4CMBA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 94
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmbA00
3QJ5A 5JCXA 5FF9A 2C54A 4KUHA 1F0YA 5KOIA 1VC2A 3IS3A 1P77A 3GR6A 3GUYA 3ST7A 1N1GA 5TSDA 3P5SA 5T57A 4RJTA 4F46A 3PYLA 5CPFA 3BXXA 3UOGA 2C5AA 3EHEA 3KYBA 1MP0A 3U62A 3ZHZA 2HMUA 3PJDA 1HF3A 1T2DA 3P7MA 3PWKA 5JY1A 3JQ7B 3ONFA 5BNFA 2AG5A 5B12A 1EMDA 2GLXA 2NU9A 4RL6A 4XR4A 4CLRA 2Q2WA 1I24A 1E1KA 5AXCA 3C1OA 2B69A 1TLTA 1WAMA 4HV4A 3ONEA 3ZWVA 1PJ3A 1LSUA 3QWBA 5I9LA 1YQXA 2POQX 1VL6A 2HCTA 2D3TA 3VZSA 2V6MA 2B5WA 1ZSVA 5ADHA 2EKQA 4A2CA 1VLLA 2ZYDA 4E31A 5L7WA 3GAZA 2QHXA 1PGNA 2FR0A 1DO8A 2PWZA 1KC3A 4LRTB 4RPKA 4AVYA 3D1LA 3UHAA 2WSBA 3KUXA 2EHDA 1O8CA 5BSFA 1WDLA 1K6XA 2X0RA 5KJEA 1YBAA 1N5DA 1GD1O 3VDRA 3DBHA 2NTJA 1F12A 5JS6A 4XYMA 1GQ2A 1U8XX 4BNYA 1R4NB 2DBZA 3WTCA 3QVOA 5TNXA 1LLUA 1K2WA 1N9GB 2YW9A 4RORA 4YA6A 3WS7A 2W2LA 3JQAD 1E6EA 3WIEA 4L4RA 4FFRA 3B1FA 1P31A 3KM0A 4WK6A 5AXDA 3PGJA 4QQRA 5CPBA 3A06A 1W0CA 1JKIA 3IMFA 5I9MA 1OMOA 3VH2A 1FJHA 3HN2A 3EC7A 6ADHA 1E6WA 4QO7A 3ENKA 4PN3A 1QV6A 3WMXA 1R4MA 3JQ9A 4J9UE 4P4NA 2CDBA 3PGXA 5JXWA 1OZAA 2HMTA 2LDBA 2I65A 4RGBA 3NDRA 4NBRA 4XDYA 4IM7A 5I7SA 3RBXA 5F21A 4BQPA 4YACA 3AY3A 1Y81A 4XYEA 1GU7A 1ZNQO 3RC2A 1GUYA 2BFMA 2CF6A 4CMKA 4XQ9A 3AW9A 5LDGA 1GYRA 1NPDA 2G1UA 4NR0A 3UICA 3VH4A 4CQLA 2EGHA 3DBLB 5TQVA 3ZWMA 3L4SO 2EXXA 4EGFA 4XQCA 2G0TA 4W9NC 1T1RA 2O3TA 4R9RA 3ZWWA 5HS6A 4NJMB 4DL9A 4RVGA 2QRJA 3ZNOA 5AYVA 5KJ6A 3VC7A 2X1HA 4DYDA 5C7OO 2VT3A 3DZHA 3LLVA 3ZH2A 2CZCA 2WM3A 1E7MA 1GZ3A 1U2GA 3GPDG 1SEVA 4JJIA 1QXSA 2X4GA 3G49A 3C3XA 1WWKA 4GMGA 3IQDB 4WNCA 3HWRA 3HNPA 2HK9A 1AHIA 4GLOA 3I83A 2AHRA 3LC7O 1ZCJA 1ZXLA 3LT4A 5DOZA 3WICA 5EN4A 5J23A 3VDQA 1QMGA 3VZPA 4U0JA 2QW8A 3OSUA 5IFLA 2AMFA 4OO3A 2QRLA 4RVFA 5JSFA 4PLHA 2VHZA 4R1SA 4WCFB 2QG4A 1O0SA 2GPTA 5LC1A 4PLZA 1SB9A 3TN7A 3ENNA 5AQ1A 1HWYA 1PS0A 1NXQA 1MGOA 1TT5A 2DPHA 3WFJA 2O48X 4Y6PA 2WE8A 5JDCC 1HYHA 1LDBA 2BFAA 2OFPA 5A5EA 3U4HA 4UVGA 3AU9A 4B3JA 4KWHA 1GPDG 4NNJA 1ZO8A 2FP4A 1M6HA 2HLPA 2J5QA 2CY0A 2WE7A 4Q3BA 3WJAA 3RU7A 1I10A 3ZU4A 4D3SA 4EJ0A 4EBFA 2A94A 1GEEA 1MA0A 1XEAA 2PV7A 5A3JA 4DA9A 1E1MA 1KBZA 1S6YA 5JNLA 2V65A 3F4BA 3W8DA 1ADFA 2PK3A 3CZMA 1BW9A 3KSDO 1EEHA 4I5DA 2GZ2A 5FI3A 2IXBA 3EW7A 1JVBA 4KDEA 3P2YA 4IINA 4J6FA 3STHA 5L7TA 1Z6ZA 4J7UA 1V35A 4ZD6A 1X7GA 4AL4A 2OP0A 2YDXA 3MZ0A 2YUTA 3ZWBA 3TL3A 4RDIA 4CMBA 4ALIA 4EW6A 4QFDA 4JJGA 2PZKA 3PPIA 1E6UA 2VUUA 3K30A 1D1TA 3F1LA 1ZKMA 2VHVA 2JCVA 3KYCB 4OXKA 4TVOA 3X2FA 4OSPA 4BKPA 1P45A 1H6BA 3HUDA 3WQQA 3NGLA 4MOWA 4D42A 1PQUA 3OFSA 1TEHA 1LDYA 4BMSA 2P4QA 5KNLA 1RYEA 3S55A 1EFKA 4XDZA 4OOEA 1P3DA 1YRLA 3GGPA 3DZGA 4UVHA 3L4BA 3MTGA 1A27A 3AOEC 1UH5A 1XELA 2VTDA 4AJ1A 3GUCA 1Q0QA 2DUWA 3JQDA 1YOVB 2PZLA 3HDQA 1FDUA 1GQYA 4G81A 4FJ0A 2ZKLA 4UUNA 1M75A 3FD8A 3WXBA 4MVJH 2FR8A 4YXFA 1Q7GA 3DQPA 1LC3A 1J49A 3DXFA 3TOXA 4KUGA 2D5AA 1XYGA 4IY1A 3OEYA 4WJZA 2CNBA 5CG2A 2VZ0A 1H9BA 5EERA 2C29D 3NGXA 4FW8A 1E7RA 3BMNA 1PS9A 4CLRB 3HZZA 1WPQA 3GN2A 4J7XA 1T24A 2ZATA 2R00C 4LSWA 4PRKA 5K6AA 3ICCA 3PEFA 1JVSA 4AICA 4PLGA 5JE8A 4GWGA 3IIEA 3CE6A 4DPLA 3RKUA 2PKQO 1RPNA 4IMRA 4D79A 1R0KA 3BZUA 4R41A 4MIOA 3WNVA 4AJ2A 3AFMA 4BKOA 2ZQZA 2SCUA 2X6TA 4O6VA 3MJVA 1PZEA 1G0OA 2YHIA 4BL5A 5K0ZA 4AJHA 5IN5A 3D4OA 7MDHA 1XQ1A 1UZNA 1ZVMA 2UYYA 4RF2A 5THKA 4FOSA 4XX0A 4XEHA 4BNKA 1KETA 2EEZA 2ZB3A 4FS3A 1RM3A 1MFZA 3DBHB 4NQZA 2DTEA 4D3DA 4CLHA 1YJQA 1LQTA 2ZYGA 4CMAA 3IJRA 1C1XA 1G6KA 4YRDA 1K5HA 2Y68A 4I08A 4GVLA 1UDAA 1PIWA 1EQUA 5I7FA 4BO1A 2P68A 2Y1FA 3H8VA 4AJIA 3QWHA 4W82A 2DTDA 4GH5A 1F06A 1KC1A 4CMEA 1X13A 1XA0A 3F9IA 3OEWA 4Y9DA 2VN8A 4WNIA 3OIDA 3FCOA 5TF4A 5HA5A 1M67A 4BNLA 2PR2A 1UP7A 2AW5A 4YPOA 4YB8A 1R4MB 2YV3A 3UAGA 5L45A 4CLOA 5G0VA 5JAZA 3CKYA 1V3UA 4R1NA 4CV0A 1H93A 2YQ5A 4CV2A 4WLFA 3G3EA 4D44A 5AXBA 3TF5A 1DHRA 3GNTA 5A1TA 2FY8A 1I3LA 4MKXA 1YB1A 3VKVA 3E5RA 3GRPA 4BKQA 2VHXA 2DKNA 3KEOA 4HX5A 3RC7A 1SBYA 1YBMA 5JCJD 3GGGA 1X1TA 4S3MA 1BDBA 3PLRA 1SC6A 2JJYA 1VSUA 2VHWA 2YHUA 3GA0A 3I9NA 4ND3A 2Z95A 5L7YA 3QP9A 2IZ1A 3VKUA 4CQLB 1X1EA 4E5PA 2C0CA 4ZQGA 2O2YA 2JFGA 3KLPX 3NDJA 4XQGA 3V2GA 3NUGA 4BO9A 3ZN2A 1E7QA 1QYXA 2ZCVA 2Y93A 3NDIA 3E6AA 3FPLA 3WNQA 1V0JA 5CEJA 3IKTA 4XGKA 4EYEA 4B4WA 2RAFA 3CMMA 5I7EA 2J3IA 3NT2A 1DB3A 3ZDFA 1IYZA 4PLVA 1N92A 4CM8B 1UR5A 3ETGA 2NTVA 3AUTA 2PD6A 3TRIA 4LCEA 4BHTA 4DVJA 2FZEA 1Y9AA 1YL7A 3VVCA 3PZBA 4HADA 3EZYA 1EQ2A 4FGWA 4YJGA 4YT4A 3B1JA 3C24A 1GAEO 2EWMA 3W4IA 4YAGA 2QX7A 3DMYA 4D0SA 3B1KA 2X0NA 1GYQA 2YY7A 1L7EA 2RH8A 2DBRA 1PL6A 2E48A 4KZPA 3OQBA 4DMLA 3KEQA 2FSVA 2GDZA 5LDHA 5JDIC 1CF2O 4ITUA 5T67A 3GHHA 1TT5B 1JWBB 3WDSA 5KVQA 3NT5A 3QLJA 1DFHA 4EI2A 2I9PA 1E3IA 1YXMA 1KEUA 4K28A 2P91A 4JX8A 4YJFA 5COAA 1E7YA 2Y1OA 3CSDA 3JD3A 1BXGA 4WPGA 2PGJA 1NQ5A 1KY5A 4DLAA 3PHGA 4RPLA 4E0BA 4YRBA 4RCVA 1P0CA 2NLOA 4NFYA 4XB1A 1E0DA 1U3UA 2I67A 3LT1A 3L9XA 4DQVA 1P74A 2O3QA 4E2WA 4QEDA 1Q2XA 1BW9B 1SNYA 3TFQA 1HDOA 4DLBA 3FTPA 4Y67A 4PZDA 2I66A 1T2FA 4GAEA 4L4XA 4BO5A 2JAPA 3F4LA 4N5NA 3JQFA 5CDGA 4RPJA 4MVJA 1SOVA 2UV8A 3WFIA 2FOIA 5F5NA 3F6YA 1I0ZA 2BFOA 2C7GA 1A4IA 1Z45A 4YCAA 3S2GA 2NWQA 4MP3A 1VL8A 1CERA 1DSSG 1VE9A 3AFNA 4RLHA 7ADHA 4BO6A 4BNTA 1JN0A 3VOSA 1EK5A 5FWNA 2GERA 1QR6A 1PJSA 4TRRA 4HFMA 2B4RO 5T6BA 3AJRA 1L7DA 1DFGA 1XG5A 1EBUA 2YV2A 1V9LA 3M1AA 3LDHA 3UF0A 2OL4A 4YWJA 4DPKA 1SO8A 1SMKA 2QQ5A 2AQ8A 3GVPA 2QRKA 1EE9A 2BI8A 5DCYA 4BV8A 1DFIA 3WMWA 1LDEA 4RV9A 1A4UA 2EW2A 1WXDA 1NNUA 1R15A 4Q3AA 2WD7A 4YJDA 1M6WA 2H5LA 5JC1A 1DAOA 5GMOA 2O3UA 3ZU2A 1B8PA 3JQFC 3T7CA 4WLNA 4DIBA 4E5YA 2E49A 3H5RA 4FC7A 1V3VA 2GYYA 3EVNA 3GZNA 4OKNA 1M76A 3L6DA 4YAJA 4W7HA 4ZQFA 4NBTA 1ENYA 3S8MA 5CDYA 5C5IA 4ZHSA 1PGOA 2NM0A 2EP7A 2ZYAA 3AM3A 4ID9A 4ALKA 4E32A 1H94A 3O38A 1LA2A 3BMCA 3BMNB 4BO0A 1EUZA 2VQ3A 1ADBA 4MINA 3R6DA 4JXKA 4J1TA 1UDBA 1EVIA 1FDVA 2IZ0A 1WDMA 2C2XA 1IZ0A 2VYND 1JDJA 3DC2A 3GDOA 3CMCO 4QSMA 2HK7A 1GPJA 4PZCA 1LX6A 2YV1A 3OMLA 3DMTA 2E82A 2XXJA 4GBJA 1Z7EA 3DO5A 4ZQEA 3RBVA 2EIHA 4J4TA 1ONPA 4XZ3A 3NV9A 3PRJA 2J3JA 1GR0A 1T25A 4MVJF 3E9QA 4Z0TA 4A27A 1KVTA 2Y0DA 1B3RA 3ICPA 2YHIB 4XCVA 3DZBA 3DHYA 4KP7A 5TRTA 5BR7A 3OQ6A 4QXMA 3DZIA 3GNQA 2RHCA 4DXHA 2OBNA 2AEMA 1X0VA 3GDGA 3H9UA 1ZW1A 1L1FA 5KKCA 5GZ3A 1W4ZA 4RZHA 1P1FA 3FNGA 1C1XB 1H0KA 2Y0EA 2VYVA 3JYQA 4EJMA 3JTMA 3I4FA 3Q9NA 2Y1GA 1K89A 2EKLA 3DOJA 5THQA 3WIDA 1I2CA 1MXHA 2NSDA 1PSDA 2EW8A 2AQHA 1YQGA 3ZWAA 1ZK0A 2VZ8A 1DJQA 3O8QB 4FJ1A 4CL8A 3PYMA 5BSEA 4MVJE 4PLCA 5TLSA 4CLOB 4R54A 2H1SA 1IULA 3GOHA 1B7GO 3JQ8A 3F1KA 1YS4A 3SBOA 1NVGA 1ZEJA 2P4HX 2O50A 4Z9YA 2WJPA 5TS3A 1ZK3A 2AQIA 4CR8A 1BXKA 2B0JA 2G82A 3OQ1A 1DLIA 5F1KA 4RVSA 3JQAA 4E13A 5CEEA 1M66A 3QWAA 4E2XA 4FIZA 3EYWA 4EUFA 2JKVA 3IJPA 3JYPA 4I9UA 4DTIA 3H5AA 4P22A 3BTUA 4IJWA 2IE0A 1YKFA 5B4TA 3KYCA 3HDJA 2A92A 3K5PA 5JAMA 5KIAA 4E30A 4PLFA 4WLUA 3LVFO 4GSKA 3OJLA 3R3JA 3N58A 1ISFA 3DAGA 1LEHA 5G4LA 2HK8A 2PH3A 3JYNA 1B0AA 3JV7A 4UUPA 3PIDA 3BTSA 2JHGA 4ONEA 1ARZA 1JKJA 4XIYA 1M2WA 4E5KA 2JFFA 1XU7A 3NJ4A 2Q49A 1Q0LA 3DBRA 2BGLA 4J0FA 2P9EA 4JN6B 3HB5X 4RZIA 3ZWCA 2BKAA 3V8BA 5F1PA 1ISJA 4YAIA 2QYTA 2VUSA 4B4UA 2BF7A 3PP8A 4F45A 1E3EA 3Q0EA 3S2IA 2VZ9A 4NHEA 1IB6A 1GYPA 2Q1SA 1DRUA 1O9BA 2HAEA 3T4XA 4Y6RA 3F5QA 1PJCA 5CHEA 1UZMA 3SEFA 1YQDA 4JCOA 3PHIA 2OZPA 2IRWA 2NU7A 3FN4A 3UCXA 4RF3A 2DLDA 1IZ9A 3RWBA 4E5NA 3GT0A 2QZ9A 4YJFB 1BXGB 1QORA 2HMWA 3K96A 4L74A 3IOYA 1R16A 2OGUA 2VTEA 1DBVO 4UVEA 5F1OA 5TJ9A 5MDHA 2ZTLA 3JQGA 4G65A 5HWSA 4NMHA 1J0XO 1ZMTA 3QV1A 2UUOA 2EJWA 5DF1A 3EK2A 1C0LA 2X8LA 1YB4A 5DULA 4BKRA 5G2OA 1AE1A 4Q3NA 2GUGA 5JO9A 3RFXA 4TSKA 4OJNA 2IODA 1DJNA 4MP6A 1GV1A 3HDYA 4XGIA 3I9MA 1E7SA 2VNAA 5DBGA 3GEMA 4FFMA 4NBUA 1KY4A 3UCFA 1O95A 1NVMB 2FR1A 2Q4EA 2I3GA 1SCUA 2WEKA 4W9NA 4QX6A 3H3FA 2AXQA 4IIVA 4DRYA 1O94A 1DIGA 2NVUA 3LT0A 1PGPA 3OJ0A 3NAQA 3SLKA 1X15A 2ET6A 2NVBA 4IS2A 2O3SA 4GKBA 4J4BA 3C7AA 2GN8A 4A10A 5H81A 2DBVO 3INTA 4CQMD 3GVCA 3AUAA 3ETEA 4YT2A 2WD7B 3U4DA 2J8ZA 4B79A 4HNHA 3BAZA 3GEDA 2EJVA 1IPEA 1GZ4A 2IYPA 1IL0A 1E92A 3F3SA 3D5TA 3MJ4A 5FFFA 4UUOA 1CQIA 3GZNB 3VH1A 4J4HA 1LSSA 5A9TA 3OJFA 1QLJA 4ZQBA 5ER6A 1HETA 3JD1A 2F1KA 3H4VA 1CYDA 2ZCUA 3O26A 4HP8A 3RU9A 2RIRA 3E48A 1D1SA 1Z74A 4AJEA 2P2SA 4HY3A 1BWSA 1UXKA 3BMCB 3MJCA 4P8RA 5JDCA 4IMPA 3P19A 4Y98A 2JD0A 2UDPA 3Q3CA 1QYWA 3HE3A 2PKQP 2OHXA 4U5QA 1F8FA 1VJ1A 1X7DA 3LZ6A 2NU6A 3O4RA 4CM8A 4R9SA 1R0LA 2VCYA 4ZRMA 3E03A 5CP8A 1HKUA 3MJTA 1JQBA 3FWNA 4QO8A 1H9AA 3DTYA 5IJZA 1Y8QA 1IPFA 4RQTA 5HM8A 2HRZA 4NFSA 5JO0A 1ZEMA 3DB2A 3ON5A 4ZVVA 3W6ZA 4JBIA 3E5MA 4PCVA 3OHSX 3IC5A 4WGGA 2Y1DA 3P2OA 4PLWA 6LDHA 4ZRNA 4OHUA 4KWIA 3CUKA 4TZTA 1HE5A 4I9HA 4NI5A 2X9VA 4NIMA 5C37A 1LLQA 5TT0A 3E82A 1PZHA 1KYQA 1R0SA 4R3NA 1TXGA 2AEFA 2E6UX 4I5GA 1QYCA 1PJTA 3UKOA 1FK8A 3A9WA 4J2HA 1GQQA 4LCJA 4W4TA 3U09A 4OM8A 3C85A 4L8VA 3ZV6A 4BS9A 5HTOA 3NRCA 1NP3A 3Q11A 1CJCA 1XR3A 3AOEA 5G0UA 3JQ8B 1VKNA 1ZK4A 3PJGA 4GWKA 3CEAA 1OI7A 5IZCC 3RUHA 1LI4A 1EFLA 1K6JA 2B4TO 3AY6A 2UVDA 5TJHA 4OXNA 3VPGA 4BNUA 2GZ3A 3JQAB 2R2GA 4GQAA 4AJOA 4C7JA 3V2UA 3JCZA 1LRKA 2EG9A 4ALMA 3EGOA 3RI3A 2ZJ1A 3LLSA 3WGZA 4A7PA 4DLLA 2VWPA 3PJEA 1XDWA 2BD0A 3OA0A 2VWQA 1HLPA 4WKGA 4FQ8A 3RFTA 3SLGA 4F3YA 4XJSA 1HT0A 3MTJA 3INRA 4I5FA 1P1KA 4NDNE 3K2EA 4U7WA 2NNLD 4W6ZA 4BNWA 4JJFA 2R00A 5FEUA 4OQYA 1TVEA 1N8KA 3ZNPA 1AUPA 1I8TA 1LJ8A 3PQEA 4BQRA 1BRMA 4E21A 4D45A 1A5ZA 2X7HA 5B1YA 1DC3A 1WZEA 3K6JA 5JCJA 2WDZA 1LRJA 3WLEA 3WBFA 2X0JA 2X9GA 4NU5A 1J5PA 1HZZA 5IDWA 3VPSA 1NFRA 3SC4A 3DR3A 1OAAA 3VVBA 2GO1A 2IDZA 3WGGA 5ILOA 4GVXA 2I5PO 3DBRB 1P0FA 1GUFA 4GX5A 1HE3A 3H2SA 3QWIA 5DN9A 4XRRA 4P4GA 4CM5A 3TZQA 5L4LA 3RBZA 1PL8A 1UAYA 4UVIA 4YVFA 5CDTA 3JQBC 4R51A 1J4AA 1R6DA 1W6UA 1VJ0A 3H3JA 3KRTA 3GMDA 1JA9A 1V6AA 2DFDA 4MVJI 5A5FA 1DRVA 2JL1A 1CRWG 1U7TA 1Z73A 2C7VA 3GGOA 2CVQA 4BKUA 2G76A 3I5MA 1LRLA 4MP8A 4XB2A 3HADA 1WMBA 5T5QA 4INAA 2GCGA 1EUDA 3KB6A 1U8FO 1Y5RA 2D1YA 4GX0A 5KJFA 1I2ZA 2C20A 2YYYA 3ONDA 3QVTA 3KLMX 3PDUA 3RFVA 4M87A 3INGA 1PU2A 3RD5A 3ROQA 4PLTA 4CL3A 1XHLA 3C1TA 1ZK2A 3FR7A 3VTZA 1XLTA 1K0UA 2B35A 4KQWA 1P1RA 4JLWA 3JQGB 1B15A 5FYDA 1B8UA 3RASA 4PFJA 4GI2A 2B83A 3JD2A 4RLSA 1O5IA 2BI7A 4U8GA 5JYDA 1KVRA 4KDFA 4YQZA 5JPIA 4LMRA 1MXFA 3SJUA 2BLLA 3PWZA 4K26A 4LVCA 2WYUA 3HFGA 2B5VA 2DQ4A 5A02A 3TOZA 2Q2VA 1N7GA 3SJ7A 1UP6A 3WR5A 1F17A 2IZZA 2FHSA 4TZKA 4DYVA 3NTOA 3CXRA 3DWFA 3C7DB 4F6CA 2X0IA 4CM9D 1GUZA 5HRUA 5DNAA 3PLNA 3FRJA 3DZJA 1QYVA 3W8EA 2Q46A 2Q45A 4J49A 4EZBA 4RF4A 1CEQA 3JQEA 1BGVA 1T2CA 4CLEA 3H9EO 2Z5LA 4GSLA 1BXZA 1E3JA 3DL2A 3AWDA 3KVOA 3O8QA 4TKMA 3L07A 2NVUB 3EMKA 4R1UA 3ZWPA 4KTVE 2BFPA 3MWDB 1C0KA 3WQSB 2CDAA 5L3ZA 2Q3EA 1VM6A 2ZB7A 4BGEA 1Q7CA 2BGKA 4M86A 3LU1A 3SVTA 3KSZO 1E3SA 4FFOA 3WBBA 2ZIZA 5TGDA 3ABIA 3I4CA 1IHXA 1OC4A 1DPGA 4OXYA 1JAYA 4TMFA 3RJ9A 4R4JA 3G1UA 3CPSA 2DVMA 1OFGA 5A04A 2WYVA 1BVRA 3QE3A 5JY6A 3HDHA 1KERA 2PLAA 3ZV3A 4GGOA 4BIIA 5L9AA 3V1UA 5JDIA 2I3AA 3HG7A 3LSYA 4TWRA 4PG8A 3V1YA 3ZU5A 3KOUA 3TPCA 2W4QA 2WWRA 4IJKA 4IGEA 3TWOA 5JAQA 2Y67A 5KTKA 3VH3A 3WSVA 4IDFA 4QECA 1XGKA 3ZWNA 3D4NA 2VRBA 1R37A 4XWYA 1JTVA 1R12A 3KO8A 3LQFA 3Q2IA 4Z6KA 2VWHA 3TFOA 4ALJA 3C7CB 3OIFA 2YJZA 4ZN6A 5AOVA 1HDGO 1KVSA 2OOSA 3FTNA 4WASA 3HN7A 3RUCA 3QQPA 1D8AA 1ZJYA 4WOKA 1Y8QB 3ROMA 2A4KA 4MPDA 3ZI0A 2D4AA 4E12A 1TB4A 2PGLA 4EDFA 2HMVA 2WTBA 1U4OA 4ALNA 5ICMA 1NX6A 1DC6A 3PFFA 4LVUA 3PI7A 1EDZA 2Y0CA 1QYDA 1GCUA 4UEKA 4FFNA 2VYNA 2D8AA 1HLDA 5H83A 3SC6A 5EESA 2HQ1A 1PJ4A 1VSVA 2EV9A 5JAIA 5AXAA 5B37A 1LC0A 3RC1A 3I9JA 1QKIA 3ZNNA 3KSUA 1GV0A 1I3KA 4FDAA 1NVTA 1E5QA 4DMMA 2CMDA 5B4UA 1LUAA 3ITDA 3LF1A 4PZEA 3WGHA 1ZK1A 2OORA 1BSVA 2PGDA 1NHWA 4BB5A 4M55A 2JHFA 4Z0PA 4CM4A 4OYRA 1YJ8A 4CMGA 1DC4A 2E37A 4FSHA 1T1SA 1H2BA 3MWEB 2X5OA 3UVEA 4EUEA 3KETA 2WYWA 3JQCA 3WYCA 3G17A 4A0SA 4BMNA 3D7LA 4NK5A 3UGKA 3E18A 3GDFA 2DBQA 2GASA 3KYDB 9LDBA 4U0KA 5BQFA 3Q1LA 3ASVA 2AA3A 3GFBA 3U5TA 1WVGA 5EL0A 4GMFA 4Q9NA 4DIOA 1DHTA 4YBZA 3ROKA 3W6UA 4LRSB 4P4LA 5CDSA 1HDXA 1NHGA 4Z3KA 3DOOA 1ZBQA 4PIVA 5IXYA 1WW8A 3U49A 2FZWA 3FNHA 5TT1A 1DOHA 4CJXA 1U2DA 1U5AA 2ZTUA 3IKVA 1RJWA 4FPXA 1C0IA 1MFPA 4HFRA 4U6QA 3NKLA 1U7HA 3BMQA 4UUMA 4IDBA 4R5HA 1HE4A 4ZU3A 4HUJA 4R16A 1NASA 1Y1PA 3RUDA 3IAHA 3IUPA 4XGNA 4R01A 5IDYA 3IP3A 5DZSA 3NT4A 1WZIA 1H6DA 3RROA 1BDMA 1NPYA 2W2KA 3AUUA 4RF5A 4CM6A 3Q9UA 2B36A 2O4UX 4HXYA 3KBOA 3H9QA 1NTOA 3D4PA 4K1LA 4RVUA 4ZJUA 2NU8A 4UEOA 2AE2A 5G4KA 1CIVA 3F46A 3GAFA 4WLVA 2NV6A 1IY8A 3AM5A 3UXYA 3S2FA 3RQSA 2HJSA 1MUUA 2Y1CA 3W4JA 5L53A 2C5EA 4GKVA 5A9SB 1N1EA 3L6EA 4RQUA 1A9ZA 2X5KO 3EDMA 3FHLA 3R3SA 1YGYA 1F14A 3LC1O 2HRBA 4W99A 4YYZA 3DTTA 4H7PA 1NBOA 4FCCA 1G1AA 4B3HA 1WP4A 5JMWA 3B20A 2Y05A 2JFHA 3S1LA 2YQ4A 3U4IA 4BGUA 1XIVA 1XWFA 4B8WA 4Y8VA 1B26A 5JBIA 2HSDA 3E8XA 3K2BA 3KXDA 4II3A 1I30A 4FGSA 1LU9A 1E1NA 1YWGO 4RO0A 2BRUA 4O63O 5T8KC 4CLDA 4E3ZA 2EERA 5DBIA 3DONA 4GX1A 4NH4A 1P9LA 2VOJA 4CR7A 4AJJA 4ESOA 5KKAA 4R68A 1BMDA 4ILKA 4OSOA 3OJEA 1ISIA 4OGWA 4QT0A 1NR7A 4B4OA 3ZHBA 2C82A 4IZIA 2V7PA 1A71A 3GHYA 4AJLA 3GVHA 3DHEA 4M54A 1H6AA 2HUNA 4RVDA 3RAJA 4MVJM 1ULUA 1PEDA 5H82A 1AXEA 1VI2A 1U28A 5MGBA 4A26A 1DEHA 2EKPA 5ES3A 2O3RA 4XA8A 1E77A 3DHNA 3NJ8A 4FFPA 1NAHA 1ZZEA 4PVCA 2CUKA 4I9NA 5DT9A 5TC4A 1UUFA 3QW2A 3RJ5A 4DIFA 4LK3A 3NTQA 4QFCA 5IDQA 4J9VA 1QP8A 4H3VA 1PJBA 3FF4A 5BT9A 4C4OA 4L76A 3HHPA 1HXHA 5AVOA 5TIIA 4MKRA 2XPCA 3JYLA 4IS3A 3F47A 3DFUA 1FDTA 1HDZA 4I8XA 1EUCA 1YB5A 4ZA2A 3HB4X 2J6IA 3L77A 3A28A 3ZW9A 2EGGA 1O89A 2ZB4A 5A9RA 3K92A 1MG0A 4XYGA 4IBOA 5DCWA 4CQMA 1ZH8A 3MJSA 1PGJA 1ONOA 3KZVA 3WYBA 1ADGA 1DC5A 2GRAA 1LDGA 3MEQA 4B7UA 4Z9FA 4DWVA 4RDHA 3MOIA 4DQXA 4E5MA 3DEYX 4O5OA 2J3HA 4CODB 3OICA 4ND4A 4S1VA 4WCFC 1S7CA 3VAZA 2GF2A 3WTBA 2Y1EA 1HZJA 4L75A 2RCYA 1JKFA 4OMUA 3VZRA 4BMVA 1P44A 3LC2O 3U0BA 3QY9A 2OXIA 3R0IA 4MJLA 1RM4A 2JD2A 1Q7BA 3ZV5A 2GZ1A 4ZICA 3UFXA 4WCDA 3QVSA 1U9JA 2OUIA 4OQZA 4IQ0A 3G1TA 5ITWA 1SPXA 3PTZA 3ASUA 3I23A 3GN1A 3HQ4O 3WGYA 1ISHA 3ZZNA 5EPOA 1KEPA 4X54A 3PDJA 1I5RA 3ROPA 2GN9A 5JFOA 1RYDA 4BNNA 4BOYA 2O3JA 4KMSA 4PLYA 2R6JA 3PXXA 3ZCXA 3UCEA 1U1IA 1UJMA 2VRCD 3SXPA 4BO8A 4IDAA 3UH1A 1I33A 1KVQA 3S2EA 1GZ6A 3OA2A 2W90A 4CM4B 1MLDA 4UEJA 3N74A 9LDTA 3D3WB 3GG9A 4BO2A 4L0QA 4IXTA 3K9QO 3DZFA 1D7OA 4CMJA 1W8DA 4J1NA 3OETA 2YDYA 4JBHA 4NPCA 3V2HA 5IG2A 1EZ4A 4HFJA 4N18A 4YDRA 4H16A 5U9CA 1Y8RA 5ICSA 3TL2A 3JQ6A 4J90A 3GY0A 3RUEA 2V6GA 2VYVD 1U3TA 4J7CA 1FXSA 2DPGA 5GZ6A 1KOLA 3AI2A 4J43A 3NTRA 4XQEA 4IDEA 5U4QA 5T64A 1YDEA 1HL3A 3F5SA 3MJEA 1HEUA 3ZWOA 3BMQB 1V8BA 4J1QA 1RWBA 2D59A 5DP2A 1Y7TA 5C7LO 3GC6A 1RM5A 4DC1A 3B6ZA 1MC5A 3BYZA 5A05A 1GDHA 4I5EA 1U3WA 4W7IA 4U6SA 2PZJA 1B8VA 4M89A 2W2KB 4IZHA 2Q4BA 1WLYA 4TRNA 3ANMA 3JD0A 1OC2A 4HBGA 2CD9A 3AUSA 2QIOA 3E9MA 4CMIA 2FWMX 1YO6A 5C7IO 3PZRA 3UUWA 4BNGA 4DUPA 4PG6A 5G4KB 1Z75A 4XR9A 2I76A 4J0EA 5BNIA 5EJ2A 2HO5A 1K3TA 1EVZA 3I6QA 4O0LA 5DDIP 1SOWA 4N5MA 3TNLA 1I32A 4R69A 3L0DA 4A73A 4J16A 4XD2A 5A3VA 3X2EA 4M1QA 2V6BA 1UDCA 4PGFA 1WMAA 3C1AA 3D0OA 5EINA 4DC0A 2NTNA 3WWYA 4AJNA 1JW9B 3GNSA 1E3LA 4FFLA 3BA1A 4M49A 4WLEA 5JW6A 1T26A 4A03A 1NQOA 5ITVA 4Q3CA 5C3MA 3TZCA 3GG2A 4TKLA 4K6FA 4YR9A 2D0IA 4I1IA 2J3KA 2PKRA 3GVIA 4IUYA 1LNQA 2G5CA 1KS9A 2YFQA 2JCXA 3AM4A 1YL5A 5IZCA 1CETA 4FJ2A 1PZGA 5BSHA 1ZXBA 4IPTA 2O4CA 4YQYA 1EE2A 3ZW8A 4RPHA 3TJRA 5LCXA 2HU2A 2H63A 1ENPA 4ZQHA 3WGIA 4CM7A 2VT2A 3NYWA 2P9GA 2PA3A 3GZ4A 3TZ6A 3RCBA 3JQ9C 4BO7A 4D3FA 4YRAA 1KVUA 2IEDA 5I7VA 2I6TA 2C07A 5KJCA 4FC6A 2DT5A 3CH6A 2AQKA 3V5NA 1P1IA 3KV3O 3VHRA 2Z1NA 3I9KA 4P38A 2CVOA 2FRDA 5I8ZA 1GL3A 3K73O 4B8ZA 3PHHA 1VJTA 3EUWA 2O7SA 4AJPA 4BNJA 5KVVA 4EEZA 1T4BA 2PY6A 3PWSA 1O6ZA 1PJQA 2XOXA 1JU9A 2DUUA 1J6UA 4BO3A 3PJFA 4CM9A 4IDGA 3OJOA 4XRGA 3ZGYA 4BNVA 4CMHA 1ZSYA 1A7AA 4JGBA 4II2A 1IE3A 2TMGA 1V3TA 5L51A 3BHMA 1NM5A 4TVBA 4C7KA 2B37A 3DAPA 3SX2A 3JQBA 3ZNQA 3KYDA 2B4QA 5ENDA 1ID1A 1AGNA 2HMSA 4RPGA 3GEGA 1UXHA 4FD3A 1QRRA 3DOCA 4BNFA 2NACA 3I9OA 2W2LD 1ORRA 1FDWA 2X22A 4JNKA 5GZ1A 1NFQA 1TT7A 2H6EA 4Z9XA 2GGSA 4CQMB 1U5CA 4DQUA 4L9RA 1PL7A 1F8GA 3GRKA 1VPDA 5DBFA 3QA9A 1SB8A 3GFGA 3K8ZA 4R5MA 1CDOA 2PNFA 1ADCA 3OM9A 1A72A 2P9CA 4JP2A 1QV7A 1UXIA 3OH8A 2NADA 2VWGA 1HYEA 1JWAB 2NQTA 2BMAA 5G0TA 1B3BA 2ZJ0A 4WLOA 4BNIA 3AI1A 1BVUA 2CSUA 4A5OA 1OBFO 3FSRA 3BMOA 3CINA 1B16A 1NAIA 2D2IA 3IL2A 1DAPA 1SZJG 1T2EA 1Y5MA 1NQAO 4NFHA 3JSAA 4OOFA 1Z7BA 5KCZA 4UAGA 4BNMA 1EVYA 3DAFA 1ZFNA 1LDNA 1UAGA 4WE3A 5COBA 3I1JA 4FB5A 2X5JO 1GEGA 1U4SA 5DCUA 4ALLA 2JAHA 2G17A 4UREA 4XIJA 4YJHA 3RUIA 2Q50A 1E1LA 4Q3EA 1HTBA 2A35A 2IYOA 1ML3A 4PLPA 4Z0HO 5L4NA 2RBEA 5A9SA 5A06A 3RSHA 3ORFA 2O7QA 3W1VA 4IDDA 4FN4A 1PS8A 1GTMA 3PFWO 1C1DA 2E4AA 1D4FA 1XQ6A 3UW3A 2IXAA 1PJ2A 1TA4A 4BGIA 3EZLA 3DFZA 3FBTA 3A4VA 2XXBA 3TQHA 1EK6A 2Q99A 2QYSA 3ANLA 3M1LA 3WG9A 3FI9A 4ND5A 2IEBA 3RIHA 3L6OO 1QLHA 3PQFA 1D3AA 1IHYA 2FN7A 3M6IA 3R1IA 3WLFA 2P5UA 5HS4A 4OH1A 5EMHA 4CV3A 5I9NA 4KUEA 4PRLA 3H5NA 5CFZA 4JK3A 3LYLA 5CG1A 4Q3DA 1PWXA 2XF8A 2Q1TA 3FR8A 1HDRA 3TZHA 4LMPA 1Y8RB 1DIHA 3AU8A 3FNFA 1B2LA 3HJAA 4IGFA 4CM3A 1W73A 1H6CA 3AI3A 3L4BC 4CUKA 1K6IA 1NWHA 1C3VA 3JYOA 1RKXA 2X58A 3PHLA 2H9IA 3IDSA 1GFSA 1ENZA 3EAGA 1DDOA 4ROSA 3WB9A 4ZGWA 1UXJA 4NBWA 3GH3A 4EUHA 3VPFA 4PG4A 3ITKA 2ZTMA 4YEDA 4NZ9A 2NVWA 1GY8A 1P1HA 5JLAA 2VHYA 1I2BA 2GSDA 3GVXA 4WUVA 3H65A 1ENOA 1GCOA 3ZWXA 4TRMA 1Y9EA 1LXCA 1NYTA 4J1SA 5EQDA 4GPD1 2NQ8A 2ZTVA 3NEPX 5IF3A 4URFA 4LGVA 2EF1A 3WGTA 4NK4A 5IDXA 5JMPA 1P33A 4IJVA 4DPMA 1X7HA 3EY4A 3KTDA 4CUJA 4BUCA 1CQJA 4AJKA 4QUKA 3G0OA 2Q1WA 1G0NA 2QZZA 4CLXA 1Q0HA 1C0PA 5IAAA 4XYLA 4O59O 3RUFA 3PIIA 4GL4A 4KOAA 4CMIB 4D0RA 5K6AC 3W4KA 3I9LA 4K6CA 1HSZA 2OO5A 2DTXA 3T4EA 1TI7A 1I36A 4CUZA 1NPTO 5G0SA 2Z1MA 2OP1A 3LT2A 4G2NA 4E6PA 4XKJA 4MDHA 1ONNA 4LISA 1C14A 1PGQA 1YDWA 4CR6A 1X14A 4IQGA 4D43A 2JD1A 5A03A 3CTMA 4IQ8A 1IOLA 2P5YA 3PHJA 1LQUA 1LLCA 1N7HA 1NR1A 2YZ7A 1ZSNA 4JROA 1WNTA 5L95A 1MB4A 2OBYA 3BTVA 2HJRA 3RUAA 4JQCA 3AY7A 5ER9A 2GN6A 1LSOA 4NBVA 3H6KA 3C8MA 2Q1UA 2AG8A 4N5LA 4HNGA 4CV1A 2VNSA 3COSA 1U3VA 2YFHA 3ADPA 3BHJA 4CMEC 4BV9A 4AJ4A 1E3WA 4BGVA 4O1MA 1N2SA 2J5KA 4TQGA 4FOOA 1HDYA 5K9ZA 4LSMA 4XYBA 2HKIA 3GMSA 3WX0A 3ZV4A 2CF5A 3L9WA 5F3RA 3H2ZA 4D46A 3BHIA 1PZFA 4D41A 2ZQYA 1HE2A 3RKRA 5IN4A 1I3NA 3QVWA 2PTGA 4QTZA 3M2PA 2GN4A 4YAEA 4L73A 1FF9A 2FMUA 3WSWA 1XU9A 1T2AA 2WD8A 1MV8A 4UVDA 1T4DA 1IUKA 3ANNA 2GNAA 3E9NA 2Y99A 4IIUA 2OMEA 1NQTA 3T7EA 3CZRA 1E5LA 3K31A 3QIVA 3PQDA 4MVJP 2DC1A 3FNEA 1LBEA 3D3WA 3HSKA 3JQ7A 4ND1A 4AG3A 2VOEA 5U1PA 3PYXA 4N54A 2D5CA 1YONA 1B14A 3RC9A 4BNZA 1HDCA 4K9DA 1MX3A 2AE1A 2I99A 4LW8A 4GGPA 4MIYA 1SEPA 1AHHA 1KIFA 4L4SA 4M8SA 3PVZA 3ZU3A 4BNHA 1HRDA 4FR5A 3CIFA 5A4DA 1PR3A 2UAGA 3AOGA 4IXWA 1EDOA 1H2HA 3OBBA 4WEQA 4OKIA 3PK0A 1A7KA 3ETDA 3FPCA 1YVEI 5BNTA 4NU6A 4EEXA 4JP3A 3ZHYA 3VPXA 1NWCA 3IP1A 4R1TA 5CEFA 1ISMA 1CWUA 1DLJA 4HWKA 1YBVA 3VZQA 1SAYA 1OOEA 5GY7A 4WOJA 1R4NA 1LSJA 1NFFA 1PR9A 1N9GA 5B4VA 5L4SA 1VRWA 3BMOB 1WDKA 3GF4A 2WMDA 4XJTA 5COQA 1EBFA 3JD4A 2W98A 4TRJA 1Z82A 4B4VA 1KEVA 4B3IA 1P1JA 1QG6A 2X86A 4WEOA 3OP4A 1ZJZA 2W8ZA 1PJLA 5T8KA 2RHRA 5BSGA 2ZK7A 1Q1NA 4J2OA 1Y6JA 3G79A 2O2SA 3QRWA 4YT8A 5JYEA 2F00A 1JAXA 4GX2A 4E33A 1X0XA 3KHUA 3WGOA 3D64A 2CFCA 4DBZA 5CAEA 4YJHB 5ENVA 2J5RA 8ADHA 3VTFA 1UXGA 4IDCA 4E2YA 2JCYA 3BTOA 3I6IA 3O03A 4RVHA 3U4CA 2X9NA 3OIGA 3D5QA 4PG5A 1PTJA 4NJOA 3DDNA 1C1DB 4DGSA 3WQRA 4H15A 2AEJA 4E4YA 3GQVA 2PH5A 4FBGA 1HYGA 1LTHR 4JBGA 4TROA 5DOVA 3HFSA 3LF2A 2Q2QA 2O23A 5I8WA 3DBLA 2Y66A 4Q39A 4HFNA 1ZUD1 1YL6A 5EIOA 1GADO 2BHLA 3Q2KA 2NUAA 3O9ZA 1DIBA 1UP4A 4Y6SA 4DBVO 4NJMA 3MCVA 3I52A 1EVJA 5F5LA 1LDMA 3GLQA 2DAPA 4YTEA 2FPGA 3OECA 2VRCA 3W8FA 4MVJG 1A9YA 1ISGA 4UULA 3V1TC 1AN9A 3E1KA 5DP1A 1R66A 3BIOA 1I3MA 1KEWA 1I01A 1PQWA 2PFGA 3U3XA 1VKOA 2LDXA 2V6FA 4MO2A 4E2ZA 4YT5A 1VL0A 1YH3A 4KQXA 1PQPA 4N7RA 3ULKA 4AFNA 8LDHA 1JLLA 4IJUA 1DXYA 3TDKA 3EVTA 4BNXA 1ULSA 1FMCA 2BGMA 2GR9A 3IUSA 3QHAA 1FDSA 1HSOA 4WCFA 1DIAA 5EQFA 4CM1A 5JC8A 4MIEA 4OAQA 4EJ6A 3WGQA 3DZKA 5ILGA 3TZKA 4NG5A 3WOHA 3WJ7A 3FWZA 4MVJD 4ND2A 4LN1A 3QWFA 1UZLA 4OIMA 1PWZA 1XCBA 5KVCA 3FBGA 4MKZA 4PVDA 5IXSA 4GLLA 3ADOA 4CMCA 2CVZA 2RH4A 4EITA 2BH9A 3B70A 2PD4A 5HBRA 4OL9A 1BG6A 2FPIA 3QSGA 3VPHA 3DMTC 2C2YA 4CPDA 1ZIDA 3GPIA 2HDHA 3WWZA 3H9JA 3DBVO 4YAKA 2ILTA 3D3EA 4DREA 3ZHXA 3Q6IA 1PX0A 2PZMA 3AK4A 5KJ1A 3TSCA 3MOGA 1DRWA 1H5QA 3A1NA 2A9FA 2DM6A 3RVDA 4R3WA 4BVAA 2TMDA 2UUPA 2X23A 4B7XA 2EP5A 3M2TA 1BHSA 1LLDA 5KWEA 3OF2A 4F6LA 1MG5A 1XSEA 2DFVA 4D7AA 3WYEA 3QVXA 1ZMOA 3I3OA 4Z3DA 2PD3A 1RM0A 3NX4A 4B7CA 2FSSA 2CDCA 2BELA 2VUTA 3A14A 2GD1O 5CDUA 2FPPA 4BO4A 4JIGA 4PG7A 5IZ4A 1MC4A 5FI5A 1E7WA 5L40A 1E3WB 5G0WA 3UN1A 5TX7A 3LK7A 5KVSA 1BTOA 2DU8A 2C59A 2XAAA 4J91A 3N7UA 1QSGA 4KTTE 1AXGA 2ZB8A 1YE3A 3H7AA 4WECA 3GK3A 3H9GA 4J3FA 3U9LA 4YJGB 4G5HA 3ZWYA 4HKTA 1YOVA 1XKQA 1DIRA 4BB6A
chains in the Genus database with same CATH superfamily
5JCXA 3A9TA 3CVXA 2C54A 5LMNB 4RAQA 3JSXA 3IS3A 3DULA 2WICA 3GUYA 2VF8A 4B3DA 2FWPA 5F23A 4HRXA 4PQYA 4PYQA 2XGSA 1ZM4A 3PYLA 4CCYB 3BXXA 1Z34A 4QDJA 3EHEA 1SG6A 1W2GA 4XCXA 3ZHZA 1RRKA 4GICA 4Z7NB 3FDZB 1VIDA 2VJKA 3AR3A 5I7OA 1A7UA 1HNNA 2R751 1U0RA 2NO9A 3N0XA 1RQNA 2ZZMA 3FGPA 4RL6A 4KWEA 4LZPA 2Q2WA 4DARA 1K86A 1I24A 1JAHA 5CHYA 1D5WA 2QRQA 2B69A 3KB1A 1MPXA 4S1OA 1EJBA 1BA2A 1LSUA 4HNQA 1OSNA 1TYDE 1N2ZA 3GPCA 1YQXA 4IOLA 5I9LA 5K7SA 1C80A 1YS1X 1A0OA 3UAOA 2D3TA 1CUSA 1YQTA 4F86A 4YAUA 3VZSA 4DV5B 1E1CA 4A2WA 2EKQA 2ZYDA 2FG6C 2JLSA 4H7JA 3BGSA 5T6MA 3EBLA 2FR0A 3U7QB 4EDHA 4DDWA 4HUQA 1VB5A 1QE3A 3IRVA 2PWZA 2X19A 4RPKA 3UHAA 3KUXA 1QTIA 1RKVA 1N5OX 3I92A 1ZZGA 2D00A 2PFKA 1WDLA 3GV0A 3LFUA 5IC4A 1K6XA 2R1VB 4UPVA 4X3OA 1K7XB 2C83A 4R1QA 3LA6A 5GOTA 5C18A 2SKEA 4LHSA 1OD6A 2ODPA 3D1VA 4EZIA 4G26A 4K86A 3HKBA 3DBHA 2Q5IA 3O1IC 5A2GA 2QROA 4ISCA 3T1YB 1MJ5A 3DV0A 2FZ4A 3FCUB 1Q7RA 2X1MA 3NWBA 1EGMB 3RG8A 4Z51A 4BNYA 2WT4A 2ONJA 1VGVA 2QGNA 3WTCA 2YW9A 3WS7A 1N9GB 4F9TA 4I81A 3WIEA 3Q5GA 1BD3A 1IAQA 1IG0A 3IBFA 1X19A 4QQRA 1WVMA 3K9HA 4NJEB 4TTVA 3ELBA 2W6MA 2ATEA 1W5SA 2JI9A 5I9MA 3ZDAA 3AHHA 2A84A 1DAMA 1FJHA 4L4YA 4OB8A 1XZGA 4RZXA 2PUBA 1PCXA 1F2VA 3BWVA 4HH3C 1P4GA 2HV9A 3DVLA 2VPIA 2YFYA 1G8KA 3K6SB 3JQ9A 3DTNA 2IV2X 4HDCA 4ECEA 3T7IA 3T95A 3UYLA 3Q3VA 2VJOA 4URWR 3TR5A 3WO1A 2G40A 5JYBA 1N78A 1E5XA 1OZAA 1OA1A 1V8DA 1EK0A 2I65A 4RGBA 4B09A 4L0DA 2KJQA 5AUNB 4I6JA 3PCTA 3NGMA 3X43A 3HBNA 5CFRA 4Q9IA 1E0JA 4J8PA 2FZVA 4XYEA 3M1IA 4KKXB 1ZNQO 1KEZA 3GLKA 1KZGB 3NHPA 2P62A 3PQ4A 4LXHA 2ARKA 4ZVSA 3RF6A 1DKMA 2MMCA 4AS3A 4CMKA 1FC0A 2BDUA 1IZYA 2C96A 3RRZA 1NPDA 1NOIA 2PL9A 4HZUB 4RIGA 2IU4A 4PC6A 3S1AA 2NXCA 4I55A 4U9HS 5F33A 3PX2A 1G8FA 5EVJA 3O4GA 1NP6A 4CQLA 3DBLB 4N0DA 3UYKA 3J7AC 2F59A 1QOZA 3IIKA 3L4SO 1D2CA 1Y3HA 2G0TA 5BUSA 1XQWA 4RTMA 1T1RA 1VLMA 3JWEA 3MLBA 4OLAA 5LFAA 1HYQA 1S2IA 5AK0A 2W2NA 3AM1A 5JPCA 5KJ6A 5AYVA 3VC7A 3MUEA 4INPA 4ND8A 1S3GA 4U4AA 3ZH2A 2BGWA 1OXBB 3FYTA 3ZTWA 1OLOA 1SEVA 3OPYB 4W1SA 1I7NA 3UAZA 5L6MB 1NA5A 4R1OA 4HPJB 2WQ7A 5BSRA 2BYTA 4L8LA 4ZT7A 3HNPA 2BFBA 1E58A 4C3VA 2A9OA 3I83A 3LC7O 2J5XA 1ZCJA 2Q6KA 4M9UA 3CZ4A 3JALB 4LNUB 4MRRA 3MTEA 2RBGA 3DKRA 5DOZA 4WBSA 1BJKA 2AV6A 3VZPA 1JG2A 3O1HB 1ZP6A 2ZT5A 3HCEA 4S24A 1UWKA 4RJKA 2VK4A 1DTWA 3B3QA 1FUEA 3NM6B 2PGNA 1AF4A 3RVSA 3BWBA 5BR7A 5EJ4A 2FUCA 3UHOA 1TLFA 4R1SA 1OX6A 1O0SA 3E23A 3GPBA 1RHRA 2EWWA 2WZQA 2QJWA 2FPUA 2Y4OA 3R09A 5K0GA 2RHGB 1RZUA 3FPGA 2JCSA 3GBVA 3RSGA 3INNA 2ZP1A 1JHUA 2CKDA 4MR9B 4CCSA 4DIMA 2DPHA 2FLKA 3I6ZA 4DWJA 4KX5A 2RBKA 2BFAA 3NCTA 3TQFA 1UDWA 2D1RA 4P34A 3U4HA 5AKEA 1G16A 3BXGA 3LPDA 4KWHA 1ZCAA 4NNJA 1ZO8A 5AKLA 2HLPA 1CQWA 1GLVA 2J5QA 3VPCA 2I71A 4I8DA 4UOZA 1WSAA 2WK1A 2XT6A 3RU7A 2P7IA 1I10A 2PR7A 1TZJA 4D3SA 3ZHSA 3B38A 5A3JA 3QBJA 1S6YA 1UKZA 1EFPA 3DTVD 4G36A 1D03A 3V34A 1ZOIA 1FRZA 3N8KA 5EJAA 1NRWA 2D7CA 1ADFA 1C9JA 2UYQA 3MGGA 3JVDA 2BFCA 2RGNA 4R2IA 3GGSA 1RC1A 3KSDO 1EEHA 1QIKA 3UM9A 3TNFA 3KSBC 3U7HB 3MOSA 5FI3A 3P9KA 3UMYA 4O2AA 4KQIA 5EE1A 3BCSA 3STHA 3G82C 4AULA 1RYNA 4PO1A 4D9CA 1YGPA 4RZSA 1Y1QA 3Q3JB 3ZDXB 4F56A 1KRHA 4X7MA 4K88A 1DJOA 2BZ0A 2GK6A 2QUJA 3HBAA 3L01A 3CJRA 2ADMA 4HEHA 1Y3IA 2OQRA 3IOEA 3TL3A 3TNYA 2OPHA 2J9ZB 1TU0A 3GEPA 3WZLA 4QFDA 4ALIA 4EW6A 5JJ5A 1LBHA 1JDSA 2A0XA 1JXQA 2O0HA 1E6UA 3NQ41 5EZYF 3TQCA 2LZ0A 3IALA 3VJRA 1Y3DE 2QRGA 2YVQA 3F1LA 1ZKMA 2VHVA 1S2LA 3KE9A 3KYCB 2GK7A 4U63A 1G6HA 1WNFA 1NF9A 1YDGA 3BF7A 3MMXA 2BM9A 5JSHA 2P2DA 1JVNA 3NIGB 4I1YA 2F8SA 2OCLA 4FGZA 2ASEA 3QE9Y 3E4CA 4QYIA 1EDEA 4UBKA 5IH3A 4C4PA 4YUVA 1WHSB 2AYXA 4M7OA 1E1DA 4DA7A 1IPHA 3L4BA 2OGSA 2GAFA 4YY3B 3IA2A 2J09A 2VTBA 1QM5A 4NSNA 2ZRCA 4YIKA 3GT7A 3ZQ4A 1QC5A 3GUCA 3HUUA 4WXPA 4AK9A 1Q0QA 3DJYA 5EE3A 3D8TA 2DUWA 4REQB 3AG6A 3JQDA 1XFAA 3AR2A 2PZLA 1PUJA 4HNRA 1HM5A 1IMJA 1FDUA 1GQYA 2BMFA 2WFZA 2CE2X 2CUTA 3IQEA 4OF4A 2XUOA 2PSHA 3QTLA 4UUNA 3IBCA 1R0XA 5IKPA 5KPDA 2QE7A 2D1QA 4BECA 2QQ0A 2PEYA 1MEOA 4DM7A 1Y3CE 2J4DA 4YXFA 1OV6A 5KNDD 2VS1A 1M0TA 1LC3A 4LOJA 3T7JA 1YQ9A 3C5HA 4DLPA 2KM1A 3LY8A 1O03A 1XYGA 2AN5A 1JSRA 3OEYA 3TH5A 3AYXB 5F2EA 1RZ3A 4XVHA 3EEQA 3EQ2A 3NGXA 1JG3A 1E7RA 3SR0A 5C1PA 2JF0A 1PS9A 3MPOA 3HZZA 2J1LA 1W35A 4JBNA 2IZ5A 2EW1A 2Y76A 3GX1A 2HDWA 3BC1A 2IYTA 3LLMA 3D02A 4LSWA 4PRKA 1A9OA 2DERA 5K6AA 4V2UA 1X74A 3ICCA 1JVSA 3PEFA 2P27A 4C4YA 4F5ZA 4JR0A 4F4FA 5T7BA 1K9VF 2H5IA 2QW1A 4PLGA 5AICA 5JE8A 2Z5VA 3S2YA 4AU1A 3O82A 1I7SB 3V4SA 1K7SN 1TW2A 1DC7A 4MW0A 2VG8A 3ZBPA 3ZH9B 4D79A 3U7GA 2ZSIA 4XVCA 2WVHA 3BZUA 1B8NA 1B1CA 3PUHA 1E9DA 3AFMA 1H2WA 4I99A 4BKOA 4JX9A 2X6TA 3LTEA 1K5PA 3MJVA 2W0SA 4AJHA 3HGTA 2X9LA 3M6MD 3QSYA 1XDSA 1Y7HA 4YUXA 1GFIA 2NPIA 4IMIB 3D4OA 1W88A 2OXEA 3AJ9A 1KJ8A 2YXBA 1BROA 4RF2A 5THKA 5CYOA 4QZVA 4NBSA 1FTYA 1II0A 3CGGA 4XX0A 2OQIA 4XE5A 2ESRA 2EEZA 2ZB3A 3KQVA 1KYYA 3R3YA 3VR5D 3OLCX 1JDTA 4D3DA 1HLFA 1YJQA 2JH3A 3KSAC 1CIJA 1EP9A 2YJ3A 3FNIA 3IUBA 1G6KA 1DBSA 5LOVB 4I08A 3UIEA 5D7NA 3NPAA 3W5CA 1UDAA 2EL7A 4U2FA 1FP2A 5I7FA 2TS1A 3W8RA 2ZU0C 4UCWA 3L4JA 3DDSA 3QWHA 1SKBA 4GH5A 1F06A 4CMEA 1XLTC 1XA0A 3I5UA 2WSIA 4NYJQ 4BWFB 4DQ0A 3F9IA 4EG6A 3QPVA 2CNDA 5TF4A 5KYUB 5HA5A 2H1IA 3H84A 2I6QA 5LM3A 1RXSA 2RB4A 1UP7A 4ETIA 1E4VA 1J7JA 2HLNA 1TW3A 3QH4A 1L7VC 1ZKDA 4KVFA 3HI4A 3OTHA 4TXHA 1WZNA 3CKYA 5G0VA 5HG0A 2NAFA 4CV0A 3OPYI 3OU7A 5B6PA 1UFQA 1WQ4A 3R7AA 3C39A 1DHRA 3JATB 3O8LA 1I14A 2QM8A 2VEDA 2ZG6A 3JARB 3NC0C 4IR7A 1YB1A 2PQ2A 4RMHA 5HIMA 4LGMA 2PBZA 2VHXA 3NPMA 3C3BA 3KEOA 1SBYA 5I01A 3FWYA 1FE8A 4R6WA 1X1BA 3KOWA 4UFOA 3IMCA 4BJ5A 3KUUA 1BDBA 1RWVA 3AF0A 2VHWA 1Q11A 2XHEA 2YHUA 3KX2A 3DNPA 4RSRA 3V7UA 1O6FA 1S9HA 2NTEA 3TW4A 2IZ1A 4GRIA 1DEOA 1X1EA 4RK4A 2P2GA 2O9JA 3FZNA 5JCPA 3IERA 3KLPX 1H0SA 3AV0B 4X93A 3RC3A 4AS1A 4ZZ3A 4LECA 2FX5A 3ER6A 4BO9A 2OHOA 3ZN2A 1E7QA 1QYXA 1RXVA 2ZCVA 4PHHA 2Y93A 3H9BA 2CBXA 2XOKA 4I4TA 4XAQA 4XGKA 2K2QB 1NMZA 1VMDA 2RAFA 2ISSD 2H2FA 4IUCS 2HQOA 3NT2A 4D92A 2ACVA 1MNQA 4KGVA 4MYTA 2XEDA 1N92A 3N9IA 3KUCA 1FMFA 5H16A 3A9RA 4C0SA 2X4DA 3WWDA 4QUDA 3L49A 3EZ9A 4N7BA 5CT8A 2F9LA 2FZEA 5IAJA 2D7JA 1VPLA 1YL7A 4BHTA 3GUVA 1JB9A 2H2DA 3PZBA 4HADA 5H3HA 3SR4A 4P4SA 2BGRA 5E2IA 1ZY2A 1ESMA 2ZETA 1GAEO 2EWMA 4CKXA 4DUYB 2O54A 1SUCA 2QX7A 1Y1RA 3C5CA 4LX0A 2X0NA 4P3NA 5SZHB 1GYQA 1SC4A 2OV8A 4RKEA 2FA9A 3DLTA 4RMIA 4F9FA 1L7EA 2AZXA 5D3MA 2RH8A 1OXTA 5E4FA 5I5GA 3WMRA 1XVLA 2QI9C 1ACJA 3AEUA 4KMOA 1KI9A 4UNQA 1S2NA 1NXTA 2QXYA 4TWZA 5H9VA 1CF2O 4KMRA 3GHHA 3NIBA 1B1AA 1Q21A 3S4YA 5LNK1 4RHCA 1DFHA 4EI2A 3ICWA 4G1MB 3KZOA 3DEIA 1QH8B 4EI7A 1L1QA 1Z7GA 1RWOA 5COAA 4JX8A 3BHNA 1FMJA 2HU5A 4MHSA 2Y1OA 4IIJF 5CA0B 1YULA 4PHTA 3CURA 5EIEA 4WPGA 1TJYA 3BCHA 2IU0A 3N2ZB 1XHEA 4DA6A 2R65A 4XXHA 2ZPTX 4DLAA 2YIVX 2F64A 4DAOA 1X1DA 4RPLA 4DAEA 1XUOA 5ADWA 1OU0A 4NFYA 1WEKA 1E0DA 3DDCA 5DGDA 4R7GA 4DQVA 4E2WA 5TQ0B 4C0XA 1F0NA 1USGA 3X1JA 5HOEA 1BW9B 5C4IA 4W63A 2XCTB 2I4TA 3QXCA 2QTWB 1XTUA 3AEXA 4PZDA 4BO5A 1T2FA 3C8HA 4LC0A 3GFSA 1PDVA 3OZVA 1MKYA 2O06A 4LSGA 3A6HA 4E5MA 4GKJB 2VBIA 1U0EA 3OZEA 2HPAA 4KE6A 5KYWA 1YC5A 3AEKB 2C8VA 2FN4A 1Y82A 3DVAA 3OZFA 3F6YA 1ZH4A 2UXDB 1FBNA 1N5RA 1PSWA 2MSCB 4LDQA 1KGDA 3F97A 3DT6A 5GJVC 4CYMA 1B6RA 3C8ZA 4MB0A 1QH9A 1VL8A 1DSSG 1VE9A 2ZIXA 3EUAA 4D8WA 4FXOA 1T5LA 7ADHA 4WNAA 1UAAA 3IR7A 3VZBA 1M2OB 4U5XA 1L5QA 2B1QA 5FWAA 2IHNA 1QR6A 2C9CA 3ZDBA 2WG2A 4R9VA 2B4RO 4KQGA 3AJRA 4B80A 1XG5A 5JEEA 3I9V6 4U02A 2YVAA 2V8OA 1SXGA 1GQSA 1X8XA 3UF0A 2I8AA 4YWJA 1EP3B 1SMKA 4IXMA 3GD5A 2AQ8A 2QRKA 3B3FA 5FUBA 1EE9A 1FSFA 3K9WA 4BV8A 3HKEA 4EPTA 2EW2A 3T5CA 4X41A 1ODFA 4Y0NA 3GRZA 3PKIA 1X7YB 4MVYA 4RD1A 1JHPA 1DX6A 5JC1A 2FEOA 5KQLA 2CVHA 5EJMA 2VNHA 1D2NA 5BPHA 1ZUHA 2A78A 1Y4ZA 3ZU2A 2YJ5A 2WG0A 3RS2A 1NJGA 2NXEA 4HRYA 1USVA 4F2HA 5ISMA 3ZXXA 1DBIA 2B30A 1Q0SA 3QU2A 3NHWA 4FC7A 2ZSEA 4HNSA 5BRJA 3SAJA 4YAJA 1SIWA 4QUEA 4ZQFA 4F8EA 1IY1A 1QE0A 1MJNA 1TVCA 2AJTA 1CDEA 3EXAA 3KKEA 3KV1A 3OHMA 4FYWA 5FFMA 3ORSA 1SKYE 3P27A 4FKBA 2R25B 4G8BA 4ZHSA 2ZYAA 4DA0A 1BH2A 3AFOA 1H94A 3MWGA 1PR4A 3WLAA 1LA2A 4IOJA 2WVGA 4NICA 4GI5A 2GBLA 1AM4D 3BMNB 3JW8A 2VQ3A 4ZO9A 5FADA 1WV1A 4BO0A 3BJMA 4WZBB 1MB2A 1WTAA 3R6DA 5DHFA 5EHGA 5IKOA 4I3HA 3D3QA 3MB8A 3FCAA 2OPBA 2XNHA 1RQXA 2VYND 3WOVA 2YXEA 4FINA 3DC2A 2PGIA 2HWWA 3DV9A 4PZCA 1LX6A 1P4AA 3R3ZA 1NBEA 3WWEA 4GGMX 2E82A 2N42A 2PFSA 2XXJA 2FE1A 4IGIA 2QTMA 3UAVA 1QZ3A 5AKJA 4JXJA 4ZQEA 3RBVA 4FSDA 3QITA 4J4TA 3Q2OA 2FU5C 3FH0A 2WFLB 5M04A 4MVJF 2SCUB 2H65A 3E9QA 3DQZA 4IIGA 3ICPA 2YHIB 2A57A 3DHYA 2RDMA 3DZBA 4ANFA 2E7ZA 2OBBA 4R8SA 4G4SP 2BTOA 4HLUA 4BZWA 4DXHA 5JNRA 2R1TB 1GFZA 1NP7A 1CS0A 2O6HA 1O4VA 1XD2B 1P5FA 1UBOS 1BCRA 1T9GR 3FWPA 3HJRA 2UU9B 1MAVA 2R7MA 4O8ZA 4EITA 1NQXA 1Z26A 4RZHA 4EHDA 2GXAA 2EYUA 3O7MA 4DQDA 2Q5CA 4N6GA 3FNGA 4QDZA 3CTPA 3IV6A 4EJMA 3JTMA 3I4FA 5FJIA 1TZBA 3T3PB 3DBIA 2Y1GA 1K89A 4PWZA 5GOZA 3WIDA 1VXRA 1G42A 1MXHA 1QYRA 4NFLA 1PSDA 3C5EA 2AQHA 1T1EA 3WI7A 4YHBA 1ZK0A 4ZEMA 3O8QB 1IIRA 4OVKA 2JHPA 4ZKDA 1NOJA 1K5DA 1NV9A 1BHQ1 3HYLA 1WEHA 3P45A 1H8HA 1BXRA 3PYMA 5AVXA 3OO1A 4I1RA 4XSVA 1QTRA 3P9QA 1FOEB 4MVJE 1QK4A 1G17A 2GTPA 1GT6A 1Z33A 2H1SA 1IULA 4FFBA 5T3UA 3QENA 4H6XA 5J63A 3EOBI 3RRXA 1NVGA 1Y6GA 4CTMA 1VYUA 4EHIA 5C1DA 5HVNA 3SQXA 1DUIA 2WHQA 1EESA 1DLIA 3S8YA 4AKIA 3FZGA 1VRCA 4X1OA 5CEEA 2EX0A 2BRUC 3QWAA 2PUFA 4RTNA 3EYWA 4PANA 5GONB 5GV7A 4X90A 2JKVA 3T99A 4EUFA 4YUYA 5JG7A 4QOSA 1JR3E 1DBQA 3KUKA 1FUIA 4IDQA 4QWMA 3H5AA 3PWTA 4YRFA 4N8DA 2Q3BA 1WPRA 3A3PA 3BTUA 4ETWA 5JI2E 3HDJA 3LBIA 3MYRA 2A92A 3NUZA 5EGNA 1LV8A 2X5NA 1P9OA 1NRJB 1KKLA 2FKNA 4G01B 3CISA 1NONA 3RARA 2DULA 4I14A 3C98A 4HB3A 4Q4DA 1U1FA 3VNSA 1UFOA 2C57A 2D5IA 4GSKA 4OAPA 4BFUA 1SVMA 4YJ2A 1NW7A 2M1ZA 2PH3A 2JBAB 3WB1A 5KSYA 3D7SA 2FDRA 4ONEA 1IQRA 4LOLA 5B7NA 1RYYA 3QUAA 5IU6A 3QFFA 2DFNA 1FUUA 2GK4A 1ECGA 2OK7A 1M2WA 4ZVNA 3QJYA 1Q3TA 1NYRA 2Q49A 2ZDQA 2BGLA 3D6TB 3DBRA 4J0FA 2C1XA 1DQSA 3ELWA 4PZYA 2GARA 4FZ5A 1XP5A 3NIWA 2BKAA 3I73A 3V8BA 4OHZA 4QJ3A 5BWBA 4IRMA 4W5RA 1E3EA 1ABFA 4HVTA 2IDJA 1U04A 3OEED 3S2IA 4BP1A 2XZTA 4BZPA 3UMJA 1L6IA 1IB6A 1N1DA 4JBWA 4ZOLF 1O9BA 2PDAA 2H1FA 4AO8A 3I53A 4IIEA 1YUBA 4W8HA 3TEFA 2IY8A 1PSZA 2EFDB 2OZPA 3IE2A 2IRWA 4IVNA 4RF3A 5FR2A 1C3OB 1FU7A 3L8ZA 3R77A 2PYDA 4FDLA 3ESRA 4KIJA 4LDRA 4MW4A 4DLTA 4NXMB 2GA9A 2IPLA 2QZ9A 3DUFB 4YJFB 2OEPA 1BXGB 5D5HA 1XZLA 4OQPA 1KYVA 1GAWA 1QORA 3K96A 4K40A 2NV2B 2OY0A 3IOYA 2KSQA 1R16A 2OGUA 4GKAA 4Z2YA 3I4LA 2LP4Y 1ZLYA 4OJKA 5TMBA 4NMHA 1J0XO 2Y6UA 5EY5B 1NVFA 1H2AS 2O2GA 4PIPA 1PNTA 3EDOA 1OJ7A 2R66A 3IXMA 4W5HA 2EJWA 1WUHS 5DF1A 4LQCA 3EK2A 1C0LA 2X8LA 5FOWA 4ARSA 1XEXB 2ONKA 1M5TA 1EE1A 2ZVQX 3IBTA 3LMKA 4Q3NA 3ZXIA 1BMFA 1DAIA 5IEJA 1QPGA 2GD6A 3I05A 4MP6A 3A11A 2MDTA 1YHNA 4URZR 3IUNA 5DE3A 4X44A 4E1AA 4XGIA 2BSQA 4YV2A 1TMYA 3HGMA 3WL7A 1XNJA 1KY4A 1WXEA 4FVTA 1T0PA 1KJNA 1RXCA 3ZY2A 1EH5A 2B2CA 4OYHA 2QTHA 5ALJA 2Q4EA 2W5UA 1Z6YA 4MI3A 2ODBA 1JFRA 5CNKA 2XA2A 2GEVA 2I3GA 4OATA 4P2BA 3RU2A 5B2FA 1SCUA 1JR6A 3AW8A 3DWEX 4IZ6A 1JIVA 4L51A 1I7DA 4B6PA 1Z25A 2H3HA 5EE0A 3CWCA 2XDQB 3HYTA 5EFOA 4EARA 1O94A 1U9IA 2GN0A 3O2JA 4JZKA 5B7GA 1DCMA 2NVUA 4EPRA 3NAQA 3ZY5A 2VHEA 3F7MA 3JQRA 2QPAA 1X15A 4FEAA 3TR0A 5HZMA 5KMGA 2V1UA 5I4BA 5MF6A 2RK4A 2X2FA 4DILA 2QN8A 2QN1A 4MS3B 4F1WA 1CDDA 5H81A 1BN7A 1OZGA 1Q91A 1G7SA 1BMTA 3H2BA 4NBNA 3FHOA 1OA0A 2WJZB 5FBQB 4P54A 3RW9A 4CQMD 3U4DA 4PX9A 1WCYA 4ZO4A 1DKNA 1EG2A 2AFHE 1XVAA 3HM2A 3EGWA 2EJVA 3OCZA 2NPFA 2J48A 1IPEA 3IHKA 5JECA 2RGGA 1IDOA 3Q8LA 2YZKA 1AKRA 4HAXA 4NOKA 4QE3A 5CX1A 2BKVA 3D5TA 3OM8A 3TRKA 3MJ4A 1G5RA 5FFFA 5HQJA 4EG4A 3SKYA 1A1VA 3GZNB 3O74A 3W5DA 4J4HA 1AB6A 5DRYA 3OUUA 3C43A 3H0KA 3ZHOA 5ER6A 2RHLA 1XRRA 1J9ZA 3F71A 1MOQA 2CXPA 3OEHA 3WRXA 3KZKA 4HP8A 4XWGA 3HJHA 4GU5A 4QEKA 5ANRB 2RIRA 3E48A 4GDFA 2IY7A 1BWSA 1P5JA 1LS1A 1UXKA 3BMCB 1A5TA 4P8RA 3A3YA 3KQTA 2YOHA 3P19A 1E94E 4EX7A 3WWCA 4ZCMA 2BM0A 2UDPA 1UKVY 3Q3CA 1QYWA 1YA4A 4MLCA 5KSOA 2PKQP 3BEDA 4BX9A 1F8FA 3X3HA 1AH2A 3LZ6A 3O4RA 4CM8A 1G5TA 1V7ZA 1FFDA 4ZRMA 3E03A 5I3CA 3FMOB 2YWRA 1RLUA 3T1VA 3KXLA 3R6TA 4ZVPA 4AZVA 3W3AD 4D81A 1EFUA 2C2KA 4D9KA 3H0EA 4QO8A 3UBTA 3DTYA 2ZJ8A 4ZT2A 3PQ8A 2AIRA 3QVLA 3WBKA 5HM8A 1IZ7A 6REQA 3BILA 3C2QA 3OQPA 1ZEMA 3DB2A 1I4EB 2W11A 4CF6A 2WTEA 3C6QA 1JLHA 1RE0A 5HKLA 3W6ZA 4JJEA 4DMFA 3EZ6A 4JBIA 3E5MA 2VTKA 4WGGA 3BZWA 4KQFA 2FMIA 2V0NA 2FWIA 3UJNA 2AC7A 4PLWA 4ZRNA 5FOXA 1CR6A 1M1XB 3GNLA 4KWIA 5MN5A 1QO9A 4TZTA 1P9WA 3PQ6A 4I9HA 4NZMA 4NIMA 4BVGA 5C37A 1Z2DA 2W2TA 5TT0A 1RYMA 1PZHA 3O8OA 4R3NA 4W8OA 1KZ1A 4TSFA 4DT1A 4JKIA 4GKKB 2AEFA 2WMOB 1QUFA 2DQKA 2M6LA 4O2RA 3QYFA 1EKXA 4Q19A 3DOHA 3UKOA 3FJYA 3A9WA 3I2KA 2FPXA 1M1NB 3LD9A 2BGIA 4J2HA 4LCJA 4URVR 3NBFA 4G1FA 1T6NA 4KO4S 4UMDA 4EPYA 4JI8B 4OM8A 4QJIA 4AZ3B 3Q11A 1X1AA 1SXIA 4MV3A 1AX9A 4MV9A 4XX1A 5CVEA 4CEHB 4GXNA 2ZSUA 4EHBA 3AOEA 3JQ8B 5KYYA 1LVHA 5J58A 2BJWA 3ER9A 1G5PA 3PVCA 4QRIA 3RUHA 2C4HA 5B7PA 1EFLA 5AO9A 1K6JA 2G63A 3HYRA 3TSOA 2UVDA 1DPFA 2XMDA 4O02B 4OI0A 2DLNA 1R5OA 1CR0A 1EB8A 2R2GA 5F77A 4AJOA 4HQ6A 4C7JA 1MBZA 1ZU4A 3JCZA 4ALMA 3HZOA 3FZYA 2ZJ1A 2A0YA 5J4LA 2OT3B 3V4RA 1UBSB 1P4SA 2QMZA 1N5JA 1CZRA 2VAXA 4A7PA 1I0LA 1QHGA 5J4VA 5KTTA 4HYEA 2JVJA 2C03A 3A2KA 2AB0A 2AFIA 2A6PA 2DR3A 2NO5A 2XECA 4RFLA 4BN5A 4RQAA 1YS6A 1HT2E 3SLGA 3PS9A 3R9XB 2HFKA 4WBXC 4F3YA 1U0FA 2HX1A 4U7PB 2BP7A 3MTJA 3W9UA 5JAUA 4FWTA 3LQYA 5I3ZA 1C4XA 4B33A 1NI4B 3M6AA 4I5FA 3K2EA 4MYUA 2AUNA 4U7WA 4W6ZA 1GVHA 3HP7A 3LX6A 4EY4A 4OQYA 1W52X 4EVQA 1E96A 5ADUS 3AVQA 1AUPA 2XT9A 4XJXA 2IU6A 1TF7A 3PQEA 1KSHA 1KF0A 4D45A 4DC9A 3ROFA 5A4MS 1YCGA 5B1YA 1WZEA 1PJAA 1GDDA 5JCJA 5EKDA 3TD2A 1A95A 5K4GA 2I2CA 1HZZA 1JKJB 3FUVA 4JKOA 5IDWA 3SC4A 3P9ZA 5J5CA 4ENWA 5D51S 3NNSA 1UC4B 4HDSA 4PXYA 5CIYA 3LXUX 2V1XA 3OOWA 4KCGA 5DN9A 4XRRA 2DHCA 5JNTA 2D0DA 4V1CB 5IS2A 3TZQA 3B7WA 1BKYA 5FNVA 3S40A 3VU9A 1UAYA 4YVFA 5CDTA 5L4LA 4R51A 1ORDA 4O3FA 1GZDA 4YV7A 4ZT3A 4OHFA 5BR8B 1V6AA 2DFDA 2X7JA 2YWCA 3T5DA 2UKDA 4F8JA 1CRWG 4ZCLA 1U7TA 1GQFA 5M2QA 5LXTB 2G76A 1IHDA 4N9QA 4AQYB 4MP8A 5T5QA 4PR3A 2PXAA 3ZJ5A 3KQOA 4H7FA 3IDFA 2VSXA 2I2AA 4JY7A 2V7UA 5KJFA 3RFVA 4XUDA 3KLMX 2QSUA 3PDUA 3EGCA 4G2TA 5EC8A 3UWSA 4CL3A 1XHLA 5LUBA 3TW0A 3BKXA 1KAQA 1ZINA 2BBOA 2I29A 1NIPA 4CDNA 1VG8A 2JAXA 2XVXA 3G9QA 4UUQA 1B15A 3RS7A 1B8UA 1NU8A 1I4WA 4EFLA 1USKA 3DH0A 4PFJA 1HX7A 4QBKA 4GI2A 5IM4F 5HKBA 3F9RA 3QG5A 4OH7A 4U8GA 5EWJB 5JYDA 4LRYA 2X40A 3SJUA 2ZYWX 3EGXB 4LVCA 1V39A 4ZC1A 4RVNA 5JSZB 2Q2VA 3IE0A 1N7GA 4N9WA 2R1ZA 4LF5B 4YQEA 2I4RA 2ZE5A 1UP6A 2ZJFA 3WR5A 5KWSA 1IH8A 2BSXA 4TZKA 4J0KA 3NHKA 2JGAA 3QUCA 3PFHA 4AT1A 3WKAA 2X0IA 2ZI4A 1Z62A 1EJ2A 3ANYB 3HMQA 3X1ZA 3RK1A 3REFA 2H5JA 3AJEA 5GIPE 5DNAA 2JIPA 3FRJA 3DZJA 1T13A 1A69A 1NVVQ 3UWMA 1IMOA 2KYRA 5BN5B 1XZBA 3KB2A 3NM4A 1IOVA 4EZBA 1NURA 2R5WA 4JITA 1CEQA 2DPYA 1TOAA 4RMJA 3K71B 1E8DA 1V4BA 2V3WA 3H9EO 4QWWA 5E6SB 5JD4A 1YI1A 4GSLA 4F4DA 3L07A 2FDXA 2PVSA 2CXQA 3EMKA 4KKVA 2GPBA 1OBHA 1DV2A 3ZWPA 4MA4A 4DSOA 2O1SA 1WBJB 1IOWA 1P3Y1 2CDAA 2GHIA 2H57A 4JUAA 4N0MA 4U2BA 5L3ZA 5C35A 2Q3EA 4O08A 5DLYA 5CA1B 5KHAA 4OHCA 4L78A 1I7QB 2AK2A 3IAM1 3IQGX 5HF5A 4FFOA 4I4CA 1CR2A 1AY0A 1RBYA 4J29A 1CUYA 1IHXA 5SYNA 1OC4A 3C3WA 1WDWB 5HKOA 1VI6A 2XUGA 5IT4A 5LQKA 2XUIA 4NNPA 4TMFA 1ZG3A 3G1UA 2JH9A 2LV8A 5CYPA 3CPSA 4DOMA 2DVMA 1CQIB 3EMDA 1O8BA 1JECA 4NDAA 4D8XA 5JY6A 1C30B 3HDHA 3QPWA 4YYEA 4HJXA 5KOJB 2PLAA 2QTGA 3HL0A 1ST2A 3DYBA 4LYEA 4BIIA 1A9XB 4DDUA 2ZSHA 3QHPA 5A4JA 7REQB 4W1RA 5JJKA 4EMSA 3HG7A 4Y2HA 3BM5A 1M6EX 3QVJA 2W4IA 3QU7A 3KOUA 3A1TA 5TPWB 3T7SA 1HEYA 3BH0A 4KR6A 3ABQB 3D0KA 1OYOA 1Z6QA 3RVMA 5JAQA 2ID7A 1L3IA 2FETA 2PQ6A 4E07A 1RAEA 3W2TA 3Q4GA 4QU9A 1NVKA 4UCQA 5AVYA 4BE7B 5BN4A 3L4KA 2IUFA 4TV9A 5KCMA 2QAIA 4MLDA 2RD2A 2XQIA 3N2KA 1FPQA 2VDOB 1QRSA 1Z7WA 2VJMA 3Q2IA 1U8EA 4OHBA 5L3QB 3F6RA 4OA5A 1ZIYA 4PS0A 5ELLA 3W06A 4P82A 1KJQA 4M0CA 1OAKA 1KVSA 3RUCA 3RAPR 1XVVA 5IT5A 3O8CA 1MCZA 1NATA 2VK1A 1Y8QB 4WOKA 1YE8A 2D4AA 3PFIA 3RTDA 4MTLA 4N4AA 1CJTC 2A0KA 1EWRA 4EDFA 3ZHCA 2QE7D 4Q15A 1ORWA 2WTBA 3EVGA 2DJ5A 3MT0A 3QPDA 4NP6A 3T7KA 1FFEA 4DHWA 1NX6A 1SKMA 4LDNA 1B6GA 3R4CA 3PI7A 3R24A 3C3PA 5E0KB 1ILWA 2R6CA 1TQDA 4Q3OA 4RVCA 1QYDA 5ALWA 4TPKA 1GCUA 1P7YA 2YJGA 3E3AA 3FAZA 4Y7CA 2ZUWA 2YZGA 2VLBA 2XKJE 3JZAA 3ESXA 2YWFA 5GM2A 3OU2A 3U1TA 1YJ5A 1PJ4A 3ZBTA 1YMUA 4S12A 4DCMA 5JAIA 2FFHA 2BHTA 1V2GA 3BH6A 4Q4LA 3RF7A 4BGDA 2V96A 1VECA 2Y1XA 3QI2A 1IWBB 2OG1A 2QOEA 2X1LA 1Z5GA 2YTZA 3PUIA 4JUFA 4I6EA 4DMMA 3DFMA 4BQSA 4Q7LA 1L7QA 2HIAA 2PZBA 3AP2A 1RJDA 4R81A 2GQ0A 2A5YB 4ER5A 2JHFA 4BN4A 2JI7A 3P71T 2C4MA 3N7TA 1JMKC 1L3BA 1XP8A 1YJ8A 4OYRA 4PS1A 5CVUA 1XNQB 1H8EA 4NNOA 3CONA 3QXGA 1A04A 4W9RA 4KXLA 2EZ9A 1M2HA 2YOFA 3OWXA 5ICEA 2X5OA 2XVMA 3GJTA 3KPVA 5FCDA 3UVEA 4CHTA 4EHNA 3KETA 3Q5EA 4FNAA 5EXPA 2R97A 1ESZA 4C0JA 4UC0A 2VXCA 4MDEA 4B6RA 1WUYA 2DBQA 4DIUA 4FYPA 5DNDA 2JZOA 1QPBA 1ZM3A 1E1QA 3JRNA 3KYDB 4M53A 4U0KA 1AD2A 4WNYA 5EP4A 3HK2A 5BQFA 4V1CI 2UYCA 3WP0A 3ASVA 3DLIA 3MQ4A 2CFOA 1TQHA 3DNFA 5ERGB 1ZL0A 4D9EA 3EIUA 1DHTA 4YBZA 3D4LA 4A1OA 2YRWA 2ENWA 3ISVA 3EEIA 3K0BA 1A7JA 4Z9BA 3ROKA 3H1FA 4CG0A 4QGSA 2R6GA 1VDZA 1NTRA 1P19A 5F9FA 1SUFA 1RBMA 4PIVA 3ZYCA 3ZVKA 3OX4A 4EIWA 5IXYA 2WZCA 1JJAA 4BATA 3KU4A 2AHOA 3U4QA 2RAPA 1KJZA 1DOHA 2BCGY 3EG9B 4IHQA 4LDZA 3BD6A 1IM5A 4BRZA 2O8BB 3GB9A 1HFJA 2TMYA 3RTGA 3NKLA 1NJ1A 3BMQA 5AJYA 5JZ9A 5BQXA 2MOKA 5IJ9A 3VO8A 4EKIA 1FDIA 4QDOA 3PRKE 4QUAA 3IV7A 3O75A 4Q00A 5CLQA 5KU1A 1V96A 4HL6A 4ARZA 4IFIA 2LXNA 3SX4A 1EFVA 4R01A 3G2JA 1MV5A 2XSZD 3IP3A 1KTVA 4ZHQA 1EX1A 2FXVA 3RHFA 1H6DA 1UIMA 4ZK6A 1NPYA 2OFFA 3GUZA 3ZE0B 3GUUA 4CM6A 1QQBA 5LYJF 2E2WA 3D4PA 1SU8A 4GPBA 1QGUB 3EFOB 4C76A 2VXBA 3N8DA 1XEFA 3WKCA 3EH1A 1B6SA 1SVKA 2YYZA 1B23P 3F46A 4M38A 5J5AA 3W9SA 2GBFA 3N59A 3EMBA 1XO1A 3PFCA 1FQOA 1L5VA 1VHQA 2WB4A 3KBBA 5SY9A 3BIWA 2WHRA 3F3KA 1EUDB 3TAXA 1PV4A 3ELYA 3UXYA 1QKJA 2DHRA 1CUHA 2QL5A 2R4UA 1SUBA 1QHXA 2W6CX 5DO9A 5EIBD 3W4JA 1L2TA 2GNPA 5E3HA 5L53A 1MJFA 1TDJA 3A1SA 4GKVA 4J0HA 4YRTA 4C5BA 4RQUA 3X1YA 1Y6ZA 3FHLA 1CEXA 2EG5A 3R3SA 3LC1O 1BVYF 1R0ZA 4DNXA 5KSWB 2AOUB 4RTKA 3ORQA 1TE2A 2DUNA 1WP4A 3PFKA 1YB7A 5LZ7A 2G08A 1JPNA 2ZRMA 3LNTA 2M32A 5A4FS 1V7CA 2F90A 2Z6VA 4Y8VA 3QE0A 3NTVA 1RRFA 1KOFA 2HSDA 3M5PA 3UB4A 4ENPA 2WTMA 4J0GA 5KO2A 3DW3X 1ZRHA 4ZV7A 2ETXA 4UU1A 5SY6A 4FGSA 1YWGO 1QDLB 3IOMA 4NCKA 1KARA 3ONVA 4O63O 4PCUA 4ZV9A 5T8KC 1HGXA 4C5CA 4E3ZA 1LWOA 4C0WA 5DBIA 4MIKA 4L7QA 3PA6A 1XJ5A 4A2PA 1CYEA 1ZH2A 1J9EA 1PDWA 1TECE 1TYEB 2GEKA 4PYIA 1T36B 1OXXK 1BMDA 5FTJA 4RJ2A 1LX7A 2WOJA 1NR7A 3R3HA 1Z0FA 3IGFA 1A71A 5TQJA 4RZ3A 1HT3A 3B51X 3UBMA 3VO2A 2OENG 2ZWIA 4I66A 2H59A 3DHEA 1H6AA 2HUNA 3ESBA 2FX2A 3NTUA 4HHEA 1XKLA 4MVJM 3RAJA 2HCFA 1A9RA 5FYQA 4P9NA 1Z4OA 5JISA 4UUAA 4K6KA 2GVZC 1BHO1 1ULUA 1IN7A 3DMRA 1PEDA 1X3SA 5AW8A 1U28A 3K72B 2AI3A 2IGTA 3KKZA 4LWOA 5J43A 10MHA 3DA8A 3ZHUA 1NAHA 4D56A 1VL1A 1JDPA 3RJ5A 1R9JA 2H85A 1Y33E 3PNLA 4QBHA 4TYPA 4A0RA 2OV2A 1RYBA 3MUNA 5CBPA 2V5VA 5LD2C 4DV0B 1EIWA 3EC2A 1RSZA 3FPKA 4WADA 4YASA 4QREA 4C4OA 1N7JA 2Q4OA 1D09A 3P9RA 3UZUA 3FDIA 3C14C 5GJCA 2C2HA 4MULA 1K7CA 2R8YA 2QAGA 4O4IA 2RC6A <