2V7EA

Crystal structure of coactivator-associated arginine methyltransferase 1 (carm1), unliganded
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
322
structure length
322
Chain Sequence
GYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE-ARGININE METHYLTRANSFERASE CARM1
publication title Insights Into Histone Code Syntax from Structural and Biochemical Studies of Carm1 Methyltransferase
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 94
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2007-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 2v7eA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2v7eA01
2Q41A 1BC5A 4GQBA 3TMAA 4PYIA 1IXKA 4GOLD 5JR3A 4ER7A 2JHCA 5KVAA 1O9GA 3OPNA 1RJDA 3FPGA 2XBMA 2B9EA 2QM3A 1SQGA 3G2PA 5HEKA 4HSGA 3M6WA 1NW6A 1TW2A 4X63A 2DPMA 3BUSA 3ELUA 3EEOA 3I58A 3G5TA 2B3TA 2HV9A 3KPVA 4FSXA 3KKZA 3FTDA 4LWOA 1NBHA 3OU2A 1NW3A 5T6BA 4PCAA 4F86A 2XVAA 4Z2YA 3TR6A 3KR0A 4PGGA 2EFJA 3TPZA 3A25A 1KHHA 1XCLA 3ELYA 3T7RA 3UJAA 3P2EA 2NP7A 2IBSA 4MQ4A 2IP2A 2XYVA 1KYZA 2AN3A 3G89A 4A6EA 3K0BA 2JG3A 2YX1A 3EGVA 4PIMA 3BGDA 3BWBA 3CCFA 4RVFA 3SSOA 3DLIA 5FQOA 2JH8A 2B25A 3PVCA 3AXSA 2VS1A 4HTFB 1KPIA 3P9KA 5GINE 3KU1A 2ZBRA 4C07A 3PT9A 1NW8A 2ZWVA 5E9WA 3G8AA 3CVOA 4DF3A 3PLAE 2UYQA 2FRXA 3FUXA 1R8XA 3Q7EA 1M6YA 2FCAA 3UJ8A 4GC9A 4AX8A 4QPPA 5T67A 4YV2A 4R05A 3G2QA 2NXEA 4QDKA 2IGTA 1KR5A 2P8JA 3M6XA 2XVMA 3JWHA 5EVJA 3EVGA 4RTOA 4E31A 1YF3A 4ER5A 3BKXA 5K0CA 1WZNA 3PX3A 4RVDA 4C4AA 1ZKDA 1ZG3A 3OZTA 4RVGA 4ZTBA 3DULA 1XDZA 4DCGA 1P39A 3LDFA 2GAFA 2ZW9A 3G2MA 4RWZA 1QZZA 5ICGA 5KYGA 1G8AA 3R0QA 2O07A 3EMDA 3KPJA 3R3HA 1WG8A 3KQYA 4E2ZA 1VBFA 1JG2A 2ZTHA 3A26A 4HG2A 4EMSA 1MJFA 2O05A 3GXOA 2QRVA 5EHGA 3HVHA 4GOMD 1EQAA 2PLWA 5K0GA 2IH2A 4IV8A 4MWZA 3A27A 3LDGA 1JR4A 2HNKA 3B7PA 1SQFA 2ZVJA 3CKKA 3M6VA 4GC5A 2NXNA 3PX2A 5CVVA 1Q0SA 1NE2A 3RW9A 5K05A 2NP6A 2ZIEA 3DXXA 3BWMA 1WXXA 4U7TB 2PVCA 2ERCA 5DM0A 3LSTA 4ISCA 4OQEA 4AUKA 3T0IA 4G56A 2OB1A 5LQCA 2R3SA 3P97A 1M6EX 3M70A 3C3YA 3FYCA 5M5BA 2IH5A 1AV6A 3ER9A 3VYWA 1X1DA 3BT7A 3E8SA 3NWBA 4FT4A 3GRYA 2P40A 5P8WA 4CTJA 5KQSA 4M37A 2B78A 3OZRA 5E9QA 5HZMA 3TOSA 4HGYA 4NECA 2XYQA 5FWAA 5K0FA 5EOVA 3UJ9A 2HTEA 4OBXA 3E23A 3EVAA 3MB5A 3NTVA 4K6MA 1YZ3A 1QYRA 2BR3A 2YQZA 3A7EA 3JWIA 3OCJA 1QAQA 3HTXA 2I7CA 3SVZA 4RTKA 2UYHA 2OBFA 2G1PA 4FGZA 2AOUA 2FK8A 1KIAA 1ORIA 3HA3A 4P7JA 4YUVA 3T7TA 2V74B 1JTEA 4POOA 3CC8A 5F2NA 4BY9E 2PXXA 5GM2A 2IDKA 2IIPA 3B89A 5ERGB 3BXOA 4RTNA 5EGSA 3FUUA 4GUAA 1KXZA 1AF7A 1HNNA 5E2BA 5C9ZA 3DOUA 2HR1A 1EG2A 3P8ZA 4PONA 4EK9A 5DRYA 4XUDA 4ER6A 3SSNA 4LWPA 3EEYA 1Q0TA 4H0NA 1KP9A 4V0RA 1JQEA 4PYJA 5ICCA 2NXCA 5E9JA 3LKDA 2AOTA 4XUEA 2H11A 5ICEA 3KHKA 3AJDA 5DXAA 3HA5A 5CUQA 2V7EA 3IYLW 1G8SA 1PJZA 5H02A 1O9HA 1JSXA 1XTPA 3C6MA 1DCTA 9MHTA 4FP9A 2OPBA 3JWGA 4O29A 1YZHA 3E7PA 1RJFA 1VP9A 5KS2A 3DMFA 4C06A 4QTTB 3SX0A 3PTAA 3UZUA 4GF5A 2KW5A 3I9FA 1FBNA 2GB4A 1VQ1A 2AVNA 2OKCA 3NWEA 4P7GA 4RTQA 2N47A 4QDJA 3HCBA 4YUXA 1G6Q1 4C05A 3OU7A 3S68A 2AOVA 5ICFA 2P3QA 5FA8A 3DTNA 2NYUA 1KPHA 1L3BA 2JH9A 3G7UA 4HH4A 3O7WA 1WXWA 3MTEA 5DX1A 3GRUA 2OB2A 5E1OA 2AOXA 2Y1XA 2P3LA 2QY6A 2R6ZA 2CWWA 2Z6AA 1UFKA 2PV0A 1U2ZA 3LKZA 3OE5A 4ATNA 4PIPA 1R18A 3KPYA 1XVAA 5DM4A 3MGGA 1NT2A 3P9CA 5DTRA 5HIMA 3T7SA 5BW4A 3VSEA 3UJBA 5MHTA 5F2KA 4LG1A 2IPXA 3NDIA 4FT2A 1H1DA 5B1SA 3RODA 4RTPA 3SSMA 5DTMA 1VL5A 5BXYA 3FTFA 2CMGA 3I5UA 1SVUA 2UZ4A 3UBTA 2EX4A 2QRVB 5CVUA 3UJCA 5BW5A 3I53A 3BWYA 2AN4A 3ER8A 4PYLA 5D1HA 3CJRA 4KRGA 1KYWA 3LHDA 2I9KA 1D2CA 3TRKA 4OA8A 2BR5A 2HWKA 1X19A 2C7RA 2C7PA 5EC8A 2WA1A 5JUWA 4WXHA 1L1EA 5K09A 4GOND 3UFBA 2UYOA 4R8RA 2A14A 1SUIA 2PJDA 2YR0A 4M7RA 5HFJA 5FUBA 4EKGA 5LSAA 1WS6A 7MHTA 2I6GA 1OR8A 3H2BA 3B5IA 5FWDA 3ERCA 3ELWA 2OY0A 2P35A 1JG4A 5EZQA 4WVLA 5HIJA 3R24A 2ZZNA 1RJEA 5K01A 1SG9A 3A4TA 1VIDA 2YVLA 5CIYA 2PT6A 3HA7A 3LX6A 3FUTA 2YXDA 3MERA 2VZ9A 4P58A 4CTKA 4X61A 2AVDA 1EJ6A 4BLWA 4XCXA 1YB2A 2O57A 3K6RA 4R6WA 3BZBA 2AOUB 4EVIA 3SMQA 3TQSA 1FPQA 4CKCA 4E33A 4RYLA 4IWNA 1D2HA 2PSSA 4YV1A 1RI2A 4E2WA 3NVKI 8MHTA 2O0LA 4OBWA 1L3CA 4RVHA 1FP2A 5LQJA 2JHAA 3EVBA 2VDVE 5K0EA 5K03A 4E30A 1VP3A 4R6XA 2C7QA 2BH2A 1L3IA 1IM8A 3HCAA 3OE4A 1XDSA 4JXJA 3KQQA 4OA5A 3EVEA 2PWPA 2OO3A 2PX5A 3C6KA 1QAMA 4CWAA 4E2XA 3PS9A 5K0LA 1NW7A 3P2KA 1ZQ9A 5LQKA 4MIKA 1M0EA 3TM4A 2AR0A 2GH1A 3HCFA 4EKIA 2P1DA 3TKYA 4QQNA 3B3GA 4XUCA 3BKWA 4V0QA 1PRYA 5EMJA 4C04A 3IV6A 3KR9A 3FTCA 4CXMA 3IEIA 4RTSA 3FPEA 3GIWA 1P1BA 2I62A 3U81A 3UA4A 1JG3A 5DM2A 3GCZA 4RTRA 2GA9A 3GRRA 4QTUB 3LCCA 3M6UA 3G8BA 3LBYA 4X41A 2G72A 4A6DA 3FUWA 1G60A 1SKMA 1JG1A 3CJTA 5EMLA 1B42A 3HP7A 5EQJB 1NW5A 2VP3A 4DA4A 2ZULA 5LQNA 2PBFA 1JTFA 2PY6A 3LL7A 4KDRA 3NMUF 2YTZA 3DH0A 4HGZA 5E2AA 5T64A 1FP1D 3GU3A 3P2IA 3P9IA 3KQSA 5K0BA 4LECA 4DKJA 2YXLA 2GS9A 3O31A 3JWJA 2G71A 3OU6A 3HCDA 3NVMB 4GBED 1R8YA 1XCJA 2P7HA 5E1BA 1NV9A 3EVCA 3NDJA 5FHQA 2IBTA 5FULA 1QAOA 3ELDA 5K8VA 3HEMA 2AN5A 2XYRA 3TKAA 4AZTA 2PWYA 5LQRA 3KR1A 2C7OA 3SR4A 2VDWA 4PCLA 2VDUE 4MTLA 5E1DA 3GRVA 1WY7A 2NNWB 4P7KA 5EPEA 4YV0A 4KDCA 4P7FA 2Z6UA 3AWIA 1G38A 2ZFUA 3GGDA 2LD4A 2WK1A 3OFJA 2O06A 2YXEA 3DUWA 3HVJA 4PINA 1INLA 4MHTA 1JQDA 3FYDA 1Z3CA 4HRAA 4RV9A 3UJDA 2BR4A 3O4FA 4EQZA 1D2GA 1EIZA 3FRIA 4F84A 4KW7A 2BM9A 2WA2A 3GWZA 4DMGA 3MAGA 3CGGA 3FUVA 3B3JA 2OYRA 4E70A 3RIEA 3ORHA 1ZGJA 4FR0A 1EAMA 3P71T 3F4KA 1DUSA 2CKDA 4C03A 4KIFA 4PYNA 3SM3A 1ORHA 3OZSA 3R9XB 2H00A 1N7JA 1F38A 1HMYA 2P3OA 3QOWA 3QV2A 1VE3A 4QVKA 1UIRA 2ZBQA 5DXJA 3DMGA 5CCBA 4KIGA 2FHPA 3TLJA 3VC2A 3EVZA 4RTMA 1TW3A 3UWPA 4DQ0A 4M38A 3EVFA 5EIFA 5EMKA 4OQDA 3EGIA 3DXZA 1RI5A 1I4WA 3G2OA 3MCTA 3HNRA 1R6AA 5E1MA 4CKEA 1O54A 2QYOA 3LDUA 3LGAA 2BZGA 2G70A 5DLYA 5LQUA 2PXAA 3AXTA 2ESRA 3HM2A 3MHTA 3C0KA 1BKYA 5E8JA 2BM8A 4FS8A 1IY9A 1F3LA 3THRA 3KQWA 1XDUA 2P41A 1P91A 1XXLA 4B17A 5EEHA 5LQAA 1YFLA 4E2YA 5EG5A 5DTQA 3CBGA 2Y1WA 2ZBPA 4BLUA 2YUIA 3GDHA 4YUZA 4RTJA 2PXCA 3B3FA 4QVGA 3V97A 1KPGA 2ZIFA 3LCVB 2ZZKA 2AS0A 4PWYA 4PYQA 2NXJA 3ME5A 1QANA 5KQRA 2PGXA 1I9GA 3NJRA 2PX2A 4X60A 2CL5A 4ER3A 5CVDA 1R74A 1YUBA 3PFGA 4IV0A 2FK7A 5EKUA 5FADA 1DL5A 3GJYA 3M33A 10MHA 3DLCA 3VC1A 2FYTA 1X1BA 3REOA 3R6TA 5EIWA 4YMGA 4QPNA 2K4MA 5DRTA 2JJQA 2ZSUA 3BGIA 5DSTA 1JQ3A 3KQOA 4HTFA 2ONYA 3KPUA 5HILA 1V39A 1FJXA 2ORED 1MHTA 1RI4A 1TPYA 2CMHA 4UOEA 4OX9Y 3HCEA 5LR6A 2JHPA 1ZGAA 4Y30A 2ZZMA 5F2OA 4BLVA 3E05A 2PKWA 5FA5A 4GEKA 5HIKA 4YUWA 3IHTA 3UA3A 5CD1A 1Y8CA 3KQMA 3EVDA 4R8SA 4KWCA 3HCCA 5DWQA 1BHJA 2ZCJA 5EZSA 3FZGA 5EEGA 2GPYA 3HVKA 2GLUA 4FZVA 1YFJA 2ZIGA 3GRZA 5C0OE 3TM5A 5GM1A 3BWCA 3EGEA 2AZTA 1AQJA 3KQPA 1N2XA 4FSDA 2PX4A 3FRHA 2IH4A 2E5WA 1BOOA 3D2LA 3LPMA 5DX8A 3LBFA 3WSTA 5U4XA 1G55A 2PX8A 3AY0A 1VLMA 1XJ5A 2B2CA 2HMYB 2AOTB 1NBIA 3A7DA 3HVIA 5E8RA 4M36A 2QE6A 5EKXA 5GIOE 4Y2HA 3I64A 1RI3A 5HOQA 2UYCA 3LECA 4AZWA 5IKMA 1I1NA 2H1RA 2OZVA 3C3PA 3KR2A 3SXJA 1N7IA 2IFTA 3CJQA 4GOOD 4DCMA 3BGVA 3TFWA 5D1NA 4RTLA 4IKPA 3GO4A 5FQNA 3LCUA 3MQ2A 4CKBA 5IH3A 3G5LA 4YUYA 5BP7A 4BP1A 4C08A 3EMBA 3KQVA 5FHRA 1UWVA 1ZHFA 2DULA 2EJTA 3DMHA 3FPFA 3OFKA 3FPJA 3PB3A 4DZRA 3FPHA 3MCZA 5C1IA 4PNEA 5CCXA 5EHIA 5FCDA 5DT2A 4PYKA 3V8VA 1X1AA 5HIIA 3EPPA 4AZSA 4PGHA 1NV8A 1AQIA 3DXYA 5GWXA 4DM3A 1SUSA 5GP1A 4U7PB 2ONZA 5CVJA 2ZLBA 3SGLA 4PYOA 2ZWAA 5GOZA 4E32A 5GIPE 2PT9A 4QQKA 4YMHA 1L9KA 1RI1A 3KQTA 3MTIA 3M4XA 4RX1A 5DM1A 3THSA 3UJ6A 1RJGA 3PFHA 1VPTA 3NW9A 3FTEA 3P9NA 3ID6C 2Z6QA 2G8NA 5K0JA 4ER0A 1NKVA 5EMMA 1T43A 2IDJA 2F8LA 4KVZA 4X1OA 3DR5A 2OXTA 3DP7A 5G02A 2P7IA 3QOXA 5DPMA 3ANXA 1EJ0A 4HC4A 4RSRA 3L8DA 2EG5A 2AOWA 3Q87B 5FTWA 4AZVA 3X0DA 5CM2Z 1JSZA 4BP3A 1X1CA 5DSXA 2FPOA 4F85A 5DX0A 3G88A 3KPWA 2EJUA 4L7VA 3GNLA 5K0NA 3UJ7A 1R00A 4PYMA 5CVEA 1P1CA 2ADMA
chains in the Genus database with same CATH superfamily
3NHLA 3RTBA 1JXOA 5FLXA 4GIBA 2XKAA 2ZYVX 3KUXA 4C4OA 4CMEC 1BAPA 2FKAA 1YRYE 5JWOA 1XZPA 1XKQA 3G8CA 1N8SA 3IAM6 4AI6A 2O3UA 1V5GA 4MO2A 2GR9A 2R4UA 1H6BA 3QVGB 1K0UA 3WHKA 3EPHA 4EL0A 4FKZA 1L4NA 4PG8A 1UJ4A 2BGRA 4DQVA 1VL2A 2I6UA 3PNOA 2WF8A 4KHZA 3A3OA 5CK4A 2DUMA 2XVXA 3K9FC 2QMOA 1QG2A 2M1ZA 2HLHA 5HMMA 1M67A 2EFJA 3RDPA 5BPFA 3ELYA 2BSXA 1L7MA 4UHCA 3EFHA 4K2HA 3WMXA 3G89A 2Q0QA 3D8TA 3LZDA 4ZO8A 2V58A 5J5AA 2Y05A 5IPFA 2FP4B 5JAMA 3L05A 1OX4A 4XM2A 2ASEA 2JH8A 3A9SA 3AL0C 1SXGA 3GGGA 2YV2A 1KRXA 4NY1A 5ILGA 3PZRA 4CKZA 2Q8NA 1PJQA 5HZGA 1T8TA 2FWRA 4U4AA 1OJ7A 1Z0SA 3V34A 3OLCX 5DCUA 4JP8A 5T67A 4WHMA 2WE7A 2AG8A 1AO3A 2ZRJA 5D51S 5TF0A 1OLXB 1QV9A 3GJ0A 1WB9A 3OE7A 1XC7A 3JWHA 2XTAA 4UEOA 1M76A 2W71A 3OOWA 5EVJA 2G04A 4YAKA 3BD8A 2A4KA 3HFGA 3SF8B 3W9SA 5L3QA 3T4PA 1M8FA 2DH6A 2PNFA 4MVJD 4N0PA 5AXDA 1IN6A 2H5LA 4MITA 2K5UA 3CZPA 3S3TA 3AY7A 2QLNA 2VT3A 3HVUA 5G1PA 4D82A 4QUKA 5B4TA 2GRUA 3K5WA 4ENVA 3ZVNA 3L0SA 4P22A 5I4BA 4R1QA 5CA1B 1RWBA 5LZ4A 3GLGB 3K0FB 3ZV7A 1BX0A 2HNKA 3IE0A 2GFHA 1VL0A 2HBRA 3RW9A 1QOZA 3SXPA 3VR2A 1SVKA 2AL7A 1A5BB 4WNAA 1OUMA 2ZIEA 3TRDA 3TQOA 4QD3A 2B9VA 3EQ6A 5DLDA 1Z39A 4QIHA 2L69A 1JR2A 4R01A 4ZVKA 4M1SA 2IOHA 1O4WA 1EZ1A 1MG0A 1ZIDA 4CKWB 4FDMA 5A4MS 4LNHA 1YQ9A 3DBLA 4JLBA 4NABA 4KGZA 2H57A 1H5QA 5IM5A 2IYYA 3LX8A 1AKUA 1GPAA 4R2LA 5ILQA 1U8FO 4GWKA 4KBFA 5LOVF 2PWBA 5ELXA 2EZ8A 3U39A 3JV7A 3NWBA 4H7FA 4GMXA 2BE9A 4ZTZB 1QU2A 3KJZA 3GLFE 1XDDA 2GZ1A 3SEAA 3ZBPA 5HZMA 3PGJA 4J0CA 3JQ9A 2XMZA 3E5RA 3GUHA 5EOVA 2BFBB 4NOKA 5TARA 4BRSA 1QYRA 1VBKA 2Q7DA 3UBMA 2H7XA 2VRWA 3B9BA 4RZXA 1P33A 3ZI7A 3AR5A 5HPYB 4BV8A 4HZIA 4D3XA 2BFNA 3RAEC 1A9OA 4WMLA 5HXAA 1ANKA 5LOVB 4X97A 1ZBDA 3CC8A 2FSVA 2YN4A 2YIVX 1SWWA 2IDKA 3UMYA 2VJKA 2PD6A 3CIFA 3DZGA 1F48A 1KSJA 1Z6GA 3K96A 4OHFA 1OOEA 2IY9A 2F9FA 4CQMA 4OLBA 1KNQA 2XQVA 1JHQA 2CVZA 3DOUA 3RG8A 2WUFA 4LAFA 1JIVA 1RW4A 3GA5A 2FJPA 2WAOA 3PNSA 5MN5A 5EE0A 4KIUA 4XUDA 3EDMA 4Q4AA 1WPXA 2H5JA 4H08A 2W2PA 4LWPA 1ZM7A 3IUEA 1IZ7A 1Q0TA 4NAUA 4D5EA 5JSHA 2W00A 3FYTA 4WKBA 3A6ZA 1BCRB 2D0IA 1KY5A 3L77A 1KEEA 5DE3A 3W2HA 1Y4ZA 1HQCA 1RRVA 5DNVA 1HV8A 1AVTA 3OCVA 5LQDA 1KIFA 1EJBA 4NENA 3SSAA 1HT1E 3T5BA 1DELA 3HV0A 5DGHA 1UBTS 1O6BA 2PMWB 1MJGA 1DEHA 4MCAA 3GQVA 2OZKA 4X6UA 3KJIA 2CJXA 1HXHA 1E1YA 4UUMA 4D25A 2WV9A 2RCNA 4K9MA 4UNIA 5DDIP 1W36B 3BRCA 1EG7A 3EZGA 1XPUA 1FBNA 2SECE 2PSHA 5DMXA 2OKCA 3NWEA 4H7IA 3ROQA 3L82B 4C4RA 1KKMA 1O57A 3CPSA 4K1XA 2DP4E 3T1OA 1BW9A 1R50A 2QAGB 4QULA 3AHGA 5K4GA 3FRJA 4Y7CA 3D0KA 3CR8A 5T57A 4DJEC 3WFZA 2JH9A 3K09C 2NUTB 4HX9A 4UDXX 4YAIA 1ZVKA 1W2GA 1P7VA 4PPYA 2QY6A 5KTTA 1PSDA 2QX4A 3A1TA 1DB3A 3RIMA 1DAOA 3MG9A 4J91A 1U2ZA 2PQ2A 1X80B 4IGKA 3VR0A 4Z4CA 1NXTA 3L93A 3LKZA 5G0SA 1MXFA 4W8HA 1KI6B 3LV8A 2R5FA 4I5GA 3I6QA 4L4SA 5HRAA 3IOYA 4F8JA 3AVVA 2F17A 2D06A 4FFPA 4OHRA 4HNQA 4GZ6A 3R40A 4LG1A 4ZKEA 5ECYA 4D4LA 2PTHA 5DTMA 5AW8A 3GZ4A 4KLRA 4LDJA 2GASA 4PO8A 2CMGA 5L4NA 1SVUA 3G5MA 4UAVA 3T5MA 5I8PA 3PGKA 1LGYA 2REBA 3R7NA 4FN5A 5J3JA 4A15A 4YMVA 4DEYA 3M6IA 1C9NA 4ZO6A 4CIBA 4LMRA 2YOFA 3MYRA 2WWVD 2RI0A 4K88A 2E4YA 2VP9A 4UULA 3IEKA 4EPVA 3CEMA 3EYAA 4N48A 4YP1A 4GYJA 8ATCA 2FWAA 4L76A 2VG8A 3AR4A 4IH1A 1O5IA 1XWIA 3PFKA 4Z9FA 5ADHA 5B6IA 4XCQA 2E1RA 2C4WA 1L5WA 1W5EA 4OVKA 4UFOA 3BRWD 3GQBB 1HEYA 1XTKA 2FMUA 1RXYA 3U44A 1P2TA 3OEYA 2RGCA 1ND5A 2B4AA 3HUEA 2OA0A 3PUKA 5H9WA 5LZ2A 5IANA 1VL8A 2OENG 5KPJA 2PA0A 2VWHA 1Z73A 1G2QA 4I1IA 4RENA 4QBKA 3KYCA 2NLOA 1FLNA 5DOVA 4PG7A 3TLGB 3HB1A 3N0WA 2VRCA 3E9ZA 4IIBA 4BJ6A 1DKNA 2HK8A 2O8DB 4IJMA 3L7BA 1C7EA 3F98A 2WU1A 3IMGA 4EGAA 2UU9B 3TQSA 4MULA 1L5QA 2O8BA 1YA8A 4INZA 1N1MA 1Z4OA 3PQ7A 4XB1A 5KHOC 1ADBA 1KAEA 1LDGA 1YS9A 3MWGA 4YJFB 3FUCA 1TX4B 5F33A 1HORA 1NRWA 1PJ4A 1TF5A 3RC7A 3RFCA 3HJRA 4GICA 4BB6A 1F1JA 3EGDA 2W9XA 3OTIA 3A04A 3BCUA 3ZK8A 1TRHA 3CB2A 1CVIA 1PL6A 3NETA 4RK5A 4AP6A 5GVSA 2Z2YA 3FYSA 2IYEA 3PUVA 2R66A 1GG9A 2Q2WA 2AF4C 2YDXA 1JIXA 2R8PA 3TECE 4B3HA 1P5HA 3K9LA 1IU9A 3MW8A 4G1BA 2XIQA 3PPXA 5AOBA 5DISB 1O03A 3RIGA 4EKIA 5TIIA 1N8TA 1MC8A 3ZNNA 3WNVA 2YZNA 1QHSA 2OGWA 1T1GA 4U3JA 4Q1DA 3F5QA 1X87A 1QYCA 2R65A 3ROKA 1F17A 5EJGA 1X7HA 2X2EA 1CW2B 3QG1A 1UT6A 4GHWA 1P7CA 2FG7C 3RLIA 5C5EA 1SHTX 1DCKA 4I9FA 4ND7A 1QXSA 2AKAB 1D2NA 1HRDA 1Y7PA 2DAPA 4QTUB 2BTOA 4GYKA 4NYMR 3RVOA 2DJIA 1QVRA 2IUTA 3CZ9A 1M34E 1MHPA 3OP1A 1JDBC 2C9YA 3FBGA 4G5QA 5B1YA 1P2SA 1JG6A 1KGSA 2ZSAA 5EMLA 3LCJA 4NULA 3I8XA 3KQNA 4ETNA 4ZZ3A 1C50A 5HK8A 2WSSA 1RYBA 4NDAA 2ZATA 3OEWA 4R2HA 2YTZA 4DIMA 1G5QA 4CQLA 1XFDA 3G9XA 5DHFA 1H8EA 2EOAA 1HI9A 3RABA 1L0BA 3BRQA 4DUZB 4ZOQI 2HSEA 4INAA 3AVUA 3EVCA 2GX6A 4TPKA 1B0ZA 3BJRA 4BC1A 3KXDA 1U63A 4OXQA 4ZI5A 3EBLA 4H0FA 3KEOA 3WAKA 3OZFA 5AVTA 3TB4A 1EKXA 4B8ZA 2H65A 4NE2A 4PBRA 4P36A 4WI1A 1TK2A 1IJFA 5AVWA 4RDCA 1K3FA 2Q4EA 3DHEA 4MHTA 5J63A 2IEZA 1GU7A 4G41A 4HJRA 1VKNA 2LV8A 3DEIA 3Q5DA 1S89A 3W06A 5IT5A 1EIZA 2BM9A 3TOZA 1G17A 1QO9A 2AR9A 3MLEA 3B3JA 1D5CA 1Q22A 1YT5A 4LZWA 1C4XA 1HLFA 1W4LA 2BEUA 2XX3A 3NGXA 4LMBA 3T9CA 3ZU6A 1M74A 1P1JA 2FPRA 5IUJC 3D3KA 1QHHB 3B9QA 1NSYA 4UBNA 4BO4A 3F3MA 1UOOA 2CMDA 5GAJA 1SQ6A 1ICIA 1REQB 4NH0A 2ZAMA 1TL7C 3WO1A 3OIWA 4CMIB 4O2AA 4EF5A 1VE3A 1U2DA 3QKRB 4R9RA 4Y6LA 5EKDA 5FO0A 3S2GA 5GJCA 4EEXA 2CXRA 4X20B 5L8VA 1CDZA 1QQ7A 5JHGB 3KKPA 2FE4A 3SZOA 3PJFA 3BWVA 3ZW8A 4YVFA 4XWYA 1HQYE 3UWPA 1EU1A 2B5OA 2F8MA 3UMSA 1K0FA 4CODB 1G20A 4DMLA 1CE8A 2WWHA 1RI5A 3EZNA 4JLAA 1PYGA 5BN5B 4AAYA 4RPIA 4YCJA 3PQ6A 3V2UA 2VAXA 4IM7A 3UT0A 1TXGA 1ZD5A 4QYMA 1YASA 4RULA 4MUIA 1VCIA 1LLCA 4ZJUA 1T1JA 1ZGCA 3FMPB 1HEIA 1ZK4A 2MSCB 1FXWA 2XUIA 5EWMB 2PGJA 4D8VA 4NCIA 5FUMA 4H31A 1R1DA 4FMPA 3W8EA 4M1TA 3QVGA 5C8ZA 2JKYA 4UHEA 4EHAA 1USWA 2AS0A 2CNNA 3CS3A 1S9DA 1ABEA 1KYVA 3ME5A 2VBCA 1BN6A 3E5MA 3ZLJA 1I9GA 3OE7D 5HKKD 2ZB7A 4BUJA 4RHEA 3KUDA 2CBGA 2LBPA 4J1TA 2Q4TA 1U31A 3O6VA 1QG0A 1XRLA 3DVAB 2XJ4A 1LJ8A 2BFOA 5BYKA 3SPXA 2FP4A 4IVNA 4EHLA 1C8BA 4YAOA 5AOCA 3BGIA 3DP9A 5LXTF 2WYOA 4O4JF 3VR4A 4DYDA 1UXJA 3M4YA 1W47A 2JFNA 3HGTA 5DBEX 5FNVF 4AZ3B 1YR3A 1GLNA 1QKIA 5CLFA 1P4RA 5ALOA 1F2DA 3Q9UA 3HR8A 1Y48E 1ZGAA 1EGQA 4YRPA 2DPLA 1IMOA 1PIWA 1FUUA 2OV2A 1IULA 2Z95A 3FNQA 1OLXA 3VR2D 2BGLA 1Z13A 1ZZEA 1UC4B 2PWAA 1GIAA 3VMMA 4DV7B 4OB8A 3DKRA 4MRMB 3SF8A 5CJJA 5DKFA 4BZWA 5ED4A 2GEBA 1JFFB 2P8SA 3AG6A 4QU5A 1G18A 4RH0A 1J97A 2BAGA 1NVUQ 1I3CA 1SZJG 1V0JA 4O4JB 1AQJA 1YOVB 1D6SA 1EAYA 1GEEA 1G5HA 1BOOA 3HYNA 1MB3A 2V3VA 5FNVB 4KVFA 2GO7A 1P5ZB 4NP6A 3KE8A 4HWRA 3WWZA 2PX8A 4ND2A 2B2CA 1GGVA 3R5XA 4OYHA 3ZQ4A 3IILA 4QRHA 4MR9A 3PQCA 4HNVA 3I64A 2X7JA 2CUTA 2RBGA 3GLSA 3GLGA 2QZ9A 3K0FA 3EC2A 3A4LA 4XJXA 3OTGA 2GCGA 4DREA 5TRTA 5IWCA 2IFTA 5JH7F 1QG6A 1Z0DA 4BAGA 3LVBA 3GDOA 4Y18A 4G0ZA 5FOQA 1L6IA 4ACBA 5BOVA 3WG9A 2O2YA 3G5LA 4LOHA 2ZUSA 1QCDA 3HBMA 1DKOA 1BHQ1 1YFZA 3KQVA 1W5BA 5FYQA 1KO1A 3D7LA 4TN1A 5BSMA 1SBQA 3TSOA 1DAEA 2C92A 3LPNA 1EGAA 3TD2A 3VPDA 5BR7A 1TZKA 1OILA 2X0JA 3HYSA 3VH2A 1ZRSA 4NEGA 4NF2A 1Y6GA 1K88A 2BONA 3IEXA 4CQMD 3ZPXA 4DM3A 5FPKA 3QXCA 3DM9B 4ROSA 2B6HA 5JH7B 3UICA 1U1IA 3ZHSA 3Q3JB 1Y8QB 2DPHA 3JQBC 2ADFA 2BFBA 3EXG2 3WYBA 4F06A 4ACAA 3PHCA 4DIUA 4QT4A 3H1AA 3B5JA 2QTFA 4GZ3A 5E4JA 5JVDF 5KPDA 3AQIA 3TRHA 2WINI 3L0BA 1JL3A 3EZ9A 3P5BA 5HE9A 5I7RA 2Z6QA 5B7QA 1F3OA 1KK3A 2G4VA 1R3DA 4X1OA 3IEVA 4GOKA 4EY6A 4N41A 5G02A 1EUCB 1MXHA 5LOVA 4HXEB 3H75A 4YXWA 4QG7A 1EJ0A 4CLHA 4AZVA 2EG5A 3ESZA 3P9PA 1RPAA 5CM2Z 1U5CA 3NH6A 4WXRA 2GPSA 4OHZA 3LXRA 5A5VA 1WQ1R 2XMCA 1R9MA 3K4PA 3UJ7A 1U0BB 3JQBA 4DNPA 2OFPA 2VJDA 4X7PA 1P77A 5JVDB 1BC5A 1JIIA 1ZM9A 4QU9A 3VYTB 1QP7A 5JMOA 1T91A 3PUZA 3AETB 1PJAA 4MUAA 3JVUA 4YASA 3TL3A 5LB4A 2OV6A 5HEKA 1ZMTA 1ZUIA 2J9XB 1Z74A 4HSGA 3HEBA 1BCRA 3MTAA 4M98A 3D7MA 3C3CA 5CPBA 2R2AA 4ND1A 4XVUA 5A9SB 2QAGC 3JR7A 4PS1A 2JLSA 3W2FA 1BRMA 1PG0A 3VV3A 3KDAA 2RJOA 2O59A 5JDIA 2HLDD 4JIMA 1A2QA 1IEXA 1CUXA 1V7PC 1XMPA 4Q0MA 5JE8A 4IOJA 4PGGA 2BMWA 2W2KB 2G7ZA 4RPKA 2R79A 1ESDA 3P2EA 5AHXA 3GXBA 1HL7A 2AC4A 4UBLA 4QECA 1NUSA 4JH0A 1NFFA 4BNXA 1WNFA 1PHPA 1US8B 1GUAA 4ZU6X 3V1TC 3C3XA 4EL5A 5B2EA 1LSJA 1SOUA 3TSCA 3COSA 3QQ5A 4Q12A 1XK7A 3U3DA 2RSLA 1PK7A 3QI2A 4OYLA 1ODTC 5BT8A 3CVOA 5JD4A 1J56A 2FRXA 2ZOSA 4L8GA 3EZXA 3Q85A 3R9IA 1DGQA 3NAZA 4RJTA 4P5PA 4N5DA 1U7DA 2G0AA 5CMLA 3ML1A 5KU1A 2OHOA 1IN7A 2VPZA 3TAUA 1L7VC 3G2QA 3FAZA 2C20A 1IUKA 5CM8B 1KR5A 1JZTA 1YHNA 2HDWA 5GADl 3KYDB 1SG0A 1X80A 3H2IA 2XNCA 3K9GA 3LVQE 4NMMA 4TS3A 3RU2A 3F8TA 2OXFA 4RVDA 1E6EA 1YZLA 4V0NA 4ZTBA 2HA5A 2P9BA 3RUCA 3VPSA 5CG2A 2IIQA 3IMCA 4XSGA 1GNSA 3ZHZA 1DQSA 2O1WA 3MUOA 1VRWA 3GPDG 1RE0A 3IFSA 4RLHA 1QM5A 2VR1A 3A26A 3TXXA 2ZYWX 1UT5A 3AFMA 2UZIR 4KYUA 5FR2A 3WK7A 3R75A 3DONA 4FMBB 4HLCA 6YASA 3RTDA 5G4KB 4MQFB 2BM0A 2J9FA 4CUJA 1I01A 1Y9EA 3ASYA 4PZ9A 1T4CA 4MNTA 2Q46A 4I1UA 1H0RA 2L18A 1IY0A 3DBRB 2CLFB 5DIZA 5IEJA 1KQ3A 2FEWB 2YMMA 3QVTA 4GW3A 3FBTA 2PGNA 4U0KA 1GUFA 5JNLA 1XPJA 3EAGA 3JRXA 4BPBA 3DXXA 4WFQA 4ARSA 2ZT5A 2FLKA 5KVCA 3MJHA 4AX4A 1CNMA 5JECA 1OFGA 4ZJZA 4WGGA 4XH9B 1KAQA 2HRRA 2IS4A 3H2YA 4NYMQ 3RBAA 2PKXA 6NULA 3OVMA 5IJAA 1E1LA 3NM4A 3SN6A 3WC4A 1YBMA 3VNVA 4D43A 1X7WB 4H7HA 4C3VA 2ZYDA 2C4NA 2WQ6A 1ZD2P 1PF7E 1O08A 3BQNB 2C7BA 3KD3A 1PYOA 4M37A 3BIFA 5EFZA 1PUIA 4EB6A 2B78A 2R60A 2O54A 4LEIA 3I3OA 2OZPA 2QT9A 4R51A 2TMYA 4HYYA 4A0GA 3HYTA 3TLGA 3M81A 2BR3A 1H5UA 2DHQA 3ZKAA 4D26A 3HTXA 5J58A 1CY6A 1KR2A 3MB8A 3NHKA 2J48A 3NRBA 2XDAA 5AOVA 2OGSA 1EDEA 4M9ZA 2CDCA 3ZYZA 3BZUA 3AKEA 1FRVA 4DN6A 2PSDA 4R8VA 4UATA 1RZRD 5DYYA 3MLAA 1VKRA 2OBLA 1FNNA 1FA9A 3DEKA 1SXPA 3UB4A 2Y9PB 3GT7A 4LVOA 2DVMA 3INRA 1EESA 1J1IA 2CW5A 4GVLA 3DYVA 3SDZA 5LLTA 3H97A 1SHKA 4X6LA 2ZAOA 3WHLA 3Q2IA 2FPXA 3G2KA 3CLRC 3H3FA 2NZVG 5TR9A 5EFOA 3WVNA 1X0VA 2H4WA 3WKAA 3TQQA 2YS6A 1M1NB 3HXTA 4RMNA 3WL5A 2HSJA 3STTA 2VF8A 2H31A 2HRZA 3I04A 1V7QA 4DABA 2WSSD 4EHNA 4MP6A 4PYJA 4LXYA 1RC8A 4ZYUA 4PLPA 1WXIA 4DW8A 1H8ED 3U60B 3OM8A 5ICEA 5KC8A 3HA5A 1U7UA 2HEIA 1Y33E 1W49A 1AK9A 4XI9A 4YCAA 5LIPA 1WPQA 3IRUA 3FTFA 4IEEA 1H8HA 1D0SA 3I28A 4WQMA 1W6UA 2QQEA 4KRYA 2GM4A 3GUCA 3JWGA 3SZRA 3NANA 1IK6A 3EQZA 4B31A 1T1IA 5LBTA 3X1JA 1L4KA 3L7IA 4EVRA 4GF5A 5AVKA 3S40A 4OMDA 521PA 2XEXA 2B1GA 5F9FA 1PGJA 4JIGA 3AIKA 1TYCA 3NC0C 2K7FA 3TR0A 3FHCB 4FFDA 3QXGA 3VDXA 3MCUA 4W5WA 4CEJB 5FA8A 3HU2A 1ZSYA 2IV3A 2OBBA 2QTVB 5C1DA 3E9EA 5TGTA 1TT5B 1P3JA 1MPTA 4P4UA 5SZJA 3W4IA 2YWHA 1EFCA 3GAAA 1ULAA 4EENA 2V1XA 3I39X 1KYTA 4BQEA 1GSIA 2EZ9A 2B8NA 3JZIA 1DMRA 5CYFA 2BFMA 4ODIA 2H1CA 5KMGA 4RL6A 1LCIA 4XD2A 5AW7A 1B1CA 3H0EA 3VR1A 4V02A 2WOJA 3AR2A 3V7WA 1R4ZA 4FT2A 1OBHA 3ZWDA 1SU6A 2D2EA 1CIVA 5IP5A 4BCDA 3LYHA 3PRHA 4TL9A 4BLOA 3O4GA 4D8WA 5T4HA 4E1AA 1V1JA 1JJ7A 1C8LA 4MUYA 4WDRA 4QARA 1GNQA 1RBZA 3DWFA 4YFYA 1SXJA 3LUCA 2PNJA 1KZ4A 2GI4A 3K0AB 5EI5A 4LJ5A 2D5LA 2PX6A 3MRVA 4WKNA 1PV4A 1CQWA 1ZK1A 1QHHA 3UOAB 1Z68A 4OXXA 1OROA 3CEHA 4P3XA 1GNPA 5I4IA 3RVKA 1FQWA 1YRWA 4HX2A 1TZJA 2Q9CA 4BZQA 3L0YA 2O5VA 1VBNA 4IR7A 2CXUA 5CYOA 4MUXA 1V4NA 1WUHS 1L1EA 4CMIA 2QXTA 1CR6A 4HVAA 5IG2A 1RFLA 4UVDA 3QKRA 4R1TA 2GTHA 2CK3D 2HM7A 4YT4A 1GN9A 4X20A 4NE7A 5CDUA 3FWHA 4EKGA 4KE8A 3RYCB 4LJLA 4DDHA 4TWAA 3GPBA 1CQIB 1H0KA 2VYQA 3O2QB 3GFBA 3IDOA 5BN5A 5JISA 2GARA 3WKCA 3QUCA 1GL9B 1F60A 3DAYA 2DFNA 1TYZA 4DGQA 3U7QB 4YP0A 4NJEB 2RK3A 3FFXA 4KRFA 4TRRA 4XCXA 1YB2A 2HF7A 1F0YA 3O8CA 1Y5IA 4HAZA 2SKEA 4BX9A 3F3YA 4XIFA 3EDOA 4AKTA 1HLGA 1IZ0A 3FB4A 4ZT4A 2ZBGA 1H6CA 3VPXA 3OJOA 4JL6A 2QTCA 1GU1A 1LNQA 2REQB 3BMQA 5LQJA 1P9RA 2DH5A 1PEYA 5HCNA 4GG1A 3QQPA 1NP6A 4LUCA 1EE9A 3D31A 3ZY2A 1BYUA 4G25A 4RMGA 4KQKA 5D3KA 2I7DA 5DNYB 1KH3A 2CJWB 1PFKA 2HHHB 1E1CA 1IDOA 1NVMB 3DM5A 1CJCA 5HZKA 5LP6F 3DVAA 2XGOA 4UJ3A 1YKSA 2YXNA 1CETA 1JQ5A 3WL7A 1QFJA 1M1ZA 2HZBA 3RJ9A 2VAWA 4BCCA 2JA2A 1M6WA 1C4OA 2QM8A 2QQ5A 1VIYA 4TTTS 3S8EA 1G5IA 1P2DA 1THZA 4AZ3A 4DPLA 4YLYA 3MAJA 3CE9A 3TKYA 1JT2A 4C5BA 3A6DA 1PRYA 4LXQA 4R1NA 4AL4A 1NPTO 1FVHA 2QN8A 3KR9A 3R9KA 4J1QA 1G41A 2OE2A 3I01M 4A23A 2Y3IA 4QGBA 2ZJ0A 2IHUA 1OPRA 2OO5A 2PO7A 3RCBA 4BNHA 2GHRA 3HSSA 4MRMA 3LCCA 3PD1A 2YFHA 4MQFA 3RS0A 5ALRA 1JFFA 2O3RA 2RKBA 3FUWA 3K1AB 3N0XA 5I7UA 5LXTA 4D8UA 4KU4A 4O4JA 1YOVA 4LFCB 4FILA 1ZN9A 1ZBQA 5GV7A 5FNVA 3WK8A 1ZCFA 2JW5A 2C61A 4D4GA 2FMFA 4HNGA 1PFGA 5HKBA 4HGZA 4R9UC 3P2IA 4XYEA 5DF1A 2N46A 1L7AA 1OY1A 4DCPA 3W5CA 4DKJA 5IDYA 2XYPA 4R9SA 1QQ6A 2L42A 5ITZB 3BM5A 4C7VA 3Q3CA 3NDJA 5C4IA 3HKBA 1EB9A 2IYQA 2RAFA 1HL3A 3IXLA 3PC8C 5SY4A 4CLXA 4R1UA 3GJTA 4XWTA 2DR3A 1F6WA 1R9JA 5FOSA 1E5XA 2VDUE 1DS6A 3KKMA 4QDTA 4R8KA 1W35A 4N76A 5B30A 4P7FA 3IQIX 3CVUA 3SLKA 3AWIA 2D3TA 1Z15A 2ZFUA 4YRRA 5B58T 2PU7A 3WX0A 4PGAA 4EBBA 4MV7A 4PINA 5AW2A 4CCAA 5LWHA 2IC5A 1Y4AE 3DDWA 2VSFA 3LT4A 2O2XA 3IIEA 4L8WB 5ALDA 1BA2A 2FPUA 1E9RA 4FBMA 5G53C 4MRPA 3S8YA 2QN9A 3RHSA 1OI7A 5CNKA 1NVBA 1ORTA 2Q1UA 1H2YA 4IMRA 2Z8YA 5C34B 1BTOA 2CLCX 5D00A 5EZ5A 1W25A 3SJBA 5KTYA 2I54A 3MAGA 5JH7A 3GBSA 3P4UA 5ADWA 1Y8QA 3SU8A 3ZY5A 2WIKA 1V8DA 4NBNA 2G1KA 2FP3A 3M83A 3ZKWB 3WLTA 1IXYA 4EH1A 3B2QA 4EY3A 2WG0A 1AQLA 1IIBA 1FFYA 1ZWKA 3OZSA 5EXDA 1EWYA 1KOJA 4ZT5A 3DOOA 1G0OA 1HTWA 3QV2A 1DEXA 4BWVA 3AM1A 4DXDA 1B8NA 1CJMA 1WMFA 1J0EA 2H17A 2OBNA 4HDCA 3TLJA 3O9MA 2C42A 4N5NA 1N2EA 3RC9A 4DMFA 5ABPA 2YN2A 3NU1A 4UQOA 5EMKA 4NX2A 4OLHA 4OF4A 3LA6A 1ZQ1A 2W93A 3RYFB 5LN1A 3ILYA 5JVDA 2KQUA 3IHKA 2EU8A 1DC4A 2PR2A 1U65A 2QTZA 3ANMA 1ZEJA 2VLIA 2XCUA 3DBVO 4OQQA 3V1YA 4RXUA 1W36D 3VC7A 1FP4B 3WGQA 2COKA 1F3LA 1TAQA 3LG2A 3MZ0A 4YI5A 5KTOA 4KBGA 4B74A 1A8IA 3NHPA 4QNRA 4MKGA 2QZ4A 3U7HB 2WIJA 2FMKA 4DJFC 1C7QA 1SEVA 1SBZA 1RPJA 3EAQA 3DMRA 3LCVB 2NXJA 3OPYB 3E70C 3NYRA 5JJKA 3NJRA 2IEGA 4LJ7A 5KVVA 3IR7A 1JEQA 2GFIA 2GEDA 2W2KA 3NWJA 4EVSA 3L4KA 4NXNB 1NW9B 2HC9A 3QWIA 5ALUA 3W6UA 4DV3B 1JFTA 1LUAA 4CUZA 3V2GA 3THXB 4QPNA 4YQEA 3SAJA 4JQZA 1L5ZA 1PFYA 3BSFA 1E69A 1EDBA 2R00C 4P82A 5DBOA 4YP9A 3A1NA 3W2GA 4F4DA 1IOLA 1B6TA 3FGOA 5EPOA 5I5EA 1AQUA 2BHSA 3R20A 3UAGA 1N3BA 1BEZA 1X1RA 2JA1A 2ZT8A 3AW8A 3ABRB 3QE2A 2ERYA 3FMOB 3FNRA 3ZH9B 1V4BA 2EKDA 3A9CA 3QKTA 1N0IA 2NUAB 3LQYA 1QBGA 5F2OA 1SPBS 3ZIAA 4QLBA 5FA5A 2IE8A 3L4EA 2NPFA 1X9IA 3ZXUB 3UA3A 4B8YA 2QVBA 5L9AA 1Q74A 1PL0A 3ZGZA 4MUGA 3IDQA 2FZGA 3RK4A 1G8HA 3FZGA 3KYDA 2GPYA 2MTBA 2PMFA 5KJEA 1IZ8A 4XX0B 5DYTA 4HQOA 1VKOA 2IODA 3DQPA 1U11A 2AG1A 2JCSA 2WU8A 1G5RA 3GLKA 4JZYA 5M34A 5MGBA 2EW2A 3I9V1 1T2AA 4URHA 2IDMA 4O3FA 2QDXA 2WSLA 2ZT6A 3D2LA 3O4IA 5DX8A 4L1KA 4DCVA 2KBFA 3EVTA 1OPXA 1VLMA 2PEZA 2H1WA 4JXKA 4DY4A 3PPVA 3KOOA 5E8RA 4M36A 4UAJA 4BNWA 3KSRA 4HXYA 2IRWA 3F5MA 2BHNA 2ACWA 4QGGA 2WM2A 2W6MA 2PAFA 2ZSFA 3SC4A 4AZWA 5IT0A 3I5MA 4C22A 3Q11A 1W48A 2A6PA 5CLLA 2JFZA 3PKZA 4HWSA 4IKPA 1JAYA 3CN7A 4M9UA 4OQFA 1K4MA 2BM1A 3BFKA 1OWMA 5BQ3A 1D07A 1FMTA 4HFNA 1BU8A 1A5ZA 2IXFA 5D6OA 2ZJBA 3RF6A 1XN1A 4AF7A 3SQWA 4I5EA 5KSZA 2BHRA 2VDNB 2C2ZA 4IX9A 5EHIA 2I33A 4X8OA 5FCDA 4LRXA 4YRGA 5KWSA 3C6YA 5LUAA 2JLWA 3RROA 2HSZA 4NKRA 4XVQA 1EWQA 4TMVA 4OBEA 1Q0LA 1IRIA 4BMYA 3W4JA 5EJ6A 2GA8A 3RJZA 4Z0HO 3TQIA 4PYOA 2C3YA 1FRNA 2Q6LA 2WAYA 2ZWAA 4BJ5A 4ENSA 4KQFA 4BGIA 4BVKA 3VI4B 1ZIPA 4QUEA 1A27A 1TK9A 1T3TA 3DQQA 1RZVA 2TSYB 4PM4A 4N7BA 2GYWA 4ALKA 1QQAA 1R2QA 4RX1A 3A1VA 4WOKA 4KBYA 1VHLA 5CIQA 5DOZA 1R5JA 4B85A 3FTEA 1XTZA 2EJCA 2ZXEA 2IDJA 2DF8A 2F8LA 2JL1A 1FY2A 1Z2DA 2ST1A 4KVZA 3DP7A 2PKQO 4H1WA 4R2MA 4WY2A 2YY7A 3MXOA 4JLJA 5IW8A 5AW9A 1H8HD 1A9TA 3RRFA 3A2KA 4WK6A 3IXMA 2FPOA 3CLRD 4ZKDA 2C0PA 3DYIA 2ID7A 4QJ4A 4YRTA 4DJTA 2WMYA 4RACA 3V4FA 1P8AA 4EJ6A 1C8KA 2WABA 4UREA 2ZRGA 4C0JA 2R8YA 1U8UA 3COWA 3GLHA 2ZUCA 4UDNA 1T5TA 1J2TA 3LRXA 4EJ2A 5JR3A 2A9QA 3CEAA 1FTGA 4L75A 4XKJA 3LGXA 1L7QA 3N7TA 4CKXA 1UKBA 4MZDA 3VSDA 2HA3A 1BXGA 1I30A 4FGWA 4A8PA 3WO0A 3ZEAA 4KPYA 4KPUB 5EP1A 5C31A 4JBGA 4WLNA 4FKMA 1XT6A 4OJYA 2W6OA 3ZU2A 3DL2A 3KKZA 2FSHA 3FTDA 4U39A 2X0EA 3V4RA 4LE1A 4XRRA 2OAGA 3VNSA 3I9LA 3AR8A 5KNBA 2GPBA 3RRNA 5B1IA 1PS0A 2HQSA 3E61A 3J7TA 4NJOA 3AM3A 3BWBA 1CUAA 1Q6ZA 2VYND 1N1GA 2GN1A 2ZROA 2W70A 1DKRA 3AHEA 4TM7A 4FBGA 2ZUTA 4G67A 4DANA 4JLKA 1EX7A 1HTTA 1GAJA 4PBTA 4EY7A 1CQZA 3WWPA 2VH2A 4RIFA 2QTVA 4EKNB 4EUSA 1WSWA 3H9UA 4YMIA 3I61A 2PH1A 3ANTA 1PL7A 5DK6A 3MJVA 4UQPA 2DWUA 3DLPX 1J90A 5DTJA 2GN9A 2NSHA 4DRXB 3H2SA 2QJTA 5M29A 1Y6JA 2YXBA 3LHSA 2IWRA 4CCYB 3F6SA 2QR3A 2Y0BA 2EERA 1X9HA 2JVKA 3CRNA 4BAZA 4C4AA 1P19A 2PQ0A 3BHNA 3NBMA 3LXXA 3OZTA 3QEKA 4LQLA 4X92A 5AJXA 2V1UA 5AK5A 2QOEA 4IQ8A 3N87A 3KE9A 3MMPA 1E92A 2PIAA 2VI5A 1VJ5A 3GMTA 5I7FA 2ZTHA 2GXSA 2VWGA 1Z22A 3GXOA 3CT6A 4CETA 2VNAA 2FFBA 3VU9A 3A1FA 3THYA 1XZBA 2DR2A 3O1IC 3L01A 3KLMX 3K0AA 4MCJA 3PHJA 1KMHB 2H8KA 1J9EA 3WICA 1GAWA 1DC5A 2XQGA 3LM8A 4L6CA 1M7BA 5CDFE 2W42A 2VSNA 5BR1A 4QM6A 4CM3A 4L5AA 4ZVOA 2OB1A 2IOYA 2V8BA 3GVPA 4TKZA 1J8VA 3AHIA 5BNFA 2I4MA 1KA9H 2C31A 1QYVA 1ECBA 1F4LA 1QH8B 4LWQA 5H3CA 2QU8A 3V8BA 4LOIA 3REGA 5BUQA 2XF8A 1X1DA 4O08A 1GNRA 4OYRA 4TVKA 5CA0F 3RYCA 3QSYA 3K0SA 2V7UA 5CW2A 2BGNA 1CQIA 2AI3A 2GBCA 4YDHB 1OGJA 4G0OA 5LDGA 5K0ZA 4UDOA 3NOVA 4ZVPA 2GETA 2DRIA 2JCYA 5F5XA 2OD9A 4LIPD 4KPGA 4OG2A 5AKXA 3ZVRA 1P2UA 4PTYA 4CKWA 1MGPA 2VCHA 3U7QA 3JWIA 4NJEA 5EXEA 2ZTVA 4EFDA 4GX0A 4NI5A 4RF3A 3E35A 2V4ZA 3TMYA 5B3JA 3RVJA 5KO2A 4NDNE 4O8ZA 5DGDA 2XRMA 5A7FA 3E9YA 5AT1A 2NVWA 3W6OA 4C5CA 2WKPA 3GEPA 2HA2A 5F2NA 3TZ6A 1KI3A 4ANFA 2VQEB 2F9LA 2J0EA 5A4DA 1O2DA 3WZ2A 3QTLA 2REQA 2WJHA 3KZXA 4TSFA 4JGBA 4X85A 1YOBA 4EBFA 1ZOOA 1NA5A 4Q3EA 4Z4EA 2Q4RA 3QE0A 2N9UA 4G26A 2WHQA 1OFUX 1NM5C 1YHYA 3R5HA 1TM4E 4Y1GA 5CAEB 4OQNA 4R69A 2YCLA 2H48A 4MYTA 2BTQB 4MAAA 3ZR4B 2JARA 5KYXB 3OJFA 4PCVA 2ZIXA 4ER6A 2XCIA 3F7TA 4NHOA 1I1QB 2Z58A 3AHCA 3TGWA 5ESRA 3W5VA 1FNBA 1N2IA 1NMXA 2JCBA 4PX3A 1VI5A 1V8PA 1R8JA 4ZODA 2HXYA 5CH8A 5TMDA 1SCUA 1E4OA 2OQRA 4CM5A 3T1VA 2SNIE 3DEYX 2JIDA 1GTG1 2HYDA 2JLBA 3NPMA 3HC7A 1UPBA 4J7XA 4OQ4A 3VOAA 2NSLA 3FX2A 4CKEB 1XU9A 4NCNA 3AW9A 1HA3A 4DBVO 2NZJA 3JVEA 5LP6A 4Q19A 2C2MA 5KS2A 2BFCB 2TMKA 2Z30A 2VTVA 3MILA 3K1AA 3MT7A 4WDQA 4CFZA 1JLMA 2VC2B 2IZ1A 2FN9A 3CLHA 1KJ9A 1X8LA 2G9QA 4GR9A 4QUDA 5BSUA 5KOHB 4UU8A 2O8VA 3HCBA 3T5PA 4X6YA 3ZNOA 5IM4F 4OATA 2GZSA 5ICFA 4F56A 4CM8B 3QMMA 4G5RA 4PLTA 1NGSA 4H4DA 5KNDA 2IYLD 3DZJA 3MTEA 4E22A 4BGDA 2LCQA 2Y1XA 3GG9A 4DVGA 4IH9A 2PV7A 1RHMA 2FFQA 3OEEA 2CWWA 3V55A 3WWCA 2JGIA 1B4DA 4WOBA 4CL8A 1V6CA 4YBRA 4EHFA 1EX6A 1XELA 1RBQA 1MA3A 2E6KA 1GXSB 3E2PA 4ZV9A 4DXAA 3MGGA 1NT2A 3P9CA 1Z2EA 2C2KA 2AMLA 4MA0A 2F1JA 3R3WA 1T6ZA 3TOVA 4KH0A 1IUPA 3PFNA 3BTVA 3MM4A 5CTJA 1LTKA 4A8JC 4HUTA 3HO1A 2ORYA 4BB9A 3F74A 3H42B 2HMTA 2MMCA 1ADJA 2DC1A 2YW9A 5HW0A 4ETMA 1QDUA 1XE3A 1GZ4A 5G0TA 3BXGA 2DYKA 5MN6A 1YDHA 2RKWA 1D03A 1MT3A 4LY0A 3TOCA 1HEUA 1VL1A 3JQ8B 3BF7A 4FEYA 2IV2X 1QGED 5EC8A 1XZDA 3ZKWA 1A8QA 2J59A 1UWKA 1T6YA 1AKNA 5JUWA 1QZXA 1V1RB 1NAIA 5HK9A 2AMFA 1U3WA 2HSDA 1Q7TA 3N2ZB 4M8LA 3K5PA 2VHZA 1QTRA 4JC8A 4Z0TA 4JMPA 3GDGA 5AJVB 4BNNA 5I51A 4QTZA 3KQKA 1UJ2A 1PSZA 1X70A 2PJDA 5AJHA 1V16B 1TYDE 3OM9A 4FNMA 1B8VA 1WS6A 2XUKA 5A1JA 3DQZA 2CHFA 1YJ8A 2Z5FA 4B7ZA 1JG4A 5I7OA 5HIJA 1OAOA 3RYFA 1J23A 3VAAA 5CBPB 3GT4A 3QPCA 4Z51A 3IEMA 4OHYA 4X61A 1OZ0A 4WCVA 4ZD6A 1T0BA 3ILHA 3LUGA 3O3CA 2HFJA 5F77A 2IW1A 5JWHA 4UM9B 3E84A 1D1PA 4QZVA 3WB2A 1ESCA 1UEXC 1ADCA 3ONEA 4CV1A 3SVLA 2IK8A 1E98A 1P1HA 2KLBA 5ENDA 4M7WA 4DJJA 5K0EA 1XRRA 2PGDA 4R6XA 2ZKIA 4PU0A 3UEOA 1ZH6A 1XCGB 2UZ1A 3TX6A 4CG0A 5KU7A 2PWPA 1H9AA 1DC3A 4GX5A 4H60A 3EIQA 1SKBA 4MWDA 3F6YA 5SY6A 4CTNA 2PZEA 3THXA 3B51X 5BSRA 2BW0A 4LRUA 1D0IA 1GPWB 3L7AA 4RESA 1HYHA 2QT1A 4EO7A 4UPEA 3J81A 2AR0A 4CDMA 3HCFA 4EX6A 3DSRA 4UASA 1E59A 5B53A 3O9ZA 1E3TA 3GL9A 1YA6A 4K9DA 2OAEA 2NUAA 2PGOA 4XOUA 1GTVA 3VO8A 3FGZA 2C1EA 1LSOA 4E09A 1ZD8A 1XZ8A 2CJPA 3JQPA 4GZLA 3RARA 4ZJYA 3OQ6A 1P1BA 1RJ9A 2OTCA 3VZRA 2FFRA 3OJCA 2OC4A 1WZ2A 2ZI4A 1I2DA 4PN3A 2Y2UA 3VVMA 4BFWA 2Q5FA 2W2LA 3I6BA 1H85A 4XX0A 1ETHA 5LFAA 5T4EA 1EHIA 1AZSC 1DIRA 4Q1VA 5B2ZA 1KI1A 2HNBA 3N9IA 1TVKA 2FPGB 1O8CA 3OA2A 2ZS9A 4QUIA 1GTJ1 1C3LA 2E48A 5LZ5A 3ETNA 2PBFA 3DHNA 3M0EA 2FZWA 3Q7SA 4HAVA 2Q1WA 1MDFA 2PMDA 1GM5A 1X74A 2ZJOA 5L3VA 1WUIS 1MEOA 2RARA 4MP8A 2ZEJA 5LBIA 4REQA 1XCJA 4Q3DA 2WQ7A 3CGWA 2FZKA 3UT5B 1M8JA 1N2GA 4MUFA 3ONWA 1KYQA 1VPEA 3TKAA 5LQRA 2C2WA 3L0ZA 3R3YA 2EEZA 2PLNA 3C5CA 2COEA 3QY0A 4WERA 1GZUA 1GZ7A 1WDLA 4NZYA 4XFJA 2MSEB 2C9CA 4NS1A 2WEKA 4MJLA 5EJ4A 3HNPA 2YMLA 1YGPA 4PLHA 4W5JA 4JR0A 3ZLBA 4B09A 4XGNA 5AIBA 1AKWA 3OWXA 1MAAA 3LQKA 2XOEA 1Y81A 2FNAA 2PWZA 5C46F 2ID4A 3OFNA 2PCJA 5DZSA 3AZQA 3IUQA 5JNWA 3HS3A 1OT3A 3WLIA 3U4MA 4BNUA 4QGFA 1FFXB 3UMMA 1HR0B 4OQYA 4DMGA 4WFIA 2CXHA 1SEPA 2WUVA 4J8PA 1LFAA 1UWLA 1IPEA 4FXOA 4QKQA 2C2GA 4JWKA 1N9GA 2W6JA 3FDJA 3P71T 4W5TA 4FMCB 4UU0A 2OXCA 4EG1A 1X2EA 1VG1A 2ISSD 3NKLA 1DOAA 3W3AD 3GC6A 1CY7A 2O3QA 1L4UA 3CT4A 4BV9A 5EJEA 3TE6A 3QP9A 4CHGA 4DM4A 4OFWA 3ZZNA 1ZI9A 1ISSA 5DXJA 1HGXA 2A1UB 3CFYA 3DMGA 3NBQA 3PT5A 4H7PA 3M5WA 4KOAA 4X94A 1WW2A 2WJGA 5H3LA 3VC2A 5JDCA 1YZTA 4RTMA 3FPLA 1QG4A 1WTCA 3QX8A 5KNBD 2PRIA 3LYLA 3LTEA 3V4SA 3LT5A 3IUNA 2VNHA 3PDUA 3RREA 3PICA 3ZHVA 2J5QA 2ZAYA 2WZBA 3AP3A 3E0QA 3QPAA 3L0IB 1I7SB 1PR2A 4HMQA 3PIRA 4C4PA 2V4MA 4F3RA 2EJBA 3HB9A 5B6PA 2QV0A 3UMGA 1IJEA 4Q03A 2WY2D 5AQ1A 4LW8A 1TEXA 1OX5A 2I2AA 1E99A 5FPTA 3OJWA 1MNQA 4MRNA 2J6CA 2ZDHA 2DMRA 3DJYA 4KPUA 5FI1B 5FPSA 1HFEL 1LTQA 3RVQA 3WOHA 3WWOA 4DLAA 1YE8A 4HGPA 3OCYA 4E1VA 1PLKA 5EA2A 3VISA 1LLUA 2B5VA 2IT1A 2MWMA 4ZRMA 3JTEA 3Q3IA 2NU7A 3RO7A 3OQJA 1B6SA 4S1VA 1EK6A 3O82A 4FEAA 3IT0A 1EQ2A 4AMBA 4JI2B 4KTVE 3M33A 2AQIA 2E87A 3OECA 4ZICA 4HZUB 4LA4A 1PL8A 4UEQA 1NJSA 1IPHA 1GPKA 3SG0A 2G08A 2HJHA 3BK1A 3RRXA 3QENA 2JGDB 4F45A 2RAUA 2FPIA 1UADA 2I76A 2IYPA 4JCOA 1FJXA 1I2ZA 2ORED 4NQRA 1TPYA 3S81A 1U7HA 3SYNA 4EFLA 2WWTA 5AR1A 2ZVQX 1J2EA 4V1CB 3CY6A 3NQ41 3RF7A 1J2YA 4EJMA 2ZGVA 2ATVA 3MWEB 2ZP1A 1B14A 1Y8CA 4KPFC 3RR2A 2AMYA 1XMSA 2PUHA 1RQLA 4CLRB 1NN3A 2DLDA 1U8ZA 4MI1A 4OHVA 3RC3A 3K0CC 3U3MA 3ZK9A 1R0SA 1GO2A 2PJZA 1DBPA 1PZFA 2R7MA 1WD7A 5M2QA 2OM6A 4FK8A 4JGIA 2B37A 3RSZA 2AZTA 3KWMA 3SLGA 4PPGA 2AZMA 2V7TA 4DVJA 3P0FA 2O50A 3FTNA 3H8JA 1K2VN 4PQFA 3TBKA 2QRGA 2AXEA 3EEBA 4BQSA 2DFDA 2EBUA 3J81k 2HMYB 1KI2A 2E4AA 3SZLA 1MFPA 1M72A 1B6GA 2F1IA 2GUGA 4QO7A 1NBEA 2NV2B 4R5HA 1RTKA 5DGIA 4UMDA 5AK0A 4F7DA 1HT2E 3AEQA 1CUCA 2KMLA 2XADA 1AGRA 2CYCA 3IAHA 3OZAA 4MIOA 4UBOA 1KDPA 1KMHA 1VJRA 1WXQA 1Y1SA 2FZEA 8OHMA 3SNHA 1GKIA 3QA9A 1K5DA 4XYBA 1E66A 5AHKA 3EFOB 4ZQFA 2D2IA 4J49A 2B98A 4OHCA 4TX1A 1ISRA 5BT9A 1WETA 1KVQA 3JZFA 4YXFA 3QEMB 5HBRA 3F6PA 3NOOA 4DNQA 1QH8A 3SFZA 3FPHA 3I1YA 1FDOA 1U2RA 3KYBA 4G5YA 5C1IA 3AR9A 1EDOA 4XASA 2WI8A 4TSFD 3DTVB 2HO4A 3RK1A 4C87A 4BLQA 1SUSA 1TLLA 2WSYB 5GP1A 3IOMA 4F6RA 3Q41A 2OBMA 3TFOA 2WTBA 2C7VA 3VJMA 1OV4A 4OMUA 1JDNA 4M0FA 3O8LA 4MVXA 1ISHA 2OHVA 4IVRA 3MTIA 1C1DA 3M4XA 3SF0A 3QVSA 1JP7A 3AEKB 1XKTA 1TI7A 3THSA 4QJ5A 4UNRA 2IEAA 3FI0A 3H8VA 3ZIDA 4YUAA 4MIYA 3OIVA 1UC5B 1V5EA 1G21B 4G5XA 2A3RA 3HXOA 5CA0A 2DSNA 1FS4A 5DPMA 4ZRDA 2XXAB 4HB3A 3OA0A 3S5JA 3QMPA 1JTVA 2YZKA 5EXTA 4QXRA 5AI8A 1PWEA 3WLHA 4F85A 4QBGB 3K3PA 1ESZA 4C0KA 3STVA 2PS9A 1P0CA 3D3QA 3N2YA 1RYNA 2IQIA 4IJVA 4J0QA 3N2LA 1XLTC 2BFFB 2QYHA 3D6NB 5KYXA 1Q95A 1Y7HA 3DYBA 2ZTMA 2XUHA 1UKZA 5JLJA 4OJTA 3NM5A 1N7HA 5HJ5A 1KBZA 1RJWA 2QM3A 4BFZA 3G2PA 7AT1A 2CNWA 3HG7A 2VUTA 4I6GA 4ZDWA 4G5HA 1ODKA 2J7KA 4N0EA 4MRSA 4MYRA 4NSNA 1U3GA 2Y6UA 3BIJA 1DIHA 2OAQ1 2QR2A 2FUNB 1BA3A 3IDAA 2PL5A 1VC2A 4HNUA 2G25A 1MO4A 1CEQA 3OU2A 1XA3A 4DWOA 3FOEC 4M53A 2B7BA 3I30X 1ZICA 4TTQA 5A02A 3EQ8A 5ELMA 4OKSA 1JQKA 2VP0A 4LI0A 1RS0A 3PFWO 4JKIA 2BFCA 5CT6A 3SQDA 1DBSA 1S3IA 2YX1A 3SIPA 1B2RA 1IY2A 3FVRA 4P35A 3QVMA 2AH5A 4AJ1A 3CINA 4X0EA 1PAUA 3PKIA 3AXSA 5KOHA 2EP8A 1RM4A 2F9MA 1KEKA 2O0HA 4LF5B 5JCOA 1VJGA 2GJAA 1RMYA 4TS9A 1Y1KE 1TQ6A 4Y7DA 2HXSA 3KZCA 4PE5B 1M6YA 2HWYA 3AFIA 1T4DA 3GH3A 1NOJA 4ZTUB 2ZM5A 4JLVA 1N2CB 2OHJA 4LX0A 2AQHA 3E9QA 1ZAYA 4K1LA 1RWVA 2I1LA 3RIYA 4Y1FA 4WJKB 4ZCRA 4MICA 2XZLA 3P9QA 1EGMB 5TV2A 4OLAA 3DHWC 2F3UA 1QNFA 3A70A 1YRLA 5HJ2A 1GXSA 3ESDA 3GOHA 1LRKA 5JD6A 3G2MA 5IVIA 1U7TA 2YQ4A 4F2WA 5IM4A 5ALXA 4L07A 1FMLA 2EL7A 1E3SA 1WY5A 4MGEA 2BIFA 2R8OA 4AO6A 1LLDA 2ISCA 1MX3A 1W46A 4BZZA 1NP7A 4B5KA 2CFCA 2X6TA 3FCCA 5GOTA 2F2TA 1UAYA 1E96A 2EHJA 3B78A 1HO3A 1HDGO 4QOGA 5DGCA 1B7GO 1Z06A 1Z47A 2R25B 3CVXA 3ND7A 3CKKA 4I3HA 1V7ZA 1Q0SA 1QVWA 1MP0A 1C8VB 1YULA 2XECA 2ZI9A 3JQ8A 4MYSA 5SZIA 3WYEA 1C9YA 1QX3A 2AT1A 5JMTA 1ZWLA 2ERCA 3R2JA 3D6TB 3PUWA 5AM0A 1N4DA 5AWFC 1YZQA 4QOFA 4BO6A 1V1RA 1UUFA 3MTQA 1ZGGA 3ENVA 1QHNA 2VT2A 1DKUA 3PG5A 2QB5A 2ZITA 1H2WA 3CX8A 4PZCA 1CDDA 1F8YA 2EC5A 3K31A 3IELA 3FY4A 3LKBA 4UXIA 5AXAA 1BE6A 2YIMA 3T38A 3BT7A 2OXRA 2ZJ4A 1V16A 4KNVA 4FT4A 1SCBA 1TLTA 2JHFA 1KDOA 3KDPA 4RCZA 2RHWA 3REQB 4MLPA 5KSWB 1HLDA 1MMFB 1SN7A 3OUZA 5SZKB 3JQAB 2WTEA 1FVXA 4JJ6A 3WHIA 3O3MB 5CBPA 1NATA 3GH1A 1J42A 2AB0A 3MB5A 4KXXA 2KHZA 4N3GA 1O94A 4RTKA 1TM5E 3M1YA 2OBFA 4FHDA 3M1AA 1OXUA 2WR8A 1NVFA 1I1HA 3UGQA 3W4KA 3WXBA 1JH8A 2IY8A 4CIXA 2HIMA 5A71A 4JB2A 3EDQA 3U7GA 3MWJA 2P91A 3QV1A 4DKXA 2QRUA 1MAVA 1ZZGA 4IO0A 4K7JA 4R4JA 2WFMA 4ZT6A 4W7IA 3G5AA 5KJ6A 3H5WA 4PZYA 3UXEA 1KH1A 3BL5A 3GAMA 4I4LA 4N9WA 4X3PA 4GUAA 5EIBC 1ES9A 1YJQA 3AUAA 2Y92A 4IV5A 3MQFA 4PS0A 2CFRA 2XUPA 1DT5A 2W6PA 5B7NA 3Q8MA 1MX5A 3RASA 1JS1X 1E58A 1ZCAA 2P3SA 4P3KA 3VR3A 3DE1X 3LQ2A 3SSNA 4ENQA 4JXZA 1A71A 1NDUA 2GYUA 2JAWA 2G6TA 3R3VA 5B3AA 3UG6A 2MOKA 1KZ9A 3U3RA 2AG6A 9LDTA 1DXQA 1SQ5A 4DE5A 3W5JA 2EP5A 4O0LA 4YONB 4JCCA 4M49A 1E18A 3BA6A 3FVWA 2WLSA 3KB6A 4FMDB 1VKJA 2AE2A 4JYZA 4TZKA 3E1KA 3E7FA 4EHBA 1QS0B 4BN0A 3JATB 2CXNA 4MEAA 5SV2A 3VDNB 4D3DA 5DULA 5I5GA 2WJ6A 4CM6A 3HCRA 4GBMA 4O29A 1I4DD 1ADFA 3NAQA 4QPZA 3U9LA 5HWSA 5LZ9A 1FJGB 1WQ4A 2WUGA 3K30A 3FD8A 3G79A 4E0BA 1II0A 1RRGA 2FPGA 3CPEA 2FMTA 1VQ1A 3V8NA 3WSVA 4EFNA 2HPVA 4K40A 2BV3A 4RTQA 4KO3S 1Y6FA 3OFND 1O58A 3SDBA 3PQDA 1XZFA 1ZKMA 3PI6A 3D59A 1AO0A 3FPAA 5I9BA 1ZS9A 7MDHA 2NQ8A 3F8WA 1D4OA 3O7WA 4TZTA 4ADSG 1DO2A 1K5HA 1L7PA 1NF9A 4NFYA 5AYVA 1QO7A 1KDZA 4CIVA 3ZOKA 3UT5A 3OTHA 1Y3CE 1VSTA 3K1ZA 1II8A 1QPGA 2A5GA 3D5EA 3FCEA 5DHUA 4ZGWA 3MBOA 5HR5A 5EGNA 3FSRA 1N6KA 3R3SA 4AS1A 1URPA 1DFGA 2PL1A 3LUFA 5CFQA 4BKRA 1XVAA 1RLMA 1KAMA 1SCAA 1JKFA 2B6NA 5IF3A 2IPXA 1M2HA 2VPPA 4ZVUA 4ZCMA 3C48A 1AZTA 4E88A 1KJQA 2HI0A 4PFJA 4R84A 3HHPA 4U2GA 4Z8XA 2ATIA 3UKOA 1UKCA 3TTSA 2C2YA 4CMGA 5A6VA 1H2FA 1NQTA 2WG2A 1A2OA 1FFXA 1JT9A 2H4FA 1EFKA 3U3ZA 3A31A 4QODA 2OCYC 1AQNA 1KYWA 4WK0B 5E6UA 3E1SA 3OICA 3X1ZA 2GN2A 3TRIA 5I45A 1IWBB 1U0JA 4MLCA 5KSPA 8MHTA 1R6DA 4UUNA 4A1OA 2UZ0A 4FHEA 1VYHA 4LKRA 3SJAA 1A77A 4BE9A 2ZRIA 821PA 1JALA 2HW8A 3G6KA 3AM4A 1KJWA 1OBCA 1DXHA 5DNDA 3RHZA 3T3MB 3PJGA 4LJRA 1DBWA 1JPJA 1SZPA 2D0OB 2BI7A 4AXBA 4ZDKA 3X1DA 4DR2B 2YXPX 3MT8A 1YWGO 2X2PA 3VR4H 5JFGA 3UATA 1SY7A 5KYYB 1ENYA 2NVBA 4JU9A 4ND5A 2PGLA 3BTSA 1GGEA 3R7BA 4P0PB 2ZZNA 1VSVA 1K68A 1B74A 1XROA 1TM1E 4D4HA 1T9ZA 1XQYA 2ZR7A 3CQ9A 3IOBA 1NUTA 1GP2A 2JEZA 3ZU4A 2WNHA 3D64A 2W58A 4E6PA 5DI9A 3KTAB 2ZQZA 1A7JA 2PFKA 3HN6A 3A6HA 3KFLA 3LYAA 4MPTA 2HWXA 1YZNA 1QDLB 2ZQ5A 3MBKA 2WILA 1ZK2A 1NJ8A 1FPQA 5TB5A 1TC2A 2CDRA 1Y42X 4YV1A 3UFBA 5B57C 3VMFA 1HDOA 3E8MA 2OCLA 5BV8A 5AI5A 5FAXA 4BBZA 4FZRA 1UXOA 1I14A 3BH6A 5K03A 1TZMA 3K0EA 5BW6B 2IOFA 4BLRA 1ZMRA 3WIOA 1L3IA 5HDBB 4LDZA 4JHXA 2EBHX 4KMMA 1FUIA 4LZAA 1HH4A 4PR3A 2B94A 1PR5A 3KK0A 3RRMA 2FHSA 4LF7B 1ULHA 5C53B 1E6UA 2D1FA 3GHYA 1EA7A 2LUOA 4UEWA 1X39A 4QNMA 5H8WA 2CXOA 3S27A 2F3RA 1E7MA 4V0QA 3VYVA 4OHXA 2VZ8A 3H1TA 4C04A 3IV6A 2Y1GA 2QVGA 1T3HA 3MWEA 1CP2A 1I0LA 1UDAA 2JFHA 1NBAA 1JR3A 3E82A 5FTJA 3VKFA 4D96A 4CLRA 1EXVA 1SAYA 1A8PA 3I83A 5AVYA 2AXQA 4E46A 2Y1OA 2IS6A 2IY7A 1YQEA 1EPUA 1N8NA 3V4VB 4DLWA 1UINA 1TEVA 4J03A 2XZOA 5JQWA 3WWYA 5TS2A 1J9GA 1YZYA 5DYIA 2AI1A 4TXLA 4MS1B 1XQ6A 1OYVA 3LL7A 4J07A 4E5DA 1W1WA 5KNLA 1C1HA 1XNJA 3L8ZA 1Q20A 2AXNA 4LECA 4BCBA 4KE6A 2YICA 5HTKA 4FYVA 5K51A 1N0HA 4CVNA 1JAIA 1UT8A 4UU1A 4YJ2F 3GFSA 3PFBA 4YMWA 3D9QX 3HEMA 3UAZA 1QH0A 4UNNA 4ZAVA 4DCJA 3SR4A 1CIPA 1QZUA 2ZR9A 4DLUA 4MQ6A 5FBQB 5I9SA 3TO5A 3EFOA 3I62A 2BE7A 4LTDA 4ARUA 5K8IA 3QEMA 5T41A 1GTMA 4EMUA 3KOYA 4BKMA 1T10A 4DIFA 3LO8A 3M6MD 5ESWA 4AY3A 3HL0A 3BXPA 1N3YA 1PTJA 1QE5A 3T9DA 3WLKX 3EDYA 3HH8A 4JI3B 4C01A 3ZD6A 3THOA 1N92A 2IKQA 3OIYA 1UBSB 1X7XB 4IDOA 4YJ2B 4AN4A 1UEJA 4AJNA 3AOEA 2Q8PA 1EEHA 1KAOA 3OTOB 4MKZA 1GA4A 1TAHA 3ZW9A 3RBZA 5TJHA 5CEJA 5JY6A 5JG7A 3CF0A 1XKLA 3IEUA 5IKXA 1Y0BA 2JF0A 3DFFA 3G0HA 2CXQA 2AC2A 1NUAA 1A95A 2V98A 3AEKA 5AW0A 4ZEOA 3C7AA 3OJLA 4PLVA 3I9OA 4KIFA 4ZZ0A 4XGRA 5BORA 3OQNA 2CNWD 3R9XB 4P80A 1CY2A 1MOSA 1S01A 2BBTA 1G21A 2P3OA 1EUDA 3KOZA 4HX5A 5B1HA 2X40A 3D6JA 3D6VA 3DMYA 3O95A 1JIQA 3RV3A 2QKYA 1QIKA 2ZBQA 4JDUA 3DMDA 3L79A 2XXAA 4EG4A 3IIJA 1DIOB 2QRZA 3D4OA 2ANCA 3HI4A 5HS6A 1RNLA 4B9AA 5ILOA 5FBLB 2WJZB 1GWNA 1CR1A 3GRCA 3ILSA 4V2UA 4C0XA 4EI7A 1L5HB 3P2OA 3RS9A 4AYXA 1OA0A 1DKMA 1M7HA 2VSOA 3DHYA 2C5FA 3V80A 2XGSA 1YZGA 3AX6A 2PXAA 2OFXA 5LQMA 3OPXA 3H6HA 1JVBA 5TY0A 4YC7A 4EAAA 1I5OA 2WTAA 3WGIA 2VQFB 2WTNA 3AVWA 4E2YA 4KMRA 4ND4A 1U94A 1W2WB 3OBBA 3QITA 4RNCA 3TVDA 3B12A 4JUIA 2O2GA 3WK6A 4R81A 1XDWA 1ZPDA 1E7QA 1JYSA 4HNTA 4UBKA 3DDSA 3QE4A 2D6FA 4BXOB 5KQRA 5JSKA 1U1CA 3GJXC 4X60A 1CJBA 5ANRB 3TEMA 1LVUA 1IN1A 3NRCA 1IM5A 1KVUA 3FHOA 5EJAA 3H5LA 1I5RA 4ZVLA 4NC9A 3I6YA 3I52A 2WYVA 2B7LA 5FORA 1U3TA 1L7EA 4I9GA 1UXGA 1RAIA 1TPZA 4NBVA 3ZWQA 1PG5A 4P54A 3EG5A 2HNAA 3L4BA 5IHPA 5EUCA 3KSDO 1ODSA 4IFBA 4TLDA 2X8AA 1DZ3A 3TD9A 4E4RA 1N6OA 1DTSA 2CLSA 1PZXA 3R5KA 4BLVA 3AI3A 2EZTA 3LDHA 3T35A 2IUSA 1Z33A 1XR3A 1XZMA 2RAVA 4DSNA 3DLHA 1WM1A 2OP1A 3QHAA 1C29B 1R0WA 2IZZA 4FZVA 2J7PD 5EEGA 5JNTA 3DLAA 3GLRA 4GKKB 3FVTA 3PDIA 4JR1A 1U9IC 3BWCA 4KB5A 3SXUB 3U2QA 4P4LA 1N2XA 2GZ2A 3IGFA 1UANA 5U1PA 4WINA 1AE1A 3M4ZA 2REXB 3PR3A 2JAXA 3DL4A 3DGFC 2GBPA 5C8DA 3A7DA 1FUYB 5FJIA 2UZ3A 3OPMA 3II6X 1K4KA 1UZNA 3LPCA 3PR1A 4BNVA 1A0OA 1NHGA 4KE9A 3RRZA 2H1SA 1VXRA 4YDSA 1C2YA 4U6SA 3LIPA 1D6JA 1AGYA 1KYIA 2JEOA 1VE9A 3QIVA 1SR8A 3AF0A 4DC0A 1GLVA 5D6NA 3I2KA 3OQ1A 1XGKA 4PRKA 3FMFA 1SC1A 3QOYA 2IYRA 1BKDR 2VJNA 3I42A 3SC2B 2ZTLA 4UM9D 2HA7A 4Q3OA 1BFUA 4KLAA 1EM8B 3ZYCA 1C41A 2FXVA 4F96A 5AUPB 5CCXA 1MN6A 1YDMA 1F5SA 4HDOB 2Z4TA 4J0DA 3HWWA 3AF6A 2Y6VA 3EPRA 4PGHA 3AT1A 1AF4A 3DXYA 4EUKA 2GMWA 3REQA 4XYMA 5CVJA 1BFDA 1CJVC 3JQAA 3HKDB 3LUKA 4RIIA 2GT1A 5ESDA 3ESYA 3VR3D 1COWA 3O8RA 2G36A 2IUYA 2ZJZA 2A78A 5ENZA 5A2GA 3JYLA 1RT9A 1VCHA 2GM5A 3B7WA 2BELA 4LSZA 4MGZR 4V0OA 2JJ2D 3IUJA 2R6DA 4AG5A 5D7BA 4BGUA 4ZI2A 2IKSA 3FGPA 4PSCA 3R0IA 4YMUA 5EIBD 4B4WA 1P7PA 1OZFA 4DRYA 3T3EA 2YFKA 3ENZA 4QHYA 2RHDA 1YHZA 2GK3A 1NWCA 4Q4JB 5C3MA 2C00A 1KHTA 3ZXXA 4WBNB 4PYIA 1GKLA 4N3BA 4ER7A 3K9BA 1Z0AA 2CDBA 1ECLA 4AP9A 5COQA 4OHOA 5IABA 3PXBA 4PG4A 3TQRA 1XD8A 4CI0B 3PF9A 4P32A 2EKZA 4G9GA 2VJBA 1XRQA 3B1JA 4CMAA 4EGQA 5LLDA 3HO8A 2FG5A 2KB0A 4QATA 1Z5PA 1GCIA 1ECFA 4AJ9A 3TR6A 3ETJA 1JHUA 4YP5A 3A25A 3PUYA 3T7RA 2QRKA 3NR2A 4MV3A 3UHPA 1MTOA 2ZUFA 4B0OA 2AN3A 5JW6A 2ATCA 4MLDA 2ZYHA 3BGDA 3CN9A 3LD9A 4D80A 3ICWA 4D0SA 3OT1B 3MELA 4WESB 3PVCA 4B3XA 1ZX1A 4PZLA 3IH5A 3E5HA 1KPIA 1DQZA 1BMDA 5FDFA 1F14A 5CB4F 1Y7IA 2I7TA 4I1RA 1R8XA 3NBXX 4YB8A 2BFEA 2Q3BA 1ZCBA 5G3ZA 3VHXB 1P7ZA 3PE4A 1RKVA 2P9FA 4ZCPA 5H5JA 4TTSA 3T7DA 3TVTA 3EXHC 5KOIA 1H9CA 2RJNA 3UOWA 4DAOA 2IGTA 1KORA 3BMOA 5C8YF 1CVLA 5ICSA 4MQBA 1I3MA 3MTGA 1DRVA 3HUDA 3HXMA 1YF3A 4ER5A 1N5IA 2H2DA 1FBTA 3NTLA 5HHTA 3FDFA 4CMKA 1GUZA 1NQUA 2FGJA 1P39A 1JHAA 2FRVA 1SPXA 2ZW9A 3FYUC 5LKRA 1G8AA 2O5CA 3WAJA 1VBFA 2LVBA 4LK3A 2CE2X 2MINA 1VL6A 1HMPA 1UPFA 3GVXA 3WNCA 3DKPA 1ISMA 4ND6A 2XCSB 4W8OA 1WUKS 4N82A 5CEEA 1JDUA 2ALJA 4H3HB 3LDGA 3QUBA 1N33B 2P4SA 4UBIA 4CM9A 1T0IA 2NXNA 3ZC3A 2NP6A 4TL7A 4DNFA 1UOPA 3OMLA 4C7OB 3QY9A 5TT1A 2VYCA 3D0RA 1XPOA 3T0IA 3ZX4A 3B52X 5LQCA 1RWKA 2R3SA 4N03A 1I4TD 2O2ZA 1UDXA 4C3ZA 1KETA 1GYRA 1NMZA 2Z56A 4DYVA 1NNEA 2RC5A 1PNQA 1N7GA 4XEHA 3LFUA 4YMLA 4LBZA 2R7NA 5KYYA 4MLZA 2ZR0A 1Y1PA 3PJDA 3GJ8A 2C95A 1NBME 3RBXA 2BHTA 2WFZA 4LXTA 3ZE2B 2VDQB 5E9QA 5J2TF 2FW1A 1NVXQ 4H3VA 2WP8J 4TKUB 5MDHA 1U02A 4N7JA 4XZ3A 9ATCA 1YS2X 2MSWA 1YJCA 3KHSA 3NX4A 5JO9A 4OBXA 4QWWA 5JANA 1H22A 2BY4A 2G9UA 3C3DA 3D0OA 3IURA 3OZUA 3GLHE 4E4YA 2FFJA 1W4AA 3KTAA 3GA7A 4C6SA 1NJ5A 3S6JA 1FJ2A 1GN8A 1E3DA 2Q5JA 3IMEA 3L9XA 2FTKE 3DE6X 5TMEA 2O8FB 3DC2A 1ZINA 3CCCA 3FKQA 2A94A 4FGZA 1XJ0A 2J5BA 3RVSA 1KNXA 4R31A 3ZK7A 1RMTA 1NLMA 2GJSA 3SYKA 3UAOA 2NO5A 1UQUA 5C3UA 4BY9E 1MEEA 1FVFA 4MUBA 2XKKA 4S1PA 3VNUA 2HA4A 2W2NA 2H6EA 5J2TB 5AHRA 1KJJA 4CR7A 1ZH4A 2A9VA 5CDTA 2GERA 3IPLA 4LRQA 3GEEA 1ULZA 4URWR 4M55A 4QX6A 4ENRA 5C9ZA 3B53X 1T9HA 3DDCA 3AILA 3EIEA 4GRDA 3RBVA 3WLRA 4JUDX 2XUFA 4LY9A 4CUKA 2HLPA 3PQ5A 1GFSA 1CS0B 4RPJA 3OUUA 4F21A 2PBZA 1KP9A 3CO0S 4V0RA 3T1QA 3BTUA 3OLXA 5EKSA