5ENDA

Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg)(q152a) from vibrio cholerae
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
244
structure length
228
Chain Sequence
QFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGAANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase FabG
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
total genus 79
structure length 228
sequence length 244
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5endA00
1HYEA 4RQUA 1DEHA 4RZHA 3LC7O 2Q2VA 5DNAA 1UDAA 4E2YA 3IJRA 5JLAA 1I10A 4CUKA 4MVJD 2R6JA 4HX5A 3CEAA 4M49A 5BT9A 3SJUA 1VC2A 1OC4A 3MJVA 4EZBA 1N7HA 3JYPA 2WMDA 4GVXA 5EERA 1TEHA 4FGSA 4E2XA 1PJTA 1W0CA 4G5HA 2O4UX 5U9CA 4CMHA 1DIBA 3I4CA 5G0WA 1DIAA 5JDIC 4E5KA 1TI7A 3D0OA 3DZBA 5JAQA 5G4LA 2HKIA 3P5SA 4PFJA 3ETEA 8ADHA 1TA4A 3GLQA 3OHSX 3VVCA 1EVZA 2EEZA 4OXKA 3KRTA 4YAJA 2VOJA 3UCEA 1YL5A 1Z45A 4XD2A 3GY0A 1HL3A 3BA1A 4UVDA 2R2GA 1YS4A 3QA9A 1FDWA 3NJ4A 1PJBA 3QWAA 3PGXA 1T4BA 2UDPA 3L07A 2BMAA 4GKVA 4IIUA 2P9EA 1U28A 3KM0A 3BTVA 3FI9A 4BV9A 3PHGA 3WGZA 3Q3CA 4LK3A 5TQVA 4NZ9A 1K6XA 2YDXA 1DLJA 2GNAA 3ZW9A 5BNIA 1ZFNA 1ONNA 4IJUA 3D1LA 3INTA 1GFSA 1PZFA 4BUCA 2X1HA 3PJEA 5IAAA 1HRDA 1WDLA 1DO8A 2ZB8A 5KKAA 4YA6A 4R41A 1XLTA 4NG5A 1GV0A 3JQFA 2Q1TA 1IB6A 1Y5MA 3HADA 4WLEA 4RVSA 2OZPA 4NPCA 3WIEA 3QIVA 2YQ5A 4B4UA 2Q46A 1VL0A 4BKPA 4Y8VA 3ZU3A 4W6ZA 3RJ9A 3JQ7A 3VH3A 1PQPA 4CM8B 1M75A 3OIDA 3WGTA 1UH5A 4XQGA 4IDAA 5IZ4A 3BHJA 1UXJA 2IZZA 3GVPA 5C7OO 5TIIA 2YQ4A 3V1YA 2GZ3A 3GOHA 2YDYA 4AJNA 4CMCA 5I9MA 4I08A 4R1UA 3DHNA 1JAYA 5U1PA 5G0SA 1YBAA 1UAYA 4DPLA 2V6GA 3GNQA 2VZ9A 3IQDB 4PLYA 3GNSA 4AJEA 4BNFA 5JO0A 3VC7A 1T2FA 4IQ0A 3IJPA 1YB1A 5IFLA 3C24A 2X9VA 1TLTA 4GKBA 4RLSA 3ZV5A 3JQDA 5JC8A 4ZQEA 2V6BA 4J16A 1PEDA 3JYNA 1GEGA 4E5PA 1I2ZA 3RWBA 1C0LA 1MB4A 5EL0A 1NNUA 1PIWA 2VHYA 1DC6A 1F14A 5G0VA 3V1TC 4L4RA 4J9UE 2CNBA 1QSGA 2I99A 3LF1A 4M86A 1O8CA 3GN1A 5JC1A 4YR9A 1PL7A 5JDCC 2GO1A 4IS3A 1ADGA 1IHXA 3W8DA 4KUGA 5L40A 1YRLA 3OP4A 1R4MA 2FZWA 2UYYA 3CPSA 4Y6PA 2WYWA 3N7UA 4IDBA 4RVHA 4WKGA 4BNKA 2I67A 2VWGA 3GR6A 3M1LA 3H65A 4YJGB 4ROSA 4FFOA 1VKNA 4XYEA 3ZU4A 4IUYA 3DBVO 3S55A 3H9QA 2Z1MA 5DF1A 2VRCD 5A1TA 1H9AA 3FF4A 4F3YA 1I32A 1M76A 3QW2A 4PLCA 5K0ZA 3H5RA 4MVJA 4RF3A 1O0SA 3PZBA 4GLOA 3R6DA 2Q50A 2H5LA 2EHDA 1T2DA 3EYWA 4YVFA 1A4IA 2JFGA 4Y6RA 4YT4A 4MP6A 4GX0A 1UXKA 3LT1A 4ZRNA 3BMNA 1MG5A 4DMLA 2WWRA 1Y8QB 2ZCUA 4DQVA 1PGNA 4EJ6A 1ZSVA 4PG8A 1A4UA 1BRMA 4I9NA 5DCYA 4IQGA 2ZK7A 3ZHYA 1GQQA 2Y0CA 1C0IA 2VTDA 1QP8A 3OF2A 1DBVO 3MJEA 1NR1A 1U8XX 5AXDA 1U5CA 3GEGA 3JD4A 3FSRA 4BS9A 3FNFA 3K2BA 4M1QA 5CEEA 3QE3A 4B3HA 2O3TA 3RJ5A 3GAFA 3JTMA 5COQA 3TQHA 4W99A 3VTFA 1QMGA 4NU5A 1D8AA 3MJTA 4B4OA 4CM6A 1E3WA 1HLPA 5DBIA 5HS4A 5IXSA 1WP4A 1AXGA 5KTKA 4R5MA 4R68A 4P4GA 3GF4A 1EDOA 2C0CA 4N54A 5TJHA 4L74A 1E0DA 3S2FA 1QXSA 3ZWMA 4RORA 4A03A 4J4TA 1NPTO 3I5MA 1ZK1A 3E48A 4J3FA 3LK7A 5DN9A 1ADBA 1IPFA 3TL3A 1YQXA 4D79A 1MC4A 2BFAA 2OO5A 3GAZA 1UDCA 4BNZA 2BELA 4JJIA 1XG5A 4AICA 4ITUA 5ITVA 3HB5X 3I9JA 4NHEA 3VH1A 1LXCA 4BKQA 3NTRA 1QYWA 1MGOA 2X5KO 2DFDA 1AE1A 5ENVA 1KVRA 3ZI0A 4WPGA 2ZTLA 4CM1A 4J2OA 1PJ3A 3OSUA 2YHIB 2HJRA 1KC1A 1ZBQA 3H9GA 4XQEA 4CMEA 4R9RA 3WGHA 3B6ZA 2EIHA 1ENZA 2HK9A 3WYBA 1O9BA 3I9OA 3PQFA 4YQZA 1F8GA 3ZWXA 1GEEA 4IBOA 1R6DA 2EERA 2PZKA 1EBUA 2J3HA 3PWKA 4JQCA 5TX7A 4A73A 3GT0A 2HCTA 2VOEA 4HFMA 5DBGA 1G0OA 4CLRA 1DSSG 2E48A 3F4LA 2YY7A 2Q99A 2GLXA 4NBVA 1OOEA 3JQ8B 3JD0A 4KTVE 4J6FA 4UVHA 5L7TA 2EW8A 4BKRA 3H5AA 4BO3A 3HWRA 5CHEA 2JCYA 2BGMA 2G82A 3X2EA 4Z0HO 1LSJA 2X0JA 3QP9A 4EUFA 5C7LO 5L4NA 3RBVA 2Z5LA 3SBOA 3ZWAA 2PGLA 3L0DA 1MG0A 1GV1A 4EBFA 5FWNA 1WDKA 1T2CA 2IYPA 2LDXA 1PTJA 2WYVA 2NV6A 2CSUA 4Z9XA 1K89A 3KYCA 3TRIA 4WCFA 1TT7A 1U8FO 2R00C 1BXGA 5EJ2A 5MGBA 3P19A 2AXQA 5LDHA 2I3AA 4AFNA 3OM9A 1LQTA 3Q2IA 2CDAA 3VOSA 2I65A 3I1JA 1UXGA 1E3LA 1XU9A 2O48X 4JK3A 3FPLA 3SEFA 4ZD6A 5AXAA 3UW3A 1QYVA 5A4DA 2W90A 2SCUA 1VSVA 1UAGA 2X22A 4WLNA 4FFRA 1P1FA 3AW9A 2WSBA 5K9ZA 1PJ4A 3KB6A 2GZ1A 4FJ2A 1LJ8A 3VKVA 4WECA 3ZHBA 1LTHR 4FC7A 2FRDA 2PZLA 4IMPA 4E13A 1LNQA 2DBVO 4ALNA 3HQ4O 3E5RA 4ND4A 5THQA 1X0VA 3O8QA 3H9UA 4O0LA 1U5AA 1N5DA 3HZZA 1DAPA 2VUSA 1LLDA 1HWYA 3DZHA 4BKOA 1GADO 3PLRA 1QORA 5G4KA 1RYEA 3HSKA 4G2NA 3ZGYA 1BVUA 4FJ0A 2EKPA 2ZCVA 4BVAA 4RJTA 2ZB3A 1PU2A 3CZMA 4UEJA 3WXBA 4DPKA 4L4SA 4PLWA 1UXIA 1GQYA 2VYNA 3AY3A 4DL9A 5KOIA 2NVBA 3RFVA 4PIVA 3HE3A 4ZQBA 4BO2A 3NJ8A 3WR5A 1KEWA 4ZGWA 3HN2A 5CPFA 2GCGA 2GRAA 3RASA 2O2YA 4DXHA 1C3VA 4JXKA 2ZJ1A 2WD7B 2HK7A 1SEPA 4OIMA 1EVYA 4OXNA 1H94A 4PZDA 5IDWA 3GG2A 3W8EA 5KVCA 1H9BA 1UZLA 1ZH8A 5TF4A 1BG6A 2HAEA 3QVTA 4TZTA 4CM7A 3BIOA 4CQMB 4MP3A 3BMCB 4H16A 3DZGA 1U3UA 1Z73A 2D5AA 2NADA 4MVJG 4CMBA 3ZV6A 4I5FA 2VT3A 2O3RA 1K5HA 3AJRA 1YQGA 3C7DB 3JQ6A 3JQCA 4FN4A 5DBFA 4FBGA 4CV1A 1ZK3A 5DZSA 3U9LA 3AK4A 1VJ1A 1P31A 1KY5A 3PYMA 4PG5A 4ALLA 5CDUA 1YL7A 1ISIA 4JNKA 2PA3A 2BI7A 4TROA 2RIRA 2PH3A 3VPHA 2AQKA 5K6AC 5EMHA 1HE3A 1U3VA 1N8KA 1ZMOA 4TRRA 1Q7BA 4ND5A 3ZDFA 1SC6A 4YAKA 2IXAA 3EY4A 4XGKA 4II3A 1IZ0A 3IUSA 2CVQA 1V3UA 2HO5A 1HF3A 3SLGA 1Z6ZA 1X7HA 3FNEA 4W82A 1LI4A 1HE4A 2A92A 4F6CA 1RPNA 2HRZA 4ZQFA 3RUFA 1AHHA 3PYXA 3NDJA 5COAA 4BO8A 3RQSA 4IPTA 1OFGA 3BHIA 5JNLA 3NTQA 5BSFA 1R0SA 1R66A 4GL4A 4ALKA 4P4LA 1YVEI 3WGYA 2PTGA 1BW9B 2RAFA 4MPDA 4CM8A 1P1KA 5JYDA 3LT2A 5FI3A 1SZJG 3GVCA 4TRMA 2DTEA 1U9JA 3KEQA 3NV9A 2AG8A 4RDHA 4XJSA 2PLAA 1W73A 4RF2A 4BB6A 3DQPA 3GUCA 2Q2WA 3OA2A 3T4XA 2J3JA 1XIVA 1VSUA 2PZJA 3LC2O 4IIVA 1K0UA 3IAHA 4RQTA 4AJ2A 1JU9A 4YEDA 5I7FA 3MOGA 1Q2XA 3GZNA 4NMHA 3C8MA 1I24A 3EDMA 1AHIA 3DDNA 1HDOA 4ONEA 4GI2A 4QO8A 4A0SA 3U62A 2O7SA 4YAIA 3VVBA 2JD2A 2NM0A 3KSZO 4LISA 1I2CA 1UDBA 2GN9A 2X86A 4CV0A 3H5NA 4OMUA 1K6IA 4Q3BA 3WQQA 1GY8A 2BLLA 1O89A 2Q2QA 3G17A 3ZCXA 1RM0A 1BMDA 2NVUB 1PL6A 3ICCA 3LF2A 3UOGA 1PWZA 1XGKA 3FBGA 4MOWA 2G17A 3VPFA 2A94A 2FR8A 4YT2A 4CPDA 1QLHA 3OA0A 4BNWA 2HK8A 4ND3A 4W9NA 4U0JA 1JWAB 1NP3A 2OBYA 2YFQA 2FZEA 1XA0A 5DP1A 4BGUA 1H6AA 4OSPA 3OH8A 3DFZA 1FMCA 1YDEA 3MJCA 4JBIA 4Q3EA 3UFXA 2B4TO 1A7AA 1U4SA 2HMTA 4MVJM 1PX0A 1P1IA 2WTBA 2D4AA 2E37A 4KMSA 3WGIA 4KQWA 1NQ5A 2DUUA 2H9IA 2BFOA 3VHRA 1LEHA 1TT5B 5JAMA 3JQBA 4BMNA 3CE6A 1QKIA 3ZV4A 4DC1A 1D1TA 5GMOA 1OMOA 1ZK2A 4ID9A 4BOYA 1MP0A 4YJGA 4K9DA 3WDSA 5IJZA 4YPOA 1E3SA 1D1SA 1LDBA 3D5TA 5T8KC 2EKQA 3VZRA 2CMDA 4OYRA 3RVDA 3V2GA 1DIHA 1XWFA 1YE3A 3E8XA 4E5MA 4JCOA 3PFWO 2B5WA 5ICSA 1Q7CA 3JQAB 3ENNA 4I9UA 5L51A 2GYYA 4PRLA 3AY7A 2FSSA 4OL9A 4XGIA 4K28A 1PWXA 4E3ZA 5TNXA 1X15A 1UJMA 3PPIA 1NTOA 4KWHA 1J4AA 3EVTA 4OKNA 1DC3A 3OECA 4CLOB 1Y8QA 2EWMA 3BMQA 1G1AA 3UHAA 4HY3A 5L95A 3UUWA 1V0JA 2QHXA 4CODB 2VHWA 1FJHA 1ML3A 3C3XA 5EQDA 5CDYA 1N9GB 4YAEA 1H2BA 1GAEO 1B26A 1PZHA 3I9LA 3KBOA 2EF1A 4CJXA 1ZK0A 3TZKA 1OAAA 4KZPA 5T64A 2WEKA 3HDJA 3BTUA 2HDHA 4NI5A 4S3MA 4J0EA 3RAJA 5I7VA 3OJ0A 1R16A 4RPJA 4XIYA 4U8GA 5KVVA 1QYDA 4AJHA 3KOUA 4J1QA 3LQFA 1X7DA 5DULA 1B14A 3NRCA 1EQ2A 4WE3A 4BIIA 3RUHA 2UAGA 4DBZA 3INGA 4R3NA 2WDZA 2DUWA 4E12A 1DRVA 3EW7A 2UUOA 3D4OA 5TC4A 4R1NA 5DT9A 2Y68A 1PS8A 3H3JA 2YUTA 1E7QA 1O95A 2IXBA 3UAGA 1SMKA 4MP8A 4DIOA 3T7EA 1MFPA 2JHFA 1Y8RB 1P33A 4JP3A 3LLVA 5A9SB 1EEHA 4L75A 4R54A 4EEXA 1IOLA 3ZHZA 3I9MA 2PH5A 5KVSA 2HRBA 3QVOA 1JKFA 3MOIA 4URFA 4GVLA 1SO8A 3WGGA 2P9CA 4YT8A 3L9WA 1SCUA 4NR0A 4UULA 1HETA 1M6WA 1FXSA 2YHIA 3DBRB 5EPOA 4B8WA 3F9IA 3GN2A 4KDEA 5B4UA 4IQ8A 5JAIA 3E9NA 3MJSA 4W7HA 1P0CA 2VUTA 4XKJA 1FK8A 2ZB7A 3W6ZA 3IP1A 2QIOA 5HWSA 5BQFA 1R4NB 1CQIA 3LT0A 3VPXA 2WM3A 1KIFA 1ZW1A 2VHVA 3UGKA 4JJFA 2BFMA 3ANMA 1F0YA 3NDIA 3VPSA 3WGQA 4AJIA 4ZJUA 4DMMA 2DBRA 3GZ4A 3ABIA 3JQ8A 3DTTA 4C7KA 2ZYAA 4E4YA 5AOVA 4BO1A 4ALMA 2A35A 4RVUA 4TKMA 3DONA 3PXXA 1LLUA 1C0PA 3CSDA 1T2AA 2HMUA 2VWPA 1PJSA 3CH6A 3L4BC 4TSKA 5TS3A 1UZMA 3O9ZA 4TVBA 4HXYA 1E1MA 4GSKA 1KEUA 1ARZA 1KC3A 4DPMA 4H3VA 3RUEA 4B7CA 1WWKA 1UP7A 3PHHA 3RROA 2AEJA 4FOSA 5KCZA 3TSCA 4Q3CA 1YOVB 2PKQO 4UVIA 4TRJA 4BNIA 2EV9A 2IRWA 4IINA 5U4QA 1NXQA 1M67A 5EQFA 2F1KA 2GN4A 3GDOA 1ENPA 4JROA 4PN3A 4K1LA 1CDOA 3WJAA 3CUKA 3PIDA 2A9FA 5L53A 2YFHA 3KXDA 3B20A 4QFDA 2WJPA 4NFYA 3WYEA 4EITA 2QG4A 1OI7A 2VCYA 4XB1A 4D44A 1DLIA 2Y1CA 3DFUA 1HE2A 4A7PA 3BHMA 3G1TA 1Y5RA 1Y7TA 4CL8A 1NFRA 4O1MA 4F6LA 1XQ1A 1LLQA 1B8VA 4ZRMA 3WWZA 1MC5A 3MTGA 3TF5A 1MA0A 1SOWA 2YV3A 1IULA 3TN7A 4IDCA 2Q3EA 4R16A 1NM5A 4CLXA 3ZNPA 3JSAA 1B8UA 1N7GA 1Y1PA 3I6QA 4G65A 4O63O 1PZGA 2EJVA 2X9NA 3E1KA 2H1SA 3ZWYA 3SXPA 5C7IO 4INAA 1QLJA 4F46A 3I6IA 3S8MA 2YZ7A 2P9GA 1WDMA 2O3QA 1LSUA 4NBUA 3DOJA 2Q45A 4WOJA 4M54A 4MIYA 4OSOA 4NBRA 3TDKA 4OH1A 3PDUA 4WEOA 4NJMA 5LCXA 3BMOB 1HSOA 1P1RA 2DBQA 1Q7GA 3RU9A 1JW9B 2WD7A 2ZQYA 3NT4A 2VWQA 2BF7A 1DHTA 2NACA 5ADHA 4LN1A 1L1FA 3ULKA 3DBHB 3PP8A 3KHUA 2J3KA 1CJCA 3CIFA 4MINA 3ZWCA 5FYDA 2AW5A 4IDFA 4CQMA 4CMAA 1BHSA 1QRRA 3BMCA 2B36A 2FSVA 4NIMA 1LDMA 4H7PA 4YJFB 1Y81A 3V1UA 4YRDA 4CV2A 3DHYA 3QVXA 3TJRA 3KETA 4AG3A 1XDWA 1E3EA 3GQVA 1HE5A 3TZ6A 5JAZA 1PL8A 5JDIA 1EFLA 4N5NA 4E30A 3GH3A 5AVOA 3ZH2A 4QSMA 3ONEA 4FCCA 1YXMA 3D7LA 3K96A 1GCUA 5A05A 5EESA 4PCVA 3D4NA 3PK0A 4MIOA 4ALIA 3MJ4A 4UAGA 4PG4A 3K5PA 4GMGA 2PWZA 4XA8A 3AFMA 1D7OA 4EI2A 1DOHA 5DOZA 3W1VA 3TPCA 4DQUA 2Y93A 4CMEC 5LC1A 4KUEA 7MDHA 3TOZA 4BKUA 1ISGA 4WLVA 5CAEA 2AQIA 2DVMA 3I4FA 4UVGA 3E9MA 1GYQA 2O3UA 3UCFA 2FPIA 3IKVA 3QWIA 4XDYA 2JCVA 1LC0A 1LDNA 4GWGA 1XR3A 1RWBA 4PLFA 4BNGA 5ILGA 3FPCA 4HFNA 5THKA 1XSEA 2CZCA 2NU6A 3JD3A 5GZ6A 3U09A 2IODA 3DHEA 1FDTA 1QYXA 5HBRA 2PKRA 3BAZA 1P45A 1ZXBA 3EZLA 2ILTA 3R1IA 3WMXA 3WLFA 2QRJA 1Z75A 4N18A 4I1IA 1HT0A 1Q0LA 4JBHA 1YO6A 4OQZA 3PQEA 3AY6A 4GX5A 5JO9A 1LDEA 1B8PA 4YT5A 4LSWA 1BXZA 2VYND 2C82A 3CKYA 4RF4A 2VHZA 3SX2A 4YCAA 4FS3A 3UKOA 3V5NA 4G81A 1YB4A 1E7WA 2YHUA 4RCVA 1I3LA 1P1HA 5L3ZA 3VZQA 5AQ1A 2AG5A 4J9VA 3ITDA 2Q49A 4BV8A 4WCFC 4C7JA 3BXXA 5CG2A 2PD3A 1P77A 4E5NA 1PGPA 3WFIA 3VDRA 2ZYDA 2NVUA 4YDRA 2C5EA 2JAPA 4EYEA 4J1SA 1E7YA 3W4KA 2OP0A 3QWHA 1BDBA 1E7SA 1C14A 4LMPA 3O26A 4MVJH 3D3EA 4B7UA 3DR3A 1E6UA 4IMRA 3ZWNA 2FHSA 3KSDO 4RVFA 5A3VA 3PWZA 4KDFA 4MVJP 1T1RA 1TT5A 4NK4A 1R12A 5IXYA 3GG9A 1KETA 1GDHA 1R37A 3HDHA 2EJWA 3M1AA 4HP8A 1O5IA 2NTVA 3KUXA 3T7CA 1ZKMA 2FWMX 3DBLB 6ADHA 1NWHA 1YJ8A 5IDXA 1J49A 5BSGA 4GQAA 1NWCA 4QFCA 2GGSA 1NVMB 1WXDA 4BNJA 1I36A 2CY0A 4L76A 4LCEA 3GPDG 3DZJA 1SEVA 3B1KA 3JQAA 2OL4A 5COBA 3ANNA 4EJMA 4U6SA 1B7GO 3SLKA 3FN4A 4KUHA 1JVBA 5ITWA 3U4IA 4YAGA 1KERA 1F17A 2CD9A 4UEOA 4CLOA 3WBBA 2P5YA 4A26A 2RCYA 3Q9NA 1IUKA 3QV1A 1A7KA 1EVIA 1KVQA 1A5ZA 3ANLA 5IZCC 3ZNQA 3LVFO 2V6MA 5BSEA 1GPDG 1N9GA 1YGYA 4D42A 1DFGA 2Y99A 5JS6A 3V2UA 3JQ9A 4R9SA 1NFFA 3D3WB 3OJFA 5I9LA 1B3RA 4BO7A 5B4TA 1GR0A 2JFHA 3DAPA 5EINA 1M2WA 3WYCA 3R0IA 4U7WA 2O2SA 2I3GA 3RUAA 3RU7A 4BNLA 1KEPA 4TWRA 3A9WA 5HRUA 3QVSA 2OP1A 4PG7A 1H5QA 4E2WA 5B37A 3U49A 3PEFA 3WS7A 4E5YA 2XXJA 5I7EA 3N58A 1VM6A 1YB5A 4CMKA 3Q0EA 1E6WA 1GZ6A 4BHTA 2DPHA 1Y8RA 4S1VA 5A9SA 1FDUA 3WGOA 5T67A 2GERA 4MJLA 2EP7A 1HDGO 1WLYA 4PG6A 2D0IA 2CF5A 5JY6A 1GCOA 2NNLD 2EGHA 4FR5A 2NTJA 5CDGA 4E33A 5B1YA 3U4CA 5JBIA 4W7IA 1EE9A 4ALJA 3FD8A 4HNHA 1PGJA 3ADOA 1S7CA 2NSDA 3FR8A 4YTEA 4XYMA 3C1TA 1MUUA 3KZVA 3F1LA 5DCWA 3DBRA 4R1SA 1E7RA 4EUEA 4D0RA 2HJSA 5JE8A 2O50A 2RH8A 1OZAA 4AJOA 1Z74A 3GC6A 2NU9A 4Y67A 2JKVA 5IF3A 2AQ8A 5DCUA 2XOXA 4H15A 4JN6B 4IGFA 4U5QA 3RC7A 3W4JA 4FJ1A 4RL6A 3CZRA 3DMTA 2B4RO 3EAGA 3E18A 5T5QA 3VPGA 4YWJA 3EUWA 2C59A 2V6FA 3QRWA 3VTZA 1HXHA 2DBZA 1EE2A 2JD1A 3ASUA 3ROKA 1I3NA 2D59A 3PJGA 5A5EA 3BYZA 4MKXA 3JQ7B 3VH2A 1GD1O 3AU8A 1P0FA 1N1GA 3ZW8A 4D41A 4D3SA 2HMVA 9LDTA 1BWSA 4Z6KA 4XQ9A 5F1KA 2DFVA 3G1UA 1N92A 3GMDA 4OM8A 4GPD1 4BNVA 1ENYA 3IC5A 5G0UA 2NUAA 3PJFA 4GSLA 2I76A 2HMSA 3ITKA 3OIGA 2VNSA 2P5UA 2POQX 5JCXA 4QTZA 1XEAA 4HNGA 1DRWA 2JJYA 1JDJA 1NQTA 2J3IA 3DAGA 4BNUA 1LDGA 4W9NC 2Q1SA 4E32A 4JJGA 4PVDA 7ADHA 2PR2A 4CMIB 3GMSA 4XYGA 5FI5A 4MDHA 1C1XB 1ZK4A 4FFLA 2P68A 1R15A 2C07A 5CFZA 4DGSA 3JQGB 4CM4B 4NU6A 4GX1A 5TGDA 3AUAA 4MIEA 3KV3O 3UXYA 3SVTA 3JQBC 2DTDA 3LSYA 1ORRA 3G0OA 4IDDA 1SB8A 5DOVA 3JYLA 4OO3A 1E77A 3C85A 1PS9A 1ZJZA 4MVJI 4DIBA 4QECA 3H7AA 4Z9FA 4YACA 1CQJA 4AJ4A 2IDZA 3ON5A 1M66A 1SPXA 3R3JA 5KKCA 1WVGA 1ADCA 2ZIZA 3E6AA 4B3IA 1LLCA 1JVSA 3WBFA 2W2LA 3CMCO 4QEDA 5BNTA 2PY6A 1EUZA 3ZU2A 3A1NA 1LRLA 3UH1A 5G0TA 2VYVD 1U7HA 5HS6A 1GQ2A 3R3SA 1E6EA 5ILOA 3DEYX 1R0LA 4IGEA 4JLWA 4LSMA 4TVOA 5ICMA 4RGBA 1H6BA 3JD1A 3S2GA 1V8BA 4PLGA 2GASA 2O4CA 3PHIA 4OOFA 2OXIA 4Q39A 4XJTA 4CM9A 1KBZA 4NH4A 3AI2A 4PLTA 4RV9A 3ROQA 4BMSA 3HUDA 1I8TA 1SBYA 5F5LA 4WOKA 1FDSA 1T2EA 3GDFA 3GHYA 3BMOA 5KVQA 4Z3KA 1WZIA 3A4VA 5IG2A 1HYGA 2G5CA 3OBBA 5LDGA 4JIGA 2BGKA 3QHAA 1NHWA 4E0BA 5HM8A 3GDGA 1UZNA 4RZIA 4DLBA 2X23A 1PGQA 2AE1A 3JCZA 3WFJA 1AXEA 1GUZA 3G3EA 1KVTA 3U4DA 4XCVA 3TL2A 5J23A 4DTIA 3H6KA 1M6HA 4FGWA 5JYEA 3ZV3A 3LT4A 2HLPA 4DVJA 4YJFA 3AI3A 4D43A 1E5QA 1UR5A 3ETGA 1HKUA 1EMDA 3F6YA 3L6OO 5HA5A 1C1DB 2OUIA 4D7AA 2UV8A 4BMVA 1ZSNA 4DWVA 3VAZA 3O03A 3W8FA 1SNYA 4PRKA 3DOCA 3GEMA 1H6DA 3H9EO 3H2ZA 1NFQA 4CLDA 2Y05A 3B1FA 1GUYA 1NVGA 3C7AA 4GH5A 4MKRA 2BRUA 5CEJA 1R0KA 4FQ8A 2BHLA 4BGIA 5JXWA 3ENKA 4QUKA 3P2OA 4LVCA 5A02A 5HTOA 4FFMA 3JD2A 5K6AA 3FRJA 1DAOA 1ISJA 1LRJA 2Y1OA 2OGUA 2I6TA 1D3AA 1E92A 3HJAA 4FW8A 3O38A 4DYVA 2GPTA 3HDQA 6LDHA 4XZ3A 3F1KA 1FF9A 4XYLA 1JWBB 2BH9A 1PJQA 1WZEA 1U3WA 1F12A 2GDZA 3WNVA 3ONDA 3AWDA 3FNGA 2PD6A 5KJ6A 1DDOA 1YONA 4IJWA 2JFFA 4J43A 3AUSA 3DTYA 3K9QO 3AOEA 1I2BA 1P44A 2NTNA 2CFCA 4EGFA 3WJ7A 4CQLB 3JYQA 1ZJYA 2DLDA 4UUPA 1I33A 3OQ1A 4XQCA 1ZVMA 4FFNA 2EG9A 2X5JO 4CR8A 1MXHA 1I30A 2TMDA 3X2FA 2AQHA 5A9RA 3SC6A 3QQPA 3JV7A 2BKAA 5I8ZA 3QVWA 3ZU5A 4BQPA 4CMJA 4WEQA 2O3JA 4QT0A 3KYCB 2VWHA 4WCFB 3EHEA 4LRSB 3GVXA 1I0ZA 2OHXA 4D46A 4CMGA 3NX4A 4CQMD 4R01A 2HMWA 2VHXA 1PJ2A 1T25A 5ENDA 1NAHA 3I9NA 2VYVA 2X5OA 1NX6A 3W6UA 2IZ1A 1EZ4A 3MEQA 3DZKA 1ZCJA 2IZ0A 3IIEA 3JQFC 4BL5A 4WGGA 4LGVA 4L4XA 4NNJA 1P1JA 1NBOA 4WJZA 3PIIA 5JW6A 1CEQA 4OXYA 1I01A 3KLMX 1EUDA 2J6IA 5CP8A 3TWOA 1E3JA 1RJWA 3OJLA 1U4OA 3B70A 4QO7A 4B4WA 1X1TA 1QR6A 3C1OA 2G1UA 4IXWA 3AM4A 3OFSA 2Q4EA 4IY1A 1GYPA 2DU8A 3WB9A 2EKLA 4Z0PA 3AFNA 1Q0HA 3WG9A 4NBWA 1HYHA 1YKFA 3LC1O 4J4BA 1EFKA 4TRNA 2OBNA 1U1IA 1DHRA 3ONFA 1LBEA 1X7GA 2AHRA 2B4QA 1GZ4A 4ND1A 4NJOA 1VJTA 2XAAA 1UXHA 4DQXA 1HSZA 3TZHA 1W4ZA 1E1LA 4YXFA 4FFPA 5C5IA 3HB4X 3TFOA 2UUPA 2PK3A 1BVRA 4E21A 5KNLA 3IDSA 1LC3A 5CG1A 4UVEA 4AJJA 2G76A 4N7RA 4OGWA 3D3WA 4GMFA 2GUGA 2XXBA 3O4RA 4LRTB 3PZRA 1PJCA 1BSVA 4HFJA 3WTBA 3ZZNA 4CR7A 5CPBA 4JX8A 2ZATA 4A5OA 5KJFA 3HN7A 5JCJA 1IPEA 2FOIA 4DLLA 1ZSYA 1PQWA 4OHUA 2GN8A 3WSWA 4LW8A 4EDFA 1MV8A 3GUYA 1JLLA 3NGXA 2DT5A 1KVSA 3WQRA 3WTCA 3WQSB 1HZZA 5GZ3A 5F3RA 1CF2O 1EK5A 2AA3A 2YJZA 3ASVA 3OQ6A 4RVDA 4P22A 3RBZA 5BR7A 5JSFA 1UP6A 4IZIA 1LU9A 4D3DA 1CIVA 4Q3DA 4DBVO 3QJ5A 1P3DA 3ZWPA 1NQAO 1ISFA 4DREA 2Y0DA 3KO8A 1YL6A 3OJOA 2V7PA 2PGDA 2W2KB 1ZMTA 4L0QA 2ZQZA 4NFSA 2OORA 1WMAA 1L7EA 1LSOA 1HEUA 4MKZA 4WUVA 1ZXLA 2EW2A 1ZUD1 4YJHB 5G2OA 4XR9A 1YBVA 1DIRA 1TXGA 4ZQHA 2RH4A 1X0XA 3KYDB 3ZWOA 4I9HA 4Y9DA 4YJDA 4EW6A 4OKIA 1E3IA 2DTXA 1ULUA 3T4EA 3OEWA 1ENOA 2HQ1A 5T57A 3WWYA 2OOSA 3MTJA 4RVGA 3VZPA 4DIFA 1T26A 3DOOA 3F47A 3PI7A 3VZSA 3WOHA 5BNFA 5I9NA 1J5PA 2QZ9A 2B83A 5KJEA 1O94A 4RPHA 2X9GA 4XDZA 4NDNE 2OMEA 2PFGA 3DC2A 4J7XA 1K6JA 4R69A 4GX2A 1WAMA 3JQAD 1XQ6A 1SB9A 2Q1WA 5C3MA 3KTDA 3TZQA 3QSGA 4DLAA 1E1NA 5KWEA 2I9PA 3NDRA 4FPXA 1VRWA 3H4VA 3ZN2A 5DDIP 4CR6A 4R1TA 2A4KA 3FWNA 3PHJA 1X14A 4CV3A 4P38A 5JMWA 1U3TA 4E2ZA 3E03A 4YYZA 2FR1A 3BTOA 2P4HX 2ZTMA 3GPIA 1ULSA 2CF6A 3D4PA 1E1KA 1QV6A 3GFBA 3FCOA 3LZ6A 3MZ0A 3GZNB 4IXTA 3S1LA 3W4IA 4DA9A 3C7CB 4LMRA 4O59O 1VKOA 3L4BA 4XGNA 1W8DA 4A27A 4BO5A 3LDHA 4PVCA 4XRGA 2O23A 3NT2A 2VUUA 4GGPA 1GZ3A 3RKRA 2Y1DA 3DWFA 4GGOA 4OQYA 4CMIA 3LLSA 4I8XA 3CTMA 3Q9UA 1C1XA 5A5FA 4K6FA 3HG7A 4FD3A 2QRLA 3KSUA 1A9YA 1CRWG 3LU1A 5IDQA 2QYTA 3LYLA 4WNCA 1KEVA 3GHHA 3JQGA 4CM4A 4WLFA 2Y1EA 5FEUA 4FC6A 5TLSA 5JFOA 4TKLA 3DZFA 1HLDA 1SOVA 3OETA 1KVUA 2CDBA 3VDQA 3NEPX 1E7MA 4XRRA 4CLEA 1X13A 3AUUA 3KVOA 3V8BA 3RIHA 2JD0A 4BNYA 5A04A 5H81A 1NHGA 1MX3A 2B69A 3UF0A 4KOAA 4N5LA 1NASA 4PZEA 3PDJA 1LQUA 5TRTA 3RUCA 1DC5A 2W98A 4XR4A 1U2DA 2EXXA 3A28A 1W6UA 1BTOA 1G6KA 3AI1A 5JMPA 5CEFA 2X0IA 3IL2A 1PGOA 4L8VA 3PLNA 3ZWVA 4TMFA 3RD5A 1BW9A 1I3KA 4ZA2A 4RPKA 2PZMA 1VJ0A 2YV2A 4NFHA 2P2SA 1FDVA 2Y1GA 5TSDA 4WNIA 2WE8A 4IS2A 1Y9EA 3FHLA 2AE2A 4AL4A 4LVUA 3QWFA 1DFHA 3EGOA 2ZKLA 3PFFA 1ZZEA 2B37A 1IYZA 2WYUA 3U4HA 1EBFA 2BD0A 5A9TA 2GN6A 3JQ9C 1H0KA 1VLLA 5F5NA 1LSSA 2QYSA 4YRBA 3BMQB 2DKNA 1H93A 3D5QA 4KWIA 4GLLA 1IE3A 2FPGA 1EK6A 1MFZA 3FTPA 2JAHA 2NQ8A 4RPLA 2CDCA 5F1PA 3TNLA 3DZIA 9LDBA 2VZ0A 3PHLA 4FOOA 4M55A 3S2IA 1F06A 1JKIA 2XF8A 4BGEA 2XPCA 5MDHA 2C2XA 3GGGA 1N1EA 3HNPA 2J8ZA 2FY8A 4I5DA 1VI2A 1XKQA 4PLPA 1HDCA 3RC2A 1X1EA 2ZB4A 2Y1FA 2ZTVA 2QX7A 3F5QA 4M89A 4C4OA 2C29D 1Q0QA 1PZEA 1C1DA 1V3VA 4HWKA 4ZHSA 2D3TA 1IL0A 4M8SA 4D0SA 4B79A 1RM3A 1QG6A 1Y6JA 3SC4A 4PLHA 5BSHA 1A71A 4L73A 4AJ1A 1ZNQO 5IN4A 3OICA 2X0NA 3BTSA 4XEHA 2C7GA 5JDCA 2PNFA 3SJ7A 3GEDA 1U7TA 2AEMA 3ZWBA 1RM5A 2IEDA 3GK3A 3I83A 3NGLA 2VZ8A 3UCXA 3WLEA 1PJLA 5I7SA 1XCBA 3IUPA 2E6UX 4PZCA 4BO0A 4A10A 3NT5A 1CERA 1LUAA 3DMTC 2YYYA 2C54A 4B4VA 3D64A 4HBGA 4WCDA 1IZ9A 3CINA 5I8WA 5AYVA 4MO2A 4Z0TA 1XYGA 2W2LD 5DP2A 5L4SA 4BNHA 4QQRA 1T24A 1KOLA 1VPDA 5F21A 4ZN6A 3ICPA 4HADA 2QRKA 3Q6IA 3OEYA 3F4BA 1DXYA 4J90A 1T4DA 1OC2A 4I5GA 4BO9A 1ADFA 3U3XA 3JQEA 2PGJA 2EGGA 2X4GA 3RSHA 4AVYA 4EUHA 1YWGO 4R3WA 1B16A 5GY7A 1PR9A 2WD8A 2GZ2A 4LCJA 4RDIA 4CM9D 4YB8A 5KIAA 4CQLA 1VL6A 4GAEA 3VH4A 3A14A 2NU7A 4ND2A 2VN8A 3I52A 1NAIA 3P7MA 1DIGA 4ZVVA 1PS0A 5EIOA 5TT1A 2P4QA 2X7HA 4U6QA 1ZEMA 1AUPA 3EK2A 3FNHA 4N5MA 4YRAA 4R5HA 4PLVA 1CYDA 5A3JA 3MWEB 1JN0A 2TMGA 3M2PA 1LRKA 2DQ4A 2W4QA 3AUTA 2RBEA 3ZNNA 1AGNA 2Y66A 3GRPA 4TZKA 4Z9YA 4CLHA 1TVEA 2QQ5A 1GPJA 3K30A 4HFRA 3U5TA 2D2IA 4FB5A 1NPDA 4IJKA 3GNTA 1ISHA 2JL1A 3GVIA 3H9JA 3AOGA 5C37A 4KQXA 1NVTA 2B35A 1IHYA 5H82A 4RF5A 5L7WA 1V9LA 1ZIDA 2VRCA 3RBXA 3QY9A 2AMFA 1GTMA 3AU9A 3RKUA 2D5CA 3WIDA 4CM3A 1A27A 4J7CA 3ADPA 3L4SO 2X58A 4OJNA 2B5VA 2Q4BA 3AM3A 3INRA 1V6AA 4Z3DA 4TQGA 1R4NA 1JKJA 3Q11A 3WICA 1B15A 1KY4A 8LDHA 4Q9NA 4NQZA 3RUIA 3WSVA 3ZHXA 2EP5A 3P2YA 2C7VA 2GSDA 5CDTA 3G49A 3DO5A 3PWSA 3DAFA 4IM7A 1V35A 1HTBA 3E9QA 2DAPA 5T6BA 4CUZA 3C1AA 3IMFA 4IDEA 2FMUA 1UUFA 4JBGA 3AM5A 2VT2A 5F1OA 5KJCA 4XYBA 1YH3A 2ZJ0A 4BB5A 1JQBA 4OOEA 2GF2A 4K26A 1EUCA 1QYCA 1T1SA 2W8ZA 3KLPX 3M2TA 1HDZA 2H63A 4QXMA 3OMLA 2DC1A 4FDAA 3UVEA 3RI3A 1YOVA 4WLUA 3STHA 3S2EA 3H3FA 1J0XO 3JYOA 1OBFO 1KYQA 3IOYA 2YW9A 1A72A 4NJMB 2C2YA 2FPPA 3ST7A 4AJPA 4CUJA 1ID1A 3Q2KA 1ONOA 3RC1A 1WPQA 4B7XA 3ZWWA 3L6EA 1ZO8A 3NUGA 5IZCA 2VTEA 4K6CA 5ES3A 4ILKA 1AN9A 3ORFA 4UUOA 1GU7A 4R51A 1I3MA 3H2SA 3ETDA 3K31A 1RM4A 2QZZA 4B8ZA 1Q1NA 3K73O 3TOXA 3RUDA 2R00A 1XU7A 2B0JA 1NPYA 2O3SA 2AEFA 3GGPA 5ER6A 5FFFA 1I5RA 2H6EA 1DPGA 1VE9A 3ROPA 2NQTA 3ZNOA 4NK5A 1R4MB 3BZUA 4O5OA 3NYWA 3V2HA 3MWDB 4Q3NA 1H6CA 2RHRA 1DB3A 4DC0A 4MVJF 1GUFA 1O6ZA 2W2KA 3OIFA 3DL2A 5JPIA 3K6JA 2PV7A 3K92A 1HDXA 3I23A 4YJHA 2CVOA 4A2CA 2QW8A 5B4VA 1JTVA 1JAXA 3KYDA 3VKUA 1MLDA 1BGVA 3GA0A 1B3BA 1TB4A 4ZICA 4J0FA 4GWKA 2ET6A 4MVJE 3GRKA 3EMKA 4BNNA 5L45A 2CUKA 3GFGA 2JHGA 3KEOA 1YBMA 1ZEJA 4J2HA 3L6DA 3K2EA 1GYRA 5TJ9A 4J1NA 2J5RA 2IE0A 1WW8A 4Q3AA 4YQYA 3BMNB 3DB2A 3WNQA 4BNTA 2J5KA 3F3SA 4W4TA 1JA9A 4UEKA 2VQ3A 1HZJA 1MXFA 3F5SA 3AOEC 4DRYA 4R4JA 3NKLA 5A06A 3WMWA 1YQDA 2I66A 3KYBA 1IY8A 2DPGA 4M87A 1DJNA 4AJKA 3EZYA 1Z7BA 1F8FA 3DBHA 2BFPA 3FBTA 4BO6A 2ZYGA 1V3TA 3ROMA 1YJQA 3COSA 3I9KA 4Y6SA 3IS3A 3K8ZA 1K3TA 3PQDA 1CETA 2D1YA 2Z95A 3CXRA 1HDRA 4BQRA 4BNXA 4RPGA 2I5PO 1QV7A 4J7UA 4CL3A 2OFPA 5L4LA 1E3WB 1J6UA 3G79A 4KP7A 4E6PA 2GR9A 4HV4A 4WASA 3PRJA 3A06A 5KJ1A 3EVNA 2LDBA 4IZHA 3H8VA 3PYLA 4II2A 1A9ZA 5B12A 4RLHA 5FF9A 1LA2A 3OJEA 5L7YA 2X6TA 5JCJD 1KS9A 2VRBA 1E5LA 3FWZA 4I5EA 5IN5A 4BO4A 4F45A 4ZQGA 2D8AA 3PVZA 4P8RA 3MCVA 1C0KA 1NR7A 4FIZA 3UN1A 3M6IA 1Z82A 3Q1LA 3NAQA 4XIJA 3RC9A 3U0BA 1NYTA 1PR3A 1Y9AA 1SAYA 3OQBA 5GZ1A 2IYOA 4GBJA 1S6YA 1U2GA 3HFSA 1EVJA 1ISMA 5L9AA 3QLJA 1WNTA 1L7DA 1BDMA 4Y98A 4J4HA 2C5AA 2BI8A 3PGJA 1RKXA 4ESOA 2NVWA 3GVHA 2X0RA 1N2SA 1XHLA 4IJVA 1DC4A 2BGLA 2NWQA 4XWYA 4CM5A 5IDYA 2CVZA 3FTNA 2HUNA 1PSDA 1P9LA 4CLRB 2E82A 2UVDA 4OAQA 4DUPA 1D4FA 3F46A 2FR0A 2PD4A 4PGFA 2X8LA 3E82A 3TZCA 5CDSA 3IKTA 4XX0A 1VL8A 2HSDA 2HU2A 2GD1O 4KTTE 3HHPA 2ZTUA 1HDYA 3PJDA 4P4NA 3WX0A 2E49A 1YDWA 3IP3A 5TT0A 1LX6A 2P91A 4WLOA 1Z7EA 4EEZA 4B3JA 2G0TA 4X54A 3L9XA 2Y0EA 1BXKA 2YV1A 4JGBA 1RYDA 5AXCA 2V65A 3CMMA 1B2LA 3RFXA 4D3FA 4J1TA 1BXGB 5AXBA 3E5MA 3DMYA 4E31A 5H83A 4NBTA 4QX6A 4JP2A 2NLOA 5JY1A 2JCXA 3B1JA 5A03A 1PQUA 4J49A 3RFTA 1XELA 2C20A 4RO0A 3RCBA 4PLZA 2DM6A 2Q1UA 4BNMA 5EN4A 2E4AA 4ZU3A 4J91A 3N74A 1DRUA 1H2HA 1ONPA 1WMBA 2O7QA 1EQUA 3PTZA 1P74A 3I3OA 3UICA 3NTOA 3L77A 2WE7A 4IDGA 1UP4A 3HFGA 4FSHA 3FR7A 1EDZA 3DBLA 3GGOA 4YBZA 2NU8A 4U0KA 3EC7A 4EJ0A 2FN7A 3HDYA 5ER9A 2F00A 3O8QB 4AJLA 4D45A 1DFIA 1GL3A 4DYDA 1NQOA 1LDYA 5T8KA 4HKTA 3DXFA 2Y67A 2FP4A 4HUJA 1CWUA 2IEBA 4WK6A 3TFQA 2RHCA 5G4KB 4UUNA 4XB2A 1DJQA 3QWBA 1G0NA 2J5QA 4O6VA 4BGVA 2PKQP 1B0AA 4UREA 4L9RA 4UUMA 2Z1NA 2VNAA 1K2WA
chains in the Genus database with same CATH superfamily
4U2KA 4RZHA 5C18A 1WZCA 2F67A 4O8CA 3LC7O 3VA7A 5DNAA 3OZBA 2W2PA 3Q7IA 3IJRA 2DKOA 3ZQUA 3E61A 1G55A 4ZU6X 4MVJD 4TLAA 4D80A 2R6JA 5H5JA 4HX5A 4FOPA 5E1DA 1NW3A 4M49A 4C1BA 4H7FA 1ECPA 1BS9A 1VC2A 3MJVA 2BMVA 4OGKA 1K92A 5GONA 3STVA 1T4MA 5LUBA 1TJ4A 1VRVA 2LD4A 3OZVA 3I30X 1N2HA 4FGSA 4YCDA 4EHNA 1SVMA 3F6SA 5AR1A 1UK8A 2GCIA 3H75A 4HATA 2O4UX 4E7OA 5U9CA 1I7QB 3AGQA 5K45A 2AOTA 1RYYA 1GTJ1 4QELA 4ER3A 4IDHA 3ZHOA 2WNHA 3BZBA 2WF8A 5G4LA 2Z2YA 5GVSA 1VLJA 3BFKA 4C78A 1Z13A 4KVAA 4OIFA 4NWIA 2CNKA 2V7UA 3JX9A 5BOVA 1NXWA 3FRHA 3CCFA 4LRUA 3MWEA 3G02A 3DE0X 3EVGA 3KBBA 4LE2A 1MX1A 4R2MA 3ESYA 3RSCA 1G5PA 1N6IA 3U31A 4DLSA 2RKWA 1OLUA 4XD2A 4UVDA 3C6ZA 2AMJA 4RTSA 4FHCA 1FDWA 1CZRA 4KNVA 1FY2A 2WJAA 2DBYA 3CLSC 3IAM1 2VVTA 2EHJA 3OHPA 1ZCFA 3H5LA 1NATA 2G0NA 5GGYA 4IIUA 1UBTS 3W5HA 4ZYVA 3KM0A 5JATA 3FI9A 1UBLS 2PHZA 4BV9A 2IHTA 3BWVA 3PUWA 1L2TA 3B6MA 3Q3CA 4URYR 1CZHA 5LBTA 3TR5A 4C0XA 2G9ZA 1TLFA 1PK7A 3ZW9A 5BNIA 2UXDB 4YLEA 2OXFA 4IJUA 3D1LA 3INTA 1WMFA 1YHZA 4QPZA 1GFSA 5LZ7A 2IEZA 5CD9A 1P7YA 1LX7A 3HEBA 3IAM6 5IAAA 1F2UB 3FFTA 4KR6A 1E59A 3ZDQA 1AUQA 2ZB8A 2IHUA 4YA6A 7ABPA 1B00A 4WZAE 1YB7A 1CQJB 2DWUA 1T4GA 1T0BA 2Z6AA 5AI5A 3QEAZ 3CNEA 1GQSA 3T38A 3GFTA 4M7WA 1NN1A 4WLEA 4JB0A 3ZS8A 4RVSA 5DXFA 1ORWA 4NPCA 1RXIA 1YRHA 2OD9A 3QIVA 1QVZA 2YQ5A 4R8MA 3MLEA 2VTVA 3ZPXA 4W6ZA 2FVXA 3I5YA 4LMBA 2HXSA 3VH3A 4DT1A 1NUSA 4YH1A 2BTEA 4XQGA 1W5AA 2NYRA 4IDAA 4QM6A 4M7PA 1VLQA 4Q9HA 4R9UC 2B8WA 3IQGX 1T29A 4ZP1A 4BB9A 4MWBA 1BZYA 4MJ3A 1H66A 2JBAA 3PEUA 3M6VA 4PPGA 3SSAA 4Y6GB 3V1YA 1T15A 4G0QA 3H05A 4I08A 1PR6A 3DHNA 3HKCB 3Q3GE 4Q7MB 4EVQA 5F7XA 5JQGF 1JAYA 2XX3A 3C15C 3I3SR 5G0SA 1Z0DA 5KNCA 4JIMA 2R25B 2O8FA 1DG3A 2P3OA 2QL5A 4HR7A 4R7ZA 5CNKA 4ER6A 1RZVA 2BFBA 2XUPA 3IQDB 4URZR 4AJEA 2M1XA 1E61A 1DQRA 1JEEA 3F3MA 2IXDA 3QV2A 5KYTA 2R3SA 3NTUA 3C24A 3OP1A 5J5VA 2R8OA 4PZ9A 2OC4A 1KQPA 1TLTA 4O08A 4D5GA 3ZV5A 5CGZA 3B9PA 4DA4A 1OR8A 3PUKA 4ND7A 2V6BA 4E1AA 3G8YA 3QPBA 4ZCQA 2E4ZA 2W6IA 3RWBA 1BE8A 2YH2A 5DTJA 2VHYA 1PIWA 4LZLA 1XZQA 5EL0A 3V1TC 3G9QA 4I1PA 4M86A 1QSGA 2I99A 2X6QA 3ZDCA 3KOXA 1Y4DE 4L5BA 4S24A 5J4HA 2RIPA 3DAOA 1H1LA 1OI2A 3R6WA 4QXRA 4BKMA 1FP4B 5EYPB 3PXBA 3U13A 1D6NA 3I53A 1R4MA 1W35A 3OP4A 4E15A 2WYWA 4IDBA 4WKGA 4IVQA 1EX7A 2I67A 4G89A 2C4UA 3EVDA 4Q16A 5C5CA 2ONKA 4K6MA 1USKA 4Y0AA 2WTNA 3H65A 1WKCA 2GD0A 4N3NA 1UBNA 2FHPA 5HEKA 4RTJA 3N3AC 2VBGA 2A2ZA 1N4DA 1Y8AA 1Z0IA 1QCDA 1KEEB 2C5HA 2DZDA 4KE6A 2Z2XA 3UOAB 1USVA 2WM8A 1S8AA 2V7QA 5DF1A 2VRCD 3ACBA 1H9AA 3O5AA 4F3YA 3MJFA 1RQ2A 2J07A 1TZ2A 1J0DA 3EVCA 5CX1B 1QFXA 4RF3A 3PZBA 5ALUA 5E8JA 4QQ8A 1PR4A 3FNRA 4MZXA 3VKFA 5JD5A 4OD0A 2Q50A 5EFZA 2H5LA 5KAMA 4YVFA 3FYUB 2XJ4A 3QELA 5DNVA 4YT4A 3EF3A 2V54A 3LT1A 1F8UA 2JASA 1XZPA 4UTXA 4DMLA 2WWRA 2XKJE 3AF3A 5HFJA 5JMTA 4EJ6A 5BSRA 5KDDA 1NBIA 4JJKA 4HB0A 4U6NA 2C8JA 2IOQA 4KHPB 1A4UA 2EJBA 2RI1A 3OG9A 4L6AA 4I9NA 2ZK7A 4G0PA 4HN9A 4CYMA 4KX3A 4U3JB 4FBLA 3W05A 1GCGA 1IBKB 1MO4A 3IPAA 4OMDA 4OU4A 1QP8A 2GXUA 3OF2A 4HAIA 3REFA 3W5BA 2XCIA 2Z58A 3MJEA 2BEUA 4JUAA 2G77B 4L57A 4QYIA 4R9VA 1DWPA 1KO8A 1NR1A 3DMNA 1J2JA 2EQ5A 3TPZA 3WAGA 1I7LA 3FNFA 4A1OA 4F4DA 1G21E 5CEEA 3GGJA 4INPA 3QE3A 3RE1A 1DINA 3HI4A 1CR1A 1EGHA 1KH1A 1WV1A 2HI0A 2QTRA 3RJ5A 3TQHA 1CB0A 1FNDA 1Z2NX 2CFIA 2PMWB 4UBLA 2GF0A 3KJZA 3VTFA 4AY4A 3D3NA 4DDWA 5IXJA 1SVLA 5EE5B 2ETVA 5FO0A 5J4YA 3O7MA 4U5XA 1KJYA 1O8BA 3ZHRA 2CN1A 1PX2A 1XDBA 1ZPDA 2Q5OA 1N2ZA 2P2NA 2R1VA 3K2IA 3TYXA 4BP1A 4YUAA 1EDOA 4N54A 5AFSA 4EWLA 4GZLA 3NEJA 4O2AF 1LPSA 3P2EA 4U39A 3ZWMA 5JWOA 1MTZA 3FUXA 4V2IA 2AI1A 3WY9A 3E48A 4KK3A 3MD9A 1RJEA 2ZRLA 5CDHA 3V46A 4R1LA 1G5QA 3A31A 5MN4A 2DHDA 2XAUA 1RKBA 2NIPA 5CCBA 4DLXA 3D54D 2RD2A 1XG5A 4EJSB 4ITUA 2OENG 5ITVA 3I9JA 1RS0A 4F11A 1AGYA 1L5SA 1RYNA 2M2IA 2ODPA 4IILA 5KSYA 1SCUB 1MGOA 3MWJA 4GFDA 4DUZB 3H9CA 1REQA 1AE1A 2ZJOA 1KVRA 5ENVA 1TVMA 3AR5A 1XAGA 3L2OB 1E79D 1GKIA 1JFSA 4NEHB 3OSUA 3H9GA 4B6QA 4ZARA 3WGHA 3B6ZA 3L8CA 4R0MA 2O8NA 3R6GA 3WDKA 2W6CX 4C5CA 1F8GA 4MUYA 3GLHB 2ADOA 2JI8A 3AHHA 1R6XA 5IJWA 5ESWA 2J3HA 5DT2A 4KQ2A 3R0JA 4MJ7A 1XA3A 5FPTA 2P4SA 3H1FA 3KL2A 3U44B 1QOZA 3CS3A 3WBKA 1AA6A 1F7VA 2QPAA 3F4LA 3ZH9B 2RGRA 1TJPB 4MKFA 4OAOA 1KS2A 3JQ8B 5FBZA 3H5AA 1KOGA 4GPAA 3HVHA 2AN3A 3O4FA 4RM3A 5CHEA 3L1JA 2XYVA 4AC9A 2GT1A 3EARA 2X0JA 3NHYA 4NHOA 4KMOA 3QP9A 5FRDA 4PNEA 3DTVB 4R6WA 4HQRA 1V1RB 1GWNA 5L4NA 4L85A 1YI1A 1J2TA 3TMKA 1ZJ5A 2F1HA 2PGLA 4R40A 3L0DA 3P97A 2JC3A 3T3PB 3Q9SA 2IY9A 1ZIOA 1QHHA 4EBFA 2A0KA 3IV6A 3IGFA 4R8RA 3WQBA 2IYPA 2LDXA 5WRFA 5FKJA 3JPWA 4LJ9A 1U8FO 3U39A 1YR6A 5EJ2A 3ZXSA 4HDNA 4Y2QA 2VXOA 3HCBA 3ADKA 5CTJA 3DP7A 1S2OA 4DMFA 2GN2A 4LXTA 4TQUS 2I3AA 3L3BA 5FO1A 5FT9A 3RT9A 4AFNA 4ZHQF 3Q2IA 1DAFA 1GSHA 4G5XA 3OZWA 1U6KA 2I65A 1VSBA 2JGNA 3I1JA 1UXGA 4IH4A 4KIWA 5ALXA 1Q5PA 4DYHA 3WL8A 3RSOA 3UW3A 3ETJA 1QYVA 1G7RA 1C2YA 2W90A 3M9LA 3CRNA 1T13A 1SD1A 1VSVA 4IG9A 4J6EA 4X8MA 3H0CA 5ALOA 3K70D 3ESDA 1OA1A 2EKDA 3T5CA 2WSBA 5AM1A 1FX1A 3KB6A 2GZ1A 4FFVA 4YV1A 4V0LA 4HTFB 3FYTA 5HKKD 2J85A 4DIDA 1JA0A 3ZHBA 4FC7A 1SXPA 4YO7A 3O7WA 4ALNA 2CHUA 2NSHA 4R0VA 1ULTA 2ZIXB 3E5RA 4BUZA 2J4DA 1ZVVA 1QQ6A 4HDKB 4C88A 2ZRQA 2WUEA 1X0VA 2AW3A 3EMBA 1S3GA 4QQFA 3H9UA 2FA9A 1G291 2CJWB 3LZCA 621PA 4N48A 3Q8MA 1ZJ6A 3PPYA 3TLEA 5E95A 3SQDA 1HWYA 1UPAA 4DV1B 1PR1A 1QORA 2CLMB 2NQ2C 1P2TA 2P3LA 1GQRA 1NE7A 1BVUA 4E1BA 5HX7A 2EKPA 2H9AA 3M3DA 2AMYA 4RHUA 3LTNC 2Y1LA 3CXUA 3MTQA 1Z5GA 1ZD9A 2ZJAA 4DPKA 4LPKA 2ETXA 2XBLA 4L4SA 4WI1A 3UHFA 2D00A 3PXCX 2MYUA 4XVRA 3T0FA 3U9SA 5KOIA 5HPYB 4U63A 2I71A 1STOA 2G9UA 3DLAA 4Q4JB 5F7ZA 3ZHVA 1XPUA 2JH8A 3G0HA 1U9CA 3AP1A 4HDSB 3VR5A 4PS1A 1L7MA 1QHXA 3MINB 3DWEX 4FZJA 2F3SA 5CPFA 2I2DA 2WSYB 4NPHA 3X1YA 4DZTA 2QE6A 1C3VA 4DXHA 1FMLA 4ZYUA 4QBIA 3HY6A 1N0HA 4OX9Y 4WV3A 1ZH2A 4WL0A 4OXNA 3U60B 2FFRA 1H94A 3UPTA 3BC1A 2FSPA 1ULHA 3QQ5A 4M9QA 4QUIA 4WA7A 1NBWB 3SSMA 1ZH8A 5IVIA 4FDMA 1BG6A 1WUKS 2HAEA 1PUJA 2PKCA 3QVTA 1ZM7A 5AK4A 2VI5A 3RFFA 1GPLA 4KWTA 4FCWA 1QTIA 2R8BA 3KKEA 3PFBA 4RVOA 1J90A 1XEWX 3DOIA 5FUWA 3W6PA 4CXMA 4YMWA 5AVTA 3UMYA 4O0MA 4MVJG 1FS4A 5HQ3B 3O94A 3T1VA 1D5WA 4Q1DA 3IUEA 1V5WA 3DEHA 3LJKA 1LPPA 3ZUGA 1CIJA 3RIGA 3CZPA 3JY6A 4GOND 1YQGA 3JQ6A 5EWLB 3E3OA 4GI7A 2FXIA 5DBFA 1YZ3A 3TW8A 1MAUA 1IN7A 4HAXA 5DZSA 4EY6A 1AOXA 3O47A 2K4MA 3ELDA 2A5JA 1K5DA 4E88A 5JECA 3EIEA 1NA5A 1Y3AA 5EKTA 5SY4A 1ZWKA 3V1NA 1ISIA 3N2IA 4ALLA 2IDKA 4EK9A 1N77A 1G8HA 4LJLA 2PA3A 2Z8XA 3DP9A 3RM3A 2P69A 1FRNA 4DA8A 1YFJA 3VPHA 2AQKA 1JWLA 2IPXA 3EQ7A 3OCVA 1N8KA 4ECAA 5CB6A 4ND5A 2O06A 1SC6A 2W6MA 4LXXA 5AESA 3EY4A 3SZ3A 1GL9B 4MDEA 4CE6A 1F0KA 2DQSA 3GRUA 3PFNA 4L4YA 5FUMA 4C2UA 2F9FA 3L8HA 3SXJA 3FNEA 1X7HA 3CYFA 3TRJA 5AKKA 1FQJA 3KTAB 1SBZA 2A92A 5DSTA 4B82A 3DV0B 3RGGA 3HDTA 3A4IA 3I5UA 3PYXA 5COAA 4BFTA 4YN3A 2XUDA 5GWXA 3BHIA 4IWYA 4ZT2A 4OP3A 1TU3A 5BSFA 1VL2A 2F43B 1NKSA 2K87A 4J07A 2NO0A 4MGEA 4GL4A 1BHQ1 2B8TA 1DIOB 2VF8A 3DUFB 2NU6B 2LPMA 4GEGA 2QGFA 3WGYA 2PTGA 2RAFA 4GD3Q 4MPDA 1T6BY 1SBCA 3L7NA 3VR6A 8OHMA 2H8KA 4EPYA 2FPMA 2AJDA 2OZKA 3GVCA 1U7UA 1OAOA 1UMBB 2DTEA 3GNLA 4GVPA 4OUDB 4WY5A 1IC6A 4EYKA 4XJSA 4LWQA 5C8YF 5IHXA 4NFLA 2PM8A 1W73A 1XRSB 3OMXA 2II6A 3WGLA 2RKOA 1X3SA 4Y6OA 1G3RA 5JH7A 4YGXB 3GUCA 2Q2WA 4LVNA 3W5UA 4D9IA 1Z07A 5ALRA 4HLQB 1D5CA 3FJOA 4AJ2A 4YRMA 1K0UA 5BOSB 5IWCA 1PF7E 3MOGA 3DF7A 3GZNA 3D4IA 1VLHA 3I64A 2C7OA 2HLHA 3KLOA 1TOAA 3EDMA 2WDPA 1NKTA 4FQ7A 4ND8B 2OCKA 4QO8A 3SX4A 3W5SA 1OPRA 5LNK1 1GUBA 2NM0A 2MHCA 3DE6X 3KSZO 3QE0A 4LISA 4EVSA 1ZXXA 3MILA 4TZ0A 2GN9A 1JAIA 1UDBA 2C7BA 2X86A 5DHUA 1PFVA 3HVIA 5G1OA 5I3ZA 1K6IA 2RH5A 2O8DB 3DNFA 4AWAA 4LF9B 2PX4A 2Q2QA 4J0CA 4DRXB 2QTAA 1JBEA 1RM0A 1PSZA 2R4TA 4EHAA 3UOGA 3LF2A 3KR9A 1PWZA 4OQXA 1G7CA 3D8SA 5E6RB 5BORA 5LNK6 2C9OA 1YR3A 3MLAA 5AJTA 2GYWA 2BYTA 5F9HA 1I7PA 5FLEX 4QBFA 3WI7A 1ACMA 4NCAA 2C5GA 2PRZA 3ADCA 2YFQA 1XA0A 3ENZA 5DP1A 1C3JA 2V7WA 3BJMA 5JWHA 5CJPA 4B17A 2HHHB 2NV0A 2DCMA 1HE8B 3IDAA 3MJCA 4Q3EA 1W30A 1U4SA 2C2OA 4CGZA 2WT4A 4MW1A 1ZI6A 2QNRA 4QAQA 5IVDA 3UJAA 4DUYB 2QZSA 3LUHA 1P1IA 5CYOA 3THSA 1FP4A 5EYPA 1YK1A 2D2EA 2D4AA 3L0CA 4KMSA 4BQQA 4ZFNA 1ADYA 2DUUA 3F5MA 1Z6YA 2BFOA 2VJKA 3IV7A 1TT5B 3UJHA 3VHRA 4ZMBA 1VYTA 1D1TA 3CEJA 4RULA 1ZK2A 4JP5A 1HM5A 1MP0A 5DHTA 1ZX1A 4YPOA 1KEKA 3MRSA 2DX7A 2XSZA 4A2QA 1LDBA 4NZYA 1WULS 4CKXA 3KDAA 2UZ4A 4LSGA 4JI1B 2BUBA 4OYRA 1FFDA 1AKWA 4Q1FA 3ZE9A 1EGVB 3O3CA 1USIA 4IGIA 4KC0A 3V2GA 1XWFA 1YE3A 3GJ4A 3X1DA 3N8GA 2XGMA 1T0JB 1E5TA 3OTOB 4JODA 1U94A 1YVUA 2CL0X 4JCOA 5CX1A 3PFWO 2G70A 4O1HA 1H0RA 4FNMA 4JP8A 1Q7CA 1UEXC 3DO6A 2GYYA 4M76B 4GO1A 1P80A 3BREA 2QR3A 2EQAA 5DK6A 4XGIA 3PUIA 5B6PA 4G1EB 2XYGA 3FYUA 3JZFA 3EEQA 4JLNA 4X7BA 4MVWA 3RS9A 1DCFA 2PS1A 3EUAA 1L4KA 2C88A 2G7MC 1J4AA 3UJNA 2V8BA 3I1FA 3IDQA 3P0RA 2J7PD 3V80A 3UATA 3UHAA 1G3UA 3IAEA 3UUWA 3MMPA 2VHWA 3C3XA 1TK3A 5EQDA 5CDYA 1P0IA 4U3JA 1H2BA 1GAEO 3AL3A 2CNNA 2EAUA 2QTHA 1TADA 1KDRA 5BWOA 1DKUA 1MQSA 1ZK0A 5SZIA 5DHRA 3CGWA 2P4EA 3HDJA 3MTEA 3NOVA 2AG1A 3B3JA 3O6VA 3RAJA 3CT4A 5CT4A 3OTGA 2QRMA 3PFIA 4L7VA 3VTKA 3F5FA 1QYDA 4O2BB 4JT4A 3ZCPA 5KTRA 1B14A 4MZDA 3NRCA 1XNHA 1EQ2A 4WE3A 5HDBB 3VPCA 2P65A 3SAJA 1BE0A 4L95C 2ID8A 4DBZA 5HIMA 4YRRA 2JPDA 1XQWA 2WDZA 2ZS7A 4H6WA 3VO9A 1SBHA 3C3DA 4E12A 4XFKA 4LY9A 3D4OA 5TC4A 3QU4A 3R7NA 3HPQA 4H17A 3PUZA 3LQKA 3SZMA 4IIFA 1XMQB 4NU8X 3WK4A 5ECYA 4B3GA 5JJCA 1R6VA 3WYNA 4JP3A 2VF4X 3GJTA 3FCYA 2OVBA 4IHKA 3GU3A 1IOVA 1Y5LA 3M6AA 4EEXA 3X1KA 1L7RA 2JLVA 5EY5B 2PH5A 4EJSA 4LJ8A 2C9ZA 3N6RA 2IITA 4KO4S 1OIVA 1JKFA 4PCUA 4Y9RA 1SO8A 4G37A 1M2JA 4IJ5A 3WGGA 2IBSA 1SCUA 2FRXA 4YIHA 1SBTA 3R0ZA 5KYYB 1NXSA 3QA3E 2GLUA 5IWAB 1BA2A 1Q83A 3F73A 4RXUA 5AI8A 3K9BA 3DBRB 3SICE 1Z7WA 1GPWB 1J7JA 1SHLA 1XALA 1Z17A 4JBWA 4X1OA 5EPOA 1DX4A 1XCLA 2H0RA 2HDNB 3ZLTA 2QX4A 3NG1A 4W7HA 3AKEA 1P0CA 2JGRA 2WVAA 2XUZA 1QRUA 1OJLA 1KIMA 2RCNA 1FK8A 2QA5A 3GLHA 1VXOA 3IP1A 1OGJA 2Z3VA 3B6IA 3BAFA 5HWSA 1CQIA 1A50B 3VPXA 1G38A 1KIFA 1KBQA 2VHVA 2BIFA 4NAVA 4CKYA 1NBMD 3UGKA 3FKSA 1KWGA 2R11A 2PUCA 1AK9A 2J3DA 3U44A 1SXJB 1VJGA 4AZ3B 1SQGA 3EIQA 3OCJA 1OXMA 3N2GB 3JQ8A 3TD9A 4QBTA 2BGGA 4X8LA 4QPCA 5AOVA 3E53A 3WB1A 4ALMA 4E4YA 3BRSA 2LE0A 1Z25A 4HUTA 4ZV4A 2IXTA 4QBHA 4ZI7B 1H65A 1LLUA 3NM4A 3OQOA 2L82A 5DTMA 3O1JC 2HMUA 1GFIA 1PJSA 3WKEA 2VEOA 4D4HA 3O9ZA 4KODA 3B2NA 1U9YA 3DTVA 3S5UA 1ARZA 1KC3A 2O1EA 1GXSB 4JQZA 1V1RA 1F4LA 5FUYA 3RUEA 1NLFA 1JDBB 1UP7A 3RROA 2AEJA 3WK8A 4FOSA 2XKBA 5BW8A 2H31A 1JQKA 2I3DA 4QXOA 2EV9A 3DNMA 3NETA 4DQLA 1OBHA 2IRWA 3KD2A 4IINA 5U4QA 2FPPB 5EIXA 5K7SA 2G07A 4FMDF 3NWEA 2F1KA 3AF6A 3HJFA 2XKAA 2RMKA 4C89A 1XQXA 3UJ6A 1CDOA 3OE7A 3WJAA 3SYRA 2A9FA 4O25A 1PI3A 3LKBA 2YFHA 4FE3A 4MWGA 4YGYA 3H3XA 3UEOA 4Q18A 3RRZA 2XUOA 1NJGA 2WJPA 2BM8A 4NFYA 4EYOA 1DWUA 2G09A 2FF5A 4C0SA 4U2EA 3ZJTA 1KAMA 2FJ0A 4R1QA 5I9BA 4YCSA 3BE4A 3BHMA 3G1TA 1Y5RA 1Y7TA 3T0IA 4FM9A 1QPGA 3MQ4A 4OXRA 1QVVA 4MQFA 1ZHFA 1PVOA 1CRZA 5GOTA 4B35A 4F6LA 3D0KA 3MUOA 1XQ1A 5CCEA 1Z63A 3H5IA 1LLQA 2P0EA 3PV0A 4P7FA 4MHOA 3JYHA 4HTFA 4ZRMA 2O2JA 2OV6A 4F2HA 2PZ8A 1IULA 3TN7A 1FMJA 5LQAA 1IG3A 2NZWA 1TC2A 4HDKA 5JNWA 4LGCA 5ETJA 4X00A 4R16A 1NM5A 4EG6A 1JDNA 2ZM6B 3AESB 1IZ7A 3JSAA 1EFRD 1B8UA 2CJWA 4M1TA 1JAHA 4L4ZA 5CXQA 4O63O 2X9NA 1XWWA 2VP5A 1S3SA 3LPNA 2H1SA 2A7QA 3N0WA 3SXPA 4F46A 4KR9A 3DEKA 1CTQA 1KZ9A 1Q6ZA 5C9ZA 1XN1A 3W3AH 4HCJA 4S0ZA 4WHMA 4B76A 3AXTA 5I7OA 3CHYA 1LSUA 4NBUA 3FYHA 4FGZA 3DOJA 3PB3A 1DAIA 3B3GA 1Z8FA 4MIYA 4R7GA 3DCJA 1CLEA 4OSOA 1WF6A 2WR8A 3ORRA 4NBRA 3TDKA 3UA3A 4ZYXA 2SNIE 1VE6A 1A2BA 3IQWA 3RTDA 4KGZA 2PX0A 2DQZA 4FONA 4UD6A 4WEOA 4BMOB 2Q3MA 3CLKA 1UBMS 4RD2A 1A9TA 1HSOA 3SE0A 4CCAA 5TVGA 3K8QA 3N7AA 3AB7A 4L5AA 2WU3A 3P9RA 3NT4A 4HNAB 2BF7A 3ZLVA 4P58A 3UAOA 2XT0A 4JLSA 1GN8A 4A6DA 4JLJA 1IAQA 3ZX5A 5A62A 5ADHA 4ESEA 5L8VA 3DBHB 3PP8A 3KHUA 3CIFA 4BLSA 1TGYA 1M7HA 1KZGB 5FYDA 2AW5A 1Z37A 2P27A 3UC5A 4N5DA 4CMAA 1I5OA 3TG8A 1JLHA 3CZQA 5AIBA 3LWNA 1CEXA 1Q1AA 3G1WA 5F64A 3USES 3K5WA 4PV7A 3V1UA 1Y81A 3X44A 2XWQA 3LXMA 4CHTA 3DHYA 3TJRA 4DDTA 5LZ4A 3P94A 3CVYA 1U8ZA 2FP3A 2XGSA 4NC9A 2XGGA 5EWLA 3E35A 3TZ6A 3M70A 4CL2A 4PNPA 5A3SA 4N5NA 4YROA 2IP2A 3O4HA 1VHJA 1CUJA 3D7LA 2XQFA 3GT3A 1GCUA 3ED5A 4RACA 5B7PA 5EESA 2CDNA 3OQIB 4LHYA 4MIOA 4GYJA 4ALIA 3FPJA 3K5PA 1CUXA 2PWZA 4WBNB 4S05A 5AOCA 5DOZA 3A9UA 5FWAA 3D6UA 4DQUA 4ZZ0A 3OFNA 3OZFA 7MDHA 1KTVA 2AUMA 2FW8A 3KTAA 3QVKA 3VR1A 1S89A 4HJRA 1HC7A 3UAXA 3J81k 1AHNA 1UMDB 2NG1A 4H4DA 2GRUA 4KN8A 1ONBA 1M74A 3L1VA 3F9RA 3CNLA 1MN6A 3OPQA 1UJNA 3C4VA 5G53C 2SICE 1YVPA 1LDNA 1N0IA 4GWGA 4MMXB 4L5YA 5CB4B 4LXIA 1IUNA 3GLKA 2NU6A 1WCWA 4YLGA 3SU8A 2R8PA 3U09A 3DD1A 4UM9D 1WBJB 2G28A 3N86A 3F5DA 1JYEA 1YR8A 3KYIB 5E3JA 3BAZA 3E3AA 5HBRA 3NV7A 2NTYC 3UJ7A 3EZLA 1UJ2A 1ZXBA 2LKDA 4OHKA 2WPDA 4OUDA 1B8OA 2H1VA 1N5IA 4HZUB 1FFBA 4ONEA 2XDAA 3T34A 2GA8A 2QRJA 2VL7A 4N0MA 4Q1VA 1QTQA 1P1BA 4PM4A 5LP1A 1ABBA 3AEXA 1TIBA 1TEXA 2XWPA 1YO6A 3K9HA 4I1VA 1QRDA 4Z1MA 1KQFA 5CLHA 3GGDA 1NLYA 1J9ZA 3AY6A 4IUCS 121PA 3E9EA 4YT5A 4XX0B 4LSWA 5BOSA 2QUAA 4X6YA 4ETMA 4UMVA 3FHTA 2MSWA 4TZ6A 4ND8A 3Q5EA 5K0NA 4G81A 1RTKA 4K9OA 5TR9A 3MTAA 1P1HA 4OBXA 2C2ZA 2BFFB 3O8OB 4LJKA 2UYQA 5AI0A 4IFIA 3THYB 3ZK7A 4BV8A 2O59A 1QO7A 3QLUA 4GPIB 3V55A 3BXXA 2IU0A 5CG2A 2PD3A 2O8DA 4PC2A 3ZQKA 3CF2A 3IUBA 4AB1A 2ZI6A 1S9HA 1QQ7A 3D8RA 2IP4A 4KWCA 4NBKA 2C3MA 3FJ1A 4W1SA 5D5HA 2NXEA 4BASA 3E7PA 5E6RA 3V4VB 3N5KA 1YCDA 2RGUA 3W4KA 1E7YA 4I0WB 2QQEA 2IY7A 1VI6A 2XNDA 4B8YA 2FLKA 5E9QA 3DKRA 1BNCA 5EGNA 4EGCB 5AM3A 1WDTA 3FFXA 5BQ5A 4LMPA 1EFHA 3B6JA 3O26A 3LFTA 1KDZA 2IK8A 4DLVA 3N39C 2WWXA 4KR3A 4IX9A 1XQYA 1JXOA 3BFPA 3D3EA 3EEIA 4Q82A 1IM5A 2ANCA 1NJFA 2NXWA 4RVFA 1M1UA 3E8SA 1L5OA 3LPLA 4KDFA 4MVJP 4PWZA 3INNA 5CXUA 2OGSA 5A3RA 4EF6A 2P2CA 5K0LA 1T1RA 3UANA 2Q27A 4KR7A 2EKZA 3AVVA 1TT5A 2BT4A 1R12A 3FDJA 5IXYA 2ACWA 2IQ5A 2BEWB 5KOHB 3HDHA 2J0VA 3H1EA 4LDNA 3M1AA 3H18A 2XNJA 5AT1A 3ZKWB 4HP8A 5FP0A 4TXLA 1O5IA 2VKTA 3KUXA 1IU9A 1RLUA 3P96A 4LJ4A 5D5PA 4PYLA 1NWCA 5CVUA 5G3YA 1NVMB 5K3OA 1RMQA 4YCNA 4O4JA 3V33A 1I36A 5F52A 4L76A 4LCEA 5BWLA 3H87A 3KQOA 2PT9A 3AIIA 3PCRB 1I1QB 4K87A 4RLQA 1TQ2A 2JFPA 2OL4A 3IA7A 3PGA1 1IQRA 3K1ZA 3JWGA 3O2NA 4FOLA 5LOVF 2Q6LA 4P35A 3DLIA 5LA6F 2JZCA 2ZXFA 3SLKA 2GVZC 2PPVA 4HQOA 2VSYA 3KKKA 2WSSD 4YUVA 2F4NA 2CD9A 4RH3A 2JHCA 2P5YA 3QV1A 1IXSB 1CHNA 1OJ7A 1UQTA 1R8SA 2O20A 3HBLA 2ZIAA 4NE9A 4AZWA 9ABPA 2VRNA 1OWLA 5E2IA 4DQKA 3CW8X 2V6MA 4EENA 3L46A 4KSCA 1YUBA 2BBSA 3A6ZA 4LZPA 4XSGA 5LSAA 3D0RA 3N8NA 3GJSA 1XRPA 4O4JF 1WB6A 2FN4A 1RPAA 3JQ9A 3OJFA 3D3WB 4IF4A 1B3RA 4BO7A 5I9LA 5JAOA 1TRKA 3DPUA 1GR0A 4QPNA 4D0LB 1WBBA 2WIBA 4ZWNA 5ULLA 3DAPA 3VSBA 3E3MA 4OB7A 3NEAA 4GDMA 4QQNA 1SUFA 3RU7A 4CEIB 3HPRA 2W42A 3UB4A 3L7OA 5TY0A 1RQRA 3AEUB 1JHAA 4MNTA 4N7BA 1FFWA 2H1FA 1J8MF 1NONA 4K9SA 2H9YA 4X3OA 4FSXA 2P30A 3CZAA 5M34A 1R5JA 2PL1A 3PEFA 2XXJA 3HRHA 1W48A 3CBGA 4I50A 4B4DA 2XRMA 4COOA 5GPBA 3EXEB 2C2GA 2V5VA 4QJ3A 3FCUB 1F51E 1U7WA 4S1VA 3WGJA 5F2EA 3SMVA 1KRWA 2GERA 2WHQA 4KBFA 1HDGO 1FSZA 4HF7A 1Z56C 2FMIA 3K05A 2WMNB 2YJ6A 3NRJA 4PG6A 1CB7A 3WA6A 3PFCA 4FR5A 4RHCA 3TQOA 3T8YA 4E33A 1QONA 2JVKA 2QAGC 3BGIA 3GEEA 5ARDA 1FRQA 3U4CA 5IH7A 4JB3A 1BMTA 2G67A 3DLCA 4OFWA 4P1ZA 3EAFA 5H70A 3TLMA 1PGJA 4BC0A 4HAYA 5KYYA 1K97A 4C14A 2QBYB 2IPMA 1MUUA 1G19A 1FXWA 3DBRA 3AUKA 4INJA 4R1SA 3UY4A 2QMYA 1TUEA 1SU6A 2HJSA 1RE0A 2RH8A 2OHHA 3GJ8A 3KUKA 1OZAA 3O0TA 2WWTA 2PMEA 4Y67A 3U3OA 2AQ8A 2AC7A 1Z26A 5DCUA 3CSUA 3W4JA 2PJZA 2A84A 3AVXA 2GCOB 1TZMA 3NXSA 1OAOC 2LXNA 5CK5A 2PMBA 4WRRA 1TKRA 4Y2HA 2HYDA 2ZB2A 4RETA 3SNHA 1VHQA 3EAQA 4Z2YA 5T5QA 4ZIRB 1SXJA 3BF7A 4YWJA 4I1RA 4AZ3A 1L5GB 3GDWA 4F56A 1JFFB 2DBZA 1EE2A 4UDYX 1I3NA 3H8JA 2D59A 1N8NA 2AC4A 2QTVA 3BYZA 4RFSB 3NTVA 1IM2A 3JQ7B 3SYTA 3T7RA 1GD1O 1SD2A 2LBPA 2IXFA 2C4NA 2ORWA 4NZOA 1P0FA 4Z3OA 4FHFA 1E4VA 2HMVA 1M83A 1IVYA 4GEKA 3TQQA 5F1KA 4OJYA 4P3NA 4C4PA 1OPXA 3JASA 1YRYE 5PGMA 2I6SA 1N32B 2QD1A 4EHDA 1JEJA 2UXCB 1WCV1 3KDSE 4PS0A 2HMSA 3ITKA 4I55B 2LP4Y 5IASA 3BZWA 2FMHA 3FOEC 1GSIA 1MD9A 3FROA 1DRWA 2OCBA 2VQSA 4Q6BA 2JJYA 3DKVA 1JDJA 4U2DA 4BLTA 2D3WA 3I6ZA 3IOEA 1LDGA 3HRIA 4J0IA 1TCAA 2EGUA 2P5SA 1ORHA 4L8LA 4MXDA 3UJBA 2B4AA 2PX3A 2VZEA 1CJKC 2Q1SA 1BAPA 4KQEA 4RMIA 1N0VC 4E32A 3PGKA 3A1CA 2YWEA 1TECE 3QENA 2D5IA 4EFDA 4UNRA 1NT4A 4CMIB 4YCBA 1ZK4A 1G8KA 2FZ4A 3VSAA 2P68A 2A59A 3V42A 4BEBA 1HFJA 2P9HA 1PV1A 3QW4B 1QDEA 4DGSA 5CFZA 2ZROA 3JQGB 4K6OA 4UQOA 1KMHB 1TMOA 3RWMB 2VH2A 1JG7A 3Q8WA 2G4LA 3UXYA 3CKKA 1L4HA 2DTDA 1ORRA 1ZZGA 1L4GA 2IVZA 3G0OA 4TMZA 1MH1A 4CCWA 1G2IA 1Z7GA 3NVKI 4IDDA 3V8QA 1Z5UA 4D4KA 3OZDA 1SVIA 1B76A 1H2WA 1F2TA 3JYLA 5DOVA 1RLOA 1H22A 1QIEA 2R6FA 4BMXA 3NBUA 2RC5A 3UGTA 4DA0A 4Z51A 1AKYA 4MVJI 3OQVA 4DIBA 2WILA 4RIFA 2P6NA 3H7AA 4Z9FA 2M6SA 1RYHA 2COKA 4RSMA 1OYWA 5FV7A 1M66A 5YASA 5DTRA 4B3IA 3PXUA 2W2LA 3AESA 4QEDA 4P5PA 3S28A 1KRHA 2SHKA 5LP6A 4UAVA 3GCDA 4RAQA 2QNIA 4UTPA 1XUOA 4BU1A 2BFDB 4E46A 3FYUC 2R5WA 2FWPA 2NMVA 4IGEA 1TVKB 2CEKA 4LSMA 1BXRA 1H6BA 1ND5A 4NV1A 3J80A 1E1YA 1MAVA 1Q15A 1T8SA 3L7JA 1E9VA 4M4SA 2OC9A 1RYZA 4BQIA 3QXGA 4URHA 4G0NA 3AYZB 4XJTA 3K6SB 3EEYA 3A6KA 2LCQA 4MV7A 3Q0TA 3WLRA 1EG7A 3K5HA 2QRHA 2I2AA 4B0PA 4LX8A 1G63A 3GJYA 3CZ9A 4RV9A 4BMSA 1P2GA 5J4VA 3CW2A 3S27A 4A6EA 2LZ0A 2XE6A 3T9DA 1SELA 1FDSA 1VKHA 4QUHA 4JQYA 3T1YB 1AB5A 5KO2A 1EU1A 1U7OA 1KO1A 1C1YA 5HW0A 1HYGA 1WV0A 5EAIA 1Q3TA 1N3IA 2R84A 1AY0A 2CNWA 4HNAA 4B6SA 1YA6A 2BGKA 1AZWA 4TL7A 4J3NA 3P0FA 4MUIA 2AF4C 4DEYA 3HB9A 1NHWA 3G8CA 3AM1A 2QN3A 5HM8A 3SM9A 4G23A 2XUQA 5DB4A 5SYNA 3PX7A 2C9MA 2WZCA 4QJ5A 4MHSA 4RZ2A 3OHMA 3ZIAA 2PXXA 5KTMA 2HV8A 3K0FB 3ZR4B 4UTVA 3U4DA 5J23A 3TL2A 4KVFA 2V0NA 2P75A 4BVBA 3A9VA 1AUOA 3V4PB 2QF7A 5CH3A 4P81A 3KUCA 1MZVA 5ALTA 5KWSA 1EDDA 1OU0A 1HKUA 4UASA 4C6RA 3E9CA 1EMDA 4HLDA 2JGKA 3L6OO 1XT6A 3I12A 3S29A 4KO1S 1C1DB 2G63A 2QVBA 2JAWA 1NOJA 3HB0A 1GG9A 2IIBA 3CH5A 1E0JA 1NW5A 2A9JA 3FFBA 1BH6A 1PDOA 1SNYA 2HWWA 3DOCA 3H9EO 4BYMA 5E4FA 1CQZA 1L5NA 3BD7A 1HGXA 2IEGA 3CISA 3OQIA 4MLPA 4TX1A 2L69A 3OIVA 3ABQB 5BW4A 4NCKA 4YMIA 1GUYA 1NVGA 2R1ZA 3ZY5A 1YAHA 1G8GA 1IIRA 1AV7A 3HKDB 4B48A 4WBNA 4YV7A 3OC0A 2HOQA 2BRUA 3ASZA 4MKRA 5JXIA 3I8OA 3AH8A 4U7JA 2H00A 3O9MA 4ZOAA 3ZJ5A 4KAXA 2RGCA 4QUKA 5LYJF 3R76A 1Y6GA 3JAWB 5FFNA 4KRGA 1OBCA 5A02A 3GLGB 3RKSA 3JD2A 1W0JD 1PR2A 3FRJA 3N59A 1EJ2A 4JHLA 1V8FA 5EIHA 2OPHA 2Q5IA 2I6TA 1T1JA 3LM8A 4BPBA 3IT2A 2YZGA 4GG1A 3LECA 1U8UA 1H5UA 1TMKA 4Z4EA 3G88A 1FQWA 5IJXA 4B6JA 2OSBA 1PZNA 4XZ3A 4OAPA 2EYUA 1FF9A 2YZMA 1JL3A 1JWBB 4GMXA 1WZEA 2W2OA 1A9RA 1S3IA 1U3WA 1XPJA 2Z4RA 2GDZA 3Q7QA 4HZUA 1PJZA 2DHQA 1RWXA 4HEJA 5CLQA 4YPFA 5SYAA 2DPYA 5C32A 1TTHA 3FNGA 1PDVA 3D6MA 3K09A 5AHRA 2I78A 1TUGA 4FHZA 4IWXA 2O6HA 2O8VA 3UUEA 1YONA 1G3QA 1DBSA 3UPDA 1T8YA 2SKCA 4C7MA 1OFIA 1CUUA 1KFKB 4MKHA 2MCFA 3TNJA 2C57A 2O8BB 3E1SA 3LQYA 5HIAA 4R8KA 2XUFA 4CQLB 5L3SA 3O8OA 2BFFA 1Q0TA 2WF5A 5K09A 4PXSA 3THYA 2GZSA 3NEYA 4UUPA 5D3MA 1I33A 5JROA 2CT8A 4BPRA 4XQCA 4RKRA 4PX2A 4BTVA 4QWMA 4AF8A 4H2DA 4C7OA 2AQHA 2ISSD 5A9RA 2W71A 3GEPA 3CVUA 2L42A 3TZEA 3CWQA 3ONWA 4UBJA 4U2FA 5JXGA 2H18A 2H07A 2VWHA 2VSXA