4CMBA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
251
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 94
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmbA00
5L51A 3FSRA 4WPGA 1ISIA 1LLCA 1ONOA 1PGJA 5T8KA 4BKOA 1GEEA 4OHUA 1LRKA 2UDPA 4D3DA 3BMCB 1C3VA 3KVOA 4O6VA 2V6MA 2PGDA 1ZEJA 3GR6A 2JFGA 3G49A 4E3ZA 2ZKLA 3DDNA 2AQHA 5ITWA 3L9XA 2NU6A 1BXZA 2E6UX 1NVTA 4CM9A 1S7CA 5COAA 1MXHA 1R0LA 3E9QA 4PZDA 1GCOA 2HSDA 4YA6A 3DOOA 1CQJA 2Q4BA 1U2GA 4M87A 3AU9A 3C7DB 2C2XA 3KO8A 1BW9A 1ZNQO 2CF6A 2ZJ0A 3Q0EA 2WYVA 1FDUA 1C0IA 5DCWA 5ITVA 2BKAA 4DQUA 5K9ZA 2HUNA 2ZK7A 1EBUA 4E5MA 1BXGA 1H6CA 4NFHA 1MG0A 3HB4X 1EK6A 4AG3A 2VNAA 1A4UA 3V1TC 1CRWG 3OA0A 4CLHA 1Y8QB 3Q2IA 4OXKA 1E7SA 4ZRMA 5JCJA 3PRJA 1W73A 4Q3DA 3ZU3A 4O59O 3NYWA 3ON5A 2CDCA 5U4QA 2HAEA 2A9FA 1IL0A 2X6TA 3DZHA 4B7CA 4EEXA 5L9AA 2I66A 2IE0A 3V5NA 2YZ7A 1GR0A 5JXWA 3U0BA 3H6KA 3GAFA 3KB6A 4N54A 1IUKA 2EIHA 4OL9A 3U4DA 1Q0QA 4BO3A 2VWQA 5TQVA 1QYXA 5KVCA 1YQGA 1W4ZA 4FGWA 1VLLA 2W8ZA 4GQAA 4YAGA 2PKQP 2DAPA 2O3JA 3S55A 3AOGA 4NU5A 2AG5A 2BFAA 2PH3A 2HK7A 4B79A 1MFPA 1PQUA 1X7GA 1Z75A 3KYBA 4ITUA 2I3AA 1LDGA 4XIJA 5DOVA 3TZ6A 2NQ8A 3LLSA 3QV1A 4YJHB 3VZRA 1T24A 1DC4A 5JAMA 3BMNA 1QR6A 3LT0A 5ENVA 4XIYA 4Y6SA 4BNHA 2ZTLA 1GADO 1SCUA 3MWEB 3P19A 1LSJA 4OIMA 4RF5A 1H94A 3F1KA 4BV9A 2QRLA 5CEJA 4ALMA 3GZNA 2JD0A 1YWGO 1YL7A 4HKTA 4Z0HO 5IN4A 3PGJA 5FWNA 3L4BC 3NT5A 1B8VA 4J9VA 3MTGA 4CV2A 4ZQHA 3ZWBA 2WM3A 4C7KA 2VUSA 1E6UA 4PG5A 3VZSA 4YYZA 2DLDA 3R1IA 1A27A 4WNCA 2FPGA 4Q9NA 5CDTA 4GSLA 1I3KA 3LC1O 1EDOA 4R3WA 3QVXA 5I8ZA 1KY4A 1B3RA 3JD3A 3GVPA 3KXDA 4J91A 3G3EA 1FDWA 2GZ2A 4G65A 4FPXA 1T2FA 3F47A 1QXSA 3JQAA 2JHFA 3VPFA 1R37A 1QV6A 1N1GA 1WDLA 1GUYA 1MX3A 4EDFA 2CD9A 4NNJA 2PZLA 1B26A 2GN4A 2JD1A 1CETA 5L7WA 1SO8A 3RFTA 4R41A 1LU9A 2G5CA 4PLGA 1RM4A 2HKIA 1V0JA 2I76A 3IKVA 1H0KA 1KOLA 2VRCD 3E03A 3ZDFA 5IAAA 3MZ0A 2BHLA 4FD3A 4PLVA 1PL6A 3CINA 4Q3EA 3AUTA 2RH8A 2GASA 1L7DA 3UFXA 3VH1A 1VE9A 1JWAB 1NFFA 4EGFA 5CFZA 2IXAA 3RC9A 1P74A 1QYCA 1RM5A 4B8WA 4DMMA 5JO0A 2JCYA 2AEFA 4TZKA 1B14A 4ILKA 2ZIZA 3JSAA 4FR5A 3UF0A 3PFFA 1QYDA 4IDAA 2DPGA 4OM8A 1OC4A 1QP8A 3GG9A 1LC0A 4IINA 2CUKA 2HMVA 2Q99A 3ANNA 3ABIA 4YB8A 3U09A 4LGVA 2BI8A 3DHEA 1NQ5A 2VWHA 2DU8A 4R68A 4BQRA 1O89A 1YOVB 4J0FA 3U3XA 4NQZA 3HQ4O 4YCAA 4ND2A 5TIIA 1QRRA 3KM0A 2DVMA 5KJ6A 3HJAA 2X8LA 4AFNA 3V2UA 1MB4A 2GRAA 4WCFB 1V6AA 1LSSA 1M67A 2RH4A 2FWMX 4BKQA 3HDJA 3KLMX 3WIEA 4CUJA 4PLWA 1NQOA 1R12A 1R4NA 2Q1TA 2C7VA 3FNFA 4P4NA 3R3SA 5MDHA 2AE2A 3JQFC 3KTDA 3MJTA 3WJ7A 2UUOA 3I9LA 3DZGA 4KUEA 4CLOA 4TWRA 3VTZA 1UXHA 1EFKA 1LLQA 3AI2A 3K96A 1G0NA 5A06A 4XEHA 2NACA 1MLDA 3FPLA 1BG6A 2Y68A 2PZMA 4JN6B 3S2FA 3WXBA 4X54A 1K89A 4RQUA 4AJEA 4CMGA 4MVJE 5A9RA 1LDEA 5C7LO 1DLIA 4QQRA 4A5OA 4BNFA 1C0PA 1E7RA 2EP7A 3AI3A 4ALNA 1EZ4A 5THKA 3GEDA 2NVWA 2V7PA 4WNIA 4Y6PA 5DP1A 1O8CA 3INRA 4BVAA 1AN9A 3S2EA 3ZWWA 1GCUA 3A4VA 1N9GA 3JQ7B 2BFOA 4D7AA 4WLUA 2CDAA 4AL4A 1NWCA 2GO1A 4CMEC 2RHRA 4DGSA 4YAJA 2FSSA 2DTDA 3GMDA 1XYGA 2AW5A 3ASVA 5EESA 3D3WA 4B4WA 1E5LA 1GEGA 3QWBA 1AXEA 2UAGA 4WE3A 4YJGA 2X1HA 3GNQA 3LT4A 1ZH8A 2HQ1A 3K5PA 1U1IA 5DBGA 4JJIA 1UDBA 2NU7A 3WBBA 2A35A 2Z5LA 1VJ1A 3WDSA 4PFJA 4CMIB 4PRKA 4ZD6A 2DC1A 3DO5A 2TMGA 1VKOA 1KEWA 3K92A 1C1DA 3JQ9C 2Q2QA 1P3DA 2OGUA 3BTUA 3BMOB 1L1FA 4IIVA 1A7AA 3HNPA 4Q3CA 1QYVA 3LYLA 4ZHSA 4ZICA 3HDYA 4XX0A 2B0JA 3GGOA 1BMDA 3DZIA 1D3AA 1EVZA 4JBIA 4YBZA 4FIZA 3LLVA 3ZWYA 1M75A 5AOVA 4F6CA 2NU9A 5DBFA 3U4IA 2YFHA 4I1IA 1VKNA 1XQ6A 1ZBQA 1YRLA 3WYBA 3V2GA 3WTCA 4E6PA 5TGDA 5ER6A 1ZK3A 4R01A 2GNAA 4Y67A 4CMBA 1VSVA 3OMLA 1GV1A 3VKUA 1A9YA 4BMNA 1P0CA 2ZTVA 4H3VA 4WLFA 2B36A 2YHIA 1CEQA 3B70A 2PH5A 1EDZA 1P1RA 1Y8RB 3BTVA 3E48A 4FFPA 4YAIA 5JC8A 1HYHA 1Y81A 1HLDA 4H7PA 2FHSA 3H9UA 4A73A 1DJQA 1FDTA 2HMSA 2B4QA 3MOIA 4C7JA 4NBVA 3JQGB 4JK3A 4YTEA 2X9VA 3SJUA 4EW6A 3VDQA 5LCXA 1MP0A 1NP3A 2Z1NA 3SLKA 3WQSB 4BGEA 3NDIA 5KJFA 1YKFA 3TZCA 2FY8A 4WLEA 1H6DA 2OP1A 2Y67A 3ASUA 4N7RA 1RKXA 5JY6A 4XB1A 1Y7TA 1EMDA 4IGFA 4FSHA 1Q7GA 2P4HX 3WS7A 1LXCA 2J6IA 4NZ9A 4F3YA 1HYGA 2Y0EA 3C7CB 4BB6A 4E5YA 1UZMA 1T1RA 3RI3A 4XYMA 1N92A 5HWSA 4R9SA 1MV8A 5FFFA 3JQAD 1DC6A 4BGIA 4W9NC 3DEYX 3EYWA 2NSDA 3RFXA 2R00A 5K6AC 2CVOA 3H5NA 5AXDA 1JVSA 3Q6IA 2VHYA 3AUAA 3GPIA 5AXAA 3RAJA 1GD1O 3E9MA 1ISJA 4DA9A 3NEPX 4LCJA 4IS2A 1I36A 3IIEA 1HDCA 3C24A 5A1TA 2EEZA 3GVCA 4MVJF 3KV3O 4Y9DA 3JV7A 2G82A 4NMHA 4E31A 3LK7A 4J2OA 4RVUA 2ZJ1A 1E1MA 5FI3A 3ZWAA 1LBEA 1O6ZA 4MP8A 4I08A 3ZHZA 1BW9B 2VCYA 4FFOA 4GX5A 4G5HA 4BNUA 4NR0A 5EERA 3LT1A 1J5PA 1PJCA 1GQ2A 3GC6A 3AOEC 5F5NA 3WMWA 2O4UX 1HZZA 5COQA 2HLPA 1BXGB 1T2CA 2CZCA 1YQXA 4KDEA 4MKXA 4YQZA 2A92A 4CM8A 5BNIA 1ZK4A 2JAPA 2NVUA 5L7YA 4L76A 1WVGA 2VOEA 1JA9A 3OEWA 2OHXA 3IP1A 2Y1OA 2O3SA 3FI9A 4JX8A 2DUWA 1IULA 3ULKA 4BMSA 1TT5A 1DHRA 3AUSA 3I4CA 1JVBA 4FCCA 5A9TA 3PEFA 3HFSA 3P2OA 2ET6A 3PJFA 4EJ6A 3S1LA 1BDBA 3DBRB 4MVJA 4XJTA 2BFMA 1BGVA 4FN4A 3RASA 5BSEA 5L53A 2PA3A 3GLQA 3FR8A 2AEJA 2W2KA 3ENNA 1H2BA 5DN9A 1E7QA 3WJAA 2EW8A 4TSKA 1ISGA 3K2BA 4MIOA 2ZTUA 3K6JA 3H8VA 5T67A 5JE8A 1JW9B 4R5HA 2AG8A 4M49A 2IRWA 4CMAA 4PVDA 2O7SA 1DB3A 5DT9A 3UN1A 2E48A 1LRJA 4GKVA 1DIRA 3CEAA 1NFRA 2GYYA 1E6WA 1EEHA 3H7AA 1EUDA 4CLDA 3AM3A 5JO9A 2NNLD 3FNGA 1UUFA 4CJXA 1V8BA 2GPTA 2C7GA 3DZBA 2RCYA 3EK2A 1PQPA 3KSZO 1O9BA 3X2FA 2VT3A 4I8XA 2G76A 3RKRA 5GZ6A 4PZCA 4K6FA 4Z9XA 4AJLA 4NBUA 1JKIA 1GYPA 4GL4A 3ZV4A 4TQGA 2FZEA 4QX6A 4BNJA 4KOAA 2Y99A 3KSUA 1DSSG 3T7EA 1K5HA 1YO6A 1ZK1A 4PLPA 4FGSA 5A5FA 2P9GA 1LRLA 1SNYA 4BV8A 4QSMA 2F1KA 3WGHA 3DAFA 5JFOA 2HMTA 1LDMA 1R4MB 1UAYA 4UUOA 2B69A 2EW2A 4WGGA 4BO7A 1SPXA 2OP0A 4BO6A 4WOJA 4RDHA 2XF8A 4CM4B 3QVOA 1VI2A 3NJ8A 1HTBA 1IZ9A 1GPDG 4OYRA 1YJQA 4J6FA 2JCXA 5KTKA 1A71A 3C8MA 3DBHB 2AE1A 2BGKA 3HSKA 2ZYAA 2VRCA 1GZ4A 3L4BA 3I23A 1UP4A 3F6YA 4JP3A 3LSYA 2F00A 3CUKA 2BFPA 3RSHA 5B4TA 2VHXA 3QP9A 3FTPA 3ANLA 2QHXA 1ENPA 3I6QA 2J3JA 4KMSA 4R54A 3NUGA 3ETEA 3C1OA 4TKLA 3K2EA 3RC2A 6LDHA 5I8WA 4DWVA 1YBMA 1LDNA 5KVVA 1N5DA 5JDCC 2DT5A 2WJPA 4I5FA 2D8AA 1YB1A 3RBXA 2WE7A 1OMOA 2Z95A 3F46A 3H9EO 5DCUA 1X7HA 4MVJH 4Y8VA 5TX7A 5U1PA 2YDYA 3SX2A 4GAEA 3O4RA 4WKGA 1HT0A 1ULSA 4II3A 3KUXA 1ISFA 1YH3A 1NFQA 4UVEA 1V3VA 1P44A 4FDAA 4IPTA 3UGKA 1M76A 2X5OA 3E6AA 3DOJA 3D7LA 4HNGA 1ZFNA 1TA4A 3QHAA 4J43A 1P1FA 3EVTA 2IYPA 2IDZA 4XYBA 3SJ7A 3WMXA 4CLOB 2PZKA 4NPCA 5JAIA 3M1LA 4B3JA 1I8TA 3GAZA 3ZH2A 1HYEA 2FMUA 4GH5A 5B37A 4ND1A 5JAZA 5EQFA 4JCOA 1NVGA 3TF5A 3RBZA 3T4EA 3H9QA 5KKCA 1UH5A 4IQ8A 5F1PA 1DO8A 3NGLA 5KOIA 3M1AA 2EKQA 4DPKA 5DCYA 4GMGA 4WOKA 4OXNA 3INGA 2WSBA 3LQFA 1M6HA 5C37A 1E77A 2IZ1A 2CF5A 4QO7A 4YRDA 1NWHA 2JCVA 1FDSA 3AU8A 1M2WA 3HB5X 4HFRA 3VAZA 3WTBA 4FJ2A 2BGLA 4RPLA 5JC1A 1WNTA 4W4TA 3WQQA 1F12A 1J0XO 2PLAA 3ANMA 4GKBA 4XA8A 1SOVA 5G0TA 3BHMA 4MJLA 5F21A 1I32A 3IC5A 3VPGA 2WYWA 1EFLA 2PD6A 3JQ8A 4BMVA 4E0BA 3PDJA 1YJ8A 1GZ6A 1H93A 4UVHA 3V1YA 2Y1GA 4CL8A 2P5UA 1D1TA 1JQBA 2O2SA 3RU7A 3IP3A 4IDEA 2A94A 3D3WB 4JQCA 2WDZA 4YXFA 2UUPA 2VHZA 3JQFA 2EG9A 4WLVA 1BSVA 1UAGA 1NTOA 3I1JA 5ER9A 4ONEA 5CDYA 4WUVA 2Q1SA 3JQBC 5HS6A 4PG8A 1ONNA 2H1SA 4E5PA 1SC6A 4J16A 3STHA 1X15A 4IIUA 5G0UA 4CM1A 4BIIA 3Q2KA 3WX0A 2WWRA 4O0LA 4IJUA 9LDTA 1GUZA 2V6GA 4NH4A 1KVQA 5KWEA 1PS9A 2GDZA 1EUZA 5HTOA 3K9QO 1E6EA 4ALKA 1PS8A 1GUFA 4KQWA 4Z3DA 5THQA 4CM7A 4Q39A 3BAZA 5HBRA 4EJMA 4ZGWA 2IEBA 2XXBA 1U3TA 1HDOA 5EMHA 5A02A 3FBTA 3GT0A 4D46A 3LU1A 2Q49A 2UYYA 2HCTA 3O9ZA 4E2ZA 3MOGA 4U8GA 5ILGA 4CQLB 1HE5A 2PKRA 2PGLA 1QORA 2FSVA 2JJYA 3EGOA 2J5RA 1R66A 3IAHA 3UICA 4LK3A 3WQRA 4PIVA 1C0LA 2D59A 4L74A 4HFMA 4IGEA 3ZV6A 3DL2A 4PLYA 2X22A 1WXDA 3CSDA 3RJ5A 3WIDA 4WCFC 1DPGA 2B4TO 1R15A 4MVJD 2GLXA 2O2YA 4CMEA 2QG4A 4XYLA 3DXFA 4PLCA 2YHIB 4E32A 4PLTA 5GMOA 1ML3A 2VOJA 1AHIA 4BO4A 3V2HA 2IZZA 1EQUA 4QT0A 4A26A 3MJSA 1A72A 1RYEA 1ZMOA 1JKJA 4RLSA 3N7UA 5F3RA 1PS0A 1X0VA 1MFZA 2X5JO 4EJ0A 3DMTC 5JLAA 2B4RO 4J90A 1FMCA 3JQ9A 3SC4A 4DREA 2WMDA 2YV1A 1V3UA 4UVIA 3L6EA 3B1FA 4J1NA 5CG2A 1IPFA 1VJTA 1IYZA 3BA1A 5G4KA 2I67A 1ISMA 5JYEA 4NBRA 3TSCA 3MCVA 1F14A 5BSHA 1DC5A 3D3EA 3HDQA 3VH2A 1X1TA 2O50A 2NUAA 3LDHA 4RO0A 1S6YA 3L6OO 5IXSA 4FB5A 1ZKMA 3BYZA 4IJKA 4U5QA 3KSDO 3IQDB 3ZV3A 1H9AA 2PWZA 3NT2A 5HRUA 1O95A 2VZ0A 4GBJA 2P91A 2PTGA 3PVZA 4DRYA 4FFNA 3RC1A 3RKUA 1ENOA 5T5QA 1ZO8A 2JFHA 4IMPA 1JN0A 3A06A 2Y05A 4JROA 1LDBA 3I5MA 1HLPA 3G1UA 2QRKA 3TOZA 2X0NA 1DRWA 3O8QA 1PGNA 4NDNE 3JYPA 5CPBA 3OM9A 5KVQA 3TNLA 1EVYA 1YXMA 1B2LA 2R2GA 1HL3A 2FR1A 2QZ9A 1BXKA 1VM6A 3U9LA 1TVEA 1K3TA 3UUWA 1DEHA 1PJTA 1UP6A 1UR5A 3RUDA 1HKUA 3CXRA 4J4TA 2Q50A 4LISA 4R1SA 5JCXA 1R0KA 2H5LA 1E7MA 4NG5A 3D4NA 3N58A 2OBYA 3ONEA 1Z74A 1HDGO 3JCZA 4RZHA 1PJ3A 1SB9A 3FHLA 1DHTA 3UAGA 3PZRA 4IS3A 4JJFA 4IZHA 4GVLA 3FNEA 3IL2A 2O3TA 4NJMA 1GDHA 4UVDA 4HFJA 1E0DA 2GUGA 4A2CA 4OOFA 1DJNA 3KYDA 4P22A 2PGJA 2P9EA 4XJSA 1MG5A 3JYOA 3RC7A 4IXTA 3PHHA 5A3JA 2DBVO 1PZFA 1P0FA 4W9NA 1TT5B 3E82A 3QLJA 2CY0A 5K6AA 1NX6A 5EL0A 1BWSA 2DBZA 4KZPA 1KBZA 3OIFA 4ROSA 4EUFA 3VDRA 2TMDA 1U7TA 3QA9A 1Y9EA 1U3WA 2DBRA 4LRSB 1T4DA 3WBFA 3WGGA 1B8UA 2ZYDA 1Q0LA 1W8DA 2IODA 3H9GA 4PLZA 3GF4A 1SBYA 4B3HA 2G17A 3FRJA 5JDIC 3BMQA 3OF2A 3Q9UA 4QUKA 2QZZA 1UXJA 1ZSNA 4JNKA 2YQ4A 5G0WA 5F1KA 3RCBA 3AOEA 4BUCA 1PL8A 4RF4A 3H9JA 1CYDA 4FC6A 4K1LA 2JKVA 5L4LA 1MC4A 2GZ1A 4MDHA 4DQVA 5ILOA 4QTZA 4IM7A 3IUPA 3JYNA 1RM0A 1YQDA 2X9GA 3RUCA 3IS3A 3WG9A 4CQMA 3F1LA 5CAEA 4RV9A 1AXGA 3H5AA 3MEQA 5A5EA 4XYGA 2E82A 1IHXA 3JD4A 1DXYA 1PTJA 2YY7A 1F8GA 1EVIA 3DR3A 1CERA 4JIGA 4DLBA 3C3XA 5T8KC 1EQ2A 4P4LA 3NDJA 3COSA 4ND3A 4W7IA 2EXXA 3AFMA 1LTHR 4GPD1 4MINA 1DAOA 3L77A 4DIOA 1FDVA 2EHDA 4DTIA 5B1YA 4BHTA 2WTBA 4I9NA 1SB8A 4KWHA 1YDEA 3I9MA 4L4RA 2WD7A 1PZHA 3M2PA 5B4VA 3HG7A 2J3IA 3W6ZA 2BH9A 3EAGA 1KEPA 4DLAA 1IB6A 1LDYA 4D41A 4Z9YA 4CMCA 2W4QA 4BO9A 1C14A 3PGXA 2BELA 2EV9A 1NYTA 3FPCA 3D5QA 3MJVA 3PTZA 1E3JA 3C1AA 3UCXA 3GVIA 5CHEA 3FWZA 2D5CA 3PP8A 2PY6A 4EZBA 4LVUA 3DAPA 3I83A 3SBOA 4IJWA 2O3QA 3LF2A 2VRBA 3KYCB 4Y6RA 4RVSA 3H4VA 3WOHA 1GQYA 3RBVA 3OJOA 1F8FA 4YACA 3W6UA 1PGOA 2VT2A 4BNVA 3FR7A 5DZSA 4PG4A 4O5OA 3HE3A 4M89A 4Z3KA 2DUUA 2P68A 4BNXA 4B8ZA 1J4AA 1NPYA 2CVQA 3BMCA 1U9JA 1LX6A 4W99A 4W7HA 1E3WA 4GI2A 3VC7A 3FTNA 3OBBA 4NFSA 3QRWA 2LDXA 4TVOA 5J23A 4C4OA 4RPGA 4EITA 1XU9A 1YE3A 4XQGA 1WLYA 1HEUA 1AE1A 1N2SA 2FRDA 2J5QA 4YAEA 5IDWA 2I5PO 3JD2A 1KYQA 1PGQA 4DPLA 4E2XA 3W8FA 2FP4A 4F45A 1NBOA 3VHRA 1DDOA 3QWHA 1EE9A 4AJPA 4CMJA 3HZZA 3JQ6A 3PIIA 3ROMA 3OA2A 2IYOA 3FNHA 4R1TA 3VVCA 5BQFA 2NLOA 3QWFA 1PJ4A 3G1TA 3HUDA 1OZAA 2CVZA 3WGQA 3SEFA 1HF3A 1E3IA 1HDZA 3BIOA 4R3NA 1WW8A 4NU6A 5JPIA 3C1TA 1DRVA 2DFVA 4U6QA 3FWNA 1E1LA 2D3TA 3D0OA 5AYVA 5KVSA 4ALIA 4BGUA 1DC3A 3D64A 1U3VA 2XAAA 3M2TA 2PK3A 1SOWA 2ZTMA 2X0IA 4BO2A 4URFA 2IEDA 5L3ZA 3W8DA 5IXYA 4IZIA 4BNMA 2ILTA 2PZJA 5IF3A 5ICSA 1UZNA 3QSGA 3D1LA 3GRPA 1TT7A 1I01A 1Q0HA 1N8KA 4CV1A 2OZPA 3MWDB 1DIHA 4HADA 4FFLA 1OFGA 1YL6A 4G2NA 1C1XB 5GY7A 4BKPA 2QQ5A 4ZVVA 2DKNA 1ZSYA 1LSOA 3GFGA 4WASA 8LDHA 3LZ6A 1RYDA 4OQZA 4XDZA 4GMFA 4B4VA 1U4SA 1I3LA 2WE8A 4L4XA 1M6WA 4IDGA 4Y98A 2B37A 5CPFA 3G0OA 3WWYA 3DTTA 4AVYA 3UOGA 4B7XA 1NM5A 1UDCA 2EKLA 5I7SA 3ZWMA 1KEVA 1YS4A 3VTFA 2Q4EA 3VZQA 4YJHA 4KP7A 4Q3BA 4OXYA 4DPMA 1GU7A 4OSPA 3HDHA 3NV9A 3L07A 3WSVA 3ONFA 3DFUA 2A4KA 1Z73A 4J1TA 4XCVA 3ETGA 3GUCA 1QKIA 3L6DA 3OJFA 3WB9A 2AXQA 3PWKA 1Z7BA 2X9NA 4RVGA 4BO0A 1HDRA 1QYWA 3OQ6A 5TSDA 6ADHA 4J3FA 2VTEA 1NHGA 4FW8A 2VYVD 2EGHA 2VWGA 2OOSA 3HWRA 4TRJA 3VH4A 5IZCC 1PU2A 2GR9A 2VQ3A 3NX4A 4XZ3A 3D4OA 5BT9A 1BVRA 3BHIA 3L0DA 2BI7A 5DP2A 3DHYA 4IMRA 4OKIA 5FI5A 4E12A 3L4SO 2EERA 4MIYA 2GD1O 3CMCO 3INTA 4YVFA 5TJHA 4DYVA 3R3JA 4D45A 2EWMA 5TT0A 1OI7A 1QG6A 5BNFA 4YAKA 1SAYA 3F5SA 4IJVA 1OOEA 3B1JA 4GGPA 4J9UE 3TJRA 1ZIDA 1T2EA 1PJ2A 5G0SA 1RWBA 4NK4A 2QW8A 4YJDA 2QX7A 4YJFA 4L73A 3O03A 4E33A 3TFQA 2J5KA 2FR8A 1HE2A 4RF3A 3RROA 3PXXA 2ZB3A 2O3RA 3EDMA 3GY0A 1TXGA 4QEDA 3UH1A 1T1SA 3GNTA 2GZ3A 2C0CA 4YEDA 3TZHA 4A03A 2CDBA 3AY3A 3EHEA 1BRMA 1BDMA 5H82A 2RIRA 4H16A 4BQPA 4PZEA 2CFCA 1I0ZA 4J0EA 5CG1A 1PJQA 4OQYA 2OO5A 5FF9A 3PJEA 3F9IA 3KLPX 3NRCA 3D4PA 1GAEO 1ZSVA 2XXJA 1WDMA 4I5EA 3VPSA 2W90A 3E8XA 4OH1A 2X7HA 2PFGA 4YQYA 3BMNB 4CQMD 3ZGYA 2P5YA 1QLJA 4E30A 2RBEA 1V9LA 1J6UA 3LC7O 5IG2A 1MGOA 4YRAA 3GZNB 4K28A 1U3UA 3WFJA 5GZ1A 4AJKA 2NTJA 2G1UA 3K31A 2AA3A 5JSFA 2B83A 2W2LD 3WICA 5A04A 4NI5A 3S2IA 3W1VA 1VPDA 1YDWA 2PV7A 4CMKA 4B4UA 3PYLA 4JJGA 4N5LA 1JDJA 1JU9A 5C3MA 4WCFA 1KEUA 5JMPA 5C7IO 4AJOA 4WECA 2OUIA 1PWZA 1HSOA 1RPNA 3JQAB 3IKTA 1NASA 3NDRA 4I5DA 3O8QB 3EMKA 1IY8A 3DTYA 4BO5A 3KETA 2WD8A 3ONDA 1FK8A 4M54A 1DFGA 1E92A 4B3IA 3OJEA 1UXIA 4R69A 4RPKA 1XHLA 4OO3A 4FQ8A 1WZEA 3ZNOA 2GSDA 3ZWOA 4MVJI 3F5QA 3LVFO 4XGNA 5EQDA 1NXQA 2D0IA 3RVDA 2H6EA 3DFZA 3JD1A 3JTMA 1G1AA 3GZ4A 1P1HA 5TLSA 1B8PA 3NTRA 4NJMB 2JD2A 4CR7A 1XGKA 5KCZA 3QQPA 3U5TA 3ZW8A 4K26A 4OKNA 4N18A 4PVCA 2VHVA 4M1QA 2PR2A 2C07A 3I9NA 4XR4A 2X58A 4W82A 1ENZA 4YWJA 4D42A 3KEOA 4CLEA 1SMKA 8ADHA 3PWSA 4XRGA 1DIAA 4IXWA 1PR9A 2NVBA 1OBFO 2O7QA 3AY6A 3CZMA 4II2A 3TRIA 1D8AA 4J4BA 4BNYA 2ZB8A 2Q2WA 2FPIA 3K30A 4O63O 5EJ2A 5C5IA 3R0IA 2CSUA 4LVCA 4BNNA 4HNHA 1CIVA 4K9DA 4F46A 2YV3A 1NQTA 3F4LA 5TS3A 4RQTA 1EVJA 2YV2A 2NV6A 4OSOA 3D5TA 1O0SA 4R51A 3NAQA 4E21A 1I33A 1Z82A 3BMQB 1H5QA 3BZUA 1Y5MA 3KZVA 1T2AA 3GHYA 4R16A 3ZWNA 1IOLA 1HDXA 1U4OA 2J3HA 4QECA 3ZU5A 3DBLA 1ZJZA 5U9CA 1T4BA 1X7DA 3WGOA 1I30A 1R4NB 4UUPA 1NHWA 3GK3A 3NT4A 3I9JA 4EUHA 2C5EA 1CQIA 3DZKA 4P8RA 4U6SA 1QLHA 1T25A 1XA0A 1BTOA 4E13A 4DUPA 4ZQBA 3TL2A 4RLHA 2E4AA 4KTVE 5IDXA 3ZN2A 4IY1A 5I9MA 3W4KA 3RUHA 4FOSA 1E1NA 1K6JA 5L4SA 1PR3A 4TRMA 4DQXA 3OSUA 2JL1A 4XGKA 4JBHA 1HSZA 4CV0A 1WMAA 1LEHA 4GVXA 3PK0A 4L8VA 5IN5A 1B0AA 4R1NA 3Q1LA 2NWQA 3P7MA 2HK9A 4Q3AA 3PQEA 4W6ZA 2WD7B 2Y0DA 2EJWA 2WYUA 1LNQA 4J7XA 4HBGA 1C0KA 1DBVO 1F0YA 1P1KA 1PX0A 1TLTA 1Y8RA 2SCUA 4RL6A 3U62A 1R6DA 4XD2A 3ZI0A 2V6BA 4KTTE 3ZZNA 5ES3A 1EK5A 1N9GB 1Q7CA 1XSEA 2ZQYA 4S3MA 4D43A 5JDIA 3VVBA 4ALJA 3E5RA 4HY3A 1A9ZA 2CNBA 2DQ4A 4UEKA 5F5LA 4RVFA 3ZHXA 2C2YA 4YT8A 5C7OO 2Y1DA 1N7HA 1AGNA 1WWKA 2OFPA 2ZYGA 4IDCA 4LSMA 4DL9A 3SVTA 1XIVA 2NM0A 3NKLA 4UEJA 1VSUA 5KJ1A 4MVJG 3OETA 1R16A 4YJGB 2QYTA 2YUTA 3G17A 1ZK2A 4BO1A 1KERA 3VH3A 3H5RA 3RIHA 1PJSA 1JLLA 4DIBA 4JP2A 4N5MA 3U49A 5KJCA 3KOUA 3RU9A 4RGBA 3ENKA 1C1DB 4WEQA 4PG6A 2CMDA 3ZNPA 3WNQA 4AJ1A 1NR7A 1E3WB 2I99A 3QJ5A 3UKOA 1ZXLA 4UVGA 5T57A 3GQVA 4I5GA 3UVEA 1UP7A 5JS6A 2FOIA 4HUJA 4ALLA 5JBIA 4CM3A 1A4IA 3EUWA 4E2WA 3OJLA 4XRRA 4UULA 1YONA 3ZU2A 4OOEA 3LT2A 1ZEMA 5A9SA 4GLOA 2G0TA 4D44A 1UXKA 1I10A 3JD0A 3M6IA 5KNLA 3Q3CA 5TC4A 1CDOA 4RDIA 1F17A 2DFDA 4NHEA 2AQKA 1PQWA 3WSWA 1GQQA 3KEQA 4WCDA 3SC6A 5DNAA 1AHHA 1O5IA 5IDQA 4MVJP 3AI1A 3GEGA 1BVUA 1U8XX 2I3GA 5KJEA 1WDKA 4J4HA 4U0KA 4Z0TA 3CPSA 4OAQA 2UV8A 1ADCA 1FF9A 3CIFA 3CZRA 5COBA 4EUEA 1ZJYA 4XGIA 2Z1MA 3QW2A 3FCOA 3OQBA 4ZN6A 4S1VA 4J49A 4RPHA 4CM5A 3IJPA 1DIBA 3NTQA 1PWXA 1I3NA 1AUPA 1YBAA 2AMFA 4INAA 2AQIA 4A7PA 4DXHA 5I7FA 4NJOA 1U8FO 3QY9A 3PHLA 3GDGA 4DIFA 5DBIA 1JAYA 4XKJA 1U7HA 2ZQZA 1E7YA 1LUAA 1X13A 1UJMA 3RJ9A 3RWBA 4ESOA 3ICCA 3JQEA 4YT5A 3DBRA 3U4CA 3Q9NA 2FR0A 1X14A 1ZXBA 5IFLA 2BRUA 2OBNA 3AWDA 3GHHA 2EF1A 3ZNNA 1ZZEA 4BKUA 5AQ1A 2DBQA 5DDIP 1CJCA 2YW9A 4FBGA 4QFCA 1P45A 2D1YA 4L9RA 3Q11A 2VYND 1P31A 4L75A 5L7TA 5JY1A 4GLLA 4BNZA 2XOXA 3QVTA 4GX2A 3FN4A 4CM6A 5AVOA 3GDFA 3ITKA 4WLOA 3UCFA 4E5KA 2NADA 3WLEA 2ZB7A 1LQTA 1W0CA 3AJRA 3GPDG 3PJDA 1XQ1A 3U4HA 5T64A 3FD8A 5JMWA 3PI7A 4H15A 2HRBA 4CL3A 2V65A 3GGGA 3H3JA 3RUFA 1YB5A 4P4GA 2DM6A 4HP8A 3GH3A 1V3TA 5AXCA 3W4IA 1RM3A 2I9PA 2VYVA 1PIWA 3IUSA 2NU8A 4CM8B 3MTJA 1JTVA 5DOZA 2DTEA 2NVUB 5I9LA 2QIOA 1LC3A 3GVXA 4CPDA 4DC0A 3PIDA 3OJ0A 4MPDA 3WNVA 2GF2A 2I6TA 2BD0A 3A14A 3WFIA 2HU2A 4K6CA 3UHAA 3PPIA 4YJFB 1I3MA 3A1NA 1I2BA 1WPQA 4PGFA 5A03A 1R4MA 5HA5A 1B16A 4PN3A 3GN1A 4D0RA 3OH8A 4OMUA 4L0QA 5EN4A 3WYEA 3HFGA 2GN6A 1NQAO 3GMSA 3QWAA 4ZQEA 4BGVA 1E3LA 4J2HA 4ID9A 2YYYA 1K0UA 1U5AA 3I6IA 3TOXA 4BNWA 4CM4A 4DVJA 5I9NA 1QMGA 1Y6JA 4M55A 2EP5A 4TKMA 3DBHA 2FZWA 4CMHA 1Q1NA 4XWYA 2W2KB 5DULA 4CV3A 2DTXA 4WEOA 4Z0PA 4YRBA 5KIAA 1P9LA 2HDHA 3EVNA 3HN2A 4EI2A 3WGYA 3PYXA 5DF1A 4EYEA 1ADBA 1LJ8A 5CEFA 2GGSA 2O48X 4HFNA 5CEEA 1DFHA 1NNUA 3PQDA 4TRRA 5IZCA 2OMEA 1HE3A 5A4DA 1MUUA 4L4SA 1CF2O 5I7VA 1Z45A 1E5QA 4M8SA 3CH6A 5JW6A 1NVMB 1DAPA 4ND4A 2Y1FA 1BHSA 1G0OA 3RD5A 1KVTA 1GYRA 1UXGA 3OIDA 4JLWA 3DQPA 3R6DA 3CKYA 2GCGA 3JYQA 4HWKA 4J1SA 2X5KO 3LC2O 4NK5A 1B7GO 3GNSA 4IDDA 5HM8A 1K6XA 2W2LA 3B1KA 4YDRA 1P33A 2E49A 4RORA 2E37A 4EBFA 3E1KA 3MJ4A 4CR6A 4TMFA 5IJZA 3OFSA 4UAGA 3GDOA 2X86A 2HMWA 1HWYA 4BOYA 5I7EA 3A28A 2X4GA 3TZQA 4CUZA 2RHCA 1ZMTA 3TZKA 1ARZA 3ZNQA 2AEMA 2HMUA 1VL0A 3OIGA 4CLRA 1I2CA 4WLNA 1Y5RA 1ADFA 2ZCVA 2PD4A 4RCVA 2ZCUA 3HADA 3LF1A 1EE2A 3DAGA 4LSWA 1YVEI 4OGWA 3OQ1A 5JYDA 3E18A 3E9NA 3WGIA 3ADOA 2C54A 1LLUA 1MA0A 3GFBA 4O1MA 4BO8A 5L45A 4N5NA 4RPJA 3GEMA 4DBVO 1VJ0A 4J7CA 2FN7A 4A0SA 2AQ8A 1WP4A 4R5MA 7MDHA 1ADGA 4WK6A 5LC1A 4NBTA 1NPTO 3F4BA 4TRNA 1WZIA 3RUAA 4QO8A 2Q1WA 4FFRA 3WR5A 2P2SA 1XCBA 2O4CA 1OC2A 3ROPA 2Q45A 4BNKA 3ZW9A 5BSGA 2XPCA 3VPHA 1JWBB 1O94A 3VKVA 1A5ZA 1T26A 4AJNA 4CM9D 4Q3NA 4J7UA 3TL3A 5BSFA 2X0RA 1H6AA 1LSUA 1HDYA 1PZEA 4TZTA 1JKFA 2Y66A 4MP6A 2IXBA 4FS3A 2C29D 1IHYA 2VHWA 4PRLA 3JQCA 3BXXA 4G81A 5EINA 2VUUA 1DLJA 2X0JA 3K8ZA 4PCVA 3DBLB 2HO5A 5K0ZA 1UDAA 2POQX 3DOCA 4RVHA 1Q7BA 2I65A 2ZB4A 4LMPA 3ROKA 2B5WA 1VRWA 3DZJA 1XKQA 2VZ8A 4CR8A 3BHJA 4YT4A 3P2YA 5JCJD 2C59A 3MJCA 4UUMA 4UUNA 5G4LA 5A05A 1XG5A 3I4FA 2VTDA 1WMBA 2J3KA 4CQLA 1YL5A 4GX0A 2NTNA 4BKRA 5LDHA 2RAFA 1Y8QA 3E5MA 2JFFA 1D7OA 2NQTA 1E7WA 2VZ9A 4XYEA 1XR3A 4XB2A 4D0SA 3WGTA 5TNXA 1TEHA 4KUHA 4KQXA 1H9BA 3X2EA 5ICMA 1G6KA 3F3SA 3L9WA 3OHSX 9LDBA 3MJEA 4FFMA 5TF4A 2JAHA 5JDCA 4U7WA 4I9HA 4TROA 1Y1PA 5G0VA 4MKRA 4DC1A 3ITDA 3G79A 1M66A 1HZJA 3T7CA 1Y9AA 4HXYA 4RJTA 3JQ8B 5B4UA 3KBOA 4IDBA 1XU7A 2IZ0A 2C5AA 1NR1A 1W6UA 3HHPA 1IPEA 3ETDA 3WLFA 1HXHA 3DB2A 2HRZA 4B4OA 4NIMA 5JNLA 4BNGA 2UVDA 4JGBA 3S2GA 1NPDA 3KHUA 5TT1A 4BNLA 2OORA 5H83A 3RFVA 1FXSA 1XWFA 4B7UA 1EUCA 4RZIA 3PFWO 1KY5A 5H81A 5FYDA 2QRJA 4LN1A 3I9KA 4MKZA 4P38A 4AJ4A 4BL5A 3NJ4A 5JAQA 1ISHA 3VZPA 3ZU4A 3K73O 1JAXA 2BLLA 2YQ5A 2VNSA 1E3EA 1GZ3A 5AXBA 3CTMA 4IQGA 3OECA 4BNIA 2R6JA 3EZLA 3AFNA 3GOHA 3AY7A 3PLNA 1KC1A 3DWFA 4TVBA 1YGYA 1TI7A 3H2SA 4AJHA 4I9UA 1XLTA 2BGMA 2B35A 4IQ0A 3PHIA 3GUYA 3B6ZA 4E2YA 2BF7A 3ORFA 4MP3A 1ORRA 1K6IA 4R4JA 1RJWA 3OICA 4MOWA 5A9SB 3AK4A 5EPOA 2V6FA 4KDFA 1KETA 1YBVA 3CMMA 4A10A 1KIFA 4EEZA 2B5VA 5L4NA 3RUEA 1E1KA 3DZFA 5CDUA 1PGPA 3NTOA 4BS9A 4CODB 1DFIA 3AM4A 4FJ0A 4JBGA 5LDGA 3TFOA 3AM5A 1ZUD1 1B15A 3EW7A 1XEAA 4LRTB 1NAIA 3A9WA 3C7AA 4OJNA 5FEUA 3QVSA 2Y93A 1GPJA 2J8ZA 4ZU3A 3TQHA 3ZHBA 1T2DA 3C85A 2YFQA 3QIVA 2H63A 3JQBA 1KC3A 1KVUA 2PNFA 1ZK0A 1H2HA 2HK8A 1NAHA 2BMAA 3PHGA 4QFDA 5ADHA 3ZWXA 1GTMA 2PD3A 5KKAA 3PHJA 3I3OA 1TB4A 3I9OA 1ZW1A 4RF2A 4AJ2A 1P1IA 3RUIA 1CWUA 1GFSA 4Z9FA 5GZ3A 5G4KB 4HV4A 1GY8A 3H65A 4BB5A 5CDSA 5MGBA 1I2ZA 2OL4A 4F6LA 1X1EA 2X23A 2HJSA 4DYDA 1Z6ZA 1PZGA 1QSGA 7ADHA 5BR7A 3NGXA 1YOVA 2PKQO 4XR9A 1U28A 3OP4A 4XDYA 1WAMA 3QE3A 1SZJG 1YB4A 2ZATA 1ENYA 3V1UA 2D5AA 4RVDA 5EIOA 3UW3A 3IJRA 4UREA 2H9IA 4YPOA 2D4AA 3IMFA 1U5CA 3T4XA 1SEVA 2VN8A 4IBOA 3ZWCA 4ZA2A 3GN2A 2Q46A 1VL6A 3SXPA 3GRKA 1ULUA 4ZJUA 3FBGA 1PJBA 4IUYA 1LI4A 3ICPA 5BNTA 2C20A 3GGPA 2VYNA 4CLXA 1L7EA 2EKPA 2C82A 5CP8A 4LCEA 1PSDA 3DMTA 4GGOA 2O23A 5TJ9A 1K2WA 5F1OA 1VL8A 2EJVA 1Z7EA 3O38A 1X0XA 4YR9A 3RQSA 3O26A 1D1SA 3PQFA 4QXMA 3TPCA 3ZV5A 1E3SA 4CUKA 1P77A 1XELA 1FJHA 1I24A 1V35A 1DOHA 3BTOA 3IDSA 4NBWA 4M86A 3UXYA 1R0SA 4GWKA 3H2ZA 2AHRA 4FOOA 3TDKA 2WEKA 3BTSA 2VWPA 1KS9A 1VC2A 3KYDB 4A27A 4J1QA 2YDXA 3UCEA 4D79A 3JYLA 3IOYA 4DBZA 3JQ7A 3PZBA 4GWGA 4LW8A 5CDGA 4FJ1A 4DMLA 3N74A 4U0JA 3AUUA 4ZQGA 1GL3A 3AW9A 2FPPA 3WGZA 1LLDA 1QV7A 3ST7A 1SEPA 3CE6A 4GX1A 4E4YA 5HS4A 1B3BA 3KYCA 3OEYA 4KWIA 4R9RA 3PDUA 4AJJA 4UEOA 4WJZA 3ROQA 3VOSA 2D2IA 2GN9A 1EBFA 4CMIA 3ZCXA 3WYCA 1LQUA 1U2DA 2QYSA 3FF4A 1F06A 2O3UA 4Z6KA 1A7KA 3BMOA 5IZ4A 4KUGA 4PLHA 5ENDA 1ONPA 2Q1UA 1P1JA 1DRUA 1GYQA 3DHNA 4ZRNA 4JXKA 3WWZA 3ZWVA 3W4JA 2P4QA 4ZQFA 3ZWPA 3PYMA 4CQMB 5TRTA 2JHGA 1XDWA 1KVRA 4MIEA 1HETA 1HE4A 3P5SA 1UZLA 3PJGA 1D4FA 2LDBA 3EY4A 1Q2XA 3V8BA 4YT2A 3TWOA 3SLGA 1PEDA 4NFYA 2Q2VA 1MXFA 3JQDA 2YJZA 3DMYA 4DLLA 3GA0A 2R00C 4AICA 2GN8A 3QVWA 4E5NA 2NTVA 4ND5A 2GERA 1PL7A 2DPHA 3W8EA 3H3FA 2Y1EA 3HN7A 3B20A 4AJIA 1J49A 3GG2A 3ADPA 1I5RA 1MC5A 3QWIA 4R1UA 3EZYA 3DBVO 2P9CA 1GV0A 1ID1A 1IE3A 4GSKA 4XQ9A 2VUTA 1IZ0A 2EGGA 1H6BA 1KVSA 2Y1CA 3I52A 4MVJM 4CLRB 4IDFA 2HJRA 4XQCA 3KRTA 5A3VA 2Q3EA 1LA2A 3JQGA 3DC2A 3EC7A 3PLRA 1OAAA 5B12A 4D3SA 4D3FA 4PLFA 1DIGA 3DONA 4PG7A 5G2OA 1HRDA 3GVHA 2YHUA 3VPXA 3ZHYA 1C1XA 4XQEA 1PJLA 2OXIA 4LMRA 4BNTA 3PWZA 3TN7A 5IDYA 1N1EA 5T6BA 4MO2A 1N7GA 3S8MA 2Y0CA 1ZCJA 4HX5A 5L40A 5L95A 1ZVMA 2W98A 4FC7A
chains in the Genus database with same CATH superfamily
2PWAA 3DDZX 3GFQA 3HU3A 4JZKA 3ZD8A 1ISIA 5ADVA 1ONOA 1PNRA 4YAFA 4H4DA 4U2FA 1R50A 4BIMA 4W5TA 1UK8A 2FR8C 2BAGA 1K5PA 2QTWB 5HIJA 1WJGA 4B6RA 5G3ZA 1TD1A 2P6OA 3VYVA 1OHHD 4O6VA 3AB8A 2PGDA 2UVPB 1ZVKA 1D04A 3QK7A 1EJ2A 3QF4B 2JFGA 1WHSA 3G49A 2ZKLA 1XB2A 4JVOA 4MW0A 5EMMA 3L9XA 2C0PA 3RSOA 4YQEA 4CBVA 1RJDA 5AI8A 2HBYA 3AP2A 1DS6A 3VHXA 5I4KA 2E6UX 3I61A 3VPAA 5JBNA 2PFKA 1MIHA 4ZIRA 1W5BA 1MCZA 1S7CA 4CM9A 5COAA 1MXHA 3E9QA 3H0EA 5EZYF 2QSYA 2HSDA 1U7UA 5CX1A 1CQJA 2HSEA 1OA0A 4EHBA 1E20A 5BOSA 3AU9A 5KINB 721PA 1BW9A 1KBOA 2YH2A 3GBPA 1RS0A 4V0NA 4LYFA 2KS6A 3Q0EA 5F2KA 4Y7DA 5P21A 2QP9X 3NV7A 1VE7A 1GZ5A 4DUYB 1L1RA 1K7CA 2BGNA 3KT3A 4FDLA 3N0TA 1HNXB 4ZYVA 3I92A 2ZK7A 4MB6A 4EO9A 1EBUA 2XVZA 3D7RA 3ZDZB 5B6IA 3JR3A 5CBPA 4K0RA 1W9HA 1DNPA 1FYXA 1CULC 1A9QA 4GXNA 1L5LA 4EM6A 3BC1A 1CRWG 3H87A 2WAXA 3NMUF 1QVVA 4TT3D 4EA7A 3FMPB 5J4HA 2NZXA 4OXKA 1ECBA 4ZQIA 2K87A 3QPBA 4WNAB 2I4OA 3RO7A 3GIWA 1I7PA 1QK4A 3DYIA 3NYWA 3R5XA 4ZVPA 3T9BA 3DZHA 3Q3IA 3A58B 4UNSA 4Z99A 1G1MA 2I66A 3UQYS 2CEKA 5JCOC 2R7KA 2QBYB 2KQUA 1GQRA 5A4FS 2KM1A 1O9HA 1JDBC 3AKZA 3GAFA 2AHOA 4FKMA 1ZR2A 2FZCA 1ODFA 3U4DA 2BGGA 2ORYA 4GT1A 2F62A 5KVCA 4HDMB 3QX3A 4GQAA 3FOBA 2IS4A 2PKQP 2Q07A 4EVRA 3SSMA 1NSTA 2HCJB 1NSFA 4M7PA 3RTGA 2VAWA 2G83A 1NJFA 5JSZA 4BYMA 1HYQA 1UBMS 2O5CA 5EZYA 1T0IA 2HK7A 4JJ4A 2DHQA 3QU7A 4MQFA 1MFPA 2FLKA 3DPUA 4MZDA 2VXYA 1FA9A 2FZVA 4F3CA 4ITUA 1FDRA 3REOA 2LR0A 1N6HA 3ETHA 3HJGA 1LDGA 4N6NA 5DOVA 3TIFA 6REQA 4GM0A 3CW9A 1GRNA 1UT6A 4NG4A 4RWEA 5CRIA 1QR6A 3LT0A 3NB0A 3ZX4A 4B3RB 2AG0A 5ENVA 1GADO 1SCUA 4BV9A 4RF5A 1LSJA 4POAA 2B1IA 1G60A 1H94A 3SR4A 5CEJA 2DLCX 2WWGA 3GELA 3NHWA 5CT9A 4ALMA 2JD0A 2CK3D 1YWGO 3A6LA 3K0AA 3OPNA 2QD4A 3AHHA 3PGJA 2J08A 4MVWA 3K0CC 2EKBA 3M81A 3RTAA 1RRFA 1YZVA 3OZBA 5IARA 1XTRA 2VUSA 1E6UA 4O0MA 3PC4A 3VZSA 2DLDA 2PGXA 3R1IA 3CUYA 2V6IA 4KVFA 1RWNA 4D80A 1EDOA 3OX3A 4EWLA 3RAPR 1KY4A 1WB9A 3HNRA 4KLAA 3V7WA 3AJ9A 4ZYLA 3KXDA 4B6OA 3G3EA 3FLEA 4G65A 4WZ6A 3MTIA 4JD5A 3D6HA 3C5WP 1T2FA 3JQAA 1MAAA 3QG1A 4ZZ3A 1S7GA 2G5GX 5GPBA 1NT4A 2L0XA 1RC0A 3C6QA 1KH2A 1PLKA 1WDLA 4C06A 4UM7A 2NXJA 5D87A 3W8RA 4F2DA 1N1MA 1U0GA 4BY9E 1Z08A 2JD1A 2GN4A 3NC0C 2GHRA 4M1SA 4P7BA 1AU9A 5DM60 1E9AA 2GWRA 2ZGVA 3R6LA 2FPXA 3ZQJA 1FOEB 1YMUA 3DXYA 3KKQA 3PPYA 3RFTA 1SXQA 1BWQA 4B4DA 1LU9A 5A71A 1D6NA 4KLNA 2YHBA 4PE5B 4NICA 2OLKA 3VMFA 4E11A 1LNSA 2G09A 3BBLA 3WWEA 3ZDFA 521PA 3ZDEA 5E1DA 1PL6A 1VDMA 1YA4A 1BQEA 2R11A 3I2GA 4ND8B 3AUTA 4Q3EA 1XTTA 5ALJA 4DA4A 1C7IA 3KKPA 5E1OA 1U04A 3VH1A 2LRHA 4OFBA 5CFZA 1BMFD 1P74A 4B8WA 1SULA 2H52A 3O84A 4IZ6A 1NSYA 4HJRA 2V0NA 3S5UA 1TQ8A 5DCLA 5BSMA 3H5IA 1DEXA 2RONA 2OQ2A 1KI9A 2XTJA 3P2EA 3RVQA 2GF9A 3EODA 1OC4A 1RQXA 4AD8A 3VR4H 4IINA 1L5ZA 5F9MA 3HCFA 2IKSA 4URXR 1H2AS 4FEEA 2VA8A 3O7MA 3O31A 5CFLA 2DU8A 5DI3A 2CLFB 2EYQA 3DLCA 3IPRA 4FMCF 2JFQA 4BQRA 5A5VA 4MUYA 2K5UA 1QV9A 2XEXA 5F76A 3BL6A 3TB6A 4TPKA 1J1UA 1RAHA 1W85A 3GUUA 3G88A 2ZCJA 5BR8B 3ELDA 4Q7JB 1Y7IA 3IBFA 4A82A 2FUCA 3SMVA 3TINA 1K7YA 1X7YA 1X94A 5C4IA 4P7GA 3PQ8A 1UKBA 2GZDA 2X8LA 4AFNA 4LQCA 3THYB 4J0GA 2HREA 4BCBA 3V2UA 1MB4A 2R1UA 4AKEA 5CA0B 1II8B 2RH4A 1M67A 2L69A 2QLTA 3KB8A 3C6ZA 1ODKA 4DNXA 4PXSA 3WIEA 4W8GA 2IH5A 4MV7A 2AZXA 3QLTA 4RS4A 3MRVA 3IHWA 1LPNA 3IPLA 2Z98A 5MDHA 5AKKA 4X66B 4NJEA 3RG2A 4O33A 4EATA 3HKEB 4NY1A 5LWQA 1E9DA 1D5CA 2WJYA 1V9SA 3DZGA 5GJVC 4OFXA 3R0VA 3VTZA 1TRKA 3K9LA 4G01B 3AI2A 1SU6A 2QJRA 1TMKA 3O91A 4MB0A 5A06A 2NACA 1O5OA 2ZRCA 1JHZA 2AN9A 3IIKA 4V38A 4IGAA 4LOJA 3JZAA 5KO2A 3M4YA 1NUQA 4GRIA 1Q22A 5KWSA 4CMGA 4B35A 4JEMA 4MVJE 3CPJB 3ESRA 1DLIA 3ACDA 5DBHX 3X2SA 1JFLA 4YIHA 4BNFA 4DXAA 1ZWLA 1RLTA 4CGZA 3W2TA 4MMZB 1Z7WA 4N3CA 2BZSA 1PHRA 5K0GA 3C16C 3FYCA 2NVWA 3VFDA 1UKEA 2QT9A 4P54A 3QUBA 4M60A 1ULBA 3TSOA 3SZGA 3WRXC 2D1TA 5IH3A 1E2IA 4U7GA 3TBHA 1FFEA 1IN5A 1V4NA 3TL6A 3PKIA 3ZWWA 2BMEA 4CETA 1G9TA 3DDSA 4I9FA 5BYAA 3AF4A 4I9GA 5J58A 2BFOA 4M0FA 1EI9A 5J2TF 3KFLA 2CDAA 3M9LA 2J3DA 2OZLA 1Z68A 2ZIUB 3AEKB 4HMPA 5FUMA 2B1QA 2C4UA 2QPOA 4KYVA 2GO1A 5K0LA 1QP7A 5D5QA 1U0RA 1QGYA 4G89A 1B4DA 4AZ3A 3BFKA 3GT3A 1V95A 1E18A 3HO6A 3QKSA 4QKQA 3ASVA 3KELA 3LOPA 3U7GA 1YD7A 1P72A 3B1XA 4UTNA 4RK6A 3SP1A 3AVWA 1FU4A 2WKPA 4WE3A 4YJGA 5JHHB 4AU1A 3NVMB 1FSFA 2BBOA 5DBGA 4JJIA 1UDBA 1F8UA 3QYJA 1S9HA 4RKQA 5DIFA 4P3YA 5HFNA 2CV0A 3DWIA 4R1MA 3NNSA 3R3UA 1NP7A 3ET4A 3DO5A 3D8NA 2APJA 2UXBB 2FSGA 4HO1X 2R68A 3K92A 1C1DA 1YI8A 2Q2QA 1FBTA 3UOAB 5E9AA 3ISJA 3BTUA 3BMOB 3WLAA 4BDSA 3PJRA 4FS8A 2GCIA 3QU2A 2G1JA 1A7AA 3HNPA 4Z4IA 2AX3A 3PDHA 2YRWA 3PF8A 2PEYA 4IQFA 4ZHSA 4ZICA 4XX0A 1YQUA 5EJ7A 3IAM6 1G20B 2IZ5A 4PQYA 4K6GA 4HUQA 3DZIA 5B7NA 1D3AA 3IUQA 4YBZA 3LLVA 5LBUA 3MS2A 4HI0E 3SQWA 4JBNA 4KODA 2NU9A 1UMCB 2PBRA 2BRUC 2ZYVX 4H31A 4G0QA 3VV2A 3VSAA 2YFHA 1GAJA 3V2GA 4F3NA 1ESCA 2ODAA 2C4TA 1MO5A 1SKBA 4HPXB 4N0PA 1SVSA 4Z2YA 2JIBA 2JGAA 1V47A 1VIDA 1G21E 2I4TA 2XCQA 3SVLA 5J2TA 1VSVA 5CNIA 1KMIY 5BVGB 1ZC3A 1A9YA 1E2MA 1Z6YA 4BMNA 2H7VA 1FDIA 4X7RA 3OE7A 1WX1A 1QHHB 2ZUDA 2HJGA 3M6MD 2B36A 4JYMA 1E2NA 3P9ZA 1Y8RB 4W1QA 3E48A 4YIKA 4C03A 3OTGA 5JC8A 4PICA 4DLWA 1HYHA 1LF0A 2ORIA 3EIUA 1HLDA 3IBSA 5IJWA 3T1HB 4OHRA 3OCWA 5JWOA 2RJNA 1QPZA 4X1IB 1Z36A 3B36A 3CKKA 1QHSA 3NH6A 2X4LA 4RS3A 3ZOZA 1FBNA 5JUWA 4LTDA 1FS6A 2QRVB 5AWFC 4EFDA 4I1SA 5BR4A 2RHWA 4B0OA 2BGJA 4KLCA 1XZPA 4ACAA 3TTXA 2X9VA 2L42A 3MGAA 1JKMA 3QXGA 2QPLA 3VKWA 3U0VA 2ZLBA 3GXBA 5C8YF 2ODEA 1NYQA 1RWKA 1NBEA 3OESA 3OKFA 4FYPA 4OHPA 1MP0A 5LCXA 4OJQA 1NP3A 3X3HA 5K0CA 1JJBA 3IEMA 1Q1ZA 4X20A 4RZXA 3WQSB 4YFVA 3A8TA 1Z0KA 1GNPA 3BVPA 4G1VA 4UBNA 3TZCA 3WJ1A 3H9BA 5JFGA 4WLEA 5EP2A 4YQFA 2Y67A 1SHZA 2OZKA 1PR6A 4N7RA 1F1JA 1RKXA 2O2CA 3NVAA 2OXCA 3EJWA 4ZAVA 5JY6A 1EMDA 4PSUA 2HLDD 4XVHA 4D4GA 3WS7A 2ZJ6A 1HYGA 1EK0A 4JGGA 4EQZA 1O9GA 3OUTA 2BUAA 5AJXA 4DKJA 2PT5A 1JZSA 4PZZA 1MV8A 3RS9A 1KI6B 3FGZA 1UDWA 1UEIA 1DC6A 1OFVA 1BKDR 3A2NA 3F3YA 5EE3A 1G3QA 4MVCA 4F71A 1K1EA 3DEYX 3WKDA 3AERA 1EWYA 4B71A 5K6AC 1EX6A 2CVOA 1TZJA 2FGJA 2PSSA 2ZIGA 4AQDA 4HQ6A 4E5SA 3QFFA 3RVPA 3DPSA 2VHYA 2X4DA 3GPIA 5LIPA 1DL5A 2GS9A 3IIIA 3VR5H 2O7RA 3UBMA 1ISJA 1GGEA 2Q3CA 4DA9A 3T1NA 2I4RA 1HDCA 2I54A 3C24A 3NHLA 1KFEB 3GVCA 1P0IA 3JALA 3QMPA 4N9WA 4QPPA 1PRYA 4DEYA 1KDRA 2EG5A 4E5VA 3S8EA 4E31A 1XHFA 5CB8A 1OHHA 4O4LB 5BV1A 4CKZA 5ABPA 5HFJA 1ISPA 2JGDA 3HU5A 1DZ3A 1YMVA 4M8KA 4WY5A 4UZSA 4I08A 2PZBA 1LWNA 4B2YA 2OV2A 2HHCA 3PUWA 4HX9A 5EIAA 5C8YA 3DL4A 4INZA 3PFGA 4XUEA 5LB4A 2XMDA 3GC6A 3M4ZA 2ISCA 4LRXA 5BURA 2O4UX 2XJ4A 5COQA 4YMIA 1PUJA 4G1UC 2HLPA 4P3NA 5HHTA 4C29A 5D86A 2OCIA 4CI9A 2XGJA 1W52X 2JGRA 1HI9A 2C2BA 2VA9A 3AEUB 1Z28A 4G9BA 1OZFA 3OEWA 2BM1A 1WSDA 4V0LA 2PV0A 4ZODA 3WDKA 1YVUA 1L3CA 4Q9HA 1OKKD 1FU7A 2BV3A 5D3MA 3IP1A 4Y9RA 1QE5A 1JXAA 1VG0B 5DGHA 1KPGA 5T6MA 3FI9A 1KGDA 2DUWA 3A3KA 4G24A 4C4TA 3KQYA 1GPKA 2BHRA 2C9BA 5LKRA 1HL7A 1IULA 4HZUA 3TRDA 1FFCA 2PX5A 4M0MA 3KCQA 2XB8A 4YGYA 2PT6A 2V96A 1TFRA 2P6MA 4N8DA 5ALZA 2CL5A 3HFSA 1TKCA 5EHQA 1JFTA 4GOLD 1SUWA 5G1PA 3PJFA 2QA5A 3IT0A 5B7GA 5K99A 1BDBA 1NY6A 1OXUA 1UEJA 1Y0BA 3DUFB 5KNDD 4UDNA 2BFMA 3B5EA 3HCWA 2ZR0A 1BGVA 2WWIA 4QQKA 4YH1A 5L53A 1OYVA 2ZAGA 3TX2A 2Z2XA 4YK7A 4F2WA 3FR8A 2XKBA 1YQTA 1UMDA 4WJLA 4XWOA 4H60A 2L82A 1ISGA 3H3XA 4KQ1A 2OB1A 2LCIA 3SS7X 1JW9B 1GAWA 1U4NA 2DUNA 5F33A 1BH2A 2J46A 1GOTA 3IKMB 4QE3A 1U99A 2Y4NA 3FDZB 4MI6A 4AMZA 4RGVA 1AN0A 4ON9A 2M6RA 2E48A 1M2OA 5LQRA 2RGAA 4GWLA 4P83A 2BMDA 2CSXA 2VDKB 3Q3EA 3AKYA 3H7AA 4K9RA 2H07A 4Q00A 2YWXA 4LBWA 3VX4A 1EUDA 2O0LA 1L5VA 2D00A 3HNOA 1LKZA 3OFND 1NC1A 2BBSA 3L18A 5LXTF 5P8WA 3UMSA 2NNLD 1M8KA 4RSHA 4YPFA 2WQ6A 1XNRB 1XL0A 3B6KA 3PUVA 4D97A 3DZBA 2I3DA 1HO3A 4FM9A 2H0QA 2YRXA 2OXRA 2C3YA 1UBHS 4G5GA 2FPGB 4QYTA 4X8HA 2YIDA 1I5OA 1USKA 2CK3A 3SNKA 4EF5A 5B1YA 1UBEA 1MJGA 3JWGA 1GYPA 1GFWA 2HCFA 2I2WA 4L9AA 4L1KA 3LIIA 5E2AA 3RIGA 2FZEA 4QX6A 3RM3A 1ZDMA 1IBMB 2GZHA 5JVDF 3EZNA 5K7SA 4Z1OA 1YO6A 5ARDA 1YJAA 3ZQ6A 3B12A 3FB4A 3DDOA 1CZHA 2KSQA 4N3NA 4TYNA 1CUUA 1SNYA 3WSTA 3ZCPA 4BV8A 5CXSA 2F1KA 1ACJA 2GZRA 3O4VA 1Y5LA 2VJQA 3LUPA 3SMQA 2JLXA 2EW2A 3QJYA 4ZWNA 3L7JA 1U0NA 4KPUA 1YJ5A 3RQIA 5L3QB 1J00A 4PXYA 3I04A 2WHRA 4RDHA 1UJBA 1A8QA 1NF9A 1JNXX 1W49A 1Y89A 3K1YA 1NJ2A 2XUIA 5EJEA 4PYRA 4PGGA 1CNMA 3NOXA 3UFXB 2O2HA 4RJLA 4PWYA 2DCUA 3RSSA 3G9TA 5FOWA 1JR3E 3DBHB 2AR0A 1BOOA 4CIYA 4D9FA 2R65A 1CG6A 3OCUA 4E15A 4YXFA 2BGKA 3HSKA 4YN3A 1WOYA 2A5YB 5LXTA 4JYZA 1NNEA 2QSZA 1GZ4A 3F6YA 4KXNA 4IRMA 4JJKA 1XTVA 2PCLA 1GNLA 1K98A 3LP5A 4B34A 5B4TA 1NW6A 3H2GA 3QP9A 1XVVA 1H2EA 3FTPA 2H9YA 3EIXA 2N1MA 1JLSA 5KTOA 3H0CA 3QH4A 1JZTA 1BMFA 3NXKA 3O8NA 4L8LA 2RK6A 4BTLA 2IIVA 3I6QA 3OT1B 3ZVLA 5AVSA 4LWZA 1UIMA 4KMSA 3NUGA 1UMBB 3HYCA 4TKVB 3S1SA 2RHHA 3K2EA 4G0ZA 4PZLA 3RC2A 2BFCB 5B2EA 5I8WA 1OXTA 4DILA 3BFXA 1X1RA 4ZVRA 5JDCC 2W6JA 2W93A 2WJPA 4I0WB 3KJIA 4OHFA 1XU4A 2GAOA 4N1AA 4GBED 4WCVA 5DCUA 5JMOA 3THXB 1EK2A 2MSLA 2JI6A 4Y8VA 5TX7A 3CSSA 2F3PA 5A2GA 1ULSA 2PPLA 3KUXA 1ISFA 4UU0A 1JDVA 1YKGA 2H5EA 4TKZA 2WKRA 4C0LA 1LBTA 1V3VA 3SSNA 4ZCMA 4FDAA 1OT5A 3TMYA 3DHVA 3TSWA 3ZJVA 2GILA 3E6AA 1BS2A 2X5OA 4W1PA 4WD3A 3R0QA 3ICVA 4J43A 1IM8A 4Q05A 2IYPA 2IDZA 5AIAA 1XEWX 5DU2A 2FQWA 4NPCA 4B7AA 5IABA 1H8HA 1QWSA 1I8TA 1J09A 5DHTA 5E4TA 2J4FA 1ZD8A 3ZDQA 4EZIA 5B2FA 1XDBA 1F8XA 1NNLA 3ZH2A 3T4PA 3ROXA 2JFPA 2JH8A 5B37A 3X1KA 4EO4A 5JAZA 4YP9A 4RY8A 4JCOA 3ZG6A 3TF5A 4QICA 3OOJA 2A88A 4PZYA 4RTQA 5JOQA 1SHUX 2HEGA 5F1PA 1DO8A 3R20A 4JKYA 5U4QA 4G5FA 1CY1A 3PQ3A 2EKQA 4TLAA 3NOVA 5H70A 3JVIA 3HV2A 3RRMA 3WNCA 4BB9A 4DPKA 2WSBA 4M88A 1UPCA 1KOJA 5I7OA 4JT9A 5JIBA 3UT5B 4YRDA 4QO7A 5ES4B 3A6ZA 1L5YA 1M2WA 3G13A 2PX6A 5DHPA 4YRFA 5JC1A 1G8YA 5D3QA 1F12A 5DHAA 3LY8A 2HRCA 2P3QA 1VLQA 2Q5JA 1QU2A 3QIAA 2V03A 5TVKA 1Q0UA 3HA7A 1T5IA 2PZGA 3IA2A 1COZA 4GBMA 3VR0A 3KTFA 2QF7A 5JALA 3H2YA 1M8PA 1YJ8A 1XKTA 2JNWA 5FXMA 5D7NA 4ZVLA 4I6JA 4UVHA 3V1YA 3F6CA 4J0JA 5HQJA 2O2SA 3P96A 1FSPA 2WLTA 3I2KA 3QVUA 3D3WB 4Q16A 4YRMA 3HLTA 1KA9H 4EB0A 3HXOA 4CIBA 2BEWB 3JQFA 4IP0A 3UJ9A 2PPVA 2X6RA 1NTOA 5A3SA 2OPHA 3I1JA 3ME5A 1SD5A 4KOEC 1YV9A 4OHCA 3G8CA 5HS6A 1MD9A 1G4AE 1WSAA 3HCDA 4PG8A 2H1SA 4E5PA 3EWAA 4J16A 3TLCA 1YBFA 1X15A 3MA0A 3OZ7A 5G0UA 3VC1A 4KO8A 1P7CA 4RHYA 1C3LA 4DLXA 1BE8A 1M34E 2R1ZA 5EWMB 2WWRA 3WX0A 2P8SA 1GUZA 2V6GA 3C8UA 5ECYA 3ZKAA 3K6SB 2YVQA 5F3DA 2ASVA 3IP7A 4ZGGA 4KXXA 1IXRC 1GTL1 2VF2A 2EGUA 3GLKA 4Q5IA 5CCXA 1G18A 3FPAA 4BQSA 4KGDA 3LJKA 4Q39A 3S44A 3TMKA 1PUIA 4QL3A 2Q8QA 5HKKD 5DT2A 1TEXA 3CF4G 4HYTA 4QLAA 1ZOOA 3NOOA 4XTCS 3BDAA 1EZZA 1KJZA 3LU1A 1VMKA 1YHZA 2CKDA 5ALUA 1FPQA 1XAHA 2WHPB 3A36A 4U8GA 5KPJA 3B3AA 5HK9A 1HE5A 3OZIA 1IFXA 1M7HA 1B93A 1QORA 2FSVA 2KW5A 1PG2A 2P9ZA 3DVLA 1T29A 1X8KA 4LAFA 4EHJA 4HUTA 2WT8A 5M7EA 2XYPA 3GIDA 4C3VA 4PN7A 3FOZA 4NV3A 2D59A 5AW2A 1RWVA 4IGEA 1UBTS 1IQUA 2H2AA 1CBUA 4HH3C 2IHVA 2P0AA 4C0WA 4UXJA 5AUOB 3RJ5A 4JOSA 1RIFA 4WCFC 2D1FA 4MVJD 2O06A 2GLXA 2QG4A 3AVPA 3VDXA 1HFEL 3DXFA 4PLCA 1AK9A 4LZAA 3PQCA 4XXHA 4DCGA 3IYLW 4NATA 3RG8A 1L5GB 4I50B 3RRYA 3TLJA 3TAXA 2GHQA 5HJ5A 4M1WA 3V2HA 2IZZA 2B3TA 1EQUA 2XCRB 4GO1A 5IF9A 4JC4A 3EW9A 2D4HA 1A72A 3W5IA 1OUMA 3QITA 4NZYA 4UAUA 5AP9A 1E8DA 2WJVA 3GP3A 4C7VA 4LF5B 1EYZA 2BIFA 1MFZA 1DT5A 2AEEA 3VO1A 1E5DA 1XTSA 4GLBA 2B4RO 1P9WA 4J90A 5E6SB 1FMCA 1OXBB 1XN4A 3JQ9A 2FG7C 4GRDA 1ZD4A 2OAQ1 4UVIA 1UODA 2LCFA 3FJYA 4DAEA 2VXBA 4G0UA 5CG2A 1IPFA 5BXQC 4OD0A 5K3BA 1LI5A 3SPXA 1TDJA 3TGWA 5EHNA 1ISMA 3I6BA 5JYEA 4ZARA 4HSEA 3TSCA 4BQQA 3L0PA 3ETJA 3UK1A 3JATB 1F14A 4R7TA 5DTIA 3RK4A 1GRCA 1BD3A 2IXDA 2DMRA 1X1TA 4LNUB 4RTNA 2XGGA 1UFOA 1R5OA 3LDHA 4R9VA 2YZNA 3TB4A 2JASA 4DLRA 4BBJA 1GT6A 1HTWA 2R6GA 4BFZA 2E2WA 3CJQA 3HSYA 5IEBA 1TZ2A 3IQDB 4AP6A 4G5SA 5ECWA 3TKYA 3OJXA 2PWZA 3KPJA 3A3OA 3NT2A 3OX4A 4FQ7A 4GBJA 1TECE 2H11A 1L4GA 1FLNA 1J97A 1YR3A 2CLEB 2BKLA 1DPFA 2RFLA 2F43A 2HLDA 4Y1RA 4QSHA 2OE2A 4BFXA 5REQA 2WZDA 5KC9A 3EEBA 4POOA 4E7OA 1SKQA 3DSRA 2FETA 4N8SA 3QXSA 5IVIA 1SPBS 4YMWA 4ZTZB 4C7BA 4MCIA 2ZPAA 3GYBA 3A06A 4AG6A 4B48A 2EL7A 1U2TA 1WMSA 4KAFA 2PX8A 5HE8A 3BQ9A 3UATA 3AB3A 4EMSA 1JEYB 1DAEA 3FOAA 1DRWA 1ZH4A 1EGHA 4LYHA 3QLUA 2H1VA 3D3JA 3EF0A 3DNMA 3S6JA 1PJTA 5FWXB 2DLNA 5BORA 4RK0A 1HKUA 1Q16A 3NHZA 3SYTA 1W96A 1B00A 1PFGA 1K63A 4S0ZA 2J7PD 2WFAA 1JDTA 4X9XA 4ZHQB 1NKSA 2L18A 2GZSA 1NL3A 3JCZA 1VG8A 5NULA 4IUDS 4IO0A 1D9XA 2XIQA 4BFVA 1E69A 3BJIC 4OATA 4DIDA 3WA7A 4DVGA 4RBNA 3HPQA 3PZRA 4IS3A 4JJFA 4MUIA 5G3YA 3LL7A 5KNCH 4QUGA 4GVLA 2VPYA 3W5JA 1HRKA 3CZCA 1GDHA 2ZJFA 4UVDA 2ODNA 4HFJA 4NONA 2QGNA 4UNIA 4I36A 3T9CA 1TEZA 3W2HA 3F67A 2JRCA 3QU5A 2WZBA 1MG5A 3RC7A 4IXTA 4PSDA 4F3TA 3C43A 1PZFA 4FYVA 4F7DA 3C3AA 1TT5B 4WSOA 3QLJA 5A4AA 2CY0A 3I72A 5E1MA 1E89A 1NX6A 3K0FA 1U5BB 4BFYA 1BWSA 2HT6A 1OKKA 4MWBA 2YR0A 3RWOA 3OIFA 3TX6A 3X1DA 4KVAA 2P4EA 1YFZA 3C3JA 1TO2E 3IJ5A 4LRSB 4CL2A 1JT2A 3BK1A 1T4DA 1IY2A 3HB0A 2P9FA 3WHKA 1B8UA 4C2AA 1DU4A 1MO2A 4PYQA 1U2PA 2MINB 3LK6A 4BMCA 4FT2A 2G72A 1SBYA 4EY6A 4XARA 3GEPA 3FRJA 4DNOA 2BOVA 1QNLA 1EDDA 1RAAA 4HNUA 4R6XA 3DLIA 5FOUA 5KQPA 2PYIA 4DNPA 4LHEA 3ZQUA 4BQNA 1UXJA 1X8LA 1ZSNA 2YQ4A 3UJ7A 4A8PA 5C1IA 1UQTA 5F1KA 2R7AA 1PK7A 3AOEA 4BUCA 1PL8A 3H9JA 3PC8C 2WG1A 3DVAA 2WHEA 1MC4A 1KSJA 1C9KA 4QBIA 3W2FA 5DNUA 1ANKA 4LWPA 1G98A 2I6UA 4IM7A 4LWQA 2Q4RA 4ERXA 5AVZA 1YQDA 2VSQA 3COYA 2QZPA 2X9GA 5ECDA 5CUQA 2BHSA 2IYUA 2LV8A 4CT4B 2HRRA 5FA6A 5CAEA 4WZZA 3DE1X 1KDYA 1N3YA 3CGGA 3JD4A 4P86A 5ALYA 3MIIA 4M99A 1DXYA 1PTJA 1WKCA 2H0AA 2IA5A 1H05A 1Z3IX 2C5HA 2O57A 2WJJA 2YYAA 3QUCA 4JIGA 3UFBA 4U63A 1EQ2A 3EGXB 4QBGB 1DWUA 3COSA 3OFNA 4ND3A 1ZM4A 2PUVA 4GPD1 4MINA 5C8ZA 1FDVA 1GPMA 2IPAB 1A96A 3EC1A 1Y6ZA 1TTTA 1JPUA 3KQTA 1YDEA 2QV0A 5AJWA 1MOZA 1PZHA 1QAOA 4QAJA 3LPCA 2QX6A 3M2PA 5THXA 4FGLA 5B4VA 1TAUA 2HBQA 3HG7A 3H0KA 2P41A 4BLUA 3IP6A 3ELYA 3V55A 3EAGA 4JFAA 2QL7A 1NI4A 4O4JF 3IMGA 4DLAA 3A1WA 3SKVA 4Z9YA 3A4YA 2W4QA 4BO9A 1G17A 4LRYA 4CMCA 1RI3A 1SQ6A 1T36B 3PGXA 2BELA 4QDZA 3FPCA 3W2EA 3NFRA 2CFRA 3PTZA 1WP9A 2QTZA 3C1AA 2C57A 3KYIB 4B4KA 4X92A 2J3LA 2B0CA 1NMSA 4OREX 1H8ED 3U4MA 1YUBA 2D5CA 1JHOA 1KI1A 3PP8A 3UW1A 1IJEA 4QBTA 3SBOA 4PZ0A 2E0IA 3LFTA 1O5TA 3S5JA 3KYCB 3TRFA 2FG5A 4YCCA 3A27A 2IDJA 3WL5A 1AMUA 3RBVA 5K3CA 2F17A 4CHTA 1RD4A 3KAQA 3Q8KA 2FFBA 4JA0A 1SXHA 4DDKA 2XE8A 5DNEA 2VT2A 2PRJA 4B75A 4BNVA 1Z15A 5IWAB 5DH9A 3EBLA 2WWYA 4XD7D 3CKLA 1G6HA 4L57A 4M89A 1KOGA 2Q41A 3IEXA 1XTZA 4NDZA 4YJ2B 4HXEB 4DSUA 2P68A 4BNXA 2QUJA 4Z3KA 3NVKI 4QM6A 4K6MA 1J4AA 2WJAA 4LYAA 5F7XA 1E3WA 3DVSX 4HN2A 5JNUA 2P67A 3NUQA 3OBBA 1HX7A 1TCBA 1Z9BA 2QRHA 3L93A 2OECA 3KFXA 2QQ0A 3KJFA 4RCZA 1NVVQ 3M82A 4RPGA 4TVOA 4C4OA 5KYWA 4XQGA 3IB3A 4FWBA 1L9KA 2XXAA 1KJJA 4W1SA 1HEUA 5CYPA 2FRDA 2JK0A 1MTOA 3JD2A 1QHNA 1VJDA 1TYBE 1X2EA 2H1IA 3BGIA 3E22A 5FI0B 4DPLA 2QD3A 1NBOA 3FUXA 2ZIEA 2Z0MA 2D5LA 2VH5R 3DDUA 3JQ6A 4UDYX 3VC3A 4BP1A 3FNHA 4MUAA 1QPBA 1TM7E 4Q6WA 5FL7A 3QWFA 1RI4A 1T91A 3G1TA 1FB5A 2OMKA 1U81A 1C4XA 1Z5NA 2CVZA 3NLLA 4L4ZA 2BCEA 2R5WA 3F90A 3SEFA 3T9AA 1HDZA 1EPUA 4JY7A 2Z9CA 1MB2A 1OLSB 3H1BA 2H17A 1C4OA 1AGPA 5DNYB 3CQ9A 1ODIA 3VVMA 2WM8A 1DRVA 4DR1B 3KTAA 5IT0A 3HKBB 5D1HA 4U6QA 2D3TA 2DUJA 5JNSA 2O8DB 2GA8A 4IMJB 2O7NA 5KVSA 3KZNA 2ZJ7A 3BD7A 3D8BA 3RSLA 7GPBA 1IHOA 3L8YA 3GLHE 4V24A 2POCA 1SOWA 2I0FA 2ZTMA 2P9BA 1OH6A 2AZDA 2XMBA 3A1EA 2FZ5A 2IEDA 5L3ZA 3E7PA 5KOHA 3IPXA 4IZIA 5CXXA 1VPLA 3VR2A 5I4BA 5ICSA 2RGNA 1RVV1 3QSGA 3EPLA 1QQ5A 4JT4A 2PKWA 4EW2A 3ZHTA 1DIOB 1IEQA 5AESA 4KI0A 1N8KA 4CV1A 2GETA 2GCNA 5JECA 4M36A 5F7JA 1JMYA 3WGMA 1K7XB 3ZDDA 2Q6LA 1RLUA 1H2YA 4F38A 1U1EA 2QQ5A 1G7TA 5A4KA 4ZVVA 1THMA 2P1ZA 1J8MF 1LSOA 3GFGA 3MWGA 8LDHA 1H23A 4BLSA 4LPKA 4C0JA 1T0UA 1JR3D 1GVNB 2FSFA 5FBLB 4B4VA 3LLCA 4RQAA 1I3LA 3USES 1T2NA 1M6WA 5TXGA 1JEAA 1VECA 1JDZA 3LGXA 5EOVA 5F23A 4MNTA 1YI0A 1O0CA 1UC5B 3WWYA 2M98A 1G8KA 1D09A 4JOBA 4AVYA 2CB9A 4W5HA 4NCJA 2QK4A 4N41A 2JF0A 3RS2A 5CLFA 4B7XA 1NM5A 3HXLA 4DLTA 3Q6MA 1HGXA 3O0DA 1NLYA 2CYCA 5C53B 1X7WA 2Q4EA 3KWJA 1U0BB 4M9UA 1K92A 2Z08A 1ESMA 1H3NA 3TBKA 5FTWA 3SIXA 4CKWA 3NV9A 3WLTA 3L07A 1JIKA 5E0KB 3OG9A 4LS3A 5JD4A 3VHXB 1YS6A 4J1TA 4K1XA 2O8BB 5AQEA 1OFHA 4HATA 5IKXA 1V43A 3OJFA 3WB9A 2A1UA 2AXQA 3O6VA 2NPFA 1HLFA 4UZEA 3GP8A 2ONKA 4CTJA 2VTEA 3RS4A 5K03A 3T5MA 4PPGA 4IV0A 1PG0A 4P36A 1C8BA 1XOIA 1XZCA 3IRUA 4AIRA 1TNDA 2OKCA 2VWGA 3CC8A 1K5GA 2MSDB 4RY9A 3AXTA 1EFAA 2F1HA 1PU2A 3NX4A 4ZAYA 1TCAA 1DTWA 4QIHA 4AULA 5FI5A 4BQFA 4OKIA 4QQFA 2IHTA 1BU5A 2Z3VA 4OSEA 4E12A 3NEYA 2EERA 2GD1O 2EFGA 3L3BA 3CMCO 3INTA 4WN9A 3MELA 1NULA 3DNFA 3R3JA 1GL9B 1Y3BE 4F92B 2WIJA 3MWYW 4IJVA 2A5GA 3B1JA 4EA8A 3ZK8A 3UMJA 1K75A 5HKKA 3J7TA 3BX1A 3MB5A 1VL5A 3I01M 5FWYA 3N05A 3H11B 4P98A 5IX8A 3EA0A 2QX7A 1VXRA 2CD7A 4X90A 4YJFA 5TDHA 3K2QA 3PFIA 3NU1A 3SBXA 2FX5A 2J5KA 3N0XA 3DOFA 4RF3A 1QIHA 4M0UA 1DBRA 1YRQA 3O75A 4OB8A 5AKYA 4Z3OA 2X2FA 3EDMA 2J5BA 4CFYA 3AIIA 4WK4B 4Q4DA 1T1SA 3GNTA 3PCXA 4YEDA 4XJXA 3TZHA 5JAUA 2J9XB 4UKDA 1UIRA 3R8CA 1G8HA 3PNVA 2BYTA 1MEJA 1IOVA 1H22A 1QK5A 2BCGY 3ZY2A 2AH5A 3TQIA 4YI5A 1I0ZA 2WYIA 4J0EA 4GM1A 1AT1A 1PJQA 1TADA 1VMIA 2B9EA 3MIZA 4C0HA 3KLPX 3RF7A 4RHTA 1GAEO 1ZSVA 2XXJA 3FWHA 1RLJA 3K6RA 3VPSA 1QVRA 2QAJA 3BL5A 4R84A 4JI4B 2W6NA 2HDOA 1HT3A 4PSCA 2OQIA 5ITSA 3UC9A 5AVYA 5DRYA 3S7TA 1HTTA 2IPNA 4YQYA 4CQMD 1SCQA 2P5YA 3AH8A 4KDCA 4BZXA 1S5PA 3SICE 3CPEA 3LC7O 1MBZA 1WCXA 1YZKA 4YRAA 1GGJA 3CRZA 2COEA 2FFHA 4K28A 3K0AB 4TMYA 2UZ0A 4FX2A 4OHYA 3OOHA 3D8TA 3WICA 2I2DA 1E79D 3WV4A 2LNDA 1JSZA 1LBQA 2WMOB 4KAAA 2P6RA 4D8YA 1L4HA 1RLIA 1VPDA 4XFJA 3SX4A 1Z5OA 2QD1A 4LF4B 4HAVA 2XUDA 3NAMA 5FJIA 4RZ3A 4XTRA 4DQ0A 5JRDS 3EOBI 3A0UA 4N5LA 2XUAA 1M0EA 5C3MA 2Q5EA 1VRCA 4YI3A 1XRQA 1WY7A 3FWKA 4KVZA 1NE2A 1L5QA 3VZBA 3A1FA 4Q93A 1QDEA 5DGDA 4JASB 2B4YA 3JQAB 2PM8A 3PA8A 4TXMA 5A6VA 2XGSA 3JASB 4F4CA 4XCXA 1NASA 1QG4A 3EA4A 4BO5A 3WHIA 4DTCA 3DTYA 2QMEA 4ZOQI 4M54A 5DSZA 1CC1S 1JPJA 5AUNB 1QM5A 4GL2A 3OJEA 3L7MA 1UXIA 2BFFA 2IY7A 3EQ9A 4R69A 2MU1A 4F2PA 2NP6A 2KYRA 5J4VA 1F2TB 5IPFA 2I71A 3S2YA 1R5BA 3LVRE 2RC6A 4B6EA 1NXQA 2ZM6B 2R3SA 4GOKA 3COWA 3DUWA 3P0EA 4OMDA 5I7AA 3ZGZA 3VUEA 1G4UR 2HF7A 2NSHA 3F5MA 1G38A 1R0CA 2FEAA 1E9RA 3L82B 3JTMA 1J0CA 4LJ5A 1G1AA 1TL7C 2AD5A 3GZ4A 1B8PA 1UC9A 1H0SA 1G21A 2CLLB 4CDMA 3PRHA 2E18A 1TVKB 2BHNA 2IS2A 2W2PA 2JD2A 3PRKE 2OD2A 1R5NA 5KCZA 4MUBA 4OKNA 3CVVA 2WQZA 3OZEA 2YUIA 2VHVA 4N18A 4NARA 5KYWB 2ODBA 4JI0B 2D2VA 1CCWA 2PR2A 1UJCA 3TCXB 1US8A 3W04A 4A36A 3NGMA 4MW4A 4W82A 4AN4A 1QGDA 4PR3A 1J23A 4V0RA 2Z43A 4IVRA 2VP4A 5CFMA 3PWSA 1A1VA 2IPOA 3GFSA 1ZI6A 4RJIA 2DSNA 1LW6E 1PR9A 1JXQA 2NVBA 1PVDA 2Q4TA 3TRIA 3I0MA 4HQFA 1KJQA 4J4BA 4KFUA 1CUDA 5DI3B 3QXHA 4JWTA 4B3XA 5CBPB 1WKBA 1OY1A 1Q15A 1QZUA 4KQ9A 2ZXUA 2GXAA 4G85A 5EXSA 1JJFA 3R2JA 3EJ6A 5IBRA 4GI1A 4LVCA 1CIVA 4YUWA 3QMVA 1FVFA 1XMSA 1UCFA 4R98A 5TS3A 1X7YB 2YV2A 2NV6A 1P81A 1ADJA 3MYRA 1XZJA 3NRJA 3NAQA 4IQ4A 4BFSA 2EWVA 1AZTA 4KV9A 1T2AA 3GHYA 2O2ZA 4FGUA 4D9IA 4GMXA 1IOLA 2ZTHA 1HDXA 1U4OA 3P32A 4PINA 4YPVA 1JKXA 3U5ZB 4F85A 5I6DA 3EIHA 1CLUA 3R5JA 3WGOA 1T8WA 2GFQA 3LHFA 1I30A 3WLHA 4UUPA 4PONA 4RZUA 1A5AB 3WKBA 2ZPUA 3IQFA 4AMBA 2QVYX 3DZKA 4LV8B