5ENDA

Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg)(q152a) from vibrio cholerae
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
244
structure length
228
Chain Sequence
b'QFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGAANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase FabG
molecule tags Oxidoreductase
source organism Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
total genus 79
structure length 228
sequence length 244
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5endA00
2C82A 4NK4A 1UXIA 3ITDA 4U6SA 2E48A 2GN4A 4OXYA 1P33A 2O3UA 1WVGA 3AUAA 4GLLA 1BW9B 2YHUA 3PJDA 4ILKA 4BUCA 3B1FA 4RDHA 3JYOA 4MINA 4NBUA 5T8KA 1P74A 4WECA 2DFVA 1J6UA 2WWRA 3Q11A 5G0UA 3FNEA 1Y5MA 4BIIA 2EHDA 3N74A 1EEHA 3S2GA 4PG5A 3NJ8A 4NQZA 2O3RA 4PGFA 1E92A 4MVJM 3HDQA 5JDIC 4UUOA 2Y0EA 5DOVA 1PGJA 1I8TA 4E32A 3K96A 3R1IA 2B0JA 2DBQA 1CYDA 3AW9A 3FTNA 1X0VA 1B8VA 3LZ6A 3JQ8A 4UEJA 4NIMA 4OSOA 1C14A 1HE5A 3CH6A 1K0UA 3EC7A 5F21A 2UVDA 4YJGA 4XD2A 4OH1A 3C3XA 5U9CA 4EEZA 3H5NA 3L4SO 2J5KA 4UVDA 1GUZA 4CV2A 3NDIA 5DDIP 3NKLA 4IIUA 1G0NA 1TXGA 4BO1A 1GFSA 4NMHA 2WD8A 4FJ2A 2GASA 2YV3A 3P2YA 3D3EA 1VKNA 5ITVA 1JVBA 1U1IA 3M1LA 3DBHB 3E5MA 3TRIA 1C1XB 4BNYA 2X5OA 3KV3O 4PLPA 4MIYA 4GGPA 2RIRA 3CUKA 1PJTA 5A06A 4MVJP 5KTKA 1R0LA 4PZEA 3D4OA 4CR7A 2QYSA 2XF8A 4IBOA 4TZKA 4MVJE 4FCCA 1KY5A 4WCDA 5AXDA 2ZB8A 5TC4A 1P1IA 3HWRA 4B3HA 4KWIA 3GUCA 3JYQA 5L4NA 1U3WA 4JBGA 4CLEA 1QLJA 2JL1A 4CODB 3AFNA 4R4JA 3KUXA 4Q3AA 4XRRA 3UH1A 1Y9AA 5FYDA 1I30A 3L6EA 2BMAA 3PHGA 1AXEA 4GI2A 1YH3A 4XQ9A 4DVJA 3ZHXA 4E2WA 2IDZA 2HDHA 5JDIA 4YRAA 1XWFA 2IEDA 1NWHA 3VOSA 2FOIA 5DULA 4A5OA 4ALIA 3AFMA 2BFAA 4JP3A 1M67A 1PJ3A 1YL7A 2IZ1A 3JQGB 5G0WA 3L4BA 2YV1A 4NNJA 3WWZA 2NTVA 1FDUA 1KEWA 4J1NA 2DBRA 3BMNB 3BHJA 3GPIA 4XDYA 2BGKA 2I65A 5COQA 4IJUA 3ZCXA 3D5TA 1QMGA 2CD9A 4UVEA 4D3FA 3CPSA 1PSDA 3ZWBA 1W73A 3DZIA 2GZ1A 2AQHA 2BI8A 3JYLA 4J16A 4CR6A 1ISGA 3GOHA 4BKQA 5KNLA 2GO1A 2PLAA 3I9NA 4CLHA 1T4DA 3CXRA 3RQSA 1WDLA 1Z74A 3AM5A 4FJ0A 4TKLA 5GY7A 1QORA 2EIHA 4Q9NA 2NACA 3GFBA 3K73O 2WMDA 4LVCA 5JSFA 5A9SA 3UGKA 3HQ4O 3FSRA 3CEAA 5JY1A 3JQCA 4R1UA 3B20A 4OKIA 3ZWNA 4BNTA 1EDOA 3U0BA 2C7GA 2C20A 3DAPA 4PZDA 3NDRA 4R1TA 4MVJI 5AYVA 1GV1A 3MJSA 4MPDA 3WMXA 4WLFA 3AU9A 2VYVA 2FN7A 1GCOA 2HUNA 1HLDA 1I3LA 3PHHA 2B36A 3FR7A 1ISMA 4R54A 1D1SA 3H5RA 3LK7A 1X15A 3EHEA 2Q4EA 1VM6A 4CUKA 1X7DA 2VZ8A 5IDYA 1ZKMA 3D4NA 5JPIA 1DIHA 1F0YA 4WLOA 1F06A 3OJ0A 1P1FA 4YJDA 3AUUA 3MOIA 2EW2A 4OMUA 3W8EA 4E5PA 2Q2WA 2WYVA 4IMRA 2VHXA 1MP0A 2DKNA 1NTOA 2YUTA 3O26A 3PJGA 1GL3A 1FDWA 3R0IA 1VRWA 1W6UA 4XEHA 4B4OA 4RPLA 3M6IA 4O63O 1JQBA 1ZK3A 1BSVA 5CPBA 4I9NA 5U1PA 4GX2A 3VKUA 3H9GA 3JD1A 1M66A 1UZMA 1NYTA 4UVIA 4AVYA 2Q1TA 3BMCB 2W98A 2UV8A 4MVJD 3W4JA 1U5AA 3TZ6A 1KEPA 4J1TA 1XCBA 1L7EA 2AHRA 2YYYA 2XXJA 4JBIA 4W99A 4NU6A 1DEHA 1R37A 3UUWA 7ADHA 3KSZO 2Y67A 2NNLD 3TWOA 1Y8RB 2NU9A 2WJPA 1LDBA 1YBAA 4P8RA 3SLGA 3WTCA 3V1YA 4BO8A 5JCJA 3JQ9C 1P1JA 3QHAA 3I9KA 2D5CA 4XR9A 1NXQA 2G0TA 3DFZA 4IIVA 4ND1A 1RPNA 4CLDA 1WAMA 7MDHA 4KTTE 4RL6A 3DR3A 4E2YA 1I24A 3U4DA 2ZTLA 1PJCA 1DC3A 1JWAB 2H1SA 2WD7A 3F5SA 2O4UX 2HLPA 2Q50A 4PRLA 4R41A 4AG3A 3ROPA 1UZNA 2BGLA 3VTFA 2C59A 2HK8A 3JQ6A 2VHWA 3KXDA 3WYEA 2WSBA 5KVVA 2Q49A 1BVRA 3ZV6A 1CDOA 2FY8A 4ONEA 2LDBA 4RLSA 5TS3A 5JXWA 2GPTA 3SXPA 1XU9A 1HE4A 1RYDA 3QVOA 4K28A 4R01A 5C3MA 1Q0LA 4ZQHA 3WYCA 4CQLB 1LA2A 5DN9A 3PXXA 2FZEA 3E9NA 4D46A 4NR0A 1C0PA 1A27A 2AMFA 4CM9A 4OOFA 3AUSA 1CETA 3WGHA 1JA9A 2VOEA 3AK4A 3IC5A 3KO8A 4IDBA 4B79A 2PD6A 1EZ4A 3FNGA 4BKRA 3TFQA 1B2LA 3D3WB 4XQCA 2V6GA 3GNSA 4AJLA 4CQMB 4II2A 4R5MA 4XQGA 1Y1PA 5EQDA 2OOSA 2JHFA 3H8VA 3GZNA 4TROA 2XPCA 5KCZA 3NT2A 1ZJYA 3RJ5A 3RFVA 5JC8A 1PEDA 5A3JA 2VQ3A 2QZZA 4PN3A 1R0SA 4FW8A 4DXHA 1JN0A 3AOGA 1LI4A 5FFFA 4BNXA 2QYTA 3BAZA 5DP2A 2EXXA 1VJTA 3FR8A 2UUOA 3WS7A 1X1EA 2FR8A 4KMSA 1JLLA 1OFGA 3OMLA 4YAKA 2HMVA 3GRKA 1V3VA 4JXKA 3E8XA 1O8CA 4BNHA 1J5PA 2LDXA 1LSOA 2OL4A 3SX2A 4XRGA 4CMIB 3T7EA 4GX1A 4HFMA 5A1TA 3T7CA 5F1PA 3OICA 5U4QA 1E7RA 4NI5A 4H15A 4WK6A 4E2ZA 1A7AA 4KTVE 2X58A 2HMWA 2Q1SA 1JWBB 4DBZA 3GC6A 1JAYA 1DRUA 3QVSA 2J3HA 4EEXA 4GSLA 4XB2A 1C0IA 4RZHA 4YQZA 4E5YA 1QYCA 4IPTA 4ND4A 1UXKA 1XQ6A 3W8DA 1DJQA 4HNHA 2F1KA 1U7TA 4DLLA 1EFLA 5EPOA 1I2CA 1NHWA 1ZSYA 4FS3A 1XIVA 2Q2QA 1UP4A 1Y5RA 1LJ8A 3HN7A 4XB1A 2WDZA 1D7OA 5MDHA 1BVUA 4RF5A 4IGFA 4LRSB 3L07A 1NQAO 4E0BA 4OO3A 2IE0A 1ENPA 4D3DA 2H6EA 1YXMA 5IAAA 4MP8A 2PD3A 3HE3A 1MXFA 3GVIA 2ZYDA 4HKTA 4L75A 4DC1A 4ZD6A 3JQGA 2VT3A 3GG9A 4OJNA 5ICSA 4NG5A 1CWUA 2ZIZA 3RIHA 5HWSA 1FXSA 1LU9A 1WLYA 1IPEA 1DC5A 2VCYA 2O4CA 1KEUA 3O38A 3K30A 3IUPA 3LDHA 4J90A 3IS3A 1Q7GA 5ES3A 2NADA 2X0NA 2IYPA 4I5EA 5TIIA 1I2BA 2FHSA 4YAGA 1ENOA 4YEDA 2AE1A 4UVGA 1E7YA 4LN1A 3A9WA 1E5QA 4DUPA 3VDQA 2AA3A 1HXHA 3N58A 4L4RA 4E4YA 3TSCA 1DRWA 5F1KA 2NVUA 2JCVA 3L9WA 1P0FA 4EBFA 2P9GA 1LC3A 3HN2A 3FNHA 5KJ1A 2BELA 4LSWA 2Z1NA 3LC1O 3U4CA 2JFFA 1PZGA 3HADA 3L6OO 3EVTA 3OECA 2JAHA 3ULKA 1EE9A 4M87A 2Y68A 1QG6A 4J3FA 4J2OA 1I3NA 1X0XA 1YQXA 3OSUA 4R1NA 4MVJG 4FN4A 1QSGA 5HTOA 1WNTA 4DC0A 1XG5A 3LLSA 2IZ0A 4YDRA 3BHMA 5FWNA 5JAIA 3ANMA 2ZTVA 2O7SA 4JBHA 3ROKA 5J23A 3LT1A 1ISIA 1MFZA 4BGIA 1NM5A 3ZV4A 2GSDA 1SOWA 2FP4A 5JCJD 2EG9A 1TT5A 1BDMA 3GH3A 1OI7A 3M2TA 2BHLA 3EZLA 3GHHA 3OJFA 5T6BA 5DOZA 4E5KA 4ALMA 1V3TA 3INRA 4WLEA 3ICPA 2PV7A 4AJKA 1SB8A 3HHPA 5THKA 1TT5B 1V8BA 3GGPA 2YHIB 3MJCA 1PS8A 3UICA 5CDTA 1O95A 1G6KA 3AM4A 4RZIA 3UKOA 3ZWWA 1EVYA 3AU8A 1GYQA 2Y1CA 3RJ9A 2DTXA 4J7XA 4FGWA 4I08A 3GAZA 4EUEA 3U3XA 4FR5A 3ZWMA 5IZCA 4I9HA 3U5TA 1WZIA 2GN8A 3DOOA 3AJRA 1Z6ZA 3GF4A 3M1AA 4P4GA 4CLRB 3ZWYA 4ZICA 1QV6A 3SEFA 3RUHA 4BGEA 5CHEA 5JO9A 5IN4A 3PQDA 1ML3A 3AOEC 2VNAA 4GKVA 4QO8A 1F8FA 4Z0HO 5G0TA 1CQIA 1SC6A 1YL5A 3G1UA 3DZGA 1E5LA 1H6DA 1BHSA 1N2SA 3I3OA 3LVFO 4ESOA 1AXGA 1PR3A 3GVXA 1DRVA 2HMTA 3A1NA 1TA4A 3EYWA 2X86A 3MJEA 1LSUA 3IP3A 4GGOA 4BMSA 2ET6A 2I76A 3HNPA 4XIYA 4EJMA 4QXMA 3ONDA 1H94A 3B1KA 5KJCA 1EVIA 3N7UA 2R2GA 2ZYGA 1UXGA 4GBJA 4IS3A 5G0SA 5JYDA 4G81A 1YDWA 1AHIA 1TEHA 4PFJA 2A9FA 2H63A 4LCJA 3ZU3A 1KETA 5ENDA 1H2BA 3OJLA 5L45A 1MV8A 4LGVA 4YCAA 3WQSB 1YE3A 5BSEA 1OMOA 3VTZA 1GY8A 1NAHA 1Y81A 2BH9A 3G3EA 4R3WA 1UAYA 2O48X 4MDHA 3DOJA 1UDCA 4Z0TA 2F00A 2FPGA 2Q46A 3GNQA 3IMFA 1HE2A 4FQ8A 2BGMA 1P77A 3WGYA 1LDYA 3JQ7B 5TSDA 4CM1A 2FR1A 1ADCA 2DFDA 4UULA 3WTBA 4CMKA 2RHCA 3HG7A 4IGEA 1ULUA 4J49A 4CM3A 3PIDA 3QV1A 4GH5A 4EW6A 3QIVA 1E6WA 3JQFC 1ZEMA 5F5NA 2X5KO 1E3JA 2RCYA 2VWHA 3OFSA 3RUEA 3OQ6A 5L7WA 2EERA 2I99A 5KIAA 3IUSA 2YHIA 2D4AA 5IDXA 1YKFA 3GGOA 4E5NA 3CE6A 2EP5A 3E5RA 1HDZA 1T2CA 1Y8QA 3GFGA 4JJFA 3DZKA 4AICA 3WR5A 4BOYA 1SNYA 4OOEA 4EI2A 4HADA 1LLDA 2QRLA 4QQRA 3NJ4A 1NAIA 3PHIA 2ZK7A 1PIWA 1N7HA 1BXKA 4D79A 5I7SA 5I9MA 5ICMA 3TZHA 1W4ZA 5JYEA 1YB5A 3UOGA 3WNQA 1F17A 1KVQA 3JTMA 4DREA 4NFSA 4CV0A 2EW8A 2VHZA 5JAQA 2AQIA 1I5RA 3E6AA 2C7VA 5TJHA 4IQ8A 4ZHSA 3EK2A 4D0RA 3OIGA 4XX0A 1DC4A 1EDZA 1SBYA 3PYLA 1P9LA 3ORFA 4BGVA 4HFJA 1N5DA 3DL2A 4CM6A 1NNUA 1B16A 1EUZA 2Z5LA 3A28A 1E7QA 2JAPA 2QX7A 4EGFA 3UAGA 5BT9A 3V2HA 3RD5A 1XYGA 3IAHA 3F46A 1N7GA 1E1MA 2NU7A 4GPD1 2B5VA 3W6ZA 3GGGA 1VKOA 2HO5A 4WLUA 1IHXA 4G65A 4B7XA 3HFSA 2VUUA 1QYXA 2V6BA 1CJCA 4X54A 1X7GA 4ALJA 2P9EA 4PLTA 2GZ3A 3DO5A 4QSMA 4DBVO 4MKXA 3UCEA 2HKIA 3PTZA 5HRUA 1PR9A 4U6QA 3RU9A 4I9UA 3JD2A 1VLLA 1IHYA 4C7JA 2A4KA 2IYOA 5DBFA 1WP4A 3WJ7A 1R66A 1NPTO 4URFA 1M2WA 1GPJA 2DTDA 3PYXA 2NU6A 4GMGA 1PZFA 4M86A 1E3WB 3F4BA 4NPCA 4ZRNA 5KOIA 2ZB7A 2Q1UA 2GRAA 2NQTA 2YQ4A 4M49A 3GAFA 1CEQA 4E5MA 1UP7A 1UAGA 2AXQA 3L77A 1R12A 4YJHB 1EBUA 2PZMA 3WIDA 3IL2A 1OC2A 4XYMA 1PL6A 2Y1EA 2X9GA 3JV7A 4W6ZA 3DBRB 1C1XA 5BNFA 5CDGA 3UF0A 3WX0A 4E30A 4IJVA 4PZCA 5DZSA 3C1AA 3A06A 2RAFA 1P31A 1Z73A 4NHEA 4FOOA 3S1LA 1PJ4A 3PPIA 2GN6A 2JFHA 4PRKA 2VN8A 1IUKA 3TOZA 4JJGA 4IINA 4LCEA 3C7DB 4CR8A 4XCVA 4YJHA 3PQEA 3I9JA 1SEVA 3F3SA 8ADHA 3ZWOA 3E9MA 5TNXA 2Y0DA 4Y98A 1HDCA 1LDGA 4JLWA 4RF3A 4A10A 3KEQA 2BLLA 2CDAA 2O3TA 1JKIA 1VL0A 2NLOA 4YJFB 3HB5X 1KS9A 2VRCD 3SVTA 3QW2A 1BTOA 4NJMB 3Q2IA 1HL3A 2R00A 3VHRA 2ZJ0A 4WCFA 1MA0A 1HWYA 2NVUB 3IP1A 1GZ6A 1I0ZA 1TT7A 2YV2A 1DC6A 4D42A 4HV4A 2I66A 1ONOA 4D43A 3JQ7A 4FPXA 3A4VA 5A4DA 3W6UA 1LRJA 2W90A 3ASUA 3DZFA 4D44A 2DTEA 2ZCUA 1O6ZA 1UR5A 1HZZA 4OIMA 3ADPA 3QE3A 3G49A 3GLQA 2CDBA 1HYHA 4YWJA 5C7OO 2ZATA 3ZI0A 4TRJA 4IZIA 2J5RA 4BNGA 1D3AA 2G1UA 4MVJA 1M75A 1ORRA 2D2IA 4TWRA 3F6YA 5BNTA 1KVUA 2P5YA 1R6DA 4OM8A 4D0SA 4PLFA 1N1EA 3C1OA 3I9LA 2HJRA 4IDEA 4ZJUA 3ZU2A 3C7CB 1O89A 2HMSA 6ADHA 1E1NA 1F8GA 1GYRA 2DM6A 4RPHA 2X23A 3PVZA 2EGGA 5DCUA 4Q3NA 4FC6A 5FI5A 1HYGA 1MG5A 4J0FA 3D4PA 1E6EA 3PWZA 1XGKA 1ISHA 3WBFA 4AJOA 2GLXA 1ZFNA 4R3NA 1NBOA 4BV8A 1DIGA 4BB5A 5CG1A 1N9GB 1YQDA 1PQUA 4OQZA 4AJEA 3I9OA 5BSFA 5TF4A 1UP6A 4NFHA 3P5SA 4M55A 1I32A 1YQGA 2DU8A 3K31A 4CMAA 1E3LA 5AQ1A 4E13A 2D1YA 3JQFA 1E0DA 4AJJA 4KZPA 2JD0A 4CMGA 5K9ZA 4PLVA 1NQTA 2DBZA 3IQDB 1GUYA 2Y99A 3GR6A 3PDUA 4LSMA 4XDZA 3UCFA 3OF2A 3ON5A 2B4TO 1A7KA 3HDJA 3WB9A 4A03A 5IF3A 5JDCA 2Y66A 4KQXA 1HF3A 1NR1A 2A92A 2UUPA 1RM0A 4WE3A 1E6UA 1A9ZA 3E18A 3ZN2A 5L7YA 1DOHA 1NX6A 2B4QA 3E03A 4B8ZA 2Y1DA 4EZBA 3KYCB 1RYEA 3PP8A 3DZHA 1B3BA 2V6FA 1I10A 1K6XA 3GHYA 3OIFA 4R69A 4YR9A 4NJMA 3GDOA 1KY4A 4DL9A 3VH3A 4L4SA 3QWFA 1JDJA 3OP4A 2G5CA 4TSKA 3B6ZA 4RF2A 3RFTA 2J3IA 1PTJA 2O2SA 1GUFA 4FDAA 3VZSA 3PRJA 1ZK1A 3GRPA 3D0OA 1T2EA 3UFXA 4E6PA 2PK3A 4Q39A 4FFOA 3OJEA 3ZU5A 4BNMA 3ENNA 3QJ5A 3DQPA 2WYUA 2NVWA 3BXXA 3BIOA 3QY9A 1LSSA 4JJIA 3FHLA 3DZBA 5COAA 5DF1A 3WYBA 4DGSA 3IKTA 4OAQA 3SC6A 4E21A 1XU7A 1NASA 4WUVA 4ZQGA 1IPFA 1PGNA 1PGPA 1NVTA 1CIVA 2RHRA 3WOHA 2ZB4A 3NT5A 1AHHA 1H6CA 2ZJ1A 3OQBA 4OHUA 4MIEA 4NBWA 2ZQYA 1NPYA 1VL6A 1T4BA 3U4HA 1TI7A 4CUJA 2FMUA 5K0ZA 4PLWA 2DT5A 2CUKA 2PY6A 3PJFA 3H9QA 3BMQB 1BXGA 4BO7A 5H82A 1HSOA 4RDIA 1NFFA 3JQDA 3FD8A 2E37A 1GPDG 1VJ1A 4W9NC 1LEHA 4MOWA 3UVEA 5C5IA 4AFNA 1GTMA 2AEJA 4J43A 4QUKA 3S2EA 4UUPA 4EUFA 4CQLA 5B4VA 5HBRA 3DHEA 1MUUA 3WXBA 4M8SA 3E48A 2X4GA 2E49A 1JKFA 2O3QA 1F14A 1I01A 1OZAA 1CF2O 2QIOA 4LMRA 3ZV3A 1GZ4A 3K92A 1VJ0A 1O9BA 5G0VA 3CZRA 3GEDA 3MJTA 3W1VA 2HK7A 1EQ2A 1IZ9A 4WEOA 3VH2A 1WMAA 4PLYA 4WNCA 1E3EA 3B1JA 4XGKA 1XKQA 1DFGA 3KYDA 1ADGA 1MC5A 4BGUA 4A2CA 5JMPA 3RUIA 4WLVA 2J6IA 1IULA 4N5LA 1KOLA 3L9XA 4RVUA 4L74A 1YS4A 1WXDA 4ALNA 3VZPA 1Y6JA 2NM0A 1YB1A 3TDKA 1T1SA 3D1LA 1NQOA 3W4IA 4B3IA 4IDGA 4AJHA 4XYGA 3EY4A 2D5AA 4AJ4A 4N18A 3TL3A 3P19A 4GMFA 1GDHA 1I3KA 4U7WA 1HE3A 4WEQA 3EW7A 4ZA2A 2FPPA 4BNVA 5L40A 2CVOA 3RKRA 2X1HA 3TZQA 5C7IO 5I7VA 1DHRA 3WLEA 3EDMA 5GZ3A 5IZCC 3UHAA 2VWQA 1E7SA 4L8VA 4Z9YA 2BF7A 3QA9A 1YDEA 2Z95A 2O3JA 3I4FA 2WEKA 3JQ8B 4YYZA 4BO2A 2CZCA 3NT4A 1T24A 2AG5A 1ZO8A 3OQ1A 4WPGA 4MVJF 1JU9A 1N92A 4I5GA 1DHTA 1M76A 1DB3A 3KRTA 5A02A 1Q1NA 1Q0HA 1B26A 4EITA 4CM9D 3GVHA 1YGYA 4N5NA 3WBBA 2D59A 5LC1A 3LT4A 2QZ9A 1A4UA 3DBVO 4RVDA 2BFOA 2Q99A 2DPHA 2XAAA 3Q6IA 4FIZA 4IDCA 4KOAA 3JQBA 4K6FA 4MO2A 4D41A 1FDTA 3ZWVA 3MJVA 4RGBA 1WDKA 1NFQA 1Z75A 1Q7CA 4CM4A 3DBLA 4Z6KA 4MIOA 4DLBA 2ZTMA 4NZ9A 1ZK4A 5KJ6A 1UH5A 1PS9A 4DIFA 4I5DA 1ZEJA 1VL8A 1A72A 4LVUA 1IL0A 1E77A 1T2FA 4GAEA 2DUUA 3DHYA 2D0IA 5TLSA 4ZVVA 2HK9A 2Y1OA 1HDGO 3EZYA 1A4IA 2I3AA 4HXYA 3VDRA 1MG0A 1Y9EA 4NU5A 3FWNA 4BNUA 1U5CA 4TVBA 1P0CA 1YBVA 2HMUA 1LSJA 4JP2A 4HBGA 1MB4A 4ZQEA 2RH4A 3NYWA 1PL8A 3KETA 2VYNA 1U28A 1D4FA 5CG2A 5KVCA 1XHLA 3SLKA 4U0JA 4CLOA 4IXWA 1OOEA 4O59O 4YBZA 1JAXA 3EGOA 2ZKLA 4Z3KA 4OXKA 3U49A 1AN9A 1U3TA 3WGOA 4QFCA 2W2LA 1DDOA 3JQBC 4BKUA 4CLRA 5LDGA 5ENVA 4KQWA 3LF2A 1E3SA 5B1YA 1A9YA 5TQVA 3PYMA 4PG6A 3RC9A 1HLPA 2EKLA 2P2SA 4H3VA 1K3TA 3ZNOA 1ZMTA 4ZU3A 4KDEA 1GD1O 2CFCA 4ALLA 3H3FA 5F5LA 1EBFA 3OETA 1PWZA 2FZWA 4EUHA 3NUGA 3H4VA 3U09A 3HDYA 3K2EA 3MWDB 3RU7A 4K9DA 5JNLA 5IZ4A 2PA3A 1EE2A 1Q0QA 3JD4A 2EKQA 4GVLA 5JMWA 1NVMB 4YT5A 2EJVA 2NQ8A 4B4UA 5EQFA 5JE8A 3ZGYA 1U7HA 4B8WA 4YT2A 3S2IA 3BTSA 3KSUA 4IDFA 3GQVA 3RI3A 2X8LA 4WGGA 4DPLA 4OXNA 4GL4A 1BXZA 1PJBA 4L9RA 2OBYA 3TOXA 2QQ5A 4A26A 4HY3A 1S7CA 3JQAB 3WICA 1EFKA 3WFIA 2GR9A 4U5QA 3KLPX 1WPQA 4BO9A 2O50A 1ONPA 4WOKA 3H65A 4FJ1A 4CM7A 5CEEA 3SJ7A 4I8XA 4Z3DA 4R1SA 4MVJH 1NPDA 2PTGA 4UVHA 5AVOA 1PZHA 4MJLA 4AJ1A 4DPKA 8LDHA 3I1JA 1SB9A 1PQWA 3GEMA 3DBRA 4RPJA 5EESA 3U9LA 4CPDA 3KTDA 1LXCA 2QG4A 3G79A 4ZGWA 2GN9A 5GMOA 3BTUA 3TZCA 4BO4A 2X6TA 1K6IA 1PS0A 4BO3A 1R16A 3GEGA 4AJ2A 5IG2A 4N5MA 4FB5A 2OXIA 1VSUA 1XEAA 4YRDA 4TRMA 1IZ0A 5TT0A 3T4XA 4CMCA 3R3SA 4Q3DA 1HT0A 3C1TA 5A3VA 1ARZA 4A27A 4BO6A 3H9UA 1LUAA 3FPCA 3PI7A 2OO5A 2IZZA 2C5EA 2B37A 1DLJA 3WDSA 3BZUA 2CF5A 2X7HA 3KM0A 4GWKA 1EVJA 5L3ZA 5T64A 3FRJA 1X1TA 5KJFA 3DXFA 1BG6A 1LRLA 3CSDA 3DB2A 3GDFA 4YB8A 5EERA 4IM7A 4CJXA 1UDBA 4WASA 1SCUA 4CMJA 2ZQZA 4L73A 4DQVA 2BFMA 3EUWA 3DZJA 2OMEA 3OEWA 4PG4A 3BMCA 1NVGA 3VH1A 4EJ0A 3NRCA 3ROQA 4BKOA 2GGSA 2YDYA 4HX5A 2I5PO 2DC1A 2XOXA 3LYLA 1QP8A 3A14A 5A5FA 4L4XA 2W2KA 3O9ZA 1P3DA 3RUDA 1LDNA 3CMMA 1HRDA 3L0DA 5JS6A 2BKAA 4OGWA 3PZRA 4IZHA 1UXHA 4L76A 1FF9A 1LLQA 3TF5A 1QXSA 5CDUA 1GZ3A 1I33A 1DBVO 2NV6A 4KDFA 4WLNA 4CUZA 3BYZA 2VOJA 4J4TA 4IJKA 5EN4A 1RM4A 4CMBA 4I5FA 3ICCA 3Q2KA 3ETGA 4YRBA 4N54A 2H5LA 4WCFB 2IXBA 5JBIA 1QV7A 1CRWG 4DYVA 2HRBA 5JW6A 3AY3A 5KKCA 4E2XA 3VAZA 1QLHA 4TQGA 2OFPA 4C7KA 1XA0A 4YJFA 3NAQA 3H3JA 1AUPA 3WQQA 1T26A 3QWIA 1E7WA 1NFRA 4ZRMA 4RVHA 4DPMA 2DUWA 4BNLA 2O3SA 3TPCA 4B4WA 3K9QO 5BSHA 1GR0A 3ENKA 4PLHA 4ID9A 2QW8A 5H81A 3I52A 1SAYA 3SJUA 3KZVA 3UN1A 1E7MA 4XJSA 1R4MB 3V8BA 6LDHA 2JCYA 3DOCA 5A04A 1FDVA 2AG8A 3GUYA 5ER9A 3E1KA 3ZNNA 4J0EA 4Y67A 1P1KA 3FTPA 3DTTA 4O6VA 3I5MA 5C7LO 3FBTA 4UAGA 3F1LA 3D3WA 1HEUA 1UXJA 1X14A 3EAGA 3L6DA 2AEMA 4J7CA 3G0OA 4HP8A 1SEPA 3H6KA 2YQ5A 3JD3A 4KWHA 4BMVA 3ZNQA 1A71A 4RQUA 3IJPA 2HCTA 2YJZA 3OM9A 1UJMA 1T1RA 2V65A 1SPXA 4R68A 3QVTA 3RC1A 4BNWA 1WMBA 4BQRA 4J4HA 1PJ2A 1FDSA 3ZWXA 5H83A 4CMEA 3WJAA 2VRBA 1HDRA 2YFQA 2AQKA 1YO6A 4HFRA 3ZNPA 3CINA 4DWVA 2HSDA 2JKVA 4C4OA 2HAEA 2PKRA 3ONFA 4N7RA 4ND2A 4XKJA 2FSVA 3H5AA 3Q9UA 3BMOB 1O5IA 4JROA 2Y05A 5CDYA 4TKMA 1E1LA 1LX6A 1GQQA 3BTVA 4MKZA 4BL5A 1R4NB 3LC2O 3BMOA 2GCGA 1Q7BA 5A9TA 1JVSA 5DBGA 2EKPA 2I3GA 3TQHA 1HETA 1FJHA 2BI7A 4EJ6A 4XJTA 2IRWA 1W0CA 4FFLA 2NU8A 3BA1A 1ISJA 1Z7EA 5EL0A 1U8XX 4ND3A 3VPXA 4DQXA 3X2FA 1K6JA 4DIBA 4BS9A 4RVGA 5I8ZA 1GU7A 1YOVA 4YTEA 2X5JO 4R51A 4IY1A 5IDWA 4S1VA 3V1UA 1MLDA 3KYCA 3PDJA 3K6JA 1GQYA 3W4KA 1H0KA 2IEBA 4OSPA 1GEGA 2AEFA 2V7PA 4JQCA 3DAGA 1R0KA 4F46A 3DBHA 1V9LA 1TLTA 4J9UE 4WNIA 3E9QA 4F6CA 2YW9A 3CKYA 1DIBA 1IE3A 1YWGO 2JD2A 3LQFA 3FPLA 3IKVA 1WWKA 1UZLA 3DMYA 4OQYA 4P22A 4BV9A 2HJSA 3AY7A 4RCVA 1R4MA 2VUTA 5IDQA 5JO0A 4E12A 2Y1FA 4IS2A 3C85A 1M6HA 3ANLA 2Y0CA 4AL4A 5HM8A 1KYQA 4INAA 1EVZA 1ZVMA 2G76A 1MX3A 4XZ3A 1M6WA 2BD0A 4YVFA 1T2AA 3VPHA 2I67A 4UUNA 3G1TA 2NTNA 2VUSA 1QKIA 1S6YA 4BNNA 5ER6A 1EMDA 3QRWA 5T8KC 4XWYA 4G2NA 5A9SB 4NK5A 4QO7A 1EUCA 1SZJG 2DLDA 1KVSA 3H2SA 3H9EO 3ZHZA 1QYWA 1FK8A 3KOUA 1HDXA 3QVXA 3TN7A 2B4RO 4GVXA 2X9VA 4XGNA 2GUGA 3C24A 3OA2A 3V2UA 5ADHA 2GNAA 2O7QA 3LF1A 5IXYA 3C7AA 1GQ2A 1K89A 1DLIA 3WSVA 5B4UA 1VPDA 4B4VA 4JK3A 3OH8A 4EDFA 1JW9B 5GZ1A 1X7HA 2WTBA 3AUTA 4J9VA 1EK5A 4K1LA 2UDPA 5DBIA 4AJIA 4DMMA 3WGTA 3ZV5A 2JHGA 3P7MA 3DDNA 2HU2A 4CMIA 2C07A 2RBEA 3INTA 3CIFA 3K5PA 4YACA 2Q45A 3ABIA 3JD0A 1ISFA 5KKAA 3RUCA 3ZWPA 1JTVA 3FF4A 4RPKA 3VVBA 4D7AA 1LDEA 3QWAA 3F5QA 4RPGA 4GSKA 2GF2A 2DQ4A 1U3VA 3PEFA 5TT1A 1DAPA 3CZMA 4JIGA 1LRKA 2PR2A 1CQJA 3ZH2A 1ZXLA 3ITKA 3RSHA 3RASA 5B12A 2PFGA 1ZZEA 1MFPA 4XYBA 4J4BA 4UUMA 1YBMA 5EINA 3WFJA 9LDBA 5G4LA 3GNTA 4NBRA 2G82A 2X22A 1ZUD1 1LQTA 3D7LA 2HRZA 3JYPA 1ZSNA 5AXBA 5G4KB 1A5ZA 1L7DA 1XELA 2PH5A 1LC0A 3PGJA 1YJQA 3H9JA 4QTZA 4Z9FA 2NTJA 3BHIA 4IDAA 1NP3A 4QEDA 4B7CA 1J49A 2C5AA 3TZKA 3SC4A 3VPSA 2P68A 3F47A 1H2HA 1UDAA 1B7GO 2A35A 4PVDA 4RORA 4DYDA 2NUAA 3CTMA 5EMHA 4FFRA 1H6AA 3RC7A 3TL2A 1ZIDA 4CM5A 3QSGA 4ROSA 4D3SA 1G1AA 3HDHA 4W4TA 5FF9A 3WIEA 1LTHR 2P5UA 2Y1GA 4IUYA 5L9AA 3WWYA 2OZPA 4CMEC 1RKXA 2WM3A 3OEYA 5A05A 2Q1WA 2C2YA 2O2YA 4DMLA 5IJZA 2Y93A 3V5NA 2O23A 3FBGA 1ZK2A 3UXYA 4XA8A 3VC7A 4QFDA 1B8UA 3D5QA 2PKQO 1LDMA 5A5EA 5KWEA 4OYRA 3RBVA 1DJNA 3ZWCA 3LT0A 4NDNE 4W7IA 3I9MA 1P45A 4P38A 3OHSX 2PD4A 4FBGA 2GZ2A 4FGSA 3ZU4A 2POQX 4F3YA 2C0CA 4WJZA 4K26A 1R4NA 4I1IA 1ZW1A 4R16A 5AXCA 1VSVA 2EWMA 1C3VA 1KBZA 1KC1A 4K6CA 4BNKA 2OP1A 1DPGA 4WCFC 1KIFA 4CLOB 1C1DA 1BXGB 1BDBA 3GK3A 3JQEA 9LDTA 1PWXA 4CV1A 3AI3A 1H5QA 1Z82A 4UREA 3ZZNA 3MTJA 2ZB3A 5EJ2A 3WG9A 4R9SA 1Y7TA 2PZKA 2VYND 5KVSA 4Q3EA 3JQAD 4J2HA 3QVWA 3RUFA 5K6AC 5DCYA 1L1FA 1ZJZA 1E1KA 2GDZA 4IJWA 3VZRA 2DPGA 1CERA 3ASVA 5DNAA 1B3RA 3VKVA 1LLCA 3F1KA 4U8GA 3AI2A 4A7PA 3KLMX 4XQEA 5BQFA 1BGVA 3SBOA 3ROMA 2W2LD 1DIRA 4CL3A 4DLAA 2IODA 4DTIA 1C0KA 2E6UX 4ZQBA 4G5HA 1LLUA 1X13A 3HFGA 3ZWAA 3COSA 5MGBA 3MCVA 4PLCA 1HDYA 4XYLA 3IIEA 4J6FA 2I6TA 3NEPX 2R00C 3EVNA 5L53A 2FSSA 1JKJA 1QRRA 3HJAA 2G17A 1DIAA 5BNIA 3D64A 4FSHA 4BNFA 1U3UA 5CEJA 5HA5A 3GG2A 4W82A 1BMDA 4H7PA 3VPFA 4OKNA 3ZHYA 2B5WA 1B0AA 3KSDO 1EQUA 2WE7A 4B7UA 4BMNA 2BRUA 2GERA 1ZXBA 2Q4BA 4YXFA 4R5HA 5A03A 1GV0A 2OORA 4Q3CA 4WKGA 4F45A 4IQ0A 4MKRA 3QWBA 3O4RA 4KUEA 5I9NA 1N9GA 2VNSA 3ONEA 5AOVA 1PQPA 5JCXA 1UUFA 1MC4A 2E82A 3FI9A 3JSAA 1YB4A 4KUHA 3PLRA 1ZMOA 2C2XA 2TMGA 3WQRA 3FWZA 1BRMA 1YOVB 4E31A 4II3A 5ITWA 3I6IA 2VWPA 5I9LA 2QHXA 3I83A 2AQ8A 2GYYA 4CV3A 5THQA 1XSEA 4LW8A 2PGDA 3WLFA 4A0SA 3WMWA 1R15A 3U4IA 1J4AA 4GX0A 2FPIA 1ZNQO 2WYWA 4DQUA 3S55A 3MOGA 4Y6RA 4IXTA 3INGA 5C37A 5CAEA 3ZHBA 5A9RA 2AE2A 3RVDA 3NGXA 2J5QA 3O03A 4D45A 1RWBA 5DP1A 4BO0A 2FR0A 3G17A 1OBFO 3TNLA 1RJWA 3Q1LA 5B4TA 1DXYA 2ZCVA 3F9IA 4FFNA 3BMNA 4JN6B 4UEOA 1KC3A 3ETEA 1RM3A 3KYBA 1O0SA 4CL8A 3PHLA 3GPDG 2BFPA 2OHXA 4Z0PA 5TJ9A 2X0RA 5CFZA 3DEYX 1G0OA 2D3TA 5CPFA 2VT2A 2WD7B 4FD3A 4GWGA 4O1MA 3GN1A 3S8MA 1HZJA 3PFFA 3UW3A 4FC7A 3WGIA 4BVAA 3TFOA 5B37A 1J0XO 4AJNA 3GDGA 5T57A 2FWMX 5JAZA 5JC1A 1WDMA 4TVOA 2VZ0A 4BKPA 3ETDA 1Y8RA 3BMQA 5HS4A 1AGNA 1XQ1A 3AI1A 1U4OA 4PLGA 1Z45A 3O8QA 1KVRA 4Q3BA 4F6LA 3OJOA 2DAPA 3NX4A 2JJYA 4RVSA 1IOLA 2A94A 2TMDA 3GMSA 1XDWA 1VI2A 1MGOA 4J7UA 4CM8A 5BR7A 4P4NA 1DSSG 4CMHA 4Y9DA 2C29D 1DAOA 4ITUA 3MWEB 2YZ7A 1NWCA 2UYYA 1OC4A 4RLHA 4XIJA 3HB4X 3VZQA 4MP3A 4YJGB 5CDSA 4ZN6A 3JQAA 1YONA 2NWQA 2P91A 1QR6A 4B3JA 1IYZA 2CNBA 3NTQA 4YT4A 1LBEA 3KYDB 3RBXA 5L4SA 1PJLA 5TGDA 5I7FA 1O94A 4FOSA 1V6AA 1DO8A 2PKQP 3I6QA 3O8QB 4QT0A 1SMKA 3PZBA 4RF4A 4LISA 5DCWA 1HKUA 3PQFA 1Y8QB 1E3WA 4RJTA 5L4LA 2UAGA 4M1QA 2SCUA 4ZQFA 3QQPA 4DIOA 1BWSA 5G4KA 2I9PA 2H9IA 3TJRA 1I2ZA 4YAIA 1YVEI 3PWSA 4R9RA 5JDCC 1HTBA 1Z7BA 1ZBQA 2DVMA 2CVQA 1F12A 1N1GA 3PK0A 4FFPA 5G2OA 4Z9XA 3T4EA 4QECA 2EV9A 4ND5A 1FMCA 1NQ5A 2YY7A 4O0LA 3ZDFA 1V0JA 1V35A 3GA0A 3DFUA 4J91A 4YAEA 2OP0A 4PLZA 3X2EA 3DHNA 1PZEA 3AWDA 2CVZA 1N8KA 2X0JA 2CDCA 2PGJA 2YFHA 1NR7A 1KERA 3WSWA 1XLTA 3NTRA 4AJPA 3MZ0A 3Q9NA 2PH3A 3RAJA 2B35A 3JCZA 4DRYA 2CY0A 3FN4A 3GN2A 4KP7A 3VPGA 1U4SA 3F4LA 1B15A 1U9JA 3KB6A 5F3RA 3MEQA 4TRRA 2P9CA 2W2KB 3FCOA 1ID1A 3GVCA 1YRLA 5L95A 2ZYAA 5L7TA 2NVBA 3C8MA 2IXAA 4IDDA 1P1HA 4XGIA 3KBOA 5I7EA 3L4BC 3GMDA 4BNZA 4BHTA 5IFLA 4LRTB 4ALKA 2VTDA 1TVEA 1V3UA 3DBLB 4JCOA 4LMPA 3I23A 5L51A 4W7HA 3UCXA 3WGQA 1ZCJA 3JYNA 3V2GA 1PX0A 2XXBA 1PJQA 4TRNA 2P4HX 1GADO 1B14A 4BNIA 1T2DA 1RM5A 1KVTA 4M89A 3NTOA 3QP9A 1C1DB 1H9AA 2WE8A 3H2ZA 3H7AA 4H16A 4TZTA 5KVQA 3RCBA 3STHA 4O5OA 3S2FA 4CLXA 3OBBA 3W8FA 4BNJA 3DAFA 3LU1A 5HS6A 4YA6A 1ULSA 4GQAA 1QYVA 3PGXA 1SOVA 3K2BA 3DC2A 1D1TA 3MTGA 1EUDA 3CMCO 1IB6A 3DMTC 2NSDA 3RROA 3EMKA 3DTYA 4WOJA 3DONA 3B70A 3NGLA 5TRTA 4Y6SA 4NH4A 4RO0A 2X0IA 5JY6A 2VRCA 2J3KA 2EF1A 4RV9A 1ENZA 3HUDA 5JFOA 4DA9A 3JQ9A 2HQ1A 3I4CA 4JX8A 5LDHA 2D8AA 2FRDA 3BTOA 1KEVA 2Q3EA 3R6DA 4XYEA 3K8ZA 4J1QA 4P4LA 5T67A 3U62A 3AY6A 4JGBA 1AE1A 4NFYA 5T5QA 4KUGA 2YDXA 3HSKA 4QX6A 5JLAA 1MXHA 1E3IA 4CQMA 2R6JA 3OA0A 4CQMD 1ZK0A 5COBA 2VHYA 3DMTA 3GT0A 3LT2A 1ADFA 1GYPA 1H93A 4GLOA 1IY8A 3GZNB 2B83A 5K6AA 3IOYA 4PG8A 3ANNA 2P4QA 3KVOA 4BB6A 3OIDA 5BSGA 4OL9A 4UEKA 1D8AA 1K2WA 3RUAA 1HYEA 2J3JA 5I8WA 3WGZA 5ILOA 3KHUA 5FI3A 3KEOA 1HDOA 2Q2VA 4GKBA 3IDSA 5DT9A 1LQUA 2B69A 3PHJA 3WNVA 3VVCA 3R3JA 5AXAA 4E3ZA 4M54A 3PJEA 4RQTA 5KJEA 1GCUA 3WGGA 4YPOA 1LNQA 1NHGA 1WZEA 4BQPA 3LSYA 3V1TC 2PWZA 1HSZA 5CEFA 4NJOA 4MP6A 5F1OA 3Q0EA 1DFHA 4HWKA 5ILGA 1PGQA 1ZH8A 3RBZA 2VWGA 1I3MA 4HNGA 5IXSA 5JAMA 2PNFA 4YQYA 4YAJA 3ZW8A 1OAAA 4J1SA 2JD1A 1QYDA 1ENYA 5LCXA 2AW5A 3RC2A 1YJ8A 1PU2A 1U2DA 3PFWO 3Q3CA 1Q2XA 2Z1MA 1VE9A 2W4QA 2V6MA 2EGHA 3PWKA 1PJSA 3IJRA 1TB4A 4HUJA 4A73A 4CM4B 3ADOA 3FNFA 1T25A 3LC7O 3AM3A 3LLVA 4PG7A 2VHVA 4JNKA 3MJ4A 4PIVA 4W9NA 2OGUA 2W8ZA 2CMDA 3HZZA 4E33A 2PZLA 2OUIA 1PGOA 1P44A 2EJWA 4LK3A 2JCXA 3RFXA 1DFIA 4YT8A 1U8FO 2ILTA 2X9NA 4PVCA 5FEUA 1K5HA 3QWHA 3VH4A 1I36A 4NBTA 3NDJA 1GEEA 4FFMA 5GZ6A 3ZW9A 3PLNA 4U0KA 4S3MA 2VZ9A 5CP8A 1P1RA 2PZJA 5TX7A 5IN5A 2PGLA 2JFGA 2QRKA 1B8PA 1ADBA 2EEZA 3RKUA 2CSUA 1SO8A 2CF6A 3ST7A 4BO5A 3P2OA 3AOEA 4GX5A 2RH8A 2DBVO 2OBNA 2EP7A 1H6BA 3M2PA 2VYVD 1C0LA 1PL7A 1GAEO 1ZSVA 4XR4A 2VTEA 1H9BA 5EIOA 4TMFA 1W8DA 2C54A 3GY0A 2J8ZA 4RVFA 2QRJA 3RWBA 4NBVA 3GVPA 4PCVA 4Y8VA 1BW9A 4CM8B 4Y6PA 1ONNA 3E82A 1VC2A 1XR3A 3PIIA 1U2GA 2GD1O 3DWFA 3QLJA 4IQGA 4L0QA 3GZ4A 4IMPA 1WW8A 4HFNA 3NV9A 2E4AA 4EYEA 1EK6A 1YL6A 2ZTUA
chains in the Genus database with same CATH superfamily
2C82A 1OFVA 1QF7A 2V54A 1PBNA 4D74A 1JBKA 4AY3A 2E48A 3BL8A 1UMDA 4BLSA 1VE1A 2GA8A 4HDKB 3I0NA 4OXYA 1PT8A 3AUAA 1VKJA 3JAKA 5ECWA 2VVTA 1PKXA 1ORIA 1CC1S 3RS4A 4H35A 4RDHA 4I4TB 4MINA 1IXZA 1P74A 1OWPA 3G0GA 1JQAA 3ONVA 2A7XA 3TSWA 1IWOA 4LMBA 3W3AD 4LFCB 3GEHA 5JXHA 2VJMA 2D4HA 3E7FA 1RXSA 4KQ1A 5JCOC 2Q41A 1JAZA 3D2AA 4NQZA 3MWLA 4PGFA 3R9IA 3HDQA 1Q1GA 5JQGB 4AMYA 5DOVA 4MUNA 1N6KA 3AIOA 1UJCA 3C3BA 3K96A 4TWZA 3R1IA 4TSFA 2PRKA 2VJCA 3FTNA 3IDAA 4MWOA 5ALHA 3WJ2A 1B8VA 1AHPA 1OI3A 3AR4A 4UEJA 4OSOA 2Q0QA 1H2WA 4AQYB 2VDRB 1P19A 2FB9A 2UVDA 4N39A 1WS6A 3K8OE 1VKHA 3N2KA 5U9CA 4EEZA 3H5NA 5EPUA 2OFOA 3GLIA 3BF8A 3K9WA 1J7JA 4IGAA 4UVDA 5EPEA 3DUFA 2JGAA 4P93A 5TMBA 2XH8A 5KQMA 3NKLA 4IIUA 1G0NA 3JRWA 3BWCA 3IHWA 3O6VA 2HLNA 2Q9CA 4X64B 4BO1A 4NMHA 3UMCA 2X13A 2ORIA 1LI7A 2WD8A 3PNQA 1QQ7A 3INNA 2XQFA 4HH4A 3EZ9A 1JMKC 5A4AA 2ZREA 5CH8A 3TRIA 4JI4B 1WZCA 2FPPB 3LO5A 1G291 5DMHA 2EQAA 5L8VA 4PLPA 3PKIA 4GGPA 4HCJA 1GPLA 3CUKA 4KPUB 2BM9A 3VAAA 1JAIA 3FTDA 3MM4A 1DCKA 4F2WA 1MF7A 1ZGZA 5KTKA 5F64A 3B1ZA 3PDIA 2VCHA 2JHCA 4GYYA 2V7GA 4OA5A 3AESB 1XXHB 3K70D 1RRPA 1VFNA 3D4OA 3R6WA 2XF8A 4NICA 2P0YA 1GNPA 4TZKA 3FVQA 4UZFA 4WCDA 2LUOA 2ZB8A 1HGXA 4B3HA 4JYZA 2GJSA 1E66A 3JYQA 1JDVA 3F9RA 4MH0R 5T6MA 1ZIYA 1JEOA 4AF7A 3AKYA 3RU3A 2BGNA 3I5UA 4XGRA 3FJYA 1HMPA 3V1MA 4DB2A 4Q48A 1VG8A 3KR1A 3LC0A 3O82A 2A2ZA 4N40A 3ENQA 4EY6A 4NV0A 4XRRA 3B36A 2FQYA 1ZNXA 2HJGA 5FYDA 4AKEA 4Z49A 4A6EA 3PHGA 1EWYA 3DEIA 3FM9A 4DARA 4LMAA 3M6AA 2HJVA 1NMEA 2GB4A 4ZAVA 3TB4A 2JHPA 4B3XA 5D3MA 3H05A 3O0TA 1H2RS 1K7CA 2IDZA 4FYKA 4N3BA 2PMDA 5DE3A 2DPLA 2HDHA 5JDIA 1OWMA 1GIAA 3VOSA 3N6RA 1Z4LA 2CJFA 3COWA 4KQHA 5DULA 4FFBA 5HJ5A 1TYCA 2QP9X 5K01A 2ZSIA 3N2NA 4ALIA 1WHSB 2BFAA 2VTKA 3HLKA 3Q7SA 5KX5F 3VNVA 1Q95A 4HQFA 3R23A 4Y2PA 2A9PA 4E6EA 2GFHA 3WWZA 2YV1A 3IUQA 3U1VA 5LUBA 1TF5A 3PXAA 2VSOA 2H2DA 3C4QA 3WGMA 3VSCA 5KO2A 3B6EA 4I4TA 4Y30A 5EUMA 1YKGA 4F3YA 4XDYA 1XCJA 1LWNA 3VJRA 1Y4SA 2DH5A 5COQA 4IJUA 1MKYA 4QKQA 2NQ2C 4O8CA 4OXRA 2CD9A 3P9YA 2I7VA 4M36A 1PSDA 1MJGM 2H1WA 2IEIA 3VKGA 1W73A 3DZIA 4LC9A 1NIJA 5KYYA 2Q6IA 4TTIA 5BQ3A 3L82B 5LU8A 4ZZ1A 2C83A 2EBWA 1SXQA 3NBAA 2JVIA 4FGKA 4ZO9A 5DNVA 1B42A 2JS7A 5BMVB 3GOHA 1MHPA 3BL5A 2O1WA 3SHFA 3UAVA 4AY2A 1T4DA 2ZYRA 3R5KA 4G0VA 1NJGA 5HQJA 3RQSA 2ZBVA 3MAAC 1Z74A 4EFNA 1X80B 2VA8A 2VI5A 3IEKA 2NACA 1YBFA 2F4NA 4NDZA 3PA8A 4Q4DA 4KRXA 3A9TA 5A9SA 4KO8A 1A2BA 3N8IA 3HQ4O 2AYXA 3FSRA 3UGKA 5JY1A 2F8LA 3AX6A 5HCIA 4R1UA 5CU7A 3VUEA 4JXJA 4M0FA 1M6VB 3ZWNA 4BNTA 3AFHA 2ZUUA 4NESA 1Z2PX 2C7GA 3WQBA 1AKEA 3PDHA 3DWIA 1MV5A 2BFWA 2G04A 1CZKA 3E7PA 3EDQA 4UU7A 4NCKA 3ENVA 2HUNA 1QU2A 2WMYA 3PHHA 4PZYA 3U4QA 2B36A 3FR7A 1PVVA 2GETA 3K0AA 3F67A 3MRVA 3M7IA 3AJAA 5EHNA 2P62A 5JBQA 5K7SA 1H1TA 4KAFA 4R54A 2DY0A 3PKJA 2QNBA 1D1SA 2V5VA 3LK7A 5AVYA 1NUSA 2QX8A 3EHEA 4Y2RA 1ZRNA 1O58A 2Q4EA 3AVYA 1P2VA 3ABQB 4CUKA 4QYWA 1TQHA 1JZTA 3OJ0A 2VF5X 3R5FA 4B83A 3AUUA 4LE2A 3HR7A 1EXDA 4Z4EA 4FDMA 3W8EA 1ES9A 1AIPA 5E4JA 2A0YA 2OR3A 5C53B 3HKCA 3KTAA 1U3DA 2A1UB 1HDIA 2VHXA 3M3PA 1MP0A 2IHKA 1NTOA 3O26A 1U1GA 2ZIUB 3PJGA 4KAAA 4LYEA 4US2R 1R9GA 3KG2A 3KPWA 3M3DA 1VRWA 2BKVA 4LJ9A 3R7WB 1CF4A 4LG1A 3ETJA 4YP6A 1MABB 4B4OA 9ABPA 3M6IA 4O63O 5JSZB 2AXEA 1LNZA 4JI5B 4GM1A 2PZBA 4HI0E 1BSVA 2OCDA 3F90A 2MOKA 3E1SA 3BOSA 3H9GA 1M66A 3CRVA 2J09A 1RAIA 1SXIA 1B6GA 1CY0A 1Z2AA 3AV0B 2W98A 4JI2B 4FX2A 2OLKA 3P94A 3TZ6A 3RRYA 5A2GA 2VKQA 3OLXA 2AHRA 1RI2A 3TQSA 1KFCB 2GSWA 3CJRA 1BCRB 4JLMA 3ZX4A 5FUWA 4NU6A 1R37A 1J8VA 1QJ4A 3E3OA 3T1TA 3C8DA 4B76A 2JH8A 2WWWA 3DXYA 1CUAA 3FOAA 1KO8A 2AMVA 4G01B 5G1NA 7ADHA 2K7FA 2Y67A 1LQ2A 4JUDX 5ED4A 2PX8A 1BWQA 2WJPA 4GXRA 1OJLA 1YBAA 5EXSA 1UPBA 3SLGA 3WTCA 2AL7A 3OC0A 4M1KA 5JCJA 2QW1A 2P35A 1YIOA 1P1JA 2JI7A 3QHAA 5C5EA 1N5LA 1WSDA 3HA7A 3HABA 3L7IA 3I5YA 3UUEA 1R0XA 2ZYVX 2ZTSA 1G2QA 4CLDA 5C8ZA 1WAMA 3H86A 4ZC8A 4EENA 4E2YA 1ZQ9A 2OHJA 3ROXA 3G2NA 2B6HA 4QYIB 5KBYA 2SKDA 1JWAB 2R5NA 3KALA 4L3OA 1G20A 4PRLA 3ROPA 1XDZA 2B1IA 1DC7A 2HJHA 2GA9A 1NVDA 1QE5A 3HO6A 1NURA 4KMRA 2MR5A 2XMQA 2WPNA 1IEWA 1I4TD 1XEXA 1JE1A 2BR4A 5EEGA 4DDMA 4F4HA 1E0KA 2HL6A 4RLSA 3I92A 4G36A 4LBYA 4QGAA 5TS3A 1B43A 1HE4A 1UBUS 5JXWA 2GPJA 1K8XB 2R6GA 3QVOA 2GPNA 4RMJA 5DGIA 1JWLA 5D1HA 1Q0LA 4MK4A 4NMXB 2QS9A 3BE8A 3WY9A 2LNDA 3VV3A 1E1CA 3PXXA 1N0VC 4MUFA 4RH0A 1CG6A 1UOPA 1XFAA 3MBKA 1ZA2A 3D4IA 1A27A 2AMFA 5L3SB 4GDFA 2BHSA 1JVNA 4AZVA 3WGHA 5AT1A 1DARA 1JA9A 3KO8A 4Q9AA 4F1WA 4ZDIA 5JSKA 2IV2X 2QTCA 2PD6A 4CKWA 1DT5A 1EZ4A 5HGJA 2GHRA 5ALKA 4KPYA 2AK2A 2V97A 4XQCA 1RLJA 5IJ0A 1N32B 2QI9F 3KKNA 4AZSA 4AX4A 3LA6A 3QU2A 1GAXA 1XLVA 3LX5A 4WKOA 4AJ9A 1Y4DE 2DJIA 1RPAA 3IBCA 3UJ9A 1TOAA 4S04A 3R8FA 2AOTA 1IONA 1J8QA 2RGXA 3LOQA 1R0BA 2JHFA 2P4SA 3CZQA 2AR7A 3GZNA 3H8VA 3LP8A 3N59A 4ZQIA 5CA0B 3VA7A 3H0EA 3ZE2B 2EGUA 2NYAA 4NULA 4DSNA 2CL5A 3RJ5A 2CXSA 5DGTA 5CA1A 2C4KA 1NXTA 3RFVA 4FDTA 5JC8A 1WHTA 5A3JA 5JWRA 2Q3DA 4Y1FA 2J1LA 3SVZA 3U7FB 1NW4A 1R0SA 3OIYA 1Q74A 1TZMA 3OF5A 1JN0A 3U4GA 2CLFB 1LI4A 1RE1A 3QGMA 1KK2A 2JDID 4GD3Q 5C8XA 3NWBA 3FR8A 4J0JA 2QXUA 4WUTA 4ZAFA 2FG7C 4QDXA 5HUQA 2B7CA 4DUYB 4RHYA 1X1EA 4MQFA 2ZSBA 3Q1KA 5A4MS 4LRUA 1GU0A 2QG9A 4YRKA 4BP8A 3L0PA 1CF9A 1Y98A 4UOEA 2QN9A 3OPYA 3W2FA 5CURA 4DIUA 1SUCA 3LFHA 3SGLA 4YJ3B 5AW9A 5KNCD 2O1XA 5DNCA 1A97A 1O8CA 5KSYA 3OWXA 2OL4A 4XRGA 2IPMA 3K53A 4GX1A 2D0OB 4RY9A 1M5UA 5HEKA 3CH5A 3TD9A 4FYWA 5F1PA 3W0LB 3I2FA 4DA7A 2B9EA 2JZCA 3TMAA 3IMCA 5AUNB 3GGCA 2HRRA 2X58A 3JYHA 3R3YA 1TRKA 1QGOA 2PUWA 5BRNA 1KZ7B 3QVSA 1JAYA 1MEOA 4PFKA 1XAJA 1II0A 4UFPA 2J3HA 4V1CA 4FUQA 1C0IA 1Q11A 3DOHA 1H2AS 4BVGA 4CKEB 4RZHA 1EGAA 1U31A 4K0RA 4YQZA 1JQJC 2MSCB 1RCTE 2SICE 4IPTA 1AS0A 1VDZA 1BMFA 3AETA 1L5OA 3NRJA 1EFLA 3KE8A 2XZOA 1EK1A 2EP8A 4NNPA 2WP8J 1SUAA 4RELA 3PUXA 1CV2A 1Y8AA 4D0LB 3C43A 2OK8A 3KTOA 1G1MA 4JNCA 3OFND 1YUBA 2UVQA 4HDSA 2X0KA 1BVUA 3ESYA 5EUQB 3KQHA 3Q87B 4RF5A 1SCJA 3EXFB 3E53A 4BEBA 4HN2A 3X1WA 5KWIA 1KQFA 1NQAO 4M76B 5F2KA 4HDOB 5FOSA 4D3DA 2FYTA 1U90A 5EWLA 4PQRA 3BRQA 2XDQA 4AUEA 2IIVA 1JU3A 1M8GA 2LPMA 1UPFA 3HM2A 2Q0SA 1FS5A 1Z5GA 2BFBB 4MP8A 4TXNA 1NVVR 2GN0A 5C5CA 1NKTA 1TECE 1KRXA 1VOTA 1T9CA 4JVOA 1VCHA 4QDKA 3VR4H 4ZD6A 2VT3A 5K2OA 4ZYTA 5IW8A 2FK8A 1CWUA 2RKOA 3T38A 4WOPA 2IHJA 1FXSA 1LU9A 1YULA 1YZ3A 4QGSA 4KN6A 1P4RA 2CB9A 5KWJA 3SEAA 1YAHA 2VCYA 2VJKA 2O4CA 2YWXA 3QKTA 1GTJ1 4IQ4A 1D8TA 3BSYA 1GFZA 3KUCA 4RWZA 2BHTA 3TTTA 1V5WA 3DKKA 2X4LA 5ES3A 3K70B 1WHSA 1TK2A 2X0NA 2A0KA 5D84A 4YRFA 3ZYCA 4A2WA 3IP5A 2R8XA 2VXYA 1UWLA 3EGXA 3H42B 2HA3A 5H59A 4UMEA 1W76A 1G66A 4F3KA 4R84A 4I3FA 1U9CA 1E5QA 1L3IA 1E20A 4BLVA 3T1VA 1FE8A 3LIIA 5E95A 2WQ7A 1IG3A 2UZ1B 3ZS8A 3FKQA 2ZAGA 2W0MA 1ZBDA 4X92A 1F0PA 1ATIA 2OAP1 1EA5A 3JZIA 4FSXA 4MW0A 5GQSA 3MIZA 2J87A 3HADA 3BD8A 1EFDN 3L6OO 3ULKA 3VU8A 4KR7A 3UHOA 3A6DA 5K4HA 4D9MA 1I3NA 1NULA 1YQXA 3EUFA 4R1NA 4MVJG 2XGMA 3GLRA 1N0WA 4AXBA 1E1QD 1WNTA 4DC0A 1ZL0A 2QB5A 3EQ9A 2QAGB 3LLSA 1IJKA 2P9BA 4MW2A 4ON9A 3CLSC 5FWNA 3FYCA 1UDRA 3KS9A 2ZPTX 2I03A 3ANMA 3QPCA 4LQLA 4ILEA 1JHQA 2E7ZA 2XCLA 3LUHA 3PC4A 4QGGA 1L4HA 4FLFA 2NAPA 4Q21A 2Y27A 3GRCA 3S1AA 3PDCA 4ARUA 3LL4A 1NM5A 7ABPA 1OH5A 2CNWD 5JHHB 5JCJD 1C7IA 1NSYA 1TF7A 4RS4A 3NHUA 5BORA 2XCQA 2V0NA 3GH3A 3M2TA 4Q1EA 4Q03A 2FZ4A 2HDNB 1U7WA 3EZLA 3GHHA 5LZ9A 2XBUA 3E7XA 3QVKA 1HQKA 3BREA 4I4CA 1BE0A 1HI9A 3INRA 2JAOA 3SLRA 4AJKA 1ZINA 4WJKB 1AO3A 3L5KA 2YHIB 4BPBA 1PS8A 1UWKA 3UICA 4D9HA 3EZ2A 3ND8A 4J03A 5CDTA 3GJ7A 2QROA 3QBEA 1EVYA 2HWYA 3CRRA 3AU8A 5HJEA 1XT6A 1GYQA 2GAOA 3QVMA 2QLNA 4I08A 5B30A 3JPYA 4EMSA 1IXYA 3C6KA 2WG1A 4GZMA 2OBXA 3GAZA 1PG2A 3NQ41 2J7PD 4QVKA 4EUEA 1E69A 1DMSA 3U5TA 1NBIA 2GN8A 5CDHA 1Z6ZA 4OXXA 1IM5A 3PGMA 4OD0A 3K09C 4CLRB 3L8CA 3ZV7A 4E15A 1TU3A 3VO2A 5CFPA 2XNDD 4BRSA 1OU4A 3AOEC 4QO8A 2DULA 3OZCA 4TUYB 5G0TA 4V38A 2V9PA 5C1PA 4FK8A 2AC7A 2QX9A 3G0CA 1JXMA 3DZGA 1HG0A 1O95C 1BGWA 3GBSA 3I3OA 1E2DA 3EIUA 4ICIA 4KBFA 5BPFA 2HIAA 2LE0A 3BJZA 3K6RA 3RHFA 2PYDA 3HKEB 1M6NA 1BS9A 2PAFA 1F1JA 2EIXA 3I2GA 4F96A 2GN1A 4LSGA 3S5JA 1QH1B 4YMUA 3I09A 4BMSA 1I1OA 1V6CA 1FFCA 2PBRA 5ICFA 1T8TA 3CVOA 1Z3IX 5M2QA 4MDEA 5AOCA 4JU8A 2JG3A 2WM8A 3HCBA 5EWJA 3PFIA 2FPUA 4C7OB 4XEUA 3TRFA 2JEYA 3MBIA 3G02A 1ZS9A 3HU3A 4PZPA 3PQCA 1IN4A 4GBJA 3UA4A 1OWOA 1ZU5A 3P52A 4IS3A 4BMCA 4OX9Y 1CIJA 3JVIA 3B3GA 3H75A 4QPDA 2P41A 1AHIA 4DQKA 2HR1A 4KFCA 2A9FA 1EHCA 2BR5A 3ZBPA 2O57A 2JI8A 3E0XA 2VEDA 4LGVA 1SIBE 3HXLA 1YE3A 5ITZB 1M73E 1UBOS 3VTZA 4WY8A 1NAHA 1RWMA 4HWTA 3RSZA 1YMVA 5ALZA 3NH9A 4MUAA 4R3WA 1VSBA 1XMIA 1UAYA 4MDHA 3DOJA 3CKMA 5HP4A 4ZOAA 1V2HE 2FPGA 1OT5A 4YRIA 3QBDA 4KR6A 1J2UA 4JT4A 1OIVA 4B2IA 1KE1A 1HE2A 2P7HA 5K0ZA 2H3EA 2OZEA 1XTVA 2XYVA 2N46A 1MNQA 1LDYA 1YOBA 2JIZA 1W9HA 2WWXA 4CM1A 4UULA 5FIUA 4UBJA 2F7SA 1L5RA 1RWWA 4D0GA 3WTBA 3RAGA 4CMKA 2IYEA 2UYGA 2RHCA 1OLSA 3WB1A 3HG7A 4IGEA 4MQBA 1A98A 1JTEA 2IH5A 3OOWA 2FU5C 3QY0A 1YB6A 3JQFC 2BSAA 1E3JA 2ASVA 2IFTA 2P1ZA 2RCYA 3K35A 3OFSA 4QTXA 1YASA 2YHIA 3RLFA 1KU6A 5HCUA 1YKFA 4E5NA 1QFJA 1T1JA 1T2CA 3E5RA 1VL5A 4UASA 2N0SA 4QA9A 1OXTA 4HADA 3ME5A 3QIAA 1XI2A 1JEAA 3FAZA 4OLFA 1NAIA 2Y1LA 3PX2A 4I3GA 2ZK7A 4JOQA 2EDCA 2I4OA 1N7HA 2P90A 4Q05A 4NF2A 5I9MA 5I7SA 3TTWA 5IBQA 4B71A 5ICMA 2WWIA 4R8MA 5JYEA 4FMDF 3WNQA 1R1DA 2PS9A 1KVQA 2VNHA 3THRA 4NOMA 4CV0A 4DREA 3WZ2A 1OTYA 4EDHA 1I5RA 2POCA 1NYRA 3CHYA 4ZHSA 2K7ZA 4D0RA 4XX0A 5IAJA 1EDZA 3HBFA 4EELA 3T54A 5ALYA 1XZHA 4EPWA 4U8HA 3ORFA 4BGVA 4ETNA 1EQAA 2R62A 1N5DA 2WBLC 1NOKA 2WMOB 2X9LA 2J9FA 4EGFA 2BFCB 2G9ZA 4ZOCA 2FA9A 3VU1A 2WHRA 3M6VA 3BB1A 5DGHA 3V2HA 4EPTA 3KQVA 4OF4A 5BMVA 3RVPA 4EJSC 4D8XA 5LQCA 1RRVA 5KU1A 1ZNZA 1W35A 1M7GA 2ECQA 4RZ3A 3VBEA 3WC4A 5JTTA 3NBYC 1NVKA 3A2LA 2HO5A 2ZRDA 1AQIA 3LA8A 4E5DA 2ZI6A 2R3SA 1JEQB 1AQYA 1VJ5A 2HPZA 3K94A 4G65A 3LPAA 2C8VA 4CWAA 1CJCA 4X54A 3R7BA 1PT9A 2P9EA 4P0QB 4WHMA 2ZAMA 3BG5A 3DO5A 3LW7A 5IDVA 1JHDA 4M0KA 1VG0B 2HKIA 2QI9C 5JVDF 5HRUA 2HREA 4JZKA 3AGPA 1W75A 3OTIA 4G23A 1Y7LA 4F91B 1IHYA 2F43B 3KUUA 1DAKA 1O3YA 4LEIA 4DLUA 1CUCA 5DVZA 2R6DA 1DUVG 1T4GA 2HM7A 5KUTA 4U7GA 2WSIA 4FVTA 4RTMA 4P5DA 1VIMA 4GMGA 1NW9B 3UUGA 4M86A 1PZFA 1E3WB 8AT1A 2C2ZA 1KSFX 4ZRNA 1BC5A 3CTPA 1U5BB 2QT1A 2N1BA 5DTEA 4YP9A 2GJ8A 3MF4A 1ESZA 4E5MA 1RPJA 5LJLA 4JXXA 1UAGA 5A4KA 2VHUA 1R12A 1II8A 4J94A 3DFMA 1Q7RA 3T52A 2JIRA 4XYMA 2Y1EA 3I04A 2X9GA 5ALXA 5GONF 2XOEA 4CN8A 1Q2UA 3NHMA 2RI0A 2ZITA 3D3KA 4M99A 1RQPA 3A1CA 3EXFA 3FPBA 4YJ2B 1TW2A 1KMHA 1SKUA 2YJ6A 4IJVA 4AMVA 2GD6A 5DZSA 4E30A 4MS1A 1PR1A 4YLEA 5AMXA 2RE8A 1K5GA 3SXJA 2RAFA 3E7DA 4L15A 3QE0A 3TRKA 1MAAA 2I6UA 3MMZA 3EPPA 2PLRA 1NU6A 4B31A 3K7EA 3PC3A 2G5TA 3HRIA 2CJPA 2VN8A 5I4KA 1IUKA 2RHBA 3TVYA 1I7QB 2W6PA 4ZKEA 2P6OA 4YV2A 4EFMA 3QBVA 3MILA 1EIWA 5JXGA 1M1YA 3PQEA 1LJUA 2NO5A 1BAPA 2BHNA 3I9JA 1IAQA 3BDIA 3ZWOA 4N9QA 4ZHQA 5JR3A 1GUAA 2WFAA 3B6JA 3G9XA 1N7JA 3EEIA 3JQQA 4XWWA 4A10A 3FJOA 3MTBA 1VLHA 2BLLA 2E3JA 1VL0A 5C3UA 1A8HA 1KH3A 3HB5X 3KTFA 4RJ2A 4CCAA 1TUBA 1ORDA 3DE0X 3EA0A 1BTOA 1FSZA 1XD2B 4NJMB 5LYYA 5T4EA 1XQXA 2ZJ0A 5CYPA 1KMQA 4PTLA 3ZDEA 4F0JA 1HWYA 3SSMA 1X7ZA 2J3QA 1L7VC 4RHXA 1XZIA 1CT9A 4XDGA 4R40A 5CJ2A 4HV4A 3EISA 5FUQA 2XD9A 3CF4G 1I4LD 4D43A 4GICA 1M33A 4C03A 1ZGBA 2IA5A 5A4DA 1F51E 1LRJA 2O0MA 3JAMA 3AO0B 1DAFA 3ASUA 3KZ1E 3RSOA 4L28A 2DTEA 1NATA 1QYIA 1UR5A 4TL6A 3GWZA 3TTUA 2ZWPA 3RYFB 3HZHA 1L4GA 4NBSA 4D4GA 4OB7A 3OCWA 2HSEA 4KIWA 1E2UA 1M2EA 3LBIA 3VAYA 4DM7A 1RXWA 3TNFA 3ZI0A 4PX3A 4TRJA 1HEIA 4IZIA 1T3TA 5UKDA 5C32A 1QHXA 1RADA 4HWSA 3CZAA 2IIPA 1NVEA 2JFWA 4EYOA 1DBQA 4PAQA 3D4BA 1XCMA 4TWRA 3F6YA 3O1LA 3DNMA 2P5YA 1RQGA 2P3SA 5BN4B 3RTAA 4D0SA 4PCLA 4PLFA 2IX9A 4Z4QA 5FNVB 3A05A 4F85A 3G13A 2YJ5A 4C3VA 3ISVA 4HZGA 1TADA 1W5EA 2QE7A 2X23A 3O4FA 3E3AA 3UJHA 4Q3NA 3VXKA 4RKYA 2IYRA 3UH0A 1WF3A 4CKWB 1W96A 2XUOA 1XGKA 3V4RA 3U4MA 1FEZA 3JX9A 1C3OB 1OGIA 4BWFB 1ECPA 1UZAA 4LGMA 3ZE1B 2CUZA 2GLXA 4M7RA 4UMVA 2YN4A 4QLOA 5LXTF 4DE5A 2IHNA 1VMEA 3X1ZA 3Q12A 1OFUX 1H05A 1WCXA 3R41A 4W8OA 3VR6D 1SKAA 4BB5A 1N9GB 4DYHA 1YKSA 1D4AA 3I9OA 1NY5A 3T95A 1P9RA 1QKKA 1UP6A 5J4HA 1T4CA 1I32A 3K31A 4ZU6X 1E3LA 5AQ1A 4E13A 2D1YA 3JQFA 3O47A 4WBNB 3CA8A 5FPTA 2QP4A 4PLVA 3HFRA 2OG1A 1QV9A 2DBZA 2Q5OA 5AM1A 3V7WA 2IY8A 4DUGD 4E46A 4TKVA 5KEIA 1K3FA 3UBMA 1ZJ6A 3JWEA 2IKQA 3ON5A 3FGOA 2P2ZA 2WUEA 2X5XA 1NUUA 2IJGX 4M3NA 4MUXA 3SM9A 2Y66A 2ZJZA 4ZVTA 4KQXA 2C61A 1IH8A 4GP9A 2UUPA 4IUDS 5FBVB 3GO4A 1FDRA 3L02A 3OQIA 4BQSA 2DHDA 2P69A 1P6UA 5I5GA 1WXWA 3FCUB 5L7YA 2CZGA 2G7MC 1U2DC 4K1XA 1YCDA 2QKYA 4C01A 3ICEA 1RYEA 3CO5A 3PP8A 4GE0A 3V8PA 1COWD 4OHBA 2BI4A 3OIFA 5E7MA 4YR9A 2FWJA 5GPBA 1KY4A 2LWIA 1L8AA 4L0DA 5JAPA 2Q5CA 4PGHA 5JMTA 4LGCA 2XNJA 4L4SA 4K0KB 5DK4A 4QOEA 3AVUA 2G5CA 4GWLA 1J70A 1UKZA 2IPNA 2J3IA 5K3BA 2P2CA 2V3VA 3IO5A 3K5IA 4BECA 1XYVA 4GPBA 2QR2A 1FSPA 3GRPA 1W7AA 1T2EA 4QNNA 1BFDA 1SU7A 2F59A 4FFOA 4X91A 4Q7QA 1II8B 4R0VA 2CXTA 2H17A 4HNSA 5DHQA 3QJ5A 3A1EA 2WYUA 2Q3JA 3Q9LA 3QA3E 3IKMB 3LE8A 4KNWA 3BIOA 3PPWA 4ARZB 4CNQA 5F5XA 3FHLA 1JR2A 4LRXA 3UK6A 1O03A 3NTXA 4OAQA 4Q7EA 4X6UA 5K0JA 4CDGA 1BJRE 1XU7A 1T5SA 2OQRA 1KRHA 1X7WA 1IPFA 1CR0A 1RVV1 3SR3A 3DFIA 3OQNA 1T43A 1DQSA 5B1DA 1S2NA 1NGSA 1Q84A 2N1MA 3C3JA 3H5TA 3KT0A 1EGVB 1H6CA 2HF7A 3OQBA 4I46A 5JLJA 2UZ1A 4NBWA 4MW1A 1A9TA 1VL6A 1IZ8A 2A57A 4QRDA 4UAVA 2W42A 3BAFA 2DT5A 1MR3F 1U7XA 2R86A 4AM8A 2IYTA 3EVCA 4O33A 2LKCA 2MSNA 4WZAA 4BZQA 3F3MA 3JALB 5H16A 3C39A 1HSOA 3D8TA 3VR3D 4TZ0A 1JNXX 3A9CA 3OEHD 4P08A 3TLXA 3D1JA 2ILVA 1GPDG 1YAJA 2R60A 5C5IA 4QUKA 3DJYA 4MULA 5HBRA 2B0CA 3W04A 5TEVA 3QOYA 3D8RA 1IJFA 3GT4A 4ZCIA 1I01A 1OZAA 1SOMA 2JAUA 2Q9BA 3L04A 3SICE 2HQBA 1WPXA 4C0KA 1Y1SA 3N7TA 1IATA 2PXXA 4O1IA 4UEWA 3CEJA 3KZKA 3K0BA 4ABYA 1SH7A 4WEOA 1WMAA 2HV9A 4PLYA 2KMLA 5EHZA 1CXZA 1ST3A 2M6KA 3EIEA 3GARA 4JV5B 1JG6A 5H8WA 2O5EA 1UFOA 5HMMA 1IY1A 4HHEA 4QPNA 3ADCA 1JLKA 2O07A 1XZFA 3OX4A 1VE6A 2XUKA 4RZSA 4N5LA 4HQOA 2R4TA 4JUCA 4X5OA 4L74A 2WU3A 1RTTA 3AZQA 5HQ3B 3BC1A 4YH1A 2BM8A 1C2TA 3QXHA 3D1LA 4HDKA 3W4IA 3AWIA 4IDGA 5EJ6A 3FYTA 1WG8A 1A04A 1NSTA 2AVDA 2V7TA 4N18A 3TTXA 5FPQA 4CI0B 3ZDDA 1GDHA 2VK4A 1I9GA 4XE5A 5B7QA 1HE3A 5HX7A 1ANKA 3CPEA 2FPPA 5EJ9A 4CIYA 3COPA 5JNWA 2FSHA 2O2ZA 2X1HA 3K0SA 1G7RA 3OFVA 4OHZA 2Y0PA 4B3DA 2BBTA 1DHRA 2XMDA 3EDMA 3WLEA 3I1FA 3M5PA 4MQ6A 2FUG1 2QUJA 1PEKE 2PM8A 1IQRA 2VWQA 1E7SA 1I3OA 2V7QD 4YP1A 3SIXA 2WWHA 4L8VA 1R5OA 1EFTA 1EPUA 3PCTA 4BMDA 3E5HA 5LA6F 3RTCA 4OL0A 1NZFA 4LHWA 3EULA 2CZCA 2AG5A 1THZA 5EY5B 7REQB 1SXPA 5KTRA 1X87A 2A5DA 1Z6YA 4I5GA 2PWBA 4EFDA 2R4QA 1DHTA 1M76A 1PQ4A 3KRTA 1M0EA 1VCOA 5A02A 4QYTA 1DRKA 3ZXSA 3IMKA 4JT2A 1H66A 1K97A 3EZGA 3O1JC 1KK0A 1UC5B 5FUMA 3LRPA 4F8EA 2CBGA 4N5NA 2FF7A 3WBBA 2G77B 1IHUA 2I33A 1C8KA 3BSFA 2PNJA 2Q99A 4EG0A 2XAAA 3TLKA 4IDCA 4RVCA 5D00A 2JGIA 2X8JA 4D41A 5F3WB 4D8UA 4KRFA 4HDAA 2O8FB 4C4SA 2YHSA 1NFQA 1Z75A 3L8MA 2JNWA 3WK8A 1Q7CA 4NCJA 1H23A 4CM4A 1HH4A 5IAGA 4I19A 2RHGB 3RDPA 5E3IA 3DBLA 3TRHA 1J0CA 3R3XA 1UFKA 4EA6A 4GS5A 2F3TA 4DLBA 2FQ1A 2FN3A 5HKOA 3TGPA 1ZR2A 2FSFA 3G88A 1E0JA 4ETIA 1PS9A 4DIFA 1PK9A 2XJ4A 4PHFA 2REQB 2BEWB 4BFXA 2BOVA 2PXHA 5E9AA 1P2BA 1LZLA 3ZGXA 1T2FA 2ZDQA 5TLSA 5DB4A 1T0IA 4ZVVA 2HK9A 2Y1OA 3EZYA 2C98A 1A4IA 1V7PC 1G6HA 3BGOS 2L42A 1CNEA 3WYDA 1G8GA 1L5WA 1Y9EA 2EJUA 2CCGA 2HHCA 3MLBA 2KW5A 1U5CA 4TVBA 2YWDA 1YBVA 3CX6A 3EARA 5D3ZA 5DEIA 5J4VA 1MB4A 2RH4A 3OKAA 1WMDA 4YRTA 3RT7A 2VYNA 1KDYA 5LVAA 5EJ7A 2PSEA 2FPXA 2NZWA 3IV7A 1XHLA 4JHXA 1RHRA 3SLKA 4UJ5A 4E22A 4O59O 1EFRA 2GHTA 3HYNA 4G37A 3HJTA 5EMJA 4M4SA 4OXKA 5AUQA 3U49A 1OH6A 3AUFA 3JQBC 1EVKA 4CLRA 3IFSA 4HLUA 5LDGA 1ZVVA 1KNXA 3LF2A 1O9GA 2CHGA 4OI1A 3DVQX 2G9NA 3FDFA 1E5XA 1E3SA 4TTRA 2JGJA 3LWBA 3TVDA 2GFIA 1VBNA 1DVRA 3UBTA 3KOMA 3RC9A 4E4TA 4N3AA 1Z36A 1C3EA 2P2SA 4B6GA 1EJ0A 1JT9A 5ABPA 2V4ZA 4X20B 5CX1B 1ZMTA 1YZVA 4ZU3A 4AS3A 1OFUA 2EX0A 2Z30A 2IY9A 4GKAA 1YQQA 1MQSA 3OT1B 3H3FA 1QIFA 3REFA 1VIVA 2QBYB 4IHAA 1PWZA 1V4NA 2FZWA 3NALA 3ZK7A 1C7EA 1MB3A 1YDGA 2I55A 5F73A 4PC7A 3TO5A 2ZCJA 3U09A 4L07A 3HDYA 1HQDA 3MWDB 1ZY2A 3VRHA 2M2IA 2TMYA 5IZ4A 2JLSA 3JD4A 2HNBA 2YS6A 5FWAA 3AEYA 4N8EA 3M6FA 1GDDA 1QRDA 1Z7GA 1Z5ZA 3T0GA 2CVPA 2EJVA 2CXUA 1HYBA 1K75A 1EX7A 1OILA 1WHTB 2NQ8A 2PVSA 3O3NB 4KQIA 4O5AA 1TMKA 5HMLA 3R7LA 1NTRA 3IULA 1VE3A 5SYMA 1U7HA 1UEIA 3FZEA 5TDHA 3DE5X 4B8WA 2COEA 2IL1A 3BTSA 4IDFA 3S2IA 4DPLA 3PFNA 4FE7A 1CE8A 4OI4A 1BXZA 2AF3C 4K05A 4EGAA 3E1GA 1IB0A 2D2FA 4YO8A 5BUQA 1KI2A 2XT6A 3LCMA 2I2XB 5P8WA 3WICA 1S7CA 3GGJA 4DCPA 4ATNA 4U5QA 3MQ4A 3A8TA 3NIBA 2RMKA 3EOAI 2NT4A 2PSDA 2O50A 4KGVA 5FQOA 5JAUA 2C00A 3HUFA 5K99A 4WOKA 1L1RA 3AHCA 3MWEA 3CS3A 3NHKA 4FJ1A 4I5IA 4LDAA 2O6LA 1HE8B 1I80A 4OFBA 1GNQA 4WIAA 3OZ7A 1PT6A 3A32A 3SJ7A 4BBJA 4F71A 3OEHA 3E70C 1NPDA 1HT2E 1A7JA 1JR3D 3OOSA 2A58A 4A2QA 3R0QA 4LXUA 1GPKA 4F9EA 2OD9A 1A5AB 2D62A 4QDUA 1PQWA 1XRRA 3N8GA 1ZH4A 1E1YA 1RYMA 1ZM9A 4FFWA 4P3PA 4QQ8A 5CTAA 4WESA 1QR2A 1AKUA 4QTYA 3DM5A 3OX3A 5K3CA 3ZLUA 5GMOA 3BTUA 2F8TA 2NUPA 1Q14A 3VZCA 1E6CA 1R16A 1XP8A 2B30A 2H2WA 3OJCA 1XEAA 4JLUA 1IJBA 1RLUA 1LX7A 5DU2A 1G20E 2O52A 4RL4A 3T4XA 2KM1A 1KBOA 2PGAA 3WLTA 4NCHA 2XWPA 4MW6A 1X1DA 1HT0A 1O2DA 1CQIB 1ARZA 3QFCA 3DE2X 3GFQA 5FL7A 1CQJB 4ACBA 1UXOA 4RPCA 1DKRA 1O96B 1DUSA 1E1RD 1FX0A 2VQSA 2ZRMA 3O8DA 2O2HA 4BMPB 4JKIA 1WMSA 3MPUA 3PL5A 1KDOA 4L4ZA 4ZYVA 5LZ2A 4DKXA 2J6CA 2YXBA 1Z4QA 2X7HA 3MGGA 3KFXA 3KM0A 3MWJA 3QMMA 1BVHA 1Z88A 1TLFA 1VG9B 2AD5A 2KS6A 2IW3A 2Q27A 4GWKA 4WKCA 5J2UF 2MR6A 2R11A 3GCXA 1FFSA 1MVOA 1XBTA 4WZBB 4LJSA 4YP0A 5KJFA 4RD4A 1Z9BA 3EXHB 3BFPA 3QM1A 4L9SA 1YVUA 3DB2A 5EERA 3PQ4A 3RTEA 4BWGA 1SQ0A 2QR5A 3GRVA 4JMPA 1XLWA 3ETLA 1TQDA 3L2OB 1VBMA 3R0ZA 3UWDA 1FIUA 4XX0B 4TQ9A 1S1CA 2BFBA 3NYQA 2W6QA 4J0HA 2J0SA 2P3QA 1H69A 4H6XA 2JGKA 2ZQZA 4H4EA 1Z0JA 4L73A 4DQVA 1AGXA 1HFKA 2FEKA 2B94A 4KPGA 3DB1A 2IHUA 5LLSA 3AY0A 2ZDGA 3VH1A 4UBLA 4MMZB 2I3DA 5EXXA 1Z22A 4B34A 4LOHA 2I78A 1SKYB 4CF3A 1RRMA 1FTSA 4G1UC 1DZ3A 2X0DA 3SM3A 3H5VA 2V45A 4MYCA 4ERXA 1QP8A 3A14A 1OZFA 1SD2A 4INOA 1XA4A 3LUBA 3MTAA 1NJFA 1Y3IA 1IM8A 1YVDA 1ZUHA 2ZIAA 4WDRA 5DWDA 1LDNA 4GZ3A 5CT4A 3RUDA 2YV4A 3QEBZ 4KU4A 4IZHA 3EVBA 1V3QE 3MWYW 4L76A 4LQCA 5WRFA 2CHFA 5LOVA 1FF9A 1LLQA 3KOZA 1GZ3A 1I33A 1DBVO 4QASA 3B9RA 5TQ2B 3BYZA 1PEYA 1NNSA 2R44A 2P0EA 4MW4A 4QG7A 1GRNA 1UL1X 3ETGA 4YRBA 1G21B 1JQLB 4HGRA 2BCJQ 3HN6A 3Q7EA 4KO1S 1OGJA 5C31A 1NMZA 3SR4A 1SG0A 3DEZA 5CRIA 4DYVA 1G38A 4IDOA 2WFLB 1YRWA 1EESA 1QLHA 2RGWA 4LVOA 4DLYA 4WCVA 2BPOA 1E8MA 4C7KA 1VGVA 1XA0A 4YJFA 3RV4A 6GPBA 1KP9A 2XQKA 4ZC1A 2WINI 4F84A 4IIDA 5BQOA 3WQQA 5FORA 5EIXA 3QWIA 5JRZA 2IP2A 5JH7F 3ZEIA 1NFRA 3IAM6 2WLSA 1ZD4A 4MR9B 3VQTA 4DPMA 2B8JA 5LD2B 3QU9A 1HFJA 3S7TA 1W88A 1GR0A 2VPZA 4BP3A 1I6WA 2YIVX 4C7BA 3FFTA 3FSGD 3QVGA 5H81A 3I52A 3B5JA 4L3VA 5IT4A 3KZVA 1U2QA 4MCAA 3UN1A 2C94A 4BV2A 4DGQA 3IE0A 4LWPA 6LDHA 3U44A 5LZ5A 3UJ7A 2JCYA 2DR2A 4RIFA 4TKUA 5A04A 4ZDJA 1SWWA 2J3EA 5C46F 5ER9A 2WAXA 4BUJA 2QZPA 3BRWD 2NZXA 5JS2A 1NXPA 4KIUA 1T0PA 5FBLB 4EY7A 2FPKA 2I2BA 1G6Q1 4YAGA 5C7LO 4H31A 4UAGA 3TXXA 3OMXA 1HEUA 3FNIA 1X14A 4FHGA 4J7CA 5GVRA 1JJIA 4HP8A 1NF8A 2F67A 3DQZA 5K6TA 3JD3A 5IRCD 3FLAA