJGB 3W4KA 2RH8A 1H94A 3E5RA 2AW5A 4NZ9A 4DYDA 2NVUB 4A0SA 1YO6A 1XIVA 3H8VA 5KKCA 2HDHA 3N58A 4P38A 1PR9A 3W1VA 4Z9YA 2HU2A 4P22A 3H65A 2Y66A 3PJGA 2E48A 3GGOA 1H5QA 4XQCA 5ILGA 4L75A 5JYEA 3AUUA 1HDXA 5CDGA 1FDUA 1GCUA 2C5EA 3CTMA 3H6KA 4HXYA 4BNMA 2A9FA 1HE2A 1P44A 2HK8A 3B6ZA 3F5QA 3B1KA 1ZJYA 3HB4X 3QVWA 4Y6RA 5KNLA 3K73O 3BMOB 3G49A 1O89A 4M89A 3RFTA 4OAQA 2C7GA 3ZZNA 3DBHB 1P33A 3JYNA 1XU7A 2J3HA 1QMGA 3TQHA 4CLEA 4BNJA 3GVIA 4FOOA 4CODB 1HDOA 3U49A 2VNAA 2X0JA 4BMVA 1LSUA 3DAFA 1GY8A 4ALKA 5FEUA 2C59A 4B4UA 5ITVA 5EESA 2O48X 4TRMA 5I9NA 5EERA 1PS9A 4WNIA 4CR6A 2OBNA 1NASA 4YBZA 1NNUA 1Q0LA 4JGBA 4G81A 3OJLA 4XJSA 1DBVO 3MJEA 4OMUA 1JW9B 2JFHA 1U3WA 5KTKA 4RZIA 3VZRA 1QYWA 1UR5A 4I5EA 3PEFA 4CQMD 2CZCA 3TOXA 4JIGA 3WQSB 3GEDA 1ENPA 1H93A 5FI5A 4S3MA 1E77A 2BRUA 4OXNA 1QLJA 1DB3A 1V3VA 1VSVA 1VE9A 1YWGO 4JX8A 2AQKA 5JO0A 1PL7A 1R0LA 2NTVA 4LGVA 1CYDA 2H1SA 3R3SA 3ZV5A 4QFCA 1U4SA 2I3AA 1I2BA 1MLDA 2IZZA 1I2CA 5IXSA 5JMPA 3VH3A 1UZNA 4BL5A 3GDFA 4CLHA 5A04A 3WIDA 1ZXLA 4ALNA 1LQUA 3HE3A 3FWNA 3MJTA 5GZ3A 4KWHA 4J1TA 4DPLA 1P3DA 2GSDA 3FN4A 2Q2VA 2R00A 4ZQBA 4FFRA 4IS3A 1I3NA 2VUUA 3F9IA 3KUXA 3HFGA 4MVJA 3KYBA 1T1SA 1E7MA 1SC6A 1Z73A 3JQDA 4B7CA 1E7SA 3T4XA 5JDIC 2Q1TA 4D44A 2H6EA 3CMCO 1Q0QA 1ZNQO 1F12A 1GDHA 1I8TA 4GX5A 1UP7A 4FC6A 1YBAA 3A28A 5JDCC 4GX1A 1Z45A 3DBLA 2P9GA 2XF8A 4RPHA 1NHGA 3RWBA 1NWHA 2VOJA 3FHLA 3QW2A 2DQ4A 1H9BA 1DO8A 4FFPA 3S2EA 3HG7A 1LDNA 4DQUA 1ARZA 2HMUA 2GUGA 3BHJA 1ADGA 4IJUA 1EQUA 3OICA 3NX4A 1MP0A 1QKIA 1GPJA 4L74A 5A02A 1TB4A 3OJOA 4ZJUA 2NQTA 1ISGA 3H2ZA 2JAPA 2D8AA 4J7CA 2OXIA 4M86A 3RBVA 2UUOA 1QV6A 2NLOA 3F3SA 3KV3O 1SMKA 4DLLA 1E92A 2ZYGA 1ZK3A 3W4IA 3OEWA 5L9AA 1KEVA 2QG4A 1L7EA 1YKFA 4FOSA 4RF2A 4GPD1 4U5QA 2W8ZA 3WJAA 4FC7A 4NI5A 1ZMTA 2AXQA 2DLDA 2G0TA 1VJ1A 3WIEA 2A92A 4XYMA 4H15A 4IDFA 4GWKA 1B3RA 4D79A 4J0EA 3U62A 4ZQGA 1W0CA 1A4UA 1DPGA 3PWKA 1ENOA 1FDTA 1IZ0A 3BMQA 1N92A 1QXSA 3K92A 2FP4A 4FB5A 4IDDA 2XAAA 3JQ7A 4MIEA 3BYZA 3JYOA 4IIVA 4A03A 1QV7A 4ROSA 4FGWA 1WWKA 1GZ4A 3A14A 1VM6A 3GEMA 4PCVA 4E30A 4YAJA 3NKLA 1N7HA 3QVOA 4ZU3A 4NNJA 5THQA 4JBIA 5U1PA 1GR0A 2UAGA 3DMYA 4MIYA 1NHWA 1BTOA 1UP6A 4Y8VA 3KB6A 2X58A 4PG6A 3NRCA 2D1YA 1KC1A 4J7UA 1WNTA 1KC3A 4Q3AA 3I9MA 4J90A 2ZTVA 4MVJD 4YT8A 5DT9A 2ZTLA 4KTTE 3IJRA 1XA0A 4IJWA 5HS6A 4A2CA 2JFGA 2HK9A 1MG5A 1C0PA 4L73A 5F21A 3WNQA 2CVZA 3I9KA 3GK3A 3KSDO 1PJSA 1IL0A 1I3MA 3HDHA 4M54A 1A9YA 5TT0A 3LYLA 4PIVA 1U2DA 4S1VA 4RVFA 1M6WA 3MOIA 5JYDA 3LC1O 1E7RA 1C14A 3DMTC 4WLUA 4Z0PA 5A4DA 4BHTA 2HMVA 2QRLA 5JSFA 4NPCA 3CZRA 1LNQA 4ZGWA 1YDEA 4Q3NA 3ZU4A 1O94A 3OIDA 3R6DA 1HF3A 2OP1A 3ONEA 2J8ZA 5IDQA 4ALIA 1GUFA 1KYQA 1RWBA 1RYDA 3OEYA 3GUYA 3PFWO 3JQEA 4MP8A 4PZEA 1D8AA 5K6AC 5F5NA 3IAHA 4F45A 4E5KA 4HBGA 1TT5B 3QWIA 3RASA 1CIVA 3VC7A 3KO8A 4RF4A 2FPIA 1UAGA 3QJ5A 2TMDA 4WNCA 2PA3A 1AXGA 4YT4A 3BMNA 4Z6KA 1H6CA 1Q7GA 2PZKA 4KDEA 3PQEA 1NVGA 2C07A 4CMIA 4CMKA 2FZEA 1PJ4A 4G5HA 3EHEA 3NT2A 3WGIA 4BMSA 2GN9A 2WWRA 1ZEMA 3NYWA 3JYPA 4DVJA 4B79A 4II2A 4FDAA 4LRTB 5CG2A 4J16A 1ZIDA 3PLNA 4LW8A 2FRDA 3I9JA 1ZSVA 1P77A 2AE2A 3D7LA 1IHYA 4GSLA 3B70A 1P1KA 2YW9A 1H6BA 1TI7A 3JQGA 3QP9A 3WWZA 5HM8A 1GV0A 1WDMA 1KY5A 4WLOA 2DM6A 2IZ0A 2WD7A 2YQ5A 3TZHA 3QVTA 3H9JA 1ZK1A 3E6AA 4INAA 1RM5A 3PTZA 2EW2A 4XGNA 5L45A 1MXHA 1AHIA 3RFVA 2BKAA 1EFLA 3FPLA 3R1IA 4YCAA 5JC1A 4D46A 3DZHA 2ILTA 3AWDA 1IHXA 2QHXA 3ETDA 3GLQA 4CM5A 2C20A 2YFQA 1AN9A 5T6BA 2FOIA 3EZYA 2IYPA 2QQ5A 5L40A 5H82A 4EDFA 4JLWA 2PKQO 4JBHA 1T4DA 3K96A 2DUUA 3UCEA 2DPGA 4XQEA 3C7CB 4L9RA 3U3XA 2X23A 4FGSA 3RC7A 1KEWA 1XU9A 2PD3A 2EWMA 4F3YA 1PJQA 2RAFA 1F8FA 2FR1A 3EY4A 4DIFA 4YRDA 2PNFA 4YT2A 1Q1NA 4IGEA 1ISIA 1YGYA 4J4BA 3QWAA 1DC4A 2B4TO 2NWQA 2O3TA 2O4CA 3H4VA 3HDYA 4XA8A 3VPFA 4OH1A 3H7AA 3ZDFA 3ZNPA 8ADHA 2I65A 2JJYA 2WMDA 4L8VA 1I32A 3GNQA 1A4IA 2HLPA 2OUIA 3WYEA 1V3UA 4NH4A 2HRZA 1ID1A 1E5QA 3U0BA 2RCYA 3C24A 3LT0A 3QRWA 4R3WA 3JV7A 5KIAA 3DFUA 1LRKA 1HLDA 2ZJ1A 3EAGA 2FY8A 3V2HA 2NUAA 3ZN2A 3QWFA 4BNLA 1F17A 3JQCA 2DBZA 3ITDA 4BO8A 1Z6ZA 3WSVA 3HQ4O 3ZNOA 4TKMA 1O9BA 1ENYA 4DTIA 2PK3A 4TSKA 1NVTA 4NHEA 3Q9UA 5DBFA 2GCGA 1UXGA 2I9PA 4IIUA 4LVUA 3AUTA 3I6QA 1KEUA 1ZH8A 1QYXA 3PJFA 4WKGA 4QQRA 1Y5RA 4R68A 3QA9A 4XRRA 5CDTA 2GGSA 2YHIB 1ISJA 4CLOA 5CEJA 4UUNA 3L0DA 5GY7A 2P9CA 1Y8QA 5TQVA 1YQGA 1F0YA 2JHFA 3QWBA 4GKVA 3ROKA 4IDEA 3ZV4A 2NADA 3U5TA 1C0IA 2J6IA 3ZCXA 1I5RA 4KQXA 2AA3A 4YA6A 3UH1A 3S8MA 4ZICA 3H9QA 2D2IA 1BGVA 2O7QA 4MINA 3WMXA 3GPIA 3K2EA 1J4AA 1J6UA 1TVEA 2QRJA 2JCVA 3GNSA 2DPHA 4A10A 4CR8A 3OF2A 2WDZA 3AM4A 3OJEA 1SEPA 5COAA 1DFGA 4IBOA 1NFQA 2VZ0A 4UVHA 1MFPA 2OL4A 1NVMB 4MP6A 1EVYA 2A94A 3PP8A 2B4RO 2O3SA 4JQCA 3DZBA 3G79A 3IP3A 3K6JA 3TL2A 4BNFA 1B2LA 2UV8A 3FCOA 4KUHA 3DQPA 4IXWA 1LSOA 3ICCA 3I9OA 2BF7A 4ALMA 2EHDA 2NU6A 3WGZA 1UAYA 2P5YA 4P4LA 3RJ9A 2VYVA 3IQDB 5DBIA 1F06A 1P0CA 3TOZA 1PJLA 2R00C 4TQGA 1GYRA 3OQ6A 3LLSA 3JQAA 3LDHA 5COQA 3WR5A 2OHXA 2IDZA 1JKIA 3EGOA 2BD0A 2P5UA 3GVHA 4E4YA 3VKVA 2FSSA 2WE8A 4UVGA 3L4BA 2V65A 1LTHR 2Y05A 4RORA 2NACA 4YJHA 3GGGA 4N5MA 5HWSA 2VUTA 3ASVA 3PWSA 1YB1A 2BGLA 3AFMA 4FFNA 4PVCA 1Y9AA 4ZQHA 3GOHA 1U7HA 4IMRA 4KWIA 2PZMA 2G17A 2VOEA 1V8BA 2OO5A 3MJVA 4MVJM 4Y6PA 4PLVA 2JFFA 1IYZA 4BMNA 1E3WA 4DBVO 4EUFA 2HO5A 4GGOA 2PY6A 2WYWA 3JQ9A 5ENVA 5HRUA 3M1AA 4TVBA 2CDAA 2NU7A 4M8SA 2X0RA 1W6UA 2VZ9A 4KOAA 4AJ1A 1T25A 3O8QA 4MVJG 1T2DA 5JCJA 3RKRA 5CEEA 2DTDA 4E3ZA 4IJVA 5GZ6A 5C7IO 4XYBA 4XB2A 1E6UA 1SZJG 3K30A 1Q0HA 1ADCA 3R0IA 4QO8A 4YDRA 4CMEC 4IDAA 4XX0A 3DOCA 4YJFB 3VKUA 2HJRA 1W73A 1KEPA 1LX6A 5G0SA 1MGOA 2GZ1A 4DGSA 1HDYA 4A73A 2CD9A 2GYYA 1YL6A 4QTZA 4CM9A 2X22A 2EP5A 4XDYA 1A27A 2PD4A 4GMGA 1HZZA 2LDBA 1A7AA 1V3TA 3QE3A 1FK8A 2ZKLA 3NGXA 4GBJA 2Q3EA 1PQPA 2JL1A 4CLRA 1U4OA 1Q7CA 2CFCA 1HYHA 4MKXA 2Q1UA 5G4KB 2DVMA 4JNKA 1GUZA 1NPTO 4BUCA 3RCBA 4YTEA 3DB2A 3GDOA 5KVQA 3ZWCA 3ADOA 3PHIA 2D5AA 3V2UA 1D4FA 1WXDA 3PIDA 4ALJA 3PQFA 1R4MA 3RSHA 4IUYA 2YV2A 1N9GA 1P1JA 5IDXA 4UUMA 2WYVA 3E9NA 4OOEA 2O50A 4YRBA 3RU9A 2I5PO 1QYVA 3V1YA 2X9GA 2GR9A 3QY9A 1UH5A 3Q0EA 3MTJA 1XQ6A 2B83A 3SVTA 3WX0A 1BXKA 3AI1A 2VYVD 2X4GA 2OFPA 3C3XA 3G1TA 3TF5A 2AEMA 4BGIA 4GL4A 1NBOA 1GZ3A 3GHYA 3JQAD 1D7OA 5JXWA 5TSDA 4R9SA 1WMBA 1GCOA 1EE9A 3L6EA 1OOEA 1HDZA 2X1HA 2JD2A 3M2PA 3MTGA 3PRJA 3TFOA 3BTUA 1OBFO 1VLLA 5I9LA 3VH4A 3WQQA 5DP2A 2TMGA 2GO1A 4RLHA 4AICA 1QYDA 3GZNA 3HB5X 2IXBA 4FD3A 3VPSA 5KJFA 1X1EA 2B5VA 2J5KA 3DHYA 5CFZA 4A7PA 5TLSA 4AJPA 2Y93A 4R16A 1PJ3A 4QT0A 1XSEA 4ONEA 5TX7A 4A5OA 2GD1O 5TNXA 3ULKA 5IAAA 1IE3A 5DCUA 1KETA 4NJOA 3JQ8A 1BVRA 2B69A 2CVOA 3MZ0A 4XWYA 5JCJD 4JP2A 4PLGA 3UF0A 4I8XA 5THKA 2V6FA 4YAIA 5DULA 4AJIA 2PGLA 4RGBA 3QWHA 3L07A 3WTBA 1Z7BA 1JDJA 2J3JA 2H5LA 1IULA 3M2TA 5EPOA 5G2OA 1JAYA 4J49A 4ZRNA 4E0BA 1SPXA 5L51A 3TZCA 3VPGA 4B4WA 1NM5A 2Y68A 2J3IA 4CM9D 3AI2A 3FF4A 5T67A 3JYQA 4BO3A 4ESOA 4NMHA 2BHLA 2GDZA 1E3SA 2IE0A 5ER6A 1B8VA 2V6MA 4PRLA 5G0UA 5JAIA 1EK5A 1ONNA 1XWFA 4TMFA 4HFNA 4PGFA 1JN0A 1Y8RB 1GZ6A 4YT5A 3L77A 2PTGA 4WCFA 3VTFA 3SLGA 1LU9A 3S1LA 3BMCA 1E7YA 3ZHBA 2JKVA 4U6SA 1ONPA 4RPKA 1CJCA 1NQTA 1ZO8A 3RD5A 4XGIA 3ZHYA 3WLFA 3FBTA 1KVUA 3ICPA 3CPSA 3FPCA 3SJUA 1MFZA 4FW8A 4Z9XA 3UUWA 1DHTA 3UKOA 2PZLA 3TJRA 1R15A 3KYCB 1RPNA 1BW9B 4AJLA 3HNPA 3MWEB 4R1UA 3LU1A 3A9WA 1HTBA 2Q2WA 2IEDA 2XPCA 4AJOA 4CM8A 5A9SA 5JAMA 2R2GA 2D59A 5JAZA 3ONDA 4WLEA 4QUKA 5KJ6A 5I7VA 4BNVA 1LRLA 4CM6A 4KDFA 3T4EA 1LQTA 1HDCA 3CXRA 2P4QA 3PXXA 4JJFA 2W2KB 4N54A 4NBTA 3WGHA 3CIFA 4GX2A 4OM8A 4J0FA 4OHUA 3NTRA 4W6ZA 2GZ3A 3TSCA 4YVFA 4PG8A 3UGKA 3AU8A 1AE1A 2YFHA 4XQGA 1B8UA 5I8ZA 3VTZA 1LXCA 3EYWA 3JQFA 3ANLA 4CV0A 2HK7A 1H9AA 3NT4A 3F6YA 1UDAA 1YBMA 4XKJA 3ZWWA 1H2HA 2VWGA 1I30A 3CUKA 4FJ2A 3BZUA 5KVCA 1J0XO 1QLHA 4G2NA 2JD0A 2HAEA 3HHPA 4BB6A 3KM0A 3OJ0A 1P1IA 4WECA 3D3WB 3PK0A 4NBRA 2EGGA 1YL5A 3I4CA 3ANNA 3NDJA 5AXBA 4XYEA 1ZCJA 4BQRA 3OJFA 3GA0A 1O95A 4BNYA 4F46A 1HSOA 3KLPX 3UFXA 5HBRA 2OZPA 2W2LA 3GMSA 4E2YA 4EW6A 2X0IA 2GRAA 3PPIA 3KYDA 3VPXA 1A5ZA 2D0IA 4CQLB 4F6CA 3HWRA 4B7UA 1IPFA 2YV1A 1TA4A 3BHMA 3PGJA 4GKBA 3EVNA 2CSUA 4IDGA 1SAYA 4E21A 3KEOA 2E6UX 4ND2A 5CP8A 2VUSA 5TF4A 3K9QO 1IOLA 3ROQA 4CQMB 4TKLA 1TLTA 3IKTA 4PLFA 5L3ZA 5BNIA 3FBGA 3GEGA 2C54A 3GG2A 4LISA 3TN7A 4II3A 1X14A 1GD1O 4D42A 2F00A 1VL8A 4EITA 1K2WA 2X6TA 2NTJA 3QV1A 4BV9A 4R51A 4Q3CA 4J9UE 4N5NA 5CDUA 2UYYA 1CRWG 4NU6A 1YOVB 4XR4A 3AOEA 9LDTA 5CEFA 2WJPA 4DA9A 3AK4A 1R4NA 3DR3A 4G65A 1BDMA 1G6KA 4CLXA 4OQZA 3U09A 1GEGA 1PS8A 2V6BA 1HXHA 4U7WA 2I76A 4MKZA 3AUSA 4BKRA 1Y7TA 3AI3A 2QZ9A 2OOSA 4U0KA 5DNAA 4XRGA 1QR6A 3ABIA 4AVYA 5DOVA 1K3TA 1U9JA 2VZ8A 1XR3A 2I3GA 2RBEA 4RF5A 3V1UA 1MC4A 3UN1A 1O0SA 4PLHA 3DAPA 4J4HA 4MJLA 1HE4A 1UXHA 4NJMA 5TT1A 3VZPA 1LC3A 3GQVA 2VYNA 4CMAA 3H5NA 4BNWA 5DN9A 4MVJI 1EUZA 5IDWA 3LC7O 3RIHA 4KTVE 1KVTA 3UCFA 1QYCA 3ZI0A 1F8GA 3L4BC 1GAEO 4AJKA 4YQYA 1X7DA 1VJTA 1JKJA 2WM3A 2SCUA 1AHHA 4ZVVA 4E5YA 2NTNA 4XJTA 3WSWA 3JD1A 3G0OA 3WLEA 4RZHA 1GADO 5T57A 1E6WA 1E6EA 3KSUA 4YJDA 4MO2A 2O3UA 1WAMA 5BNTA 1EDOA 3GRPA 3O9ZA 4W7IA 3KRTA 3MJCA 3JQ9C 4YYZA 4E5NA 1YONA 4GVXA 5EQFA 2W2LD 3RVDA 4O0LA 1EVZA 1JKFA 3U4DA 3F1LA 1UDCA 3L6DA 3OP4A 3WGGA 1PQWA 1G0OA 3OHSX 1DC3A 3HJAA 4XB1A 3S2GA 5BSHA 2BLLA 3MJ4A 3HDJA 1QORA 2F1KA 3JD0A 1I2ZA 4YAEA 4BGEA 4BVAA 4E5PA 1P9LA 1Y81A 2P9EA 3ZW9A 4OJNA 5B37A 1S7CA 4PZDA 4J4TA 1Y9EA 3L9WA 1SO8A 4ZN6A 1GQQA 4IXTA 5MGBA 3DZIA 3H3FA 3MOGA 5EINA 2E37A 3WFIA 1ZSNA 2VT2A 2V7PA 3F4BA 4C7JA 4PLCA 2DTXA 1F14A 4L4XA 4GLLA 2IYOA 1RYEA 3IC5A 4BO6A 5JMWA 3FNHA 3JD2A 2VQ3A 4NBVA 1MX3A 2XXBA 1P1RA 3DL2A 3AM3A 1PSDA 2OP0A 4IQ0A 1A72A 5COBA 3WDSA 2WE7A 5ER9A 1NX6A 2Q46A 3D4OA 2X9NA 1BG6A 1W8DA 1ULUA 4D0SA 4J7XA 3NTOA 1HYGA 4Y98A 4PLYA 2RHCA 4MDHA 3JCZA 2POQX 3DHEA 3EW7A 4I5FA 3IIEA 3OECA 4ND1A 2X86A 4DLAA 4O6VA 3ZWAA 4E6PA 2R6JA 1DFHA 4IDCA 1S6YA 3IJPA 2AEJA 2AQ8A 3PYXA 4TZTA 1E3JA 1DJQA 5F1KA 2C82A 4OGWA 2QYSA 4WEQA 4W99A 4PLPA 2EP7A 1U5CA 3RBXA 2AG5A 2EXXA 3DZJA 2E4AA 2O7SA 3D4NA 2HCTA 3DAGA 3LF1A 4K9DA 4QXMA 3TNLA 4UVIA 2Q45A 1VL0A 5A1TA 2VYND 3DBLB 3DO5A 5IZCA 4RQTA 3B1FA 1FDWA 4IJKA 4ZD6A 3WGOA 4PVDA 2PR2A 4HNHA 3ITKA 1NQAO 4OXYA 1XQ1A 1T26A 1YXMA 3TRIA 5IJZA 3U4IA 5L4LA 4CPDA 4OYRA 2EEZA 3GF4A 4GI2A 5DCWA 4H3VA 4OKIA 1E3LA 2ZQYA 4WLFA 5JS6A 1XLTA 2VTEA 4N5LA 4Z0HO 1JA9A 3RAJA 2D5CA 3NDRA 3GAFA 2HMSA 2RH4A 3FSRA 3RI3A 5HS4A 3D64A 3OMLA 1B7GO 4FFOA 3C8MA 1LSJA 2Q1WA 4XEHA 2Y1DA 4J6FA 1R66A 2IODA 5DOZA 1MG0A 1TEHA 2VT3A 2PZJA 3F46A 4YAKA 4AJJA 4TROA 2I66A 3AFNA 4WASA 4EJ6A 3IL2A 4FFLA 3ZWBA 4GGPA 1PGNA 1LSSA 2BFAA 2Y1FA 2YV3A 1GYQA 1EUDA 1GQ2A 2YUTA 4K1LA 1U5AA 2VWQA 4BNXA 3WYBA 4BNKA 1JWBB 4CM4A 5K9ZA 4DUPA 5L7YA 1ISHA 4P8RA 3ETEA 2CDBA 1K6XA 3BMQB 3IOYA 4Z0TA 4EYEA 1FF9A 2PKRA 2OMEA 1LDEA 3TWOA 3JQ7B 1BXGA 3KVOA 1PJTA 3EVTA 4AL4A 2Y1CA 4DIOA 4L76A 4BB5A 4UUPA 4JP3A 2GN6A 1CDOA 3FD8A 3DBRA 3WWYA 1LDBA 4LSWA 1M76A 1U3VA 2G5CA 2Y0EA 1ZK4A 2O3JA 1WZEA 3INTA 3KLMX 3LT4A 5CAEA 4PG7A 2NVWA 3GR6A 4WCFC 4UUOA 4ZQFA 4UVEA 3RUFA 4BNIA 4DBZA 5C7LO 2EKQA 3M1LA 4OKNA 1VC2A 2DBRA 3OSUA 3OIFA 5JLAA 5ICMA 5EMHA 4MPDA 1XYGA 4ZQEA 4E33A 4D41A 2WTBA 3GFGA 4I9NA 3GFBA 4B4OA 3HADA 3DZFA 3UAGA 1T2CA 1UXKA 2ZJ0A 4HWKA 3U4CA 3EMKA 4GH5A 2WSBA 1ZKMA 1GEEA 2B4QA 3GT0A 1DOHA 1JVSA 2HMTA 4BGUA 2BGKA 2C7VA 1OAAA 5AOVA 1B0AA 4IMPA 2VHXA 3I9NA 5B4TA 5J23A 1RKXA 1BSVA 4FBGA 3LK7A 5A3JA 3CH6A 3DOJA 4RL6A 4RQUA 4W82A 1HL3A 3GZ4A 3B20A 4BO7A 1N8KA 3DONA 4WOJA 2EKLA 4CV3A 1I10A 1M75A 1NQ5A 1GFSA 4BO2A 4F6LA 3ZWMA 3K31A 3KSZO 3WTCA 2VWPA 4WUVA 1GTMA 3PJEA 5BSEA 4Z3KA 4WPGA 3W4JA 1BHSA 1BRMA 1LA2A 1VKNA 1Z75A 5AQ1A 1LLCA 2ZQZA 1CEQA 1FMCA 3JQFC 3A4VA 3GAZA 4NG5A 2Y1EA 5IF3A 1PL8A 4LN1A 1VSUA 2NVBA 1MC5A 2FR0A 4OIMA 4WLVA 4DL9A 1ULSA 1BDBA 4C7KA 3D1LA 5ADHA 3QVXA 3N74A 2EG9A 4BKPA 1AGNA 5KVVA 4BNHA 1C1DA 2UVDA 3NAQA 3HN2A 4TRJA 2Z1MA 1DRVA 5A5EA 3L4SO 4FSHA 3BMNB 2DUWA 1HEUA 3EUWA 4CMIB 3V5NA 3S55A 1HETA 3I52A 1HE5A 2GLXA 1T4BA 4CL8A 1B14A 1RM3A 3BXXA 5I7EA 4R1SA 1C1XA 2CVQA 4B3HA 3V8BA 1ZUD1 4LSMA 3NEPX 1UP4A 3GNTA 4Z3DA 3WQRA 5KJEA 2AEFA 2A4KA 3ZH2A 3DZKA 3JQGB 3NDIA 3VVCA 5I8WA 4YWJA 2WD7B 4DXHA 3AW9A 2GNAA 4YEDA 3COSA 4Y67A 5IG2A 3RFXA 3K2BA 4U6QA 2YYYA 1JLLA 4YXFA 2BFPA 2X8LA 1UXIA 3T7EA 1MXFA 3DDNA 3GGPA 4YJGA 5U4QA 2B36A 1DIAA 3OBBA 3AY6A 4AJEA 3ADPA 4LCJA 1HSZA 3CSDA 2NVUA 4GAEA 3AOEC 5EIOA 4BO1A 3PHJA 1WPQA 1YDWA 4L4SA 5ICSA 1UUFA 3BTSA 2DFDA 4FN4A 4NFHA 1QSGA 2FHSA 3GVXA 1R0SA 3DC2A 3I6IA 1V0JA 5KJCA 5G4LA 5I7SA 4MVJE 4RDIA 4LMPA 3K8ZA 2NQ8A 1CQIA 4NBWA 3U4HA
chains in the Genus database with same CATH superfamily
3FR7A 1J06A 4FGUA 1KMCA 3KEMA 4LRQA 4MV0A 1YJAA 1XJ0A 3SHVA 1NRJB 2JZCA 3H5RA 2ZB4A 1L4KA 5AJWA 4IQGA 3NOXA 3IKJA 1PJ2A 3NG1A 1K89A 1R4ZA 4PQFA 1EXVA 3EXFA 1CRQA 3IH5A 3IXQA 5GMOA 3RSQA 2QU8A 3PL5A 3TEMA 1Z0DA 3NFYA 4DPKA 2WK1A 3JZAA 3ZLJA 4B6EA 3UMMA 3W04A 3LUHA 4H60A 1IRXA 3ASUA 1JQBA 2OM6A 2NUAB 4HMPA 1S7GA 1Q14A 3CWCA 3EZGA 4LXIA 4U5XA 5K8IA 5BY2A 1BVYF 5LCXA 4ZYUA 4WESA 4MQMA 1NTOA 1H2BA 3EZ6A 1FYVA 2OXRA 2HCBA 4R5MA 2C2ZA 2J5RA 3R7NA 1Y4DE 3VZSA 4EVRA 1E20A 4MS1B 1TW2A 1YB7A 1E59A 1KAHA 2AJBA 2GJAA 3WZMA 5KOJA 1Z15A 4PO9A 3ZCTA 3L4JA 1EWKA 1TGYA 1O4VA 1BCRA 1XKXA 3HGQA 2AHRA 2DWOA 3NV9A 4HFJA 4EJ2A 2PX0A 5JHGB 2AVDA 1JR3D 5DRYA 2WSIA 2Q41A 4YMWA 4Q7LA 3WGTA 1Y33E 4ZTZB 1JI3A 2VDPB 3FCEA 1LC0A 1XEAA 1DKMA 4K40A 4YPOA 2HCRA 1A1SA 4PC6A 2OGZA 1RLTA 2EJVA 4CLOB 3C8ZA 4I1RA 3W1WA 1N77A 1BMDA 1Z68A 2G1UA 4IDNA 4TRRA 2WSSA 4JN6B 4X54A 2C4UA 3ROPA 3T9FA 1UC8A 5EGSA 4EEXA 3CCBA 4UQLA 2WSMA 4J0IA 3CKLA 3PG5A 4X97A 4AKTA 4JYCA 2OB2A 3HA5A 4JI6B 3NWEA 3E4CA 5GJCA 5JTUA 3WWPA 1XF1A 2AG8A 3A10A 1KE2A 3ZIDA 2QUAA 5CNJA 1W44A 5KREA 1JLMA 1JDVA 5DGDA 2BTEA 4MKFA 2C29D 1F20A 2DC1A 2QRMA 4G1UC 1D2NA 2AX3A 3S2SA 2D7JA 5KJCA 5EKXA 2EZ9A 3AESA 1RQXA 1DELA 3H2IA 1A77A 1VE1A 4IH4A 3I61A 2CY0A 2A1IA 4EX7A 4TUYF 1I1QB 3WBKA 2YH2A 1A96A 1A8SA 1F0NA 2I6TA 1XQYA 1YL7A 2AOTB 2C2XA 2QD4A 3FNGA 3WRXC 1FTQA 3E9ZA 3RJ5A 4ENUA 2HF2A 1GYPA 1DKOA 5IVPA 5JRJA 3AVWA 4CFYA 1MV8A 2J3LA 4FCWA 3ZWVA 2D3WA 2W2OA 3TVTA 2DPXA 3V4FA 1M2VB 2QA5A 3FBWA 1SBTA 1NXQA 3EISA 4DDUA 1YIOA 4LZOA 5JOQA 1R6BX 1I3OA 1JX6A 2QOEA 2P2SA 3AONB 4MVJH 1GTSA 1DAIA 4V0KA 1BZYA 1XJCA 1E79D 1JEQA 4E1AA 1X19A 2ZSBA 3I6YA 3TG8A 2J6BA 4YQFA 1B6SA 2SKDA 1W88A 2UYQA 3GN1A 5FOVA 2ABWA 2GB4A 1CDEA 3VGJA 2HW8A 3F5MA 3BGIA 3EBLA 4YP9A 1M8FA 3OQIA 4CTOA 4HLNA 2FPOA 3P5SA 3UICA 3WB0A 4RVUA 1BVHA 2OOKA 3IAS1 2Q2QA 1MB4A 1RNLA 2ZB8A 1DQRA 4I9FA 1LS1A 1V1JA 2H29A 3P9YA 5C52B 2VCYA 5HCNA 3UVEA 3SEAA 4B6GA 3G89A 4X85A 2P2GA 5HTOA 4JL8A 3E82A 3MS2A 4MAFA 1Z5UA 5KOHB 5KYXB 5CITA 5BN1A 4Q7EA 2GZSA 1PL6A 4BVLA 2Z5GA 4JVMA 4JDPA 2X0KA 3CRW1 4LWPA 2ZI4A 2G9NA 1XVTA 2VVTA 1UJ2A 5A03A 2W6NA 2GVNA 4ZU1X 5AVTA 4MV1A 5C1OA 2Q4RA 5HG0A 4CIYA 2XOEA 3RB8A 3HUUA 4ND5A 3HUDA 5GJVC 1XHLA 5KTTA 2I7TA 2XMDA 3C3JA 5F7OA 1MOSA 1ZZEA 4AAYA 3DE0X 1FMLA 3LVQE 4CV1A 5FPKA 2IVFA 2XNKA 2ZB3A 3N6VA 1LW6E 1D0SA 1BHQ1 3G8DA 4JJEA 4PFSA 2FQXA 2B35A 4PIPA 4RKWA 3MQFA 3SIPA 2I6QA 5C3MA 4C6TB 3QX3A 4JA2A 2ASVA 2VJCA 3E18A 1OFUX 4C01A 1KHTA 1X0XA 1VKZA 3STHA 1NW4A 3N7AA 2PMFA 2YWBA 3DCIA 1MDBA 1MAWA 2J30A 3GLFA 4XM2A 1GXSB 2CD7A 2ZTUA 1QIFA 3KP1A 5CMLA 4O59O 4MO9A 1PNOA 1KH3A 3ZHXA 2FSVA 4OHCA 1MOQA 2OD7A 2J3KA 5HKAA 3RC8A 3SF8A 4E31A 1J33A 4UMDA 4JT8A 4MXDA 1UEJA 1ZCZA 3HMQA 4DBLE 3QG5A 4LC9A 5CB4A 5ITWA 4F3NA 1HX7A 1B93A 3TRFA 5ILQA 3ZGVA 1U1GA 4HAOA 4D4KA 2IF2A 4RD2A 4PV7A 3WL7A 1ZN8A 5AVOA 3UT0A 2PKYX 1U3GA 2AZMA 2WM8A 1PNVA 4J1SA 2G1PA 1RPTA 1PDWA 3AUAA 1JT9A 1LNSA 2HLHA 4YCDA 3SC2B 2EX0A 1R4MB 3T3DA 4LFAB 3TDNA 3PD0A 1TQ6A 2FFBA 1YR7A 2XMBA 3HYNA 1UKBA 4IQ8A 1N9GB 1MKYA 1HNXB 2FR8A 1J07A 4NFYA 5FF9A 2NZUG 2YJ5A 1UK6A 1MORA 1P0FA 3CG4A 3N70A 4LXYA 3U5ZB 2A67A 2EYQA 1G3IA 4OXQA 3KJGA 3ICVA 3JD4A 4G3XA 1XCGB 2WJ3A 3H9GA 1UK9A 1WCIA 3ZBTA 1OFTA 2B7LA 3ETGA 3ZY3A 2ISSD 3P2YA 3P52A 5EWMB 1WVIA 4D25A 5KMGA 4RPJA 1T3LA 4YQZA 1XTBA 2OC9A 1UJMA 3AQIA 1RYMA 2A9QA 3ECSA 3LPDA 5CG1A 1JF8A 2NIPA 4K6OA 4LHYA 1NAIA 4KLAA 1X1CA 2VDUE 4MRSA 2Y3IA 4S1WA 4WZBB 3NXSA 1GGKA 1SULA 3GCZA 3HP4A 4H6PA 2VEDA 4PG4A 5DBGA 4ZRMA 5FNVA 2VHEA 1CVLA 2HHJA 2B8JA 1TAQA 4QU0A 1BS9A 4N3AA 1NI3A 2VRCD 3WGYA 4PINA 4GMXA 4EKEA 2ZUFA 5CVVA 1NOIA 2WTUA 1DKPA 1NSYA 2OLKA 3LT2A 3CBGA 3ET4A 3FKSD 4E2FA 3I0NA 4YN3A 3JVIA 4R1TA 1X7WA 2CF5A 2X77A 4P81A 5CX1A 4YHHB 1THTA 1Z12A 2I87A 1K4KA 3FHOA 3MNFA 4FSXA 4J0HA 4ZMSA 1QFMA 3LP5A 4JR2A 2CB9A 4DXAA 4KIUA 2D54A 4DRZA 3K5HA 5JSKA 2P6MA 2ZI7A 5IM5A 2JATA 3ZLBA 3E5NA 3TUIC 5CDFE 4IG4A 2HFKA 3ZDZB 1KXJA 4Y6QA 3S81A 1GKLA 2XLBA 1S2OA 1YH3A 3Q2KA 1R6TA 4X9XA 4FINA 4RFLA 1J49A 4AZVA 4AF8A 1SVSA 1W30A 3LY8A 4IYJA 4JH0A 1QRTA 4BKMA 4X71A 4RKRA 2YZ2A 4Y2VA 2O8FB 2W93A 2FN4A 5HA5A 2VHYA 1U7DA 3EIHA 4M9CA 4QFDA 4DMMA 3X1ZA 1P81A 4QATA 4LJ7A 1EINA 2EP8A 5I9SA 5IABA 1XCBA 1RQRA 2GVDC 3WJ2A 4RANA 3Q6IA 4FYVA 3OOHA 4U9HS 5DH9A 3WHIA 1Z2OX 4QBGB 3GJ7A 1PT6A 3BS4A 2XUPA 1NNEA 1B8PA 3NJ4A 4AC9A 4QOEA 1BFKA 1M2OB 5AHXA 4WCFB 2AE1A 3WA6A 1M5UA 3PE4A 3BMCB 3IEIA 3JWGA 4US0R 1NI4B 3MXOA 3UNXA 1GPAA 1TCCA 2HJSA 3WNVA 2NZJA 3D6HA 5AI4A 3T06B 5EFZA 3K6RA 3JASB 2BBOA 3V1TC 1U8XX 1N2OA 1K4YA 3EXG2 5HJEA 4K9OA 2PUFA 3TLJA 5IAOA 1RACA 5FBQB 3RWMB 1ECFA 3G9XA 4DUZB 4KXNA 1F48A 5KSYA 1W7AA 2PT6A 2PKQP 4QUBA 4YONB 4CQNA 4ZV9A 4L4YA 4LWZA 4URUR 3O1JC 3Q6NA 4XSGA 2WUDA 4BZZA 5K0GA 2RG1A 2BEJA 3LVRE 4FGZA 1OLSA 1UKYA 3S1AA 4EEZA 1D3AA 2F3SA 1EVJA 3BWEA 1S2DA 3DTVD 3GLGB 2X5JO 3VR5D 1I2AA 3EOBI 3OLCX 3DZCA 1Y6JA 3WYFA 1Y6QA 2VQDA 4XR9A 3UAOA 1NFRA 1GCIA 1R6DA 1YE3A 2CK3D 1UZLA 2YZNA 2ZYAA 3RC9A 3IQXA 3CKKA 3WMWA 4QYIB 4X8LA 2HIHA 3RUCA 3ORYA 2Z95A 3WNZA 3IT2A 4CFSA 3PHGA 4CQJA 1M73E 2BHTA 4KRFA 1N0VC 1XTJA 2XOKD 1ZCAA 2H9IA 1MCZA 5ALTA 3O1IC 1IY8A 3C1OA 3K70B 4BXOA 1DBWA 1E1KA 4NCIA 2C5SA 3CIOA 2WFLB 4LJAA 1LLFA 1CR4A 2RK4A 2W6PA 4NARA 3DVLA 3NALA 5C1DA 5DIFA 4MQUA 3SYRA 5IAEA 2RKBA 4HAIA 4MKRA 4WEOA 4H0CA 2YCBA 5DHUA 3EEFA 2B8NA 2FN7A 5KSZA 3QSYA 3DEIA 1KO8A 5KYYA 1P73A 3K9NA 5A3VA 4HMOA 2ZIXB 3D0RA 2HADA 2MINA 4AMYA 4YUXA 5CX4A 5ALWA 4ZCLA 2VXYA 1E3MA 1NNI1 3A11A 3UMFA 2C2HA 2Q8NA 3KTDA 4EHKA 1M6EX 4K6HA 4K28A 1PIWA 4CKWA 1HORA 4RHUA 2C4HA 4MEAA 5HE8A 3IX7A 2VHVA 2OD2A 2XUDA 3KYDB 2HA5A 3I9LA 2YDXA 1Z2EA 2JHPA 3EARA 1DJNA 3MFYA 3L7YA 9GPBA 2IEYA 4R7TA 1EG7A 3OIWA 2BMDA 3TEJA 4EB0A 1VKOA 3WYAA 4MW9A 2TSYB 2XOXA 1DEHA 5EIWA 4OOFA 2J0SA 3PGKA 1LKZA 1Z5WA 1GO2A 3OIGA 3SIXA 2C94A 3HDQA 3OKPA 3O38A 4WN9B 1EMDA 2A1UA 1MC8A 3E9CA 5JASA 1MC1A 1O6BA 1RRPA 1WHTA 2HQBA 3ND7A 2BCEA 2Y1OA 2ERCA 3N3BC 1U3FA 3Q9LA 2JGIA 4XDGA 4ZK2A 1D5WA 2OCPA 1Z8FA 5CK5A 4YK7A 5K5EA 2HYDA 1D1TA 1C8LA 2J87A 4LSGA 4EB3A 3VAYA 3EXIA 3D4LA 3W78A 1IUKA 2C5HA 2FP3A 3AIOA 4Q7QA 4AZWA 1C0LA 2O5CA 4PLWA 5CFPA 2DWUA 2CXTA 1XG5A 3WL6A 4UXJA 3IDQA 4OGGA 1BO6A 2AMJA 4IPTA 2VA8A 1KE1A 4FZ5A 1DSSG 2BLNA 1XL1A 3FSGA 3N8KA 4MRMB 3DD5A 4KC0A 5TQ0A 1MUUA 4J3NA 5EXXA 1VRWA 4RSRA 4I9HA 2NT4A 1AK2A 4XIIA 3ODPA 4RY0A 1FTGA 3QVSA 1WEHA 2PBFA 1YJ8A 4N0PA 3EW9A 4PRKA 3RUDA 1DAFA 7ADHA 2X13A 3PGXA 2FZCA 5FO1A 3DFKA 2OYSA 3H2KA 2JCYA 4GI5A 2IU6A 4X1IB 9ATCA 4MW7A 5K8VA 1BC5A 3IOBA 4Q66C 5BR1A 1THZA 4F21A 1EZ4A 2G04A 5LMCA 5FI1B 1K4MA 2HLDA 1NZFA 3EZ7A 5EQDA 4DNFA 1YF3A 4Y9TA 3KETA 5A5FA 1U2GC 1EWVA 3KL2A 1NF9A 2OV3A 1K5HA 1PTJA 2NO6A 5T4FA 2H52A 5FWYB 1Z22A 3JVEA 4C2AA 2PRJA 4ZEXA 1SNYA 4FNAA 1M2EA 4WGGA 3V46A 2BSQA 2W11A 2PEYA 3W2TA 1TJPB 2FMHA 3CKYA 3UV7A 4C30A 1A2QA 1C9NA 4LTNA 4Q19A 4WW0A 4YROA 3TW6A 5F23A 1EH5A 5CA1B 2Q9BA 3EULA 3PA6A 2BFEB 3KKMA 5AFSA 3NMUF 3FZQA 3DDOA 5AM4A 3F3KA 4LRSB 3IXMA 4JCOA 4XQ9A 3C4JA 2UZ1B 3G88A 4J03A 4WVLA 4ERXA 1JKJB 3MCUA 5AKKA 4U00A 1O4WA 4XLTA 2PKCA 2NUTB 3RPEA 2OR3A 5ES4B 2QTVA 4FYWA 4GS5A 5B12A 4GSKA 1JSZA 1E3IA 1RHUA 3BIOA 3BORA 1U7UA 4DMFA 4YRSA 4D43A 1T1JA 3ZGLA 2FE1A 3PLRA 3KJIA 2W37A 4PNHA 3VYTB 4YJFA 3G13A 2IKSA 4LCEA 5J2TB 4P93A 3NOOA 2DT8A 4PXSA 5JO9A 3LPMA 3WGUA 2ZI9A 1LQ2A 3R3UA 4G1FA 5AO9A 2MJLA 4MHSA 1ULHA 3LF2A 3OPQA 3ENVA 1G63A 1KBZA 1W4ZA 2FZWA 2FI1A 3MJRA 1P9WA 4CFZA 1OI7A 2B0JA 5JNTA 1MPXA 1YQUA 2C8JA 2J9RA 2VH2A 1TEVA 1WZUA 2DR3A 2QIOA 1JQ5A 2WUGA 2A6PA 3KQKA 1BGWA 3R7AA 3QPCA 5K0SA 1SCUA 2WQZA 5JCPA 3LC2O 1ZNWA 4Q03A 1XCMA 4Q3LA 1JEOA 3NFRA 4HH3C 5FBZA 2ATEA 2YYAA 4RTJA 1SUAA 2IDMA 5DCLA 3VOTA 3LM8A 2ZYWX 4F4IA 2ZUVA 5B1YA 4UBLA 2VPYA 4O8ZA 3I92A 3F6CA 1BH6A 2FWMX 3IHTA 2ZVJA 3PQ3A 2WPNA 3WGQA 1OYVA 4N9QA 1FDOA 2YYSA 3K9BA 3O8DA 2EEPA 1XMJA 3HB1A 3TDKA 1WCV1 2DY0A 4F6RB 4EF5A 5EIBD 2PFGA 1EK2A 3TLBA 2ZI3A 3K2IA 4GYWA 3SX2A 2W4MA 2Q0QA 4N6NA 2WAOA 3GUVA 4K81B 2EL7A 4YACA 1Z7WA 1I5OA 1WMEA 2EKDA 2PM8A 3JTEA 3K0EA 5K3BA 4OLAA 4G5SA 4Y7CA 3TJZA 4B73A 1CQWA 2WZDA 4TVOA 1P39A 4ND3A 5JV5A 1VP9A 3CUWA 3LLVA 4JC5A 4LXUA 2JFBA 4OB7A 5CHYA 1NR7A 5JDCA 2WB4A 1L5NA 1OE0A 1KDYA 4IF6A 2P62A 2XNSA 1GPDG 1TQHA 2GN8A 2RHBA 5H9WA 1G5TA 4EHHA 1HTWA 2QTZA 1G55A 2VDQB 2IPNA 3GY0A 1VSQA 4WNYA 1YS6A 4PWZA 5EYPB 4OLFA 3SJZA 4YPVA 3CH4B 4AJ4A 3QE0A 1RC0A 2PH5A 2C2KA 4FS3A 2JIRA 4BAUA 4JXKA 3L79A 1DBSA 4EYSA 1XEXA 3GLFE 1QRAA 4RHCA 5BSTA 3ZEAA 4J6EA 3EGXA 3FROA 1O6ZA 4NAUA 3O75A 2NMVA 3P97A 2WWHA 1FW8A 1X7GA 5FO0A 1II8A 1TM7E 4MDFA 3ZCSA 3B9RA 5FBWB 4CM7A 2GPBA 2DFVA 2NZWA 1KNQA 1KMNA 3U37A 3U44A 2UVQA 1U5BA 2Q5LA 3AJRA 4FDUA 4J75A 4NDNE 3NC1C 4B3IA 4NOLA 3SEFA 1J25A 2BZ1A 4BATA 4XVCA 5KTPA 3JD3A 2HT1A 3O94A 3FYCA 2QL5A 4WACA 4YDHB 3ETNA 5ALRA 4H6XA 2JIOA 5DYTA 3V2IA 1TQ8A 4BP8A 1XNRB 4P92A 1NKSA 2RGUA 3LT1A 5KS2A 4UM8B 3GO4A 1TJYA 4D9KA 1KAMA 1SBYA 1X13A 1OX6A 1DQNA 1PU2A 2P79A 3IUNA 2B1GA 2G5GX 4OL9A 1T2AA 2XB9A 3WICA 4EZBA 2D74A 5HJ5A 4FP9A 1L4LA 2FPSA 2CLDX 2OHGA 4OGLA 3S28A 1M8JA 1RKQA 3VSDA 2ERXA 2NM0A 1YZUA 1PR3A 2ZUWA 3Q87B 5EMNA 2FAXA 2E0IA 4C1NA 4JLPA 3GOQA 1KY2A 3AR7A 3RU7A 2XCIA 2XYQA 4Z49A 3C7TA 1XFDA 1EUDB 3HJHA 2CLKB 3ETCA 5EUBA 2Q5HA 3IUPA 3A4NA 3ZGYA 1W2GA 4CTNA 3UJ9A 2DE0X 1Y8RA 2YXLA 3MWGA 3ZNQA 5EXSA 1NW9B 4P3OA 2XUQA 1S3SA 1V1MA 4LF5B 1BXGB 2E87A 1XXLA 1QTRA 3R5SA 1EDZA 1ICEA 4BV2A 3TMKA 2W98A 3C3PA 4RJJA 2Q7XA 3FKQA 1ESMA 1EM6A 4HQ6A 5JAHA 3PFNA 1M0TA 2XE8A 3KB8A 5ULLA 3ISJA 4LZNA 2QRQA 3AR3A 1UOQA 2R96A 3SSAA 4NP6A 3NZEA 2OCBA 4B4KA 4DCPA 4CEHB 4DCGA 1OXUA 3LFHA 1F7VA 1EJ0A 1GVHA 3OM9A 1NE7A 3FIJA 1OLXA 2ONJA 1UPAA 4YB8A 3COZA 4QNMA 1UFOA 4J3FA 5LYJA 2DT5A 3LCCA 4MMZB 5ERYA 1QG4A 3HSYA 2YIDA 4HYYA 3NCTA 3KBOA 4BUZA 2X5KO 4DLRA 4XD2A 1QV9A 3D3JA 5HTKA 3SYMA 4L8WB 5BQOA 3UHAA 2VWHA 4E70A 4F2WA 5JYCA 4K26A 3W9SA 4NIMA 2NSDA 2J59A 2IBSA 1MEJA 1Z6TA 2I99A 2QJWA 1YVEI 2BTQA 5DASA 5DNVA 1DL5A 4S1OA 2VT7A 2Z6UA 3A3KA 4KXWA 3IIIA 2FQWA 3ZLTA 1XTKA 3SC6A 4BUJA 2OB1A 3UHJA 5L53A 5LPNA 3OETA 4FT4A 3ZOZA 1DTEA 3K53A 4HDSA 4HRXA 2NYAA 4QOIA 1O54A 2IWRA 1QK5A 2WJWA 3U7IA 1KJ9A 3N2ZB 3B6IA 3UJAA 3P7MA 3HXKA 1WQ4A 4J07A 2BGRA 3QX7A 3T1YB 3PDIA 3UMVA 4LBVA 1XROA 3N87A 1D09A 4CMBA 2CXRA 3ONFA 3URKA 4ZARA 4L02A 1L5GB 4CUKA 5K6AA 2RAUA 3FTQA 3IPAA 2QAGB 5DSTA 3NM6B 4RVDA 2R65A 2KQUA 3BTOA 3D3WA 3ZV6A 4GW3A 3G6KA 5M3BA 1G21A 2RAPA 3AI7A 3HJRA 4GOJA 4ITRC 3AUJB 1JSLA 4O8CA 5JHHB 2QQEA 4C21A 1LRJA 1L1FA 3IP9A 1K6MA 1B3BA 1NBWB 1OX5A 1PWZA 4DKXA 3SXJA 1DRJA 2J41A 2ONCA 3CISA 1RBMA 4IZHA 4FOPA 2ZGVA 2F8TA 2QZPA 1RADA 1ZSYA 1HEYA 2QLTA 3G85A 4MWSA 2FE4A 3RVBA 1VYTA 2FUNB 2Y1GA 4QUDA 4QUIA 3QXHA 1GN8A 5K09A 3QXXA 2WWGA 3A6JA 3SKVA 2DBVO 1P60A 4YCLA 3F1KA 2ADFA 3HS3A 3OZXA 3ZY4A 4E14A 1EGMB 3WQHA 4F71A 2C4VA 2ZRMA 4EUEA 3N8NA 5B36A 4X64B 4EFDA 1HT1E 4KAAA 1CY2A 3BSFA 2G6BA 2QZZA 3DD1A 2W22A 4MGKR 5D3MB 1X8KA 1BMFD 4R3UC 1BN6A 4R71A 4GECA 1FNCA 1E2HA 3LSYA 4KITB 3C3CA 4F7WA 2WWYA 2K2QB 2VXOA 1C1XB 4YUWA 1V8DA 2V7UA 2V98A 3FYTA 2VNSA 4OYHA 4TRNA 3SICE 2JFXA 4JJ4A 4L2IA 4NL4H 3TRHA 4OO3A 4O1IA 1IXYA 5HR5A 5ED4A 3ZQJA 1KGSA 1EIZA 3M6WA 2F59A 1Y3AA 4DLSA 3ZKWA 4WFJA 3MYYA 3TB6A 3BRWD 2Q2OA 2ZRFA 1EA5A 3R3ZA 4PSVA 4CMJA 3DMHA 2ZSIA 5BV0A 2W9XA 4BN5A 1I9GA 4BAGA 1GTZA 3I2IA 4E5SA 1DT5A 4DB2A 3QFHA 3JQ6A 4TV8F 1JLLB 3ZJTA 5F3RA 4P5PA 1I33A 4X7MA 2Q0SA 1NXOA 4KI0A 3W4KA 1TAHA 2PZ8A 5I3CA 4TLEA 2QN2A 3IIJA 4EZIA 2QF7A 4FDMA 3GZTB 3PFGA 1U1DA 1E69A 1PD0A 2L0XA 2NVUB 4NOMA 4A0SA 1IWPB 1XIVA 1XRPA 3W1VA 2IUSA 1TUEA 3KU4A 1XBTA 4UMFA 3EZNA 3TUZC 2DWQA 4RU1A 3CJQA 4PSCA 4AN4A 1JB1A 2YMQA 4XQCA 3ENQA 2AYXA 3CLUD 3H5TA 2G71A 2I1VB 3QE2A 1FDUA 5CDGA 2Q07A 3B6JA 2C5EA 4L50A 4DG9A 1PL0A 3DLPX 3A6FA 4HXYA 4L72A 4BNMA 3UWMA 1E6CA 4HDAA 5EIEA 2HK8A 3H11A 3A4LA 2VIIA 5IT5A 5D7BA 4W1QA 3QVWA 3WRWA 1TEZA 2EWVA 1G20E 3AZQA 3F9CA 4I1SA 5DLEA 4ABYA 5BOSB 3QPVA 1O89A 4M89A 3HJFA 4OAQA 2C7GA 1Z0ZA 4N47A 3VYVA 3ZZNA 1RP7A 1UBRS 1DZIA 1CR1A 4JWTA 4QGGA 4CLEA 4E51A 1W36C 1U0JA 3OZWA 4EL0A 1HDOA 4A0RA 3MMSA 1QQ7A 3TZEA 3FPJA 2JAXA 4ALKA 2B1IA 4QREA 3KR0A 4D9EA 2C59A 3KUUA 3L7KA 4G25A 1M5RA 1DARA 2K2WA 4G67A 3G9UA 4TYMA 3DV9A 1E9DA 4OPMA 4TRMA 5JBNA 2ZM5A 2IHYA 1L3BA 2JJ1D 4QDJA 2OBNA 5EHIA 3F5DA 3ZG6A 2V74B 3PHBE 3VDQA 3PCTA 3B38A 4G81A 3OJLA 3CCFA 3FZEA 4A8JA 3O4FA 3NTVA 3UMRA 1U2EA 3MJEA 4OMFG 2JFHA 1U3WA 4LHSA 4OHPA 3VR3A 2IHUA 1UR5A 3G0IA 3L7DA 4I4TB 4TV9A 3CCCA 2X40A 3CPHA 4IVRA 4JIGA 5AKIA 2WM2A 4LHVA 4BZXA 2VPXA 1QGZA 4S3MA 5FPSA 1PVVA 3C6XA 4LF9B 1PCXA 3COJA 1ADJA 2AQKA 5JO0A 1PL7A 1YUNA 4CNQA 3L7AA 4AU1A 3QBDA 1CYDA 2FFHA 2H1SA 3L0IB 5CT9A 1SD1A 1RYZA 3OLQA 4CG2A 1EP2B 3WLMA 4QFCA 4HC4A 2M6LA 1U4SA 2I3AA 1I2BA 3BJRA 4ZO8A 1I2CA 4RKYA 3MUFA 2I4TA 5D6NA 2AFIA 3HXMA 2GUWA 2HA3A 4I4IA 5DM0A 2F1IA 3VH3A 4B6PA 1UZNA 4GOOD 4MAAA 1QQ6A 3WIDA 2P6PA 1FYWA 2ST1A 2IW3A 1V3QE 2D62A 1LQUA 3FWNA 1NF8A 1JR2A 1V8OA 3GXOA 4TSRA 2A0YA 3UBMA 3VU0A 1BN7A 3ND6A 4QPDA 4DPLA 4H7EA 1P3DA 1C1YA 3H3XA 4DSAA 2D13A 1OHHA 4LDRA 1UDRA 2XT0A 3LGXA 1C4OA 2P9HA 4IS3A 3ED1A 2VUUA 2VBCA 4OP2A 5G40A 1NVVR 1T1SA 4K6MA 2VI5A 3JQDA 4QXRA 5FFNA 4B7CA 2WG0A 5E6UA 4HVLA 2WG1A 1TQ4A 4HXFB 1C4KA 2ZRHA 1XRNA 3D9QX 2X0DA 3ZTWA 3L0BA 1V7CA 1ZNQO 1GDHA 1IQ0A 5BQXA 3GMIA 5ITZB 1YIAA 2ACVA 4ZT7A 3U80A 3BK2A 1LPOA 2BIFA 4FX5A 4I66A 1YBAA 4HPXB 4IILA 4LNAA 5FPPA 1Z45A 2FPUA 3TTWA 4KH1A 1Z08A 1Z4MA 2IYQA 4X1KA 4MV3A 4Z8YA 3MJFA 4BC1A 4CEIA 1R8SA 2A0KA 3K6SA 2P9GA 1ACJA 2QY6A 2XF8A 3CN7A 3MSCA 1NWHA 1W581 4TN5A 2FRXA 1ZNXA 1LPBB 1VP3A 2ZIAA 3V34A 3MGGA 1UODA 1ZVKA 2DQ4A 5CT4A 4AROA 3HZHA 5KHLB 2WU0A 1RYBA 4JLUA 2GD0A 4D97A 1LDNA 2XB6A 4X5OA 4GRAA 2OXTA 1ARZA 5LR6A 2BFCA 3QX8A 2YN2A 5DHTA 3BVPA 1L5HA 3D7SA 3BHJA 3H5IA 1V8FA 2Z2KA 4YIKA 3ENZA 2OD9A 5A02A 2VAMA 1QH8A 3T3OA 1IWBB 3K9FC 2HLNA 2YICA 2ECFA 3WGVA 2I8LA 4J7CA 2QLLA 2XHEA 4M86A 3RBVA 1EI9A 1XMQB 5DM4A 2WTXA 1C7ZA 2ANBA 2WR8A 2GAOA 2I4LA 3KV1A 3G0GA 3WGJA 1J7KA 4DLLA 4OMCA 5BXQC 2J08A 1CB0A 3OEWA 4IHJF 4DV5B 3OO1A 1ZOLA 4H1UA 1QUEA 1XZIA 1L7EA 2DFTA 3OE4A 4FOSA 3T5TA 4YFVA 1UWLA 3C70A 3GT3A 4FC7A 4U5QA 3C7KA 3STYA 4QHYA 3AF6A 5IJ9B 3PUIA 2C2OA 1PHPA 4B44A 1IIRA 1FLVA 1HFWA 2O2IA 1K7XB 2M6SA 1GPH1 1V47A 3FUCA 4H15A 1RQ7A 3A1CA 4GWKA 3WRYA 4P34A 2F1JA 2PIDA 3TGPA 1W0CA 1L7AA 5D3ZA 5CFQA 1VYUA 4DMCA 3PWKA 3ZR4B 2CLHB 4FUTA 1KEEA 2ORYA 4PQYA 4ARIA 3GWGA 2ZCJA 1GU1A 4H77A 1QXSA 4UCQA 5H3HA 2GM5A 3ZCQA 1CKEA 4UU0A 4BJ5A 4ME6A 4R2IA 3QVKA 2FDXA 1T35A 3ELUA 4UHDA 5IASA 4IIVA 2B82A 2G88A 1QV7A 1EFTA 4K46A 1Q6YA 4EJSC 3DL0A 3AV3A 4FGWA 1E1CA 2VRWA 3A14A 2PZAA 2Z43A 3AHDA 3LUJA 4KR2A 1Y34E 1N7HA 3OCYA 2XCQA 1P3JA 5D01A 5E1BA 2Z58A 3UG6A 2E4WA 4KIFA 3AJDA 3I2HA 4LE0A 5G41A 3L6RA 1JIQA 2O2ZA 2WHPB 4LIPD 5U1PA 2UAGA 2JAUA 3GARA 3FGOA 2GNOA 1NHWA 1TKCA 3QLUC 4FMBB 4U4AA 3LZCA 5DYWA 3K5IA 3THRA 3NRBA 3A05A 2PRYA 5KZMB 2XW6A 2PX3A 1Z4NA 1KC1A 3P2EA 16PKA 2R5FA 1CY7A 1NQXA 4NMWA 4PFQA 4EH1A 3CVOA 1KC3A 4Q3AA 2Q5FA 1WF3A 2Q6IA 3CXUA 3X1WA 3I9MA 4J90A 1JGTA 2JGLA 4PGGA 4XW2A 2IUFA 4BLQA 3RRNA 4C04A 2QT1A 3QKRB 4LEIA 1REQB 1AUQA 1ZCBA 2Q6VA 4MVJD 5ICGA 2DJIA 1XA0A 2GCEA 2AYZA 1AGPA 2YXEA 4FCTA 5EQTA 4BLOA 3I42A 4V2IA 1FSPA 4A2CA 1L4EA 1WO8A 2HY7A 2JFGA 2JJQA 3USES 1TKAA 4EA9A 1MG5A 4L73A 4F3CA 5F21A 3WNQA 2WAMA 5EMLA 4LZAA 2N46A 3I9KA 2AV6A 3GK3A 2D0PB 1TK2A 5E9WA 4D8XA 1YFJA 4AWXA 3L8ZA 1I3MA 2D4HA 1L3CA 3PGA1 2ODWA 1FRNA 4QYXA 4R40A 3U3DA 3Q41A 4G4JA 3ZXUB 4A82A 3FDJA 4BRWA 5KQRA 4S1VA 3RYFB 4RVFA 3BWYA 4AT1A 1YBHA 1RRMA 2PWYA 4KKVA 5K8JB 1E7RA 4QJBA 5GAJA 3DMTC 3HWSA 2QV0A 4N8DA 2QRLA 3HVHA 3A58B 4NPCA 4V1CA 5J2UF 4C3OB 3K0KA 2FQYA 4ZGWA 4UBIA 4ZHQA 3HPQA 3QOWA 4FR2A 4WOCA 3DZ8A 4Q3NA 3ZU4A 3DHVA 1IMOA 5DM60 1AD2A 1O94A 2ZE8A 3CR7A 3OIDA 5CYOA 2BE9A 1CUEA 4URYR 5GIPE 4D9IA 3T7DA 3IAUA 4KE7A 3DT8A 3B82A 2XHZA 3HXOA 3ESAA 2E4XA 3O3OB 4AZSA 1A95A 2YUIA 4R6XA 2A9PA 3A9RA 1COWA 1L5LA 3IAHA 4CIWA 4YMLA 4TTJA 3DQZA 2G5TA 5DHPA 2NAFA 4CIBA 5L3SB 3ODGA 4P0QB 4UDXX 3L1KA 2OV2A 2C5GA 1RI5A 4QLAA 4HB4A 3MLEA 1KZ1A 2TMDA 5EE5B 3ZI7A 1IBLB 3NHAA 2VBFA 1U7PA 3BMNA 4DLZA 1H6CA 5KWIA 1A4RA 1M3SA 4YC7A 3PQEA 1E0KA 1X7XB 3MLBA 2X7XA 4CMKA 4DWOA 4M0MA 1MU0A 1HL7A 4G5HA 1YZYA 3IUJA 4B32A 2JI8A 3EHEA 3NT2A 1C9MA 4EW3A 2A7QA 1P4GA 4ZVSA 4B79A 1H8EA 2BV3A 1YC5A 5CG2A 5LA6F 2N1MA 3PLNA 2HX1A 1MHTA 4ZGGA 1ZSVA 4B85A 3D7LA 4POAA 1U0TA 5LP6A 3LP8A 4MJXA 7AT1A 3L8YA 3LY9A 5DHSA 2GYVA 3JQGA 3DJFA 4J0GA 4UDOA 4EF6A 4WLOA 2VSXA 2V7XA 3VPAA 2A0UA 2DM6A 2WPDA 2ID9A 3OPVA 3H9JA 3V4ZA 3ZK9A 1K86A 5E8JA 3TD6A 4Y9SA 5D1HA 1L5RA 3PTZA 2PS9A 4MQBA 3DTNA 2EQAA 4JB3A 1G7SA 2YFKA 1MXHA 1T5TA 2DB3A 1Y98A 3RFVA 1A0OA 4DVGA 4DZRA 3U56A 4GYJA 4HZGA 4D46A 1Y4UA 4MR7B 4V0NA 4KXXA 1AIPA 4KPEC 2ZJ3A 5FOXA 5DW3A 4OFXA 4MW5A 2Z2ZA 2BY4A 4ZVKA 3EZYA 5KDLA 2C3PA 3T1TA 3ROTA 5L40A 3M4NA 5H82A 1Y6RA 1X70A 3DAYA 3WI7A 4UXHA 5F7XA 1WCXA 1A7UA 2DUUA 4RGQA 2QGNA 4O4IA 3PITA 4XQEA 4L9RA 5TQ2A 3O9MA 3NAZA 1KEWA 2JH9A 3E3AA 3RTAA 2ZB2A 3TD9A 2HXYA 2N9UA 1TMGE 3ZDAA 4MWTA 2FR1A 2QM8A 5FTNA 5THXA 2HTEA 2VP3A 1KDTA 4MLDA 4PPNA 3AQ4A 2PNFA 4GU5A 4DIFA 3ADDA 1GNTA 4CCYA 1TYBE 1W52X 1JDBC 2J0EA 4J4BA 2W2MA 3MTEA 2OA0A 2XDWA 3QWAA 4Y2UA 3L82B 3NHWA 1L1EA 1LJUA 3N8DA 3NNSA 3H7AA 1J7JA 4UM7A 3TDMA 3F73A 1Z39A 1RT9A 1N5KA 4LKRA 1VIVA 1ORHA 2V8OA 4FMDB 4R2XA 3RIGA 3PL1A 1QGED 1R9GA 2R8YA 4NOJA 5KHAA 2IYAA 4F4JA 4GPBA 1WBDA 3G6WA 3ZS9A 4CCAA 3CY6A 4QBHA 2WMNB 4N0QA 3D1JA 2UVPB 4TWJA 5ALEA 2WU8A 3X0DA 2RCYA 3KVRA 3LT0A 3VU9A 1NUAA 3H84A 2AC7A 2QN8A 4R3WA 2ZJ1A 3EAGA 3N1UA 4YPFA 1T6YA 3QWFA 4B2PA 2FCRA 2CEKA 2Q6OA 1P19A 2VG8A 3KB2A 3SDSA 1KF0A 1ZHOA 1NVKA 1ZJ5A 1Z6ZA 3IOEA 3HQ4O 5JCOA 3WSVA 4ZTUB 4XOUA 1E1RA 1C3OB 1RE0A 2BEUA 5B2FA 1Y4AE 4MQ6A 1J1IA 5BXYA 4W8OA 2NTYC 3KPWA 2JLUA 3A9TA 2IDKA 4EG8A 4DTIA 2QM0A 2PK3A 1E6MA 4LDPA 4UM5A 1VLVA 4AUNA 4AECA 1FQOA 1NMZA 1VFNA 3H0KA 3WLNA 1GNSA 4NWIA 4TXMA 5ESDA 1XDUA 2HJHA 1KEUA 4X84A 1ZH8A 1JHUA 1T6BY 3USCS 1DJMA 4KIWA 5C5CA 4C5AA 3OPYB 5JXGA 5KWVA 4H2DA 4BBJA 3EPKA 4RM2A 4AS1A 5CDTA 3HO8A 3GLHB 4XGRA 2O8DA 4H7JA 3M3PA 3W5BA 3AY0A 4OQPA 4J76A 1Y8QA 3L84A 4AWAA 3B89A 1W5AA 5HDBB 2NADA 3ROKA 3OFJA 4U7TB 1KPIA 4XWAA 2PNJA 2GTPA 4H1HA 4P4SA 3RRJA 1I5RA 4KQXA 4TWAA 3UH1A 5E2BA 3H9QA 2O7QA 3HCRA 3EH1A 1NN5A 3QNWA 4DBLC 3G2KA 4TS4A 4Y9RA 2V7WA 1FFBA 3SD7A 3RS2A 1J0BA 2X2PA 3G2LA 3L4EA 2BRUC 1J99A 5EE1A 3SNHA 4EKYA 4H3KB 1Q0TA 5LJLA 1W4RA 2B78A 4UVHA 3VPDA 1UBCA 2F43B 1K27A 3H5OA 4DNXA 4J0JA 4F8JA 3KDPA 4KH0A 1GRNA 2B0CA 2O2DA 3I04M 1EX6A 4LV8B 1KFCB 1ZLXA 2IYEA 2R1VA 3F7NA 3LTEA 4HHEA 4ZEVA 3K6JA 2GBLA 5A0FA 1LV7A 1B2LA 2UV8A 4HQLA 4WXHA 2QNBA 3FCOA 3CLSD 4N5IX 2ID7A 4UAJA 1DBRA 5GM1A 3DQPA 1SKYE 2HYIC 3ICCA 3NIDB 4ALMA 5IWCA 4YLYA 1G3RA 3D8TA 4P4LA 1GIAA 2I2FA 1KORA 2RHJA 2VP2A 2MT9A 1WXGA 3TQIA 1Z0UA 1PJLA 2R00C 3VHQA 4A16A 4MRRA 1P72A 3TNDA 1F60A 3JQAA 4MDEA 3LDHA 3WR5A 2IDZA 3U16A 3OQNA 4LOLA 4RA6A 2P5UA 1F6BA 1USVA 1HURA 1WUYA 1XNGA 1RHMA 2PX5A 3VKVA 3DPIA 4MIKA 4BVHA 4P7BA 1CYEA 1JDSA 1TF5A 3NHZA 4YJHA 3GGGA 2R7KA 3FGPA 4N5MA 3SOPA 1NNLA 3ZJ5A 1O96B 3PWSA 4RE6A 5BUQA 2B9VA 1YB1A 2G77B 3AFMA 1GUAA 1EWTA 1DTWB 2FB9A 3L18A 1L9KA 1Z56C 4CG1A 4G0OA 4HDNB 1B4DA 1R5JA 4IMRA 4KWIA 4N3GA 4YJ2B 5TDHA 1S2MA 3LUAA 3W79A 1EHCA 3D6JA <