2V7EA

Crystal structure of coactivator-associated arginine methyltransferase 1 (carm1), unliganded
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
322
structure length
322
Chain Sequence
GYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE-ARGININE METHYLTRANSFERASE CARM1
publication title Insights Into Histone Code Syntax from Structural and Biochemical Studies of Carm1 Methyltransferase
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 94
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 2v7eA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2v7eA01
5DTQA 3BKXA 5H02A 4QDKA 3EVDA 3L8DA 2XYVA 3P97A 3PFHA 1RJEA 1VP3A 3JWGA 2VS1A 5GWXA 1ZHFA 2OKCA 4HSGA 4ER7A 3ER8A 3SXJA 1ZG3A 1X1CA 3ELYA 2UYHA 3KR0A 2R3SA 3HVKA 1Z3CA 1SVUA 1UWVA 3P2EA 3BWYA 2N47A 5DTRA 4AZVA 4C03A 1YB2A 3T7RA 3BUSA 5CUQA 4E2XA 4LG1A 5FTWA 1R8XA 2UYOA 1UIRA 2KW5A 5K0FA 1AQIA 2YUIA 3VC2A 1RI5A 2AOUB 3CGGA 3OCJA 1YZ3A 2AOVA 2PWPA 4EMSA 2BR4A 7MHTA 4IKPA 1SUIA 1VQ1A 5DRTA 4KRGA 2O06A 3AXSA 1P91A 3FZGA 4LECA 3Q7EA 2ERCA 4OX9Y 1XTPA 1FPQA 4EVIA 1RJDA 2YR0A 2AOUA 5HIJA 2NP7A 3OE5A 3SMQA 4PYLA 5ICFA 4M38A 4ER6A 2PKWA 2OYRA 4IV8A 2AR0A 4OA5A 5BW5A 5LR6A 1M0EA 2Y1XA 1FP2A 3KPWA 3Q87B 4RYLA 5K8VA 4RVHA 2OB1A 3EVGA 2UYQA 4RTOA 4Y2HA 2AN5A 3UBTA 5IH3A 2P40A 3R0QA 1R6AA 2JHAA 3IHTA 4K6MA 3GRRA 1RI4A 2O07A 5E8JA 4CKCA 3FYCA 5F2KA 4E2ZA 2IP2A 3MHTA 2YX1A 2ZBRA 1KXZA 2OB2A 5E2AA 4MTLA 1R74A 4LWOA 1KR5A 5FCDA 1L9KA 5DRYA 5E1MA 2B3TA 2YXLA 3RW9A 1DCTA 2G70A 4M36A 3LL7A 4DF3A 3EGIA 1BOOA 3JWHA 2FK8A 3KR1A 2C7QA 1IM8A 2FK7A 3A7DA 3NVKI 4G56A 2I7CA 1EJ6A 5EPEA 2GS9A 5LQAA 4KVZA 3ER9A 1ZQ9A 3RODA 3SSOA 1QAQA 3HVHA 4WVLA 4YUYA 5EG5A 4BLVA 2XVAA 3V8VA 2C7RA 3FTFA 3M6WA 5CVJA 1VPTA 3GGDA 3EGVA 3G8BA 5HOQA 5FQNA 1KYWA 1BC5A 5CM2Z 1F38A 4GOOD 4M37A 2ZWAA 4P7FA 2B9EA 1XDZA 4WXHA 2V7EA 5FULA 2ZTHA 4KDRA 4AZWA 2IDKA 1ZKDA 3FTEA 3P9IA 5CVEA 4DMGA 3TLJA 5F2OA 1QZZA 3OZTA 4QTUB 2NNWB 3SGLA 1U2ZA 3TKYA 3K0BA 5K0NA 3SVZA 5DXAA 3RIEA 3B89A 3FPEA 3HCBA 3GXOA 2NXNA 1RI2A 3MERA 3PFGA 4FGZA 5EOVA 5KQRA 1X19A 3E23A 5ERGB 4DKJA 2BM8A 2GB4A 3DULA 3OZSA 4IV0A 1JSZA 3DLIA 3ELWA 4DCGA 1NBHA 1N7JA 3FTCA 4FR0A 4GEKA 5CIYA 3NMUF 3OU7A 3I5UA 3I53A 1VP9A 1NV8A 3DR5A 4GUAA 2IH5A 1UFKA 2FRXA 3CVOA 3ELDA 3QV2A 5M5BA 3G5LA 4E32A 4XCXA 1KP9A 1EAMA 5HILA 5K09A 1EIZA 1TW3A 5DXJA 3LSTA 4PINA 4OQDA 4BP1A 2AN3A 2PX2A 3DMFA 4V0RA 2PWYA 2ZULA 1WS6A 3M4XA 4RTKA 4PYJA 3GRVA 4FSXA 1KYZA 5MHTA 1DUSA 4OBWA 2P7IA 2ZZNA 3ERCA 5LQUA 8MHTA 4MHTA 3JWJA 4FSDA 1EG2A 1ZGJA 2P41A 5KYGA 3C3YA 1NW8A 1Q0SA 5FA8A 3R9XB 1BHJA 2QYOA 3O4FA 4GOMD 2H11A 3I58A 3NDJA 4RVDA 5GINE 2ZWVA 2AZTA 2P3QA 5K03A 5K0LA 2XVMA 5E1DA 4F85A 1EJ0A 1VIDA 2EG5A 1JSXA 2B78A 3F4KA 5P8WA 2E5WA 2PX8A 3C0KA 4YV1A 4RTQA 1NW3A 3G7UA 2ZZMA 3UJAA 3KHKA 1I1NA 3KU1A 2I62A 3FPJA 2PXXA 3AXTA 1XCJA 1KPHA 2FCAA 3MTIA 4V0QA 4E31A 2ZLBA 4RTRA 4XUCA 3KPUA 3JWIA 5E9QA 3B3GA 4PGGA 1M6EX 3G88A 4PYOA 5EIWA 5E2BA 4CKEA 3A4TA 5LQKA 5IKMA 1M6YA 1X1DA 5LQCA 2XYRA 3BGIA 5GOZA 1XDSA 2P3LA 1Y8CA 3EVCA 5BW4A 3BZBA 4QVGA 3BGDA 3C3PA 4PCLA 3VSEA 4DZRA 4YUXA 1ORHA 3FUTA 3HCDA 4HG2A 3HA7A 2VDUE 2IH2A 3PX3A 1NW5A 3DOUA 1G6Q1 4YUVA 4EKGA 5KQSA 2AOTA 5EHGA 4MQ4A 2UYCA 2V74B 3K6RA 1JR4A 1R00A 1NBIA 2H00A 3UZUA 1Q0TA 3C6KA 2XYQA 2BH2A 4X60A 2GH1A 2JH9A 1NT2A 1EQAA 3FUXA 3M70A 5EIFA 2VDWA 2G1PA 3KQTA 3ELUA 2H1RA 3P8ZA 4HTFA 5T64A 4RTMA 1D2HA 2HNKA 5K0CA 3BGVA 4GQBA 1WY7A 2VZ9A 5DM2A 5DX1A 2PBFA 1JTEA 3M6VA 2BM9A 2P8JA 2NXEA 4PYMA 5CVDA 2ZFUA 3UJCA 4C04A 4A6EA 4X41A 2EFJA 2VDVE 4NECA 4DM3A 5K05A 3QOXA 2GAFA 3HEMA 2YXDA 4C07A 1D2CA 3CKKA 2GPYA 2IFTA 4HGYA 4QPPA 4Y30A 1O9HA 3REOA 1I4WA 3ANXA 4U7TB 2P35A 5K0GA 3DH0A 3LECA 3LKDA 3THRA 3E8SA 3MGGA 3PLAE 4HC4A 1XCLA 2ONYA 2ZBPA 4RVGA 3TPZA 10MHA 3VYWA 4PONA 3MAGA 2PXAA 5DSTA 4BLWA 3MTEA 4E30A 2IDJA 5KS2A 1JG2A 1R8YA 2GA9A 3CJQA 3EEYA 2JHCA 2PY6A 5DPMA 3KQYA 2QRVB 3UFBA 3TMAA 3X0DA 9MHTA 3TQSA 4RTSA 2BR3A 2EX4A 1IXKA 3LBYA 4PWYA 4R6WA 2YXEA 1L3IA 5HFJA 3NWBA 4PYQA 3HNRA 4O29A 2FYTA 5HIIA 3AY0A 3BWCA 2QRVA 5FWAA 2ZZKA 3P9KA 3PT9A 3G2OA 5ICEA 1V39A 5DM4A 1JG1A 3LCVB 5GM2A 4QQKA 4PYIA 2P1DA 2R6ZA 3GDHA 3NW9A 4E70A 5D1HA 3OPNA 1G38A 3TR6A 5GIPE 1NE2A 2NXCA 1JG3A 5C1IA 3M33A 5HZMA 2F8LA 4AZSA 3KQQA 4IWNA 3GU3A 4E2YA 4YUZA 5ICCA 2PT6A 3LCUA 4PYNA 3NDIA 3T0IA 3LDGA 1B42A 3DMHA 3HVIA 2CKDA 5D1NA 2OO3A 1INLA 2OPBA 4RSRA 4UOEA 2Y1WA 1R18A 3KQOA 5EMJA 3NVMB 1N2XA 2ZW9A 3EEOA 2UZ4A 3MCZA 3GRYA 3DP7A 3H2BA 2HWKA 3KQMA 3TKAA 3G8AA 4PYKA 4X1OA 4LWPA 1XXLA 4RWZA 3PVCA 3AWIA 1MJFA 5C9ZA 4PNEA 4EKIA 1YZHA 5DX0A 2ZIEA 5K0JA 2AOXA 4GC9A 2C7OA 5E8RA 3NWEA 2ORED 2Q41A 2IBSA 4ZTBA 3TOSA 5FA5A 4PIPA 2G8NA 5EC8A 1KHHA 3B3FA 1RI3A 2WA1A 4GF5A 3LGAA 4MWZA 4QVKA 2PJDA 1O54A 2Z6QA 3HCAA 4L7VA 3BT7A 5CD1A 2CL5A 2CMHA 1AQJA 5T67A 2YVLA 3GO4A 5GIOE 4XUEA 3TM4A 3UA4A 2ZCJA 1VBFA 5EQJB 2G72A 3A25A 4H0NA 2IPXA 3IEIA 1AF7A 3P71T 2P3OA 3ORHA 4R8RA 2Z6AA 2EJUA 5GP1A 2OXTA 4CWAA 2B2CA 5EMLA 1G8SA 5K0BA 5EKUA 1MHTA 4ER0A 5FUBA 4B17A 5LSAA 5DWQA 2B25A 4DCMA 2QM3A 2ONZA 5CVUA 2AS0A 4OBXA 1P1CA 3HA5A 3G2QA 1G55A 4FZVA 3ME5A 4A6DA 4P58A 5ICGA 4BP3A 5FHRA 3IV6A 3NJRA 1NV9A 4QTTB 1G60A 3G89A 3LX6A 3FPFA 4RTNA 4E33A 3R3HA 3I64A 3FUWA 2JG3A 3WSTA 3FUVA 1ZGAA 1H1DA 4KWCA 2QY6A 2FPOA 4DQ0A 3UA3A 4C4AA 4F86A 3VC1A 2VP3A 5EEGA 4QPNA 2BR5A 3EVZA 3P2KA 3R24A 4C08A 2AOTB 3O31A 3CC8A 1BKYA 2FHPA 3I9FA 3UWPA 3SSNA 5EZSA 1YUBA 3KPVA 4PGHA 1XDUA 1P39A 1IY9A 3A27A 3EMBA 3DTNA 5G02A 3KQVA 3M6XA 4FS8A 4HTFB 4OA8A 4RX1A 5DT2A 4EK9A 2Z6UA 3EVBA 5E9JA 3KKZA 1YFJA 1DL5A 4P7JA 4P7KA 1KIAA 3EVEA 2IH4A 4QDJA 1X1BA 1FP1D 1OR8A 5LQJA 4R8SA 3KPJA 2ZSUA 2JH8A 3CCFA 1KPIA 2DPMA 4HH4A 2PX4A 3OU6A 1TW2A 5E9WA 4MIKA 1O9GA 3FUUA 3SSMA 2NXJA 3EPPA 5EMMA 3E7PA 3THSA 1F3LA 4RTJA 4FT4A 4GOND 1PRYA 1FBNA 4OQEA 3UJ9A 3HA3A 1AV6A 1HMYA 3EGEA 4PCAA 1ORIA 2ZVJA 1RJFA 4YV2A 2WK1A 5EKXA 5C0OE 1JQEA 5JR3A 5EGSA 4YUWA 3B3JA 1WG8A 2OY0A 2ZBQA 3BKWA 3FRHA 4BLUA 4YMHA 1YFLA 3BWBA 5DX8A 2HV9A 4GC5A 5EHIA 4R6XA 3QOWA 4AX8A 4ER5A 3M6UA 5EEHA 4X61A 3IYLW 3TFWA 3E05A 3HM2A 4ATNA 4CTJA 4AUKA 5EVJA 2HR1A 2XBMA 2NYUA 4AZTA 3P2IA 2ADMA 3GWZA 4F84A 1XVAA 3HVJA 2AOWA 1VL5A 3HTXA 1SUSA 1QAMA 5KVAA 4YV0A 5DLYA 1JQDA 2ZIGA 4GOLD 3D2LA 1L3BA 2LD4A 2OZVA 3DXZA 3PS9A 3B7PA 5LQRA 5U4XA 4EQZA 2PV0A 3KR9A 3FPHA 4POOA 4BY9E 4RTLA 2HTEA 1SQGA 5GM1A 3SR4A 1L3CA 3LKZA 2NP6A 3UJ6A 1VLMA 1JQ3A 5DM1A 3BXOA 2OBFA 3EVFA 3OU2A 3LHDA 5FQOA 2DULA 3C6MA 3S68A 1FJXA 4HRAA 2JJQA 4M7RA 1SQFA 3R6TA 1VE3A 4U7PB 2O57A 3CBGA 4RVFA 3DLCA 5DTMA 3UJBA 5CCBA 3UJ7A 3TM5A 3CJTA 5B1SA 3G5TA 5HEKA 5LQNA 3LBFA 4JXJA 2I6GA 2O0LA 3A26A 3TRKA 4KW7A 4GBED 3UJ8A 4CKBA 4KDCA 5F2NA 5HIKA 5EZQA 5CCXA 5CVVA 3SM3A 4C05A 2PSSA 3MB5A 1JG4A 4FP9A 4KIFA 1NW7A 1T43A 2ESRA 4E2WA 4CXMA 2CWWA 3KQPA 4C06A 1X1AA 3OFJA 5BXYA 1HNNA 3EMDA 3LCCA 4CTKA 3AJDA 5K01A 4RTPA 3BWMA 1P1BA 1D2GA 3HCCA 2IIPA 2PT9A 3FTDA 3GIWA 5T6BA 2G71A 2IBTA 3ID6C 2O05A 3EVAA 1G8AA 2AVDA 3PX2A 3MCTA 2I9KA 3P9CA 3PB3A 3SX0A 3GNLA 4R05A 3GRUA 2AVNA 4Z2YA 4X63A 4HGZA 4P7GA 5HIMA 2PX5A 4DA4A 3KQWA 2PXCA 4ISCA 3PTAA 5EMKA 3DXYA 3G2PA 3LDFA 5E1BA 1JTFA 2HMYB 1SG9A 1QANA 5E1OA 1QAOA 2CMGA 2GLUA 2EJTA 2YTZA 3P9NA 3GRZA 4QQNA 3FYDA 1I9GA 5FHQA 3CJRA 3LDUA 3U81A 1NW6A 4ER3A 3KPYA 5BP7A 1SKMA 5DM0A 2QE6A 3B5IA 3HP7A 1WXXA 4YMGA 1YF3A 2PLWA 1RI1A 4FT2A 2IGTA 1N7IA 3LPMA 3DMGA 3KQSA 2JHPA 3MQ2A 3HCFA 4KIGA 2PVCA 1PJZA 3KR2A 1QYRA 2P7HA 2ZIFA 3FPGA 1XJ5A 5JUWA 3DXXA 3HCEA 3T7TA 1RJGA 2YQZA 1WXWA 3FRIA 3GJYA 3UJDA 1NKVA 5DSXA 1TPYA 2BZGA 3A7EA 2K4MA 3V97A 3OE4A 1WZNA 2WA2A 2C7PA 2AN4A 3DUWA 4PIMA 3G2MA 3NTVA 2PGXA 3T7SA 3OZRA 5FWDA 4XUDA 4RV9A 3O7WA 5K0EA 1KPGA 2A14A 1L1EA 3OFKA 3GCZA 5FADA
chains in the Genus database with same CATH superfamily
4N9QA 1BFKA 3R5FA 3CLRC 4P5EA 1BTOA 3WL8A 2GBIA 3U48A 5AXAA 4AYXA 5A1TA 1SEVA 5HWSA 2ZUFA 4BO5A 1QS0B 1VP3A 2VCHA 4RFSB 2JI8A 2HH9A 4MICA 4V0ME 3ZQ4A 4R5HA 3ZWNA 4CODB 9LDTA 1U63A 2HB6A 4P3KA 2W6CX 1MB9A 2ZJ7A 1JTVA 1OBFO 3GFGA 1IDOA 4HQNA 1SBYA 1OILA 3QVMA 4C03A 1TJ5A 2IQ5A 4XEUA 3S1LA 1CUXA 2GAAA 1I2DA 4GXNA 1E9CA 2CCKA 2HUNA 2V6JA 2UYOA 3EC2A 4LG1A 3A6ZA 2LIPA 3V4OA 1AQIA 4AG6A 2OBMA 2FX3A 2ORWA 2AOUB 4L0CA 1BOFA 2OO7A 2XW6A 4JEIA 1BHSA 1RE0A 3VOTA 1HYHA 3HJNA 5A2GA 8GPBA 2FPSA 2V0CA 1W73A 3A2LA 4DA7A 1T4CB 2O06A 3FZGA 4MVWA 4B47A 1QR2A 4R1QA 2GETA 3UK1A 2D1SA 4Y6SA 3V1TC 2QU8A 2ORYA 5LA6F 2NVOA 4FGLA 1XCMA 1XEWX 3RFVA 5ICFA 1GFZA 1JNXX 4M38A 2VJDA 3PYMA 2JFPA 3DL2A 3LBIA 5HQTA 4UPVA 2DFDA 2AL7A 1UMCB 1PZXA 3OUZA 4LISA 4LDAA 2P62A 2YIDA 4P38A 4Q4JB 1IK4A 1N3LA 2OG1A 3OF2A 1K5GA 4P08A 2Q7OE 5AUNB 1XWFA 4PEVA 1XDBA 3C7KA 4H6WA 1YOBA 4BQEA 4WK2B 5E7JA 2DBVO 4MRVA 3WDKA 3ZYCA 4FOTA 4K6MA 1XTIA 2B36A 3ICCA 4I3FA 1TK3A 4PLGA 4E11A 1RLTA 5E8JA 2I7TA 5B55A 4F2PA 1BSVA 3EF1A 4AXBA 4DCNA 1PFWA 3F6YA 5E38A 5JY1A 3LTNC 4R41A 2GT1A 1DFIA 3HYLA 4ZWNA 2JLQA 4GUDA 4N3NA 1F14A 3BAZA 5FCDA 2JVKA 1W5EA 4YVFA 2Q99A 3O9MA 3NWPA 4G37A 5FPQA 4EY3A 1TAGA 5BN3B 1DRWA 5D85A 5BUSA 2ZSAA 2E6UX 2J6CA 4YBZA 4IHAA 4MLDA 1E18A 3T1NA 4LC9A 1CUYA 4HDMA 2J46A 2ZANA 3SVTA 2F1HA 2W6OA 1EM8A 4L95C 4Q1EA 4WTOA 3TQOA 5KSWB 5L3VA 4CEHA 4DV0B 1GV0A 1P33A 2JL1A 5ER6A 1RRKA 4YJ2F 4XYGA 3RFTA 4ZT5A 4BNKA 2ZXUA 1U9CA 3D6TB 1G4UR 4KAFA 3TINA 3EH1A 2XPCA 1LV8A 3JTMA 2WUEA 4FWBA 5HQJA 3LOQA 5JI2E 2QYTA 3GPLA 2KLBA 1K3TA 1PSDA 3ZXYA 2V7EA 1OFUA 2F3PA 1G5HA 1KAGA 1MORA 3PD7A 2HJ9A 5F7XA 3DMDA 3FNQA 1ZKDA 4LRXA 5KTOA 1BE1A 5CYOA 1EHCA 3D5EA 4FNGA 3HO1A 4X8MA 1AXGA 4JLSA 3DDCA 5F5XA 5K0NA 2JAOA 2WKQA 1NY6A 3RO7A 2Z8ZA 5AHOA 3AEUA 3WKCA 4NS1A 5EOVA 1EB8A 1PCXA 1X19A 3E23A 4P4GA 1KXJA 5ERGB 4CG3A 5AJWA 2PUBA 1VYHA 1G59A 1E0SA 1YK0A 4EPRA 1TECE 3FTCA 5CIYA 1BXZA 2F6RA 5DN6D 4JX9A 1U0BB 4UTVA 5LNK1 4HNQA 2VL7A 1TKAA 2WIDA 3PD1A 3QV2A 4UVEA 3Q8KA 3LFUA 2C7GA 3WGIA 1U7OA 4RZQA 4QXRA 4G3XA 1DC5A 1V43A 4JKYA 1VXOA 2CFSA 4DMKA 3LT4A 2B4RO 1A4IA 3TI7A 4KX3A 5KUTA 1E5VA 1KETA 3L01A 5LP6F 2GM5A 4O1HA 3U9SA 3HK2A 3ANSA 1Q1AA 2VJPA 2ZZNA 1FP4B 1NJ2A 1FRFS 4EECA 3FNHA 2E4AA 1OA1A 1EG2A 3LUHA 3R3JA 4IVQA 2P9BA 3GZNA 4KXWA 4PRZA 5ALGA 5LXTF 3RE1A 1V8FA 2O2XA 2B8EA 1DGQA 1T5SA 1MJ5A 5MFPA 1GTG1 2FWRA 2BF4A 2P3QA 4YASA 4WA8A 1VTKA 4DV7B 4IIJB 2CXXA 3O92A 1UXOA 2CEKA 4FEGA 3WGUA 2I22A 5ESRA 5JZOA 3RYTC 1M5UA 2O8VA 4RTQA 2IHZA 3IKMB 6NULA 1MABB 1ODTC 5DI9A 4KI7A 5K4HA 3TOZA 4WFKA 4RD0A 2DWUA 3ROXA 4D9NA 4R0VA 4WZ6A 3QSGA 3QYFA 3CV3A 4DLYA 3LDHA 4QDUA 1D4AA 5T3UA 3DKKA 4Z8XA 1I4DD 1XMIA 2GQ0A 3RVMA 1JEQB 4YAWA 4DJTA 1QH8A 1YS4A 1NJGA 3F3YA 1Q74A 4KPGA 3E5NA 4QVGA 2Q9BA 2FEOA 2XUHA 3FLBA 4KNWA 3IAM6 2HK7A 2Y1FA 3ZV4A 2P6UA 5FF9A 2AJTA 1RW4A 3EXEB 4EFDA 2I0FA 1LTQA 1ONNA 2J4CA 3ZWQA 3BB1A 4FYWA 4MQFA 2JAPA 2JLYA 2XUJA 1PUIA 3UCEA 3CG0A 2GH1A 3AVOA 4HMPA 1ISSA 2OXFA 3NFRA 4DBVO 1YULA 2FDCA 3GZJA 1ZONA 4NCKA 1D2HA 4KFSA 4TLLB 1D9ZA 1EAYA 3KTOA 3UT0A 2ID9A 3DJFA 721PA 2L82A 1MZPA 2TMYA 1YR9A 4XARA 4F93B 4PYMA 2AE1A 4X41A 2NNLD 2ZR8A 5SZIA 4K5QA 4WGFA 4REQA 2NZVG 4ND3A 1SZPA 4I14A 1CU1A 3HB1A 4HS9A 3HI6A 3UMRA 5LIRA 3ANXA 1QVWA 2G6BA 3TRJA 2A9FA 5C52B 3U13A 2ZYSA 3SIRA 2HBQA 1S2LA 1I5EA 3EW7A 2GEVA 1BN6A 4TXHA 5DSTA 1Z0JA 5HIAA 1W2HA 2C4HA 2HA6A 3UUEA 2R0QC 1Z29A 4LMAA 5IKOA 5GZ3A 1S3FA 2VHXA 2FNAA 3P96A 1EX9A 1H3NA 1JT9A 2VLBA 3BYZA 2WPNA 3C7AA 4KGZA 4PCVA 3SX4A 4QLAA 3BRWA 2XMDA 1M2GA 3LBYA 2WNIA 3W8EA 1WAMA 5AVSA 4M46A 3Q0EA 4AU1A 3K30A 1OH7A 4N0DA 2VF5X 2GPWA 1GTJ1 3MC1A 3PT9A 4N39A 1MJGA 4RLFA 5DM4A 1NR1A 3R3YA 5AYVA 1IN6A 1E92A 4S12A 2R6ZA 4HPJB 4KQIA 1KVRA 1YDHA 4QFCA 2UYCA 3WXMA 1FFXA 3TR6A 1EIWA 4MYDA 1YC2A 2O2SA 1JHYA 1UBLS 2O7QA 5HZMA 2DKOA 2HHAA 3PHBE 4LW8A 3TNJA 4DCTA 5BMVB 3NEJA 1MNAA 3L82B 1JUDA 3BX1A 4DR5B 3UAVA 3EZYA 1JEOA 4XX1A 4EABA 2VHUA 4O8ZA 4XIIA 4YC7A 5F2EA 2EBHX 2AK3A 3HSYA 3V46A 3WP1B 2QBYB 1FVXA 3N2KA 5A7GA 3OQNA 3L40A 2RHDA 4G8BA 1NF3A 1MOZA 3A4LA 2Q5HA 2YOGA 3P9SA 1TO1E 2QB5A 2AEFA 1SXPA 1PYOA 5EIBD 1BRTA 2ZWPA 1GGNA 5AXCA 3OEHA 1KI6A 2WU3A 1TYEB 1KQ3A 2K6GA 4GLBA 4TVKA 2DG2A 3SZGA 1OXKB 4EKIA 1W2WB 3T6KA 2BKXA 1D7AA 4OM8A 1L5VA 5K51A 1GU7A 1P6XA 3N8DA 3DFKA 1ETUA 1FSFA 1SHKA 2AR7A 1X7XB 5EC8A 1WUYA 2C7VA 5F73A 4EY7A 2NM0A 3LGAA 2Q2OA 3U39A 3MT7A 1V5EA 3K9QO 2AN9A 5JD4A 2HLDA 4WY2A 3VNQA 3ZYZA 2XNDD 1WDMA 1CHDA 4EB0A 1T36A 4BFXA 2ZR0A 4ZVVA 1SXQA 5TJ9A 2IDMA 5TPWA 5FEMA 1ZCFA 1AF7A 1YZLA 5I7RA 5FP0A 2GNAA 3AUYA 3CLHA 2B2CA 3H9JA 2KBFA 3WYAA 4BB5A 3E27A 4FGJA 4DYDA 2CYBA 2NUBA 3QEMA 5J2TF 1TL7C 5HUHA 1J8DA 1K0UA 2A8YA 4JJFA 1IPHA 2AMJA 1FUIA 3DOHA 4L4YA 3KFLA 1MX1A 3V8NA 4P92A 3ME5A 4EF5A 1R8QA 5HQ3A 3A2MA 2NU8B 5JXGA 4D25A 1KC3A 1Y98A 4IHJB 3HXLA 1N3IA 5FNZA 1H1LA 2OOKA 2NXWA 2VI5A 1JR3A 5AW6A 1MEEA 3FJOA 2IKQA 4J16A 1T9HA 4Q1DA 3ZGVA 1DVRA 3QFSA 2PUEA 2VZ8A 2J1LA 1XCPA 1CRQA 3L8EA 3UHAA 5AKHA 3RANA 4UQLA 3QE9Y 1QHGA 2DUJA 2WAYA 4RD6A 2NADA 3VGPA 5A5EA 1JEDA 2GLXA 4EELA 4GW3A 1QP7A 5D7NA 4X64B 2CLIB 2PUWA 2Q49A 4HTFB 4UE6A 1V5GA 4CEJA 1T2CA 5EJ8A 4FHZA 5DHSA 5JCZA 1M34A 4NENB 4COKA 2DETA 1RBZA 4LRUA 1FYVA 1YI8A 2JLVA 4JJZA 1NI3A 1EESA 4M8SA 1VLQA 2XE4A 1KIAA 3MT8A 2A1TS 2EF1A 4ZOBA 4L8FA 5AOAA 3VPHA 4D9EA 5JJKA 1SULA 2JGDB 1J39A 4Q7KA 1N4DA 3RSCA 3IB3A 2ZSUA 3H3XA 5L8VA 4JYZA 3AGPA 3N0WA 2E5LB 4HH4A 2WJJA 3TIXB 4BMYA 2OHVA 3A6KA 3RASA 3CO0S 1GGVA 1XNQB 2QUBA 3OLCX 3D0KA 1LBSA 1YMUA 1DE0A 4ZPJA 3D8SA 1HMYA 5HK8A 3U7GA 3X2FA 3T3MB 1NKTA 4ZV9A 4ZEXA 2I6QA 2K87A 5EKXA 1JEYB 3LZDA 5J40A 3COPA 1KI9A 4WAUA 4YUWA 3L9XA 1TM2A 1WG8A 5JO0A 5E7QA 3JQ6A 4EAQA 3GLHE 4YX9A 1DKMA 4L27A 4HK4A 5DVZA 3MRTA 3KAQA 3WRVA 4WKCA 2PXHA 3KOMA 3U7EB 1ZI8A 5IT9A 3F5FA 1V2GA 3JU3A 4RLSA 3SBEA 2VQSA 4JC4A 1YFZA 3ZOKA 3A1VA 4WPGA 3HDJA 3OD5A 1JFFA 1MEJA 1ZBDA 3QEJA 2VHZA 3ABIA 4G5GA 4PFQA 5GVSA 3WQBA 1XXHA 4RESA 2VPZA 5I7SA 3DUFA 1EDBA 1L5ZA 2ATEA 2YZ2A 3D2LA 3PC2A 1J1ZA 1P0CA 5IM5A 3WHIA 1RXWA 3I1YA 3W9YA 3EDQA 1X1TA 1UPAA 4UXJA 4IXNA 4GMHA 1P75A 5KX5B 2BV3A 1R3UA 3ETEA 4WXRA 4LDJA 4C0QC 2EIHA 1DWPA 1MUUA 1KYTA 1VL1A 3C5CA 3E70C 1BQ3A 1T8WA 4RADA 3DMTC 2J3JA 4HRAA 3DO8A 1HH4A 2ZJ5A 4J90A 4JP2A 3GUYA 4MQMA 3UXEA 4CMIA 2H65A 1VE3A 1K3UB 3CBGA 3UWSA 1X86B 1VRVA 3MK31 4YMIA 3FNBA 2ZUSA 4LGMA 5AD1A 1MJHA 4MRMA 3KD3A 4WVFA 2TS1A 4ID3A 4E7PA 2W70A 2MOKA 4S1PA 4M1EA 2H0RA 4RKQA 1P4JA 3A9RA 2P30A 1PR3A 2VQEB 2QRHA 2F67A 4RMHA 5FI0B 1II0A 4BU0A 1PVDA 1RQLA 1NNLA 4Y2PA 2Z58A 4BWGA 4JLJA 1U1GA 1FNBA 1ZZGA 2HSEA 2GEDA 1HNNA 1OLXA 3O2QB 1M1ZA 1JQKA 4TUYF 5BVHA 4I46A 2HCRA 5TLSA 3FYTA 4G5XA 4X7BA 4ARAA 5F7OA 1U80A 4GSYA 2ROQA 4UHEA 5F1KA 2BGJA 1BVUA 3ONVA 5FBKA 1TT5A 2IEAA 3VH3A 3G0IA 2LDBA 2Q5QA 2WI8A 1U3VA 3EDYA 3GHHA 3KEGA 3OT1B 4G6ZA 4FB5A 4KHPB 1J33A 4FNMA 2CF5A 3MTAA 4UNSA 5AI4A 3UT5A 1MBZA 3PX2A 3MCTA 1GZVA 1ZHHA 1SVOA 3P9CA 4M9RA 1KRXA 1PTJC 2UZAA 3JY6A 1Z2OX 4UE3S 1VI5A 1ZM4A 3LHFA 4M8LA 3N74A 4QGAA 1FS6A 4WZBE 5JAQA 2VTVA 4AJOA 2OBXA 4HGZA 1PG2A 1Y34E 4JEMA 4LOKA 4DA4A 2JCXA 3PE3A 1PX2A 4QYIB 2GJAA 1JTFA 2P0YA 3H5AA 1SG9A 4XRGA 2GLUA 2YTZA 4GIBA 5LD2C 3QVKA 5H83A 2C00A 5A1JA 3RVDA 1A9SA 2PKEA 1URPA 3H16A 2QN8A 3LIIA 1NW6A 2XT9A 4DZTA 2XMGA 2WE8A 3CR7A 5KOIA 1JGTA 4YMGA 2JA2A 2GZ3A 1RP1A 2I2AA 1G2IA 3H1BA 4XPZA 3RWOA 2E49A 2FWAA 3C3KA 1ZI9A 3I62A 3HCFA 4KIGA 5D6OA 2FEAA 2XIQA 1QH1A 3TSYA 2OCBA 3HB9A 3DPIA 3OURA 4JVLA 4P2GA 4PXYA 4ZAYA 5F64A 4EHFA 1PR4A 1OBCA 2A2ZA 4LBVA 5BSEA 4ZRNA 2GXSA 1QDUA 1E6WA 1OU4A 3INGA 4CUJA 4CUZA 1KMCA 3D3KA 5FWDA 5CT4A 3RBZA 4MWDA 1M8KA 1J5PA 4ZZ1A 2CV2A 3HEBA 3OFKA 3D6UA 1AZLA 2GN4A 1ZI6A 5I7AA 4U00A 5BR1A 2VYQA 1NVDA 2PSEA 2QMHA 2W2XA 1T91A 3L8DA 4RY2A 1MJNA 4BX0A 3ZWKA 1VCOA 2AG8A 5JTUA 4CIWA 3ASYA 3GXBA 1FDVA 2ZRMA 3CYFA 2GUWA 3HB4X 4KO8A 1KVTA 1Q1NA 3DBRB 1ZXLA 1ZVVA 3P2EA 4KR0A 1QPGA 1PL0A 3QX8A 1ZIOA 4OH7A 3EXFA 4D44A 4Z2AA 2FPKA 4ABTA 4ICIA 5FTWA 2Q3LA 3V2GA 1KVQA 3QV1A 1UM9B 1YMQA 1W75A 3QVGB 3VC2A 3MQFA 2HHJA 3H2YA 2OO5C 5KKCA 5KNCD 1RPZA 2DBQA 2PZ8A 4EW6A 9GPBA 3U7HB 4KRGA 4MKRA 3MOSA 1RFGE 3WGLA 4CM1A 1PGQA 2B1JA 4JJIA 4TV9F 5AK6A 1FPQA 1ZVQA 3T5BA 3U26A 1G4AE 5KNCH 5BPFA 3H97A 1T0PA 2VF7A 3HYTA 5FA6A 4BNIA 3ZW9A 4XTCS 3PNOA 5CLLA 2DUWA 1W5FA 2EKLA 5DLEA 2ATVA 3KPWA 1T2AA 3PDCA 2QXUA 5CB6A 3ENVA 1I10A 3OMLA 1Z45A 2JJ2D 4FX5A 1FCJA 3HCNA 1MDBA 1UT5A 1T0UA 3BJEA 3E22B 1WB6A 1ISJA 5BW6B 3IBTA 4LSMA 5CRIA 4P0TA 1UXGA 4MDHA 4NULA 5DBEX 3H8VA 1NF8A 2Q0HA 4HJRA 1IHOA 1Z7BA 2I29A 3B8EA 1FNSA 2E2WA 1TQHA 2V4ZA 2XE8A 3N2GB 5I8ZA 2WWYA 2R11A 2ZUEA 4OY3A 3DZIA 4PRKA 2MSWA 3L1UA 4YRSA 4KODA 3G2IA 3WK9A 3P26A 1GT91 4IDPA 3U44B 2G70A 2OA0A 3EQ7A 2HC9A 1PKEA 1YJXA 1AKUA 3F74A 3U1TA 5LOVF 1BVRA 4M7OA 4Q3LA 1Z22A 1N2CA 4Q19A 4C76A 2VF4X 4D9HA 5JBIA 2H7XA 2MIIA 1E66A 1JSLA 4I50A 4MLCA 4OG2A 4B9AA 2YNMD 2OTCA 3KELA 4ZT2A 3VNSA 4J0EA 1IIRA 4BLVA 3WYNA 3ZE2B 1ZNZA 1VJGA 2ZTSA 4ZMBA 4R01A 3PGMA 2E5FA 2EIXA 3CLVA 3WGGA 3FXAA 3K3PA 5ALRA 4RELA 3CUYA 1RIIA 5G0WA 4K88A 3R76A 3OKPA 4Q1BA 1T6ZA 4BTVA 3ADPA 1L5YA 2EL7A 3K0AB 4YONB 4WCFB 4WY5A 4R8KA 2BL4A 2XAAA 4NQRA 1W0JD 4RMGA 3W7AA 3TKYA 3QBJA 1UKBA 2PKQO 3K0BA 1UAGA 5A4MS 3NOXA 2JFFA 4C4SA 2UV8A 1SO8A 1KQGA 2AXQA 3EB9A 1Z5GA 1FLVA 1QK5A 2OBNA 1N57A 1P7ZA 2CLMB 4Q0MA 3I1IA 5CPBA 3T5AA 2VPIA 1N6KA 2QSYA 3Q7RA 4NWIA 1B7GO 1ZN9A 2NX2A 2PWZA 1L4LA 3N39C 4M6WB 2ZXFA 1JQAA 2H7YA 3D7KA 3ELDA 1P1HA 3KB1A 4INOA 5H80A 4DSNA 1CQIA 1BMQA 3CT6A 1K6MA 2PGNA 3IQHX 5HILA 3HB7A 2XYHA 2C3OA 1U5AA 4H77A 4QAQA 4BFCA 4AZ0B 1XFDA 3DV0A 4JB2A 5DISB 1UBTS 4QG7A 2IRWA 3L6DA 1Z6YA 4O4IF 2RIRA 3FFBA 1EFTA 4Q9IA 4Y3UA 4E46A 4I4TB 4W63A 4BMPB 4DIUA 2EL9A 4EHJA 4FKBA 4UNQA 3RB8A 1TUBB 2CLOB 1F2TB 1IM5A 2QRLA 1V16B 3BSYA 3O4FA 2WLTA 4UDYX 4LF9B 5L95A 4DDUA 1A5TA 2RFLA 3T5MA 1RXCA 3BZUA 4FVTA 4W5HA 1PR5A 4L76A 4B4UA 1NM5C 4UU7A 3R9XA 3STXA 5ALFA 4DDTA 1ECPA 1T8TA 2H17A 3W1VA 3VXKA 3FYHA 2A92A 3NEAA 5JNVA 1THMA 3W8NA 4DMUB 1JWBB 2CL0X 1KH1A 1YR3A 2A4MA 3KU1A 3WWZA 4EB3A 1ZC3A 2G0NA 3TW4A 3NYIA 4HNUA 2JI4A 4YAJA 1RC1A 4JI2B 4JP5A 1WB5A 4YMSA 2C9MA 2FU5C 3WL6A 2G1KA 4FI3F 2GILA 2RJOA 5TARA 4XRRA 4Y2TA 1PFUA 3B1KA 4RVUA 3VPSA 3WLHA 1JAHA 3V8QA 4D2IA 4R31A 5DK6A 1TU4A 1FXUA 1MN6A 2XGSA 1AA6A 1NW4A 4JT8A 4P7BA 1XGKA 2EDAA 2XE6A 3PGLA 1X8LA 2RK3A 3HBNA 4HLQB 2C88A 2GSWA 1RQXA 1NQTA 3TD6A 4L16A 4JI1B 2IYYA 1E3TA 2X14A 4J91A 5IDVA 1DIHA 3K2IA 1E99A 2HSDA 3KZMA 4Y2RA 1QOZA 5KQSA 4XJSA 3EZNA 4F06A 1M2EA 2LDXA 2V74B 2YICA 1UFOA 1O87A 3K6RA 3L9WA 1NBIA 4NKRA 1KBZA 2QZ4A 1V6CA 4X60A 1UMBA 4JP1A 4L1KA 4F56A 4WJLA 5IJ9B 3QI7A 3EARA 4PX9A 3VO8A 1PZMA 2V8BA 2BCJQ 4G2NA 3ELUA 2H1RA 2HLPA 4HDRA 3UYKA 3I34X 3NX4A 1RWBA 1TYAE 5DE3A 4NBRA 1MDFA 3IO3A 5F5NA 1Z38A 1UH5A 2FWPA 2WFLA 1GU0A 1ZNXA 1JILA 2PVPA 3D54D 1RWPA 5CB4F 4CKCB 2CGEA 2ZDGA 1DOZA 3RUPA 3R7WA 4H35A 4CM9D 2BPOA 3OLXA 4IWXA 2EOAA 1XA0A 5A4DA 3R7FA 4DJFC 4CLHA 2FZGA 2BBWA 3KVYA 1AQNA 3SS8A 4C0KA 3E3LA 2XITA 3A3PA 4DDVA 5K0GA 2IDZA 3L02A 1T2VA 2X0RA 3PLNA 4B44A 2BGUA 4ES6A 3GEBA 2WHXA 3RC7A 5TF4A 1W25A 3WL3A 1RR6A 5ETJA 4E30A 2WHEA 1G21B 1HORA 5LU9A 3M4YA 2IIBA 3V2UA 3ENWA 3ZU2A 1MQ9A 1NN0A 1U0HC 1CV2A 1M1YA 2IYOA 2GBFA 2QZJA 4X44A 3SBOA 4BGIA 4JEUA 1GUZA 2GBLA 4BOYA 5KMGA 1MIOA 3QK7A 2VJKA 4J4TA 5JVDB 4P8RA 1FFEA 4B4WA 5KDDA 4F9TA 3E9MA 4ZYYA 5A05A 4OGWA 5SY9A 4U7GA 1N6RA 5ICEA 3G2OA 1O6BA 3A4NA 3BD9A 6LDHA 2FI1A 2OEPA 4A73A 4FLFA 1AO0A 5HF9A 2I1LA 4QEDA 3ZN2A 4ZA2A 5FYDA 4D9BA 1GEEA 5CDFE 2WF7A 4YT4A 1SKUA 1Y3FE 3EQ6A 3OOHA 5LMZA 1GAWA 2PZFA 4F21A 2OQRA 4MWEA 5L45A 2FPGA 2FW0A 3RHSA 1QCCA 3O1HB 4BVLA 2VDKB 5EYPB 2PJZA 1F2UB 421PA 1KZ9A 1R3DA 2HO5A 3H84A 3DP7A 3H2BA 4X8LA 4LWQA 4MWGA 1P2DA 1H2FA 2DSTA 3G8AA 3K1TA 1TM1E 4ZQEA 5LDGA 4BNWA 3QKSB 2GFQA 3ZWMA 4E1BA 1DQRA 4JVOA 1MZVA 4A0RA 2F1RA 2BTEA 1O0CA 1ZBQA 4FXPA 2C7OA 2GAIA 3RS2A 4CMJA 2ORED 2Q41A 3SZLA 2IXBA 2JZCA 1PLKA 2AXNA 3DTYA 5DI3B 3I6IA 3OEEA 5EFZA 1WSDA 3MMNA 1GZ5A 3AOEA 3M3PA 3L1IA 4JKIA 4WXEA 2MJLA 2B4QA 5EIOA 3RREA 1FA9A 2YWCA 3FCSB 3ACDA 5TC4A 3ZBUA 3D7MA 4MWSA 4FYKA 5ITZB 4IIHA 1FFCA 4MGYR 1FJGB 3OZXA 2EJCA 1KKLA 1Z0DA 3BA6A 5IBQA 2J07A 4ABYA 3IS3A 1N0IA 3OOEA 2ONZA 3FCOA 5CVUA 1TJ4A 4JYMA 4MR8B 2QNBA 1SA0B 3U7QB 4FGSA 1UKEA 4I55A 3PRHA 5B1HA 3RAGA 1JYEA 1W48A 3IV6A 1IXYA 3NHPA 4E7OA 3B51X 2AWNA 3OLWA 1IULA 1Q50A 3RUAA 1X1QA 3UNXA 4F4DA 5IG2A 2A9VA 3GUHA 1U2DA 3FWHA 1U9IA 5JAZA 3LHKA 2QZ9A 3E8XA 4PTYA 4UZSA 4DHWA 1Q91A 2YFHA 1Z5OA 3S2ZA 1N2SA 1SB9A 4S24A 2BR5A 3S27A 1Z06A 1UDAA 3RJZA 3KX2A 1OX6A 2PZAA 2X3UA 3EH2A 5DKFA 3FOZA 3ENKA 3HFJA 3WKBA 2HSJA 3BWVA 2ZE5A 1DTSA 2C29D 3IAS1 2ODQA 3HBAA 3KQVA 4XE5A 1QG2A 2L42A 3PC8A 1CERA 5EN4A 1OH8A 1COZA 2HIMA 3R4CA 3IVCA 2DLNA 2VJYA 1PS9A 4KO3S 4Z7OB 5SZKB 1SHZA 4UUBA 4CVNA 3KSDO 3N58A 1I30A 1L5OA 4LVCA 3CZRA 3WL5A 5G0VA 4F3NA 3T54A 5D3MA 3QFFA 4L9WA 2AFVA 4PFJA 3JQ9A 2QGZA 1XQYA 2OGTA 1AV6A 1ESEA 4UARA 5D8DA 1P6UA 3AUXA 5KZMB 1BN7A 4YV2A 3ZW8A 4BN4A 2IZ6A 3IBSA 5B6IA 3GD7A 1M7HA 4YJ3F 1Z6PA 4IJ5A 4UBIA 4B8ZA 3PUHA 4HFNA 5ECDA 3ZDCA 3QKIA 1X7YA 1GHTA 4GC5A 5CB0A 1ACLA 3PFWO 4OHZA 3WBBA 1XYGA 5EEHA 3RNLA 2ZRJA 4NCXA 4QBFA 4Y1RB 5FBZA 1MC5A 2ZR7A 4Y9TA 5IAEA 1A9ZA 3JZAA 4YPOA 1AUPA 5JZMA 1WHSA 2BP7A 1KORA 3K15A 3F7OA 1G8PA 2BEJA 2O2YA 3BQMB 3GY0A 1DAFA 4O0MA 4Z1OA 1ELOA 3KOWA 2V1UA 3DXZA 3JALB 1H23A 5U4XA 2FQWA 3OWOA 1XTKA 4RTLA 2E0IA 1ZK4A 3B20A 3C3BA 3SR4A 4D8VA 5IBCA 4QUGA 2I3GA 2MR5A 4U0JA 4XPIB 3V5NA 3Q7PA 1ZN8A 4CCSA 1OT5A 3QMMA 3ANMA 5JBNA 2JZNA 3PF8A 4DV2B 3NYRA 3L7DA 4JLDA 4AWAA 2GESA 2R7LA 1CUJA 3G6WA 4N9WA 2JJQA 2WFZA 3EAGA 3FSEA 3DOJA 4AQDA 4DA9A 2AFHB 1E3EA 1U0SY 1TA4A 2JIZA 3I9LA 5CD9A 3RKRA 5IZCA 3G5TA 4KP7A 5AOBA 5YASA 4W1QA 3TRKA 4N5DA 3JVDA 3U3KA 2JGEA 2Q2QA 4ZYVA 3JQQA 4HMOA 3HXKA 2FSSA 1FNMA 1HDYA 4AAYA 1K8RA 1XAGA 4QNMA 4XYMA 5FUWA 1P1FA 1T9BA 4GI1A 4NYIQ 1RSZA 5T4BA 1K6EA 1NU8A 3SBXA 4HDAA 3RK0A 4YRJA 4UW9A 1G63A 4IL5A 4LNAA 2ZDHA 3W3AH 2V65A 4PX5A 4W8OA 3T5GA 4PZAA 4KYUA 4OSEA 2HDWA 2Y99A 4GMKA 2PCJA 5FBQB 1P1BA 1T1GA 1W6RA 3LY7A 3GA7A 3NALA 4L02A 5DWVA 5IF9A 3IKJA 4JI5B 1OT3A 1K6JA 1L4MA 1AOXA 1T13A 1BYIA 3AIIA 3EY9A 2DJIA 3I92A 3ID6C 4TMFA 3JATB 5K2MA 2GTPA 4HD8A 1RDFA 3P9XA 4KIJA 1R0XA 2QQGA 4BGUA 5HRUA 1PT6A 4XFDA 4Z4EA 3CRZA 3ISTA 2RGXA 1A7KA 5JISA 4MDEA 1XN4A 4OMFG 3GFPA 1AMOA 1ZK0A 1E2KA 3GMDA 2A5LA 4D4JA 3RG8A 3ZVMA 4U6NA 2VPYA 2BHNA 4IFBA 1HE8B 1LRLA 3A3YA 1G8MA 2PQ2A 3G2PA 1Y8RB 1L1QA 1XZEA 3RC9A 5A9SA 3GLIE 4JLUA 1ODKA 2MR6A 1QANA 2NZYA 3ZC3A 5KKNB 2CFTA 1J06A 1VGRA 4QQNA 2Z4SA 3OZVA 1SUWA 5ALJA 3SJZA 1EUYA 3EOZA 3H2SA 2UZ3A 3L1KA 2BSAA 2FPWA 3RYHB 2WAXA 4ER3A 3FYUB 1TTTA 2C04A 3G9QA 4TROA 2WU0A 4DMMA 2X8LA 2GHIA 2R79A 3D81A 5WRFA 3TECE 4TTTS 5ECWA 2RSLA 4TZTA 2TMDA 2RGWA 4MUFA 1KZHA 4BBZA 5LZ4A 3ITNA 2O50A 4KGVA 3JQAA 4O2BB 1Y8QA 5LKAA 1GL7A 5DHAA 5E6RA 5FR2A 4AY2A 4AP9A 4YREA 4YO7A 1W0CA 2PA3A 1K2VN 1E7YA 3C4VA 3AF5A 3TH5A 3ZIDA 4KXMA 1CF9A 4PC6A 3SDSA 1CY1A 2D59A 1LPNA 1V11B 2GASA 5BMVF 3IRVA 3RFXA 1R9MA 2GK6A 2VZLA 1GUDA 1Z16A 3OCWA 4PE5B 3T7SA 5K3FA 2HYDA 2XA2A 5KYUA 3FLAA 4F6RB 5B3KA 5K0EA 1YRQA 2JIBA 2PIAA 5K0TA 1UJCA 1MXHA 2BRUC 4IRXA 2YFQA 4KB5A 4BZWA 3VR5D 4ZVSA 3ENNA 3QPCA 2QTHA 3DZ8A 4I5IA 1Q1ZA 1KIMA 1NWHA 4RUKA 1E1CA 5CCDA 5JOQA 1W581 3OPMA 4HWGA 3BULA 4JROA 2TSYB 4YCAA 1RM3A 3PZRA 4D46A 3MAJA 1AT1A 4ETWA 1V6SA 2UZ1B 4JD5A 5EJ2A 1U7TA 3KWJA 3OAAA 3PEEA 1QBGA 3PDJA 4M7WA 4AUEA 5C1DA 2P90A 3DR3A 4RD2A 2W6NA 1IXSB 1JWAB 3CW8X 3EXHA 2HRDA 4EX6A 2LWIA 3ZZUA 1XZFA 4J49A 1GP2A 2ATIA 2H1FA 1KK2A 5U1PA 4O08A 2G5GX 2B4KA 1FRVA 1XTPA 2XQFA 2FVYA 4OHCA 1RJDA 2LVBA 3MCAA 4PYLA 2RGRA 3J7AC 3LUCA 1UDCA 2F4NA 3CURA 3B5JA 3KB2A 4L72A 3NNSA 5KYWB 1XKQA 3I5XA 2IOYA 1PNRA 5LZ9A 2HMSA 4QDZA 5FFMA 5BV2P 1AUQA 4W9NA 3AHJA 5B7GA 5AOCA 2C4UA 4MV5A 1XMSA 3IHTA 1Y48E 3D0QA 1QHHB 2PFGA 5H3LA 4EI9A 3VDRA 3VO1A 2HU8A 2ZJ4A 5GV7A 1OCEA 4CN9A 4EUFA 3HPRA 2J09A 1T9AA 1NNUA 2YX1A 4ZQBA 3VAAA 2ERYA 1KR5A 1JIJA 3UTDA 1H0HA 1RXYA 3B1XA 1L7XA 2Z2YA 3R7DA 1C0IA 2XZTA 3UF0A 5DHQA 1DCTA 1KFBB 4Q9KA 4HZIA 1BOOA 1ZIDA 2B8JA 2PCLA 5AHXA 3PGVA 1ZZEA 4F60A 5T4HA 1THGA 3L4JA 2BE7A 3JQ7B 4E5UA 5EPEA 2X9LA 3EDRA 3L7CA 1WUTA 1FSGA 3ER9A 1OI7A 2QX6A 3W2EA 4FFLA 4PG6A 1O4WA 3WIDA 5CFPA 4PNHA 4XQGA 4KQJA 2REOA 3OE7A 2OCXA 4EB6B 4YUYA 1Z08A 1C7FA 2WG0A 3PJFA 4UZEA 5A04A 2EFEB 4FILA 3CH7A 1W9MA 1Z5NA 3K2BA 4BV3A 4GWLA 4RD4A 5IJAA 1AX9A 1NXTA 1PV1A 1F6DA 1GGJA 1R6TA 2QROA 3GGOA 4GLFA 2CN1A 2JFXA 3UJNA 3KKLA 5CB8A 3AKYA 2F64A 4RQAA 1B74A 1A5ZA 2WT9A 4RPHA 1JLHA 1VHTA 2JPDA 2REQB 3GVCA 5EPOA 2GXUA 2CLEB 3HP1A 2YJGA 4ZQIA 3D2CA 1OI4A 2NYRA 1NXSA 1LI4A 1OC2A 3QY0A 2H31A 5BQFA 2WZBA 5G4LA 1OB5A 3BMQA 4FGZA 5SYAA 1ZINA 4NPHA 5TMPA 3H6HA 1YH3A 4CQMD 2PNFA 1R6BX 3R23A 5K3OA 1BGVA 3I39X 1KF0A 4U8HA 5BYJA 3TX2A 2Q46A 1WUKS 1GRQA 2RH9B 3W06A 1W36B 4PS0A 3D3QA 2NQ2C 3L8FA 2D5AA 3QHPA 4I3GA 1R8JA 1RLUA 1P0FA 3GGGA 5CNJA 3TL2A 2FRXA 3BGSA 3DDOA 1DRJA 2H63A 3P19A 3R3ZA 3TTVA 2P67A 3WJAA 4A8HA 3A1UA 4Q02A 4WEQA 1Z0IA 4RSHA 3MHPA 1L5GB 1J20A 5SZJA 3FFAA 3PQCA 3UEOA 1NI4B 3WV4A 5JH7F 2VYND 1HDGO 4II7A 4MB0A 1NJ8A 4ZAGA 3WI7A 1RRCA 1AN0A 1YJ8A 1YE3A 1L4NA 1D1QA 1KA9H 2WIJA 1QDEA 4FSXA 1JZSA 4JR0A 3SQNA 2JB9A 3URMA 3O1JC 2AG5A 5CFRA 5JHHB 1K08A 5TVGA 1T4MA 2RAPA 5E6UA 1IUOA 1HA3A 1X74A 3PNMA 5FLEX 3UGQA 4K9NA 1RHMA 1O1YA 5IAGA 3UMFA 2Y1LA 1G18A 4DCUA 4Z7JA 1R0SA 1XEFA 1HFWA 3GT3A 2ZPAA 4MYRA 2XOKD 3P4XA 4FJ2A 4JY7A 2OCAA 2AW3A 4OUKX 4TMXA 4B7ZA 3NOQA 3PENA 4GOKA 2IBSA 4RSGA 4UUAA 4UNNA 5EWJA 2W6ZA 2WM2A 3EIUA 4X93A 1TZJA 4R7ZA 4DMHA 1I1NA 1NT4A 1T5OA 1C1HA 2HWXA 3MJVA 3ASZA 5ERYA 1ZMOA 1Z2NX 2JANA 2QLBA 4E88A 5HS6A 2AEEA 5DN6A 1EM6A 3D9QX 5M34A 4FN5A 5EIEA 3M89A 5I9MA 1B4DA 4WH0A 2L2QA 1GCUA 2PR2A 2C4TA 4QZVA 1N2OA 2P27A 3VR6A 1FB5A 2XYRA 3F46A 4CF7A 5FTMA 2H9YA 3SJ7A 221PA 3PNYA 4RANA 3EVCA 4J6FA 1XRQA 3BZBA 5BXQC 3MT9A 5AIAA 1EXMA 1E2HA 1EX1A 1T15A 2X58A 1ZC4A 2DYKA 2XDAA 2Y8EA 3CMCO 2C8KA 5AK4A 1ZVKA 4BQIA 2X2OA 5JFTA 4OIMA 3BXEA 1L7QA 2I2FA 3IMGA 4HFRA 5C7YA 1ZUNA 1JR4A 1P9NA 1NVWQ 2ISSD 2OCYC 3IHWA 3ONWA 4JBXA 5ALHA 4W7IA 3RRMA 4F4JA 3BZWA 2C20A 2YXNA 1ZK2A 4POAA 5EI5A 1HSZA 2JFHA 1XL1A 3WMXA 4EPTA 3NHBA 2YHBA 3DDNA 2IOHA 3M5DA 4JB3A 4BFUA 4IDQA 5JFOA 1VE1A 1GFSA 1WUHS 5DM2A 4CT5A 1GKYA 4MWBA 2PZKA 4C04A 4DSZA 4NECA 1FYFA 4CKWB 4Q16A 2WUVA 3VTAA 1G1MA 2HT1A 2AXPA 5FI5A 4C0LA 3AU9A 4MPRA 2WTUA 1G4HA 1RLOA 4INJA 3SHWA 1QGUA 4Q12A 4LY0A 4QOSA 3KNZA 4DLXA 4HVCA 4NV1A 2HI0A 3D7NA 3T1TA 4KFCA 1TMYA 2WF5A 4ARSA 1PJCA 3FF1A 4KQ1A 5DBGA 1RAHA 4N6OA 3LE8A 3EEIA 5FXMA 4UTXA 3GT0A 2ZYWX 4B3JA 1XLUA 2DY1A 1O96A 4JT2A 3H8SA 2FUKA 2P78A 1NGSA 2X6RA 2PGJA 4ZOLB 5EXXA 5DPMA 3T1QA 1NU6A 4G5RA 3TJZA 2QRVB 3ASVA 2XYPA 4DUYB 3FMOB 4AG5A 1QDLB 4XWGA 3IEKA 5THKA 2V5UA 4J4BA 4CKYA 5I9TA 1OHHD 1VJDA 3DMYA 1SPXA 3DDSA 3ZJ4A 2Q6TA 4A26A 3OQ1A 3B1YA 3QPDA 5HF5A 5KYYA 2NTVA 3F6PA 3HKCB 4CCYA 4JOCA 4JIGA 5CNKA 2WUFA 2X3YA 3ESQA 4EYOA 3I5YA 5JALA 2C82A 6ABPA 2DQSA 3JAMA 1HBJA 3T3GA 2BFCA 5EMHA 1SCJA 1YQEA 3ZIAA 4Z3KA 2QR5A 4F2WA 2UU9B 2F9MA 4MVYA 4P0QB 2X5XA 4UNIA 4AMYA 1BO6A 2YXPX 2GF0A 1K97A 1W87A 1QHYA 1CRZA 2C9CA 2PT6A 2DBYA 1CRPA 5I5GA 4RDCA 4HVAA 4YRZA 4M49A 4REMA 4YDRA 5KJCA 1INLA 2HQOA 5K5EA 2IUUA 3QKRB 4UOEA 4JI0B 1I5RA 1O6FA 1I2CA 2JI9A 1YAHA 1T1JA 3VPCA 2ZDQA 3ZH2A 1BX1A 4CQLA 1UXHA 6ADHA 5A4IS 4LBWA 1CQWA 1QQ6A 1P18A 1JLMA 1GTMA 2BMEA 2Z3WA 3AI2A 4PN7A 3ICOA 3PVCA 2X15A 5JCJA 1NNI1 1BFUA 2ZIEA 3CIFA 3QLTA 2C61A 4DIDA 2WINI 2QW0X 4L57A 4E5DA 4Q3OA 1N9GB 3D4PA 3GZTB 3Q5DA 1AUXA 2G9ZA 4XDGA 4RCZA 1FX0A 3NRBA 4MJXA 5FL3A 2WA1A 1ODLA 3PG5A 1IPFA 3SX2A 2UUBB 2C7BA 4IXDA 2A9QA 2PFSA 3HCAA 2WVHA 3JR3A 4PLPA 1XTUA 2CMHA 1AQJA 3RVLA 2CLLB 1E58A 1VC2A 3OJWA 3E7DA 3QBVA 4RHTA 3INTA 4MVJF 5EQJB 3ZWAA 4DLZA 4PG5A 2ZSDA 3PPXA 1AZSC 1C9MA 5IXSA 2BJWA 4P4TA 2EJUA 3HY3A 3MOIA 4RF3A 3TXYA 4QUEA 3QY9A 5FUBA 1VE5A 5C1OA 1MC4A 3FHJA 2F43A 2I33A 1C0LA 3LPLA 4JITA 4MKZA 3UWKA 1TDJA 1FYEA 2AS0A 2V7TA 4K9LA 3VNAA 1IN7A 1XZMA 4W9RA 4H16A 4KPFC 2ZIZA 3T95A 4YR9A 3DM5A 3CF4G 1Z7EA 5FJIA 1KEWA 3EJ6A 2PTHA 4TN1A 5TQ0A 3VHRA 4CV0A 4NZPA 3L7YA 3FUCA 5DCWA 4PPFA 4EWLA 1MHTA 3ISJA 5DCYA 3LF1A 4OHYA 3M83A 3GCGA 4YHHB 2WYVA 4I1VA 5C7LO 3NHAA 4O5AA 1KJQA 1N75A 4TXJA 2HNBA 1J8YF 4M1SA 4ZCLA 1C9EA 4RVNA 2Q8NA 2ZI4A 2Z1NA 3PDHA 2I2BA 4IIGA 2VAPA 1YR6A 3LBAA 4JC0A 1REQA 1HDRA 3N0XA 3ZQ6A 1P45A 4M8IA 4UVDA 2BZSA 1CQJB 4MYSA 4MEJA 1SUCA 1AC5A 3I52A 3O38A 3QQ5A 5ALEA 1YSCA 5M04A 1AQ6A 2BGLA 5DNAA 3EPKA 2HF2A 1QIHA 1GZHB 1MTOA 2ETVA 2E18A 3QYAA 3TE6A 1FFHA 2HK9A 4V1CA 3KQNA 4KR6A 1YE5A 3CISA 4GFDA 2B6NA 1R4MB 2O9JA 3K31A 4GWKA 4EUHA 4NYMR 3T0FA 2GZHA 4W8GA 4C7OB 3OU6A 2OESA 3E3NA 2BKLA 5CBKA 2QL6A 3IVRA 3PHJA 5H9VA 5IASA 2F3RA 5BR8B 5EMMA 1PQYA 1UJ4A 4O25A 5EWLB 1NSYA 2CNDA 2FY8A 3TR0A 3ISVA 1N36B 2QUHA 1QIFA 1K92A 4M9XA 4PGFA 2R6HA 5CK5A 4ZVLA 5FAKA 1HT1E 4CM4A 3CNHA 4XR9A 1SCNE 1EA7A 5ALYA 4LJ7A 1U0RA 3TZCA 4EI2A 1KTIA 4JS0A 1SOVA 2HJWA 4QOFA 2OZEA 2EFYA 2OSVA 4I4TF 4X1KB 5DK4A 1GN8A 2H1HA 3RRZA 3GVHA 1Y6FA 3L4EA 4QREA 3IYLW 3ZY5A 1I2MA 1II8A 2G4VA 1I0ZA 3KE8A 4LC0A 5KNBD 4NU5A 4NY1A 2FXVA 4IVNA 4OHOA 4JT9A 2CE2X 4DQUA 3ZNPA 2NUPB 3RTBA 4LJKA 4WNCA 1E3DA 1P2FA 3I2HA 3P2MA 4HWOA 5KNBH 2W58A 2MSNA 1V1JA 1EUCA 1V8DA 2A0WA 2JJ8A 4QPDA 4RO0A 3TMYA 3ZHOA 1N6LA 4C4TA 3OLVA 1D6MA 2EG9A 2HA4A 1TJ3A 2VNJA 2WOOA 5TVKA 2GJ9A 2L18A 1CNMA 3D8BA 3KJNA 5JO9A 5LYJA 1CVLA 5EHZA 2VRNA 3G5MA 2QX7A 5A9TA 2BFBB 1SCAA 1V47A 1K7SN 3IMFA 1TC2A 3KO8A 3TB4A 3AM5A 3EXG1 3WC4A 1N5DA 4ZAFA 1ZGHA 4J0HA 4ZDWA 3L84A 1T9CA 2ZUWA 3P9RA 3LX5A 4BEBA 1GXSB 1CR0A 3A26A 3VFDA 2ZJAA 3WWEA 2I7XA 3UKOA 3O3CA 1E94E 2GRAA 2XIJA 3GCDA 4YA6A 3RC3A 7GPBA 1YA6A 4I6JA 5ARBA 5SY6A 1TO6A 4LHVA 1C14A 2GFIA 4R51A 5J5VA 4AIIA 4BJ3A 1BXRA 4ENSA 3W1WA 4K9OA 3HU3A 4GI5A 1B0PA 4B79A 1JKXA 1XPOA 3NVDA 4WDRA 1CB7A 3UMYA 1O03A 4CTKA 3RVPA 2B7CA 4FUQA 1HL7A 1ZD8A 3DW1X 3I0NA 1ZN2A 3U31A 4YRMA 1D2GA 1SHLA 5KINB 2GR9A 2PT9A 3GIWA 3AOEC 4JL6A 1U2SA 4FHCA 1VSQA 4IQ0A 1LI7A 4YWHA 1B0UA 2R751 1GGKA 1ZAKA 3SS7X 1JKMA 5I9IA 4MAMA 3CVVA 2ZRHA 3LFTA 4NPAA 1ODJA 1D3AA 2VNHA 3CLUC 4R05A 2AVNA 2WC1A 2AF4C 3EQ8A 3ZLTA 3U61B 4P1ZA 3TG2A 1C4KA 1J2TA 2QTNA 5FRDA 4NAUA 4B3SB 3GHYA 1UPCA 2X1LA 4O2AA 2HMYB 4X1IB 5D7BA 2BFAA 2WSBA 3P9NA 4QU8A 3EDOA 4W6QA 4EO7A 4KQMA 5F77A 1I9GA 5FHQA 3VSCA 2VPQA 3VU8A 3MUOA 3EHDA 2XKAA 3JV7A 2PNJA 2QE6A 1X6VA 1TZCA 4PQYA 3ZBQA 3QWBA 3DE7X 5P21A 2W98A 3C5HA 1XB2A 2GD2A 2O7RA 4J1TA 3QUCA 5D3ZA 3ZQUA 1BWRA 1MA0A 1U2DC 2Q28A 3FNEA 1U9IC 1SUPA 4QJBA 4G2TA 2QX4A 4TWBA 2GCGA 5EJIA 1XZIA 5AW9A 4Z8YA 4R3NA 3A1CA 2N1BA 3WICA 4YLYA 4YCLA 3T3NA 1Y5MA 4DS3A 1BQ4A 1VKZA 4JMLA 5DSXA 4WXMA 3NT5A 4IJVA 2C7PA 3TIIA 821PA 3KAPA 3WSVA 2WWGA 3RQSA 4CT0A 4XJTA 4NBWA 1JIKA 4EARA 2CXRA 3PC8C 2BFFA 4WBNB 4I9NA 4UCXA 3HUEA 2FPIB 4P86A 2XZOA 1LC3A 1ZD5A 2OORA 2R1TA 1RADA 3EHEA 5FX2A 1LD3A 3EISA 2PSHA 3RSLA 1X1CA 3KT3A 4ENRA 2O8BA 1MPTA 3VKUA 2EYUA 4X84A 3NGLA 4RVSA 3ZU5A 2JVIA 1WM1A 3A1WA 5AM0A 3RF6A 2A5DA 1YB2A 3ILXA 2DY0A 4N3BA 3TIVA 4W7SA 1Q15A 3N86A 1YB5A 3QU2A 4C14A 1A96A 4U9UA 3G0BA 3PCTA 3GPDG 1ISIA 1RMYA 1ODSA 2GWHA 3I8SA 2PZLA 4DUGA 5K0ZA 4MB2A 1MFPA 5DBIA 1VQ1A 1HTWA 1OMOA 4HCJA 4BB6A 1RYFA 1QHFA 2V5VA 1FUYB 3Q7EA 3HKEA 3ROKA 4DAEA 1MHPA 1CY7A 1SVWA 2O8CA 1Q1QA 2AJ8A 2KSQA 3C87A 1APBA 1WXGA 1HYGA 1PU2A 2HEGA 1LRJA 3AERA 1RYZA 4XDYA 1TI7A 1VKHA 3CNBA 4AMVA 3DVAA 2V9PA 3I9JA 3ZWPA 1GCAA 3NASA 1F7UA 3VKVA 4DEYA 2XXJA 2JDID 1H66A 4Y2HA 4IFEA 1EXVA 4L74A 5IH3A 1G7TA 4TKZA 1P31A 3TMKA 4QTYA 4FCVA 4BGEA 4MIOA 1A76A 1G16A 1UDXA 2DWCA 2JLCA 1IEXA 1DJNA 1N2EA 1Q3HA 1M2HA 1ZUWA 2IP2A 2P1RA 4Q39A 3RYIB 4E2ZA 4NZNA 3MHTA 3WMGA 4PHFA 4EAAA 5KVSA 1U4OA 1UXJA 3ANYB 3UHFA 4CMEA 1F12A 1J6UA 5HS4A 1E1NA 3EFHA 1ZK3A 2C83A 2EDCA 4M36A 5FWYA 2JLWA 2IODA 4LJ8A 3UPDA 3IPCA 2ZU6A 3O4VA 1I2AA 2Q4TA 2PX6A 3RRBA 1X7WA 1ZCBA 5HZGA 5CLJA 1DJQA 3PXDA 1S9HA 3RV4A 4KIWA 2IX3A 1KGSA 1I32A 3RODA 5IZCC 4C6RA 4LFAB 3CN7A 3HVHA 1K9SA 4BP8A 3GJ8A 3F3KA 3QENA 1CF2O 3SDZA 1DDOA 4URFA 3M6WA 4Y2VA 4B6EA 1U8UA 4TLEA 5D84A 4FBLA 2G40A 3GQBA 4BE7B 1BE0A 2HQSA 4MMZB 2I91A 1PZEA 1YZFA 5FQNA 3OHSX 5FNVA 5IWAB 4W5RA 1PJTA 1TOAA 3CM0A 1QE3A 1YQXA 1K2WA 1CJSA 1R5JA 2IZ7A 2OAEA 3C7TA 4KDRA 5DCLA 3ZU3A 1KH2A 2CBGA 4DARA 3ZGOA 3Q40A 4WV3A 4KQWA 4HUQA 3SVZA 5FYQA 3RIEA 1UPTA 3AHCA 2O20A 3FPEA 2WTXA 3UJPA 4GOJA 1GA4A 2X5JO 5BNZA 5E9AA 2DPHA 3LO8A 3OZSA 4JJ4A 2VXYA 1QC5A 4YBRA 1DX4A 3DPUA 4UDNA 3I5UA 4UU8A 5EUMA 2X8JB 1A1VA 2BN4A 3PEFA 2HIAA 1N3BA 3CVOA 3H75A 4UBMA 4X92A 3WGJA 2ODEA 3G5LA 3ZHYA 4EY6A 2BC9A 4CIAA 3ZDEA 3CXUA 2ZYRA 1VSVA 1X94A 4OATA 1NBMD 2H8KA 2V45A 3G7SA 5IULC 2LUOA 3IESA 2MU1A 5ED4A 2ZUTA 4A0FA 1LSUA 2E37A 5H7XA 1Z0KA 2ZOSA 5FFFA 4A23A 1WS6A 3M4XA 4ZI7A 1Z5VA 4ZRMA 1H2YA 3L18A 4LQLA 4LRWA 2BFMA 3GJ5A 2IEGA 3QVTA 3HU5A 4WCVA 1OLUA 4FYJA 5IM4F 2VXBA 3Q3HA 4G63A 3KFVA 4JQYA 4IICA 1XOIA 4EPYA 5ULLA 1XXHE 2A7QA 4ZCRA 1GUBA 1GPJA 2AHOA 2K7ZA 1KY4A 3IOCA 3HL0A 3MD9A 4EG3A 2GYYA 3O4HA 1QLHA 2EX0A 5DLQC 4C9BA 3ZVLA 4CM8B 1TQ2A 4O4HB 4ZN6A 3ZX5A 2QJWA 3JQCA 1NI5A 2PX8A 5KO2A 2HF7A 4RGBA 2XD9A 2WP0A 2J5KA 2G5TA 4OXQA 4OTZA 4KPYA 3D2AA 2AYXA 3ET5A 3OZAA 1QJ4A 1V9LA 3H9EO 2A4KA 2RHOA 3O1IC 4MZXA 1BD3A 4RH1A 2AW5A 5TXGA 1ONSA 4FSHA 1E6KA 3IP8A 3KPUA 4Z7QB 1TB4A 3F8TA 2OV2A 1M6EX 3QBTA 3ZUGA 3KVOA 2ZI7A 3OZDA 4HNHA 3T5TA 1LF0A 2P1ZA 2QS9A 4RJKA 4MUEA 2ZM5A 5ALWA 2J85A 4PICA 4WUVA 2CUTA 3U9LA 2H2FA 1M2WA 2J6HA 3V8MA 3N2ZB 2ZIXA 2ZVDA 4IH9A 1QVZA 4X91A 1T4DA 4K1LA 1UKZA 3PNKA 3MBKA 1D8TA 3H2GA 2IH2A 3FVWA 2B0JA 1WPRA 1XZKA 2JGLA 4BNLA 5B1YA 5JDIA 2QWXA 3HLTA 1CT9A 1EGQA 1PEKE 3U0BA 4W5OA 4DB4A 3LZ6A 1UL1X 4B75A 4AN0A 1Q22A 2EXXA 4M1WA 1NT2A 2C2BA 5HDBB 3AEKB 2VEDA 2VDWA 3B85A 4GNRA 3LX8A 5FBLB 5T64A 2RAVA 2G80A 2ZBEA 5L3QB 2PRJA 5LLTA 3PYLA 1AS2A 1F7VA 1JTEA 1V48A 3EQZA 4IDNA 5DHRA 2P77A 1X39A 3H83A 3OY7A 3CNLA 5TE9A 4KNVA 2ACEA 1QIJA 2EERA 4WASA 2GAFA 3ROZA 1KMIY 1V8BA 4N5IX 3CZPA 1DBVO 3ZCXA 1PJ2A 4EI7A 1YL7A 2IFTA 2XCTB 1D1SA 2FMUA 2P4QA 3INNA 4HQ6A 4FYPA 4AROA 5JNWA 3HYSA 4MW4A 4ZCIA 3MGCA 1HNXB 2RGDA 2FWMX 1AKVA 2O0HA 4BFLA 4E2FA 4A8TA 5AW8A 2I2DA 3FZYA 3GL9A 4XXHA 3E9ZA 3K96A 3OZIA 5TEVA 4JU9A 1BEZA 4V0LA 3O1LA 3EEYA 4HDMB 1BWSA 2I1WA 1NZJA 1EM8B 4XWYA 1JXQA 1U9ZA 4CEHB 4MCAA 4Y2JA 1VSBA 3G82C 5EXDA 5JU6A 3RS4A 3QPUA 3DB1A 4PWYA 3HDYA 2ZYTX 1WCIA 1XJ0A 3T9CA 1N1MA 2HK6A 4O2BF 1T8SA 3ZD7A 1SD2A 4E5MA 1WCXA 3L1JA 2NU6B 1X1EA 4GPD1 5JS1A 4D96A 1UK8A 1EE2A 3FNIA 1KI8A 5FJJA 4LTMA 3ZR4B 4YYZA 3LCVB 2JIRA 4B7XA 1FDUA 3IE2A 3QE4A 1NVFA 1K06A 3UM9A 3S2GA 5HF6A 1DAPA 1O95D 2WEKA 2YIVX 3NONA 1NX9A 4FCWA 1NE2A 2C98A 3QXCA 5TX7A 3DNFA 1DHRA 3GMIA 3KQQA 1DEKA 5GADl 2XNKA 1KAQA 5G0UA 9ATCA 1WDKA 4Z3OA 4WOBA 2ZGVA 1BX0A 5D1NA 3MQ4A 4DWJA 5KHLB 2OO3A 2V6BA 4UPEA 5ISMA 3D7LA 1FW8A 4J29A 4PG7A 1QGDA 3K20A 5ILGA 2DMRA 4M0EA 3ND6A 2DUUA 3CR8A 4HDKA 2HWKA 5EXSA 3IO5A 3S2YA 4D5GA 1HURA 3AJ8A 1BU5A 2JLUA 4KXUA 4KAJA 5HMMA 4RWZA 2XZPA 1C9YA 5EKSA 1C30A 1JA9A 5C9ZA 3OJEA 5GZ6A 4BO9A 4DLNA 5C46F 5B4UA 3ZVNA 4I8DA 1WF6A 1B8OA 3FI0A 1P29A 1E2FA 3OOJA 2O2DA 1H5NA 1RWMA 3Q7TA 2Y05A 2JIOA 1E89A 2ST1A 5JZBA 5I45A 3WQRA 3IKLA 3L3BA 3GZNB 1E61A 1M33A 3ZIUA 2V0NA 5CP8A 4H6XA 4E5NA 3RLFA 5KOYA 2EFGA 3A10A 1TX4B 5BSHA 4J0QA 4R0MA 1L0BA 1YWGO 3A25A 5JMWA 2OKGA 1QPZA 4YAGA 4B5LA 1HNZB 4WY8A 3S99A 2BE9A 4MVJD 4CKZA 1GZSA 4YJDA 1D4OA 3D3JA 4TL8A 4CLRB 4AKIA 5DWQA 3G17A 1UKCA 3WA7A 3WLPA 2D1YA 2FKNA 3E82A 3OQ6A 4MVJH 4PBRA 3AESA 4AMZA 3HA5A 1NDQA 3O8BA 4PW0A 4A6DA 2VQDA 4BP3A 1DAKA 2B3DA 4O59O 1NV9A 4NK5A 3ABRB 4Y2QA 1E3JA 4EHLA 4LGVA 1ZAYA 2YFKA 3BG5A 1ACJA 2OZLA 1TD1A 4AICA 1N2CE 4XYBA 4DADA 1QH8B 1NJSA 1WCYA 1GSOA 3NBUA 2BI7A 3L7AA 3QKTA 3KYIB 2OM2A 4GO1A 3BH0A 1ZPDA 4DRYA 1C1XA 3PGJA 3PGA1 4C4AA 3BOSA 2VSOA 4ROSA 4F86A 1LPMA 3OVMA 4IJ6A 4EA6A 4C3OB 4RZHA 4NS4A 4QGBA 5EUCA 1FFBA 5K3AA 1ZNYA 1OREA 1TCUA 3S2EA 3I9FA 5DB4A 5IUKC 3WMRA 4FMCB 2G77B 1IEVA 3HS3A 3PUVA 4MAAA 5JSKA 3VPGA 4H7IA 3EMBA 4EYGA 1KAOA 4KQ6A 4Z0PA 4DSAA 5ENDA 4H17A 4NJMA 5F1OA 2H4FA 4PPYA 4H0FA 4RS3A 3IJEB 1SBCA 4ZAXA 5KNDD 1PG0A 1X92A 2OHOA 4I5FA 4QBKA 4WACA 1WV1A 4CMCA 2QUJA 1VM6A 4BNNA 1YZVA 4B6SA 2MWMA 3CSDA 1D6SA 1JIQA 4FLEA 1FTGA 2RHLA 4PV7A 4REQB 1C7JA 2HEIA 2NTYC 3LWZA 5TS3A 1RXEA 4XQEA 1ZRHA 3IA7A 4JBLA 5LBUA 4CGYA 3O8QA 1HFJA 1X1SA 4H3HB 3KYCA 2PLRA 2JGAA 3VJKA 2FSFA 4KTVE 3G59A 3DCYA 3QU7A 1SBZA 2F48A 1D7OA 1SIUA 1W85A 3O74A 2R1ZA 1U9YA 1EX6A 1GTVA 3CUTA 4AW9A 1HFEL 3GF4A 1F4VA 1ZU5A 1OZ0A 3ZBTA 4I66A 4ISBA 2C5LA 3KJGA 3KSRA 3IXLA 4TMZA 2EKPA 2GTHA 4NICA 4U2BA 1X9GA 1K9VF 3T9DA 3P94A 5KEIA 3I6QA 3WZLA 3K0SA 3QTBA 2E6KA 3E05A 4CQJA 1Z15A 4EGCB 2ADMA 3HVUA 4RH0A 3WHLA 3DV9A 5DNWA 4ETIA 1XVAA 3PEYA 2WKPA 5AJXA 1D1TA 2FX2A 1ISRA 1FFXB 1OZGA 2CUZA 3KWFA 1XU9A 1LLCA 2C3UA 5SICE 1Z6GA 2DR0A 2GARA 3VU3A 1PZFA 4QEKA 3S1AA 3SEAA 3AONB 1I4EB 1NONA 3A14A 4K8RB 1TAUA 4IM7A 2Y0CA 4GE0A 2H8GA 2YOHA 3WGOA 1XR3A 2AH5A 3PRJA 5CTAA 4L15A 1SZJG 1AN9A 3OU2A 2VRBA 1PT9A 4MV6A 4MP3A 5FQOA 1D03A 3C6MA 4P4LA 5KWIA 4B6RA 1LPPA 1SU6A 3L8CA 1RBMA 3DLCA 2PT7A 1ORTA 1KI6B 3BRQA 2XTAA 3G1TA 1KSJA 1RYMA 1ZJ5A 2X8WA 4IXTA 1Z13A 2RBEA 3NC0C 5J23A 3N2YA 4Q7MB 4ZYWA 3EWIA 1HDIA 3LNCA 4E5SA 2D74A 4N0QA 2AI1A 4C0AC 4A9AA 3T5DA 1U98A 3KOYA 3U49A 1KDRA 1T43A 3OESA 4QPJC 2R44A 2WFMA 5TV2A 3CVYA 3FF4A 3CZMA 1NUSA 3KQPA 2BH9A 5COBA 3IQZA 5C31A 1T36B 1WBDA 2KWIA 1N78A 4Q34A 3LWBA 2QT9A 1XZQA 4RTPA 2VDPB 4WX2B 2QNIA 1RCFA 1JPJA 1EDEA 3OJFA 4HZUA 4ZREA 1A71A 3F7NA 2VT3A 1I1OA 1M66A 1NVEA 4I9UA 5DWDA 1DKQA 1SD5A 2QSZA 1UBCA 2NSLA 1KP3A 3LD9A 5CIWA 4PN3A 2O8DB 3A05A 3K16A 4EEXA 4WFIA 3WFIA 3K4PA 4LOIA 4ME6A 1BHQ1 1OI3A 3AM3A 1IZYA 3IPLA 4MW5A 1CF4A 3B1FA 4ZOCA 1N5RA 2X0EA 2A5JA 5HQ3B 2QJTA 3U3RA 1V25A 2XRMA 1OF1A 5EMKA 3EF0A 3RABA 3O91A 3VC7A 4R81A 4DXDA 1LK5A 3IKTA 2PUGA 4UM5A 1QAOA 2CMGA 4ZOLF 3N2LA 1PE0A 2J0SA 1SHTX 1BNCA 1M1YE 2FOIA 2QPTA 3GVXA 4B6GA 4EL5A 4X3OA 3KB6A 5DULA 4DAOA 5A6VA 4V3BA 1DKUA 4D56A 3KJHA 1WQ3A 2OGZA 3SSAA 3UWOA 1X7HA 3CPSA 5JAMA 2ZQ5A 1MW8X 2ZB3A 2Q5JA 1MO5A 3VZPA 3WNVA 1KQFA 3DOIA 2CLDX 1P9OA 3FPGA 4GNKA 5KWJA 1A9PA 1UQRA 3U4GA 5KYNA 4XWWA 3T7TA 4C3ZA 2XB6A 4CEJB 4PZCA 1NP6A 3K6SA 1TPYA 2D5IA 3A7EA 1M34B 1A2KC 4XIGS 5ALTA 3V97A 2C84A 2F9LA 3O8NA 2QN2A 4JNCA 3N7AA 4JJ7A 4RD1A 1GTL1 2WD8A 4TKVB 2C31A 1AQYA 1N77A 3UOWA 3AIOA 4J03A 3JRNA 4TS4A 3EVDA 2CUKA 2G9RA 2XYVA 2VP4A 2QM8A 3EVTA 2VS1A 1H93A 2IYNA 3EFOA 2Y0PA 1UBFA 3IULA 2R3SA 2V6GA 3FVQA 2H9AA 3IDOA 1CS4C 2YN2A 3RKUA 1EEXB 1YDGA 2BHTA 2ARKA 4UEKA 4ZZ2A 5ALIA 2J3DA 4TMTA 3WBFA 3E03A 2QAGA 1EK0A 4CM7A 4IZOA 3WDLA 3C1TA 3EFBA 1C3JA 1GAJA 1N2HA 1JXMA 1J0CA 1WDWB 2OCDA 4QO7A 4C0XA 3HCWA 4KKVA 2YJ6A 5HKAA 1M8PA 2XMPA 1A9OA 4KFUA 2D0PB 1GGMA 2RBGA 3L0CA 4J2HA 4TYQA 4Q9JA 5KYVA 4PLCA 5DYNA 5HIJA 4EA8A 1MAHA 3NPMA 2DEUA 3KAKA 4HNGA 2R8BA 2I99A 1JFFB 2R4QA 3Q3VA 4IIXA 1UWCA 1Z3IX 3GBPA 4B2YA 4HEA1 2F8TA 3BMCA 3DUFB 4ZXPA 2J9XB 2QP4A 1RXIA 3C3JA 3PWSA 3L7IA 1LXCA 3R40A 4I4CA 3RUHA 2W2NA 2A5GA 3QNUA 4QICA 2XNDA 3UAGA 2D1TA 4BO0A 4KNYA 4KGXA 1SQSA 3HN6A 3HXMA 1Y1QA 2D4AA 1M83A 2EKZA 4L6AA 5DZSA 1IATA 3M1LA 5KSZA 3T7DA 1XO1A 3WDMA 4CMIB 1ND5A 1T8PA 5DRYA 1CJVC 2H9IA 4DHEA 2GCOA 3ZS9A 3FNFA 1P1IA 4HAXA 3LCJA 3OZUA 1R16A 3EBPA 1OLSB 5ERXA 1SCUA 3KZNA 4P81A 3A7DA 5CA0A 4BMZA 1OTXA 3OO0A 4X97A 4QUAA 1V7CA 4UCQA 2BONA 4BPBA 2ES4A 5JQWA 1AJEA 2XVAA 1WP9A 4NMHA 1NN1A 2UVQA 4O4LA 1L7MA 2AUMA 4M9QA 1XQVA 1OLXB 4IYRA 4WK4B 4WNYA 5BVHB 2JJYA 2PL3A 4I5EA 4N8EA 4BE9A 3F2VA 5HOQA 1JHQA 3LW7A 2PRIA 2YIJA 1Z26A 4FOSA 1JV2B 3ZHXA 4GS5A 4D1YA 1Q5PA 4F0JA 3DHNA 3DEZA 4N3CA 1CULC 2H4YA 3MELA 3P9IA 3FTEA 3UT5B 4C0BA 4DMGA 5LL6P 2Y1DA 2BAGA 3AFHA 3SFTA 3GA5A 1GAEO 4PQFA 3IBCA 3ZNOA 4QC2A 1VMEA 4HBZA 4QOJA 4DKJA 3W6NA 2C58A 3DULA 3BEOA 1G8KA 3KZCA 2HJRA 1CUAA 4IY1A 4MHSA 1N7JA 4JB0A 3SEFA 1AKMA 2R7KA 4MV9A 2XVYA 2HWUA 3ZKAA 4DJAA 5EJGA 5JJLA 5LLSA 1NQAO 2EVWX 5KNLA 4O3FA 4C5BA 3U7FB 3MWEA 1H6BA 4WIAA 2VNIA 1N2IA 1ONBA 4GGPA 3QXXA 3NVAA 4HL6A 3RSQA 1EAMA 3TIGA 3KQKA 1UC8A 1D6JA 6REQA 1JHAA 4PSUA 1V96A 4P98A 2BEVB 5AJHA 2QL5A 1GADO 3MGBA 1QKKA 4L5CA 1NURA 3TEJA 5GZ1A 1EWYA 3MWLA 3R0XA 1QH1B 3JWJA 3ONEA 4EY8A 4RF5A 4P83A 3W6PA 1K5HA 1V95A 5DTIA 1L7DA 5IS2A 4FHDA 3SN6A 4KXVA 3HL4A 4ZJZA 1BHJA 5BSVA 2C8JA 3W9BA 1Z7GA 2A94A 2H11A 2VRCD 2I4LA 1V4VA 4YUAA 2P65A 4ZT6A 3H19A 5H1YA 1ZWKA 2YL2A 3O0DA 1G0NA 2P79A 1EJ0A 1ZOIA 3I72A 3FPKA 5B1DA 2NAFA 1JSXA 2QPLA 5DIFA 1EFCA 1ESZA 3P0IA 2E5WA 4XGNA 4NDAA 1L2TA 3FCYA 5LPNA 1JAXA 4ALIA 4GYYA 4RPIA 2CNNA 2BJVA 1XU4A 2DVMA 1YA8A 3P27A 1ZY2A 3C6XA 4DJ5X 3CRVA 3AXTA 1LLUA 4MPJA 4DGSA 1WDTA 4Q18A 3B3GA 5BN5B 2JI7A 2VK8A 2AQKA 4CKXA 2I3BA 2JEOA 2ODAA 4IFTA 5J2UA 3QPWA 4P54A 3MBIA 1VSUA 3AR5A 3GLQA 4FYVA 3AYZB 4HNRA 2ZPUA 3EXAA 3QPVA 4IX1A 2DWQA 1EKXA 2W2KB 3QOFA 2ETXA 1KOLA 4A5OA 1OWPA 1MV8A 1G6Q1 4HWRA 3DBLA 1M2VA 1H8ED 5EHGA 5EQTA 2HA7A 2PKRA 2FWJA 1RABA 2IXFA 3C6KA 2CVOA 2J9GA 4AULA 3B2QA 3DXFA 1JYSA 3WQSB 2X7JA