1PR1A

Escherichia coli purine nucleoside phosphorylase complexed with formycin b and phosphate/sulfate
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
237
structure length
226
Chain Sequence
ATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHRQTTFNDMIKIALESVLLGDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Structural basis for substrate specificity of Escherichia coli purine nucleoside phosphorylase.
pubmed doi rcsb
molecule tags Transferase
total genus 71
structure length 226
sequence length 237
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1pr1A00
1Y1QA 2OECA 4DAOA 1PR0A 5C80A 2A0YA 3QPBA 5I3CA 4E1VA 4DA0A 3UAYA 4F2PA 4DA6A 3E9RA 5F7XA 4D8XA 4H1TA 2PGAA 1Z5PA 1CG6A 2XRFA 1LVUA 5JPCA 4GKAA 1RCTE 3DP9A 1SQ6A 5CXQA 4TTJA 2QSUA 4TXJA 2HN9A 4MCHA 3KUKA 1Z37A 4NS1A 2ISCA 3SCZA 3TL6A 4TXHA 4D8VA 2GUWA 5CYFA 3K8OE 4F3CA 5ETJA 1Z33A 1U1CA 1VHJA 1VHWA 5B7NA 1B8OA 4GLJA 4LNAA 1V45E 4L5AA 1RXCA 1I80A 1PBNA 1Z5OA 1ODIA 3IEXA 3KU4A 3ODGA 3PHCA 4OY3A 2HWUA 1LV8A 3E0QA 5F76A 1V2HE 3MB8A 1SD2A 1NC3A 1T8RA 4WKOA 4NSNA 4JOSA 1LX7A 2AI3A 5F7JA 4MARA 3PNSA 4DA7A 1A9TA 3D1VA 4YMLA 1PK7A 4L0MA 4LDNA 4PNPA 3BJEA 4TTIA 1OTYA 4D98A 1PR1A 2QTGA 1RFGE 3NM6B 1Z36A 4L6IA 1JYSA 1CB0A 4BMXA 3F8WA 1A9PA 1YRYE 3LA8A 1A9RA 1Z39A 3INYA 2Q7OE 2ON6A 4WKBA 4TS3A 1VMKA 2OXFA 5IFKA 1FXUA 1ZOSA 1A9SA 3IOMA 5B7PA 1Z38A 1Q1GA 3OZEA 4R2XA 1JDUA 4YNBA 1V48A 4WKNA 4GLFA 5CXSA 4R31A 4LZWA 4LNHA 1YQQA 1Z5NA 2A0XA 4DA8A 5F7ZA 4M1EA 1YBFA 5EUBA 3FAZA 1A9OA 4PR3A 4QASA 4QATA 1U1GA 5EPUA 5KB3A 4GMHA 1JDTA 1B8NA 3EEIA 3EUEA 2AC7A 1RSZA 5B7GA 5IU6A 3FOWA 1V4NA 4K6OA 3LGSA 1ODLA 4TXNA 1A9QA 1OVGA 1NW4A 1Y1TA 4BMYA 1U1FA 4F1WA 4DARA 2QDKA 1K9SA 1PK9A 3EMVA 2A8YA 4NY1A 1JE1A 3LBAA 1PKEA 3FWPA 5CCDA 5F73A 4D9HA 1SJ9A 3DDOA 2OC4A 1YQUA 1ZL2A 3NM4A 4BN0A 4OGKA 1JDVA 3P0FA 4TTAA 1G2OA 3OOHA 1U1EA 4QFBA 3FNQA 4UC0A 1TCUA 4TS9A 3KHSA 3EUFA 1TGYA 3OPVA 3DPSA 5F77A 4OF4A 1YR3A 2I4TA 2HSWA 1K3FA 4WKCA 4L5CA 4BMZA 5DK6A 4IP0A 3P0EA 4JP5A 2P4SA 3KVYA 3GB9A 4U2KA 1JDZA 3UT6A 4L5YA 4YO8A 1Z35A 3OZDA 3FB1A 4TYMA 4DANA 1Y1RA 1T8YA 1Z34A 4G89A 3MMSA 4F2WA 4M3NA 1JE0A 4DABA 1OUMA 1ODKA 3K8QA 4OJTA 1PR4A 1RR6A 3KVRA 3ONVA 4EB8A 2AI1A 5K1ZA 4YJKA 1U1DA 3BGSA 1PF7E 3OOEA 4D8YA 3NBQA 3OZBA 3PHBE 1VFNA 1K27A 4I2VA 1OU4A 1T0UA 2B94A 1TGVA 1V41E 4ECEA 4RJ2A 1RXYA 1OV6A 1M73E 4G41A 4QEZA 1ULBA 1PW7A 2OC9A 1TD1A 4R2WA 5F78A 3GGSA 4QARA 1A69A 3C74A 4EARA 3OF3A 1TCVA 4F3KA 1Y6QA 4M7WA 3KVVA 3T94A 1JP7A 4JWTA 4TXLA 3U40A 2QPLA 3ENZA 1V3QE 1ODJA 4KN5A 1PR2A 3O6VA 5EFOA 2BSXA 2HRDA 4MCIA 1JDSA 3UAVA 1NC1A 3PNPA 1Y6RA 4X24A 5FAKA 4QAQA 3UAXA 3E9ZA 2I8AA 4G8JA 1ECPA 5CYGA 4P54A 3OCCA 3DF9A 1OTXA 3BSFA 1C3XA 5CCEA 1RYZA 1XE3A 4FFSA 1RXSA 4OEHA 1T8SA 1T8WA 4LKRA 2H8GA 4WKPA 5B7QA 1QE5A 1RT9A 1PR6A 2RJ3A 2AI2A 1N3IA 5F7OA 2A0WA 3FUCA 1ULAA 1RXUA 3UAZA 3DJFA 2IQ5A 3NM5A 3O4VA 1SD1A 1PR5A 1WTAA 3BL6A 1JPVA 3OZCA 3UAWA 4DAEA 1PWYE 1Y1SA 4TXMA 2QTTA 4OGLA
chains in the Genus database with same CATH superfamily
4KPEC 4I08A 3RABA 3BM5A 4MS4A 1IY9A 1G4AE 2F7SA 2Y99A 4AFNA 2YR0A 4BBAA 4JI4B 1J1UA 2PJDA 3TZLA 1WXWA 5JZSA 3KTOA 3WLKX 3UAYA 4MLCA 4YP7A 2MU1A 4P34A 1JLKA 4WZZA 9LDTA 4HAUA 2QR2A 4I4TB 1AV6A 1PG5A 2AN4A 3O4RA 2KS6A 3CF4G 2PY6A 4MQ6A 5EZ6B 3B60A 3GNSA 2TS1A 4O2RA 3ZD8A 1VTKA 4ZK6A 2ES4A 2ID9A 3VO8A 3VR6H 4EFNA 2DLDA 3SEZA 1ND6A 3MXTA 1OXXK 4PICA 2ZU6A 1ZNXA 2DBZA 2HF7A 2NNLD 1ZVJA 4JB8A 4DPMA 1Z82A 3LT5A 3DZJA 3RODA 3W2IA 2W2PA 5JPCA 3LAWA 1GCAA 1FBTA 4O4LF 1JFSA 4KNWA 4W7SA 3VOAA 2K7FA 4OJNA 1U5AA 2Q0QA 3DP9A 4N7MA 3QOFA 2AN5A 3EVBA 4QYSA 4Q7QA 1DFGA 4HGQA 1D2RA 1FQOA 1PAUA 2GESA 2O8CA 4FC7A 1IULA 2OHVA 1TI7A 2K4MA 2XD9A 3EY4A 4HXEB 1UXIA 4O4JF 5DULA 2OBLA 2EFHB 4MVJM 5I48A 1CS0A 2HN9A 5IYZF 2XMGA 3MJCA 1XD2B 3CF0A 2J59A 3DL0A 3GMTA 1E5LA 1LA2A 4Y6RA 4LYAA 1QTQA 1ECCA 4N49A 3UN1A 4M1MA 2IYZA 1NUQA 3IUEA 4QRHA 4Y2HA 4AURA 4ZZ0A 1Y7PA 5MDHA 1Z18A 5TGDA 1O08A 3G2JA 5AW9A 3GJYA 1RNLA 4LRUA 1JDJA 1RBMA 4K7JA 3ZEIA 5AVUA 4KBYA 1L7MA 1H0RA 3O1IC 4F6RB 4UASA 3BGDA 2JD2A 1IZ0A 5DHFA 1M8FA 2WNHA 3KJGA 2HCJB 3CEPB 4ZQGA 4DFDA 1VE3A 1T6ZA 4DCCA 1EQAA 2B35A 4W9MC 1D2HA 2NSHA 4YECA 4HKTA 4D5EA 2G1JA 5K3OA 1JG1A 3IOYA 5FI1B 2XQIA 3DT9A 3MJRA 1RI3A 4X84A 5DV9A 4ZDIA 3EPLA 1CCWA 4JLBA 2Q3JA 1ODIA 3R6LA 3CPJB 1G7RA 2AIRA 2WVGA 3WNDA 2XAAA 4LWPA 5AK5A 2MYPA 3H18A 1D04A 1TJYA 5EXTA 3EIUA 1GYQA 1LPOA 3ILHA 5E9WA 1ZH2A 1OWLA 1JI3A 1T1JA 2O4UX 4Q37A 5EZQA 3T0IA 4C0KA 2EZ9A 1T8RA 4Q3CA 2F9LA 1ORHA 3DH0A 4DTIA 3NIFB 4U7WA 3SN6A 2JEZA 3OPQA 1T1RA 2P2CA 4JNKA 2LPMA 2E5WA 3HU3A 1D4OA 1EKXA 1YR7A 3KQMA 2C2GA 3HCNA 2ZCVA 3L1HA 1Q57A 4L85A 4UVEA 4HMOA 1Y7LA 4DV3B 4XWOA 1LX6A 4MK4A 4UXIA 1IEQA 4CTOA 4HX2A 4KQWA 3ZIDA 2X2FA 3TWOA 5KTNA 3MB5A 2WJ6A 4KE8A 4W1SA 4MVJH 3IKTA 3KD3A 1ZC3A 4Q3DA 2CSXA 2PBRA 1ZYUA 3BMNA 1JL3A 3QPUA 4QFMA 2D7DA 5KVCA 1L7PA 1QPGA 4D9CA 1KK2A 1Z36A 2IY9A 5EUCA 4A1FA 4CLRB 3Q6MA 4ZHQF 2J41A 1VCMA 2O7VA 2O2GA 4IV8A 5EJIA 4PNHA 1WXIA 3IDQA 1P9NA 4GMFA 1KJJA 4PYIA 1JQKA 1SQFA 3HKDB 3L0IB 1G59A 3O2JA 3TB6A 1E89A 2B1RA 3AFHA 2FPOA 1HE5A 5CLIA 1SRQA 5E6UB 3SYTA 5EMKA 1GAWA 1NSTA 5LB4A 1HEYA 4KI7A 2DQYA 1TF5A 2I7VA 3BF7A 4J2HA 3N5CA 4KAAA 1F2UB 1WP4A 1OFUA 1NQ5A 2DY0A 3M33A 4YCDA 3AMVA 5LVAA 2ZZMA 1JLLB 4PAWA 5J47A 1PWEA 3ABRB 4LISA 4FYXA 2ZXFA 3LPCA 1A97A 2IF2A 2BHRA 5IM5A 1KORA 2YMMA 3X1MA 4PC6A 3ZTYA 5KSWB 3QFHA 4IIXA 3NH9A 5LNK1 3CCFA 2G09A 2Z6QA 3L4EA 1E2DA 2BM1A 5JYEA 3S2SA 4Y3UA 3D0OA 1UMCA 2DFVA 1U8TA 1DAGA 3KR1A 1ZMTA 2EIXA 1T5LA 2BHTA 1Y80A 3PNBA 5DM4A 4R2XA 5B6IA 4GRDA 4GYYA 2IXFA 5FX2A 5B37A 2FPPA 5F2NA 4QVIA 3ZLJA 1UR5A 3SQXA 1WP9A 4R51A 4GKBA 2X4IA 2ECPA 3RJ9A 3BQNB 1GUYA 4KQ9A 4NMHA 5C53B 1RJ9A 1YMVA 2F8SA 3I42A 3BXHA 1PGJA 4D25A 4NCNA 1BXGA 1JWAB 1SBZA 5C3UA 2WKSA 4QXMA 1W35A 3ZHYA 5DHSA 2XLBA 2BI8A 3AJAA 3UWMA 1APBA 4HWKA 1K4YA 3PSAA 2Q2QA 3H2HA 5CH5A 3JWPA 4EW1A 2P2NA 1CUWA 2B6HA 1YZFA 4B83A 2FFQA 5EE1A 4UUNA 1OW3B 2DFPA 2E4YA 3VGPA 3X1ZA 4PYJA 4WQMA 5CIQA 3BGOS 2A6PA 3ZK7A 1PUJA 3IUPA 2WIGA 4G1BA 1ZJ4A 2WWWA 3W5DA 2DHDA 2O6LA 3UFXB 2WZCA 3I9FA 4QOEA 4XYLA 2Y05A 2G04A 1RXVA 1PJ2A 2VJOA 4J0HA 1E3DA 1C5KA 3QENA 1X7XA 2NV2B 3CONA 4BMSA 3AY7A 5ADHA 5LMNB 3SYNA 2GK7A 2VZ8A 4WY8A 2YC2C 5IAJA 1B23P 2CLKB 3CNBA 4Q3AA 1SBCA 1FQWA 1Z7EA 2ZB2A 2FE4A 3ND8A 5DT2A 5A7FA 5JASA 2IS6A 1S8AA 5JNUA 3ZHOA 1T1GA 3G02A 3V8PA 4L3VA 1KJYA 2PRZA 1BMFD 4C43A 3AU8A 4Y7DA 2QT9A 1PYGA 3BMCA 4I3GA 3U7IA 4ALKA 3KETA 2QP4A 3OFNA 2NVUB 4NYMR 1HSZA 1ONOA 4N7RA 1YZKA 1P39A 3L7MA 2Y1KA 5C7OO 1N0UA 3IGFA 2V7WA 1P1FA 1V8BA 2QT0A 2WJJA 3CKLA 3BHNA 3H86A 4GP9A 4QULA 2NU8B 4C7BA 2ZJ2A 2IYRA 1U0JA 3E58A 4LE2A 1TO2E 3W04A 3SHFA 5CDHA 2VBGA 2YZKA 4NDNE 3R5JA 4I9GA 5CG1A 4D26A 1BDMA 3T5CA 1U7OA 4NYIR 3RGGA 4DIUA 3UF0A 1U9ZA 3INGA 1H2RS 1M1ZA 1F20A 4K3VA 1HEIA 1ZVQA 3K94A 4Q01A 1QVAA 4WLNA 3I9V6 3SFZA 2K5UA 1CRQA 2WP8J 2XIQA 2HBYA 2XCOA 2YY5A 2PVPA 1ZD8A 3CGGA 3L1VA 4RVDA 1P31A 2JH8A 1I7DA 3M5PA 4BWGA 3LI2A 1P4JA 3VOBA 1KBQA 4KSYA 2PUCA 4D3DA 5FADA 4CODB 4X54A 1P1JA 1YE3A 3OLXA 5ALKA 3UG6A 3ROZA 2Y1LA 4BGVA 1A5ZA 1QV7A 2P5UA 3AM3A 3WNCA 2WJVA 3ST7A 1SVNA 1K7EB 4M22A 4ZOLB 5IX8A 1GP2A 4F5ZA 3NALA 5C3MA 1ZX1A 5EJ8A 3BZUA 3W9BA 2H2AA 2QN2A 3W8EA 4CTKA 5JXWA 1RC8A 3MQ4A 5EZSA 5AJZA 3TLYA 3ZWWA 1F6BA 2ZK7A 3S68A 4N0DA 4NK4A 3SNKA 4AJPA 4DM7A 5JAMA 2Y6UA 1PNVA 1V8FA 2EJVA 3P0FA 3BQMB 1ZVVA 3IPXA 1O94C 2Z09A 3LSTA 4DMFA 2Q49A 1KFBB 2H9AA 3ESRA 3H9GA 4PR0A 4R0VA 1HT1E 4MCAA 1F2TB 2X6TA 3C3JA 4NBVA 4U7FA 3PNQA 2R8PA 3QWBA 1DNPA 3I2HA 2HADA 4DLAA 1FNSA 2W93A 2W48A 2A78A 1TTHA 4K40A 3QA3E 1WBBA 4ARZA 2EYQA 2AX4A 3ZDXB 3C24A 3WMRA 1K6IA 1PV2A 2DECA 4YJDA 3GQVA 1Z6XA 2OP0A 3R7NA 4L5CA 3ZXYA 3O47A 3WGZA 3INTA 3KFXA 5KNDD 2G3YA 3G5TA 2O3RA 2QRNA 4ZYXA 4R8VA 4ZC8A 5CFRA 3JWGA 4GVPA 5T4BA 5IJWA 3OZTA 4N7BA 2J30A 2XPCA 3NHKA 3AF3A 1YJBA 1BE6A 4PX9A 1ZJZA 4LEIA 1OX6A 1SEVA 3KYBA 4L76A 4MRAA 4BDSA 1Z22A 1E9EA 4NFLA 4D9FA 2IXAA 5IG2A 5KCZA 1M1YB 1JUDA 4K86A 3NQ41 2WR8A 4TLAA 3QJYA 3DFZA 2OZVA 3PF8A 3VPAA 5M04A 1XTBA 4A03A 4EGSA 3OQOA 3U37A 1CRPA 4H4CA 2I7TA 4WXEA 4YK7A 1JHPA 2FRDC 1U4NA 3QVTA 4YRJA 1V43A 4Y2VA 3A28A 4KNVA 5FV4A 2QRLA 3L1KA 3ZY5A 1CDEA 2BMWA 3P9QA 2OZLA 2V96A 3D81A 4IFIA 1XFDA 2LDXA 1BKSB 3K8QA 4EJSB 1ZK4A 2MINB 2F1JA 3R7SA 3VVMA 4D02A 1G64A 1J7KA 4E5DA 2A0FA 1V11A 2HJRA 3B6EA 3M70A 3IVCA 4FCVA 1YI0A 4EK9A 1SXPA 1GTJ1 5K6AC 4ZVMA 1KPIA 2P0EA 4JCCA 1MDFA 4U2CA 1JVBA 1QG0A 3FFXA 3WK8A 4EQZA 3CVXA 2RHOA 3FWHA 1EP1B 1LY1A 2TECE 3FJOA 1JJAA 3PFNA 3SQWA 2HQBA 4X65B 4W82A 4A2CA 4CZ2A 3LKBA 2IZ0A 1VFNA 4HEHA 5DXAA 3IOEA 4QU8A 4ZKDA 1TLLA 3K6JA 2O5RA 4PRKA 4I1PA 1E32A 3EHDA 1UPAA 1IMJA 1GNSA 3SC2B 4ZU1X 1E2UA 1OV6A 5KJCA 3LLVA 3FPBA 4IWNA 3B5EA 4OFBA 4LNUA 5C1DA 4YIHA 5HZMA 4QOFA 1XA3A 2ZRCA 2GM5A 5KOJB 5GGXA 4HWGA 2H85A 2A9RA 1T91A 5GVSA 4LXTA 4O02B 2MMGA 2XYRA 3OPYB 4UHKA 1P80A 3LOUA 1R10A 4XWAA 1XALA 2C2BA 5FL7D 4HLDA 3N2KA 1Y48E 4BWYA 2C03A 3R44A 2FUKA 2W8BB 1PGQA 4KXMA 4L3OA 3PD0A 5JAUA 5MN4A 5E1MA 4ZEXA 4YMHA 2DR3A 4BJ6A 3CNNA 4OHVA 4Z9BA 3O2SB 3D7LA 2AMFA 3OQVA 5I4KA 4IFBA 2E55A 3WE7A 2Q7XA 4N0PA 5DNVA 5LP6C 2BUCA 1FJXA 1UAAA 5JJ5A 1C9JA 1ZJ5A 4UREA 5T3YA 3Q0TA 5C1IA 5GZ1A 2ZB4A 5G4KB 4MULA 4MDFA 4MWSA 2RK6A 4IFTA 2QPLA 3K0BA 5F4BA 3RM3A 4Q9NA 2VWQA 1SCJA 2G36A 4O2BF 2ZTVA 1UWKA 4D4IA 4PQFA 2O19A 3NRBA 3KOMA 3JVEA 3QU9A 2P9HA 5JD6A 4EELA 4RY9A 4DJJA 1PX2A 3IV7A 2VC2B 3B7GA 3EFOB 1NMQA 2ZSAA 2X0RA 1ZWLA 4ZV9A 4F4UA 1GGHA 2GK4A 3MTIA 4MV3A 1NOKA 5JQGA 1P60A 3V6MA 3EA0A 3ZNPA 3R3ZA 2C5SA 2R2GA 2NM0A 3CX8A 3VZBA 4O0LA 1EVKA 3UXHA 5EIEA 3DW1X 1N2XA 2VDNB 3PIIA 3NVAA 4HTAA 1S8NA 4LI0A 4NABA 4WNIA 3SJAA 1Q7CA 5HRCA 3OCCA 1JEQA 4YRKA 3FHCB 2WE7A 1NUSA 1SPXA 5K8LA 4DXAA 4I4TF 4YRLA 4X0EA 4E2XA 1R27A 2FOXA 2IXDA 3UQZA 1CJMA 3AEQB 3KXIA 1QNFA 4MJ7A 1CVLA 3V4OA 3ZDQA 4ASUD 2YFQA 1SG9A 3DXYA 4EO9A 1PW5A 4ZTUB 3VNVA 4CHTA 1XMJA 2JFPA 4HDKB 3QXHA 4EYEA 5BNZA 3B89A 1UF9A 3QK7A 2PUBA 1VOTA 4BE4A 1JVNA 2R00A 3HKCA 1HDYA 4XFDA 5HDBB 4EX7A 5ALRA 5K0CA 4IIDA 1DBRA 3O8NA 2NQ8A 4RDXA 2CT8A 1VIVA 1NW5A 2OBMA 3WWZA 1G3IA 4CKCB 3B1YA 4JJEA 4Y2SA 3ZG6A 2PSEA 4Y2YA 2ZI3A 3BRCA 2EC5A 5BP7A 5JYCA 3HJAA 1ULAA 1XEXA 3D0QA 3G0IA 5EI5A 4JCOA 3HWX1 1MQ8B 3MWGA 3TZEA 2IQ5A 4FFRA 3X2FA 2W42A 2JFVA 2RI1A 4NU6A 5FWXB 4P33A 1Q6ZA 3C8MA 1VCHA 4O2LA 3HWWA 4ZDWA 3UK6A 2H4WA 4X1KA 1E1MA 3ZJVA 2QV7A 3FMOB 3PTLA 2R1TA 3QVJA 1JH8A 4DR2B 4R01A 3NOOA 2I34A 3BG5A 3MTGA 2QPTA 3SVLA 4KXWA 5EE5B 5CEFA 2X9QA 4Z2AA 4MWBA 3FTEA 1DKNA 1VG8A 1VYTA 4YS6A 2DF8A 2YHBA 1XDBA 5BOVA 2L82A 2R8OA 4K9PA 1F60A 4E07A 1THMA 3R3UA 4L07A 3DULA 1Z3CA 5T4EA 5EINA 5IYZA 3RYIB 1ZH4A 3LUCA 1ULSA 1KY4A 2CHEA 4G5SA 2OTCA 4F2PA 3PKJA 1CNFA 1ITZA 2PZMA 4INJA 4PIVA 5CH3A 2M1ZA 1N8NA 5IJXA 4F6LA 4CFZA 1FX0A 4LMPA 2WV7A 1W581 4UTZA 4OHPA 2ATCA 4H3VA 5D87A 4FJ2A 1DDIA 3K73O 4OAQA 4LZJA 3SZRA 3P4XA 2I2AA 3ORRA 1E4YA 2GJ8A 4DCSA 1I3CA 1JPUA 3AI1A 3PUKA 5AI8A 2IDJA 4G0MA 1LV7A 3CF6R 3QVLA 2WVAA 1FUKA 4X6LA 2UYCA 5BW5A 1JU4A 5FLKA 3FOZA 3ZD9A 2VH5R 2I3AA 4YJ2B 4AWBA 4OBEA 1QZ3A 4R2IA 4GMGA 5IUKC 3THSA 1Y34E 2GZ2A 2ABWA 4K8OA 5J43A 1GV1A 2JGRA 3JWHA 3NH6A 4BNFA 1TAQA 1AB6A 3VC3A 3B3JA 1N9GB 4JJFA 1PJCA 4MQ4A 3VR2A 1LU9A 2WD9A 1C9KA 5F9FA 4MRPA 1R74A 4XTCS 4JBYA 4PSAA 4BKRA 4LC9A 4F96A 1OXMA 4BV9A 1GZ4A 3FDXA 4CEHB 3TL6A 1XTQA 3C4JA 3BMQA 4JT2A 4EW2A 3AVYA 2XNSA 1SFRA 3MUNA 4OJQA 3LD9A 4URUR 5AW1A 2CBGA 2CLOB 1I24A 1D09A 1KK0A 4P4TA 3K8OE 1JIKA 1KBZA 1MNAA 1K6EA 5AI9A 3WMEA 2AK3A 1QKKA 1WXGA 1G6HA 2OT3B 4TWBA 4EYSA 1W85B 2UYQA 4N48A 1VYVA 1I4OA 1R0WA 1UPCA 4KR9A 2KW5A 1K3UB 2E5LB 1SUAA 3B70A 3EA4A 2QGFA 3GJ7A 3SVTA 4GQBA 4LF8B 1L7XA 4O8ZA 1NX9A 4C0SA 1I01A 4G8CA 4L73A 2W2MA 1EXNA 2HSDA 2QUBA 1I3NA 2NO7A 4FGZA 1SVOA 2P69A 1HE3A 3QG1A 5KTMA 4LF5B 3H16A 1D8TA 4GL4A 1TW2A 4EMTA 2YIDA 3S0JA 1C1HA 3M6MD 3SG0A 4OSOA 3CV3A 5DLQC 3VVLA 2ZM5A 2ZR0A 2D2IA 5TQ2B 1Z3IX 3DTVD 1XWIA 3IT0A 3RS4A 2R4QA 1ONNA 2C1ZA 4I8XA 1SA0B 1WVMA 3ZGOA 1XKTA 3MLBA 7YASA 1ESDA 1LSUA 1IBLB 4WESB 1H2EA 3O9VA 4J9UE 4J4TA 2EFDB 3WHLA 3WBFA 3DP7A 3D8HA 4RGVA 3SZMA 4A73A 1PEDA 4GPEA 5FNZA 2V5AA 1CJUC 4XEHA 4LAFA 3PQCA 1T4CB 4D98A 3S3TA 2XV1A 4ENTA 1XPJA 3W90A 5EUMA 3AQIA 4U9UA 3L79A 1JR3A 5REQA 1MO5A 5LIPA 5AUOB 4LBVA 4NG5A 4K6HA 3TFWA 1VJTA 4JWKA 4A16A 3G59A 1EXVA 3FWZA 4NNJA 3C6YA 1EFDN 1P0QA 2XJ9A 8GPBA 9LDBA 4DR6B 1P19A 1TTPB 2A1UA 3BDIA 1B2LA 1JHZA 2ZAGA 3AGQA 3PXCX 4KC0A 4MYCA 2QMOA 4RLSA 1A9RA 5DBFA 3INYA 4JFRA 5CLFA 2F43A 1X1BA 1V7QA 2HV8A 3IB6A 3LX8A 5CA1A 1CEYA 3LLSA 5MN5A 5CTJA 3K6SB 4M98A 3ZVRA 1KJQA 2IDZA 3GLFB 1IXSB 5IVIA 5EHIA 1XZEA 1JJ7A 4U7DA 5H7XA 2BBTA 3RWMB 4EEXA 2HO5A 3S7ZA 3UANA 2W00A 3R77A 4NE7A 4UZFA 1C8VB 1CFJA 1W34A 3KR9A 4QG3A 3VPSA 4P36A 3G2LA 1BZYA 3QVKA 4M87A 1MEJA 1SHKA 4IXMA 4DC0A 1Z62A 1AMNA 2AKYA 5T3UA 5HJEA 3EYWA 4HPXB 4DCUA 1PZEA 3RRXA 5ALXA 5C5IA 1R8QA 3UMGA 5A1JA 3TI7A 1M75A 1LEHA 1UC5B 3L5KA 2HA4A 2G9NA 2WFLB 1GL3A 3T7JA 3W1EA 4JSTA 2QP9X 4G26A 4E2ZA 1KVQA 4EKYA 3VHLB 1AC5A 2YJNA 3VR5A 3KOYA 3BWEA 1PL6A 2D5AA 3EN0A 2VQFB 1LDMA 4F4CA 2O2ZA 1NR5A 5JOQA 1VZ2A 1UBOS 4IH9A 5G0SA 4S05A 1QPBA 4JITA 3GVIA 4D99A 3VDNB 5HP4A 1SELA 3F4BA 1YBFA 3IUJA 1FTQA 3CIOA 4OBBA 4YAOA 5EWMB 4FHGA 1SVIA 4DMKA 4E70A 4ZOLF 2HNBA 3OTHA 5M7EA 4RIGA 3FLAA 3LYHA 1RYHA 1GHTA 1KQPA 4M76B 4WI1A 4EF4A 2O2SA 5I9SA 4MNTA 1KPGA 1NI5A 2E85A 2XDQA 2PH5A 4RF4A 4DV4B 2P77A 4ZTBA 4Y2QA 2GEFA 1KGDA 3I2YX 5JEEA 1W29A 3T8YA 2JFXA 4WX2B 5TPZD 3ESBA 1M1XB 3LHKA 2Q28A 4PO3X 1UIRA 4GKVA 4ZALA 1ECGA 4HVCA 3OQMA 4J76A 2VATA 2WAYA 3TW8A 4H3HB 2QSZA 4OB6A 1UFKA 1OGYA 1M74A 5HCNA 3ZE7A 2AQHA 4M0MA 3CT4A 3A4TA 4LOAA 2HBZA 3V34A 1PNRA 4QXQA 4W9NC 2CFSA 1GCOA 3OT4A 1IBCA 4IHJB 2AFRA 2GT1A 4CMIA 2ZSFA 4ZZIA 3HEAA 2WE8A 1PT9A 1UXGA 2V5VA 3W3AA 4WUVA 2A94A 4L15A 4BX8A 5HX7A 1YO6A 1L4HA 1U04A 4J1TA 1JAXA 1A9QA 1E64A 3KSMA 3QTBA 1CZNA 2FUEA 4MUYA 5DI3B 3R6WA 4LGYA 2WU1A 3PCXA 1OIXA 1ZNQO 1FNDA 1MOPA 1SC6A 1Q1ZA 1U1FA 2CXRA 3DTVB 4QC2A 4UCFA 3N2YA 3ZE1B 4C1BA 5IBCA 5TMBA 5C52B 2IYUA 2GOYA 5LYJA 4R3NA 3O82A 3T9AA 3N8KA 2EFEB 1O8CA 3N07A 3N28A 1IPEA 1PK9A 1TEHA 2MSNA 5LDGA 2XWPA 2CNDA 4QGSA 4PCVA 3K9HA 2NTEA 1OQAA 2ZVPX 2QM8A 4TQAA 3DEZA 2W70A 4BQPA 4Z1MD 1T3SA 2QAGC 2QY9A 3KYCA 4XJVA 2WB2A 3JRXA 2CUNA 4D3FA 1QFZA 2D5LA 3FNGA 1PYDA 5IBRA 2CJFA 2YRFA 4ZAZA 4D9HA 1PGNA 5FUVA 1JEYB 4K9KA 4FPXA 3IBYA 1YWGO 1F4PA 2DJIA 3DDOA 4NCJA 1GTRA 5TF4A 2QLJA 2VYND 2W6QA 3CLSD 3LT0A 3OM9A 4HRAA 3OA2A 1HI9A 1QV6A 2R1VB 5BN5B 1DJMA 1GEGA 1MVNA 2WEKA 3F7NA 4PPQA 1Y9JA 2BTQA 3LYAA 1OJ7A 3KDAA 2FWMX 4RZ2A 3EQ2A 1ZISA 3SM9A 3CTMA 2Q3FA 3OJLA 4D56A 4GIBA 1JDNA 4RETA 3E1KA 1WB4A 2VJYA 1QVRA 4QFBA 5C8YB 1U8CB 4RSMA 3ECSA 3H2JA 4R69A 4G4SP 3AG6A 4TYPA 5FUMA 1Q2XA 1Z68A 3N3AC 4B7XA 5H9WA 2HUPA 3M3HA 2F59A 3EUFA 2A58A 1C4OA 3JQ8B 3VR3A 4LJAA 3QQPA 1X8JA 2GRAA 3KZMA 5BWOA 2FHSA 3DPSA 1LRKA 1NXWA 5FXMA 4OG2A 3R24A 1PS9A 2JL1A 3KWJA 4QE3A 3PFBA 1MC5A 3MA0A 5KBYA 3WGLA 2RC5A 1UJ2A 1H4QA 1KF0A 1LK0A 1Y8QA 2G5PA 4IJ6A 2FWJA 4RKQA 3THWA 3C48A 2HK8A 4DQKA 3WAGA 5CYPA 3GLGB 1LDBA 4JXZA 1E3JA 3KAQA 4BLSA 1DG1G 4X7BA 3ZUPA 4WINA 5K0ZA 3LV8A 1VSQA 3DFIA 2O4CA 3GB9A 4TV9B 4W5HA 1JT2A 1Z6AA 3R9IA 1P0MA 5EJEA 4J0IA 4DF3A 1AK1A 3PEEA 1Y9AA 3DCJA 3I01M 3RUFA 2C7RA 4J1QA 3T95A 4MSUA 1UQTA 5LZ2A 1GYRA 5IKOA 4DE5A 4UPDA 5ADUS 2Q1TA 1VE6A 3OZGA 1KAMA 2Q1YA 1IBRA 4KBGA 4UZEA 3KUXA 4DMCA 2JGDA 3QLJA 5EJ4A 5FUQA 3UPTA 3EK2A 2HCRA 3AOEA 4OJMX 4WNYA 3P27A 1YZQA 4DABA 1QE0A 2YN2A 1GWNA 4ENUA 3GD5A 4UHEA 1L4MA 3WX0A 4IJMA 1K0FA 3HB1A 3HK2A 1SVUA 4Z9AA 1Y8ZA 2GCOB 2NZJA 3DOCA 1MEOA 3I92A 4RNCA 4BJ5A 1EA5A 1XQYA 3OJCA 4TM8A 2QIPA 4PZPA 2BGNA 2EBWA 5IKXA 2YOFA 4B9EA 1E7RA 3EXG1 4FYVA 1JDPA 3GA5A 4ZIRA 3ENVA 3R3WA 3G9XA 3OOEA 1R8YA 2JJ8A 1NU6A 4QGHA 3SR4A 3V7WA 5LZ5A 3D8RA 5BSVA 1WMAA 4YDSA 1N34B 4I2VA 5DCYA 1YZGA 4LY6A 4Z7JA 1D5WA 2AGVA 3OFKA 4F3YA 1U6JA 2P9ZA 1N5MA 4CM4B 4LRTB 1RJWA 2AOUA 1KZ9A 5BUZA 1DX9A 3IHKA 3QLEA 4RHXA 3OF5A 3EZ2A 1YC2A 3KQPA 4YJFA 4ZO9A 5C81A 3AKZA 4L08A 3KZCA 4Z0NA 4JI5B 1OLSA 2PKXA 7ABPA 5EIOA 1LBQA 4Z8XA 3RS7A 1NTOA 4Z54A 3CBQA 1LLDA 3HDVA 1WCV1 2O57A 4TZTA 5EESA 5G4LA 3FY4A 3U61B 3HG7A 5HW0A 2QRGA 2PUAA 1YASA 2V58A 2EZTA 4ZAWA 1S0UA 2JDID 4CF7A 1RM5A 1DRUA 1E3WB 2QUIA 5L4NA 3VPCA 2I7XA 2RGWA 4BMDA 4JT4A 5KHAA 1A69A 4KIUA 4M0LA 4NJEB 1BCSB 5LZ9A 3KAKA 1L3BA 4IR7A 3AILA 4ILKA 2OL4A 4E4TA 3BJIC 3PEYA 3TVTA 2AXNA 3RQSA 2VHJA 3L8YA 3PL1A 4E22A 1O2DA 5JDCA 3GAMA 2CJPA 1QX4A 1X39A 5A7HA 4P5DA 3A1EA 3A2NA 1V3QE 1TF7A 4MITA 3RHFA 1DO0A 3C1TA 1A5SB 4TQUS 1OIWA 4P3XA 1EG7A 1ZHHA 4WZBA 4KPYA 4UHJA 3EMDA 1MB0A 3NBAA 1Y82A 5E1BA 1RYFA 1IOLA 2J45A 2P7IA 3E05A 3CUSA 5K8TA 3TKLA 1RWWA 4A3SA 1EWKA 2HFKA 3ETCA 2VJCA 3K2EA 3MT7A 5HA5A 2WDZA 2XQFA 2VAVA 2IYFA 3OU2A 4G8JA 1HYQA 2GEDA 1BA3A 1RRKA 4XXHA 1ABBA 4B17A 4JJZA 4JXXA 1GNTA 3DZGA 1BCRA 4UVGA 3RTBA 1JKJA 5AKYA 2H1RA 1UAGA 4YY3B 1ORRA 1XE3A 5GY7A 3TXAA 4EG5A 2NMVA 4RD4A 1RXSA 4D97A 4BEVA 1YDWA 1DWOA 3DKRA 1QH8A 5B3JC 2OG1A 2FMKA 2DPLA 3K70B 3SJ7A 3IP1A 1FDTA 4B3HA 4ZI7B 1U7DA 2X5JO 2JIPA 1ONSA 4RPLA 4LFBB 2OCKA 3G5MA 2RAFA 4G0YA 4O29A 1MQAA 3K30A 4PNEA 1R9JA 1W6UA 1WXEA 5B7QA 1KA9H 4O5OA 2AMVA 4FSDA 3CPSA 13PKA 3C2QA 1L5YA 4FGWA 3OKAA 2BFFB 3WGOA 2V65A 1YC5A 1RQ7A 2ZREA 4DV1B 4NESA 4QDOA 1EVIA 1IVYA 2ATVA 1L5ZA 2ZR9A 4B6SA 2A0WA 4XUEA 1G1MA 5DYYA 1AS0A 3GLHB 3UAZA 4YB8A 3NNSA 5EIBD 4PLVA 1RTKA 2D7JA 3CINA 3F5DA 3L07A 3NG1A 3NIDB 5ERYA 4AYWA 3FMFA 5EG5A 4AO8A 4BAGA 3W6UA 2ZE5A 1SXHA 3LK6A 2K2WA 1WQ3A 2YXLA 4IDCA 3SHVA 1KR5A 3V32A 2VPPA 2WJWA 1A8IA 2PG3A 3TD6A 4TN1A 4D74A 1THTA 2RCNA 1D7AA 2XMSA 5AXDA 2QRUA 2Z3WA 4QWMA 2OHFA 4NU5A 4YMGA 1B26A 2D8MA 2Q3BA 1O97C 2JLAA 2PT6A 4I1SA 4P80A 4QU5A 5KYVA 3ZYCA 5EKXA 3NTQA 4BGIA 3WB9A 2H08A 1QOQB 3GJTA 2W6IA 1PR0A 1NBMA 2JF0A 4AJEA 1SVWA 1J23A 1USGA 3NV7A 3OCXA 2DCUA 4L2IA 3IQFA 2GCEA 1RYNA 4QTZA 3OE4A 4DA0A 3T5AA 4BUZA 3KJEA 4QREA 4TL9A 4PQRA 5DO9A 3TSYA 3LC0A 1N92A 4H1TA 5MFZA 4FMDB 4NZNA 1XLTA 3B2QA 1GADO 3IBFA 2PMKA 4AY2A 2BFBA 4ETNA 1AGNA 3TNFA 4N3AA 2HQ1A 4KQKA 3S6JA 4H18A 2OGUA 4D43A 3ZY3A 4YGYA 4BU0A 1GGNA 1WSBA 1UC8A 2VHVA 3GJ3A 1ZIPA 4OLHA 2O8EB 2BDUA 4PANA 4RD1A 1BE0A 3P97A 1RLJA 2X6RA 4CM8A 4MVJI 4DV2B 3N75A 1R6BX 2WWXA 2XBLA 2VZ9A 3NEYA 4R8SA 2OCAA 2YW2A 3LIIA 2EXXA 4ALLA 2ANCA 1YJAA 2P5YA 3W6ZA 1W2GA 2ZB8A 3E5HA 1G42A 3PF9A 1KFKB 5CHEA 2C8LA 3O4JA 1QAQA 2NW6A 2A4MA 2FNAA 1FMCA 4GR4A 1LI5A 2OBNA 5BXYA 2HTFA 1EX6A 1YGPA 2P1DA 2ISCA 3JSXA 4YJHA 4BMCA 4CUJA 3A04A 3L3BA 3EOAI 4IGIA 4J3JA 4UDYX 2C88A 2ONJA 3DZHA 4PBRA 3WZ2A 4M9SA 3UKOA 1GCIA 3AF2A 2XTJA 4IIUA 3V4FA 3IESA 2H92A 2WYOA 4B87A 4REMA 2CW5A 4OHMA 2O2HA 3FSRA 1DJLA 4X8MA 2VUIB 3Q8KA 2FSVC 1TMYA 2LUOA 2CXHA 2NQTA 3ZS8A 4IIGA 3FR7A 1GLGA 3OOWA 1XEFA 1I4EB 1JFLA 2P2YA 3R4CA 1NQUA 5ISMA 4UARA 4CNBA 2O50A 4HLCA 4NHOA 4NV0A 4ROSA 2L0XA 4D3YA 1OTHA 3PIDA 5G1NA 2Y1GA 3TSAA 1QHYA 2GAOA 3W34A 1A9XB 1G60A 1RKBA 3DZIA 3GDOA 4CBVA 2X3UA 1YRAA 3PDJA 3OT1A 3A6FA 2NZVG 4KDRA 3TX2A 1KJWA 2QA5A 3QPCA 5EXPA 4MV1A 1Q3KA 3GFRA 5DM2A 3D6MA 1EK2A 1HV8A 1ATZA 3IUSA 5IJ9B 4V3CA 3E2IA 3PWZA 5JMOA 2BV3A 3KQQA 1U3FA 1E3SA 1YDHA 1JN0A 2YFYA 1K4MA 5IF3A 1SU4A 4IIEA 1NG1A 1SM4A 5AW8A 5I01A 3VVBA 4DA9A 2BRUC 5KNBH 1B3RA 2AS0A 2BFCB 3CX7A 3T5PA 1QC5A 4W1RA 1VPVA 2PSJA 1SCUA 4ZREA 3BFJA 5KC9A 5JO9A 3W8FA 3GZ4A 5K01A 2GD1O 1KC3A 3EZFA 1IN4A 3BJZA 2VRCD 3N2IA 2ZSKA 1RZRD 2AB0A 1NMYA 1F9AA 3OMXA 2O0MA 3HCBA 5E3HA 2XYVA 1KOJA 4JNCA 2NVUA 2BPOA 2CWWA 3EC7A 1QDEA 1SXJE 2JHFA 2GI4A 2CLMB 2F6RA 4WNAA 4BQIA 4WXPA 4YO7A 5BUQA 3DDCA 2IYPA 5SY9A 1HEUA 5IANA 3S8EA 1G2IA 5HKKA 2RHHA 3EX7C 1OX5A 3IDFA 1Y4DE 1QNLA 3FSGD 3ONNA 2B4YA 2HD4A 2FP4A 2W2QA 4YFVA 3YASA 5LDHA 4RKEA 1Y7IA 4AI6A 1NVFA 1ZIXA 2EYUA 1DKMA 2IEAA 2B4AA 2NZ2A 3H2IA 3N0TA 4TRMA 1L5KA 4L5JA 2FWPA 1Y63A 1FLAA 2I4NA 1D2MA 1SOWA 2GF2A 2PL3A 2QSYA 3AZPA 4NENB 1TRHA 5T4HA 4UFOA 3I2KA 3ZOZA 1LFDB 4X7MA 5DASA 4EG7A 1GUBA 2ZAYA 5CTAA 1T5IA 2YY6A 3EXEB 3RSSA 3PL5A 2IW3A 3HRKA 1A4XA 2JPDA 4PG7A 4YALA 1ZJ6A 5FA8A 2FLVA 1KJZA 5JSZA 1KSFX 3ZLUA 5EXSA 1M66A 4FC6A 2GN4A 1NDQA 1YB6A 4IHJF 1B8PA 1R8XA 5CCBA 2WMYA 1XCOA 2HH9A 4V0RA 1BXKA 4LVNA 4AUEA 1RAIA 4MMXB 4HGYA 2D62A 4LUCA 3WWYA 2O2IA 4YMUA 4RE6A 5GONB 4WLUA 1SXJD 1R16A 2IHYA 2FQQA 3PLNA 4L78A 2ECOA 1NFFA 2A9FA 2WPDA 3U26A 2B98A 1N5LA 3EZ7A 4QXRA 1DQZA 4XVHA 3WRXA 3ZGLA 4MQFA 3FIUA 3EG9A 2P2LA 1FUUA 2UZ3A 4BXOA 5K8IA 3DMNA 1BX1A 2RGYA 4RHUA 4H1UA 3VR6D 2VDKB 4D4LA 3FCXA 5EFZA 4BECA 3UW3A 2H4YA 2RBGA 4MDEA 2FRXA 1ODFA 1WLYA 3A0UA 1Z5NA 3P9RA 3HP7A 2FG7C 4NJMA 4R0MA 1IPFA 1AURA 1GLVA 1CVRA 1QJCA 1C7IA 4YV7A 4KDCA 5KWEA 2X2EA 1EWYA 2HV9A 3DPUA 2QBYB 2Y66A 4KYUA 4ICIA 2PEYA 3GJZA 4GOLD 1M2NA 3B1WA 4KQFA 4NZ9A 3AUJB 3OSUA 3VU0A 4DTCA 4PR3A 1USUA 1PQYA 4D57A 3PC7A 1T4MA 4L6AA 1G291 2AJDA 2BE9A 2KWIA 3GFGA 3W6OA 3Q6IA 3ZV5A 3I62A 1N6IA 2A2ZA 4HL6A 2XQVA 3EVAA 2W6CX 3GT3A 2HJ9A 2WU0A 5AR1A 3R5TA 1A7UA 3SHQA 2EFCB 2NTNA 3L0PA 1Z0SA 5SYAA 1JAHA 3KHUA 2F1OA 4QL3A 5T5QA 4ER7A 5ENDA 3PC6A 4EA9A 4KP7A 1NR7A 2CD7A 1YHZA 2ACVA 2GJSA 2XR1A 3ISTA 3OZIA 4L27A 3FVRA 3RVRA 3WRWA 4D44A 1GXSB 1YB2A 2OYRA 5D8DA 5M2QA 2J4FA 4BKQA 1QIDA 4IOMA 4F06A 4ND5A 3VYSB 3IAEA 2ZQ5A 3IJ5A 4F6CA 1NY5A 3HADA 1AUPA 2VF2A 4FKZA 4EWLA 3AY3A 2R68A 4GXQA 1T3GA 4KMRA 1BEEA 2Q5HA 3STHA 2HMVA 2EFJA 2D6FA 1HQDA 1HFJA 4LC1A 3SDSA 4BMYA 4US2R 3UO8B 2ZIVB 3EVTA 2VDLB 5EMNA 1UMKA 3KT0A 3NBYC 1FP4B 1K2WA 2PS0A 4PZ0A 3L7JA 3OOSA 1T9ZA 5BSFA 3ANLA 1SKAA 4IIYA 2FH5B 1LQUA 3S5UA 5DP2A 5JO0A 2OE2A 5HMMA 4QPNA 2XUPA 1EAYA 2LP4Y 2G83A 2BISA 4K9RA 1BMFA 4F4FA 2X23A 3KHKA 4TV9F 1V9LA 5BR4A 1X6VA 1YDGA 4G0ZA 4LQDA 2Q4RA 2REQB 2BVNA 4Q9KA 2ZYIA 3CXUA 3S99A 4O3MA 3GZTB 2RGGA 4C5BA 2VSNA 3NT4A 4KGZA 1N1EA 3LLCA 2H4XA 4RFSB 4DUYB 4KO2S 4OGWA 2D2FA 2X8LA 2A0KA 5LZ8A 4DCGA 3FDFA 1XT6A 4QKQA 3U4MA 3KELA 1KJNA 2GD6A 4WA8A 5CH8A 4G56A 2CNKA 1KSHA 3V48A 2DH5A 3U7HB 3LXMA 1VMDA 2YYZA 4MVJD 1DBVO 2C83A 3H17A 3WNQA 4TYQA 3MVEA 3OTGA 3ZV7A 1KU0A 3WXMA 4MKFA 1NLZA 4J0QA 3LF2A 1SIWA 4B6GA 2CXOA 5D51S 3J81A 4YTEA 1SQ0A 3D54D 4R9RA 4R9SA 1GJRA 1DRWA 1N2OA 3MWFA 4MS1A 4F04A 1ZUD1 3MG9A 1NVGA 1LTKA 4MUIA 3V1TC 1EGAA 1C81A 1IC6A 3T7AA 4EPXA 3NUZA 4PS1A 2R87A 1PBTA 3VZSA 4K6KA 3OFJA 4C4SA 4XDZA 3TOXA 1QSGA 3L49A 1IHOA 3IRVA 4JLSA 4KWIA 4QTXA 3CF4A 2C59A 3OPVA 2YVLA 4BJ3A 2B1IA 2K6GA 2DR0A 3G8YA 3GUZA 1AXGA 1WZ2A 2BIFA 3NUGA 4F4HA 2XD4A 3GROA 3CLTD 3H2BA 4KVAA 3CPHA 4L0DA 2HHJA 6YASA 5D3MB 3J7AC 5C5CA 1G5TA 3OUTA 4XI9A 1SXJB 1YHYA 5DRYA 4E51A 4CQMA 2E18A 1JEEA 2D00A 2JEOA 3TRIA 1XF1A 1Z2DA 2YXPX 5F3RA 1N4AA 1JECA 1R6XA 4JT9A 3SE7A 2FPWA 2H29A 3TCXB 1TYCA 2QG4A 4JJ7A 3OHMA 3ZHRA 1L0BA 4FDAA 5CVJA 1P91A 3HVRA 1OROA 4L1KA 1QTIA 1X1RA 3B6MA 2R7MA 1UWVA 2KQUA 2XB4A 2GPNA 4CU5A 3AFNA 3S44A 1V8ZA 2V7TA 2Z2JA 4IUCS 4RSHA 5K3EA 2EQ5A 4A27A 1QIJA 3ZIUA 4AO7A 4JC5A 3H5RA 4RA9B 4BZWA 5KREA 1C1DA 1Q3HA 2MSCB 1OAOC 4BRUA 4BV2A 2WIDA 1D4AA 2HSJA 1W8DA 3HJBA 5FUXA 2HA6A 3H4VA 4ZVNA 3RK4A 2WNSA 1GQOA 2Z08A 2C0QA 2JH9A 3IP6A 4L8WB 4KO1S 3O83A 4M1OA 3GI1A 3AEQA 2G08A 1QO7A 1TM4E 3QI2A 1SZCA 4TTVA 3ZU6A 4ARAA 4EH1A 3QFFA 1ZGZA 3B5JA 4HFMA 3WLLA 3DOOA 2ET6A 3GF4A 3RUIA 2ZJ8A 1WRBA 3C6XA 4C7VA 3MMXA 5EHGA 4R2LA 1ISJA 2WM8A 2IUSA 4WK2B 1QHFA 1V3VA 3NKLA 2X0EA 4B74A 5IH7A 4ND4A 4ALIA 3GRFA 1NQXA 1GR0A 4TYNA 4YJKA 5ARBA 3H1AA 5BOSA 4TKZA 2R6CA 4EITA 3DE6X 1RTTA 1ZI8A 1H42A 2DE0X 4UATA 3GQBA 1X7ZB 1MAAA 5JCOC 5K5EA 5KYTA 1M0EA 2H2IA 2H1SA 2QRHA 3FF4A 3U7EB 2Q3HA 3QOYA 1RP1A 4ND6A 1DEKA 4KN6A 4W7IA 1KI4A 3RVLA 4A1OA 1KKMA 1V9CA 4J2TA 5ECDA 3JQBC 3RC1A 2FQXA 1DAEA 2PQMA 1TVKA 1JZSA 4RV4A 4JI1B 5CB0A 4C07A 1W44A 1NBEA 1QIEA 5SZKB 3ESYA 1CERA 3CKKA 1G20E 2ZJ0A 3QM1A 1FK8A 2XXAA 5JAOA 4C7MA 2EP5A 3JWEA 3W5IA 4NBRA 1V95A 5JD5A 2PNFA 5K0TA 5D3QA 3ZZ1A 4RK7A 3LWBA 1LTQA 1P6QA 5IP5A 1S9DA 4ZI7F 5LBTA 1AU9A 4MQEB 2CZCA 5FO1A 4CTMA 3DD1A 2X1MA 2PT9A 3IEVA 1Y1LA 5AJWA 3UUEA 3QWAA 4EHNA 2ZS7A 2E48A 4FX5A 4LXHA 3GGOA 3BD7A 1W47A 3L4BA 4P3NA 4FB4A 2ZT6A 4LJLA 4Q16A 3ENQA 5EKUA 4TKVA 3E03A 1KYXA 1LLQA 4OTZA 1A2KC 3INRA 1E2NA 3EFHA 1DC7A 3SHWA 1RU3A 4H08A 3WDKA 3OF3A 1PFQA 4I1VA 1H2HA 3MEQA 4IS3A 1L4BA 2CNBA 2FSIA 2W6JA 1PDOA 2ODWA 2EV9A 3AJ9A 3G2OA 3P52A 3QX7A 3TXYA 4N7JA 1R6VA 1H4SA 1UJ5A 3LXXA 4TVKA 4Q0MA 4XSVA 6REQA 2IWRA 2VG8A 4AS2A 3DQPA 5KYUB 1J2UA 1S8FA 5AW5A 1WD5A 2FV8A 2KMLA 3BMOA 5HKOA 3D8UA 3NDPA 1RPZA 3RADC 2BD0A 2GJ9A 3U4IA 4F38A 3FPKA 3DMTC 2F1HA 3UKJA 3LE8A 4JL8A 4BZPA 1R0SA 3SP1A 5LMZA 4FIDA 4UTOA 3WP1B 3SQMA 3UAXA 4H15A 3OMWA 3QBJA 2HL6A 4J7XA 3TNLA 2DR2A 3UQYS 4Q7LA 5TT0A 4FGKA 4WVFA 1RLTA 2J3JA 3ORQA 4FYIA 4RK5A 3BSSA 3I8XA 5HQ3A 2PX6A 3OTWA 3WV5A 3WISA 4FMDF 2C3UA 4J8PA 3CRMA 2ODQA 4XQ0A 2V0NA 5I45A 2QZ9A 2J3IA 4GGOA 3BXXA 3JD3A 1PJQA 5DTEA 2RGEA 3WQQA 1LSJA 5CFQA 1RAAA 4EJ2A 3L7IA 1DOAA 1EHIA 1T8SA 3STWA 3RASA 2YJ4A 3H2GA 4EUHA 4LKRA 3JAWB 2ZJ3A 3U3XA 1KL7A 1RWOA 2WYWA 3BFPA 4UCWA 3KX2A 5FJIA 3U09A 2IYNA 2IZ5A 4RA6B 4QQNA 2B78A 4WKPA 2AW5A 1XZPA 1DWQA 1O87A 1DBWA 1P4GA 1RT9A 1XAIA 1IWPB 4IIJB 1Z4MA 4IH4A 1SCNE 2HWWA 3L1IA 4KV9A 4IDPA 4B2IA 4WK4B 2AI2A 5BYKA 3HDYA 4XCVA 4ZICA 1X7YB 2CK3A 1VI5A 2UZAA 3AB7A 3S2IA 1NLUA 1PZGA 2I3ZA 4B4VA 5BWMA 3RF6A 3QX8A 3RU9A 1QYVA 4QGBA 4XGKA 2HR1A 3V8VA 1Z4QA 2DPHA 1D9ZA 3FPLA 3NJ4A 3L93A 4GC5A 4UBMA 5AJVB 4ARBA 3U3KA 3GT0A 5A04A 3IALA 4KI0A 1QUEA 2DKNA 2SNIE 2RHMA 3QKTA 4JX9A 3AHHA 4UDOA 3PC8C 1TJNA 3GLRA 2UYGA 3RV3A 4Q24A 2X9VA 5SYNA 5AM4A 1DIAA 2DM6A 3TD2A 3BBLA 3M4YA 1UP7A 5I8PA 1WPRA 4CN9A 1JLRA 2JAPA 3D43A 1K9VF 4MUFA 1CVIA 4QVKA 3IDZA 4Z4GA 4I0WB 2P9CA 2C4VA 1N2CE 1HDIA 4NDZA 1NBWB 1M33A 2COUA 2DWPA 3E5RA 3H9QA 3HKBA 3JVDA 3NS7A 4YREA 4YCNA 2XWQA 4YAFA 1Z4OA 2J48A 3AYZB 1EVZA 2YY7A 3FTDA 3FOCA 3OHPA 5KPDA 1KAQA 1CWUA 5K3BA 1QIGA 4A0SA 3KLMX 5B53A 1U8YA 3GFSA 3SQDA 4CF4A 3JVIA 2OFPA 1P77A 3C3PA 4M38A 5EXDA 4FWTA 2NP6A 1MIOB 3Q5EA 2HHHB 3FRHA 1UUFA 3DE3X 3LWDA 5DK4A 2PRIA 1T1IA 4HQFA 3A8TA 1P1BA 2H1LA 1YOBA 2GPYA 5CVUA 3TW4A 4IMJB 3U3MA 5T4FA 2VPYA 2VP9A 2BGRA 1YZVA 3D7SA 1LW6E 3JQGB 3CR7A 5TNXA 4JBWA 1QIHA 3RREA 5BV8A 2BEVB 4U2EA 2RE8A 2W2NA 3EPHA 4CIWA 3U4HA 2IE0A 5ES4B 5AOAA 1DMSA 1SQ6A 2ZIWB 4L4SA 4BQRA 4HDAA 5IJ0B 4NZOA 2Q4DA 4IJUA 1SCKA 3SJBA 5AOVA 1AQLA 2FE1A 2X8JA 1AKYA 4OM7A 1DJNA 4HSGA 4ZCPA 1DQNA 2WMOB 1P2BA 2IYVA 3Q12A 4IFEA 4MZDA 3THRA 4D79A 1IH8A 3UNXA 1FU8A 3W2EA 3ZBUA 1P9LA 1J4AA 1AQ6A 1NVEA 4DCOA 5DLEA 4AJJA 5LOVB 1K98A 1N6PA 5A9TA 4S1OA 3UTDA 2B6NA 4MUGA 1GTSA 1NW6A 2FN8A 3P45A 4CIDA 7REQA 5HKAA 1RI4A 4P98A 4BFUA 4KLNA 3KKQA 4XASA 1MAUA 1G20B 1XQWA 2VDQB 4N0QA 1ISFA 1EDBA 4ETWA 2Z58A 1TM2A 3L06A 2JD1A 4E33A 3JWJA 1Z33A 5AOCA 4RKFA 1U0SY 2AJTA 3AHDA 2VNIA 3IJRA 4NK5A 3SKYA 2FK7A 3ZE9A 3I12A 4DREA 3LFHA 4X41A 2BP7B 4L4XA 1SOUA 3ITNA 1I80A 1P2DA 2W11A 2X8WA 1CR6A 3AF1A 3CMCO 2H2GA 2W4MA 4FUTA 1OYOA 2WZBA 4YUAA 4AY3A 3EPKA 3KB6A 3V2GA 3PQDA 4LZZA 3RRZA 4PG5A 3V7FA 1KVTA 3VUEA 5IABA 3PJDA 1SQ5A 4JJ6A 4B46A 3FM9A 2VQ6A 3NCHA 3HNOA 1XHFA 5IASA 1EUYA 4XYBA 2FW0A 2AG8A 1ENYA 1CS4C 3ICVA 4MGZR 1IOVA 2XB9A 1RKVA 1TM7E 2R44A 3RIGA 3UYLA 3ISJA 1NF3A 4IS2A 1JIQA 4MARA 3I28A 2ORYA 3B3GA 3VQTA 1BFKA 1ML3A 4KQIA 5SY4A 1AKMA 4PC1A 3T34A 3ZBTA 4GX0A 5JS1A 3JARB 3AEYA 4N40A 3UTCA 4B34A 1QQBA 1Z0DA 3H42B 2OO3A 4K9NA 1QF7A 1CQWA 4DMMA 4N4AA 5BSUA 2G8LA 2ILVA 1W4RA 3KQYA 3NATA 3SLGA 3DC2A 4UNNA 3RNOA 4QSMA 3UWKA 2WA2A 3CT6A 4GM0A 3TK1A 4CEIB 3LPLA 4RMNA 2M9MA 2WUGA 2VJPA 2JBAA 3AR4A 5FOVA 1C3OA 5BV7A 3OX1A 1IN7A 5KIAA 3A26A 2WSIA 3HFJA 2JFZA 2XTMA 3HA3A 4GQIA 5IXJA 3CLKA 2EZ4A 3K9NA 1CUFA 1JQ5A 1K8YB 2ZRKA 3LNTA 5GV7A 1G21E 5HFNA 3TOCA 4NH4A 1Z8NA 5M34A 2EZ8A 2V59A 1NJSA 3NKFA 4EKEA 4HUJA 3E22B 1BVUA 1R6AA 2ZAIA 5IVPA 4I1YA 1LDEA 2ON6A 4DNXA 2IKQA 4IOJA 3EXIB 3RF7A 4GVXA 2J33A 4MW7A 4NBNA 4YH1A 4DDUA 1GU1A 1DKRA 5D3ZA 3T5BA 1R0RE 3CU5A 3MRXA 1JFVA 3B7PA 3IQHX 5FBVB 5FTKA 2Q6OA 5IFKA 1VGVA 2OWEA 1TM1E 1EG2A 2HU7A 3OX2A 1WE2A 4WJKB 2H5IA 3V3TA 5CBKA 1NIJA 3ROMA 1QFJA 2LWIA 2WF8A 3AONB 5ALPA 5HBGA 3HY6A 2WW8A 3P2YA 3TSZA 1SWVA 3NOVA 4K6FA 3G17A 2C1EA 2EW2A 2XWBF 3ERCA 1ID1A 3IMGA 4Q1BA 1O6BA 4Q4HB 4ZGWA 1L6RA 4GH5A 2NAPA 2H9IA 1BXRB 3Q9NA 5ITZB 2PE5A 5HF5A 4M7PA 4DV0B 3EBPA 3O8DA 3ZQ6A 5AW6A 2AVDA 3CY6A 5HKLA 1JQDA 3HCEA 1QMPA 4YMIA 1S9HA 2Q5IA 4DBLC 5I6DA 3THXA 3JVUA 3EDOA 1DXQA 3G2NA 3NFYA 3UATA 1M83A 4K2AA 4BIMA 4DL9A 3K0AB 4B76A 2QX8A 4R1LA 1NLYA 2AG6A 1AHHA 2YZNA 3VNUA 2D4HA 1CYDA 2XMZA 1SUDA 3HLYA 4UMFA 2BN4A 2CUKA 1CDZA 3EQ7A 5I3ZA 1B6TA 1IL0A 2DY1A 4H59A 3LT1A 2NO1A 3JZIA 5FBKA 1UZUA 3LBIA 4J49A 2HUNA 1NBOA 2D06A 3OE5A 4IV0A 4LC0A 4C21A 1N7HA 1DAPA 1YRBA 3ANXA 5JD3A 4Z3OA 3GZNB 2DULA 1M34E 4B8YA 3CW2A 3M34A 4HHEA 3UHPA 3GAZA 4EFDA 4RAOA 4X6UA 3IVRA 4K9QA 4DMGA 2BY4A 5ICSA 2QZSA 4UTXA 1J0CA 1DCKA 3VC1A 4BJ1A 4E94A 4TV9A 1USWA 1FDSA 5LLDA 2ZULA 3W5BA 5ICEA 7GPBA 3PRKE 5FBHA 2I29A 4JBXA 4RULA 1V39A 4LWOA 2YOHA 4HAOA 4LFCB 3P2JA 1RWKA 1G2PA 1T4GA 1UZNA 4V0ME 2F90A 3WYGA 4S1TA 1WNTA 4DR1B 4DC9A 2OGWA 3HQ4O 3SWWA 1TFRA 2AK2A 4EQ6A 5LDDC 2Z6UA 2NXJA 3EBOA 4ZYZA 1T6BY 1OX4A 5A9SA 2EQBA 6PFKA 1DBQA 2ZBFA 1KO8A 1VIDA 1HRDA 1P6XA 1X19A 3L2OB 3OQIA 4TOIA 1XN4A 1XTZA 3P4UA 5DXJA 1L5HB 4AY6A 3NHJA 3T12A 2GCOA 1M1NA 3DBLB 3ND9A 5TPZA 4DWJA 4QJ3A 2BAGA 2IYWA 4TLDA 2DBQA 3F6CA 2IU4A 1U9CA 4Y7CA 2WG1A 1FUYB 3P20A 4NOLA 1EM8B 1OXUA 4GRIA 2VA9A 2GERA 2GHTA 2ZAOA 4HRXA 3T5GA 1N6OA 1NN1A 2FR8A 5A4FS 4A2QA 3R9KA 4J1SA 1G5HA 3O8OB 2BCGY 5GVRA 2GZ3A 1I1QB 1DEOA 3SJUA 4MKGA 4IUYA 4QOIA 2X86A 2FZGA 4JQOA 1DC5A 1OAAA 1O77A 2JKVA 3KG2A 3NC4A 2OEPA 4PAGA 4F5YA 3DVRX 3VI4B 4ARCA 3K2QA 3IEIA 5F73A 1GNQA 2OFFA 4KMMA 4KQ6A 1XJQA 4ZZ3A 2A1TS 5HM8A 1F8FA 4H7FA 1L4GA 2QG6A 2YZ7A 4FONA 4E08A 1ABFA 1L5SA 3I04A 4LIPD 3USZA 3NM4A 1ZM9A 1KSGA 5SY6A 3PPIA 1VYHA 4XM0A 5F1PA 3BC1A 3KBOA 4OGKA 2H8KA 2IW1A 1T6NA 2RIPA 1JB1A 3JQ9C 3FCAA 2WYVA 3M6AA 2AZ4A 2WOJA 2G1PA 2RGRA 1RKUA 3U3JA 4PCLA 4AJ2A 1HOXA 4D6PA 5KMGB 4GSLA 4NFYA 2BMVA 3DE2X 2UUOA 4ATNA 1SVMA 4FFDA 3PJRA 3R3YA 1RE0A 4C0QC 5AHOA 2VYNA 1KZYC 4DW8A 1QYWA 2PRKA 3O3NB 5F77A 4OF4A 1WBDA 2JLZA 2BHNA 3BTOA 1GOTA 3BB1A 3NBZC 4EHKA 4UVHA 1YUMA 2RONA 4KQXA 1OE0A 1M2OB 3BOSA 4BV8A 3REQA 1RHRA 4IVQA 2C42A 1EU1A 3ND6A 3QVSA 5AK4A 3BT7A 3IB3A 1XN1A 2BKUA 2R7LA 3C8DA 2SICE 5H82A 3MSCA 2VPXA 3BIOA 2JHPA 5CEEA 4U5XA 1I5RA 5K0BA 1WOMA 1EK0A 1K92A 1ZIOA 5JTUA 4Z4FA 2BFEB 1Z0JA 1R5JA 2DVMA 4WCFC 1M9NA 3AESA 2WHPB 3H8VA 4YT5A 5A0VA 3H84A 4HYYA 4LHEA 2IBMA 3G79A 1VKHA 2PT7A 2APJA 2YCBA 3MELA 5LP6B 2TMDA 2EVWX 4G89A 1NN0A 4ZYUA 4P3PA 4KHPB 3A3OA 4YQYA 2VDVE 4LDRA 5AM2A 1UPBA 4M1KA 1I33A 1JE0A 1TPZA 1ISHA 2JHGA 2IPXA 4MVJF 2HMYB 4RGYA 4RJLA 3RBXA 4DEXA 1FNNA 2C92A 4HEA1 4BS9A 2IYLD 1BEZA 4ISBA 3SC6A 3CX3A 3ZNNA 4DB2A 1NYQA 1L8QA 3PJGA 1DRVA 4RDHA 4Y1GA 5HIMA 4YX9A 2QQ5A 1N2BA 3KVRA 3JR3A 4FDUA 4V1CI 1KMQA 3CNQS 4G86A 1P1KA 3I9JA 5EIWA 1T9GS 2WJ4A 4UXHA 4EB8A 4LQLA 1R5NA 4QUJA 2IHZA 2L42A 3TM5A 4FFMA 5J58A 4FM9A 1Z13A 2BFFA 1U1DA 1YRHA 5JZ9A 1NOJA 1JG7A 1NXPA 5AXCA 4KE7A 5B5SA 4HDNB 4HX5A 1XOIA 3BXFA 2JIZA 2C7VA 3MCZA 5JALA 3V42A 2EEZA 2IZ1A 2BFDB 1EJBA 1UMDA 1GN9A 3D31A 2BFAA 5GPBA 3HJTA 4XD2A 2J3LA 2CXXA 1Q1BA 5J9FA 3S70A 3IQZA 5ERXA 1KI3A 1SKYE 3VVCA 1I4DD 2O8BA 3ZY4A 4H6VA 1E66A 4F84A 2QLNA 4HI0E 2QV0A 1TQ2A 3MM4A 2EP8A 3COYA 3IO3A 2C7GA 2MR6A 5JRDS 5KNCA 4NNPA 1E9RA 3ELYA 3AUTA 3MT9A 1S2MA 4QDZA 4B4KA 2YIMA 1J21A 3MZ0A 2DHQA 3PUYA 4ZZ1A 5CDGA 3KQHA 3QVGB 4J0CA 3KQWA 3KS9A 4ECAA 3CNEA 4EGJA 3BL8A 1H2FA 2A1IA 1XD8A 2XEDA 1ZGHA 2EDCA 5HHTA 3GEPA 1FFAA 3FSEA 1W0KD 2C5FA 2ONKA 2ZUCA 3SYRA 4BFZA 2ZZNA 2O59A 2YRWA 2V7EA 1J2TA 2QDXA 3I4LA 5G41A 4MRVA 2VO1A 5CU7A 4AG5A 1AGXA 2PGXA 4BUJA 1H1LA 1CLUA 4G5OA 1KYVA 4BFCA 2YHIA 3FPAA 3IVAA 1HLDA 4QUEA 2CVPA 1MFZA 4L5IA 5FJJA 1BH2A 2ZWIA 2Q3LA 1NI4A 1S4MA 1PJRA 1Y5IA 2V03A 4RENA 4HQNA 1Y6ZA 4A0QA 2QTBA 3GBSA 1CF4A 1BX0A 3K5IA 4JP8A 4BLPA 1JP7A 1RPAA 1VECA 4E2FA 4IILA 3R23A 5K3AA 3K0HA 3E3MA 4FT2A 4GMXA 1KQFA 3PQFA 3RRBA 4TT3A 3TLBA 5B3LA 4XPIB 3O6VA 4F86A 1Z16A 4GGPA 3ANNA 3BDAA 4KQ2A 5AKEA 1T9GR 2JANA 1U8EA 1C7ZA 2DUWA 2KPOA 3IAM6 4PSCA 2OV1A 4ZODA 4IICA 4E2YA 3TUIC 2OZPA 5ADVA 3H11B 2J9ZB 5TJ9A 3DD5A 1RAHA 3LCRA 4KVZA 1RFLA 3KZVA 5TIIA 4JOCA 5THQA 3F8SA 3GBPA 1TEXA 3KQSA 1L1QA 3G8BA 3NHLA 4UFPA 1A9ZA 1NXXA 1ZD3A 1DBSA 2WF5A 4XA8A 5CVCA 1WDWB 3WB0A 2Y1EA 4DCTA 4YAGA 4L0QA 5JXJA 1U7WA 3OQ1A 3BXPA 4XQ9A 3E9MA 4CKEB 3K05A 3LQFA 1FPQA 3DGEC 4ITVA 2RKWA 4XDHA 4ZP1A 5ILGA 4BQSA 2PSHA 4FDVA 4BNZA 2H0AA 4KRGA 4UQLA 5I7HA 3TS1A 3I9V1 3WLSA 4GXRA 5ALQA 2JGNA 2J3MA 3DZCA 4DY6A 3K1AA 1ZUNA 1ESMA 2AN9A 4P8RA 1VLJA 3A1VA 2B61A 3H1FA 2R0QC 5IEBA 4JFAA 1U2GA 3CIFA 2ZUDA 1B8VA 2MSEB 3PC2A 3VBCA 2Q1SA 3DUFA 1SHTX 2Y9PB 4PYRA 3CNHA 4G9EA 5K09A 1N57A 2Q6KA 3DKIA 4C6TB 1MVLA 1M6VA 3TUJC 1EB9A 4LYYA 3W9SA 4HGNA 2J6CA 2RJ3A 1FXWA 4Y6OA 1EZ1A 1G3QA 5FPKA 1NGSA 2QRVB 5F7OA 4YRCA 1DRKA 2VRBA 5JVDA 4D9NA 4QOGA 4NEGA 5EQTA 4BWVA 5H81A 4IKPA 5LD2C 2RGDA 4ILEA 4ZV7A 4Q4DA 3VV3A 4COKA 1FFEA 2BBOA 5J5AA 5TV2A 4GDFA 4R2MA 2HF2A 3R6DA 1QZZA 3RD5A 2ZBDA 3H5AA 2SKEA 4P4UA 1JVSA 3R41A 4ZKEA 1YJCA 5K6TA 5FNVA 3OY2A 4BRWA 3FTCA 1AK9A 3MBKA 1VJDA 1AVTA 3D7RA 3FMVA 1KI9A 4YRDA 1DMRA 1ZH6A 2VS1A 3TZCA 3ZHCA 4IEIA 2CYBA 4BB9A 1EVLA 4KXYA 2PH1A 5TGZA 3SI7A 4D42A 1E1RD 1X2BA 4KBFA 2ZM6B 3IKMB 4WHMA 4Y2PA 3QPBA 3LX6A 2F55A 4E1VA 1QGYA 3RC2A 1U2EA 1YT5A 1CK4A 3HY3A 4NOKA 5CX4A 3IJEB 2PZEA 3ETEA 1FDOA 4RPIA 5AIAA 2W2KA 5TF0A 3TLMA 2AF3C 3AY0A 3N86A 5TSDA 1Z6PA 5DRTA 4FNOA 3TQQA 1GAEO 4LQ4A 1PDWA 4GICA 4LMRA 5B4VA 2CL6X 4IM7A 4EJ6A 2X7XA 1PDVA 3HCPA 3O95A 1TUEA 4XQGA 1JLSA 3ORSA 2Q5LA 2HA2A 1DX4A 2Q8NA 3VBEA 1PLJA 2E4WA 2JJ1D 5IT4A 2O3JA 1JA9A 1U2DC 1VIMA 4JJAA 4QTTB 1V4VA 3EXEA 2Y0BA 4YAUA 3RIYA 2GDJA 2IODA 4H31A 4GKAA 2J67A 3WFJA 3WGNA 3ZK9A 3CVWA 2MWMA 1KJ9A 5I47A 4B32A 5I7WA 4I4CA 1JMYA 3HKEB 3QBTA 5BWLA 5CPBA 5FTNA 2OCBA 2QM3A 2CV2A 1E6LA 2NZWA 4PZAA 4QHTA 5DWVA 5KPJA 4OXNA 4YP0A 4UPVA 5DGCA 4GDMA 4P4SB 2GTPA 2IXEA 4QBKA 4TTSA 4C06A 2XNDD 1V25A 4UHFA 3EGWA 1ZUHA 3VR4H 5E95A 4AQDA 4UOZA 3QPVA 5KKCA 1XVUA 2G5GX 3AUAA 5HXAA 1TTTA 1S2OA 2C9OA 2Q6LA 2QU7A 1VL2A 3AETA 3E9NA 2BH9A 4N8EA 3S40A 4D8VA 1F51E 3HI6A 4Y6LA 5CYFA 3U3ZA 1OT5A 1RABA 1FVOA 1VA4A 3OTOB 2FU5C 4I2NA 3JU3A 3RSQA 5FUBA 1EVJA 1U2QA 3NANA 4YV2A 3DLAA 1Q1EA 3CEAA 4MW2A 2UVPB 3KAJA 3OX4A 5CX1A 2GVNA 3O0DA 3ZDYB 5DCLA 3MBIA 4LN1A 4ZOEA 2DP4E 3U48A 4AXXA 3A37A 2Q5QA 5DYNA 4C0WA 3OCJA 4IWXA 2ZE8A 3NRJA 4YT2A 3TEFA 3I5XA 4GLJA 3HO6A 3WK9A 3B48A 3LKVA 1BGWA 2RJOA 3MMNA 4L5AA 5BVHA 5CA0B 3RUCA 5IRCD 1PQPA 5CBPA 2DKFA 2HMSA 4IGKA 2DTEA 1RIFA 2FP3A 1XMOB 1C0PA 5TX7A 5C9ZA 2O2DA 1CV2A 2VF8A 4BMOB 4NU8X 3OZRA 3MB8A 4FR5A 3KT8A 4UCXA 2B1QA 1UFOA 2QUJA 1NC3A 5JCJD 3R0ZA 1J0XO 1UKBA 4WMLA 1PL0A 3JAKA 3JS5A 5KUTA 4N9QA 1KQ3A 4ALMA 5CDYA 3KWLA 1MVOA 1OHHA 1S7GA 1GTL1 5JNSA 5JV5A 4ZFNA 4YCLA 1B7GO 3WR5A 1YFKA 1RIIA 2ZBVA 3C3EA 3OZSA 4N6GA 3C6BA 4HNAA 3RS5A 1W2WB 3FFBA 4QLAA 5AQ1A 3N05A 2JNWA 3V7NA 1WCXA 2QZZA 3R0VA 2P2ZA 3JD2A 1S01A 1U7TA 1BHJA 3VKUA 4PLGA 5AM1A 3JR7A 2PV0A 4FU0A 2NN3C 1JHYA 1AQUA 2FA9A 1LK7A 1I2BA 3HLTA 1GARA 1QCCA 2NGRA 3AW9A 3BWCA 4ID9A 3ZZMA 1EESA 1UBLS 4ZT3A 2XX3A 3IMCA 3WJ1A 1FP4A 1E1YA 3I5UA 1DHTA 4KODA 5L3VA 2WB4A 1QH0A 1I4LD 3A3PA 3QMPA 3UZUA 1QQTA 4NXMB 1G6OA 1E8DA 4GMKA 4XRGA 4AF7A 1XRMA 3RS2A 4KGVA 3QEKA 1IG0A 3HB4X 1QP4A 3NJRA 3D5QA 2G5CA 3IMKA 4AG6A 5EYPB 1WDKA 2GZRA 2IOFK 3CUKA 3L9WA 5DHUA 3F3MA 1VLHA 2CDCA 3NXSA 4R8RA 4DUPA 1VLZA 3HBAA 2JK1A 3V4ZA 2WF7A 1VSTA 3QMMA 3WOVA 2BFNA 3GU3A 2QD2A 1QHGA 4Z8YA 5JMPA 1KK1A 2QL5A 5A3SA 4BAZA 1BN6A 1FP7A 3G5AA 4PN3A 1YCFA 2AEEA 1ZAKA 1GKUB 3H7AA 3MCUA 1QZTA 3N8DA 3Q0IA 3W4IA 2GZDA 4C4YA 3KKLA 4CIBA 4WERA 4OX9B 4IO1A 4OFWA 1ZOSA 3IOMA 3GA0A 3DCYA 3MAJA 1GQFA 1Z38A 2AFHB 2P5TB 1U90A 2ATEA 4DVJA 1W5BA 3P5SA 4UUMA 3ZWBA 4JYZA 3ZDEA 2ZSJA 3KTAA 4FZ3A 4YNBA 1KZHA 1V48A 4B7UA 1N2JA 4NDAA 5IT9A 3RKUA 4I50B 1J5PA 3TDKA 5JCZA 3MINA 2QAGB 3VAZA 1GZ6A 3RVPA 4EW3A 3RQIA 1RPJA 2CGEA 1TYAE 4L28A 3Q11A 1X94A 2GXUA 1FTSA 1RD4A 3OCWA 3H3FA 4GYKA 4IXDA 1Z06A 3UB4A 4TZ0A 2V3VA 3HRHA 2KM1A 2H2DA 2H1CA 4BKOA 1HL3A 4MPPA 2WKRA 4M1EA 1P3DA 2Q5CA 3KKEA 5EUBA 2QJWA 1A9OA 2V97A 4ASUA 2WTMA 2FN9A 5CB4B 1Z5ZA 4IMRA 4LYGA 4LZOA 4LDJA 4BFLA 1UOOA 1Q19A 2IHVA 1CHDA 3QKRB 5HYVA 2ZSUA 2OK8A 3N70A 3TXXA 3WB2A 5B2FA 5F23A 1UPTA 4HDRA 3RYFB 5DSTA 4RTQA 1WKBA 1MW8X 1K97A 1P7PA 2W4IA 2D1YA 4LMBA 4K28A 5FA6A 2BJHA 4RADA 2QG9A 3C3MA 1TIPA 4GE0A 3TIFA 4YDRA 3PUWA 3JYQA 1P4AA 4JI8B 3UJAA 5A6SB 1YVRA 2ZIZA 2VRNA 1GVHA 3A2LA 1AGPA 1XNRB 3EIOA 4R7TA 4FTWA 4ND7A 1MO6A 2WWYA 3MS2A 3CN9A 3CUEF 2YFHA 5K51A 1JTVA 2CVQA 3ANTA 4RC9A 1XPRA 2DGDA 1FTWA 2R6JA 4IX9A 3NR2A 1UEXC 3NU1A 2BUAA 4OGGA 4UAVA 4X6XA 2Z6VA 1E7MA 4HPJB 5HE8A 5DNCA 1JW9B 1U4OA 4X3CA 1Q1AA 2QDKA 2RHTA 3D6VA 2WJHA 2E49A 2P11A 2Z8XA 3R5HA 4D9KA 4FWBA 2FQ1A 4YRAA 5EWJA 4E30A 3WLMA 5KNBD 2WYHA 1WU8A 2QM0A 2D59A 3RJTA 4F3RA 5L7WA 4UFNA 1N36B 2YVUA 3KK0A 3GRVA 3ETNA 3GLKA 4FOTA 1X1SA 5EQFA 1ZOPA 2WSMA 2XUHA 3UKDA 1D0SA 2FETA 5J3JA 5AW0A 1UK7A 2WAOA 3Q2IA 1EK5A 1I13A 2Q07A 1DV1A 2OG2A 3B3QA 2I2FA 3DAHA 3RG2A 4PN7A 2GPBA 3H0EA 1M7BA 3WKEA 3AEZA 1HDZA 1WMDA 1YQUA 3IT2A 1YCHA 1NKSA 4KYIB 3G9ZA 3WHIA 2H7VA 4JLKA 4OUDB 3SSAA 4B3JA 4DMLA 4E5MA 4Z7OB 3ZVMA 2WIAA 4KJXA 2UXDB 3C3XA 3D02A 2QAJA 1CBUA 4Y2GA 4Z9YA 3EC1A 3V4VB 2NUPA 5IJZA 4RNDB 4QUGA 1PFKA 3DV0A 1O97D 1POXA 4BO4A 1A8PA 4QHSA 5DGIA 4FQ8A 5H70A 2JIDA 3U7QA 1TIKA 3UA3A 3NP9A 1SKMA 1CYEA 3I32A 2AG1A 3L8DA 4ZMBA 1G6Q1 1QDLB 5FOUA 4AN1A 2RFLA 3GJSA 4DMRA 1TRKA 4BO6A 3KLOA 4G0XA 1TGYA 3OJXA 2Z8ZA 5B1SA 4AO6A 2I03A 5ALMA 3HO1A 3DVAB 1KRXA 3EY9A 3MUFA 4RJJA 4RK4A 3HUUA 3CH7A 5K6RA 4A15A 1GVNB 1VL1A 2KI5A 4R2KA 3HHEA 3H9CA 3W78A 4C4RA 4TLLB 1D6JA 1E1CB 3W5VA 4RJTA 5KHLB 3JASB 4B45A 4ZT5A 2QP3A 1O89A 2EF1A 3P0EA 1I6KA 2FKNA 2EU8A 4H0FA 2O3UA 1Y4SA 4Q4JB 1Z29A 3L77A 3R09A 1L8AA 4DN6A 2A59A 4KQGA 5JISA 2OAP1 4BFXA 4BE9A 3UBTA 1M8JA 1NVVR 3G2IA 2NWQA 1C50A 2GF0A 4MPTA 4XPZA 4DCVA 2OUIA 4D4GA 3R4VA 1M7GA 2IKSA 1KZ7B 4HAWA 4OL9A 4YO8A 5C0OE 3UJ6A 1GRQA 4CV2A 2KSQA 4U6NA 2P9GA 1CUBA 1UZLA 2I7CA 3VRHA 2UYOA 3A1DA 3DVSX 1U9IA 5AP9A 3IUMA 4MJXA 2NT3A 1O5TA 2P8SA 1U0OC 2V7QD 3JQ6A 3KSRA 2VAMA 2HLDA 4DA4A 1Y5RA 3ZC3A 4D9GA 1UCFA 2GO1A 3JQCA 2VQDA 1VKNA 5A5EA 4JUDX 3C3CA 4BQNA 5FB3A 2RD2A 2J3KA 4A26A 3OF2A 3OCVA 4S2UA 4OI1A 2IS2A 5J1TB 1J0AA 1U3CA 3PQ7A 1OUMA 2WJGA 3Q1KA 1ODKA 4CV3A 1T15A 3JAWA 4W8HA 3BK1A 3QSYA 1LBSA 4LRYA 4MV4A 4Z4CA 1PR4A 1RR6A 1N7JA 3OCYA 4OJTA 2H4HA 2HY7A 4Q05A 1FFHA 3UV3A 2X9NA 2HB6A 2XZLA 1GFWA 1DJPA 1RXIA 4K2HA 2OWDA 2OAQ1 3NASA 3E6AA 2P35A 1YXMA 3GP5A 2EX4A 2W2XA 1CTQA 3PC4A 3PDIB 5AJHA 5L3RA 1HE1C 1ZU4A 1TA4A 1Q22A 4TVBA 1A8HA 1OBFO 2GPJA 3QRWA 1BH6A 1ARZA 4NEQA 5CK4A 2LW7A 1EX7A 1HE8B 4OQYA 2V54A 2DUJA 1U8AA 3MTJA 3OZBA 5CDUA 4Q4AB 1WCIA 5KDDA 4XIYA 4DLVA 5JZVA 5H68A 2W9XA 3CUWA 4Q3LA 3S27A 2BEKA 2Y0EA 5KWIA 1AUOA 1L4YA 3FOFC 1FVHA 4J91A 3TPCA 2H2HA 1XTJA 1VLLA 4BVBA 5A0FA 2EGGA 3DTTA 4OHCA 1J42A 4DR5B 2ZATA 1J25A 1X15A 1QPZA 2N75A 1PJ3A 3GRAA 1XK6A 2PWYA 3EPRA 2VDWA 3L6BA 3QG5A 4MWTA 1KTIA 4BZXA 1GPDG 2I80A 3MJTA 2I2WA 4BWFB 4R68A 3A4YA 3LCJA 2JKYA 1Q0PA 1QK4A 2OPBA 4LDQA 1AGRA 4J0GA 2D8AA 2QXYA 2JJ2D 5DYTA 3O92A 4HZUA 3FLBA 1FBNA 3O74A 4UTPA 2YWDA 3BILA 3H6KA 3ZCPA 5FTLA 4JMLA 4V3BA 3O1JC 3USCS 3A9CA 3ONWA 1U0GA 1T5HX 1Y8AA 1ZGBA 3KYDB 2YXNA 1Y3AA 3FD8A 1K66A 1SR8A 3LZ6A 4JN6B 1DZIA 2R8RA 4CKYA 4EB6B 2C3MA 3CM0A 3F9CA 3DE0X 3O8QB 2ZVJA 2XTAA 3UIEA 4LRQA 4X1IB 1RLMA 3A1SA 3VKWA 2PFKA 1GQSA 2IC5A 3K0CA 2P78A 4CMEA 1HWYA 2ZU0C 3K2BA 3QMVA 3VGJA 4EAQA 5HQ3B 4X64B 1V7ZA 5CK5A 4JMPA 3AP3A 1XMVA 2RAVA 4MCIA 4DNPA 3L7NA 1U2TA 4YCMA 2JGJA 4M6WA 1AXEA 2PUFA 2BEVA 2G25A 1V8PA 3NXKA 2KE5A 4QBTA 4RK1A 1JHOA 3GWZA 3S8YA 3D3WB 4G0UA 4EHDA 3D59A 1F8GA 4X24A 3VYUB 1E9AA 4BP9A 2W2LA 1KMCA 1IHUA 1QWSA 2FAXA 4QU9A 3TRKA 1ECPA 1H85A 4O2AA 1IXKA 1R37A 2NO0A 2UV8A 3CURA 2H7CA 3DHVA 1ADJA 4UW9A 4B73A 1IATA 3LJKA 2QTLA 3WQSB 3IHTA 4BY9E 1BHQ1 3L4JA 2G80A 3PD7A 2MCFA 4IDNA 4JUIA 5C4GB 2H0RA 5EJFA 4ZMSA 5TEVA 5B1IA 1CDOA 3LC2O 4F11A 3FHTA 2NV6A 3KSBC 1OYWA 2CJWB 1K8QA 1UDXA 1GG5A 5J4VA 2H5LA 1GTVA 3FNHA 4FT4A 1XVLA 4G85A 1WY5A 3KQUA 4LK3A 2XNJA 4RF2A 2H8GA 4YCAA 4OXRA 2R6AA 2H17A 4P83A 3VU9A 3VSAA 5JAHA 4MKIA 5K4GA 4BAUA 3SYKA 1PZXA 2WT4A 3DBOB 1JIUA 3HB5X 5AKHA 3CKYA 3NYIA 1SZDA 4GPIB 1KDVA 3U1TA 4G0WA 4MW9A 2HSGA 3PENA 3LMKA 1AKWA 4O59O 1I9GA 5DHPA 3ENKA 3EVDA 2ZIXB 5TVKA 2J08A 4R5HA 4ZT7A 2YJGA 3V00A 2JZOA 2PZ8A 4C4OA 1JV2B 4HH1A 4V38A 4B0OA 3Q7SA 5AK6A 2YUTA 2XE7A 4NPCA 2QROA 4A8JB 1NSYA 3NWEA 1D4FA 1K63A 1M3SA 2C5LA 4GZ3A 5BN4B 3KM0A 3FVTA 2YRXA 1EFVA 2FXVA 4YA6A 2NU9B 3UYKA 4Y2TA 4BX2A 1E61A 1Y8CA 1YQXA 3IRUA 5IK2D 1JI0A 4PRYA 3W2GA 3NFRA 1WABA 2J4CA 5ESXA 4N5DA 2HRCA 4L74A 1BKDR 1NZJA 5HZHA 3G9TA 3W1WA 4CV1A 1GQQA 5AW2A 5J23A 3PVCA 4AJIA 1MMFB 2ZDQA 4RD3A