5ENDA

Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg)(q152a) from vibrio cholerae
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
244
structure length
228
Chain Sequence
QFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGAANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase FabG
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
molecule tags Oxidoreductase
total genus 79
structure length 228
sequence length 244
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5endA00
1TT5B 2JL1A 1B8PA 4PG4A 2YDXA 4CM5A 4LCJA 3W4KA 5JNLA 5H82A 3ASVA 2VYVA 2X9GA 2HK9A 1U3WA 2JAPA 3OECA 3P7MA 1C0PA 2FN7A 3KYDA 2FP4A 3T7CA 1GV1A 5HS4A 4QEDA 4HWKA 1FDWA 1X1EA 3G17A 1DAOA 4IJUA 1TI7A 1GTMA 3KLPX 3FN4A 4MKRA 3V2GA 3AOEC 1P77A 2PKQO 2GO1A 4KUGA 1IPFA 3BTVA 4BB5A 2B5VA 4II2A 2A35A 1Y5MA 1E6WA 4B7UA 1ZCJA 3EZYA 4KQWA 3SC4A 1YS4A 3LT0A 2PKQP 4MVJM 3GNQA 1FXSA 3D4NA 5IDYA 2JFFA 1GY8A 1XR3A 2NUAA 2EG9A 5GZ1A 4OH1A 4YAIA 4JP2A 1Z45A 4IXTA 3JQBA 4M54A 4YR9A 4PGFA 3RKUA 4AJ2A 4ND1A 5U4QA 4J1QA 4Q3CA 2EP5A 3PDJA 4M89A 4WLEA 2AQHA 3BYZA 1JKFA 4RZHA 4AJNA 3LU1A 3CINA 4HADA 3SVTA 1E3LA 2HRBA 4C7KA 3ZCXA 4RF4A 1L7DA 1NQ5A 3RUEA 1K3TA 1I33A 2C59A 4NBVA 3S55A 2PD6A 3H5RA 3W8FA 1NHWA 2Z1MA 1NAHA 3WIEA 1F06A 3EY4A 3GVPA 3HUDA 4RVHA 1J6UA 4BNXA 3DXFA 4MVJE 5DCYA 1NWHA 5ADHA 4MVJF 4BKRA 2B5WA 3RQSA 1JAYA 1GFSA 2X0JA 5B4TA 2GLXA 1F14A 2Q46A 3KYBA 3NRCA 1KEUA 3U49A 2HQ1A 1WMBA 4RJTA 4A73A 4DPLA 4DREA 3AW9A 1JLLA 4L4XA 4AG3A 5DDIP 4GAEA 2J3JA 2UVDA 1PS0A 2ZTUA 2IXAA 4UUMA 2W98A 3A06A 2B4RO 3UAGA 3GHYA 7ADHA 4UVIA 3H2ZA 1ENZA 4OKIA 3WG9A 1H94A 5JPIA 1EDOA 4BOYA 1ARZA 3AU8A 1U2DA 3BMQA 5F3RA 1Y6JA 4P4LA 4E2ZA 4EUFA 1HDGO 2BFOA 1E77A 1PGPA 3RROA 4G2NA 4NH4A 4GSKA 2VWHA 4N5LA 3B1KA 3UOGA 1PJQA 5CEFA 3JSAA 1R37A 4FBGA 3WFIA 5A04A 4Y6PA 2PA3A 4RPJA 5IDQA 2B0JA 3CH6A 4II3A 1NHGA 4ZJUA 4DYVA 3DZIA 3QWAA 2I3GA 1E7SA 1EFLA 1NASA 3ADPA 1IE3A 3PIDA 2PH3A 1A9YA 3TL3A 3VTFA 4CMHA 4RQTA 5JDIA 2RBEA 1LA2A 3ZHYA 4W9NA 1E7MA 1K6IA 1H9AA 1E6UA 4BNHA 1XELA 3ZWNA 5KJEA 1G1AA 1IUKA 1WZEA 2VZ0A 1Q0LA 5KCZA 4HFJA 1BGVA 4Z9XA 4EEZA 1QG6A 2CF6A 1PU2A 3GG2A 4WCFA 4I8XA 4TZKA 3U9LA 2EGHA 1XKQA 4HFRA 1JVBA 2OO5A 4P38A 5FI3A 3EVNA 4I1IA 5BNFA 3UCXA 4BO4A 3CXRA 3TNLA 4H15A 1AE1A 3AY7A 1GCOA 1H6DA 1CETA 3SLKA 5ITVA 2EXXA 4BO8A 4J7CA 5ICMA 3WNQA 3DHYA 4N18A 5KWEA 4GH5A 3OBBA 4CM7A 4NMHA 3PLRA 3FTPA 4YCAA 2E6UX 3JD0A 3P19A 2WYWA 1JQBA 1Y9EA 3JQ8B 4AJJA 2PKRA 3ROQA 2WDZA 4B7XA 1A71A 1NWCA 2GSDA 4LSMA 4D7AA 2VRCA 3GY0A 1VL6A 2VNSA 3HFGA 1KC1A 1VL0A 4E5NA 3WDSA 5EERA 5CDYA 3OETA 3O03A 1LRKA 1P0CA 1VLLA 4EYEA 4XYBA 1J0XO 4HV4A 3BMCA 1KS9A 3DAFA 3VZPA 1DDOA 5T8KA 4O0LA 5THKA 2VWGA 3DHEA 3T7EA 1I36A 1MG5A 1F17A 3K8ZA 2OORA 2D2IA 5DBIA 4ZU3A 4RPKA 4W6ZA 1QKIA 3AY6A 3WBBA 1ADGA 4RO0A 3ZWCA 5TNXA 1XQ6A 3ZH2A 5DF1A 1XEAA 1VL8A 3MJ4A 4ZRMA 3EUWA 1LXCA 5JAIA 1KEWA 4M49A 2HRZA 3WS7A 4DLAA 2J5KA 3U3XA 5FYDA 3LC2O 4AJKA 1I2BA 3WGGA 4J0FA 4JGBA 3WFJA 4R51A 4AJEA 3WQQA 1B16A 3ZWYA 1B26A 5F5NA 4AJLA 4MVJI 3LLSA 3ST7A 3QVOA 4UEKA 5IAAA 2B4TO 4XQEA 3WBFA 3NGLA 2NNLD 4CMAA 2GR9A 4FCCA 1Q0HA 3GH3A 4RL6A 1NBOA 1VE9A 5AXDA 1I0ZA 4CMJA 5TSDA 1WZIA 4BNIA 1UDBA 2O3TA 4GWGA 1DIGA 4YJFB 3HADA 4U0JA 2RH8A 2YW9A 2ILTA 3DFUA 3C7AA 3K73O 1D1SA 1I10A 3E6AA 1DC4A 4B79A 4JJGA 1EUCA 3UCEA 1GZ4A 3TOXA 1Q7BA 1WDLA 4DLBA 1ZK1A 2JD0A 3D4PA 1PX0A 2Y0CA 1E7RA 2CDBA 4CLXA 1DFGA 1TB4A 1MG0A 3NTQA 3HDJA 1NFFA 3K96A 3R3JA 3DL2A 3INGA 5A9RA 2TMDA 2OXIA 3LC1O 3DZBA 2QZZA 2X1HA 4CV2A 4ZD6A 2HLPA 3F46A 3GGOA 1C0IA 1VKOA 4ND3A 3DOOA 2PY6A 1ZXLA 3MTGA 2AE1A 4TZTA 1H93A 2C07A 1R0KA 1MA0A 4IGEA 5C7LO 3QIVA 3V5NA 1D4FA 4R3NA 3JCZA 4WASA 5HTOA 2AEMA 1A27A 3IAHA 3NDRA 2BFPA 4O59O 1AN9A 1DC6A 3ONEA 1EE9A 3OH8A 4E5KA 2FRDA 4YAEA 4YVFA 3TWOA 4CMEA 3WGOA 1T2DA 1PGQA 1NQAO 1Z7BA 1FF9A 1PGOA 4BUCA 5JLAA 3RBZA 1M75A 4UREA 2VWQA 1LI4A 2IXBA 1RYEA 4CLRB 1I8TA 1ZUD1 3GOHA 3RFXA 2YQ5A 1IOLA 2CY0A 1G0OA 1X0VA 1PWZA 3DOJA 3VKVA 1JN0A 4CQLA 2FR1A 1M66A 1DLJA 2D1YA 5EQFA 2NADA 1D7OA 1U1IA 3FNFA 2JD2A 1DHRA 1B8VA 3KYCA 1HKUA 1EVIA 4IS3A 4MVJG 3AU9A 5F21A 4B4VA 1EVZA 4J0EA 1XWFA 3ZWAA 2PTGA 2PGJA 3MJCA 4HP8A 4WECA 4CMIA 3HN7A 3CMCO 2I65A 2P9GA 3ZNNA 4CL3A 4PFJA 4D43A 5KVVA 5FWNA 1A72A 1DRVA 1E1LA 3CZRA 3MZ0A 4YXFA 1PJ3A 3QVSA 2WE8A 4PLGA 1S6YA 4MDHA 4DXHA 1K0UA 2DPHA 4CM4A 2OBNA 1IZ9A 1XLTA 3O4RA 2JCYA 4GX5A 4FFPA 1V3UA 4NDNE 1P0FA 2X7HA 4BKUA 3I23A 3GPDG 3ITKA 5F5LA 3O8QB 1RM0A 4XCVA 2G5CA 1BSVA 2HK8A 3LF2A 1GUYA 3AI1A 4DTIA 2EKQA 1YJQA 3L07A 3VDQA 1V3TA 2R2GA 5GZ3A 5DBGA 3RUCA 1YBVA 4FSHA 3E5MA 1U7TA 3DBHA 3I9LA 4BO7A 4IDEA 2NTNA 2VOEA 3H9QA 4JXKA 1GD1O 4Q3EA 2X6TA 3UUWA 1MC4A 1CDOA 1LRJA 3DZGA 4IDAA 4XEHA 3WGTA 1XU9A 4IJKA 5CDUA 3GMSA 3E1KA 1ISJA 4R1TA 5JMWA 3MOIA 1DC3A 1LSSA 5IZ4A 4CJXA 2Q2VA 5F1OA 3IQDB 1C1XA 1HE2A 4G81A 2CDCA 1HE4A 3TQHA 1PJ4A 3DWFA 4MVJD 4TRMA 4J4BA 2AG5A 1Q1NA 5I7EA 4YEDA 5JW6A 1R15A 1R4MB 1R0SA 4YYZA 2DLDA 1UJMA 1N2SA 1ULUA 3LT2A 4CLOB 3GPIA 2EP7A 3AI3A 4KUEA 4Y98A 1H9BA 1I3MA 3VVCA 1LUAA 3JQGB 4PZCA 1ADFA 2ZYDA 3ENKA 5L53A 2RHRA 2ZYGA 2DM6A 2NACA 1UXGA 1LQTA 3I9NA 1P1FA 4FFOA 2VT2A 3EYWA 4UUOA 1GZ6A 2NWQA 4QECA 3WX0A 4B8WA 4KP7A 3LDHA 3NT2A 5CHEA 2WMDA 5L51A 5U1PA 4XD2A 1ADCA 1OI7A 4KOAA 2PWZA 1I3NA 1Y8QB 4IDGA 3FNGA 5JXWA 1DAPA 5L7YA 3FPLA 3OIGA 4FJ2A 4Z9YA 4J4TA 3DEYX 3E18A 1E3WB 2O3UA 4CMCA 3JQ6A 4TROA 1V35A 4JROA 1CF2O 3WJ7A 4F6LA 3OJ0A 3L9XA 1ENPA 4HNGA 1ZMOA 5C3MA 5B4VA 2XAAA 5K0ZA 4KTVE 3RCBA 1PTJA 4BKPA 2JCVA 3ZV4A 4RVDA 2E82A 5I9LA 3IS3A 1VJ0A 2PD4A 1ML3A 4RVGA 1OAAA 3L0DA 4KDEA 1NR1A 1DO8A 3WSVA 4BHTA 2JCXA 3WTBA 1KOLA 3C8MA 4E30A 4DIOA 2BKAA 4IJWA 2P5YA 1T4DA 3OA2A 4LISA 4CQMA 1E1KA 3HZZA 4DLLA 5DN9A 2EV9A 5JMPA 2WE7A 3INTA 1HEUA 1LBEA 4GKBA 4LMPA 2D8AA 3VZRA 1ISMA 4HY3A 3ZNOA 4M87A 2BELA 1DB3A 3JTMA 1I01A 4HNHA 4NJMB 1YOVB 5K6AA 3QRWA 1DOHA 4CUKA 3SEFA 1JWAB 4AJ1A 1YXMA 3QY9A 4LN1A 4BKOA 3E9NA 3GR6A 1T25A 4AJHA 2PLAA 4DBVO 2HCTA 3ZWMA 4YJGA 3UCFA 3ONFA 5JSFA 3IIEA 3FHLA 1EMDA 4FFNA 1WVGA 4I5DA 3RVDA 2Y1CA 3D1LA 2D5CA 2OP1A 2D3TA 3NTOA 1GEEA 1IB6A 1X7DA 1TVEA 2CMDA 2ZCVA 1T26A 3PYXA 1O5IA 4URFA 4YB8A 5EINA 5A5EA 3JV7A 1W4ZA 5TC4A 5HRUA 1H6CA 1W6UA 2IODA 1YQDA 4MIEA 1GQ2A 2B4QA 1A7AA 4Q9NA 4DGSA 1HE5A 4R3WA 2EF1A 2Y1GA 3N7UA 1BTOA 3RUAA 1BVUA 4XKJA 4RZIA 4EEXA 3CZMA 3D3WA 2J8ZA 4JBHA 1QP8A 3L6OO 2IZ0A 1Q0QA 3QV1A 4TKMA 4D44A 4QUKA 5HM8A 1QYCA 4XGKA 2EW2A 1PJTA 3RKRA 2C7VA 4A0SA 2XPCA 3WGZA 3H5NA 1I2CA 3R6DA 2Y0EA 1LDYA 2LDXA 3JQ7B 1V6AA 2PH5A 3AM5A 2D59A 3EC7A 3C7CB 3FWZA 3VZQA 3GNTA 3FTNA 1B14A 3HQ4O 4IDFA 3K6JA 4HX5A 4L9RA 4ZQFA 1NR7A 1QYVA 4ROSA 5TT0A 5A9SA 5B12A 1PZEA 2Y1FA 4PLYA 3Q2KA 1YGYA 3ON5A 5C5IA 3V8BA 4OQYA 1AHHA 3S2IA 1SCUA 2NQTA 3OP4A 4UUNA 2NQ8A 5CPFA 3UVEA 3QVXA 1QYWA 3DBRA 1C1DA 1BW9A 4DIBA 5DNAA 3KRTA 2D5AA 3TN7A 3WGHA 1GV0A 2FHSA 1NQTA 4H3VA 4FGSA 4BNKA 1T4BA 3D5TA 4IXWA 4D79A 3D0OA 3JD2A 4E3ZA 2Z5LA 3GDFA 1WDKA 1YDEA 5JCJA 2P68A 3GK3A 1PSDA 1YE3A 3TJRA 3BMNB 3BA1A 1V9LA 1DRWA 3Q9NA 4BNWA 2P5UA 2ZTVA 3OF2A 1YRLA 1T1RA 1EEHA 1HYEA 1O0SA 1PR3A 5EL0A 3ZHZA 1JA9A 2Q1SA 4E2WA 4JN6B 4RF5A 2VRCD 3WYEA 4BGIA 4CR8A 3PFWO 1O6ZA 3PI7A 5BSGA 2YHUA 4ID9A 4GLOA 4ZA2A 1GYRA 2YQ4A 4BNZA 4CM8A 5COAA 5K9ZA 2ZKLA 4RPGA 4DUPA 3JD1A 1K89A 4NHEA 3CEAA 3GVCA 4WUVA 5L7TA 3CTMA 1KIFA 3TZKA 4D0RA 1KY5A 3KLMX 5HS6A 5G0WA 3AUAA 3JYLA 4D42A 1P1IA 4XB1A 3WYBA 3U4IA 2AQ8A 4U8GA 2IDZA 5L4NA 5TIIA 4ZQBA 3F9IA 2PGLA 2WSBA 3BHJA 4DQUA 1KVTA 4PVDA 3AM4A 2AA3A 3H6KA 3W8DA 4IDDA 2FPPA 1LDMA 2GD1O 1KEPA 2GERA 2HMUA 2YZ7A 4K9DA 4BO2A 4CMKA 1Y8RB 4OOEA 3SXPA 1E92A 4FQ8A 3EAGA 2BHLA 3P2YA 1KBZA 1RM4A 3PIIA 1Q7CA 4IMRA 4PLCA 3WJAA 1XDWA 5ENVA 1E1NA 3H8VA 4E5MA 1AHIA 4WE3A 2DBQA 4BNMA 3G49A 1U2GA 3W6ZA 1RWBA 4QTZA 4WLNA 3DONA 4DPMA 3K2BA 1PGNA 8LDHA 3NT4A 2EHDA 4KTTE 1P1RA 1EDZA 3VOSA 3FR7A 4UVEA 3E8XA 5B37A 3RD5A 4BNGA 4XQ9A 1GEGA 2WD8A 3ZWBA 4IDCA 1UAGA 3I6IA 1I24A 4XJSA 4NPCA 2WD7B 2GZ3A 1R4NA 4RF3A 3ZU5A 1B0AA 4E2YA 4XJTA 2DU8A 2I6TA 3PHIA 1XSEA 2YV3A 4CODB 4EUHA 3IC5A 2OGUA 3BMOB 5CEJA 2BF7A 3GDOA 3GQVA 3ZWXA 5GMOA 5T5QA 2UYYA 3DTYA 3GHHA 2V6MA 1E3WA 5DT9A 1M6WA 1ISIA 2CVOA 2SCUA 3AI2A 4RLHA 3MJVA 2A4KA 1XQ1A 3ZN2A 4PLVA 2NVBA 3DZJA 3JQ9A 4S1VA 4A10A 1LDGA 3WYCA 4UVDA 1NTOA 1B3BA 4LGVA 2I9PA 1C0KA 1QLJA 4CL8A 5A4DA 1M76A 1KYQA 1PIWA 2CZCA 5COBA 2VHXA 4FJ0A 3GUCA 5JC8A 1VC2A 2IYOA 3UFXA 3GC6A 2HKIA 5HWSA 5JY1A 4FR5A 4EGFA 4F6CA 3GNSA 5DCUA 1EFKA 1HZZA 2PFGA 1H5QA 3JQBC 2YHIB 2QIOA 1Y9AA 1A4UA 4IIVA 1HRDA 1CQIA 2VUSA 4U6SA 4U7WA 5EJ2A 3OQBA 5ILOA 1EBFA 2P4HX 2XXJA 4OAQA 3ZWPA 3DAGA 4XRGA 2C0CA 2J3KA 3AJRA 4Q3AA 2ZTLA 3ZWVA 5KJ1A 1YL6A 2C5AA 3C24A 3LT1A 4PG8A 1Y1PA 4NBUA 2BI8A 4XYLA 3WQRA 4KMSA 2PD3A 4YQYA 1NXQA 2C29D 2HK7A 4MKZA 5A9TA 3WGYA 3S8MA 1VKNA 1O94A 3LT4A 3S2GA 3TZCA 3DFZA 1R66A 5KVQA 1HYHA 2Q1TA 5L4SA 4WLOA 5L4LA 1BRMA 5CEEA 4PZEA 4HBGA 4WK6A 2J6IA 4IZIA 5EESA 3QWIA 2AW5A 3G1TA 4R01A 4J2OA 3F1LA 3KOUA 4KZPA 4LK3A 1NNUA 2NTJA 4R4JA 2G0TA 3NDIA 5ER6A 5L9AA 3GN1A 2IE0A 3WLFA 4IUYA 4RQUA 1GDHA 1GL3A 1WW8A 4NU6A 2O2SA 5ES3A 3WR5A 3NDJA 2BGMA 3WTCA 5C37A 4ZQHA 4PCVA 1DRUA 4OHUA 4BL5A 1PZFA 1N1EA 2VHWA 4BNTA 4GX0A 3MTJA 2EERA 2Q2QA 3FF4A 5FI5A 5G4KA 4YAGA 1J5PA 3CUKA 4E21A 2WYUA 4OOFA 1FJHA 1Q7GA 1E0DA 5JDIC 3ZW8A 4BQPA 3LVFO 3KVOA 2GZ2A 1UXJA 3Q2IA 4W9NC 4IJVA 4Z9FA 4E32A 3OFSA 4ILKA 3ZHXA 3GLQA 1X14A 1MB4A 2ZATA 5AXCA 2BFAA 5AXBA 4AFNA 4JP3A 1FDSA 2XXBA 3LC7O 3JQAB 4J3FA 2NVUB 4YAKA 4WCFC 2C54A 5I7FA 3ZZNA 4YACA 3PQDA 1HYGA 2DC1A 2VHZA 1ZW1A 2PZMA 3JYQA 2O3SA 4UULA 1ULSA 5JE8A 4YT4A 1E3EA 2GN8A 2EKPA 3C85A 3PWZA 3EHEA 3R3SA 3C1TA 4WNCA 1U5CA 1Z73A 3NX4A 2XF8A 4YJHA 1XHLA 3K9QO 1PWXA 3GA0A 1GUFA 2W90A 1PJSA 2OBYA 1N9GB 3VTZA 3G0OA 1VI2A 4QT0A 3KSUA 5HBRA 5BT9A 5JC1A 1U7HA 5MGBA 4IINA 4QO8A 1P1JA 4GMFA 4N5NA 4FFMA 3JQAD 1DIHA 1M6HA 4BO1A 1P74A 3MWDB 1SEPA 4XX0A 2Q2WA 4IQGA 3V1TC 1R6DA 4EITA 3DBLB 3H4VA 1WWKA 5T8KC 1TT5A 1BVRA 3ETGA 4FS3A 4ALKA 1IULA 5ITWA 1MGOA 1ZNQO 2GN4A 3GRKA 5CDTA 1M2WA 2C2XA 3QJ5A 1IPEA 3JQCA 2FZWA 4MJLA 3VH1A 2GNAA 2QX7A 4KDFA 2QRLA 3RC7A 1D3AA 2LDBA 1UXKA 3OJOA 2W2KB 2P9CA 3AY3A 3TFQA 1LRLA 3GRPA 4W7HA 4A26A 2DBRA 1SC6A 1SOVA 4IIUA 1ORRA 2Y99A 3GAZA 3EK2A 2RH4A 3JYPA 2CD9A 3NAQA 4HUJA 3GGPA 4PIVA 3IJPA 3MJEA 4TVOA 3NJ4A 2FPIA 3WB9A 4IQ0A 1YWGO 3D64A 1KERA 1LDBA 1H6AA 2QQ5A 1SPXA 3JQFA 3UF0A 1PQUA 1CEQA 2PGDA 4JNKA 3Q0EA 4NG5A 3DOCA 1F0YA 3BTUA 6LDHA 1KVQA 4CQMD 1BG6A 2QYSA 3GMDA 3PTZA 4R1NA 4ZQGA 4WCDA 5DZSA 4PRLA 1Y7TA 2G82A 1TT7A 1A4IA 2BRUA 1VRWA 4O6VA 3OEWA 3GVXA 4NU5A 3ZGYA 4FOOA 4GX2A 4GX1A 2VT3A 4QO7A 4R9RA 2Y93A 1BXGB 4XQCA 4CUJA 1P1KA 1MV8A 1WNTA 2JHGA 2Q99A 4TMFA 3LLVA 5AXAA 1LLCA 1ENYA 1ZEMA 2HSDA 4INAA 4FIZA 2P91A 4P8RA 3ANLA 4CM9D 4WGGA 3KO8A 3B6ZA 1QORA 4RDIA 3RC9A 3EGOA 1JWBB 1H0KA 5G4LA 1T2FA 1T1SA 3GZNB 3I9MA 5TS3A 2FZEA 1WDMA 1DIRA 4WOKA 4MP3A 4FOSA 2HMVA 2O23A 1UXIA 1HT0A 4ESOA 3MEQA 5FFFA 4NFYA 1T2CA 5IF3A 5IDWA 3E48A 4FDAA 4XGNA 1LC0A 4FB5A 4WEOA 5U9CA 4J1SA 3HSKA 4CMEC 1TXGA 4R69A 1ENOA 2IZZA 3PYLA 1SEVA 3AUUA 1YB4A 3BHIA 4R41A 5DOVA 3OJFA 5DCWA 1ZK3A 3VH3A 4JQCA 3WQSB 4UVGA 3P2OA 2O3JA 4A5OA 4A7PA 5A3VA 4XDZA 2GGSA 3HN2A 1ZO8A 4ZN6A 1PJ2A 3PWSA 4CMGA 1V0JA 4NI5A 2FSVA 3KB6A 1UH5A 3PHGA 3RC1A 3KXDA 3ICPA 4MOWA 3H9JA 4P22A 3PHHA 2Y1EA 1WMAA 4JJFA 4XRRA 3A1NA 2BH9A 3OICA 3DC2A 3RUIA 3W4JA 1P33A 2QYTA 4K6FA 5KJCA 3KSZO 3JD3A 1I3KA 4NK4A 1BXZA 2ZK7A 5THQA 1U8FO 2EW8A 3FBTA 3HDYA 3X2EA 1OC2A 2JAHA 1MC5A 1PJBA 1FDUA 1UZNA 1FDVA 1E6EA 3ICCA 4R9SA 1MFPA 4HXYA 4M86A 4XYGA 3SX2A 2F1KA 2NTVA 4JX8A 4KQXA 1CRWG 4XA8A 1PJLA 1SB9A 3JQDA 2GCGA 2VOJA 3RASA 2FR0A 3Q6IA 1ISFA 1OMOA 2XOXA 3LF1A 3AOGA 1LJ8A 1X7HA 4YTEA 1U4SA 3KYDB 2I66A 3N74A 3JQ8A 1EK6A 4K26A 4U5QA 4L4RA 4Z0HO 5L95A 2WJPA 1T2EA 1LDNA 1QV7A 1VPDA 1NQOA 4E6PA 4F3YA 4X54A 2ZB3A 1O95A 5JO0A 1DEHA 1LSUA 1XU7A 3OJLA 3DQPA 4B4OA 3DAPA 1GU7A 4YPOA 3U5TA 1JU9A 4LVCA 3WIDA 3F1KA 3SLGA 3JYNA 1HETA 1B8UA 5IFLA 5T6BA 3LQFA 5EIOA 3RBVA 5KKCA 3WGIA 3TL2A 1GUZA 3I4FA 3AUSA 1NVGA 4IZHA 2VYVD 4S3MA 1GAEO 1ZZEA 4B3JA 4W7IA 3PZRA 2FMUA 2I67A 2OFPA 4GMGA 1E7QA 2Y67A 3V2HA 1ZXBA 4B3IA 1DC5A 4YWJA 4DYDA 4UAGA 3RBXA 2YFQA 3I9KA 1NFRA 4JJIA 1B15A 4YBZA 2J5QA 3LK7A 5IN4A 1N5DA 4RVSA 2VTDA 4BNVA 1JVSA 1ZIDA 4H16A 1SO8A 2GDZA 4L73A 2NVWA 2AXQA 2DVMA 1QYDA 1NM5A 1RKXA 2ZJ1A 4M8SA 5JDCA 4YQZA 5KVSA 2AEFA 5JY6A 3H2SA 2HJSA 2EJWA 4Q3DA 4G5HA 2NM0A 3ZU4A 5EN4A 5ICSA 1VJTA 3IDSA 4N54A 1QRRA 5LC1A 4Y6SA 3GZ4A 4GGPA 4XIJA 3SJ7A 1TLTA 1ZK4A 2V6GA 4MIYA 3WLEA 2JHFA 1X7GA 2JJYA 1QXSA 4YJFA 2X0RA 2PZKA 2X86A 3M2PA 3NT5A 3QVTA 4LSWA 3ZNQA 3SJUA 3PFFA 4B7CA 2NU7A 4DRYA 1UR5A 3BMQB 4DWVA 2PK3A 1B7GO 3A28A 3PJFA 3ROPA 3A9WA 3OSUA 3CMMA 3H9GA 2V6FA 4I9UA 3OQ1A 3E5RA 4Q3BA 1ISHA 3ZV3A 5BQFA 3BIOA 9LDBA 1U3UA 5TF4A 1J49A 5KIAA 1A9ZA 2AQKA 3IP1A 1Z82A 3KEQA 3UN1A 1U3VA 4CLEA 1OC4A 3PQEA 2C82A 1HXHA 4KWIA 4O1MA 1PL6A 4GBJA 1L1FA 4Z0TA 1PS9A 4CMBA 3FWNA 2X0IA 2UV8A 1K2WA 3F5SA 3PGXA 1M67A 2QHXA 1YO6A 2YJZA 1W73A 3F3SA 1IYZA 4PRKA 4DMLA 3PYMA 3U4HA 1H2BA 4P4NA 1UZMA 1ZEJA 3IMFA 3VPFA 4MVJP 4RLSA 1U5AA 1PEDA 4OXNA 4M1QA 3MJSA 2ZB8A 3OMLA 1I3LA 4OMUA 3RJ5A 3W8EA 3WNVA 4J43A 5JAQA 3QE3A 1UP4A 2ZB4A 4F46A 4WCFB 1UXHA 3GAFA 1XG5A 3EMKA 3DZFA 3VPSA 5LCXA 1YONA 1Q2XA 2W2LA 1P3DA 4CLRA 2Y68A 5KKAA 1GQYA 1IY8A 5MDHA 5K6AC 2R6JA 1ZBQA 2DTDA 3TFOA 3NEPX 1T24A 2WEKA 1X0XA 2BMAA 3DO5A 3E9MA 1GPJA 4LCEA 2CNBA 2BLLA 3KTDA 4AJ4A 3DB2A 1NPTO 3D7LA 1MXHA 1SOWA 3V1YA 2AQIA 4JIGA 3ETDA 3MOGA 1LLQA 4J9VA 1C0LA 1O8CA 2NU6A 4NIMA 3TSCA 2Q1WA 3K5PA 3PHJA 1YBMA 1E5QA 3A4VA 5L3ZA 3NYWA 1OBFO 2DUWA 4OIMA 4BGEA 4BMNA 4TKLA 5FEUA 1DPGA 3BTOA 1W0CA 4NBWA 5G0TA 4E5PA 3G1UA 4E2XA 2B69A 3NKLA 4KUHA 3TRIA 2P9EA 3BMCB 1G0NA 3PWKA 3WGQA 1E7YA 3M2TA 3ZU2A 1I2ZA 1RPNA 2NLOA 3QWFA 2CDAA 1QR6A 1B3RA 1P31A 4OM8A 4IDBA 4YDRA 4FC6A 3FNEA 3GUYA 4K1LA 1MX3A 1YQGA 2UAGA 5F1KA 1Z7EA 3ZI0A 3U09A 1EZ4A 2A94A 3O8QA 1KVUA 2BGKA 3ZWWA 3KBOA 3AOEA 4IPTA 1UP6A 3C7DB 3RWBA 4L0QA 2X5KO 3K31A 4ONEA 3C1OA 3S2FA 3L6DA 3RAJA 5CFZA 1HSOA 2YFHA 1T2AA 1RJWA 4Q3NA 2I99A 1HDCA 2QRKA 2VNAA 1HLDA 2NSDA 2VWPA 4MKXA 1WPQA 4AJPA 1F12A 1LNQA 1RM5A 2E37A 4WEQA 4A27A 2AG8A 2X5JO 3FI9A 1DFHA 4CLDA 5TX7A 3VPXA 1HDOA 4R16A 1WAMA 3ZWOA 1CWUA 5KNLA 2VUTA 4CR6A 1ADBA 1NPDA 3LYLA 1K6JA 4UVHA 3UICA 2CVZA 3HG7A 4NJOA 4CR7A 2O2YA 4DIFA 4TWRA 2Q49A 4DMMA 5IG2A 4JK3A 4E12A 2F00A 4N5MA 2ZYAA 4EDFA 2B35A 3HB4X 1NFQA 2JKVA 4EW6A 3QWBA 1R4MA 1LSOA 1HSZA 1ZKMA 4ZHSA 3KETA 1LX6A 4RF2A 1XCBA 2GF2A 4IS2A 5KVCA 1HLPA 4CLOA 3CIFA 3S2EA 4L4SA 2DT5A 3BTSA 3JQGA 3ZDFA 1KEVA 5G2OA 1D1TA 1L7EA 1BDMA 1DFIA 2WWRA 2Q4EA 4FW8A 4PN3A 2GUGA 4AJIA 2EIHA 4L75A 4FGWA 4CPDA 4ZICA 5TT1A 2FOIA 4GL4A 4PLHA 1MXFA 4BQRA 4BV9A 3KUXA 4FPXA 2G76A 2FR8A 2BFMA 4B8ZA 4YRAA 3GN2A 3PRJA 1Z75A 4PLZA 3W6UA 4BO0A 2VCYA 1Y8QA 1GYPA 3M1AA 1P45A 2DTEA 1UDAA 4K6CA 2B83A 1ONPA 1LQUA 1NPYA 1ONOA 2A92A 3PLNA 3MCVA 1ONNA 3NV9A 3RU9A 3ZHBA 2V6BA 1Z74A 4CV1A 3IJRA 2DTXA 2ZQYA 4NBRA 2EWMA 1NVMB 2VUUA 4NFSA 3VH2A 3WMXA 4TSKA 5A5FA 3ULKA 4L74A 4OL9A 1K5HA 4CQLB 4OYRA 3VVBA 4XZ3A 2YV1A 3ONDA 1U8XX 1JKJA 4Y6RA 3KYCB 3PP8A 3QQPA 4IQ8A 5IDXA 4PVCA 4TRRA 3CPSA 3OHSX 4TRJA 1GYQA 1PR9A 3ASUA 4CMIB 5IXSA 4DL9A 4OKNA 3W4IA 4XIYA 4L8VA 4A2CA 4DC1A 2WTBA 1P9LA 3K92A 2C7GA 1O9BA 3G79A 1UP7A 7MDHA 5BSFA 4P4GA 3GDGA 1DBVO 3PZBA 3KSDO 1HDYA 4NJMA 1YOVA 1YB1A 3ETEA 5L40A 1YDWA 2NV6A 2TMGA 5EMHA 3RUFA 5A3JA 2P2SA 2Q3EA 3OIFA 4CM4B 4Z0PA 3BZUA 4Q39A 1H6BA 3I6QA 3JQ9C 2VYNA 5FF9A 4WPGA 4DPKA 1QV6A 3OIDA 2X8LA 4J7XA 3V1UA 4R54A 4NK5A 4RV9A 3UXYA 1IL0A 3QP9A 3NUGA 4MIOA 1CERA 3DMYA 3STHA 4WKGA 1N1GA 1QSGA 4B3HA 3VAZA 1PS8A 3NJ8A 3PHLA 4PLPA 3HB5X 3GFGA 3WWZA 4RORA 3DBHB 2X22A 1HDXA 2H6EA 3DHNA 3ADOA 3H5AA 1GADO 4ITUA 4OXKA 3ZU3A 2PV7A 3O9ZA 4R5HA 4YT5A 3U4CA 2BGLA 4ALJA 2P4QA 4CV0A 1LLDA 2O48X 3AM3A 4BMVA 4GVXA 2Y05A 2DKNA 2O4CA 3RIHA 4BMSA 3KZVA 2FSSA 3F47A 1MLDA 5DOZA 2BI7A 2VHVA 2GASA 3QSGA 5CG2A 4HFMA 5ENDA 1C1XB 2JD1A 3PK0A 2B37A 3UGKA 1YL7A 3H9EO 3OQ6A 4BNLA 4BIIA 2V65A 4RDHA 1X1TA 4E0BA 1HZJA 5JYDA 4BO9A 4WLUA 3VHRA 4RCVA 3H3FA 4WLFA 4AICA 4I9HA 2Q1UA 3IKTA 2POQX 3JQ7A 5I9NA 2O3QA 2Y1DA 1HDRA 3FRJA 2D4AA 1ZK0A 2DFVA 2ZTMA 4Y9DA 1TA4A 3F4BA 4BNYA 3B1FA 2OMEA 4DQXA 3I83A 2Q4BA 3LSYA 5I7SA 5F1PA 3DBVO 1PGJA 4GLLA 3WWYA 4KWHA 1BWSA 1LEHA 2ET6A 1LDEA 5COQA 5EPOA 4GI2A 1JAXA 2VHYA 4YAJA 4EUEA 1HF3A 1FK8A 3VDRA 2Y1OA 3L4BA 5A06A 3H9UA 4FD3A 3IKVA 4E31A 3O26A 1DJNA 3FCOA 1AXEA 4PG5A 1R12A 1YQXA 1P44A 5B1YA 3FD8A 3GG9A 3RUDA 2Y0DA 4J1TA 4B4UA 3BMNA 4E5YA 1DIBA 2JFGA 3ZV6A 3E82A 4ALMA 3HDQA 5DP2A 2Q45A 1EVYA 4CLHA 5KJ6A 2UUPA 3WSWA 2CUKA 3I5MA 3F5QA 3I4CA 3HNPA 5TJ9A 3OA0A 3FSRA 3F6YA 3NTRA 1FDTA 4WOJA 4FFLA 4EJ6A 1U4OA 1Z6ZA 5CP8A 4QFCA 1J4AA 4AJOA 3DDNA 4J1NA 5GZ6A 3RJ9A 3QWHA 3I52A 1HE3A 1MP0A 1OOEA 4XYMA 3INRA 3L6EA 4IM7A 3ANNA 1AGNA 1KETA 3BXXA 4G65A 5G0VA 2G17A 5IJZA 2E49A 4ALNA 5TRTA 2YYYA 3X2FA 2DPGA 4E33A 3R0IA 5C7IO 1YJ8A 3I9JA 2VQ3A 3DZKA 1KVRA 3QHAA 4UUPA 5IN5A 4C4OA 4CQMB 1SB8A 4MVJH 1OZAA 2EGGA 2C2YA 4QFDA 3VPGA 3JQEA 3RFVA 4C7JA 1EQUA 4JCOA 5JAMA 4J91A 3L4BC 3TZQA 3PPIA 1Y8RA 1PZHA 2GZ1A 3HDHA 3ROKA 1NX6A 2DAPA 3H3JA 5CPBA 4EJMA 4BGUA 3HJAA 4Y67A 5AYVA 1AUPA 3TOZA 3QVWA 4ND4A 4BS9A 1ZK2A 1LTHR 1YB5A 1CQJA 5BNIA 4EZBA 4J49A 1JW9B 4I5FA 1RYDA 4J9UE 3GEMA 1IHYA 2HMTA 4Z6KA 1LC3A 1ID1A 3IOYA 1A7KA 5BSHA 1FMCA 3I3OA 4YJGB 2IRWA 4D0SA 3VH4A 1QMGA 1ZJYA 3D3EA 4LVUA 3EW7A 5AQ1A 3VC7A 2FWMX 1UZLA 1XIVA 3TDKA 4TRNA 5ILGA 6ADHA 3TPCA 2V7PA 3IP3A 1PZGA 2FY8A 1P1HA 4XR9A 2WD7A 4Z3KA 3L77A 1IZ0A 1ZMTA 1DHTA 3WXBA 2IYPA 4XDYA 4FC7A 4FN4A 2ZCUA 4J7UA 3ZW9A 4EJ0A 3HWRA 3VPHA 2WM3A 2H63A 3BMOA 4YJDA 4B4WA 1D8AA 2NU8A 2GPTA 4FJ1A 1GPDG 3MJTA 4CV3A 3CSDA 5CAEA 1H2HA 1E1MA 3I9OA 3UW3A 5IXYA 5T67A 3D3WB 4AL4A 1U9JA 3TF5A 4GVLA 1GQQA 4W4TA 4D46A 3DR3A 3ITDA 3DMTA 2A9FA 2PR2A 2ZIZA 5TJHA 3A14A 4PZDA 2Z1NA 1N92A 4PLTA 1MFZA 1Y81A 1YVEI 1HL3A 2O4UX 3ENNA 2QRJA 4TVBA 1E3SA 4RVFA 4A03A 4E13A 3JQFC 4HKTA 3OJEA 1EUDA 5TLSA 1YKFA 1ZJZA 1KC3A 5A9SB 3GF4A 2YHIA 2E4AA 2R00A 1O89A 3E9QA 1C14A 3PJDA 1W8DA 4I5EA 2QW8A 4O63O 5H81A 4YT2A 3DBRB 4BKQA 1C1DB 2UUOA 2VZ8A 3JD4A 1BW9B 3GVHA 3C3XA 2OUIA 4NNJA 2W2LD 2RCYA 3TZ6A 3CKYA 1YBAA 4OJNA 4D3SA 2C5EA 3NGXA 4MO2A 4CM6A 4RVUA 1XGKA 4JBGA 1HWYA 2DUUA 1YL5A 2I3AA 5CDSA 2VTEA 3OEYA 1MUUA 2DBZA 1ISGA 5I8ZA 2PZLA 4BNJA 4BNFA 1TEHA 3U4DA 3RU7A 1VJ1A 4D41A 3DMTC 1ZH8A 3PDUA 1QLHA 3RSHA 1LU9A 4PG6A 4HFNA 4I9NA 4IMPA 2H1SA 4K28A 2W4QA 4OGWA 4CM8B 4BNUA 3IL2A 2YDYA 2HO5A 4LMRA 1DJQA 3HE3A 4D3FA 1SNYA 2Q50A 4OSOA 2J3IA 3FBGA 3RFTA 5T64A 4U0KA 1E5LA 4J90A 5ER9A 1PL7A 5DBFA 5JBIA 4FFRA 3HFSA 1JTVA 5B4UA 2R00C 4DQVA 3VZSA 4YT8A 5CDGA 5IZCA 5JCJD 1SZJG 2EJVA 2GN6A 3BHMA 4W82A 1GZ3A 2X5OA 2B36A 3G3EA 3L9WA 5JS6A 1OFGA 5JO9A 5TGDA 4NBTA 3B1JA 2YY7A 4DBZA 4MPDA 4E4YA 3Q3CA 4ND2A 3K2EA 2I5PO 5L45A 3B20A 1JDJA 2X9VA 3IUSA 2EKLA 4ZVVA 1LLUA 4GPD1 4YA6A 5AOVA 3RC2A 3COSA 2HUNA 4MP8A 3FPCA 1VM6A 2CSUA 1I30A 2HAEA 4LW8A 3M6IA 3IUPA 3QLJA 3B70A 1U28A 3H65A 4NZ9A 3TZHA 2AHRA 4PG7A 5AVOA 4GGOA 2FPGA 5TQVA 1RM3A 3CE6A 3FR8A 5LDGA 3JQAA 1CJCA 4R1UA 2NVUA 4Z3DA 1NP3A 1XA0A 1XYGA 4YRBA 4IGFA 3PQFA 1DXYA 2O7SA 1IHXA 1PL8A 4I5GA 3ORFA 1R0LA 3VKUA 1SBYA 3BAZA 4DC0A 1R4NB 5I7VA 3N58A 1K6XA 4D45A 1I32A 5IZCC 1AXGA 1CIVA 2DFDA 1N9GA 5KTKA 4XYEA 5JCXA 5I8WA 2BD0A 5BSEA 2QZ9A 2J5RA 1CYDA 3AWDA 3GGGA 4U6QA 4W99A 4F45A 4M55A 3KHUA 2ZB7A 4CM3A 3P5SA 3AFNA 1S7CA 2RIRA 3GT0A 1ZVMA 4WJZA 4GSLA 1EVJA 4XWYA 5DULA 1A5ZA 1KY4A 2E48A 3Q9UA 1ZSNA 1C3VA 1YH3A 1E3IA 2DQ4A 3QW2A 3GEGA 3KEOA 4L76A 3DBLA 3GEDA 4XGIA 4BV8A 1GR0A 2RHCA 1N7GA 1R16A 3O38A 4ND5A 3PVZA 4QXMA 4ALIA 4D3DA 1JKIA 1I5RA 2GYYA 5HA5A 3GFBA 3T4XA 1PJCA 3I1JA 4BVAA 1ZSYA 4WNIA 4CM1A 3F4LA 5KOIA 3PJGA 4JBIA 3WMWA 5JFOA 5A02A 3T4EA 2HMSA 3K30A 2HU2A 2GN9A 2W2KA 2X58A 3LZ6A 4J16A 4R68A 3ANMA 5BNTA 5L7WA 2X0NA 2JFHA 4BO3A 2C20A 1BXKA 2H9IA 2J3HA 2VZ9A 4QX6A 4ZRNA 1NAIA 3SC6A 1UAYA 4PLFA 3EVTA 5JDCC 2CF5A 4N7RA 3WICA 3H7AA 2D0IA 3AK4A 3U62A 3PGJA 4OQZA 1EUZA 4MINA 4O5OA 3U0BA 2HMWA 2HJRA 2O7QA 2W8ZA 4XR4A 1ZSVA 1NYTA 4CM9A 2CFCA 4EI2A 1WXDA 2OHXA 5LDHA 3RI3A 1E7WA 2WYVA 5I9MA 4CUZA 3ABIA 4H7PA 5JAZA 3RUHA 4R5MA 2NU9A 3C1AA 4PLWA 3HHPA 4NQZA 3AFMA 1LSJA 1ZFNA 1V3VA 2ZQZA 3MWEB 4UEJA 2X23A 3UHAA 4J6FA 1F8FA 2G1UA 3UKOA 5EQDA 5KJFA 1GCUA 5GY7A 1HTBA 4RPLA 2VN8A 1BXGA 1N8KA 2QG4A 4R1SA 1NVTA 1DLIA 4J4HA 2PZJA 4I08A 2OP0A 3EDMA 3Q1LA 4UEOA 5CG1A 1KVSA 1VSUA 3PXXA 1HDZA 5JYEA 4LRTB 2VYND 4RPHA 2GRAA 3QA9A 4QSMA 3D4OA 4J2HA 3OM9A 5BR7A 5G4KB 4NFHA 4Y8VA 4YRDA 3UH1A 4BO5A 3GZNA 4DA9A 4GQAA 3FNHA 4TQGA 4IY1A 2DBVO 2RAFA 1UDCA 4OO3A 2IEDA 3R1IA 5A05A 2OL4A 4GKVA 3KV3O 3JYOA 1PQPA 4ZQEA 4LRSB 1PQWA 1UUFA 1SMKA 3KM0A 5DP1A 3ZNPA 4DVJA 4OXYA 1EQ2A 5C7OO 2X4GA 1DIAA 1EE2A 1QYXA 2UDPA 3DZHA 1B2LA 3GVIA 1X15A 2I76A 4NR0A 4OSPA 1BMDA 1EK5A 3DTTA 4ZGWA 2AMFA 4EBFA 2H5LA 2X9NA 2AE2A 2AEJA 3V2UA 4GWKA 2IZ1A 1G6KA 2OOSA 2O3RA 2Z95A 5G0UA 1U3TA 4BO6A 5T57A 4MVJA 4RGBA 2IEBA 4QQRA 3W1VA 1X13A 8ADHA 4YJHB 1N7HA 3D5QA 1DSSG 2VRBA 3PEFA 3ZV5A 1SAYA 2EEZA 3WOHA 2HDHA 4IBOA 3AUTA 1BHSA 3EZLA 1Y5RA 4JLWA 9LDTA 2Y66A 4WLVA 1WP4A 4XQGA 2YUTA 2O50A 4XB2A 5A03A 3L4SO 1BDBA 4BB6A 5A1TA 5J23A 3M1LA 4AVYA 4BGVA 3ROMA 1F8GA 1E3JA 2PNFA 3S1LA 3SBOA 1V8BA 2CVQA 3E03A 1EBUA 3PJEA 3Q11A 2ZJ0A 5H83A 1WLYA 4BNNA 5G0SA 1VSVA 2YV2A 4ALLA 4MP6A 2OZPA
chains in the Genus database with same CATH superfamily
2JH9A 1I2MA 2ZRAA 2QN9A 3A6ZA 3P2KA 3LSTA 4PG4A 1W25A 1WE2A 3W4KA 4W8HA 5JNLA 3C0KA 3L7IA 3EPKA 5F7JA 3DULA 4FFWA 3FYUB 3QVJA 4P35A 4KQ2A 3I04M 3UGJA 1M72A 2X9GA 3H1FA 3LECA 3GRYA 3T3PB 2XYRA 3T6KA 3K0AA 3CVXA 5AM2A 1C0PA 5LUAA 1XWIA 3NHUA 4AF7A 1M5UA 3N75A 1QPZA 1GGEA 2W6ZA 1N2BA 3O91A 3CWQA 1X1EA 5CK4A 1JQDA 1DTWA 3L6RA 3GJZA 1E2IA 1DAHA 3KLPX 4MKRA 3BCSA 2WJWA 3IX7A 1IOVA 2QJFA 3AHGA 2WDPA 4MUBA 3EVBA 3OT1B 4KUGA 3LYHA 4TS3A 2R7KA 2PAFA 2B5VA 3EGDA 4II2A 4R2MA 4ZZ1A 2C8LA 3S1AA 2FFJA 1ZCJA 1XVIA 1N6OA 3ECCA 3KU1A 3SC4A 4FCTA 2P6MA 4LC0A 4RK5A 5A4JA 2AYXA 3K1AB 4CG0A 3MTDA 1DUSA 1YS4A 5C31A 3KFXA 4A0HA 3INNA 3GNQA 1WOMA 3IALA 4RHYA 3UATA 4B35A 4Y3UA 1JR4A 1NDQA 1GY8A 3PCRB 5GZ1A 5LQMA 2VP0A 3LGXA 2PSFA 2VJPA 2CEKA 4IXTA 4JP2A 5K1ZA 3VPBA 4MDFA 3BFXA 2JGAA 1NY5A 3JQBA 3THWB 2G0AA 4HQKA 2GK6A 4LV6A 4AJ2A 4AY6A 2REXB 4RSRA 3IMGA 1A8SA 2JFQA 5SYNA 2QM7A 3SZOA 2C9BA 4FNGA 1JKFA 3EVAA 3L40A 4K6KA 2Q1YA 1PWYE 4XQ0A 4AJNA 4B73A 4ETIA 3CINA 1AF7A 3KUCA 5KPJA 5B2FA 1DG9A 1L7DA 1NQ5A 4RF4A 1K3TA 2C59A 4YAFA 1IJEA 4PNHA 1UPFA 4P80A 2PD6A 4EAQA 3V4PB 3W8FA 3DYVA 2PA0A 1G6HA 1NHWA 1NAHA 2QE7A 1F06A 3S5UA 3WIEA 1PFVA 5LP6B 2R6R1 4LYJA 1OCEA 4BNXA 2PUJA 1YAHA 1RLTA 3AESA 4HGRA 4B43A 1MMFB 2CGEA 4CETA 1NI5A 1SBZA 4M99A 4DNOA 3NHAA 4QU0A 4YV7A 4YRLA 2B5WA 4BKRA 2XGJA 1JAYA 1GFSA 1PBTA 1HTTA 2X0JA 4HAZA 5CX1B 1UOQA 3B9PA 5AVUA 2BSQA 3I0ZA 1CUHA 5AUPB 2HQ1A 3D4LA 1TLLA 3K4HA 3EIFA 3G6KA 3ZYZA 3L4KA 4PC6A 1OIWA 5LYJB 5BQPA 1MN6A 1L7MA 2J3JA 3TM4A 5BN5B 3ZLUA 3A06A 2JLQA 2HWKA 4GC9A 2LUOA 1TO6A 3DOHA 4ZO4A 3H2ZA 3WG9A 1EDOA 1ARZA 2BKLA 2H2WA 2VJMB 3IB3A 4XVHA 3PRYA 3FDZA 2BFOA 4GZ5A 1E77A 4ZEMA 4NH4A 4ARZB 1D2EA 1J7KA 3O4FA 2V5UA 4B6RA 2DH5A 1ZR4A 4RK1A 2XMGA 3UOGA 1PJQA 1MRSA 3HH8A 4FBGA 1BJTA 3F6BX 5IDQA 3PXGA 1AZWA 1U1DA 2B0JA 2OV6A 2PMKA 4TL8A 4Y0VA 3SZUA 5JZBA 2VQEB 1IH8A 3A05A 3QWAA 1V9CA 2X1LA 3K7EA 3R7DA 1NASA 4Q1DA 2ZKIA 1VG0B 2ZR9A 1TJPB 4XIIA 5F2KA 3OTHA 3VTAA 4E7OA 2ID8A 4GMDA 1Y33E 2F3RA 3ZHYA 3SHTA 1K7YA 2H16A 1RAFA 3A3NA 2ORVA 1QHNA 4HK4A 3LC0A 2HYDA 2EKDA 3GT7A 1E6UA 1NVVQ 2AF3C 2DPLA 2V7QA 8GPBA 3ZWNA 2XQKA 1K8QA 2GLUA 4V1CA 4Y2QA 2QRVB 3TEMA 2CKMA 3UK0A 1YA6A 2C92A 4HFJA 4GP9A 3SZGA 5BORA 1QG6A 3GG2A 1PU2A 2O2XA 3CPJB 3PV0A 2JCBA 3MLBA 1ZG3A 1DTEA 2BTQA 4HFRA 3T3MB 1OTHA 1B6RA 2AYYA 5IJXA 3EVNA 4BO4A 3CXRA 4JVSB 2H92A 2OYSA 3SEZA 2GTIA 2AG1A 1VXOA 1CZNA 1RP1A 2C7OA 3MWEA 2XE6A 1U2DC 4PZUA 3X44A 3O74A 4R83A 5ICMA 1NX9A 1RFLA 2IQ5A 4JC4A 4KQJA 4RTKA 3R9WA 1JQKA 2G3YA 4GH5A 3VC2A 4CM7A 2JANA 2VXOA 4NMHA 4DJ5X 3T7JA 1BEUB 1YCGA 4YCAA 5IBCA 2WYWA 1Y9EA 2ZRKA 3EGCA 5IYZB 4P5PA 3ROQA 2V7BA 2WDZA 3T7KA 1A71A 1XN4A 1JPJA 3WGUA 5HKAA 4I36A 4LSMA 3BFPA 5AUQA 1JEYA 5KO2A 4BYGA 3SDBA 4XGRA 3TQFA 3IBSA 4UMDA 5GTDA 2VNSA 1J06A 4YMUA 1KC1A 5LL6P 2F55A 1ODIA 3ER9A 2G5TA 2QVXX 3ECAA 5CDYA 2VHUA 4JLVA 1AGXA 2YZ2A 1V43A 1J0XO 1OI4A 4TLAA 1KS9A 1PAUA 2F9LA 1DDOA 5ALJA 2WY2D 5T8KA 4YMTA 5THKA 2EG5A 3RYFB 2Z2ZA 2B78A 3H9BA 2OORA 4JQZA 4IV8A 3C74A 1FFEA 2FE4A 2EJBA 2EBWA 3DV0A 2B1JA 1QKIA 4MUHA 1XVLA 5G3YA 2YWHA 3QLVA 4OBWA 5DTMA 3UGQA 4RO0A 4C43A 2FQQA 3QNUA 3ZWCA 1XRRA 2QNRA 1WABA 2I6FA 4FWTA 5DF1A 1XEAA 1PK9A 3WB1A 2F9FA 4ZRMA 4UTRA 1W87A 1ES9A 2PXHA 4D9JA 3DF7A 2QG6A 1NMQA 1GUBA 2DP4E 2JBAA 4ZHQF 4JP8A 5FYDA 4HO1X 4WH0A 5LBIA 4AK9A 3LC2O 4BLOA 1I4WA 1E9VA 5JCOC 3KQLA 3SYRA 3L4JA 4J0FA 1P60A 2O7RA 4CKEA 4CCYB 1GNSA 1UPTA 1Y80A 2DHCA 1ZD5A 2FLVA 4KQKA 3VC3A 4D9FA 1PR4A 4QDTA 4AB1A 4XQEA 3LP8A 4CMAA 4ZMSA 3SIXA 2AUTA 3GH3A 3Q3IA 4RL6A 1NBOA 2FJUA 4U02A 3VO9A 5CT4A 3NWJA 3P9KA 2BTOA 3KYIB 3PKZA 3GV0A 2IZ5A 2KJQA 1SD5A 2Q28A 4XPIA 1COZA 4OHWA 3P8ZA 1PFKA 4QUAA 3ZGZA 3GP5A 3ES9A 3WFZA 3HADA 5LLSA 3RVSA 2QD5A 4X7MA 2ILTA 5CXXA 4ZJYA 1NG9A 4P81A 3C7AA 1RWMA 2Z04A 4TTQA 1GPKA 4PO3X 3FM9A 1NG1A 1T4MA 1QPGA 3IP5A 1CDEA 3IVAA 1L5SA 4C0WA 2GPYA 1E1CA 4A82A 4CHGA 1HX7A 2GCIA 2JD0A 3AHFA 2QTVB 4P3OA 4C6HA 1KZ1A 3UMFA 2OHFA 4M0FA 2IQIA 3PA8A 4BUJA 1N2EA 2EIXA 3LO8A 1U7OA 2JFOA 3NTQA 4DRZA 3EWIA 3WGNA 5KQGA 2R8OA 2G72A 1NFFA 4RSMA 3R3JA 3VGJA 4F9GA 3DL2A 4Q4CA 5BSVA 2TMDA 3ZK9A 5FOWA 3UO8B 4DLVA 1XVAA 2ZE6A 2QZZA 3DZBA 3RT7A 3T3EA 5F73A 4QXOA 1W6RA 3SJBA 1WXQA 1ZZGA 4TKUA 1VKOA 4ND3A 2ZJ3A 4DW8A 1K5DA 1T3TA 2A88A 4I1RA 3DD1A 3WWPA 2WVAA 2BW0A 2O0JA 3G5LA 3R77A 1DCFA 1GSHA 1R0KA 1MA0A 3D02A 1KYYA 3D6FA 3K1AA 2PMBA 3PKJA 4IGEA 1RXCA 3VMMA 2VNKA 4DLXA 1WB6A 3LUJA 3E3MA 4HNTA 1PFWA 5HTOA 4UOEA 2AEMA 1A27A 2AVNA 1IN5A 2ZUUA 1QF9A 1QS0A 1TM7E 2AOVA 2JIBA 2XX3A 3G2QA 4QARA 1PSZA 1EE9A 2GM9A 3CLUC 3DJFA 3OH8A 3QELB 3WL7A 2Q2NA 1BYIA 2FRDA 2Y6VA 4YAEA 5AOCA 1L8XA 2P2DA 2WTXA 1T2DA 1PGQA 5IJAA 3TWOA 4AKTA 3OCWA 4LJ7A 3R6TA 3QE4A 5AM4A 5JLAA 1TM3E 3GRVA 2VNIA 3NETA 3G5TA 1X86B 4TV8F 5F98A 4J2TA 3JPYA 2PJUA 1ZL0A 1U9IC 2CFIA 2Q5HA 2FMKA 3C5CA 2O2HA 1FTWA 3MD0A 3Q3VA 4FYMA 4P7FA 3W78A 3WL8A 3HYLA 2ASEA 3WMFA 2CV2A 4DDHA 2YQ5A 2IDKA 1G0OA 1EX7A 1X0VA 4PBSA 1JN0A 4CQLA 4HH0A 2FR1A 3A11A 4M46A 4FFBB 3O2JA 1GILA 4B3MB 2J08A 4Q19A 4R81A 1SCDA 1M1NB 3KYCA 1M0EA 3I3SR 1HKUA 4B4VA 2DCMA 2MIIA 5JNTA 2PWAA 3FIJA 4BQQA 1PZXA 3LXRA 4NF2A 1EVZA 3HKCA 2VPTA 1BXRA 2RGUA 3D7NA 3HKBB 3CN9A 4JB3A 4IDPA 3EEBA 3N2GA 3R3UA 4ZVMA 2I65A 1X92A 4C6TB 3T3IA 2HA2A 3LL4A 2R8XA 1DRVA 3JAWA 1ZI8A 1QRUA 1KNXA 1SBQA 1Q7TA 4DWJA 1E1LA 2OBLA 2GKSA 2X3FA 3C3JA 1GNRA 1OW3B 2INGX 2XUIA 1S2MA 4MV5A 4B4KA 4TT3A 1CZLA 1V6CA 3IFSA 3QVSA 1I7DA 3GUZA 4JY7A 2W7TA 4MDHA 1SC9A 1L0BA 2ANCA 3LH5A 1PP4A 1TOAA 2F3UA 4OFXA 4RY0A 5BVGB 5FLKA 2JCYA 2EJUA 4LDRA 4ARZA 4GX5A 4NDNE 1W0KA 1P0FA 3LYAA 1FNNA 1CIPA 2H59A 3ELWA 1RJ9B 3NORA 5LQRA 3GPDG 2FRXA 2G8LA 1ETHA 1T3GA 5F4ZA 3O8QB 4XCVA 2QDXA 4WDQA 1OXBB 1D2NA 2G5CA 1KJJA 3BWVA 5BV8A 1R5NA 4F9FA 1CE8B 2IFTA 5BOVA 1KJ9A 3LV8A 5AVJA 4PZYA 1Z8NA 3L07A 4FE7A 1V3TA 4U7GA 4EK9A 1DRJA 1KFEB 3ORRA 4I2NA 1RRMA 4N65A 4FSHA 4Y2UA 3IAM1 2WIKA 3ETHA 3DBHA 2XQIA 4JOQA 4JJKA 3VSCA 5B2EA 4IDEA 1QUFA 2ZSDA 3AETA 3EFOB 3CVJA 3TD2A 4KIUA 1M6VB 1ZP6A 4ER5A 3H9QA 1GD1O 1GKYA 2NYUA 1J8FA 4TTTS 1MC4A 1RD4A 3VR3D 3DZGA 4PGHA 2JGMA 5J2UB 4B6PA 1QGZA 4OREX 5AVRA 2O1SA 1PJRA 3H99A 1ISJA 1GNVA 1NNSA 3B2QA 3VOBA 5JMWA 3MOIA 1REQB 4RLFA 2NYVA 4CJXA 4Z53A 3KD3A 5CBPA 5F1OA 1I9CA 4JYCA 1C1XA 3R5XA 4KPUA 5JHHB 1VKRA 3E27A 4DZZA 1HE4A 4Y2XA 1GZ5A 2ES4A 1ZCBA 3AHIA 3GAMA 4H35A 4NZMA 1J2RA 5B36A 2WIAA 2ZRGA 4TRMA 3N5KA 4V24A 2PO5A 1QVAA 2Z43A 4IF6A 1ZYUA 2ZDQA 4HUQA 1R15A 5I9TA 1YJCA 5TQJA 3LBYA 2HJ9A 3WYNA 5ECGC 4W63A 4YJ2A 1Z83A 1SUEA 1ULUA 1JP7A 1E20A 3QHPA 4NEHB 1E89A 1NLZA 3AI3A 3SQXA 3VVCA 1LUAA 1SCIA 1SHTX 1GPBA 2AHOA 3WC4A 4KYIB 2YBDA 3EH2A 4WUTA 2IS6A 1F1JA 4L6CA 5LA6F 3I9NA 3PNYA 3BZWA 1P1FA 3RTDA 4LYEA 3QVLA 1AUXA 2JH8A 2W6CX 3H5TA 1K1EA 1U2TA 3MERA 3GGDA 4DVGA 3KP1A 3QKIA 4KP7A 2B8NA 4DMFA 4LXUA 4M1SA 1UPBA 4LHYA 2XGGA 4INOA 5U1PA 3F8SA 4DLWA 1ADCA 4POAA 1MO6A 2DECA 4WZ6A 1K0FA 4NMWA 3PDIA 5BN4B 1V4VA 5I7OA 4B74A 3VR6A 2AFIE 3AO0B 2Q9BA 4M36A 3FNGA 4NAUA 4BMOB 3NIWA 4C0BA 1NRWA 2WB2A 4FBLA 4KRYA 3Q0IA 2LZ0A 3B9QA 4OHYA 4E08A 1UK7A 4BQEA 4YH1A 2DFNA 4HRAA 1NJSA 5DNEA 1E3WB 1XP8A 4D4JA 4LYDA 3T3OA 1SRRA 5ALKA 1AHNA 2H06A 3JQ6A 5E95A 3RYCB 2XQGA 1NJ8A 1XXHA 1M83A 1P1BA 2I33A 3DMDA 4FXOA 1GFZA 4JROA 1DBSA 4HQLA 5JXJA 1CF2O 3K32A 3IKMB 3IPCA 1BIFA 2P7IA 5JUWA 3LXXA 3L9XA 3HJRA 4CIYA 2G77B 1RWKA 5LMZA 2C2KA 4TLDA 1CIJA 1Q22A 4RACA 3ZV4A 4BU1A 2H17A 1DCKA 5I9LA 1U28C 5D3QA 2XA1A 3IS3A 1T2NA 1VJ0A 4WOBA 1WCV1 4US1R 2PD4A 1F48A 4QRHA 5YASA 3WSVA 5IDVA 5CA1F 1DX9A 1SKQA 2P67A 3QUBA 1KOLA 3IMKA 4E30A 1PYGA 4D4HA 3HPRA 3ABZA 4PAWA 4PC3A 2G5GX 2F8TA 4BNDB 2PG3A 2QRQA 1U5BA 4OHOA 4WKBA 1S4MA 3FYDA 4W9RA 5DN9A 4CIWA 1XAGA 4F2DA 2WE7A 1HEUA 2AMLA 1KYXA 4GKBA 5DJ5A 4MW4A 4J03A 1TAHA 1U2QA 3QA3E 1ISMA 4HY3A 3ZNOA 4HLDA 3A6GA 4N3AA 2PLWA 3SS8A 1YOVB 1BH6A 3QRWA 3SQMA 3UV3A 4WXMA 3SEFA 3PLAE 2OXEA 4CKWA 3PX3A 3QKSA 2XI4A 3BCHA 4P7GA 1N0UA 2GFQA 2FKAA 4KK3A 4WCDA 4IIGA 3DG9A 3SQNA 3VAAA 1GKIA 3JTEA 4WKOA 1CP2A 4JMLA 4JVOA 4NOKA 1UMBA 4MYRA 4PR0A 1KSFX 3V8PA 4PX3A 4EPTA 1BWQA 1L1EA 1PUIA 2XVMA 2CHUA 3L8MA 3ONFA 1EGVB 1XTQA 3IIEA 3UCFA 4BJ3A 5JSFA 4FFNA 1MW8X 2OCXA 1RABA 1MNQA 4F5EA 1N6KA 3QKRA 3EIQA 5A4MS 4GMXA 3D1JA 2IYNA 4FU0A 3WWEA 2VPQA 3NTOA 3R4CA 5KDOA 4MPTA 4WI1A 3U3KA 1UJ4A 1Z25A 4CTMA 1GEEA 1E4YA 3T1HB 1X7DA 3AUKA 1TVEA 2QTLA 3TE7A 4PQEA 1JG3A 3WIVA 1WVIA 2PN1A 4I4TA 4KNWA 1W4ZA 4LJKA 5MHTA 1IZ7A 5AIAA 5HRUA 4DV6B 1H6CA 5E2BA 5KB3A 1RLOA 4MIEA 1NBHA 1RQ2A 1ZOPA 5E9JA 3ZCQA 1NC1A 3GEIA 1T0JB 2R48A 4OHCA 2Q0XA 4ZOLA 5K0CA 4Q66C 4L85A 3RRZA 2QYHA 1BVUA 3OOJA 4XKJA 1M7HA 5F33A 4N39A 1KH1A 3ZDYB 4BN0A 1EFVA 2BGRA 1PYDA 2YRXA 3AERB 3IDZA 1IB0A 4QATA 1Q57A 2F90A 1QP8A 3U4QA 3L6OO 3MIZA 4N3CA 1HO3A 5GADl 3WNBA 1XEXA 4URYR 4O29A 1QYCA 4FX5A 4MUXA 4XGKA 4Q4JA 4ZZ3A 2HEGA 3RKRA 2OQIA 2C7VA 3H2GA 4KAXA 3R6DA 1VHDA 1YIAA 2LDXA 2V7VA 1VDMA 3I1YA 4N3NA 3K1JA 4MW6A 3ISJA 5ELLA 3HVKA 1HC7A 3E84A 4JOCA 2WC1A 4L9RA 4HX5A 5AW0A 2MDTA 3QBVA 1NR7A 5IPFA 4C0XA 3SHQA 2PS3A 2XTJA 1SC1A 1JZTA 4CHTA 1JBKA 4L5AA 4PLYA 3Q2KA 1YGYA 1ZJ5A 3ON5A 3P0EA 4DADA 5C5IA 3T4UA 2P9ZA 2RI0A 1NVEA 3IE0A 4OQYA 1AHHA 3O3MB 4GDMA 1SCUA 2NQTA 5CPFA 3QVXA 2NP6A 4QAQA 3K09A 3QVGA 1BW9A 3SBEA 4DIBA 5CDFE 5DNAA 4JHXA 3WGHA 2QSJA 3BGVA 1NQTA 4MUAA 3EAFA 2ZIEA 1JMKC 1H23A 1ND5A 1T4BA 2PQ6A 1ATZA 3D5TA 3KE8A 1T0BA 3OP1A 3QXHA 5A7HA 4D79A 3HCDA 2FQYA 4K2HA 5JJ5A 4MEAA 1WDKA 5FUBA 5EWLB 4ZI3A 3NRBA 4LJYA 3LWZA 2IOHA 3TJRA 5AHWA 1YACA 3LO5A 5ITZB 1BE1A 4ZFNA 3Q9NA 3KXIA 2ZTVA 4DQDA 4MRNA 2B7LA 2PS9A 2R751 1R0CA 3EJ6A 1HYEA 1PR3A 1YCFA 2QPTA 1B1AA 1MDBA 3BD7A 5DNDA 3AGPA 5DMHA 1KXZA 3JVDA 3FLBA 3JAMA 1Y3CE 2AX3A 2GARA 2EZ8A 3RS8A 4QOIA 4UPVA 3KQNA 3CC8A 1DC7A 3PI7A 4IHJF 3TSZA 4GLOA 1CR4A 4F21A 3B36A 1J0DA 2O07A 3G89A 2RHBA 2GBCA 2YQ4A 1YE8A 3CCCA 1E8NA 2HSGA 3WRYC 4MEBA 1KEZA 5F1YA 1JIKA 1JSXA 2G71A 4HWOA 3ZLTA 5B6PA 5I3CA 1K08A 1JHPA 4NHEA 1SELA 4XM0A 1OLUA 3GVCA 4ASUD 3TZKA 2IV2X 2A57A 1EK2A 4MGEA 2Y3IA 1NI4B 1NT2A 3K16A 1W2WB 2Z5GA 5CGQB 3ABOB 1Q95A 3COZA 3M6WA 2WKRA 3PPWA 5LR6A 3RHTA 4H7KA 1DWUA 4Z54A 1RZVA 1VJ5A 4IV5A 4RMJA 1DKPA 2ZJ2A 4AROA 5IBRA 4TYQA 3QEJA 1J9EA 2A7XA 2G08A 2I4TA 3F49S 3Q12A 1UFQA 3ZJUA 2QL5A 2JLXA 3GJ8A 4Z8XA 4KRGA 5BOSA 1BFKA 2CMGA 1E5XA 3KT8A 3L05A 4JOBA 1FFWA 1LDMA 1Y6QA 4NYMR 5E6UA 3WMRA 3ZXSA 4JVMA 4Q93A 4CMKA 2Y2VA 2ISSD 4HD8A 4P5DA 1Y8RB 1Z6QA 4OOEA 5T3UA 1MF7A 3RR2A 4FQ8A 4YRSA 3O4VA 2HXGA 5BMOA 4MYUA 3WLQA 2EDCA 1VZ3A 3VNBA 1RM4A 3PIIA 3D0RA 5TQ0A 3WJAA 1U0EA 1XDWA 3N05A 4XLZA 2XDQB 5ADUS 2PJDA 3WK4A 4AX8A 2QVLA 1CJVC 3G5AA 3JRNA 4K03A 2JRCA 3LG2A 2PSSA 3B6MA 2VA9A 3C6XA 1U2GA 3CNQS 3O8RA 2RB4A 1ZUHA 4GLJA 4QDZA 2IHNA 3OZUA 4QTZA 4EF6A 2BM1A 3ED5A 5FUYA 4DPMA 2XRFA 1PGNA 2EARA 2Q5LA 3TIGA 2EHDA 4HCJA 2CK3D 3X1DA 4KTTE 4QA9A 2D2FA 1PI3A 3NASA 2XMQA 1ZAKA 5HE9A 4EFNA 1WETA 2G9NA 2OK7A 2FN9A 2MMGA 3RVNA 1KWKA 3QX8A 4JYAB 3HYCA 4BNGA 1GEGA 4URZR 1VJGA 2WD8A 5E7JA 4UAJA 2DX7A 3L7CA 1WMDA 3KJNA 4IWXA 4QYTA 5DIZA 1KAEA 1VTKA 5DNVA 1CTQA 2NUTB 4KZKA 1BMTA 3CURA 4URXR 3WA7A 1RCTE 4RF3A 1IBLB 1JLSA 1KZ6A 5CGZA 2ODWA 2E55A 2DU8A 5IT9A 2I6TA 3PHIA 3O8OA 4CODB 4P84A 1LLFA 4Q9DA 2RK3A 2RE8A 2NZUG 1B6TA 4MV0A 5EHQA 5CLIA 1N5RA 1Y98A 1L5ZA 2UYYA 2XHEA 1ZM4A 1UK6A 1NF2A 2IPAB 3F4KA 3LOPA 4HRYA 1E3WA 4J0IA 2HHAA 4P83A 1I13A 1N2HA 2SCUA 5EE3A 4DSUA 1JDVA 1WBBA 3AI2A 1Y3AA 1A7JA 2XRZA 2A4KA 2CXTA 2VAPA 4R7GA 3DZJA 1IEWA 1SXJA 3AVPA 3EBOA 5ALNA 1LDGA 5FL3A 4NABA 4DB2A 1U8CB 3B8EA 4G8CA 3E9DA 4UVDA 3RLFA 2I9PA 1TD1A 4BTEA 3S28A 3EG9A 4XW2A 2EYUA 4HUTA 2PKXA 1KYQA 2AFVA 2OXRA 4II7A 2F2TA 5COBA 1U9ZA 3SQOA 1J1ZA 2PS0A 3GUCA 2JIQA 4EW3A 5JC8A 3KZKA 3GC6A 1RJGA 1WHTB 1CQPA 2HKIA 1YZQA 3MIIA 4TTVA 5CCEA 4I1SA 4UNPA 1VI5A 5JY1A 1YRHA 2PKCA 1KE1A 3V1LA 3HA2A 3G2NA 5GOZA 2QQ0A 1WTCA 1CZRA 2HV8A 2ZDHA 4TLBA 4A2CA 3HKDA 3D6MA 1DXHA 3GDHA 3AM1A 3D4BA 3RE1A 3H19A 4YXWD 2MSEB 4U7WA 3RWMB 1I4OA 2DB3A 2CVFA 3OQBA 4Y2PA 2FUEA 1O9GA 2G1AA 3WADA 4B6JA 2P4EA 3F78A 3MS2A 4K9SA 4K81B 4HZUB 4LNUA 4M60A 3JPWA 2J3KA 4ZCSA 4HLNA 4EHNA 4Q3AA 1MOSA 2ODNA 1QHSA 4B3SB 1IZYA 1U90A 2QU8A 2PWPA 2C5AA 2QX9A 4JLSA 1H3EA 1NNI1 2APJA 5AI4A 4F4UA 3LPMA 5LU9A 4FYYA 4EG6A 4O25A 4KMSA 4Y9RA 3DC7A 2PD3A 1BKSB 2HY7A 3LJKA 1JHZA 4KIJA 4YQYA 1NXQA 2WTEA 4ZVNA 5AT1A 3ZGLA 1QK5A 4MKZA 3K35A 4BC1A 1C30A 4DCNA 5BWOA 2DXIA 1G5TA 3GRUA 3MRTA 1G38A 1NZDA 3FTDA 2V4ZA 3PR3A 2JI7A 5JS8A 1E2GA 1YMVA 3LA6A 3OPYA 4LHEA 3CO5A 2OMKA 5L4SA 4K6HA 3MYYA 1AQNA 1CD5A 2W6QA 1EAMA 1NVUQ 1UC5B 1YA4A 1BRMA 2L2QA 5GAJA 5CEEA 4HBGA 1ESCA 4WK6A 4EG4A 1JDSA 3K8OE 3QWIA 4RNDB 4U39A 5CA1B 3ZU3A 3F1LA 1C7ZA 2HGZA 1O9HA 4C1NA 4N6GA 1C80A 1UBNA 4AZ3B 1C3LA 3CLTD 3WLFA 4Q00A 2CV1A 4LBYA 1TE2A 3RSOA 1GDHA 1GL3A 4NU6A 2PT5A 3HCWA 4N0DA 4AP5A 3OAAA 3NNDA 3I58A 4GR4A 2Q3BA 1WBDA 4K9MA 2D1SA 3GCXA 3WTCA 3PUVA 2ZT8A 4ZT4A 1ZCZA 4K1XA 1L8LA 3TLXA 4FM9A 2GM4A 2O5CA 5KQRA 3KOZA 2WNHA 1TK3A 4B9EA 4MIKA 1I4DD 4RKEA 3PE6A 4KI7A 1JH8A 3KD2A 3G9QA 2RC5A 4P3YA 3RF6A 4Z7OB 1F2TA 4XCXA 1PZFA 1N1EA 5KKNB 3L92A 1NURA 3MTJA 1HDIA 4OXXA 3NFRA 3U7GA 2AFRA 2Q2QA 1G19A 4YAGA 3WOVA 4B3TB 3CUKA 4U9UA 3JSXA 4X3OA 1GLGA 3PQ8A 1FJHA 1SKAA 5BNWA 3ZW7A 1DUVG 1E0DA 3ZHSA 4BQPA 5DGHA 1P9WA 3KVOA 5C8ZA 1KMIY 4AG6A 5A5GA 1UXJA 3FYHA 4Z9FA 5JSQA 1QCDA 1R5JA 1FZTA 1OAOA 2GK4A 4X20B 4EELA 3TGPA 1JQEA 3FDXA 5A7FA 1KO1A 1SKBA 2VDWA 1AQUA 3CB4A 2BFAA 5KWIA 1DEOA 2MINB 1T2UA 3KKOA 1DBWA 3W79A 2PUCA 5AVSA 4DAEA 4EMUA 5KX5A 1AV7A 1XQYA 2XXBA 2FPKA 3LC7O 4IX9A 4WY8A 1SURA 1GRNA 4ZAYA 2QTAA 4YAKA 5KYXA 1JRLA 5I7FA 3IDFA 3KKEA 2FEMA 5BR1A 3ZTTA 3IBYA 3AFIA 1G8YA 3JASB 3JYQA 1UC4B 5AW3A 4DTCA 5KMGB 4UULA 5FJJA 1QUEA 4YT4A 5JNRA 1E3EA 3VR2A 1FE8A 3MPOA 2OT3B 3LBHA 4BBJA 3PWZA 3EHEA 3EIHA 3C1TA 2EX4A 4P5EA 4QVKA 2RGBA 4IWNA 5HXAA 2XF8A 3PB3A 1XHLA 2CLDX 3TRKA 4WBNA 1K68A 3NHRA 1OXUA 4K40A 1PWXA 1U8UA 2V97A 3ZPXA 2ZRIA 1A04A 1N1MA 1X39A 1AS2A 4LZLA 3UJ6A 3OLVA 1USKA 3G0OA 5BT9A 3TNDA 2DR2A 4IICA 4MB6A 1CF4A 4IINA 4QO8A 1MAWA 3JVEA 4FFMA 5JJBA 4UE3S 1DIHA 1M6HA 3ORHA 3O83A 1CUDA 3FMVA 5FUQA 3N8KA 3V7FA 5EIWA 3AHCA 5EFOA 1ONSA 2C7QA 1XTBA 2BCEA 3BSWA 4L8YA 5MFPA 1GCAA 1NUQA 1TVCA 4HRXA 4OX9B 2OQ2A 3H4VA 1WWKA 1ZOSA 4UKDA 4UASA 3ZKWA 5CYPA 4HAYA 1Z38A 3R3VA 2GESA 4F0JA 1JIVA 1LF0A 3QUSA 2WWTA 1KEKA 2V9PA 2QJTA 5DXAA 1MB0A 2GN4A 3V80A 5CDTA 3BGIA 3FRHA 1P80A 2C2HA 1NY6A 1MQSA 1W75A 4C14A 3WRVA 3VR4D 3M33A 3TG8A 2CCJA 4Y2HA 1KZGB 1QOPB 3OTIA 3RC7A 4TVSA 2LDBA 1TU0A 1M2HA 2ID7A 2WPNA 3LGAA 2B6HA 5LXTA 3AY3A 2H2HA 4GRAA 4X3CA 5DWDA 1Z7GA 4W7HA 1W47A 1CS0B 2VBCA 4KEAA 1S7GA 2CD7A 4DDKA 4EA6A 4R8RA 1V45E 3GI1A 4QEZA 2LVBA 2XEDA 3EK2A 1NDUA 4CWAA 2CD9A 4PIVA 4M7PA 3MJRA 3MJEA 4GEKA 1A9TA 2IW3A 2CVPA 1T8YA 3CG0A 1YWGO 2NTYC 2JI6A 1H6AA 1WIWA 3I2IA 1TA9A 1NBWB 4QLOA 4JNKA 2VFAA 2XYGA 4TZ0A 2HTFA 3DOCA 1F0YA 3SICE 2GXAA 3IEUA 1VLVA 3MUNA 3BTUA 6LDHA 2PYDA 4BZPA 5HZGA 1E3TA 4W5OA 2D5BA 2QYSA 3STVA 5BN3B 4XB6B 4DLNA 4ZQGA 1G5RA 2ZITA 1RADA 5DZSA 3LUCA 4IX1A 2NU9B 2NYAA 5BV7A 1IU9A 1OH6A 5KC9A 4BVLA 3FMPB 1VRWA 2AI3A 2WZDA 3HLKA 3IESA 3L8DA 1F0KA 1TU3A 1OX4B 2WK1A 3GLGE 1NN3A 4RQAA 1BXGB 1P1KA 3HCAA 2JHGA 2XECA 2Q99A 4TMFA 1TMGE 3PG5A 3LA8A 3S0JA 1ECLA 2R7MA 1ENYA 3LUFA 1L5MA 4JUAA 5ARBA 1L1QA 1HMPA 2DQZA 1N2CE 3IKLA 3ND6A 3ANLA 4D81A 2XXAB 4WGGA 5I4CA 5KWJA 2WG1A 4BJHB 4KAAA 5EJGA 1T2FA 1T1SA 3QEMA 5TS3A 2VEDA 2E3JA 3DLBA 4WOKA 1DV1A 1GHTA 2Q9UA 1SCNE 1ZGZA 4Q1AA 3ETNA 4A8JC 3M6UA 2RHLA 2GA9A 3JAKA 3IHLA 3E2IA 2CL6X 1Y63A 4TM7A 5B6IA 2BE7A 2W6IA 4XGNA 3X2SA 4I55F 4YPVA 4WEOA 1B8OA 2V7UA 4RZXA 1C9DB 5U9CA 2IGBA 3DTVB 4FKMA 1L5HA 1TXGA 1K4KA 2PYZA 1XUOA 3NW9A 3ZKAA 4LNHA 3SDZA 2A0YA 2IUFA 4IOLA 3LP6A 2WRZA 1C3JA 3FBWA 5J47A 2H5EA 2R3SA 4UFOA 1TJ4A 2FDXA 2WUDA 2B8WA 3P2OA 3C7KA 5KDLA 3NM6B 3SJAA 4QG7A 3ACBA 1PDWA 1RHQA 1XT6A 4MR8B 2YHBA 3HN2A 3N28A 1ZO8A 3G2LA 3HXTA 4HAIA 1FDIA 1W5FA 5AKEA 5J59A 4DY4A 4ZIRA 1DKNA 4ZN6A 1GPUA 3IAXA 1V0JA 3AVOA 5K45A 1Q14A 2ZRFA 3PHGA 3Q9SA 4LE0A 4M6WB 3KXDA 4M38A 4ETWA 2IVZA 4BMZA 1L3BA 3BORA 1ABEA 3NYIA 2QKYA 1PRYA 1S9DA 2IBSA 1KAMA 1S8FA 5A0VA 2AVDA 4YRRA 2Z9CA 2VRNA 3DC2A 2H0RA 2GVNA 2QYTA 3AIIA 4FZVA 4YBRA 1RXUA 2I0FA 1SOAA 2BFDB 3IQHX 3JD3A 1QHGA 4PHHA 1MOZA 4A1FA 1VGVA 4N0QA 2ZK7A 5HG0A 121PA 3FBTA 3UTDA 5EPEA 2JAHA 3E53A 4Q7MB 2JLSA 4OQEA 4R2KA 3T1TA 2DKOA 1PJBA 1ZIXA 1FDUA 1MQ9A 2QU7A 3B5IA 1FDVA 2O57A 1Z5OA 4URUR 3AEKB 1E6EA 3ICCA 4WZZA 5FKJA 7AT1A 1MFPA 4GUAA 4MV3A 5C7YA 3ZIAD 3QU5A 1DVRA 1SA0B 2O2JA 3SX2A 2XNDA 4JX8A 2C9CA 1CRWG 3AF4A 1G7SA 2BJHA 1PJLA 3R3ZA 3ZBTA 2GCGA 2VOJA 2ZIGA 3CLSD 1C7IA 2FN8A 1ISFA 1OMOA 4QNRA 3P4UA 4HG2A 1KRHA 4LI3X 1I9GA 4C04A 1X7HA 3JWPA 1U4SA 4YTEA 2HRDA 2I66A 2PSEA 3KYDB 2FP4B 3JQ8A 3N74A 3U17A 1LZKA 4R40A 4Z0HO 4L4RA 3VU9A 2WJPA 5JADA 2TRSB 3P9XA 1PEKE 4UTNA 1IHDA 4AO6A 1LDNA 4B2IA 1O0CA 1YTUA 5HRCA 2CMKA 1NQOA 4E6PA 4F3YA 2XYHA 4HWRA 2ZB3A 3FPJA 4KSYA 5FOUA 1XD2A 4F8YA 3QQ5A 1QWSA 2GZAA 4GVPA 1R88A 3IE2A 1YKGA 3DQPA 2QF7A 2W6MA 1TU4A 4FMCB 4O4LF 1S2LA 4G9BA 4LVCA 5EZSA 4OHZA 4OA5A 3WRXA 4MQLA 1DRKA 1TCCA 1HETA 4V39A 3URKA 1B8UA 5IFLA 2IVFA 1ULAA 4KLZA 4W5WA 1YDGA 5G40A 2NUAB 1P2FA 5KKCA 1E60A 2C2GA 4MS4A 1JI0A 3I4FA 1XV5A 1FVFA 2EL9A 1NVGA 4IZHA 3WGKA 1PDVA 1UT6A 1ZZEA 5JXHA 4GMGA 1ESZA 2EX0A 1Z28A 2Y67A 2RHJA 4TL7A 4O8ZA 3FZGA 4GI5A 2QP3A 2X2OA 2VYQA 3WLKX 3LL7A 1US8B 1BGXT 4DYDA 3TTYA 4MWZA 1TD9A 1NFRA 2A9RA 1B15A 1TM2A 2C5HA 2YYSA 4RVSA 4PC2A 4FKZA 1GXSB 1FSFA 4BNVA 1TRHA 1N32B 2EFYA 1XPRA 3OEHA 4N1AA 2IYUA 2WT4A 4L73A 2NVWA 4RV4A 5FYQA 1BHJA 3AKEA 1RKXA 3FPBA 4BQIA 5SICE 1A8IA 1ELOA 3I32A 4LJSA 3IVGA 5JY6A 2I29A 4B3GA 1ZD1A 1IZZA 3QG1A 2C97A 2PSJA 3EA4A 1NOKA 4G5HA 3WLTA 3IT0A 1A8UA 4RU1A 3DZ8A 2GZSA 3IDSA 3PUZA 4ZV9A 2J1LA 1LJLA 1QRRA 4AZVA 2WMOB 1UMDA 3QX7A 4HWSA 4Y6SA 3BQMB 1ZXXA 3GZ4A 1M1XB 3MUFA 4GGPA 4LAFA 2CXRA 4N5DA 1ZK4A 2CE7A 2B82A 5JVDA 3FZNA 1V16A 3F97A 3A4YA 3CRVA 1VRCA 3WLEA 3ZIDA 1QXSA 2EX1A 5BSUA 5EKTA 1SOUA 3DLPX 3M2PA 3ZNQA 2J9FB 4RC9A 5CB4B 5AIBA 1V5IA 3PFFA 1JDPA 4CQNA 3KJXA 5IWCA 1AU9A 3KOOA 3UAOA 2NU7A 4S0XA 2PL3A 2VAWA 3VDNB 3A28A 2OV8A 3HU2A 1Q44A 2QE7D 3A9WA 4QYXA 3OEEA 2BR5A 2VTVA 2V6FA 3H9GA 2F4VB 3WLLA 2B0CA 1HH4A 4K8RB 4M8IA 4AURA 4BZQA 5IWAB 3T8YA 4Y6LA 1OGJA 3AVWA 1HTWA 1U3UA 1EP3B 4OHBA 4YO8A 1JZQA 3DLCA 1TQ2A 4NARA 1JXMA 4TKVA 3QH4A 4G89A 5CNJA 3PQEA 3ZVRA 2ZLBA 2MSDB 2Y1KA 1W8IA 3WLNA 1PL6A 1FFXB 3KQWA 1IBMB 2K6GA 4WGFA 2IHBA 1JEEA 3GB9A 2GO7A 2UV8A 3OU7A 1FQKA 4EO9A 4D6PA 2WB4A 3PNMA 2A9JA 3S40A 3VZDA 2Z2JA 4D74A 5BWMA 3B1ZA 3U4HA 1NP6A 5ECYA 2BMVA 1GRQA 2GX6A 4ZO6A 4RDXA 4RLSA 5KOYA 1PEDA 1UOEA 1WD5A 2I7DA 2IPLA 2VPWA 1W9HA 3W06A 4F93B 2VQFB 3MWJA 4GYKA 4OMUA 1HT2E 4XOUA 4MMXB 3DV9A 5K4GA 1JLRA 2FPXA 1IK6A 1UXOA 1V4NA 3QE3A 2ZB4A 4EKGA 4F46A 5JQGA 4QFMA 2FSFA 3G02A 1BH2A 4O4JF 4OPMA 5IT0A 4JI5B 4QPCA 2M6SA 1W49A 1FJXA 4C87A 5KNCH 2J6HA 5FNVF 1KBOA 2NO5A 5K0BA 2XMDA 5CLQA 2JGRA 1P3DA 1SULA 1XZKA 5HFJA 2BDUA 4RQBA 5IAEA 4KBGA 5KKAA 3VI3B 4TVKA 3DFFA 3UWSA 1JHXA 1TZJA 2WEKA 3DO5A 1AJEA 3E9MA 2WJHA 4G26A 4D9GA 2I2BA 3KTDA 3QF7A 1NPTO 3FUUA 1MZVA 1MXHA 4G4SP 2PL5A 1O94D 3M5CA 3NVMB 4FDMA 2BR4A 4JIGA 1J8VA 4JC8A 1LLQA 5EQJB 1O8CA 2V7QD 2ENWA 4RESA 1WZ2A 4MI1A 4WTOA 1W46A 4QULA 3PHJA 4LMAA 3A4VA 3BB1A 4KLCA 3CH5A 5CJ2A 4UATA 3ZUPA 3N6VA 3Q72A