5ENDA

Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg)(q152a) from vibrio cholerae
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
244
structure length
228
Chain Sequence
QFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGAANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase FabG
total genus 79
structure length 228
sequence length 244
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5endA00
1DIRA 1W6UA 4CLXA 2YHIB 3FNFA 3ZCXA 5TLSA 4RDHA 1CQJA 2PKRA 3OIFA 1DFHA 2GD1O 4FGSA 4R68A 3BZUA 3H9UA 3E8XA 2YDXA 5IXYA 5CEEA 5KVQA 4OO3A 3QA9A 3ZWAA 4FFRA 1EZ4A 4XRRA 2EERA 4J1TA 4L74A 5C7IO 4DMLA 2JFFA 3KYCB 3M2TA 2DUWA 5GZ3A 5TJ9A 4Z0TA 2Y93A 1YQDA 1Z74A 5A04A 2O23A 4MOWA 3DOJA 3DTYA 5J23A 2RH8A 2YQ4A 5JC1A 2WE7A 1K6IA 2FPPA 1RM5A 3K9QO 3H3JA 4EW6A 3JQGB 5IXSA 3BTVA 1PJTA 4WPGA 1J0XO 1H6BA 5FF9A 2WSBA 2Y99A 4LRTB 4CM1A 2BI8A 5I7VA 2EJVA 5ENDA 2Q2WA 8ADHA 1TXGA 1N9GB 5DZSA 3JQ7B 4CMJA 1P44A 1LLUA 5A06A 3FN4A 2ZYDA 2ZB3A 4BO2A 4YJDA 2WYUA 3NGXA 3ZU3A 3HFSA 1F14A 1PL7A 4H7PA 5A9RA 4D3DA 1NTOA 3JYOA 2BFOA 5B37A 2BLLA 4BGEA 4BO0A 4HBGA 4D42A 4XCVA 1XELA 4KQWA 2FP4A 3DQPA 2I3AA 4I9NA 3BMOA 1B26A 4O59O 5A5FA 2IEBA 5AQ1A 1CF2O 2EGHA 1MV8A 3ON5A 5G4KA 1ISHA 1HDCA 4H3VA 1GPJA 1PZGA 1IUKA 4BO8A 1UJMA 4BO9A 1ZSVA 1P1JA 1IYZA 2BKAA 1HLPA 1ZMTA 4CM4B 4PLFA 1IHYA 3HDQA 2BD0A 4J90A 4WUVA 3RU7A 1KS9A 3GGPA 1DEHA 3H9GA 3ZHYA 3GAZA 3ICPA 1LNQA 3O38A 1WDMA 2CD9A 3B1KA 1XQ1A 3H9QA 3ZGYA 3GA0A 4BS9A 2ZJ1A 3E03A 2C82A 4TSKA 2X1HA 1PSDA 3NV9A 4RF4A 1GL3A 4KP7A 3RQSA 5CP8A 3DAGA 3QWAA 4KTVE 1AE1A 5JPIA 2QRLA 4M8SA 3ROPA 4P22A 4NIMA 3BHMA 2DKNA 3VZRA 4A7PA 1TLTA 3CXRA 3GLQA 4I9UA 1FDUA 2EKLA 3NDJA 1QRRA 1VPDA 3F9IA 4OXNA 1O0SA 1PIWA 3UCFA 3ONFA 3PGJA 4HFJA 1JN0A 4KDEA 3LU1A 5A3JA 3LLVA 5B4TA 3PJDA 2Q1SA 1NPTO 1T25A 1PS8A 1GCUA 4OM8A 4XDZA 5B1YA 3O26A 1Y5MA 2YFHA 3JQEA 4R1SA 4NG5A 3T4XA 4EDFA 2EP7A 4JN6B 2NU8A 5JCJD 2E37A 4D7AA 4N54A 4JXKA 4BNJA 4XQEA 4Z3KA 1P3DA 1DIAA 1OOEA 3CE6A 2EXXA 2FZWA 4UVDA 3NEPX 4NPCA 1B0AA 3DZKA 3KOUA 3RAJA 4XGIA 3DMTA 3AOEA 3OETA 1NP3A 5F3RA 3R6DA 1GUZA 3CSDA 3Q3CA 3EY4A 1DC6A 4ALNA 5I9NA 4OQYA 3H5RA 3NT2A 3GN1A 3S2EA 1B8PA 2ZB7A 1ISJA 4MVJH 1ZXBA 1HXHA 3UAGA 2X9GA 1Y8QA 2B69A 3ITDA 3U4IA 3PIIA 4DYVA 2FY8A 5JYDA 5BSGA 1NQ5A 5L7TA 4DC0A 5JC8A 1ML3A 4K9DA 5DCUA 4E2XA 4F3YA 3FNGA 3V1UA 2YV1A 2IE0A 4PCVA 3TZCA 1WVGA 5EIOA 2O3UA 2P5UA 4RVFA 1ZXLA 3K31A 3WGYA 4FDAA 1ZJYA 4NBRA 2IXBA 2AEFA 1H6DA 3KYBA 5FI5A 2EIHA 4J1NA 4GBJA 4IINA 1MLDA 2DUUA 4PG4A 3BMNA 1WPQA 3CMCO 2X9VA 4IZHA 4YXFA 3ZWCA 2ZTLA 2GYYA 4EUEA 1TEHA 4DVJA 1GUFA 1DC4A 3Q6IA 1KBZA 3FHLA 5I7FA 1YGYA 3DWFA 1E5QA 4WE3A 3WJAA 4CLHA 3D0OA 1NQOA 3WGIA 3WNQA 4NBUA 3INGA 1F12A 2H5LA 1U7HA 2NTJA 1LA2A 5DOVA 3QWBA 4DXHA 3U09A 4W99A 2OO5A 4YT2A 4CQLA 4PLHA 1W8DA 5LDGA 3N7UA 1FDVA 1BTOA 3QY9A 1A71A 1FDWA 1OZAA 3IS3A 1JQBA 4JLWA 4Q3CA 5BNIA 1GU7A 3IKVA 3RUEA 4CM3A 3AI3A 1GYPA 4G5HA 1T26A 4JJIA 4YRDA 3STHA 4WEOA 3VHRA 3D3WA 4PLVA 3WBBA 1B8VA 4EITA 3VKUA 3L6OO 1VM6A 1MX3A 3TZKA 5EL0A 3ZWBA 1M67A 2WJPA 4ZQBA 1ZO8A 2NQ8A 4CQMB 3GMSA 2JD0A 2Y1CA 3IQDB 3QVTA 3ZNNA 1NX6A 4UEJA 1T1SA 4R1TA 3ANLA 1UAYA 3ZU5A 1KVTA 1VSVA 2GASA 3E5MA 2EJWA 2BI7A 3C85A 3K6JA 1N1GA 1R4MA 3A1NA 3DC2A 5IDXA 3NGLA 2VUUA 4EI2A 4Q3NA 5T67A 5JDIA 3TNLA 4B3HA 1N92A 4HWKA 5TIIA 5A4DA 3MZ0A 1XGKA 3VTZA 1DBVO 4BNFA 1KVQA 3H7AA 4Q3BA 4II2A 1YDWA 3F46A 5TF4A 5IDYA 3ZHBA 5CPFA 4JBIA 4B8WA 4D3SA 5CPBA 5TSDA 2VWQA 5GY7A 4J43A 3W1VA 1LLCA 1PGOA 5IZ4A 1LJ8A 1KVSA 1V3UA 4EYEA 2YFQA 3O8QA 2F1KA 1Q2XA 1BDMA 2VRCA 3ZW9A 5KWEA 5AYVA 2UDPA 2G0TA 2VUTA 3OICA 4CQMD 4EEZA 5IF3A 1BXKA 3QSGA 3AUAA 1WZEA 1LDBA 4I8XA 2DFVA 4OSPA 3EYWA 3WGQA 1EUDA 1ULSA 4L75A 3SC4A 2E49A 3ZU2A 1LEHA 4CV2A 3D1LA 5JDCA 2B35A 4PLPA 3JD4A 3F47A 5HTOA 5I7EA 1TT5B 1VE9A 2BRUA 5JDCC 2EEZA 4HKTA 3TOZA 2X5JO 4NBWA 1GYQA 2CZCA 1ZK3A 4UUMA 3E18A 2CFCA 3HDHA 2OHXA 2A9FA 3DDNA 1P1KA 1U4SA 3RBXA 4OYRA 3M2PA 3RUIA 1IE3A 4IXWA 4RVHA 1UDCA 3EW7A 1LUAA 3ICCA 1AN9A 2IZZA 3RBZA 2HDHA 3QWIA 1OC4A 2W90A 4GKVA 1R0KA 4CUKA 2NVUB 1Z82A 1EK6A 2B5WA 5GZ6A 5TNXA 3DR3A 3G3EA 5COQA 1NWHA 1D3AA 5K6AA 3D5QA 4LRSB 5H82A 4E2YA 4E4YA 2NUAA 4BGUA 3DZJA 4XYMA 4R1NA 3KSZO 1GV1A 3EAGA 1MUUA 3HQ4O 2JKVA 3EMKA 2VTDA 2GRAA 3JQAD 5DDIP 4BO1A 3P7MA 4M55A 3WGGA 1E6EA 1P1IA 1QLJA 3GY0A 3KLPX 3VC7A 5EN4A 1OC2A 2G5CA 1AUPA 4RQUA 4XGNA 5L4SA 2POQX 2RCYA 2NM0A 4B4UA 3P5SA 3AU9A 4CV0A 5G0SA 2IYPA 2X23A 4E31A 1Y81A 3QHAA 2W98A 1YDEA 2DLDA 2VRBA 4FFPA 4TVBA 6LDHA 3ONDA 4LISA 5JAQA 4PN3A 1DIGA 1GZ4A 3KYDB 3PHIA 1E3LA 1XHLA 4ZVVA 1HT0A 1YKFA 2RIRA 2PGDA 4NZ9A 2VUSA 1HZJA 3GHHA 3MTJA 2CDCA 1O89A 1PJQA 1ZUD1 1HKUA 4IIVA 2IYOA 2YHIA 1CDOA 3I4FA 1ZCJA 5DBFA 3UN1A 3LT0A 4E21A 2R2GA 2VT2A 4J4BA 2PH5A 4WKGA 1WW8A 4CMIB 4RVSA 2VQ3A 2GLXA 1GADO 1BXZA 4Z0HO 3FI9A 4A03A 2D8AA 1B15A 7ADHA 1DDOA 3D7LA 3L4BA 3WYCA 2BHLA 1EBFA 3E9MA 3NTOA 4PRKA 3VDRA 5CG1A 4CLOA 4CMKA 4ALJA 4ZQHA 2PTGA 3HFGA 4W9NA 2OL4A 1HLDA 4HFNA 2AQIA 5JAIA 3SEFA 2FSVA 3EHEA 5L4LA 1C3VA 5ILGA 2CF6A 2X0NA 3WGTA 1Q0LA 1IULA 1NFQA 4U6QA 1X15A 3E9QA 4P38A 2FOIA 1YB1A 3GF4A 2P9GA 1PTJA 1HL3A 3DBVO 1ZKMA 1EDZA 2JD1A 3HN2A 1U5CA 4RGBA 1N8KA 1U3TA 2GCGA 3ZHXA 3B20A 1HDGO 1UR5A 2Q45A 4O63O 3WQSB 3QRWA 1LQUA 4DIFA 3WGHA 2ZKLA 2DTXA 1U4OA 2GZ1A 1H2HA 5KVSA 1X13A 4AJ4A 2NVWA 4W82A 1GQ2A 3I5MA 9LDBA 2NSDA 4Z6KA 3D3WB 4GI2A 1ZW1A 1ZK4A 4YB8A 3JYLA 5AVOA 3BMQB 4RF5A 4Y8VA 4CQMA 2H1SA 3JSAA 5F21A 5IJZA 2OUIA 1SB9A 3I23A 5G0TA 3NAQA 4BNYA 3KSDO 3KV3O 1NWCA 2JAHA 3IC5A 1K2WA 4CMEA 4DMMA 3UF0A 4ZD6A 4G81A 1MG0A 4LK3A 4UUOA 2XXJA 3M1LA 3PWSA 2E6UX 4G2NA 1V9LA 2BMAA 3PVZA 4RF3A 3TPCA 3RJ5A 3T7CA 3IIEA 3VVCA 4NDNE 3HZZA 4DRYA 4E5MA 3PYXA 2IZ0A 2XXBA 3NKLA 3C7AA 3O8QB 3W8FA 3EDMA 3K2EA 4RQTA 3V2GA 2B37A 2CMDA 3IP1A 2PGLA 4RLSA 3V1YA 3OJEA 5GZ1A 4DQVA 5U1PA 1QSGA 4B7XA 1U1IA 4P4GA 4YYZA 3AUUA 3NJ8A 2DT5A 3KHUA 2FR0A 3ZH2A 2QHXA 1R15A 1ONOA 3G79A 2Y0DA 1E7MA 4J2OA 2J3IA 4KUEA 4B79A 5JY6A 3VZQA 4U5QA 2Y1OA 1ZH8A 5ITVA 1RPNA 2DC1A 4NR0A 3R0IA 5ILOA 1I10A 2E4AA 3LSYA 4PFJA 4IDFA 2WM3A 2NADA 2VHYA 5CDTA 2QZZA 4BNNA 3FNHA 2HO5A 1M2WA 2PNFA 2OMEA 4MO2A 3ANMA 2D2IA 4E6PA 3BTSA 1E1KA 1QV7A 3JYPA 5KCZA 3DBHA 3RC9A 3ZNOA 2AMFA 1NFFA 3WSVA 1YBAA 4E3ZA 3A06A 3DZBA 1U28A 3RFTA 2HCTA 2OBNA 1IL0A 1DPGA 3AY7A 4GKBA 5ES3A 1J49A 3GPIA 3SJUA 1DIBA 4K6FA 4A5OA 4URFA 2UUOA 2ZIZA 1AHHA 1QYWA 3GEGA 4ALIA 4CM5A 4YA6A 1MGOA 4OIMA 4ZU3A 3K2BA 4WASA 4BQPA 4D79A 3WLFA 4Q3AA 3KTDA 4YR9A 1EMDA 1VKNA 4CM6A 1H9BA 2PLAA 1IZ9A 2AEMA 3BMCB 3OECA 2J3JA 3GT0A 1DRWA 4KZPA 1SEVA 3QP9A 3AM5A 4YAIA 4EGFA 4M87A 2J3KA 2IZ1A 3GEMA 4RZIA 5L7WA 3W6ZA 2LDBA 3E48A 1IOLA 4B7CA 3WGOA 4M54A 4GSKA 2DBZA 4YAEA 1YQXA 4QEDA 4XYGA 1Y8RA 4XYBA 1DC5A 2AE1A 4CR7A 3BMNB 4MKZA 2PKQP 1PZEA 3MCVA 5JYEA 3MWEB 4GGPA 5HS6A 3PRJA 4R4JA 2NTVA 1GAEO 5JS6A 5IDQA 4FJ2A 2HMTA 4CM8A 3WR5A 1PGPA 2DTDA 3L77A 3W6UA 3UHAA 5AXCA 1DFGA 1OMOA 1VJTA 3JQGA 3JQ8A 3DXFA 4PLGA 3NT4A 4LMRA 5HS4A 1H2BA 1EFLA 2B0JA 2R6JA 1YL7A 4FBGA 5L40A 1W4ZA 4EUHA 1W0CA 5JO9A 4R16A 3UKOA 4N5NA 2Y67A 4MVJA 1Q7BA 1VRWA 4R1UA 2I65A 1E3JA 2Y1GA 2OXIA 5B4UA 3H9EO 4DBVO 1O8CA 1DC3A 3S2GA 1FMCA 2VHXA 4UUNA 4AJIA 1T1RA 1SNYA 2WYWA 3PYMA 1KEWA 2ZTVA 3QVWA 4J7CA 1AGNA 1KETA 3PHLA 3VZPA 4E30A 3TN7A 4NHEA 3OJOA 3WG9A 2G82A 2NACA 5THKA 1J5PA 2GF2A 1H0KA 3JCZA 4MP8A 1K5HA 3A9WA 5FYDA 2EKQA 1Q0HA 5HA5A 3DFZA 4OXKA 1E7QA 3FWNA 3RUCA 4L4SA 1A5ZA 1R4MB 3GVPA 1XU9A 3LZ6A 2I67A 4DIOA 5T57A 4DLAA 1SB8A 2H63A 1U5AA 4QFDA 4OQZA 4UULA 1M6HA 3H3FA 5FEUA 4DPKA 3PHJA 3UUWA 3D5TA 4OAQA 4ZICA 4AG3A 4ZJUA 3GR6A 2HMVA 2I99A 3BTOA 4GMGA 1YJ8A 5L53A 4YDRA 4BB5A 4JBHA 5BSEA 3C3XA 1T4DA 1ENOA 4K1LA 1YL5A 3DHNA 5F5LA 1MG5A 5TT0A 2Q2VA 4W7HA 4ND1A 1XIVA 2EW2A 3W4JA 2GERA 3AW9A 4J3FA 1JAYA 1EE2A 1VI2A 1YJQA 1YOVA 2YY7A 3I6QA 1DXYA 1L7EA 1I01A 3PIDA 1D7OA 2C29D 4RPGA 5MDHA 2D5CA 1GV0A 2CVQA 2NVBA 1NASA 5A05A 4B8ZA 2TMDA 1OBFO 3E1KA 4BKQA 4BV9A 3DZFA 1ENYA 2VNSA 3L07A 5HM8A 2PD4A 3CZMA 3ZWVA 4AICA 1GEEA 3SLGA 3PJFA 3Q1LA 4MIYA 3ABIA 4KMSA 3TSCA 5A02A 2NU6A 4XB2A 3DTTA 1O5IA 2JFHA 3EZYA 1I2ZA 2HSDA 2YV3A 3TOXA 4OSOA 3LT2A 1E6UA 2ILTA 4YVFA 4N5MA 4EJ0A 3DEYX 2JHFA 4CMEC 4E32A 2J6IA 3OEWA 4NI5A 3ZWXA 3NDRA 1I2CA 3SXPA 3WTCA 5JCXA 4MIOA 2JCVA 4CMHA 2YQ5A 1L1FA 4CMGA 5C37A 4L8VA 4J1SA 4YRBA 1D1TA 2EV9A 1I3NA 4D45A 8LDHA 2O2YA 3NX4A 1MC4A 4TROA 1SC6A 4UVHA 1WMBA 3R1IA 4CODB 1A9ZA 1KVUA 5FI3A 3JD0A 3VKVA 4EJ6A 1DRVA 1NHWA 5TX7A 1TI7A 3PEFA 3PQEA 4IJWA 4WK6A 4FOSA 2PZJA 4NNJA 4RDIA 3DBHB 1G0OA 3DOCA 3MJVA 5JNLA 2Z1MA 4CMCA 5IN4A 3NJ4A 1WAMA 3HADA 1SO8A 4J7XA 3FCOA 1PU2A 3KYCA 2CVOA 2JD2A 2D3TA 4D0RA 5G2OA 3WQQA 4WECA 4WCFA 4FC7A 5TJHA 4MP3A 4CUZA 4Y6RA 1Y6JA 1W73A 2NU7A 2H9IA 3GGOA 3IDSA 4FS3A 5DT9A 2AE2A 2VHZA 3PHGA 2PA3A 4P8RA 2JCXA 4IDBA 1SBYA 3DHYA 2O4CA 1F8FA 2JFGA 5JAZA 5L45A 4CMIA 4XIJA 4FFOA 2OORA 1EFKA 2AG5A 1ISIA 4IGEA 2NNLD 4EEXA 1HE3A 2H6EA 4QO8A 3I1JA 3OA2A 3PYLA 4OJNA 1HSZA 2GN6A 5JCJA 2Q49A 3NT5A 3S55A 4XA8A 4CQLB 1MA0A 3ADOA 3WDSA 5ICSA 1J6UA 2O7SA 2WE8A 4JQCA 1MFZA 4U0JA 3X2EA 2OOSA 2OP0A 4FQ8A 4FPXA 3U62A 2HK7A 3S1LA 2HAEA 4UVEA 3JYNA 3PGXA 4BNMA 5KKCA 3PLNA 3BMOB 4DBZA 4ESOA 3UOGA 1VL0A 2PY6A 4ND4A 3FBGA 3OFSA 2WD7A 4FC6A 2Y1DA 4XIYA 3LLSA 2C5EA 4E12A 1YRLA 4L76A 3WWZA 3L0DA 2A94A 1KC1A 2HMSA 3P2YA 1I36A 1EQ2A 1H94A 3CZRA 3C1OA 2CNBA 5I8ZA 1ZK1A 1UP7A 3PP8A 2GN8A 1HDZA 1B3BA 1U8FO 5IAAA 4IQ0A 5IFLA 3FPLA 2VWHA 4I1IA 4R54A 2C59A 5JSFA 4NK4A 5B4VA 1GUYA 2HRBA 1XA0A 2VCYA 4GLLA 2VYND 4BMSA 1GZ3A 2P9CA 3W4IA 3JD1A 2B36A 5C5IA 5JBIA 5JY1A 1BHSA 1DRUA 2VYVA 4MKXA 3UCEA 4XDYA 4UVIA 5IDWA 1Z45A 1XU7A 5U9CA 3F1KA 3QE3A 3QVXA 4YJFB 1Y9EA 3EC7A 5G0WA 1QV6A 5T6BA 4IZIA 3GH3A 4R69A 1MXHA 2FN7A 4R01A 2FSSA 3ANNA 5HWSA 4OHUA 4I08A 5L3ZA 1NNUA 3I9NA 2ZK7A 4HP8A 5AOVA 4DQXA 1UP6A 1Z7BA 1K6JA 4ALMA 1U2DA 2QYSA 4A27A 3RI3A 4RL6A 1WMAA 2HKIA 4TZKA 4QTZA 1SAYA 3GAFA 3ZV6A 3KETA 3AFNA 1ISMA 4FIZA 4FB5A 3I83A 1UUFA 3DBRB 4Y6SA 3OQ1A 5G4LA 7MDHA 1DB3A 3DO5A 4GX5A 2I3GA 2LDXA 4J2HA 1PJLA 4RPKA 3VDQA 4AJ2A 1KC3A 1GR0A 4CMBA 2J8ZA 3QJ5A 3MEQA 3RIHA 3ASVA 3ZWOA 1EVIA 3FTPA 2QG4A 2OZPA 1VC2A 3IAHA 3ZN2A 5EJ2A 1T4BA 3S2IA 3KEOA 1PR3A 1KY5A 1HF3A 1NXQA 1VJ1A 1X1EA 5T8KC 3C1AA 4BKUA 1BG6A 2WTBA 2VTEA 1UH5A 3I9OA 2AW5A 2DU8A 4JK3A 3V5NA 3LK7A 4J9UE 3U4HA 4BMVA 1JKFA 4J0EA 1V3TA 2FZEA 1HYHA 3D3EA 5EQFA 3ENKA 3MJTA 4J4HA 4QO7A 3C1TA 2AG8A 5EINA 3U4CA 1V8BA 1Y8QB 1P1FA 4PLTA 2BFPA 1LDYA 3GFGA 2JHGA 3VH2A 4ALLA 3G49A 4A2CA 1EUZA 5JW6A 1DAOA 4J16A 3PWKA 4CLDA 4DPLA 3K30A 3WICA 2UVDA 4GMFA 1B2LA 1VLLA 4XQ9A 3ZV5A 3L6EA 1XYGA 5BR7A 1Z7EA 1NAHA 4RPHA 4WOJA 4B3IA 3RUAA 4OOFA 1NQTA 1T24A 2X5KO 5BNTA 3KRTA 4P4LA 4HV4A 2XPCA 4GX1A 2Y1EA 5L7YA 2DQ4A 3AFMA 1V0JA 3WSWA 3ULKA 3L4SO 3CPSA 5H81A 4IS2A 3ZU4A 4DLLA 2IDZA 1KEVA 1NVMB 1GQQA 4GWGA 2ZATA 3PQFA 5L4NA 2EKPA 2VYNA 3BMCA 4FFMA 4TRJA 4GVLA 5EQDA 1PJ2A 4A10A 4RPLA 5CFZA 5KVVA 1GEGA 1P0CA 3HJAA 2YZ7A 4YCAA 4QECA 4J1QA 2C2YA 1R6DA 1LLQA 1LDNA 2HK8A 3IJRA 4A73A 2WDZA 4CV3A 4WCFB 4XR9A 5K0ZA 5H83A 1G1AA 1KEUA 1NVTA 1PWXA 3UCXA 3DMTC 1U2GA 3RWBA 3MWDB 3LC1O 2ZQZA 1LLDA 3RKUA 2V7PA 3QIVA 3DAFA 2B5VA 1SOVA 1ZEJA 1FDTA 4PG6A 3DBLB 4GGOA 3BIOA 4MVJF 4CM8B 3F5SA 4GWKA 5AXBA 4DREA 2HK9A 2B4TO 1P1HA 3U9LA 4E0BA 4YQYA 3RD5A 2Q4BA 2UV8A 3OJLA 3Q2IA 4FGWA 2BH9A 1N2SA 3GK3A 4B4WA 1HRDA 5T5QA 1DLIA 3GGGA 4PG7A 4BNLA 1QG6A 1QR6A 3DB2A 1MC5A 3RBVA 4J91A 2PD3A 1NR7A 1YXMA 4LCJA 1C0LA 4FN4A 4TVOA 2XOXA 4DC1A 3VZSA 2A35A 4WLOA 1R4NA 1I0ZA 5DP2A 2JL1A 4GQAA 3ITKA 1HSOA 3OIDA 4FW8A 3RVDA 3I9JA 2ZJ0A 3QVOA 1NR1A 3ETGA 3BMQA 3AK4A 3HWRA 3JYQA 2D0IA 1YE3A 1XR3A 4LVUA 1RWBA 2O3JA 2P4QA 3VH4A 4EBFA 1L7DA 2HUNA 3W8DA 5BQFA 3A4VA 4IXTA 4PG5A 4L73A 1QYVA 3LT4A 3E9NA 3AU8A 4LGVA 2W2LA 5TQVA 4JROA 5CHEA 2O7QA 3FBTA 4NMHA 1HWYA 4BKOA 1MFPA 3WXBA 1ZSYA 3C7CB 3D4PA 2B4RO 2JJYA 1TT5A 1Y9AA 4BVAA 3V2HA 4HXYA 1E77A 1P0FA 3KM0A 4Q39A 1ONPA 3CEAA 1Z73A 3HHPA 4AJOA 4KUHA 2DFDA 4UUPA 4IBOA 2J3HA 4AJEA 3QLJA 4IDDA 2Z95A 2W8ZA 3UW3A 5BSHA 5LC1A 5DOZA 3M6IA 1DHTA 3E6AA 4AJHA 2V6MA 1EE9A 2CY0A 2V65A 2IRWA 1NM5A 2O2SA 1LC3A 2P4HX 4XD2A 4YAJA 2AQHA 1DAPA 5B12A 5KOIA 3FNEA 2PR2A 3RC2A 3ZDFA 4NU5A 1I24A 4M49A 4NJMA 5KJ6A 1H5QA 2Y0EA 2BFAA 4BV8A 4X54A 3Q9UA 4R51A 2ZYGA 2YYYA 3TQHA 3KLMX 1C14A 1WP4A 4JGBA 3C24A 1ZVMA 5HRUA 1E7WA 1Z6ZA 1Y5RA 1DHRA 2QRJA 3PDJA 4AJPA 3PTZA 4J7UA 5KJEA 1H93A 1Q1NA 3O9ZA 5CDGA 1I5RA 1NAIA 2EW8A 3RC7A 2C54A 1NPDA 4QT0A 4HNGA 2D4AA 3WWYA 2B4QA 1X0VA 4D44A 2O4UX 1GD1O 3F5QA 1E7SA 3H65A 4YJGB 3PJEA 1JLLA 4CL8A 5CDSA 3AY6A 3KYDA 1ZIDA 1ZMOA 1N1EA 1UXJA 4BNIA 2C2XA 3KO8A 3H4VA 4JNKA 4Y67A 3H2SA 1QXSA 4TMFA 3V8BA 4MVJP 4B4OA 2CDAA 3D64A 4BO5A 1BGVA 1PR9A 3JQ6A 5JAMA 3RASA 1I30A 1PL8A 4OKNA 1YBMA 1A7KA 1O9BA 4OOEA 4WLFA 1CERA 1UAGA 2V6GA 4UAGA 4DTIA 2B83A 5IG2A 1JVSA 3PLRA 4J6FA 4A26A 1CQIA 2HJRA 2C7VA 3U49A 3TWOA 3RU9A 4C7KA 3KVOA 2RBEA 2SCUA 3GC6A 3ZHZA 3WFJA 3ZZNA 5TT1A 4CLOB 4JIGA 4IGFA 5KKAA 2ET6A 4IQGA 4M89A 4R5HA 1ZK0A 4IMPA 5BNFA 5AXAA 1TVEA 1B8UA 1Y8RB 1F8GA 1FJHA 4AL4A 3VPFA 4QQRA 4AJJA 2VWGA 3RROA 3DZGA 2Y1FA 1E3WA 3K92A 2FR1A 1JVBA 2DBQA 2O50A 1E1MA 1PWZA 3K8ZA 3MTGA 3LQFA 5LDHA 4BGVA 3SVTA 3PXXA 1PGJA 3DOOA 4MVJE 1V6AA 1E92A 1X7HA 1ZBQA 1F06A 5T8KA 1BXGB 1YS4A 3UFXA 3M1AA 3VPSA 1ZJZA 4TWRA 4IMRA 3ETDA 1R37A 3D4NA 2PK3A 3EUWA 3TL2A 1C0IA 3JQBC 5ER6A 4BKPA 5FWNA 3HDYA 2BGMA 4YJHB 3OSUA 4BO4A 2I76A 2W2KB 1EK5A 4PZDA 4YQZA 4BNZA 5TS3A 1EUCA 3OEYA 5C3MA 3VTFA 2I9PA 1PGNA 3LDHA 3L4BC 2O48X 4XJSA 1X7DA 1T2EA 2DBRA 3ZV3A 2AEJA 4ZQGA 1RYDA 4OKIA 2GUGA 1LC0A 3QWFA 4RJTA 3O03A 4IQ8A 4JX8A 3IL2A 1BWSA 1OAAA 3WFIA 2A4KA 1PJCA 4XQCA 1QP8A 3BXXA 2OP1A 4ID9A 1FF9A 2BELA 5A9SB 1U3UA 1YWGO 4GX2A 3TZQA 5DNAA 1YONA 1HDRA 1E6WA 4KUGA 3IUSA 5G4KB 1NVGA 1PZFA 1LRKA 2PZMA 4PZEA 1ZFNA 4IIUA 2P68A 3G1UA 3DONA 1QYXA 4YT4A 3X2FA 4PG8A 1PQUA 1XCBA 4JBGA 3GPDG 3JQAB 4RVGA 4U8GA 3AI1A 3TFQA 1EQUA 3ZWYA 1KYQA 3FPCA 3GG2A 1P77A 2AA3A 3E5RA 1S7CA 3PJGA 3U0BA 3JQBA 1UZNA 4IPTA 3F4BA 1N7HA 4II3A 5DULA 5CEJA 4FJ1A 5L9AA 3DZIA 1UXGA 2NTNA 4GX0A 1F0YA 4YBZA 2ZB8A 2X4GA 1KY4A 4CR6A 1E3SA 4BNWA 3WMWA 4ILKA 2E82A 3QVSA 3JQ9C 3OH8A 5IZCA 1HYGA 1AXEA 2VOJA 2UUPA 4PGFA 3DAPA 1P45A 4WJZA 2QW8A 4BIIA 5DCWA 4CL3A 2GR9A 3AJRA 4ZRNA 3WX0A 1ZZEA 1U7TA 1YO6A 3AI2A 1IZ0A 3TRIA 3EVTA 4FD3A 4YWJA 5BT9A 5A03A 3I9MA 4OH1A 2VZ0A 1C1DA 1NYTA 2C7GA 3MJEA 4MINA 3CTMA 4Z0PA 4PVDA 3UXYA 1VKOA 2HU2A 2NV6A 4RVDA 4KTTE 3VPHA 4QX6A 1D4FA 3GRKA 3NYWA 4GLOA 4W7IA 2GZ2A 4YACA 3ZWMA 1P31A 5EERA 4IM7A 4K28A 5JLAA 1CETA 1X1TA 4PIVA 4O5OA 1PJSA 4UEOA 4CM9D 4CLRA 5CAEA 1P9LA 2VYVD 3CH6A 3SX2A 4AJ1A 1UZLA 1QYDA 5DBIA 1PS9A 4IDCA 4JCOA 3WYEA 1QMGA 4GVXA 2CUKA 2QYTA 3MOGA 5HBRA 4ZN6A 3ASUA 3H2ZA 1GCOA 4LSMA 1JAXA 1RYEA 3BYZA 3R3JA 5A1TA 3AM4A 4FSHA 1X0XA 3CIFA 4BNVA 3JQFC 2VHVA 3KUXA 3CKYA 3U5TA 3B70A 3AOEC 2WMDA 3IMFA 3EGOA 3HB5X 1TB4A 2R00A 1NFRA 1YH3A 2Y0CA 3BTUA 3F1LA 2P5YA 1HDYA 2HJSA 5F1KA 3F3SA 2I6TA 3TFOA 3Q0EA 1GZ6A 1ADBA 3GNSA 4XRGA 4CV1A 2X22A 3OMLA 2VNAA 2F00A 1AXGA 3GZNB 1WZIA 2TMGA 1BMDA 2VHWA 4HX5A 3CUKA 2VZ9A 3NUGA 1MB4A 3FWZA 4J49A 4R41A 3ZI0A 1LU9A 1BSVA 3LC7O 1LX6A 2GGSA 2I66A 3HSKA 1R12A 2RH4A 2Q4EA 3ZV4A 2YHUA 3TZHA 1EDOA 4D46A 9LDTA 1GTMA 2FMUA 1F17A 1K89A 4BMNA 2Q1TA 3KBOA 2IEDA 4WLVA 4J4TA 3GNTA 3GDGA 1NQAO 3PZRA 1XQ6A 4B4VA 1I3LA 5U4QA 4GH5A 5EMHA 5I8WA 1RM3A 1CIVA 2QRKA 2EGGA 4XKJA 4RZHA 3VH1A 4C7JA 4IUYA 4NBTA 1JW9B 1J4AA 2X0RA 3ZWWA 2WD7B 3Q2KA 2DPHA 5JXWA 4OMUA 1CJCA 5JMWA 4FFLA 4YEDA 3FF4A 3RC1A 4NFHA 3TL3A 1FK8A 3FRJA 1O6ZA 4DYDA 1MXFA 4BOYA 1T2DA 2W2LD 1C1XB 1YVEI 3W4KA 4N5LA 4RVUA 1Q7CA 3SC6A 4NU6A 4D0SA 4EJMA 4NFSA 3FTNA 2NWQA 2O3QA 3HNPA 4RV9A 3ROMA 4IDGA 4RORA 2W2KA 4O0LA 5DBGA 1EVYA 2AHRA 1LSUA 5IN5A 4Q3DA 1DLJA 1UXHA 1PZHA 4GAEA 1VL6A 1HZZA 1E7YA 4FOOA 4NH4A 3WQRA 4J0FA 2X6TA 4YJFA 4LSWA 5I7SA 3HDJA 4RO0A 1BVRA 4QUKA 1NPYA 3OQBA 2A92A 5IZCC 4OXYA 2D1YA 1WWKA 3GDFA 2EG9A 4BUCA 2UAGA 4IJUA 2GDZA 1E3IA 5COAA 4BL5A 3RCBA 4WEQA 2PH3A 2ZCUA 3COSA 1YOVB 1JDJA 3GVCA 3GEDA 1HDOA 2Z1NA 3C7DB 4DUPA 1A27A 4IDAA 1B3RA 5G0UA 1EVJA 3ROKA 3NTRA 3BHJA 1E7RA 1H9AA 4ZGWA 1XG5A 2BF7A 1PX0A 4OGWA 1LDEA 1JWAB 3H6KA 4HFRA 2Q46A 5A9TA 3JD2A 1BW9B 1D1SA 4L0QA 1ADCA 4B3JA 3H8VA 3I4CA 3EVNA 2FPIA 2VWPA 1PJ3A 4MDHA 2P2SA 2FPGA 4NFYA 1LDGA 5JFOA 2FRDA 2YDYA 1OI7A 3SJ7A 3HN7A 1ARZA 1A7AA 1HE4A 2PD6A 4MVJI 1YBVA 3ETEA 4Y98A 3VPXA 3PWZA 2Q1WA 1AHIA 3JQFA 4DQUA 1N7GA 4PVCA 3B1JA 1U8XX 4QSMA 2Q2QA 4ZHSA 1R66A 2QX7A 1HETA 2UYYA 5KNLA 5CEFA 1LQTA 1GY8A 4E2WA 3GRPA 4HFMA 2X0IA 1ZK2A 2IODA 3ENNA 3QV1A 3I6IA 3H5AA 4TKLA 3DHEA 4WCFC 5ER9A 3BAZA 3GUYA 1I8TA 3DZHA 4Q3EA 2EF1A 4W4TA 3V1TC 1I33A 4U7WA 4LVCA 3VPGA 3OJFA 2XAAA 2NQTA 3QQPA 3VAZA 3H9JA 4PZCA 1VJ0A 3Q11A 4WGGA 5TRTA 3AUSA 2J5RA 5DCYA 3OA0A 4BB6A 1S6YA 4U6SA 3U3XA 5F1OA 4CLRB 1PJ4A 5JDIC 2O3SA 4YPOA 1XWFA 2CVZA 2X8LA 1LSOA 1JKJA 3WBFA 4Y9DA 1PJBA 3DFUA 4R9SA 4A0SA 4JP2A 2ZCVA 2WYVA 1ID1A 1BRMA 1ONNA 1ADGA 5MGBA 1R0SA 4FR5A 5JO0A 4B7UA 4C4OA 2VN8A 4BGIA 1GYRA 1ENPA 2V6BA 3WMXA 1K6XA 1E1LA 1U9JA 3GZ4A 4KQXA 2ZTMA 3QW2A 1RM4A 1DOHA 4MVJM 5JE8A 1G0NA 1LDMA 3OBBA 5C7OO 3INTA 3LT1A 4D41A 2EHDA 5KJFA 2C5AA 3AM3A 4QXMA 3WNVA 3MJSA 4E5NA 1V35A 2G76A 2X5OA 3WTBA 4IS3A 1M75A 3DBLA 1PS0A 5DP1A 4N18A 1SOWA 4I5GA 3W8EA 1GDHA 3TDKA 4CJXA 2NLOA 4MP6A 1I32A 3ONEA 3WGZA 2PZKA 4Z3DA 3GZNA 4XJTA 1KIFA 1LSSA 2RHCA 1BXGA 3JD3A 1A4UA 1ENZA 3I9KA 1SZJG 1N9GA 4E5PA 4HY3A 4WNIA 4TRMA 4BNUA 1C0PA 5L51A 1HYEA 1KVRA 1QKIA 3NDIA 4U0KA 4BQRA 4XQGA 4W6ZA 2BGKA 3MJ4A 4FFNA 1YL6A 2VOEA 3GVIA 4IY1A 2Q1UA 4UEKA 4WCDA 3RUFA 2RAFA 4K6CA 1R4NB 1TA4A 1PL6A 3INRA 4CUJA 2R00C 2D59A 1QLHA 1K3TA 4LN1A 4KOAA 3GHYA 2RHRA 1UZMA 2QZ9A 4S1VA 3A28A 1TT7A 3FD8A 3OQ6A 4F46A 5L95A 3FR8A 4F6LA 4LMPA 4KWHA 4DIBA 5ENVA 5DN9A 4AJLA 6ADHA 3FR7A 4UVGA 2BFMA 4GL4A 1B14A 3KXDA 3L9WA 1DJNA 2Q50A 3BA1A 1SMKA 1O94A 3GOHA 1VL8A 1I3KA 3GVXA 3RUHA 4GPD1 4CM4A 1JU9A 1CEQA 1UXKA 1WLYA 1Y1PA 3GN2A 3EZLA 3F6YA 2WD8A 4TZTA 2HMUA 1DFIA 4M1QA 1RM0A 4R3WA 4XB1A 2V6FA 5A9SA 1X14A 5C7LO 1SCUA 2GNAA 1B16A 1H6CA 2PZLA 4RPJA 1KOLA 4TQGA 2JCYA 3CMMA 3RFVA 3DBRA 1SPXA 3LF2A 1Q7GA 4QFCA 4ITUA 4XGKA 2PKQO 4DLBA 4EZBA 3L6DA 4ZRMA 4BNGA 2PFGA 1BDBA 3G0OA 2ZQYA 4E5KA 2OGUA 3JQAA 4ND3A 3PDUA 4FCCA 1GPDG 4ZQFA 4E13A 2J5QA 4CPDA 3TF5A 4WLNA 1WXDA 3JTMA 2D5AA 2WEKA 2WWRA 3GG9A 3WB9A 1ZSNA 5A5EA 1UDAA 1QORA 5KJCA 4HNHA 2OBYA 3N74A 4NJMB 2YV2A 3DMYA 4AVYA 5CDYA 2X9NA 4CLEA 4JJGA 1A72A 4P4NA 3WIDA 1CYDA 1JWBB 4FJ0A 1LSJA 3V2UA 2VT3A 1PEDA 3WJ7A 5JMPA 2DM6A 1DSSG 4R3NA 3LC2O 1DO8A 2P9EA 1MP0A 1YB5A 2FWMX 2Q3EA 4RF2A 3UGKA 3UVEA 4G65A 4HUJA 4CM7A 3LVFO 3F4LA 4Y6PA 2AQ8A 3D4OA 2EP5A 3IP3A 1D8AA 3I3OA 2YUTA 3B6ZA 2BGLA 2O3TA 4YT5A 4NBVA 1O95A 2FHSA 1KERA 1SEPA 4EUFA 3MOIA 4LW8A 2NU9A 2JAPA 2GN9A 5AXDA 2P91A 1YQGA 3GMDA 1LBEA 2G1UA 3H5NA 3GVHA 1A4IA 4BO3A 4YAGA 1U3WA 5TGDA 3S8MA 2XF8A 3VH3A 5ADHA 3PZBA 4PLCA 4PRLA 1UDBA 2G17A 3OIGA 2X86A 3ROQA 4BO6A 3IOYA 1E0DA 1PQWA 4M86A 2EWMA 3PFWO 5A3VA 2GSDA 2DPGA 3HUDA 1T2FA 3G1TA 4MIEA 2X58A 3UH1A 4I5FA 3P19A 1XDWA 2AQKA 4MVJG 4WNCA 3KZVA 3VVBA 5KIAA 3WYBA 1ZNQO 1DIHA 4BKRA 5DF1A 1VSUA 4I5DA 1WDLA 2AXQA 2DAPA 3AY3A 4JP3A 4AJNA 2CSUA 3K73O 1HE2A 1E3WB 4I9HA 4ZA2A 5F1PA 4E33A 4YAKA 1N5DA 1V3VA 3SBOA 4IJKA 5I9MA 1HDXA 2PGJA 2Z5LA 3RJ9A 5CG2A 1OFGA 4L9RA 3I52A 2X0JA 3WOHA 1I2BA 1GQYA 3C8MA 4DPMA 3JV7A 1U3VA 1LXCA 4Q9NA 3GUCA 3P2OA 3EK2A 4S3MA 4Z9XA 5BSFA 4KWIA 1ADFA 1GFSA 2QQ5A 1E5LA 4WLEA 3JQ7A 1EBUA 3DL2A 1H6AA 3IJPA 5ITWA 5K9ZA 4K26A 1EEHA 4R5MA 5FFFA 1A9YA 1G6KA 4L4RA 2Y66A 2X7HA 3HE3A 2PV7A 1Q0QA 2HMWA 4TKMA 1M6WA 5T64A 4XEHA 1LRLA 1ULUA 1EVZA 1NHGA 3KSUA 3ST7A 3PI7A 4YJHA 1QYCA 3IUPA 1IB6A 1XLTA 3OM9A 1PQPA 1Y7TA 4XYEA 3JQ8B 1XKQA 1ISGA 4DA9A 3HB4X 4HADA 4LCEA 5I9LA 1KEPA 2I5PO 3WS7A 4L4XA 2Y05A 4H15A 1WNTA 3GNQA 3HG7A 3K5PA 3QWHA 3K96A 4PLZA 1IY8A 3RUDA 3AWDA 3MJCA 4D43A 1ISFA 1RKXA 1IPEA 4BNXA 1P74A 2DBVO 4GSLA 4MKRA 2YJZA 1C1XA 1HEUA 4W9NC 5F5NA 1ZEMA 2VRCD 1K0UA 4OL9A 1CWUA 5LCXA 4BNHA 1LI4A 2QIOA 2ZTUA 4MJLA 1C0KA 2J5KA 1XSEA 3JQCA 1IHXA 1RJWA 3RFXA 3ZWPA 5G0VA 3WIEA 3IKTA 3T7EA 2ZYAA 1JKIA 3PK0A 3CINA 2HQ1A 5EPOA 4ALKA 1E1NA 1M76A 3OF2A 4ND2A 4IDEA 1JA9A 1PGQA 1BVUA 5THQA 4NJOA 2DTEA 3TZ6A 3GFBA 4CMAA 2FR8A 2HRZA 1M66A 4XZ3A 3ZNPA 4XX0A 3NRCA 1NBOA 3JQDA 3PHHA 3R3SA 4MVJD 4IJVA 5KJ1A 4WLUA 4XYLA 1X7GA 3BHIA 3KB6A 2VZ8A 2GPTA 3GQVA 2HLPA 4O6VA 2IXAA 1E3EA 1B7GO 3LYLA 3E82A 1R0LA 4DWVA 3GDOA 1HE5A 2Y68A 3I9LA 4E2ZA 4RCVA 4MPDA 1I3MA 3JQ9A 3TJRA 3ADPA 5KVCA 5KTKA 2DVMA 3L9XA 4BNKA 3N58A 5EESA 3PFFA 5TC4A 4JJFA 2Q99A 1P1RA 2C20A 3OHSX 2W4QA 1BW9A 2C07A 4DL9A 3T4EA 3OJ0A 4RLHA 4F6CA 1JTVA 3G17A 4NQZA 4NK5A 4PLYA 3RSHA 2E48A 2GZ3A 3ZNQA 2NVUA 3UICA 4E5YA 4I5EA 4F45A 1P33A 2O3RA 5COBA 4PLWA 4ZQEA 3Q9NA 4H16A 3WLEA 3ZW8A 1DJQA 1FXSA 4INAA 2GN4A 1UXIA 4UREA 3U4DA 3VOSA 1T2CA 1C1DB 1T2AA 3OP4A 1FDSA 4YJGA 3RKRA 1IPFA 4YT8A 4XWYA 1YB4A 4D3FA 1LTHR 1XEAA 1LRJA 2YW9A 3NTQA 1Z75A 4O1MA 2CDBA 1R16A 3KEQA 2ZB4A 3S2FA 4N7RA 1HTBA 1WDKA 2CF5A 4ONEA 4BHTA 4TRNA 4BO7A 4KDFA 5GMOA 4DGSA 5CDUA 3AUTA 4WOKA 4BNTA 3SLKA 4CR8A 4J9VA 3FSRA 4ND5A 3O4RA 3AOGA 1CRWG 4XR4A 3PPIA 3A14A 4ROSA 4YRAA 4AFNA 1ORRA 3ORFA 2OFPA 4Z9FA 4CM9A 2GO1A 4AJKA 5K6AC 4R9RA 4Z9YA 2PWZA 4YTEA 3LF1A 3B1FA 3ZWNA 2C0CA 3PQDA 4TRRA 5ICMA 1UP4A
chains in the Genus database with same CATH superfamily
2AFHB 3MGGA 2GZHA 4HQ0A 3GGCA 1BFKA 4AWXA 3FNFA 3TX6A 1RR6A 2HWKA 2OHGA 2V5VA 3O1IC 2HSWA 3T5GA 5BV7A 1X38A 2JHPA 1PFKA 2P6PA 1KYIA 2C00A 3DE2X 1M2EA 4KAAA 3W2IA 1SOAA 4W5HA 2WHYA 3QH4A 4XGRA 3IAS6 5EMMA 3QA9A 3AF1A 4GPIB 2EFYA 1EZ4A 2DUJA 3IKMB 4M21A 4F4FA 2W58A 2PMFA 3BXHA 3MHTA 4GP6A 1E5TA 2ETVA 2B78A 4UNPA 4UZFA 1ZMXA 2IVFA 4YDQA 4QYXA 5DNEA 2Y71A 4OREX 2ZI9A 4I1SA 4E46A 3N7TA 1QUFA 1VBNA 1GGKA 2PL5A 3I8OA 2DFKB 2WSSD 3L8FA 2Y93A 2ZBFA 3HYRA 3PC7A 1UM8A 4QBHA 2E4ZA 2VHJA 4H1HA 4ZMBA 1NQWA 4ZODA 2Q5EA 4CKXA 4MOWA 1K7YA 2O0KA 1KI4A 1YZLA 4TTSA 5ELMA 2D7CA 2R25B 1Y34E 4OP2A 1VL1A 2C5BA 2YC2C 3HBMA 4Y18A 2QNRA 2QTLA 2QRMA 2OCGA 2AFIB 3WV4A 1FA9A 3JQGB 3BTVA 5BOSB 2PX5A 3H18A 2I9KA 2ZSUA 3R24A 4XD7A 2R9VA 2C9YA 1DCMA 4HR7A 4YUXA 2EJVA 2MYUA 3P9XA 1N9GB 2GB4A 3ZVRA 2DQKA 3MRVA 4B2LA 5A06A 3WXMA 1O8BA 1XL0A 3FN4A 4EJSC 1IMOA 5EP1A 1NOIA 4HJXA 4PZ9A 2WYUA 3U7HB 4C7OB 4WN9B 3DE0X 3HFSA 3ZLTA 3SE7A 5B2EA 2B2XA 4X1YA 3MLEA 4J0KA 5A9RA 1DTEA 4NYJR 5LD2B 3MGBA 4D3DA 1K6MA 1MEJA 2XHZA 4RJIA 2FWPA 4L16A 4INZA 5EXDA 3U3OA 4BO0A 5A5FA 3DQPA 2I3AA 3G0DA 4PYLA 1B26A 1RT9A 1QR2A 2GBCA 5B57C 1ODKA 4MUBA 3NKFA 3F8TA 5BWOA 4W1PA 2EGHA 3A58B 3DEHA 4DR5B 4D6PA 4PN7A 5D5QA 5J4KA 1H22A 2GZSA 3GGJA 4BO9A 2DLCX 4HVTA 1CC1S 1M6EX 4HDNB 5F2OA 2AYXA 4G1BA 3BFVA 2CNNA 3B48A 3GT3A 3ZQKA 4NABA 4ZV7A 5JVDA 2QLFA 3P2MA 4J90A 2BD0A 1JJAA 1G8AA 3PLAE 1DUSA 1L8XA 4MRRA 2XXAA 1YR6A 1QGUA 1JDPA 1O6GA 2D1SA 2OYSA 4M8LA 1CNFA 2R68A 3U7JA 4L8FA 3KJHA 4Y9RA 2CFRA 1B23P 2D7DA 2ZJ1A 3HV2A 1LK7A 5FR1A 3EG9A 3PVSA 4HEHA 4QWMA 1EXWA 4ZZ0A 2ATEA 1BWRA 3REOA 3RQSA 4KP7A 3BJRA 3HYTA 5BQXA 4KTVE 4AF7A 1AE1A 4X7BA 5JPIA 3V97A 3GMTA 4V0QA 3LGAA 2QM0A 1G63A 2XW6A 2ZRJA 3O3OB 4UC0A 4DLSA 3TLYA 5KOHA 1C0EA 4BVKA 2IVZA 1EZ1A 3CG0A 1FDUA 4KDCA 5FOVA 2OCLA 5FV7A 4OXNA 2YYAA 3PC6A 3A04A 3UCFA 5L3VA 1FJ2A 4ZO4A 2DB3A 1JT9A 4NJEA 3LUJA 1I6KA 2WJ3A 4HSGA 3R7WA 4KDEA 1O03A 1J06A 1NLYA 4A82A 1NVBA 3BSFA 5B4TA 3WK7A 1NPTO 1T25A 1PS8A 1O54A 1Y3CE 4OM8A 1NF3A 1RZ3A 4XDZA 3VJKA 4BXOA 1Y5MA 3B9QA 3NIWA 3D6VA 4R1SA 2EP7A 1YJ5A 3FPAA 2C9ZA 3BE4A 5ALIA 1I1OA 1VQ1A 4AF8A 4HAWA 1OKKD 1FBNA 3QE0A 4HS9A 3ZE9A 4BNJA 3L8MA 2NSLA 1ECGA 1XU4A 2F17A 2JF0A 1VCIA 2ZUBA 3OWXA 4M7PA 4NX2A 4RS4A 5ECYA 4A8JC 1YZTA 4B80A 4O4LB 1BCSA 4X66B 3IPXA 2P11A 3OTWA 3VX3A 3VISA 3WGKA 5M34A 3DZKA 3FIUA 3LGXA 5K1ZA 3BD8A 3AOEA 2GAAA 4D9MA 4U5XA 5F3RA 1NLMA 3BOSA 2Y6VA 4MW7A 3W2TA 4DUYB 2VK2A 4TMKA 4OQYA 3H5RA 1V2HE 3WQHA 6NULA 5ALXA 1R6UA 4JWTA 3T52A 3TINA 3RSSA 2ZB7A 1KQ3A 1U8YA 1ISJA 2AI3A 5GWXA 4JMPA 2QUKA 2E3JA 3NM6B 1UC5B 3ITDA 3UMRA 1E69A 2FY8A 5JYDA 3JATB 2PZEA 3ADKA 4XM1A 1GFIA 5FFMA 1NQ5A 3EUAA 4CIXA 2R87A 1ML3A 3LX4A 4OV6B 3A6LA 1SK9A 2FEXA 2GXQA 4KNWA 3V1UA 1P6QA 2HJGA 1KK2A 3HWSA 1K7SN 4PCVA 3UEOA 1XNRB 5EIOA 3WC4A 1R8JA 5KOYA 4WVFA 1P2DA 2P5UA 3GNLA 4JCCA 3K31A 1K5DA 4LHZA 4JV5B 4F9GA 4I6EA 1CS0B 1K92A 2IHNA 2IXBA 3JVUA 4ER6A 3EC2A 3KYBA 1V7PC 2AOTA 3CLSD 4J1NA 3V8EA 1SG0A 2O5RA 1Q15A 2L82A 1VB3A 4GBJA 4NONA 1R3UA 4FBMA 3MGAA 4Z4EA 3RIYA 1MLDA 1CCWA 3K7EA 1QS0B 2WF5A 4IZHA 9MHTA 3ZWCA 4FW9A 4F71A 3TM5A 5CM8B 1EM6A 1PG5A 1TEHA 5TMPA 4EI7A 4AUEA 1DC4A 2PZGA 4IV5A 5AI6A 1B6GA 4KKXB 4WE3A 4N47A 2GPBA 3A2KA 2AIRA 2AN4A 1RBZA 5E9AA 4GXRA 2BFDB 5EJ8A 1YQ9A 4UU0A 4EHAA 3G23A 3B78A 1U7HA 4WZBA 1LA2A 3NIBA 1O0BA 2ZPTX 4WBSA 4UHHA 3T5CA 4DXHA 1MVNA 4YT2A 5BW4A 2FDCA 4B6QA 3H4IA 2QTRA 2Z9CA 2QTGA 1QIJA 2UUCB 1RW4A 4P5EA 3UJ6A 2VHEA 3E8SA 3LKDA 2PMWB 1KA9H 1FDVA 3G59A 1BTOA 2YWRA 4UAVA 1VOTA 1I4OA 3IAM6 3IS3A 4DT1A 1UOPA 3B60A 1W93A 3JAMA 1RZRD 1AO0A 3IKVA 2OV2A 4F4DA 2GEJA 3AI3A 3HN6A 2D62A 3VO8A 4I7EA 4YECA 2ZI7A 4YRDA 1AS2A 3AILA 5BURA 4KPEC 1MJNA 3FNQA 2W5UA 3BIFA 4XH9B 5CURA 4ZARA 1QM5A 1ZIYA 1OGJA 2GA8A 4RAQA 4ZVTA 3TZKA 3VKUA 3ZIAA 4LYFA 1E8MA 5G1PA 2P0EA 1BEEA 1C8VB 1N5MA 1M67A 1ORTA 2NQ8A 1QFMA 4FEGA 3GMSA 1WV1A 1KMCA 4KVFA 3CVYA 1VECA 4BVEA 3QVTA 1QZTA 2FSFA 5HMLA 3B3GA 5IEBA 4R6XA 2Y0BA 2GASA 5BRAA 2BI7A 1TAHA 1N1GA 2GO7A 1P1BA 1T5BA 3BXZA 1DQYA 2F1HA 3DC2A 3GGDA 2CLCX 3OOJA 2VJNA 4Q3NA 5K2OA 5DLYA 1C80A 3RG2A 4QXAA 4DWJA 4BQFA 4KQGA 2RH5A 3EEFA 3MZ0A 4BNFA 3F4KA 4TYQA 4FONA 1KJJA 1XAIA 3O94A 4II2A 2IHZA 1ZIOA 4JBIA 4P3PA 4B8WA 4D3SA 3I62A 1Z17A 3V6MA 2VWQA 2W6IA 4WXEA 1DKNA 1WXIA 3WIOA 1LLCA 2I1VB 5DP1A 2QP3A 2F3SA 4CF5A 4EYEA 1SG6A 4RUKA 3I04A 1NN3A 5DXFA 5DHAA 2F1KA 1Q2XA 2YXEA 3ZW9A 3P45A 3IO3A 4FQ7A 4CQMD 3O4HA 2VUTA 2RG7A 4YYEA 3R3YA 1DWPA 2GYUA 3AUAA 4I8XA 3WGQA 4ARSA 2DFVA 4TV8B 1EUDA 1WEHA 3EGXA 3SC4A 1N7JA 5C18A 4RZ2A 2FMIA 5JDCA 3U7GA 4PLPA 3ISJA 2BMDA 4LPSA 4RTLA 4JHLA 4HLDA 4JJ7A 4RK1A 4EARA 4Z7QB 4DIUA 1ZH4A 5ISMA 1S8OA 1MIOB 2G4CA 4I1OA 5BVHA 4B6EA 2X5JO 3Q40A 1IDOA 3LPLA 2ODNA 1GXSA 1OWLA 3UWMA 2VXBA 3M81A 4MMZB 1NGSA 1IBSA 4J3JA 3CM0A 3RUIA 2I2FA 4LYYA 1NNI1 4K81B 4NS1A 4H7JA 1U8EA 3BXOA 1EJBA 3BF8A 2V6IA 2QI9F 4IXWA 2JI6A 3DAOA 3L5OA 1MV5A 4H0NA 3N2EA 3UM9A 4DDKA 5IYZA 1UPUA 5D00A 4N7MA 2HDHA 3VZDA 3E4DA 2H9AA 3T7JA 2FW6A 5K0NA 1SD5A 2WFLA 2NVUB 4GE3A 5K6AA 2OLEA 3NCHA 4NKRA 2I80A 5DSZA 3C5VA 1RYFA 3D5QA 1ZI6A 2EHJA 4TUYB 5FUXA 1UL1X 1TM3E 1IBKB 4QYIB 3DZJA 1Y9DA 4R1NA 1Z0SA 2P0YA 3KSZO 1GV1A 4FYVA 2PMBA 2ORYA 3EAGA 3HQ4O 4MH0R 2Q8PA 1X7YA 3IAXA 4U7HA 4D3XA 5IPFA 2ZCJA 1XMQB 1W85A 3JQAD 1XE3A 1XP8A 5DNVA 5EPUA 5FBKA 2OZEA 2BEVB 3P7MA 1LW7A 4MS3B 1NURA 5CUQA 4Z7NB 3VC7A 4CG3A 1L7QA 4BQSA 4YNBA 1GAWA 2FH5B 2H18A 5H4HA 2QJTA 5BQPA 3GQBB 3LQRA 3T3GA 3DMHA 2DBYA 5IM4F 3G7SA 3KLNA 1C3LA 3BX1A 1KZYC 3OWHA 4MVWA 4K0RA 4QUEA 4AO6A 3AU9A 3ISVA 4AWAA 2IDKA 1X1DA 1TUIA 4E31A 3UMGA 4AROA 4X1IA 3EXAA 1OFHA 3QHAA 2ONCA 5LUAA 3TEMA 3CVJA 2EU8A 2VRBA 4FFPA 4BMYA 3V4OA 2DPYA 3BH0A 1HM5A 1QQ5A 3CBQA 3OY7A 3VXKA 4BMCA 1VMIA 3LBIA 3RV3A 1IMJA 1HT0A 1YKFA 4EA6A 3GHHA 2CCJA 3HP7A 2CDCA 2EFJA 1PJQA 1Y1SA 2ZDHA 1HKUA 3U37A 3ELUA 5DVZA 2A59A 2IYOA 4UJ5A 4B2YA 1M3SA 1Z8DA 1EAYA 1FNCA 4EX7A 3DL7A 3F5MA 3TEFA 5GONF 4V0LA 3A6KA 4G4JA 2P1ZA 3ZPXA 4KE9A 3TEJA 5DBFA 3ESQA 4AKSA 2R2GA 3ZE2B 3GJ6A 1SU8A 2BDTA 4RVSA 2VQ3A 1GADO 3HU1A 2C7QA 4FMCF 3LH5A 2XKKA 1U1GA 3DUFB 1N9ZA 1FPQA 2WKPA 1RXVA 3OLVA 5LP6F 3I2KA 3MBKA 4DA0A 5CITA 3VZCA 3QE4A 4PRKA 5P8WA 4OI4A 1T9ZA 3VSEA 1VE3A 2FDRA 1LPPA 5BV1A 2HJWA 3MCZA 3D3JA 4AUKA 1DBPA 1ECPA 5FTNA 5F78A 2QJOA 1M6YA 1QHEA 4OFWA 1A3CA 3EHEA 5GJVC 5CJJA 5ILGA 3WGTA 1Q0LA 1KPGA 1JR4A 1K9SA 1AV7A 1PP4A 2ONZA 2ZYTX 3K9GA 3MOSA 1OH6A 1X15A 1IWBB 3E9QA 4K86A 2FOIA 2J3EA 2XQGA 1YB1A 2AWNA 2BF4A 4TYMA 5IAKA 1P9NA 2GETA 2QW1A 1HL3A 2GNPA 1R0YA 2P3OA 1EDZA 3HN2A 1CVIA 1U5CA 3MJDA 1VLMA 4C6TB 2V7WA 2BHNA 4EPTA 1M0EA 2A4MA 2ZE6A 1N8KA 3DDZX 4HZUA 2BGJA 5AQEA 1CY8A 1CUAA 1P7CA 3B20A 1AV6A 3I5UA 4PHFA 1SQFA 3DLCA 1RI1A 2UZIR 4X3PA 3SS8A 1EI9A 1T8WA 3U7QB 1W4LA 4P7GA 3GBVA 1V26A 4YO7A 2LKCA 4FGLA 4RIIA 2RAUA 4K8OA 1YR3A 1CJTC 1OFVA 2DTXA 1U4OA 5TPZA 1D6SA 3BB1A 5CU7A 5HGXA 4NOJA 5AVWA 3ACBA 1WP9A 1T6XA 2HSJA 1W4BA 2NVWA 3P9SA 1KORA 4RJJA 3EXEA 2VR1A 9LDBA 1A7UA 3EULA 3GAMA 1KHTA 3D3WB 4LZOA 2P6MA 1B00A 3H5IA 4MVCA 4QC2A 5HKLA 3UATA 3ZLBA 2EWWA 5IMSA 4RELA 1IBCA 2IPAB 1TO1E 2WTXA 3TQIA 3EARA 3EHDA 3HGMA 5BW8A 3CF0A 3GEHA 5AUPB 1JHMA 5F21A 5IJZA 3FDXA 1L5ZA 5KTMA 4CIBA 2F55A 4QQKA 5AIAA 1JH9A 1S01A 1NWCA 4J8PA 2H2GA 3TRKA 1RAFA 2QQFA 1SQ0A 4DDWA 4KE6A 2JAHA 3DSRA 2G6TA 3RRFA 3RW9A 3TO5A 5A2GA 3GLSA 5AM1A 5KPDA 3OAAA 1JLHA 2IUEA 4CMEA 4CT5A 1XQXA 3IMCA 2A57A 1TRKA 2JIQA 4L51A 1G17A 3UF0A 4G81A 2JVKA 1RAGA 3TMYA 4ETMA 1MG0A 3LLCA 1LBQA 3LDUA 4JJAA 3M8KA 4F04A 3IEPA 1DZ3A 2H08A 4G2NA 4NZPA 4O2RA 4XSGA 1SVSA 1G7SA 3SD7A 4BYMA 1XD8A 3KLOA 1FS5A 4RE5A 4XM0A 1GNPA 1OD6A 4MLCA 1AGXA 3HZZA 4NDNE 4J0IA 4AZ3B 3TQSA 1MJGM 1VZ2A 1DCFA 2XXBA 2ESRA 4KN5A 1UWCA 4XASA 4ZMSA 2ZAYA 3EDMA 4UD2A 4IFEA 4JAVC 1QF9A 1UKCA 3GCDA 2QTVB 1DKMA 2IOYA 4FHZA 4RLSA 3V1YA 5I9TA 3U9TA 4MUKA 5GZ1A 4KK4A 4GOOD 5KEIA 1ST3A 4DQVA 4B7XA 3A1TA 3M82A 1X3SA 3QPWA 2YWFA 1RVDA 1TK9A 2DT5A 2JLQA 2QHXA 1THZA 3AR3A 3BXFA 2PUFA 2JATA 5DGCA 4UHKA 1JDSA 2Z83A 1L5FA 2OXCA 1UMBA 4H4DA 1RWOA 4B79A 5JY6A 2LE0A 3T1QA 4DQKA 1GL6A 1PFYA 5EPEA 5ICFA 3T5TA 1DUVG 1AGPA 4MICA 4DDMA 5IKXA 1G5HA 3QVKA 4F4HA 2WR8A 5DXAA 1JQLB 5D7BA 4A4DA 2FCRA 3MSXA 4ZOEA 3UB3A 2I4TA 5EZ5A 2Z5VA 4IDFA 2WM3A 4QDTA 2QX9A 2VHYA 1J99A 1U9IA 4GP7A 4HH4A 2HO5A 3ONNA 3UWPA 5FUQA 2D2IA 2B1QA 2R7AA 3JASB 3TPFA 4R2XA 1K06A 2BGGA 1E1KA 3SNKA 1QV7A 2WQ7A 3N1UA 4CDMA 3DBHA 3DCNA 4I50F 3BDIA 1QE5A 2AMFA 2UKDA 1AMNA 1NFFA 4GKKB 5J2TA 3T38A 4E3ZA 5ALVA 3A06A 3JWPA 1U28A 1QNFA 3CZAA 4U4AA 1IL0A 2A1UA 5DT2A 3AY7A 3UUEA 4R8MA 4EMSA 5SZHB 2XCRB 4UHFA 5A4FS 2IITA 2XOEA 3BRWA 4A5OA 4DR1B 1XOIA 2QL5A 4G8DA 3HXMA 3WRYA 1AHHA 2I4OA 1VDZA 4CM5A 1NN1A 4DUGD 4NF2A 2O1SA 4LZZA 3DTVD 4D8XA 1ESEA 2JDIA 5KSOA 4BQPA 1CQJB 4HB2A 3AR5A 1Z25A 2YMPA 2P9HA 4KWCA 3TIFA 3THYA 2ZSBA 4OQLA 1GLVA 4CM6A 1QQTA 2WDPA 3N28A 3QP9A 3DLIA 3HH8A 3K1AB 5IBQA 2J3KA 2IZ1A 3DB1A 4D80A 3C0KA 3I6MA 1VZ3A 2LDBA 3LVQE 4G0OA 1NW3A 3VU9A 3E48A 4B7CA 5FOQA 4OEHA 3VX4A 1I1HA 3FE2A 3L04A 3WGOA 2H16A 4ICIA 3RRYA 4YAEA 1Z0KA 2YY6A 5FNZA 4O08A 2QM8A 2VNHA 2RH9B 4ISBA 3AF5A 4PWYA 5K3CA 5A0TA 4XYBA 4WRRA 5FWDA 1PF7E 2AE1A 3UYLA 1KYXA 3BMNB 1AD2A 2G07A 2J46A 1PZEA 3OZAA 1YUBA 2WOOA 3HUUA 3Q1KA 2H3EA 3IP8A 4TV9F 5HS6A 3LWNA 1MW8X 3PRJA 1X6VA 2V1XA 2NTVA 1T1EA 4DG5A 1EVQA 5JS6A 1P0IA 5IASA 4PO9A 5I7UA 3G8YA 4RD1A 3UHAA 3HABA 3DXYA 4HWTA 1VJTA 5JS8A 2B6NA 3TUJC 5HJEA 1Z15A 2YXBA 3MCWA 1JJVA 1WVMA 1EGAA 2BFBB 1IAQA 1SUCA 4HH1A 3UFXB 4EPYA 1CPYA 3PGVA 3GLFB 5JO9A 3N75A 4R16A 4UE2A 3P4XA 3HLTA 3DM5A 5C51B 3MC1A 5ALMA 4TS9A 1E3JA 5BN1A 2Y1GA 3C4QA 4UOEA 2ZWAA 1O8CA 4IDNA 1OI4A 1FMCA 4ZVSA 3UO8B 5HOEA 1T1RA 3PYMA 3VZPA 1KEWA 3N7AA 1XD2B 4J7CA 2PUCA 1QO0D 3IEUA 4HDCA 4B75A 4L78A 2ZITA 2XNJA 4QXOA 2FPWA 1NSTA 3BAFA 4JYZA 1FUIA 2BZGA 4JYPA 3CUEF 1YI0A 4CN8A 5FYDA 3A9WA 2IDJA 1Y6GA 1G8SA 2KSQA 3U6BA 4YGYA 2F90A 1LNSA 1E7QA 2VP9A 3EQ8A 4TWIA 3UENA 1O94C 2GCOB 1AO3A 3GLTA 1MHPA 3HVJA 3RUCA 1NXVA 4HXEB 5HK8A 4PY2A 1R4MB 3NVMB 2QBYB 4E08A 3LZ6A 2I67A 1TD1A 1EKXA 3I05A 4NAUA 4Y6LA 3RJTA 3BQNB 2NUPA 2ZW9A 1U5AA 2WICA 3DOIA 3PUXA 2IP4A 3T95A 4UULA 5FEUA 4DPKA 3DV2A 4HQLA 2Z5FA 2XTMA 2FQXA 2GCIA 1SKQA 1QVAA 3OKCA 4ZJUA 4F7WA 1KEEB 1D2EA 1P2UA 4FYXA 1NJ5A 4DKJA 4TYYA 4JNCA 1MAWA 2QRGA 4YDRA 5CIYA 1NF9A 4IJQA 3D7NA 1EDEA 1RHJA 2GM3A 1XMOB 1QP4A 4O29A 5C4MA 1ENOA 4H6XA 4K1LA 3MN1A 1ST2A 2Z8YM 1AQNA 3DHNA 3MVEA 4LHSA 3H9BA 1SXIA 1WX1A 2BGUA 4RFVA 5LQDA 2IJGX 2M98A 5TT0A 2I4NA 1RC8A 2OQIA 4W7HA 1XIVA 2J48A 1VSBA 2C97A 3W4JA 1ZMRA 1EE2A 1VI2A 4GPBA 3I6QA 2WWYA 5H7XA 3K4PA 2VBIA 3AVOA 4H7HA 2JARA 3C87A 5MDHA 1NXXA 3D7MA 5A05A 2HPAA 4B8ZA 1DKRA 4KFSA 2XMRA 3FOZA 4N5HX 2FI1A 2VNSA 4TKVB 2GJ8A 1FC0A 3OFKA 3ZWVA 1OFUX 1GEEA 3RTDA 1JG1A 1GXSB 3C3EA 3PJFA 3Q1LA 4U9IS 3JQRA 3ABIA 1LZLA 2IYRA 5A02A 3KJIA 5IVKA 3K70C 2IIBA 3FPJA 1O5IA 5B58C 1RDFA 1DGQA 1GUDA 4RSHA 4MKHA 1TECE 5H80A 1SHZA 2XMPA 4LF8B 4IH9A 3GMIA 3LT2A 3ZCPA 1E6UA 4LC0A 1EFUA 3DLPX 1PL0A 1XTZA 2WP8J 2WAOA 2WYIA 4PAOA 1CQPA 1P8JA 3TLCA 2J6IA 5I3CA 1ZH6A 1SVKA 3H99A 3OEWA 1UMCB 1ZGGA 3RV4A 3SQWA 3ZWXA 3QW4B 3NDRA 1P5JA 4EBBA 4CMHA 1L4HA 2JKYA 2G28A 3I0NA 1TNDA 1YS1X 3I32A 3TFWA 2VFAA 3WKDA 1E2DA 2P78A 2EAUA 4J1SA 1LNZA 2JG3A 3NJRA 3T9EA 5C53B 1H8EA 1Q1ZA 3H8WA 3BK7A 5FBVB 4HL6A 2IZ7A 3PBKA 3LL7A 4UHBA 4GO1A 3VRHA 3KUUA 2A67A 4UVHA 1I7LA 4A2PA 3E27A 4CODB 4DTCA 2Q8QA 4A0HA 2ZI5A 2XQVA 3L8GA 2PZBA 1FMJA 4EJ6A 4D57A 4PNEA 3G5LA 3PEFA 3PQEA 4IJWA 5DN6D 4WK6A 3W77A 1C5KA 1IG0A 1RTKA 4NNJA 3VYSB 1G2PA 3S1AB 4EY5A 3ERCA 3H4TA 2IFTA 2MSWA 3DBHB 3MJVA 2F3RA 4KODA 3P20A 5E38A 5HF6A 4CMCA 3CH4B 4J6EA 1WAMA 3R3VA 3NDBB 1JPNA 2AOVA 3FCOA 1DAFA 1PU2A 4LNUB 5J2UF 3AQ4A 2IHKA 3QBTA 4R40A 5B2ZA 5G2OA 4D0RA 5BN5B 2KBEA 4I99A 4OU4A 4WECA 4MYHA 2W2MA 4KRYA 1HURA 1N2EA 4MP3A 7GPBA 4XUDA 3KUCA 2AK3A 4KLZA 1HLGA 2RDMA 3ET4A 2W2QA 2X2PA 3K05A 2BISA 4PAQA 4RHFA 5E2IA 4QARA 5K8TA 2ZT5A 3CPEA 3AMVA 1ZP6A 2RJ3A 4DSUA 3NM5A 2HYIC 1T2VA 4GOMD 1YDMA 3PHGA 1J56A 4LX0A 1M1YE 4D4LA 3DHYA 1F8FA 2JFGA 5JAZA 4F92B 5L45A 3HFRA 1LF0A 2V03A 4XJXA 2BMWA 2WIBA 2KX7A 5J4YA 4IGEA 4EEXA 1Y7LA 4FZ5A 2Q5IA 5K99A 3FMPB 4BMXA 1W8IA 2QT9A 2YW2A 4QO8A 3IPYA 1W1UA 4OJNA 5F77A 2H54A 1ZGZA 3UANA 3BORA 4LNAA 5JCJA 5BR4A 1OB5A 2ZJZA 1YGPA 4NWIA 2G06A 3ZY2A 1A96A 3S55A 4UXIA 5JS2A 1GQRA 2AX4A 3ADOA 4EY7A 1QHFA 2F8TA 1J6UA 2HUPA 4QULA 4TSRA 1Q22A 1PLKA 2R8XA 3ZDYB 4RH1A 4BLUA 1SVIA 4JT9A 4FQ8A 1E2KA 1W1IA 3AP2A 3I2IA 3MW8A 3U62A 3W9UA 1T15A 4B6PA 5B7NA 3KR1A 1QQ6A 4MQBA 1XRSB 2KYRA 4RXMA 4DBZA 2XA1A 4ESOA 4JXJA 1ZR2A 2O2HA 4FC6A 1QDUA 3CLVA 2ERCA 3QOWA 1CQWA 3I5XA 3T5DA 1RPAA 5CT6A 4M8NE 1YRLA 5JARA 2MT9A 4AT1A 3WWZA 3D02A 3W9BA 1KC1A 1N2CB 2VXYA 3CNEA 5DN6A 3TBKA 3T3IA 4C4YA 1EU1A 2H11A 4AXBA 4BPRA 5I8ZA 1ZK1A 5KNBA 2FZ4A 4HJRA 3B7PA 3BWEA 1T34A 3GYBA 2J6HA 1C4XA 2WF7A 3FPLA 4QHSA 4I1IA 4R54A 4S2UA 4M9ZA 1KI6A 3LX6A 4UNIA 3BJZA 4MITA 1IJEA 1TKAA 1YB7A 1UK9A 3FSGA 3MRSA 3OZXA 3AO0B 1L5MA 4FR0A 4JT8A 5F2KA 3GWGA 3H83A 3QOYA 3VR5H 4EVSA 4CCYA 2JI9A 2QE6A 1VJDA 4HH0A 4JUAA 5KUTA 2JNWA 2PUHA 1XU7A 2QAIA 5ALPA 5CA0A 1CUYA 1FXWA 4JELA 3IRUA 1I7SB 2UXBB 3PXAA 5HX7A 5G0WA 2PAFA 4MI1A 2C0QA 5DO9A 2Z6QA 1REQB 1E4VA 4MYSA 3ACDA 1E4EA 2CSXA 2R6AA 2FAXA 4C6HA 2R8RA 1ZKDA 3PXGA 2BEWB 1Y3BE 2FSSA 3ANNA 4GQIA 1E66A 1OLXB 1JPUA 2O0LA 2X4LA 3AC0A 4OHUA 2X4IA 1T9GS 5EJ5A 1JWLA 4C5AA 4ALMA 1U2DA 3MTQA 5IJ0B 5LLTA 1PW5A 1W5AA 3RI3A 1BS2A 5LP6C 5HVNA 2HKIA 4K6KA 4BMOB 3K1ZA 3LAWA 4QDOA 2ZBGA 2O1EA 3GRCA 4FIZA 4FB5A 5CM9C 2AR7A 2WOJA 1PTKA 2AR0A 3NEJA 5K45A 5SYAA 2IOFA 4ZVKA 4M0LA 3PQ6A 5E6UA 4RPKA 1T36B 3PUVA 5LWQA 3QUCA 4I4TB 1GR0A 4CMBA 2VAXA 4HD8A 2P7IA 1MQAA 5CXXA 4G97A 4MW5A 5ICEA 2CNOA 3I12A 3VR2D 1SU7A 2EARA 3IAHA 2FPGB 3EVZA 4UU7A 3S2IA 1PR3A 4IGKA 1KY5A 1HF3A 1MB3A 1NW4A 1PYGA 1R8QA 1VJ1A 2XRMA 2HLHA 3C1AA 2MYTA 3HL0A 3O8LA 3QFHA 4HQ6A 4DILA 3OI7A 5HDQA 1M0SA 1BG6A 4E5VA 2C31A 2FDXA 3ZVMA 3FETA 3V5NA 4XWKA 1SUAA 4LDNA 4TTVA 3U4HA 4BTLA 1IBMB 2WHEA 1ZQ9A 2OAP1 4BMVA 4J0EA 1W5EA 1D2MA 2VJOA 1HYHA 3ENKA 2GRJA 4X95A 2XIJA 1MEOA 5EA2A 4C05A 4IMJB 1S2DA 2X42A 1V8BA 1P1FA 3FYUC 2HX1A 3N53A 4PLTA 3UQYS 1FU7A 1LDYA 4EJ2A 4MDEA 2P9JA 3GFGA 4YP0A 1JHXA 4AI6A 1BJRE 4UBJA 3VH2A 1P80A 2H2HA 4A2CA 4ALLA 4FGUA 1PVDA 3BM5A 4J16A 4KRGA 3DT6A 2NYUA 2D1QA 3K30A 1CEEA 2VF7A 4UNRA 2R6FA 2AZTA 2NX2A 3LHKA 1G66A 3LO5A 1ZWLA 4YAKA 2AC2A 1DX4A 3B5EA 3C98A 3GX1A 2BSAA 3MELA 3VJMA 1Z7EA 3T3NA 3CKKA 1K66A 4ASUA 1TCBA 3RUAA 3V42A 1U81A 1X7XA 2VK1A 4QNRA 2A5DA 5IRCD 4GXNA 1T29A 3DLHA 1V7QA 2VPYA 3G5MA 4COKA 5BNTA 3TK1A 1ZNXA 2NIPA 4GX1A 3O9VA 3UMCA 2DQ4A 1VYUA 5DFAA 1M1NA 4G0PA 1JJ7A 2FN9A 2PRJA 3P9KA 3CPSA 1CZHA 3ZU4A 4AKHA 5LQKA 3BIWA 3ORRA 3HXQA 4TRJA 5EQDA 1XA4A 4GVLA 4A10A 4G0NA 5BSRA 2VTBA 2YZ7A 1D4AA 1ZAYA 3U1VA 2C2YA 3FVTA 1EWQA 4QPNA 4A73A 5KTOA 2TSYB 3KXLA 1ZNZA 2EF0A 3RAGA 3KJEA 3W3AA 3EXHC 4ZAGA 1WUHS 1G1AA 4EOGA 3EXHB 3FDFA 3BE5A 2Q9AA 2HN9A 3NONA 3FPKA 3MWDB 4G5XA 1JIKA 3LC1O 4OB6A 4Y2VA 4EX6A 2IE8A 4DMGA 5IU6A 4DT1B 3SM3A 1JXQA 1Z08A 1ZD2P 1CY6A 3EGVA 3OZCA 2RD2A 3QMVA 1ZEJA 2R5FA 1FDTA 4F11A 4GGOA 1E1QD 1IWPB 3BIOA 4MVJF 3F5SA 4FMPA 1LGYA 1DU4A 3U9LA 4E0BA 1II9A 5IK2D 3K9HA 3OJLA 4FGWA 3CKLA 2X15A 2FR8C 4HPJB 2WAAA 1P2FA 3PITA 5B3JA 1KO5A 3R4VA 4H7FA 2OCKA 2PZ8A 3DCIA 3TJMA 5E4YA 1OGIA 3CWQA 5DYGA 1VGVA 3HA7A 3WLIA 2WMOB 2W6JA 5SY6A 4WACA 1T5IA 1FQKA 3M6XA 3QI2A 3Q8WA 1M5TA 3QPUA 2QTBA 4FNAA 4LEIA 5JWOA 2VDPB 3HM9A 5BN3B 1DQPA 1UOQA 4LCJA 2JGMA 2PJRA 4ZANA 4DC1A 3Q7PA 3D54D 1GNLA 4B4DA 4WLOA 4EA7A 1II0A 1U8UA 3BRWD 3QXXA 5DP2A 1AKUA 2I55A 5JEEA 5FHQA 3OIDA 3CIOA 1GWNA 3LY8A 4GLFA 4PF1A 3OF3A 5IDVA 5C4GB 3RVDA 4C1NA 2JLUA 1T8PA 3M9XA 3K0FA 2VAVA 3W2EA 1NR1A 2XWSA 4IFBA 2EATA 1OU0A 5CH8A 2F3UA 3AK4A 4NXNB 2OVBA 5J59A 4M1OA 5JAPA 3NHMA 3QUSA 2W83A 3ZLVA 4P2GA 5K05A 2P4QA 3VH4A 4EBFA 1NYLA 4HF7A 3TQRA 4ER3A 4RTRA 3O7MA 4IXTA 4PG5A 1ZA2A 3AKYA 3RRNA 4L73A 1X7ZA 4UTNA 4OGLA 3AU8A 3EWAA 3O0DA 3UHOA 1VSQA 2HCJB 2W2LA 4B83A 4JROA 3FBTA 3Q98A 3NC0C 4WADA 3GLHE 1SBCA 4K9QA 1E2LA 1KKLA 2QTAA 1E60A 4FFBA 4BEBA 5JLJA 3C6ZA 4A2QA 1ZSYA 3C7CB 3D4PA 5HZGA 4FU0A 2ACEA 2J32A 2FSPA 3PDCA 4CEHB 1SCUB 2B4RO 1Y9AA 1GNTA 2H7VA 3CZ5A 4JKIA 5K2MA 1I5OA 2QSYA 1E77A 2IIVA 1Z36A 3FKJA 2CLEB 1T6BY 3KM0A 4UM8B 1Z73A 4IV8A 4YH1A 1CDZA 3CCCA 4AJOA 2AWOA 5EEGA 1X1AA 4WKCA 2DFDA 3IUNA 1K4MA 2J3HA 4IBOA 4UUPA 3PGMA 1H69A 1BZYA 1N0UA 2Z95A 4IDDA 4G5QA 5FT9A 3W7VA 1R6AA 5HQTA 3U1BA 4CEJB 1G7TA 5DOZA 1Y7PA 4ZOLB 3SS9X 1DHTA 3E6AA 4QAQA 3E15A 4GHWA 3UB2A 5JZSA 1F1JA 5CCXA 2YWJA 2V65A 3X44A 5EHZA 3H7IA 3UA4A 5AKYA 3PUWA 2AQHA 1OAOC 3MWYW 1QH1A 4XUGB 1Q0RA 1UKBA 4L5JA 4PFSA 3TDMA 2DG2A 3THYB 1I24A 1SUWA 1XZIA 2OORC 1MX5A 5F5XA 1H5QA 1IEVA 2Y0EA 4CDNA 3GFQA 3OPYB 3OTIA 2ZYGA 3IA2A 1CFJA 5DH9A 1FDIA 1ICIA 1IY2A 3NIGB 2OCIA 3WADA 4KRFA 1UBEA 4LJAA 3SSOA 4YV0A 4KXLA 1IZYA 4LZLA 3SM9A 2BFEA 3T8YA 1UPAA 3ABSB 4IHAA 1E7WA 1W29A 2I71A 1Y5RA 1TUBB 1A1SA 3LHDA 3FMVA 1VIVA 3L7MA 3LHSA 3Q88A 4PCUA 3WWEA 3KZ1E 4BRSA 1QPBA 5KSPA 1JLMA 4AJPA 2FVXA 3PTZA 4J7UA 5KQMA 1XXLA 1O4WA 3O9ZA 4IQFA 4ZYYA 3RGWS 1Y4UA 1OWMA 4QT0A 1YC5A 1JEYB 1YIDA 2QENA 2RHWA 3M4JA 4G1CA 4O8CA 1PCXA 2Q8NA 2K87A 3MERA 3V4RA 1KZ7B 1DBWA 4EG4A 5BUQA 4LC9A 3H65A 1SR8A 4YJGB 1A5AB 3ED1A 2WA2A 4RH0A 1W87A 1ZBDA 1ZMOA 4P0TA 4BNIA 4AM8A 2WFMA 4JNKA 3WDMA 3HXLA 2OCDA 3HJNA 1BS1A 4YRIA 2OKCA 4QOSA 4TMFA 1V4BA 3QIAA 5EE5B 2DLNA 1A0OA 2OMKA 1CY4A 2GLUA 1BGVA 4KR3A 2YNMC 3GA7A 5JAMA 4XGQA 2AFRA 4H77A 2V7GA 3C3JA 5J2UA 2P6UA 5KMGB 1A7KA 3GLIA 2V6GA 3EA4A 3TGLA 2NOAA 1BVHA 4Z9AA 5IF9A 2HJRA 4Z1OA 3X2SA 1W34A 4LWQA 5CNJA 1ZIXA 4I6GA 3KVOA 3ZE6A 4IJMA 1NONA 2SCUA 4JI1B 4B2PA 3UK7A 4JYCA 3WFJA 3UXMA 3ZZNA 2ZE8A 5KKAA 2C58A 3KOOA 4Q9AA 3ZZTA 1D7AA 1UWLA 3IMGA 4IMPA 3MUNA 3L7CA 3M4NA 4ILEA 2YWBA 4BLTA 5K8CA 2B21A 4BWGA 4ARZB 5E8JA 5I51A 4BC1A 2I7CA 5BOVA 4EHLA 2WAYA 2FN3A 4O02B 3ZGOA 2L0XA 2WMNB 3DT9A 4LWOA 4UHEA 2Z4SA 2X2EA 3IHKA 4ABTA 1VG8A 3DCYA 3IRVA 2O6LA 2X0KA 3WIUA 2BFCB 1WB5A 2GAFA 2O50A 3TW0A 4EVQA 1KMIY 2HXSA 1BE6A 1FNDA 2IOQA 1TJ4A 1N0HA 1RC0A 1SCDA 2ZI3A 3NR2A 3G2QA 4H3KB 1CZOA 4IHQA 4L0DA 5CLGA 2PYIA 2IOFK 4MV1A 3DOOA 1G59A 1HMYA 1OILA 3VR1A 1ZBQA 3QYAA 4J0QA 2BW0A 4MEBA 2FXIA 2PJUA 1BXGB 5T8KA 1T8TA 1PO7A 3H5LA 1KY3A 1XQWA 4LCBA 4YROA 3EVFA 1N3BA 1P2BA 1CRQA 1IDN1 1VA4A 1CJUC 3D4NA 5H3LA 3W78A 1JBKA 2PK3A 1GAXA 4TV9A 4XPIB 1QTNA 2AJCA 2R8ZA 3L18A 5ESRA 4IZ6A 5PGMA 2G9RA 3UFBA 5C2JB 1USWA 4BKPA 5MF6A 5EWMA 1SD2A 3BXPA 4QBTA 3UAOA 3K9WA 1FS4A 1HRKA 4X3CA 5GP1A 1C29B 1Q57A 1TD9A 1UBKS 3IPLA 4Q9JA 4HT3B 4JI0B 1PHRA 5LFAA 4BNZA 1PV4A 1OSNA 4MRVA 4GXTA 3PE4A 3VTFA 3B52X 4K3UA 1FQJA 4RNDB 4EHKA 5FH9A 1X7DA 2DBRA 4HN2A 4WT7A 3RYFB 3FOAA 3NU1A 3LQKA 2AKYA 4ZVLA 4K0KB 3WWCA 2X3UA 3QWFA 2NPFA 5JSKA 4LF7B 3IFSA 3PQ7A 4RJTA 4F8YA 1QCZA 2ZE7A 3HUFA 3O03A 2GEUA 5E1OA 3W05A 1C8LA 1AOXA 1ZM2A 2AUNA 1OAAA 3WFIA 1PJCA 1D4OA 4K8RB 3VM6A 3QYPA 3H8SA 2O8FA 4GG1A 4ID9A 1FF9A 4GI1A 2BELA 4KC0A 5A9SB 1YWGO 5DNAA 3MWFA 5FJIA 4V24A 3K0FB 3UIEA 2Y9MB 1ZGAA 4YRNA 5C8VA 2YRFA 2BFFB 4KUGA 3UTDA 2D6FA 1PZFA 5EWLB 1Z26A 4FS8A 4GOJA 2QG9A 1WHTB 2C1ZA 2CJPA 1ZUWA 2P68A 2WHXA 3A6GA 2BKXA 1AG9A 1QYXA 2IXTA 3AIOA 3G1UA 3IOCA 3RH0A 3CLTD 1YJCA 3VBEA 4RVGA 3AI1A 4WZAE 1UPXA 1WO8A 1EQUA 3AF3A