2V7EA

Crystal structure of coactivator-associated arginine methyltransferase 1 (carm1), unliganded
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
322
structure length
322
Chain Sequence
GYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into Histone Code Syntax from Structural and Biochemical Studies of Carm1 Methyltransferase
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords HISTONE-ARGININE METHYLTRANSFERASE CARM1
total genus 94
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 2v7eA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2v7eA01
2ZCJA 5DTRA 2CWWA 2WA2A 4HRAA 5C1IA 1NKVA 3M6VA 3MTEA 4WVLA 1BC5A 3BZBA 3KPYA 4YUYA 5GWXA 5DX0A 3CGGA 2ZZKA 4KVZA 3HNRA 5GM1A 4RTPA 1AV6A 2AVDA 5K0BA 3D2LA 4BLUA 3VC1A 2ZSUA 1DL5A 1Q0SA 1NE2A 2PXXA 3M33A 4FSXA 4HTFA 5T64A 3BWYA 3EGVA 5IKMA 1RJDA 4RTSA 4FR0A 2YQZA 3KR2A 4WXHA 3HCCA 4YV2A 5M5BA 2ZIEA 3ELYA 1EAMA 2QRVB 3C0KA 3NTVA 5MHTA 4K6MA 2AOTA 4BP1A 4E2YA 3FPJA 3FUXA 3G8BA 4GC5A 2ZBQA 1FBNA 3BWMA 3DXXA 3TKAA 1YZ3A 1RI5A 2QE6A 2F8LA 4ER0A 3TKYA 4HGYA 5DTMA 2QYOA 1D2HA 1KPHA 3GJYA 4PNEA 1WG8A 1P91A 4C04A 2EG5A 3FZGA 2I9KA 1G55A 2OKCA 4HH4A 3A7DA 2HTEA 2P8JA 4PGGA 3TM4A 2GLUA 3GWZA 1L3CA 3R24A 3EEOA 1JG1A 2XVAA 1XDUA 1YFJA 4F86A 4PYJA 1FP2A 4AZWA 4AX8A 4CTKA 2ORED 2AS0A 1AQIA 5JUWA 5EZQA 1VPTA 2PSSA 3GNLA 2Z6QA 5ICGA 8MHTA 4FT4A 4PCLA 2PX4A 4HSGA 3DULA 2C7OA 4E2ZA 4RTNA 2IBTA 1L9KA 4FP9A 3DP7A 5EIFA 1BOOA 4E32A 5EQJB 3EVCA 2N47A 2O0LA 4QTUB 2P7IA 1ZHFA 3PFHA 2G72A 3EPPA 4C06A 3KQQA 4OBWA 3CVOA 4AZTA 4DMGA 3CBGA 3FTFA 4OX9Y 1KXZA 4E2WA 3GIWA 5DM2A 2ZZNA 4R6XA 4GOLD 3OFKA 3NDIA 4FS8A 2XBMA 2GB4A 3FTDA 3JWGA 4QDKA 1DCTA 3WSTA 1I4WA 4IV0A 1SQFA 3BXOA 3OZTA 4Y30A 4C03A 4KDRA 1P1BA 3G88A 1ORIA 3E23A 3PX2A 4IWNA 2OYRA 3U81A 4R6WA 3UJAA 4ATNA 4OBXA 4ER3A 1ZKDA 5BW5A 2KW5A 4HGZA 3FUUA 4E33A 2AZTA 2OZVA 1X1CA 3HCFA 2QRVA 5EMKA 3G2QA 2Q41A 5K0CA 1RJGA 4LG1A 1ZG3A 3HCEA 3KR1A 3P8ZA 1AF7A 5GINE 5DLYA 3KR9A 4RYLA 5CIYA 4E30A 1MJFA 2YUIA 4RTKA 5EKUA 3FTCA 4L7VA 2ZZMA 1JG4A 2IDJA 4PYQA 2IH4A 3PFGA 1XDZA 4F85A 4CKCA 3JWHA 4ZTBA 2ZULA 3LPMA 3AXSA 5E9JA 5K0FA 3OFJA 3ER9A 5KQSA 4QVKA 2VDUE 2PGXA 4A6DA 4RWZA 1YUBA 5F2KA 2P40A 2P3OA 3LKDA 5FQNA 2BR3A 3TM5A 4DQ0A 5E9WA 3HCAA 3LBYA 5ICEA 3B3FA 3KQPA 3Q7EA 2FRXA 1R8YA 3MCZA 4GBED 3IEIA 3TR6A 3S68A 3UJ7A 3KR0A 4DM3A 1N2XA 5GIPE 5EZSA 5DX8A 3FRIA 2JH9A 3EVBA 4JXJA 2NNWB 4GC9A 3ELDA 4RSRA 4RV9A 3TPZA 5C0OE 3P2IA 2PY6A 1WZNA 2OBFA 3FUTA 3NW9A 5ERGB 2O06A 2XYQA 3G2PA 5FUBA 3GO4A 5K03A 3KQOA 3HA5A 2IIPA 1OR8A 1JSZA 3RODA 3MB5A 3LCVB 5LR6A 1KR5A 2IP2A 3KPUA 2DULA 3EVAA 4PYMA 1T43A 2AOWA 3FRHA 4PIPA 4P7KA 1JTFA 5HIIA 3TLJA 4BLWA 5ICCA 3RW9A 1X19A 3DH0A 5DRTA 3M4XA 3LL7A 5EMJA 1D2CA 5EG5A 4E31A 1VIDA 3A7EA 4PCAA 2Y1XA 2AVNA 2P1DA 2BH2A 4A6EA 4YUWA 1M6EX 4U7PB 3P2EA 3TQSA 2FCAA 4KIFA 2JH8A 3AXTA 1Y8CA 2ZIGA 2YXDA 1RJEA 5DRYA 3VSEA 5CD1A 1NV8A 2E5WA 3EEYA 2ONYA 3M6WA 3DLIA 4V0QA 3AJDA 4GOMD 3V8VA 2HR1A 2NP6A 1M0EA 3DOUA 3PB3A 2B3TA 3LGAA 5H02A 2A14A 1N7IA 3CJRA 3K6RA 5KYGA 5LSAA 2B9EA 5F2NA 5CM2Z 4PYIA 3EMDA 4QVGA 5FA5A 2VS1A 4YMHA 1XCLA 5DXJA 3EGEA 3EVZA 3LECA 3HVHA 4GF5A 5GOZA 3SX0A 3I64A 5K0GA 4LWOA 2NXCA 3CJQA 3H2BA 2CMGA 1JQ3A 3FYCA 4CWAA 4H0NA 2JHPA 3KPVA 4DF3A 2IH2A 1O9GA 3BKWA 3P71T 4UOEA 5E9QA 5FWDA 4GOND 1YZHA 5DM4A 5EKXA 3I58A 4G56A 2C7PA 1G38A 1TPYA 3G7UA 1JSXA 2YX1A 3HVKA 3KPWA 3LKZA 1NT2A 3SSOA 9MHTA 3I9FA 4P7FA 3F4KA 4KW7A 4KWCA 2BR5A 1TW3A 2BZGA 5HIJA 1UWVA 3TRKA 3NMUF 4EK9A 4V0RA 2V74B 1JTEA 3FTEA 2YXEA 3IV6A 2PXAA 5E1OA 2O07A 1NW5A 3RIEA 4AZVA 3KQSA 3ME5A 2IPXA 3ID6C 3OU2A 4RTRA 3G5TA 1XDSA 4EQZA 5DX1A 1H1DA 3LX6A 3FUWA 3NWBA 3EVEA 2OB2A 1KYWA 2AOXA 2IFTA 4M7RA 5FHQA 1Z3CA 4R05A 5HOQA 3ANXA 5GIOE 3KQMA 1KYZA 2PWYA 4QQNA 5EIWA 5FA8A 3MGGA 3DTNA 5FWAA 1VQ1A 3FYDA 1JR4A 1O54A 1R00A 4R8RA 4RTMA 1NW8A 3EVDA 1JG2A 2B78A 3G89A 4CKBA 2NYUA 2ZWVA 4XUEA 2P7HA 1KPGA 4EKIA 2AR0A 3ERCA 5B1SA 5K09A 4QTTB 3G5LA 5HFJA 4QPPA 1BHJA 3G2MA 2PBFA 5BP7A 4YV0A 3SMQA 3UA3A 1G8SA 3X0DA 2FK7A 5EMMA 1RI2A 5EGSA 2WK1A 3CC8A 1WS6A 3ORHA 5P8WA 3O4FA 1SVUA 3UWPA 4PGHA 1IXKA 5E1DA 5HEKA 3UBTA 1FJXA 2ZW9A 4MIKA 5D1HA 5EHIA 4PONA 3JWIA 1G6Q1 3A25A 4RTLA 2UYQA 3KU1A 4NECA 3C6KA 2PJDA 3LCUA 5E2BA 4CKEA 4BY9E 2VDWA 5DM1A 2JJQA 3TFWA 5FHRA 4M36A 3SSMA 1FPQA 2G8NA 3FPGA 2AN3A 3HM2A 3M70A 3ER8A 2GPYA 3NJRA 1D2GA 3HCBA 4X63A 5E2AA 1UIRA 1VP3A 1WXWA 4EVIA 2FPOA 5E1MA 5KS2A 1PRYA 1QANA 3PS9A 1I1NA 3DUWA 5E1BA 4GQBA 5D1NA 5G02A 2FK8A 3UFBA 2CKDA 4ER7A 5CCXA 4RVHA 5HIKA 5DT2A 1P39A 2Y1WA 1X1BA 2OO3A 1SG9A 2P3QA 3B7PA 3MCTA 5HIMA 4RTQA 2EFJA 5CVJA 2ZVJA 3P97A 5K05A 2O05A 4DZRA 2LD4A 5GP1A 1G60A 2IDKA 1HMYA 2ZFUA 4C05A 3DXZA 4C4AA 3HA7A 3CJTA 1VE3A 4XUCA 4O29A 5CVDA 3NWEA 2HWKA 5CVUA 2FYTA 2B25A 3DMHA 3K0BA 1L1EA 2PX2A 3KQYA 3FPEA 3M6UA 3P9IA 3GDHA 3OCJA 3OPNA 3Q87B 2GA9A 4OA8A 4ER5A 3MHTA 7MHTA 2ZLBA 5DSXA 1ZQ9A 5EC8A 1VL5A 2ONZA 1X1AA 1JQEA 3I53A 3AY0A 1AQJA 4GOOD 3O31A 1NW6A 3EMBA 5LQNA 5IH3A 1XXLA 3HA3A 2HV9A 3ELUA 2HMYB 3IHTA 4XCXA 4YV1A 2IBSA 5EEGA 3GXOA 1KPIA 4P7GA 3NDJA 3UJ6A 5DPMA 3UJ9A 1L3BA 5K0JA 4X1OA 3EVGA 3FPHA 3KQWA 2XYRA 5EMLA 3BGDA 3UZUA 2PT9A 4FSDA 2IH5A 4Y2HA 1R74A 3OZSA 4PIMA 2NP7A 4Z2YA 5DWQA 3HEMA 1XJ5A 2ADMA 4RTOA 3BT7A 3KQTA 2PWPA 4QPNA 5LQRA 2OB1A 1SUSA 5FQOA 4OA5A 3IYLW 3UJBA 1EJ0A 2JHAA 3LDFA 2QY6A 4BLVA 2BR4A 4MQ4A 4PWYA 4AUKA 5E8JA 4FT2A 3EGIA 4PYLA 1XCJA 2OY0A 3O7WA 4KDCA 3HP7A 3UJCA 3PTAA 2EX4A 3R9XB 3P2KA 3T7SA 3KHKA 1RI3A 3E8SA 3BKXA 1SKMA 2VDVE 3OZRA 3GRUA 2EJTA 2EJUA 2R6ZA 2AOTB 2XVMA 4PYOA 2CMHA 1O9HA 4LWPA 4AZSA 2DPMA 3VYWA 1R18A 1EQAA 4M37A 3GCZA 5HZMA 2P35A 5BXYA 1VP9A 5EOVA 10MHA 2UZ4A 3LCCA 2NXJA 5U4XA 3R6TA 4BP3A 1NV9A 3NVMB 5CVEA 3B89A 4X61A 4YUVA 3SR4A 3P9NA 5LQJA 1YB2A 1JQDA 3KQVA 4DCMA 1MHTA 4EMSA 5LQAA 3DMGA 1RI4A 3BGVA 5K0NA 1ZGJA 4HG2A 4GUAA 4MHTA 5K0EA 2PX5A 1XVAA 3MERA 3QOXA 5DTQA 3UA4A 5ICFA 2AOVA 3M6XA 2P41A 4ISCA 4RX1A 3B5IA 1HNNA 2C7RA 5LQKA 4QQKA 5DSTA 2JHCA 2PVCA 4HTFB 2ESRA 5DXAA 3GRVA 5LQUA 1M6YA 2PT6A 3MAGA 2PXCA 3OE5A 2YTZA 3BGIA 1Q0TA 1ORHA 4GEKA 3FUVA 4RVGA 1R8XA 1WY7A 1QAOA 2PKWA 3PLAE 2IGTA 4B17A 4PINA 1B42A 2GAFA 3B3JA 1NBIA 2CL5A 4X41A 2ZIFA 2OXTA 5HILA 4E70A 4M38A 4C08A 2VP3A 1EG2A 2AN5A 4HC4A 4XUDA 1RI1A 1IM8A 3GRYA 2GH1A 3C3YA 4RTJA 3P9CA 1P1CA 3E7PA 3FPFA 4MWZA 4DCGA 1U2ZA 2G71A 1WXXA 4C07A 4RVDA 5T67A 3GGDA 1N7JA 2OPBA 3BUSA 4QDJA 3T7RA 5KQRA 2Z6UA 2V7EA 3TOSA 5CCBA 4LECA 1UFKA 1BKYA 2HNKA 2I62A 3T7TA 1ZGAA 1QAMA 3E05A 2NXNA 1QYRA 2O57A 1INLA 5EPEA 5C9ZA 2XYVA 1F38A 2Z6AA 5K8VA 1I9GA 2AOUB 3CCFA 4R8SA 2PLWA 1R6AA 2PX8A 5JR3A 3NVKI 3V97A 3AWIA 3SSNA 2UYOA 3BWBA 4CTJA 4CXMA 2ZBRA 3PX3A 5F2OA 3A4TA 4IV8A 3R0QA 2NXEA 2AOUA 4P7JA 3PVCA 2R3SA 3DMFA 2UYCA 5FTWA 3KPJA 4EKGA 3HCDA 3DXYA 4KRGA 1FP1D 3A26A 1NBHA 3HVJA 4PYKA 2H1RA 1VBFA 5GM2A 1V39A 1VLMA 3PT9A 3GRRA 4FZVA 4OQEA 3GU3A 1TW2A 2G1PA 4YUZA 2AN4A 2I6GA 4IKPA 3ELWA 3JWJA 1G8AA 4PYNA 1F3LA 5DM0A 3T0IA 2YR0A 2YXLA 3BWCA 5CVVA 1X1DA 3LHDA 4MTLA 5EEHA 3SXJA 1KIAA 3LDGA 2BM8A 5FCDA 3G8AA 5K01A 3TMAA 4ER6A 1EJ6A 5EVJA 4E2XA 1NW3A 3DR5A 3LBFA 4F84A 1YFLA 3KKZA 3OU6A 1JG3A 2P3LA 1PJZA 3OE4A 2B2CA 3QOWA 2ZTHA 4YUXA 2G70A 3A27A 5CUQA 1QAQA 3SVZA 1QZZA 5EHGA 1L3IA 3OU7A 2I7CA 4OQDA 2QM3A 4FGZA 1XTPA 1RJFA 3P9KA 2PV0A 2JG3A 3B3GA 5E8RA 3DLCA 1KP9A 1NW7A 3GRZA 3LSTA 5T6BA 3SM3A 3THSA 4DKJA 2C7QA 1EIZA 4DA4A 5FULA 3G2OA 2K4MA 3L8DA 3QV2A 5KVAA 3EVFA 4RVFA 5FADA 4POOA 2VZ9A 2H11A 4KIGA 2FHPA 1SUIA 3C3PA 5K0LA 3VC2A 3LDUA 2YVLA 3HTXA 3THRA 1YF3A 5BW4A 1DUSA 4X60A 2ERCA 4U7TB 2GS9A 3REOA 3HVIA 3I5UA 4P58A 2ZWAA 2ZBPA 2WA1A 3UJ8A 4YMGA 3R3HA 5LQCA 3MTIA 3C6MA 3UJDA 2H00A 2BM9A 2UYHA 1SQGA 1IY9A 3MQ2A 3SGLA 1KHHA 3CKKA
chains in the Genus database with same CATH superfamily
4K46A 4OTZA 1B8VA 2GZAA 2OSBA 1BHQ1 4ZAFA 1H4QA 3OIVA 4CQNA 1DCMA 3AR9A 3GJ7A 1T2VA 4HPXB 1DPFA 2MOKA 3NHMA 4JDUA 4KBGA 4BB6A 4B3FX 5DX0A 4URVR 4FI3F 3HNRA 5G2OA 4PO1A 2PVPA 5IK2D 5CFQA 1O94C 4F1JA 2DERA 4KE9A 1NN0A 4ZYTA 4ZYVA 4MCHA 5LP1A 3ADOA 1KFBB 4N0DA 4E5VA 1PJCA 2WUFA 1TKBA 5IUJC 3QF7A 5AJTA 5JYEA 1CJSA 1EAMA 1HFEL 4EUKA 5GJBA 4OCZA 4FLMA 1R9GA 3KALA 4JP5A 3FIJA 4PIVA 2F8TA 4W9RA 1U0LA 2ZBQA 3VR4A 1ZSNA 2D2VA 4I8IA 1G4HA 3DUFA 1F60A 3VNAA 3WADA 1CUSA 4LZNA 4HGYA 1ESDA 2QYOA 4LMPA 5E2IA 2M6LA 2IWHA 4BCDA 1AKRA 2XH8A 3H9EO 2ZBFA 1HEUA 5HBGA 3TIXB 1YRAA 4EG3A 2IHZA 1HSOA 2X1LA 4H15A 3OPXA 4RUKA 4BFZA 1NC3A 2I9KA 1CD5A 3GGJA 4TXLA 1PVVA 3F49S 1AKVA 4ONEA 1OXBB 2R9VA 1IATA 2ARKA 3X1YA 3H5NA 3E22A 4U9UA 2JIZD 1GRRA 2I7TA 4CIWA 1IQ0A 2WMNB 4D96A 2IOFA 3HI6A 5AUQA 2J0UA 2H18A 3K4PA 1NJ5A 3VSCA 4I4TA 2QKYA 1Y7HA 2ZU6A 3DULA 4GX5A 5EZYF 1NMXA 5F3DA 3ZLTA 5EE5B 1ZIYA 3GLIB 4PPYA 5JSQA 2CJWB 3B70A 3JWEA 2P9ZA 4E13A 1PIWA 1WDTA 3BFJA 4RSMA 1FPMA 1ENOA 4XASA 2C9MA 4HQOA 4H6WA 1JDZA 1QIFA 3WGTA 1F7UA 3K6KA 1E77A 3H75A 4NV1A 1H2AS 2QM7A 5EJGA 3V00A 4DMGA 2FMTA 2YIJA 3Q1LA 1S3SA 4AMVA 2DSNA 2B5VA 3CR7A 3SE0A 3QEBZ 1Q2UA 4HMOA 1AIPA 4IINA 4IVNA 1W52X 3FTDA 5JVDB 1DCTA 1XRRA 4KO3S 4H35A 5D5QA 1NUTA 3TTSA 1P7YA 3DZIA 2AW3A 1R8QA 2O0HA 2YZMA 2ZWIA 2OPHA 1G5IA 1KMQA 3NAGA 4UUAA 3CX7A 3HY3A 2O5CA 4AJPA 4JU8A 5B2EA 4EO7A 3NRJA 1O97D 1T9ZA 2GK3A 1T0PA 2BUCA 3ZI7A 3TR5A 4BCBA 2JAOA 2JLRA 1TCUA 2PYZA 3KJZA 4MO2A 3QFRA 4I36A 1SXGA 3M1LA 1TQ4A 2EC5A 5KNDD 1Z5VA 4TLMB 3ZHYA 1AA9A 1K7YA 2Q29A 1P0IA 4C7XA 2CJXA 1E4YA 2BKVA 3AP3A 3ZJTA 2ZZMA 3V3KA 3HP4A 2IRWA 2MCFA 5KNDA 5HSGA 2PV7A 3I3SR 5BQXA 4RIIA 3FI9A 2L19A 5J2TF 3JU3A 3UJHA 1XX6A 1YNOA 2OGTA 3GYGA 4RH1A 3OT1B 4MUXA 1G0NA 3UMCA 2ANCA 1RTKA 3EBPA 1PR9A 2C29D 2UDPA 4LFAB 5EXSA 2ZRLA 4QLAA 4TTTS 1VZ3A 4CQJA 5JSZB 4J1QA 5AR1A 2H59A 2BJVA 3TIGA 3PFIA 5DT9A 5ER6A 4JY7A 4I1UA 4KPYA 1BJRE 1KI3A 1I4DD 3FNGA 4QEZA 4RK0A 4RHUA 4HZUA 1U9JA 4K1LA 2IEZA 3U19A 3N2EA 4NBSA 4UDOA 3D2BA 2VJDA 3E53A 2RGDA 4URYR 3KB2A 3TPZA 1ZOIA 5JJ5A 3NHBA 3ZVRA 2JCGA 1A7JA 1YIAA 3C6QA 2PUGA 1K7SN 1NVTA 5K03A 5BQPA 2HC9A 3N2KA 5FL3A 2GPNA 1YHYA 3QU4A 1ITZA 3QITA 1H0RA 5F64A 4DIMA 4QSHA 1MNAA 3IBFA 2ORYA 3FRHA 3ITKA 4OMFG 4MOWA 3R3SA 4LX8A 5I9TA 5CT4A 5M04A 3DH0A 3ETLA 5F12A 4O6VA 3JZMA 5EG5A 4ZXFA 4E31A 2N42A 3FYUB 5DBHX 5E0OA 3RK4A 3ZI4A 2VT6A 3IUMA 4BO3A 3B9PA 4LVNA 3TQSA 4ND7A 5D86A 3VR3A 3K8YA 1TK2A 3RU7A 3T6KA 3TRDA 4YCLA 3ZKWB 3GAAA 5DRYA 4HLDA 1NRWA 1VJ1A 3IQWA 3IP3A 1ML4A 2HLDA 4RM3A 3AJDA 1CETA 4Z86A 1EUDA 2W71A 3K1JA 4XLTA 5CDTA 5H02A 5FPHA 3WMGA 3KVYA 3LY8A 4J0EA 4LOJA 5CFNA 1NN5A 1F8UA 4CTOA 2REBA 2AMYA 1M83A 3A6GA 2PSHA 2O2SA 3LBIA 2XXAB 3EMDA 3OMLA 3HNOA 4DV7B 1M2OB 1RU3A 3HVHA 1NYQA 3C74A 4FLFA 2KJQA 5EUBA 2WUEA 4X20A 1SURA 4M0CA 2WM9B 2IH2A 3N53A 1QMPA 1D09A 2OG2A 8LDHA 2XEDA 3EBOA 4MX8A 1TQDA 4A8TA 1VXOA 5EKXA 4QOJA 2PL3A 2QUZA 2CFSA 4L0MA 5P21A 2ZBEA 5JO9A 4AJNA 4M8LA 3LKZA 5K99A 2IYTA 2XVZA 4C0XA 1CIJA 1Y7IA 1ZKMA 4M87A 8ABPA 4BO0A 4JASB 4IQ4A 4CHGA 4BP9A 1SGWA 1Z8FA 1JTEA 2QJFA 5HQJA 4HR7A 4CHTA 4AS2A 1F0PA 4AZVA 5AKKA 5EQDA 2WM8A 3G5TA 4TL6A 3FNIA 1SAYA 1LVHA 4M6WB 4PY2A 1P29A 1EFHA 1JQ5A 4IUCS 4ZMSA 4YROA 5A7HA 4AW9A 4CFZA 2OLKA 4HGOA 5F4BA 1GR1A 3KQMA 3L07A 1II9A 1DO8A 1RADA 2ECPA 2FG6C 4G0YA 5EP2A 4UCXA 5I7AA 1GZSA 1O89A 1QVRA 3FSJX 3T95A 1O54A 4PICA 3HKCA 5A02A 3W8NA 2FP4A 4YP5A 1Z0FA 3ISJA 4H18A 4NJEB 4RVNA 3KXKA 4DAOA 1PAUA 4RETA 2Y3IA 3PPYA 3SFZA 4MI6A 1B0UA 1BHJA 2ZREA 4LK2A 2PR2A 4RZ2A 1NTOA 4W1PA 4DGSA 4J29A 1C0PA 1GFSA 4FC6A 2J46A 1IAVA 2IDMA 5EIHA 1O94A 5C35A 5J2UF 1WS6A 3RB8A 1TM5E 5HIAA 2IHUA 2OCPA 3TS1A 1VJ5A 3BCUA 3A6HA 4ENVA 5KX5B 5ILOA 3DAOA 4KQ1A 1FJGB 2XMSA 2HDNB 4FMBB 3TG2A 2VDWA 3TFWA 2G1JA 2DWUA 1QZXA 4DLBA 3RHSA 2VYFA 3SSMA 4LJ9A 3KUDA 3MK31 2R87A 1XQXA 4ZOLA 1QV7A 1DWUA 2GPYA 5IP5A 3LU1A 4G0MA 1HYEA 1UK7A 1HOTA 2FVYA 1UIRA 2G6BA 5GVRA 3UMRA 2DTEA 4FONA 1G3UA 2ZTMA 4UDNA 1QDLB 1OD6A 2PU7A 1O95D 1ZRMA 3AR5A 1B1CA 1MB3A 2ZJ6A 3CW2A 1WUIS 3K2EA 3R4CA 4UU7A 4GQBA 5E1BA 4EAQA 3B48A 4EGCB 3HLYA 4RU1A 3F74A 4H7HA 4B3RB 3IVGA 3E5HA 4XTCS 3AW9A 4GMDA 4WXYB 2DGDA 1IJEA 2GFHA 1MB4A 3U4DA 4B4OA 4Q7MB 4F72A 2ACWA 3BZUA 5AI9A 2G1KA 3S7ZA 1NQOA 1KZYC 4JR0A 2B8NA 4KPUA 4FFNA 1CLUA 1DAIA 2P5UA 3QELB 4C4AA 1XTUA 3CNBA 3P7MA 3PQ4A 4IBOA 4ALJA 4EYQA 5JT1A 1XD2A 1FRNA 2A84A 5CBPB 5FOVA 2FYTA 4PC1A 2P9GA 3OQIB 1Y7TA 2CD7A 3HMQA 1CS4C 1JXAA 2GA9A 5EE0A 3C5HA 1R3DA 2YQ5A 1JQEA 4LRUA 4RCYA 3I53A 2Q21A 3ZDYB 4WJZA 1JPVA 4RJTA 4LTDA 4Q7QA 1QE3A 1PJ2A 3KZOA 4FDVA 1LD3A 1RWPA 4NSNA 1N0IA 1G16A 2J0VA 1K08A 3GUUA 4H1WA 3SYRA 4YIHA 3H99A 3EXEB 1ZEJA 4ZO7A 3V42A 5AYVA 3KQWA 3S1AB 3Q12A 4EHFA 3KEFA 1WUYA 1YB7A 2BF4A 2PZBA 2I6TA 3PXDA 1X0VA 3FLEA 1OF1A 3K2BA 4RTOA 4LSWA 1NWCA 3RVMA 2E3JA 1JUDA 4JI8B 1U1EA 1D03A 3KOWA 3ZV6A 4PPFA 2NU6B 1V4NA 1MQ8B 1W5AA 2OAGA 3OPQA 3KEQA 4H4DA 5F1KA 1SVKA 2HFKA 3LA8A 1PNQA 2PT5A 3EIFA 1XCJA 3E9NA 1L7QA 3HP7A 1K0FA 2WYHA 4BRZA 3PUVA 4M46A 3OQMA 4BIMA 1RPTA 2JVJA 1DXQA 2E4VA 4P08A 5KTRA 2EFDB 4B47A 3DBLB 3EE6A 2AOTB 2Y1CA 2FSIA 3G0BA 5HF6A 7AT1A 2YW2A 3KO8A 3KX2A 4HWRA 4V39A 2PLNA 3PRKE 4C78A 4KMOA 4TT8A 3UUFA 4CKWB 1M5RA 4B8WA 2FSUA 1TTHA 2VHEA 5T4BA 1N5DA 1F8FA 1WXEA 1Q84A 2AJBA 3IULA 1KYQA 4IIDA 4BP3A 2QP3A 2R6R1 3GZJA 4TLEA 3C3XA 4QX6A 1XQWA 1D2RA 3HFGA 2ZSBA 2WC1A 1NW9B 4YB8A 3C7CB 3RVJA 2POCA 3AVTA 1BH2A 2VZ0A 3Q2KA 3D7MA 1G2QA 3IT1A 3BICA 4FIZA 4P4SA 1G63A 1FY2A 3KBOA 4RHCA 5TMEA 1AC5A 5K0TA 3EISA 4M1OA 1EE2A 4I5FA 4E94A 1CR6A 3OZAA 2FVXA 3QGMA 3ZE9A 1U7XA 1TL7C 3OCCA 1YDGA 5HP4A 1H8ED 1R9NA 4Q9NA 3VOBA 2E4XA 4C6SA 5FR2A 2IEAA 1QS0B 1OTYA 1X8XA 2F3PA 4U8HA 4OJNA 1SXJE 4QQKA 1GHTA 1ZINA 1Y8AA 1QUFA 2BGIA 3BJMA 2O8FA 2PT6A 2EBWA 4W7IA 5FA6A 3C3BA 1ORHA 1TO1E 1TAQA 1YS2X 4FQ8A 4KYVA 4QDOA 4C4RA 4EHKA 1WY7A 4LC1A 1E3EA 1GRCA 2PKWA 2VH5R 2WSYB 2GAFA 1ADCA 1SC1A 2G8LA 4I9GA 3SNHA 3Q5EA 2YWXA 1W96A 4C0BA 1GPAA 5B6PA 3D7LA 1CUCA 1XF9A 4KNYA 1UL1X 4F6RB 1Z47A 1ZIOA 3D3WA 1J00A 2W6JD 1E6KA 4A4DA 4GVPA 1N8SA 2IZ0A 2O0KA 1JNYA 5FFNA 3K9NA 1I14A 1ZM7A 3N8DA 3U4QB 1XI2A 2C84A 2PZ8A 4N18A 3TF5A 3F98A 3GGDA 1JHDA 1QIIA 2OPBA 1B14A 1EUCB 1Y3AA 3BUSA 1X38A 3IUBA 4UEOA 5JMPA 1F0YA 2VYCA 1B0ZA 2VF7A 1ZL0A 4ZAVA 4I9NA 2ADOA 5CTAA 1OBCA 1QIHA 4RS4A 4Y2TA 4MUNA 3MMXA 1MH1A 1U80A 1W29A 4R1MA 1T1SA 2RC5A 1LPSA 1L5LA 4KN5A 4HS4A 3SSNA 2GHIA 1HQDA 2H4HA 4FOOA 3ELBA 4JLKA 1HI9A 3RADC 5H83A 1RXIA 3SQDA 4QBKA 5KOYA 3PXAA 4A1OA 2PMFA 4IFTA 3UMFA 1ZC3A 1JIUA 3UTCA 2H0AA 2Q28A 3V33A 1OILA 2C9BA 3ZDEA 4FKZA 2B4YA 5D3MA 2IU3A 2IUFA 2RH9B 1PT8A 3ORYA 5IN4A 3PEYA 3L1KA 5DYWA 2J9ZB 1OZHA 3H5AA 1IEWA 4V24A 4E0BA 3ZE1B 1SIUA 4PPGA 4B3DA 5C7LO 3TINA 2V5AA 4IG9A 1MFZA 3CNEA 3GFSA 3PHHA 2PAAA 4IKPA 1S8OA 4GX1A 1P3Y1 2H4JA 1LTQA 1QKJA 5IDXA 3H5IA 1HFJA 4Y8VA 4AP9A 3AVVA 4TYNA 1GTSA 3RS7A 5IVKA 2CHUA 4F60A 2O8EA 2GKGA 2B83A 1FEZA 3H9CA 2ZE7A 3VR6H 4C5CA 3LBFA 3SVTA 4EO4A 1OQAA 2C3PA 3ZVMA 3EJ6A 4Z8XA 4IW3B 3IAS6 1TCCA 2XRFA 1GDHA 4QFDA 4S1NA 3F3KA 3D6FA 1ZGCA 3E9EA 2GJSA 4MUIA 4RULA 3WOVA 1P3JA 2OV3A 2JBHA 1E3TA 2INGX 2KLBA 4LS3A 3ZV3A 2J3MA 4LSMA 2F6RA 1RJFA 5EJFA 3GA0A 3O4RA 1YS6A 1DNPA 3K1YA 3RHZA 3VV3A 4C3VA 2JG3A 5K3FA 3B3GA 4AKSA 3LLUA 3PDIB 1E2JA 1UMDA 4FOPA 4RWEA 4POOA 5DBGA 1KI4A 1WNTA 2WHYA 2CL6X 2CXHA 2X77A 5EP1A 4EL5A 4PN3A 1WAMA 2Z43A 1SCQA 1J90A 3MMNA 1RRKA 2HT1A 5J4HA 2D5LA 2EFEB 3HACA 3IMGA 5BW4A 4X60A 4XM1A 5BSVA 1BS2A 4CT5A 1H9CA 3RCBA 2E87A 2G77B 3D4NA 2BI8A 1TT5B 1H0SA 3G59A 3SQWA 5KWJA 2VK4A 3COVA 5G0WA 5A3QA 1KVSA 5A9SA 2JCVA 4UFOA 1C9MA 1IY9A 2I67A 1UWCA 5ALIA 1ZOLA 2HUPA 5DTRA 2CWWA 1JHZA 1E1YA 4WN3A 1NKVA 3OFSA 3OE7D 5D8DA 4DDMA 5EE1A 4NBUA 1UKZA 2HIGA 2Y1EA 2DH6A 1GVNB 1LRKA 2SNIE 4KE6A 4LZZA 4P7BA 3UAYA 3UK2A 3WWDA 1O95C 2WHQA 3VRHA 2DWPA 3MUNA 1I3NA 1XPJA 1OBOA 3EXG1 1IHUA 1IONA 5D5PA 1LV7A 3WB9A 4DFDA 3OG9A 1ZISA 4U7HA 3C15C 2GAJA 1M2HA 1TMOA 3BXGA 1FUYB 1C4XA 1Z2CA 1FOEB 3OOHA 4NPCA 4P5EA 2JFGA 1DUIA 2PQ0A 1YZVA 4K6MA 1E2GA 3AB7A 2CLLB 2AXNA 3FUXA 1AQUA 1TO6A 1VE5A 2ES4A 2YVAA 3WSVA 4ARVA 4H59A 5ER9A 4LJSA 1SELA 2P79A 4CMKA 2XUZA 3GG9A 3TJMA 3ANSA 3MNFA 1KQGA 2VWPA 1M1YA 3IIMA 3B1FA 4K88A 5DH9A 4PNEA 4FXPA 1RSZA 3TW4A 3KWJA 3JALB 1SOWA 2N3ZA 4BBPA 2CHEA 3S40A 5C1PA 3CRRA 1NSFA 1EZ4A 1JQLB 3O91A 4N3GA 2HTEA 3RLFA 3IXQA 3PIIA 3TM4A 4E4TA 3F1KA 4MRSA 1ZZEA 3JYOA 1SUEA 3AF0A 1V5WA 4HEA1 5K6TA 3RSOA 5ALHA 3V7NA 4WFQA 4RVOA 4L51A 5JH7A 1TAHA 1RYNA 1IN4A 2WM2A 4NAHA 4XA8A 4E51A 4N3NA 2C5FA 4LRSB 1SD1A 4FDTA 1UT6A 3GT7A 5LZ8A 4EA8A 5DHFA 1SCAA 3GDFA 3DDUA 1CR2A 4RYDA 3I1IA 4XIJA 2XQIA 1MQ9A 3TTYA 2CLOB 3CISA 4TVOA 4F2GA 3OJOA 2PGOA 3IC5A 4UBLA 3WV4A 4ZEVA 4YJ2A 1O7JA 3BK1A 2IYEA 4HH3C 2A3RA 2BSAA 4TRNA 4XGIA 5TT1A 2EVWX 1JFVA 1ZHFA 3OX4A 4HDRA 2IT1A 1L5NA 4Z1OA 2A5JA 2XI4A 2PN1A 3CB4A 3NI2A 4L3VA 3ZHTA 2R1TA 2AG8A 521PA 3G0DA 2ZR9A 3ICVA 3IXLA 4MWBA 3WP1B 1SBIA 2J87A 2LKDA 4POAA 1UPBA 5H3CA 4CM8B 3DJYA 4IV0A 4KDRA 1YC2A 1U9IA 3OZTA 4ZOAA 2VSXA 3RBZA 3SIXA 4EW6A 3R5SA 2V9CA 1QQAA 1NKTA 2DM6A 1G19A 2PQMA 3AI7A 3IDAA 1DC8A 3OZXA 1YVRA 2PG3A 3O8LA 5E38A 4YRMA 3KQLA 3NNDA 3PHJA 4HNAA 3RDPA 3OTOB 2FX2A 4AG6A 3C3WA 3N2ZB 2B8EA 4B3JA 1JEDA 1FTNA 2Y2VA 4KRYA 2JPDA 2PX6A 1O6FA 3CRVA 3K1AA 2NN3C 4OLJA 2BTOA 1A8SA 1GQFA 3SQOA 3AKDA 2NU7A 4PSDA 2B4TO 3ECCA 5IVDA 1RM4A 3UWDA 4ERXA 4RKWA 1QWSA 5I9SA 3BD6A 3JV7A 3NV7A 4W5NA 3R40A 1CULC 4HXFB 4Q4LA 5IKEA 4EF4A 4RMIA 2LE0A 4JITA 3VC7A 4F85A 2R8ZA 3GVPA 5EXDA 3JWPA 1BWSA 3LQKA 3EWAA 3RUCA 4IEFB 2HQ1A 3WJAA 2H06A 4RWZA 4EUEA 4M1YA 2QIOA 2AF4C 3IURA 4D3FA 3VJRA 1ICEA 3RSQA 5TQ0B 5GONA 1O6BA 3H17A 3WAKA 1LA2A 1A5BB 2VYVD 4KV9A 3GDGA 3MCZA 1X1SA 1NLUA 2Z2XA 3IEIA 2MYNA 2W9XA 3KR0A 3SZLA 3LO5A 1M34B 2ZRCA 2F43B 2YWCA 3Q8XB 1Z39A 1E1CA 1FNMA 1O4VA 1QLHA 4Z9AA 4OLAA 4QPZA 2W8BA 2EKQA 2PH5A 3E3OA 4H3HB 1DKNA 4XARA 3T38A 1NN1A 2LNDA 4F97A 3DHEA 2DETA 2ZBDA 4A26A 2XCSB 2ZSIA 3KTOA 1MEOA 1T91A 4L57A 2BFBB 4LYHA 3C6ZA 3VJLA 4WNYA 4BLWA 1UBHS 2EYUA 4R9RA 5I7RA 2GVZC 2XD9A 1YHZA 2GCEA 2OC9A 3M4XA 1Y3DE 2ZJOA 3K53A 4IWXA 4QGBA 4NV3A 1V41E 4O2AB 3BH0A 4RJKA 1M0TA 1EZ1A 3GIDA 4G6ZA 1XVTA 2PSJA 5CLQA 4AKEA 4FNGA 3R9WA 1KH2A 1DXOA 2Q5OA 1WD7A 2VZ8A 1U2QA 1QHSA 1JPUA 2CCJA 4O4LF 2OD7A 4EB6A 4GVLA 5B3JA 1E8NA 2Q1UA 1GA1A 1PZMA 2CVFA 5ITSA 3HXQA 4H77A 4KI0A 3PIRA 3VPSA 1QF6A 4I9UA 3DOUA 2B3TA 1ONSA 1M54A 1WZEA 2ZSKA 3IVAA 4LTMA 1Y9JA 2QJOA 4LSGA 5ARCA 1B26A 4IO0A 1KZ4A 3OPYA 2HGZA 4CYMA 3L4KA 2FGJA 2EV9A 3DEYX 5BO5A 2FDCA 3TIIA 4ZCLA 2OXFA 3D81A 1RHKA 3IDFA 4Z0PA 3RIGA 4R2XA 1UEJA 2ECOA 2QMQA 5K8CA 2VRCD 4JP3A 4YH1A 3IUSA 1Q5PA 3OLXA 3GGCA 1MABA 1VGRA 3MOGA 1YC5A 3QPWA 3LUHA 3P71T 1R8JA 2WT8A 4KO8A 2M1XA 1ZUNA 2PRKA 5DM4A 3I9V1 1DTWA 1PR3A 4LCJA 4J94A 3NLLA 4MUGA 2YVKA 2PYIA 3GPCA 2AZ4A 2ZB7A 3FDFA 3CPSA 3U7RA 5EMHA 4KWCA 2BR5A 4NZOA 2BZGA 4FTWA 3SHQA 5KNLA 3W79A 4EG8A 4I2NA 1JFSA 3ID6C 3GMIA 3QLJA 3OU2A 4KNVA 2VAXA 3ZJUA 2V7VA 5AKEA 3V1KA 3O1HB 5IKPA 4N3AA 3T9AA 2OB2A 4FWBA 2GO1A 1WPXA 1RQLA 2PGNA 3NFRA 1R3UA 1AG9A 2CFRA 4JH0A 4D26A 1N4AA 1DKLA 2PWYA 3WYNA 3D6VA 4WLNA 2VHCA 3MMSA 2QYSA 4PEVA 4FOTA 4RTMA 4M1TA 4Q16A 1HQCA 4KITB 4F56A 4Z2AA 5BWOA 3G7NA 5JSKA 1J21A 2ZRKA 2AR0A 1NVUQ 2B94A 4GPD1 3K0CC 1Y42X 3B82A 3H5RA 4CKCB 1R0SA 2Y76A 3JVDA 1R27A 2GD1O 2PBFA 2QTVA 5BP7A 3NCTA 2WKRA 1DRJA 1XCGB 3TCNA 1FVFA 4YV0A 4KXFB 2MSKA 4RK1A 1RE1A 1Z0SA 2XECA 3TPCA 2Q3CA 5CFLA 1SVUA 5B3AA 1D0VA 3UFXB 5HYVA 2ZPAA 1VJDA 4CM7A 3JAKA 5CDGA 1NR5A 4J6EA 1W94A 2BDEA 1TJPB 2VP2A 5F7XA 4BPRA 1VMEA 3KJXA 2GN1A 2R7AA 1KKLA 7ABPA 2C58A 1CRQA 2PE5A 1WB4A 2J3LA 2WJZB 2G8NA 3ACCA 3FCYA 3JARA 3LHFA 3NT5A 3NM4A 3O8DA 2W2LD 4DJFC 1NNEA 4DB2A 3WRYA 3S2EA 5AW4A 4EH1A 1CEQA 1YGYA 1MX1A 3KRTA 4EHDA 1LXCA 3DHNA 4M2LA 4MEJA 4OG2A 3S2UA 4OSPA 5KSPA 3LPLA 3VR2A 4F9EA 1COZA 1NVXQ 4FHGA 4G1CA 1SB9A 1T9AA 3DUFB 1WCYA 4F4JA 1XLTA 1RPAA 4EYGA 2B1JA 2VA8A 2LDXA 3LYUA 3R3XA 2BEVB 4IDGA 3VYTB 3CEPB 2WHEA 1RHMA 2C5SA 4K9DA 4NZPA 2J1LA 2QUIA 3F3MA 4ZT7A 3VVBA 4E3WA 4RIEA 1CUFA 1HFWA 3A9WA 3LCJA 5K05A 4ZDJA 2C9ZA 1U0EA 1J42A 1T6XA 2XB2A 2ZFUA 3D6JA 4OK6A 3PCTA 4C6RA 2J6BA 5LVAA 1SZDA 5IDQA 3DOFA 3DZGA 1TZ2A 4NENA 3U9SA 4WK2B 1KTIA 3BTSA 2VJMB 2RHJA 3JD0A 5AO9A 4MQFA 5GVSA 3OCJA 5FR1A 5JZOA 1ZUHA 1D1QA 2H1VA 2B34A 3GUYA 3L46A 2ONZA 1VSQA 1X1AA 1DKQA 2NUPB 1YH3A 2BE9A 3PHCA 4Q3NA 3OJ0A 3O31A 4L9AA 1GFWA 1I5OA 1XRQA 3V1NA 5LXTA 1WWKA 2QM8A 3WK7A 2G80A 3AF5A 4S24A 3R3YA 2HMYB 1O4WA 1QG4A 5EEGA 1PJAA 2D7CA 3HB4X 3TDMA 3ZE0B 1G20B 3OKPA 1C0KA 5EE9A 4AG5A 3KKNA 1NF8A 4UXJA 5DNDA 3WL8A 1SIOA 1PBNA 1US8A 2Q6KA 2V5UA 4HDMB 5I7VA 4Q4JA 5EIXA 3RRXA 1XZBA 1PQUA 3COSA 3RNLA 2PQ2A 5C7IO 2CV0A 4NMWA 4D2IA 5CU7A 2HGSA 2I66A 1LZLA 2E4AA 1WDKA 3GH1A 5IBQA 1G6KA 1TJ5A 3IKJA 2JHAA 3A1DA 1EVLA 4PWYA 1OFTA 4KQXA 4MV8A 1UDWA 4MH0R 1NXPA 1TJYA 5ALMA 4DYDA 3HP1A 2X0FA 1DB3A 2BLLA 3A6ZA 3DM5A 4UTOA 3E8SA 1GGVA 1L4FA 5DASA 1GG8A 3GC6A 2IC5A 4RDCA 3R5JA 1N6LA 1ND5A 1YI1A 4QARA 2CMHA 1J8DA 1VA5A 2QSZA 1I1OA 1M72A 5GJWC 2VA9A 3RRNA 1XEXB 2C78A 2JFQA 4HVTA 4Q1AA 4MCIA 2WT9A 4A27A 4DPMA 2P68A 4WX2B 2A5GA 3T0GA 2NLOA 4FEGA 1U7WA 1EFPA 3A1FA 4N3CA 3QX3A 1JBKA 2Q5LA 4YXWA 1FTQA 2YJZA 3BGVA 2ZSAA 1NQTA 4EJ2A 2ZROA 3MERA 3GEBA 3MJVA 2ATIA 4BLPA 1VXRA 3HYTA 2AOVA 5KQLA 1YR6A 4Y6OA 1W9HA 1NL3A 1CUIA 3AHJA 3EFBA 4HB2A 2FSVC 3Q41A 5AVTA 3D0RA 5GMOA 3WHIA 3E0QA 3ZDAA 4YLGA 1QK5A 3QP9A 4NNOA 4B33A 1GNLA 1TIKA 1CUAA 4GSKA 2J5XA 4YQFA 1VPDA 3PEEA 3ZNPA 3V7UA 1UMBB 3HZRA 4LNAA 5ISMA 3NM5A 3MCVA 3WGUA 1QG6A 1LB1B 2BCEA 3SDSA 1KVRA 3O93A 4OXIA 4ZT2A 4WAUA 4AECA 2WILA 4RGBA 3RTDA 3RWBA 3B3JA 1P7PA 1TEVA 2QZ4A 2TS1A 5B4UA 1WB9A 1OFIA 1EU1A 5CB8A 2AN5A 3HN6A 2JAPA 5EPOA 1E1QA 1RI1A 1UDAA 3GFQA 2MYPA 3EGCA 4TLDA 5C34B 1IY8A 1UBJS 3D4PA 4EVRA 5JZSA 3P9CA 3COYA 4JWTA 1P1CA 1IPEA 1XT6A 3VYSB 1L4MA 3LX8A 1GM5A 2NUTB 4MVJD 1E1QD 2V7PA 4JIGA 4CTMA 2Z6UA 1MC4A 4NZYA 4TSFD 4WECA 3AERA 4C7MA 1I10A 4P22A 4D74A 1QAMA 4W8HA 2KYRA 4DJDC 2A3NA 2ZT8A 2FPMA 2XMCA 3DDHA 1O95A 5C9ZA 4FCTA 4N3BA 4Q1FA 4ZI2A 4ENPA 1R6AA 3S2ZA 3OZIA 3GJ6A 4RLHA 3BWBA 1XN4A 3O5AA 2XIQA 4U7WA 4BAUA 2F55A 2B98A 3R0QA 3DEHA 3B1VA 4FFMA 1DP4A 1YZFA 2UZ3A 4I66A 4EHLA 1E2NA 3BEDA 3PVCA 5D01A 2BT4A 1U8CB 2LVBA 1WPQA 2AQHA 3C45A 1D0SA 2BEUA 4R40A 2BZ1A 3ROQA 4QT0A 2PL1A 3S44A 1BVRA 4MRMA 4QGAA 4DBLC 4BJ5A 1JLKA 2F64A 2QPLA 2VCHA 1DINA 4CLHA 4IMPA 5EEHA 3HU3A 4L5AA 5HKKD 1N92A 1I94B 3WX0A 5DW3A 3WB0A 5B4TA 3E3NA 5TT0A 4ODIA 5HUQA 4CNQA 4R0VA 4PLCA 1KO7A 1UM9B 3DNFA 1KDZA 1SD5A 4F3NA 4MS4B 1KU0A 1S2OA 1RC1A 2VC2B 5IM5A 3OE4A 1UP7A 2OWDA 2AFIA 4WI1A 1Z0IA 5CURA 5ALUA 1N78A 1Q19A 2Q2QA 1GNTA 1BJKA 3LI2A 4KBFA 1WO8A 3FROA 3U1TA 4P3KA 1MN6A 3D6MA 2CK3D 4IYJA 5ANRB 3V6MA 4JP1A 4RGVA 3GRZA 4J0FA 2VF8A 3K35A 3B78A 3K92A 1WD5A 3L0ZA 2H7CA 1RQ2A 2GHRA 4IM7A 4TUYA 5SZIA 4JJAA 1LCIA 4M8IA 4PV7A 2YIVX 1U8UA 3W4IA 2WTNA 1UDCA 1IH8A 3FPSA 2QWXA 1Y1LA 1EFRD 3N3BC 4BV8A 3ILVA 5JNUA 3HXOA 1R0KA 1G1MA 5DF1A 2YVLA 1Q92A 4EEXA 1PR4A 2WV7A 1ZD2P 2ZWAA 4MZXA 2W0MA 2YHIB 3NV9A 3KDPA 4PX9A 3F7NA 3STUA 3A6LA 4CQLA 8OHMA 3KDAA 2CC2A 1QB7A 4IXTA 4UM8B 1QRUA 4YNBA 3MTIA 3KHTA 1DDGA 4ZZ0A 4BFVA 4D57A 1FA9A 4MUKA 3HBFA 2ZCJA 1NZDA 3QKTA 5C5IA 4BQFA 1PKXA 2QBYA 1NMYA 3L6DA 4L4YA 4WVLA 3B36A 4X95A 3T1YB 5KMGA 3HRKA 2W90A 5K0BA 3D2LA 3WGYA 2X14A 2YQ4A 1MV5A 5F7ZA 1RZUA 4IGEA 3F5SA 2BW0A 5IDWA 3W5BA 2JFUA 4B8YA 3IOBA 5A4AA 4O4LA 4JYMA 5IULC 4FUQA 2DUJA 1XWFA 1IWPB 1F6WA 2QVBA 5JD5A 2V3VA 3DS8A 4PZAA 2H1LA 3W4KA 1BWQA 4KPUB 5JCJD 2QRVB 1E9RA 2IEIA 2UXDB 5FLYA 5CG1A 2RGGA 5T5QA 2HIHA 4URHA 2BFDB 2PO5A 3H6KA 5D3KA 5ECWA 4FFVA 3BCHA 1RAGA 4L78A 2FMKA 4YRFA 3T5CA 1XNRB 1J25A 3L01A 2P0EA 1JZTA 3K2QA 3PJRA 4DN6A 4Z0NA 3FFXA 2QX6A 1V7QA 1RXUA 1VCIA 2C3YA 1DRUA 3R23A 3OQ1A 4XB1A 3ZW8A 2P75A 5A3JA 1UC4B 2FF5A 3FPCA 1TQ6A 3QPBA 4FS3A 5HRAA 4I4TF 1DMSA 2Q2WA 3L6CA 1XDUA 3CU5A 5SYNA 1SKYE 4RFSA 2OXEA 2Q3FA 3AHFA 3EC2A 4YN3A 3WKEA 2P91A 4CEJB 5JXGA 3GLHE 5F1YA 2XWJI 2G06A 5JC8A 2O2HA 2Z5VA 4K3UA 3B6ZA 4OXKA 3ZIDA 1MO4A 2DPHA 1YV9A 4NU8X 5AIBA 4MLZA 1JHQA 2WSIA 1ZI9A 2A9VA 4ZEMA 2X9NA 3UCXA 3IRVA 2B6HA 1JHXA 4UVGA 4HWSA 1YUMA 3SDZA 2IU4A 2DHDA 1IHDA 3KYCA 1PI3A 1TRKA 3AHCA 3GT0A 5KWIA 4OBWA 3GUCA 5DK4A 3CBGA 2WWRA 5LCXA 1RWVA 2NZYA 3M7IA 4HB3A 4QFCA 4AMYA 2O1XA 2QD1A 3CLHA 3GARA 1ZR4A 2XBMA 2GB4A 1P6XA 2GHQA 2R47A 2I2CA 4YECA 3WLEA 4LXXA 2GZHA 2ZUBA 3JYQA 1WMEA 4UVEA 4Y30A 4QGSA 2X5KO 2ZQYA 2JRCA 4RLQA 2PH1A 4C30A 3RAPR 3U81A 3HJRA 3S55A 1Z28A 4FMDF 3UMSA 2ZJ0A 3GDWA 1O58A 4H1VA 4M9XA 4DYVA 2KW5A 4MGKR 1Z7EA 5EFOA 4JOCA 2C2XA 2OBMA 1OBHA 3PJFA 4MIOA 4TVKA 5THXA 4ARUA 5K6AC 1BMDA 1JYFA 1P4AA 2VDRB 4YJ3F 4CM6A 4DTCA 1YU9A 2G1AA 1KI6A 3QTTA 1VE1A 1SVOA 5IAAA 4YGXB 3F5DA 1OLXB 1DAEA 4WT7A 4X64B 1E3LA 5BSKA 2QN1A 5FUVA 3JQPA 3L1VA 4YRPA 3WICA 1PJ3A 3LZ6A 4GXRA 3DZDA 4YCCA 2FN7A 2NVOA 3OJXA 1PK9A 3G6WA 5F77A 6REQA 2OR3A 3PFGA 2PKQO 1RM3A 4P3XA 1WSAA 1Z13A 4HUQA 1YR2A 5J4YA 2COEA 2UUOA 4PSAA 5FV4A 1JSCA 3OLWA 2O4UX 3HWRA 5TVGA 3D59A 3V2HA 3JD3A 5JAUA 4LEIA 2LCQA 2WW8A 2JHFA 4RA9B 4DRYA 1G59A 1U2RA 2EAUA 2W58A 1P0PA 3ETJA 2O7VA 4G26A 4J8PA 2O14A 4WNAB 4F92B 4UTXA 4GSYA 4D3ZA 3D7KA 3EOBI 4MV9A 1Q91A 4PX3A 5EIAA 2BFEB 1CE8A 2VK2A 3DGFC 5CEFA 1AHNA 2H1WA 3AUYA 4QDXA 2XYQA 3EDMA 4FFOA 5KZMB 4MWCA 4B9AA 4AKIA 1U7OA 1AUVA 2I2WA 1DXHA 2HMVA 1L4YA 1VSUA 1Z38A 2JZNA 1KR5A 2P2DA 3DLPX 3GNTA 3QG5A 4U2KA 3FZEA 4D45A 8ADHA 1CX9B 1SG6A 3FYUA 1G20E 1P0CA 5DP2A 5ICCA 4DCCA 1ULTA 3OF3A 2PZLA 4CGYA 3WC4A 3ND8A 1XJCA 3KAKA 3QENA 4PANA 3TVYA 2YWHA 1YGPA 1VIYA 2NZUG 1JDBC 3QHPA 4BLOA 3CKMA 3D1JA 2VPTA 4Y2SA 2H9IA 1CUWA 3PR3A 2YXDA 1LX7A 4PZCA 1Y9AA 3B2EA 2FI1A 3GN1A 3TIVA 3M6WA 5DV9A 1HYBA 1ZK4A 4JVSB 4WOCA 2GBIA 3RF6A 3QWBA 3U7JA 2LW7A 2F1IA 3E3LA 3OI7A 1V45E 4Y9RA 4W5TA 4O2BA 5AVRA 2A35A 4JL8A 3ZWOA 3C85A 3L4BC 4S1TA 5F2NA 5DU2A 2Q4TA 1AN9A 3ESRA 4J0KA 4PYIA 2X8WA 2OXCA 5DGDA 4BWVA 4F6CA 1ZW1A 1DG9A 3KUKA 2CNKA 3K1ZA 3PC4A 3QVUA 3I64A 3LQYA 4GF5A 4NR0A 3I92A 2VQ3A 4Y0VA 3UXHA 1DI0A 2EDCA 3OO0A 4MUHA 4O4HF 1JLHA 1HDCA 3BAFA 1TA9A 1CJBA 1U0GA 1T9HA 4YAWA 3VPAA 3RYCA 1NXQA 1CZOA 3DMTC 5FORA 2NVUB 3BORA 2C7PA 3CZCA 1N25A 3GV0A 1J9GA 3GLUA 1SC9A 2C7GA 3I6QA 4P86A 4CGZA 3NBUA 1ZCAA 1PZFA 3QEKA 3U6BA 2VJKA 2Q9UA 1QQTA 3DR3A 4QGGA 4KXYA 1ZOSA 1W7AA 1MB2A 3L18A 4EI7A 3OM0A 3QU7A 4P4UA 3OUZA 2X8LA 5K3FB 3UICA 1JW9B 4FKMA 4OQLA 1HXHA 4RJIA 1QGDA 2IYXA 5HKAA 2B8TA 5HKOA 5JQGA 3VZCA 2GEJA 2WABA 5HOQA 3I8XA 4BB5A 3O74A 2XTMA 3J80A 4Z7JA 1FMJA 2WF9A 2X8JB 3V34A 1M2NA 4RQUA 1RWNA 1JAIA 1SBZA 2G17A 2P4SA 5I7WA 3RUPA 1NYRA 2ZM5A 5JXIA 5E7IA 1AO3A 1ISMA 5BN1A 1X8KA 1Z4LA 2YV3A 4X92A 3RD5A 4HNTA 5LZ5A 3LD9A 3D5EA 5KKAA 3SHWA 1G8SA 3UA3A 1WXIA 3MWJA 5EMMA 1GKLA 3E70C 1YOVA 5KYWB 4BMSA 4IHQA 6PFKA 4P5PA 5AXCA 2B2NA 4B71A 3ZD7A 1XQ9A 2ZDGA 5KWVA 1DJQA 2Q4BA 2ZRQA 5EHIA 5KOJA 1NR7A 1HDZA 1FMLA 2UYQA 2HPAA 2XNJA 3JVVA 1XFDA 2O0JA 2VJYA 2BMJA 2ZIXA 3BBPA 2DG2A 3OURA 3QX9A 4FGUA 4RESA 4C5AA 1C1HA 4YPFA 5ENVA 2FSHA 4FBGA 5IXYA 4IZHA 4DWWA 4E07A 4LF6B 1FPQA 4HXGA 5DI9A 5EP3A 1DAGA 1X42A 2BHRA 5IJ0B 5T3YA 2OO5C 4JI7B 2Q4RA 5F51A 2H57A 3I9V6 1NNLA 5FPPA 5TJ9A 4BZPA 2OP1A 4FMPA 1XMSA 1Z2DA 1OJLA 2DY0A 1JFLA 3BSFA 3HKDB 1TTQB 3M3HA 3NH6A 3QI7A 4NP6A 1KH1A 5AHWA 1FVOA 5ESRA 2GMWA 3W5DA 4HAYA 1RABA 1W0JA 4BO5A 1Z56C 2A58A 1IBMB 1ZD4A 4W8OA 1EK2A 4DVGA 2YC2C 4DLRA 2JLBA 4Q00A 3SU8A 3FMIA 3ZWKA 4A03A 2OO3A 1R12A 4AX4A 3Q9SA 4N7JA 3T1NA 5JNLA 3SEFA 5F33A 3SQLA 5BVGB 3GHHA 4LGVA 2PS3A 3SZ3A 1AH2A 5A6VA 3GMDA 2GNPA 1G60A 3F90A 4KLNA 4BEBA 5BRJA 3OQIA 3GMSA 1H4SA 1OH5A 3WGQA 3WLTA 4MVJM 5B2FA 3U09A 3HA7A 2X0DA 1SH7A 3WWPA 3MXOA 3TZBA 4CMBA 3UM9A 2Y1KA 3SY8A 3WB2A 5ADUS 4YQZA 1GCIA 1E94E 1VG9B 4CV3A 3VNQA 4BDTA 1GGFA 5BWMA 2EG9A 1Z75A 1VTKA 2GJ8A 4H17A 1KZ7B 5CH8A 4OJQA 2CLKB 1Y6JA 2G25A 4QQ8A 2QSUA 2W6NA 3PI6A 1IL0A 3X1DA 3U2QA 3NKFA 3DLBA 5I45A 2EZ8A 6NULA 1W2HA 1OROA 2GZRA 1IHXA 1KPIA 3VPXA 4EQ6A 3NHRA 1NURA 3JQDA 3F9RA 3CX3A 3OA2A 1QC5A 4DYHA 4EYEA 2H4XA 3QVGA 2AG0A 4RGYA 1LPMA 1R74A 2GR9A 2HD4A 3H8JA 4ROSA 3VH4A 5CG2A 5EJ5A 2QR3A 4CL2A 3SBDA 5ADHA 1GT6A 4U2EA 2OHOA 2G82A 2R5NA 3NORA 1OE0A 1H0KA 4IEEA 3IYLW 1VLQA 1M66A 3NYWA 2JA2A 1ZK2A 4L16A 3L8HA 4Q01A 5AJVB 2YZKA 2VHTA 4FT2A 3ZKWA 3ZS9A 4QELA 2OVFA 1JIXA 3MMZA 3D4OA 5IG2A 1VLVA 3MJEA 4XPZA 3TB6A 4ZTUB 2VDVE 3T7IA 2QGNA 3VO9A 1TNDA 3AEYA 3BRWD 3JW8A 3L4EA 3WL5A 4NBVA 1K3UB 4LWPA 1QHHA 1LDNA 2GN9A 2WZDA 1R18A 3BL8A 3OCXA 4B40A 1DG1G 3GLQA 2R8RA 4WWHA 4CTNA 4R54A 2HBYA 3LCCA 3MC1A 2VP0A 3BMQB 3Q2IA 4I6EA 1JIJA 4WZBA 4B7ZA 1K2WA 4OGFA 1U2EA 4Z4QA 1YACA 1ZOPA 3W4JA 4IXMA 2AK2A 2QMUA 1LVUA 1V1RA 4K87A 4YS6A 1HL3A 3ENNA 4YALA 1SPXA 4QJ4A 2RSLA 1R4MB 4JL6A 3C4JA 4KGVA 5C46F 3Q8LA 3JRNA 1M7BA 5D00A 4ZREA 3RUDA 1RT9A 3A6PC 2ZANA 1VHTA 2CCKA 3JQEA 3IVMA 3DE1X 1KMIY 2JVKA 4GLBA 3QJYA 2ALJA 4KWTA 1HLFA 4U6NA 3JTMA 1G3IA 1R0YA 4LX0A 3S0JA 1C9JA 1E2FA 1CBUA 1ZU4A 2XCQA 4GGOA 4CU5A 4KIUA 3WYFA 5J2UA 1P1KA 2J3DA 1TYBE 3W05A 4GG1A 2BGWA 3OE5A 2VRBA 2IODA 2XUFA 3L40A 4F45A 2O2IA 1KF0A 2CF5A 1ZYUA 2Q2OA 4GW3A 4OVKA 1DHTA 3CNOA 2AZMA 2GDZA 1LLCA 1LBTA 3ZXUB 4BNVA 4MRPA 2XHEA 5TC4A 2C9YA 3O26A 4ITRC 4N76A 5F2EA 1LDEA 1SKQA 1TE2A 5PNTA 3LGXA 1JXOA 1WB5A 4HC4A 2FSPA 2VHZA 4OHWA 1SC4A 3UB2A 3JQ6A 1YMVA 3ZV5A 1JA9A 1T36A 3MS4A 2IY7A 4ZCTA 3QYAA 4RQAA 2JKVA 3KYDB 3G2IA 4YJDA 2WWGA 2LIVA 3VR1A 2AC2A 3RV3A 1A5TA 4JOBA 1ZVQA 5HUHA 2H9YA 4MYTA 4FINA 1QGYA 4ZQFA 3TX2A 2Z1NA 1VKOA 2QAJA 1T4BA 3PE6A 3CCFA 5D3ZA 4ETMA 2R751 4X54A 2H2HA 1Z08A 2ECKA 4UBNA 3ZE2B 2E1RA 5C32A 2H8KA 3FHJA 3IV9A 2JFHA 4YO7A 3Q72A 3DBHA 2Z04A 4HYTA 1JMKC 5CFZA 1U1CA 2K2WA 3PQFA 1URPA 1NBHA 4KRGA 4YAIA 3PC8A 4W5OA 1K8ZB 3A2KA 4Y6QA 4FFLA 1USVA 3FGZA 1G8YA 3P2YA 3LPDA 2AN4A 4KNWA 5KC9A 1QU2A 1K5HA 2HEIA 3RH0A 3RSLA 2OK7A 2ATVA 3I9NA 5KWSA 4TX1A 1H2EA 1MT0A 4GWGA 1RD4A 3QG1A 1JU3A 4F2HA 4YCNA 5CVVA 3LHDA 1BS9A 3I5YA 4DHWA 1CT9A 1SHJA 3G8AA 3Q4GA 4F5DA 2ZUTA 1SN7A 5B3LA 5KBYA 5TVKA 4BIIA 2XMZA 1WCXA 1YFLA 1HNXB 4C2UA 4X1KA 1RRMA 1XTJA 5CXXA 2J3IA 3ILYA 3T3HA 4CMAA 2IEDA 2MIIA 2FETA 4GEGA 1PX0A 5ALQA 5AXBA 4E21A 3S1SA 1Y6ZA 2A6PA 1QK4A 3KJQA 1T3LA 3Q3IA 4N0QA 3PGJA 3COPA 2IHKA 3Q1KA 1WCWA 1CJTC 1X13A 1ZUD1 2Z83A 3KZVA 1E2LA 4FGZA 4OY3A 5FBHA 5JDCA 3P9KA 3H2HA 1AKTA 1IRXA 4KLAA 3ZWCA 4ZFNA 1H94A 2ZJ3A 3SICE 1YL7A 3SM3A 2JCXA 4G63A 3L1HA 1U7HA 4H7KA 1XDGA 4KYTA 2ZDQA 3EVFA 2F1HA 4GLOA 2FX3A 3DBIA 4HGRA 4MYDA 4PNPA 4DV5B 1DRWA 4JC4A 1RCFA 2QT1A 4MQMA 2HI0A 4ZQGA 1ESMA 1T5TA 4JENA 2C9DA 1PQPA 3ETNA 2FEXA 4TZTA 1PFQA 5LLSA 3REOA 1S3FA 3OECA 3Q6MA 5K3EA 1JXQA 1T6NA 4KREA 2JHGA 2Z30A 5DULA 2QD5A 1D9ZA 3KAQA 5LJIA 1U4SA 5FUWA 3PI7A 2I3BA 2H00A 4DCOA 3WZMA 1M2OA 2WPDA 3ZXYA 1KSGA 3UPUA 2X13A 1BZYA 4FNMA 2P9TA 2Q8PA 4L0QA 2ZT7A 3SXUB 4TYYA 2YRXA 3SC6A 3QEAZ 2X0EA 4Q6BA 3UHPA 5AHRA 3IE2A 1D4AA 4P0QB 1H9AA 1OX4A 5GWXA 4QOIA 4WKOA 3C3EA 1IUOA 1QIEA 2JBWA 4RKEA 3ASVA 1J49A 5L3SA 3EGWA 1GUBA 1GLGA 1Z7YA 2NO7A 3B85A 1N6KA 2PS0A 3QNUA 3VGJA 1BDBA 3AINA 3U3KA 4X3OA 2FPSA 2A88A 1QP0A 1QUEA 3KOXA 4J0IA 1QIJA 1WBJB 4B75A 3QU2A 3GLHA 5JNRA 3V1MA 3D6HA 1N1GA 4P38A 4PR0A 4D6PA 1F6BA 4RTSA 5L53A 4EYSA 2GEDA 2IJGX 5CDHA 4R7TA 1G5TA 1N6RA 2Y8EA 2YICA 1DAPA 2BM0A 2K5UA 4BX9A 1UKYA 1NDUA 3AEZA 1Y5NA 3HUFA 1UIMA 1BVYF 3LBHA 3GWGA 3KKQA 4NBWA 2CEKA 5FWYA 4HAVA 5DYYA 2O8DA 4EWLA 1UINA 1VLZA 1EI9A 5JJLA 1FZTA 3DOHA 2CHFA 4O59O 5FBLB 2ZJYA 3UATA 4WKNA 2YHSA 1A4XA 1MIOB 1PYDA 3PFCA 1O87A 1SO8A 2PYDA 1PJQA 2EKZA 4JX8A 2GPWA 1T2DA 4GPIB 3U56A 2W6OA 5HRCA 2BFCA 5MN5A 2G5CA 2XDQA 1T2CA 2QI9F 1SXJD 3PUJA 2BUBA 4PBSA 3U0BA 2VWGA 4AX8A 2NVWA 4YYZA 4NBNA 1I4OA 3SX4A 5FAKA 1MRNA 4UHKA 4UATA 2O7NA 5A3VA 1TKAA 4W5WA 3QKSA 1T13A 3TTTA 2Z6QA 1RWQA 1KFEB 3OZWA 4R1QA 1X77A 1EX6A 1K8YB 2RB5A 1LH0A 1XEWY 1JHRA 5ALNA 1BX1A 3DYVA 4RLFA 3VNVA 3EVCA 1G7SA 5KYNA 1E1LA 1NF3A 4E4YA 3GRKA 5ALKA 3WFZA 3NRBA 5JNSA 4EFDA 3FTFA 1JR3D 3NWJA 2CXTA 1L6IA 4X7MA 1BGXT 4QUHA 4IAOA 2J0SA 1II8B 2IOFK 3BHJA 2J0QA 4YRCA 3F67A 3GOQA 3R7LA 4E2XA 4F21A 3NHFA 3UV6A 4C03A 3JVUA 1HA3A 4M53A 2D3TA 3NQ41 5A6SA 4JUDX 3WNBA 2O3JA 1RM5A 1WP4A 2BFOA 4HZIA 1MV8A 4IILA 4PG7A 1GQ2A 1K8QA 2HHAA 2VPQA 5IBCA 1N7HA 1QH1A 4G9GA 4HYQA 4P83A 5JANA 4B82A 4F93B 5K0CA 3P1JA 4LXHA 1ZG3A 3IKVA 1I3LA 2WU3A 2R4TA 5D7BA 4ZWNA 3ETGA 3QVWA 4QM6A 2OCXA 3FRJA 3KOOA 5H1YA 4BFTA 4BVHA 1PN3A 3NDPA 4DV3B 4LA4A 4XR9A 5AJWA 3M2PA 3AILA 2C3UA 5T4HA 5HGXA 1L7EA 5H70A 3DWEX 3ZJ4A 2PH7A 2LDBA 4Y6RA 3QOYA 2QT0A 3CN7A 3FPLA 3LV8A 4IMIB 4L02A 3CUEF 2WG0A 3U80A 3L0OA 2PWAA 4U3JA 2Q46A 4LZOA 4LJLA 3FDZA 1W1UA 4FFRA 3VYRB 4D8WA 2QDKA 2ZYSA 2P3OA 2G4LA 1EYZA 2OQIA 4WV3A 4UE6A 4DC0A 3Q7EA 1IY1A 5LC1A 2ZBUA 1WSBA 1GEEA 2IPAB 3KUCA 1ZGZA 2AFRA 2P6OA 4BNDB 3HWX1 1SKAA 2QJTA 1W46A 2H4FA 1PS0A 2KSQA 2NNWB 4ARZB 4JIMA 5KTKA 4UU8A 1P2GA 3TBFA 5ERGB 5AH0A 4M3NA 4CIVA 2HLNA 1WU7A 3RT7A 2FG5A 4KN9S 3VHXB 3WWEA 3HA5A 1K9VF 3SN6A 3KU4A 3BS4A 3HB1A 3OQVA 4EKDA 2AYYA 2MINB 2R8BA 2IP2A 3EVAA 4GD3Q 4KPFC 5IYZA 1PNTA 2WUDA 3EARA 4MWDA 1CDZA 3W2HA 1JHVA 4MI1A 3VOTA 3AHHA 4EHAA 1K5DA 4JROA 2ZI7A 1S4QA 3V4VB 1UP4A 5JU6A 1JHMA 1IZ9A 2RI1A 3FI0A 3INTA 2JIPA 3KZXA 4UTZA 3UN1A 5HW0A 1E3IA 1UC5B 4IHJB 4LCEA 2HK9A 3GB9A 5IF9A 1QNLA 2WIBA 5FNVB 4TL9A 2I29A 2BRUA 2R6CA 1Y5MA 4O0MA 2ZRNA 4YCAA 1DQZA 4DADA 4NK5A 2E5WA 3TLGA 3W5VA 2AC4A 5CM9C 5DO9A 4MEAA 1RYFA 4S35A 5KTOA 2EDAA 1GKKA 1GGKA 3MPOA 3O9MA 2YJ3A 2CZCA 1D8TA 3AR7A 2AN9A 3ZW7A 1DLJA 1ADBA 3K6RA 1JR3A 3PDCA 4N9QA 1FE8A 4C76A 4NH0A 1HX7A 3IVCA 1W73A 4Q3AA 2JLXA 3CXUA 3ZVKA 4L22A 3WQHA 1VYUA 3LECA 4MROA 1GDTA 1YS1X 3CJQA 1RMQA 2EP7A 4QRHA 5FLEX 3CMMA 4DF3A 1EIWA 2O8CA 5CYGA 3VKUA 2C2ZA 3ASZA 1NG9A 2EZ4A 1ZJJA 2PL9A 5ESDA 2QAGC 3WTBA 4G84A 3HVKA 3D8NA 1TC1A 4PHFA 3BREA 1CLEA 3KXDA 4AJ9A 3T4UA 1PWYE 3I5MA 3LGSA 3W3AA 3R7NA 1NVDA 2YXEA 2AE1A 4H16A 3SYMA 3C8UA 2WWVD 4HLUC 1THMA 1UFRA 1Y6QA 2CK3A 4ZALA 1TDJA 2IHYA 2WWYA 3WB1A 4QAQA 5KYYA 5IT9A 1HWYA 4UBJA 4RVUA 5U9CA 2YHAA 1PG5A 5IT4A 3DBLA 3I9LA 4K9PA 2QRHA 3IR6A 3R7WA 4WNIA 4BEWA 2WF7A 3IKTA 2X4LA 1J97A 2J6CA 1MB9A 5CX1A 2WJAA 4B87A 1Y7LA 3ERCA 5E3IA 1N5IA 5JJBA 1PDOA 4Z4FA 4QPPA 1BN7A 1W8DA 3I9KA 2ORWA 2JFZA 4KK3A 4NX2A 5I48A 3GLGE 4H1HA 5GPBA 3SMQA 2FK7A 4A16A 1Q1AA 3L7NA 4E6PA 5LYJA 3UWPA 2A9PA 4QEKA 3EXEA 3V8QA 2CLDX 1EDDA 4ZRMA 2XMBA 5D1HA 5BRNA 4Z4GA 4I1RA 1E2DA 1JWLA 2FW0A 3ZWVA 1K86A 4A2CA 4ZCPA 3IMKA 4CKEA 5T6MA 4J43A 1YUNA 1M1YE 3VTZA 5BWCA 3OTWA 1ZEMA 3ENQA 2XCIA 3L93A 1MTOA 4HS9A 3V9AA 5INTA 2CZQA 5CB6A 1G8MA 1P7CA 1V9LA 3EEBA 2C07A 1FMCA 2AQKA 1T0UA 3A32A 1YZYA 3PQDA 4Q4CA 4KSYA 4MEBA 1GRVA 3E82A 4QG3A 3GEGA 2VTBA 1OHHD 3DAHA 3B3QA 3EWNA 2I4IA 3AGQA 5IF3A 4OOEA 4TYPA 4BLQA 2DP4E 5DT2A 3CRW1 1KFKB 1DT5A 3AIMA 2WZQA 3FPBA 3OM1A 4BAGA 3T5GA 4TWZA 3JQFA 3PRHA 3PFFA 1VI6A 2CN1A 4HUJA 4P4LA 5CW1A 5IZCA 4QFMA 3AB8A 4HATA 5LP6F 1QZUA 4JJ7A 2VJOA 1HMYA 2FRDC 5TSDA 1X7ZB 4HT3B 2HOQA 5HM6A 2YH2A 1J8FA 1LJLA 2X5OA 1KGSA 4MTCA 1RQGA 2PU5A 4P4SB 3MWYW 1UFVA 2FQYA 3OPNA 2VUHB 4P5DA 2CFCA 4C9BA 2F43A 1YBMA 2ZLBA 1ZQ9A 5EC8A 4A0GA 1T34A 1MOSA 4BGVA 1JKFA 2BEWA 3ESBA 5A5FA 2DBZA 3FYHA 3GLSA 1ZPDA 5DTEA 5GTDA 5HX7A 1MZPA 2UZ1A 4DOMA 3TG8A 3ELUA 3LXXA 1I6MA 5FRDA 5AW1A 1L3BA 4X1OA 2X8BA 3EVGA 3FPHA 3ICCA 4RE6A 4TOIA 4A1FA 5MFPA 1M1NB 3PR1A 3NBQA 4YDSA 1RLIA 2PFKA 1ULBA 2BKEA 1LLUA 2XDYA 1PQYA 4Y0NA 1AO0A 2PUDA 4IIEA 2BGMA 1EJ0A 5KNBH 3AVWA 3GRFA 4AUKA 2PUHA 4MARA 1XA3A 3W77A 2P27A 4C87A 3O82A 3ASUA 4UPDA 3KC2A 1HDEA 3TLZA 2RAUA 1BQ3A 2QTWB 5FOXA 3RARA 4TTIA 2J33A 1DELA 2C59A 2P6NA 4M7WA 2XTJA 4C1BA 3GR6A 3HN7A 4TTVA 4RA6B 4TT3A 2DVMA 5BQOA 1IB6A 2ZTLA 2HA6A 3UHOA 5A2QA 1Z07A 5IXSA 2FMFA 1E6WA 2WJPA 3P0RA 1AE1A 2J9FB 2QLJA 3CONA 3FGPA 5C8YB 4QC2A 3GPDG 4TT3D 1Z8HA 3H18A 3N07A 4G5HA 3C8HA 4IIXA 2XWBF 5J5CA 3WK8A 1IVSA 4LI0A 1WCV1 5FIUA 4JYBA 1RPNA 1UMDB 4LC9A 1P74A 1W48A 4N82A 3GCWA 1XR3A 3W3AH 4CG3A 3ZWDA 3AIIA 4EP1A 3HSKA 1XTSA 3I52A 4K9KA 5TF0A 1NJ1A 3P0HA 2P5TB 3PUHA 3NOVA 5L3SB 4M54A 3C3MA 2QMHA 3F5FA 3ZEAA 1DV2A 2PX5A 4RA9A 3VX4A 1NNSA 2R6AA 4WNAA 4OP2A 2OFFA 3H1AA 3I6MA 1I5RA 1LKZA 1OHHA 5J5VA 1CJKC 3LHSA 3TWOA 4R0MA 2QL9A 2XXJA 2Q3MA 2XCOA 3L5OA 3H86A 4JFRA 4L4RA 4DLZA 2JHCA 4JYCA 3KJNA 1TJ3A 2X76A 2N46A 1SUFA 3GRVA 3NEJA 4YRDA 2FKNA 2JIBA 1EVYA 1TZJA 2OAQ1 2ONCA 2WLSA 3EIOA 3GVHA 4JT4A 3TBHA 4MWOA 1C3XA 5CM8B 2B1IA 2P2NA 3NC4A 1EUDB 4OSEA 4UC0A 5AOBA 1AS0A 1N2HA 3AHIA 3WLQA 1K88A 4FFBA 3SSAA 3CF0A 2BKAA 1H4TA 2JFYA 1E3WB 4BGUA 4UTVA 5H7XA 4C08A 2DBVO 2OO7A 2VP3A 2B8WA 2W8ZA 1KO5A 4D0RA 4Y6PA 3DWFA 3VMMA 4FN5A 4RKQA 4DCVA 1WDWB 3A9SA 4RZIA 2O6HA 5ALFA 3U48A 2K7ZA 2QTHA 4XCVA 3REFA 1KQOA 2C5BA 2HSZA 2OFXA 1WXXA 3PEWA 1CUYA 1RWKA 2Z57A 1FS4A 2I9PA 5CH3A 3S99A 4DG8A 4RD1A 5CDSA 1Y5IA 1UFKA 4BNYA 3ZTWA 2G9VA 2JFPA 2ONKA 3K9LA 3LIPA 4HRXA 4M21A 3O2SB 4PZPA 4H7DA 4Q1EA 4BB0A 1NBME 1Y1PA 4OF4A 2WB2A 3X2EA 3FA2A 1YVDA 1R4NA 2YOGA 3QKUA 1L4UA 4HVLA 5K8VA 5AESA 1H2RS 3W0LB 5AI6A 1TMKA 3WNQA 2PX8A 3GCDA 2OMKA 2I1WA 2FFQA 2HJRA 3IOEA 1JQJC 2I65A 3NEPX 4D0LB 4K0KB 4LHXA 1Q6ZA 1M3SA 1R5OA 4I46A 2BGRA 3HCDA 3PYLA 4QBFA 4JI4B 1A96A 4EDFA 4HRVA 2O8BB 5C1DA 3PGA1 3A05A 4OEHA 4EY4A 3AI1A 2E37A 3SI7A 5FD8A 3ZE6A 4XDZA 1R8SA 2NUPA 3KB1A 4MW6A 3EGDA 3KT8A 1GO2A 1O6ZA 5TS2A 2GEUA 1TLLA 1KIMA 5AVUA 3TLKA 1MPTA 2V3WA 2Z5LA 5LPNA 3AG5A 3TMAA 1EESA 1COWA 2AFIB 4HLUA 1DWPA 2L0XA 4O4HB 1PUXA 1V1RB 1DEAA 4XAQA 5CH5A 4EB6B 1KH3A 2AXQA 3L7AA 5BORA 3W1WA 4RK7A 2Z08A 1VHLA 3MAJA 4P98A 4PE5B 2WTBA 4F8YA 4BFWA 1DC5A 1YE5A 4YUXA 4ZGGA 4CIXA 3U1BA 3THXA 4EW2A 3QRWA 2MDTA 3V2IA 1E60A 5BOSA 1PS9A 5JAMA 2AX4A 1FTSA 4BRUA 1I0LA 3PT5A 2F90A 4L85A 1LDBA 1J0BA 1W44A 3A3KA 3DLCA 4PGFA 1ESEA 2W2KB 5AK6A 1BXGA 3L84A 5EQFA 5AW0A 3IXMA 4JLJA 3MRSA 3OFND 4YDHB 1NLMA 3ZX4A 6AT1A 4DA4A 3WYCA 1CVLA 1IN7A 1ZHHA 3FY4A 1JA0A 2Z2KA 4RVFA 5JBNA 3C3PA 1SOUA 4JJGA 1PGQA 4NOJA 3RT9A 5JTTA 1YJCA 4H3VA 5ITZB 1AXRA 3BTUA 4JXXA 2BMEA 3C16C 4X93A 5GJCA 1P33A 4Q4JB 1YF3A 1KRHA 4U7TB 4KGZA 3I73A 1POXA 1Z4PX 4ARCA 5DN9A 3A1NA 4PLPA 2IGBA 1MVOA 2A0WA 2WA1A 1YA4A 3OEYA 3MBIA 2H3HA 1TMYA 4ESVA 1UAAA 1YJBA 2XQFA 2AWOA 5THKA 1FW6A 1N32B 4CLDA 4PRYA 1VIMA 5F35A 3CVVA 2GJ9A 4GLFA 1Y1TA 4ZHQB 1C7JA 1M1ZA 5CJPA 5FBWB 3V1UA 3H42B 3IODA 2YWGA 1JWAB 4Q02A 4BKQA 5KPDA 1IRIA 1IDN1 3JRXA 3KP1A 4CF4A 1E2KA 5B1EA 2BELA 2QRQA 4AI6A 4K1XA 3WBJA 3EW7A 1VE6A 4URWR 3IT3A 4PVCA 5BSMA 4YRBA 2PFGA 1TA4A 3NT4A 3VMFA 3H97A 4DNOA 1TADA 1JDJA 2F3SA 2HRDA 3NBYC 4PX2A 1DBIA 1FP7A 2VKTA 4FIDA 4G24A 5D3QA 4BFLA 3K73O 3E2MA 1RM0A 1X7DA 3RFVA 1IBCA 1WKVA 4IWYA 2PPVA 4JAVC 1C7RA 3BHNA 5EUCA 3U5TA 4B2LA 1EDOA 2KE5A 4JD5A 5HMLA 2I3AA 1TC2A 4BCCA 1MW8X 1DZIA 1D5CA 3G8BA 3ZWWA 5L3QB 1CUXA 2X2EA 4NMHA 4TV8B 5AM1A 2ZRJA 4HY3A 3HN2A 4GM4A 3TKYA 1UAYA 1IZ7A 3MT7A 2AFVA 2R7MA 1GG5A 1IK4A 2O8VA 5G0TA 3R75A 5I7UA 1KJWA 1OXVA 2IITA 4NMLA 2J8ZA 4PHHA 3RU9A 1YZGA 4B4DA 1C7EA 1HTWA 2HTFA 3DDZX 4U02A 2VNAA 3ZDQA 1F48A 1P81A 1R0CA 1TYDE 3QVKA 2EP8A 3TLCA 3AJAA 3WIVA 3EEOA 3FOFC 3W5JA 1H9BA 4COOA 4TTPA 1ZH0A 3FMGA 4X97A 2X6TA 5DNVA 4ME6A 3E9YA 4MSUA 2XITA 4AULA 4V0NA 1XAHA 2AS0A 5BSTA 4HAZA 1ISFA 4KUEA 4OJMX 1A9ZA 2GZDA 2G67A 1ZNQO 4CDGA 4BE7B 5ICGA 4FT4A 1K4MA 2BSXA 2I71A 5AVYA 1S1CA 4E5DA 1CZKA 4QTYA 4CKWA 4OH7A 4KIWA 5KNDH 4RTNA 1QYCA 3DG9A 4M1WA 2IEGA 1G21B 4H1UA 5E7MA 1XZNA 2BMVA 2FPXA 3I2FA 4E32A 2ZVPX 3G85A 4F4FA 4DC9A 2DMRA 2SBTA 4R1UA 1QP7A 3EHDA 3PJDA 3PE3A 4JUFA 3V4LA 3K7EA 3H3XA 1PZGA 1DC4A 2C0CA 3GIWA 2QQ0A 1MDBA 3DTVA 5JATA 1R5NA 1Y4SA 2CEAA 4R51A 2KPOA 3V8NA 4ZO4A 4Q24A 3AHDA 1FFYA 3LT1A 1K92A 3MCUA 1GPDG 1TTTA 1SCKA 4LYAA 1KI6B 4KGXA 1G3RA 2AZTA 3G0IA 1GR0A 1T0IA 3GRCA 4ND1A 3RYFB 3HCFA 2RHDA 1HF3A 4C0HA 1IQUA 1L7DA 4D9EA 4DRXA 5JPDA 1YQTA 4J7UA 2UXBB 1JFFA 3L4SO 2VF2A 1FDIA 4KYIB 3R9XA 2UVPA 5LQMA 2D8MA 1A0OA 4BZWA 5CEEA 1BE6A 1SXHA 1MJFA 3KWLA 3OOJA 4MWGA 4AU1A 1AKQA 1N6PA 1L7XA 1K6JA 3KTDA 4LY3A 1CY6A 1K7FB 3KFLA 2XV1A 4YJHB 3FLBA 3WOHA 4AYXA 4UHJA 2D7JA 1GJRA 2DPYA 4P80A 3AXSA 3PPVA 5E9JA 3T9EA 1KEWA 3ULKA 3CM0A 2QZJA 3DP9A 3G2NA 1MO2A 4OQQA 5K2OA 2YNMD 5CA0A 4CUZA 5EGNA 3WK4A 3BFVA 3U4QA 3PUXA 3PFWO 4AUEA 2OE2A 2P6UA 3A1EA 4JC5A 4DUPA 5JS7A 4MQBA 3SIPA 3TX6A 5ICEA 2YYYA 4NZZA 1XNGA 1CY8A 2ZOSA 3OT1A 1Z63A 2FPLA 1FYXA 2CDBA 4P3YA 3SK0A 1RP7A 4XGNA 2BTQA 3N1UA 4DM3A 2EWMA 2R1VB 3FRIA 1S2IA 1E63A 1SC3A 2R48A 2F3UA 1WZNA 2XZPA 1JDBB 2XCUA 5FUBA 5EWJB 4V1CB 3I5AA 1MC5A 4B2PA 2VF5X 1D1PA 1Z8DA 3E61A 3Q15C 4TUYB 2B30A 3LCVB 4YASA 5KTMA 5FBRB 1YA8A 2BWJA 1IG3A 1Q0QA 2X8JA 4BO7A 4GPAA 2O2EA 4IDDA 4KI7A 1DWOA 3LHKA 3QUCA 1NDHA 2BEVA 1KA9H 4XQGA 4I5IA 3U1VA 4AKGA 4C0LA 4UD6A 1A69A 1KOJA 5JD3A 4YRAA 2XR1A 1N5MA 2JH8A 3V2GA 2ZIGA 3I39X 4ZQHA 4GU5A 2WFZA 1WETA 3EMKA 2VDKB 5J1SB 4QUAA 1VG1A 1EP2B 2GF9A 2Q9CA 3PXBA 4M0PA 2RGAA 1YI0A 5D51S 4YRJA 1SC6A 4AKTA 4V0LA 3OCZA 3HK2A 1S7CA 3GUZA 3L7MA 5DHPA 1ISGA 5BXQC 4EB8A 1H1LB 2A14A 1XVVA 4YBRA 3EQ7A 1CY0A 1XTBA 3QY0A 5K0SA 1G5PA 1GNQA 2QTCA 5C37A 2QX4A 1PG2A 3VKVA 4WK0B 4QECA 1XCLA 3MQ4A 4H31A 4Y6LA 4PFJA 4WZAE 2Q5FA 3V8BA 2AG1A 1