5ENDA

Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg)(q152a) from vibrio cholerae
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
244
structure length
228
Chain Sequence
QFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGAANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase FabG
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
molecule tags Oxidoreductase
total genus 79
structure length 228
sequence length 244
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5endA00
2HK9A 2IXAA 4MVJH 2ZCVA 4JK3A 1ZSYA 3JQEA 1I5RA 1DAOA 2XPCA 2QG4A 1GEEA 3C7CB 3FR7A 3JQ6A 3V2UA 2R6JA 1U8FO 4L4SA 4YXFA 3WGYA 3WQQA 4TVBA 2I5PO 3JTMA 3VVBA 4EJMA 2P9EA 4I5DA 3PRJA 4NI5A 3ZU2A 1LA2A 2VT2A 3EW7A 3EYWA 4L76A 3LT4A 4I5EA 5F21A 9LDBA 5JW6A 2JD2A 3V1UA 3SVTA 4NBUA 4YAKA 2BMAA 4DIOA 4HFJA 2JL1A 3P2OA 2FP4A 2Y93A 5COAA 3ULKA 3DOCA 1FJHA 3PLRA 3LF2A 1PJLA 3KLPX 1HDCA 3O38A 1HYHA 3Q6IA 2D5CA 3WB9A 1NTOA 4XYBA 2GR9A 3PHLA 1KYQA 2Y1GA 4RL6A 5EQDA 1QSGA 1ADGA 4M87A 1ISHA 5I7FA 1H6AA 2VRCD 3UH1A 2RH8A 1O95A 4NU5A 3L6DA 3NT4A 5IZCC 1VL0A 3PHHA 5EESA 2CVOA 2BI8A 2B83A 3LDHA 3AW9A 3CINA 1SOWA 3NKLA 1FDSA 2OUIA 5JYEA 4BNIA 4QEDA 4RLSA 4DMMA 4XB1A 1YDEA 1Z82A 3UVEA 1YKFA 4E4YA 1NR7A 1ORRA 4Y67A 3U3XA 4WLOA 2Y0EA 4FC7A 1QG6A 2Y1EA 2I76A 2PR2A 4E3ZA 2O50A 3EVTA 1K0UA 1PS0A 4XR9A 3ZWXA 2Q2WA 2CF6A 2TMDA 2HLPA 2PZLA 3PZBA 4NK4A 3ZZNA 5A06A 4FJ0A 3GLQA 4IQ0A 1FDUA 1KOLA 3K2EA 1ISFA 2DU8A 1EEHA 1R0LA 2I6TA 4D3SA 1Z74A 2RIRA 5ITWA 4YT5A 2PLAA 4FFPA 1U3UA 4BL5A 1I32A 3F4LA 2E82A 3DDNA 1BWSA 2QHXA 3PDUA 2GUGA 4Q3EA 3H9JA 1KERA 1GDHA 4NU6A 4CLDA 5G2OA 5C7OO 4PLFA 5CG1A 5ICSA 1L7DA 4J3FA 3O8QA 4W7HA 2GERA 2GASA 3GGPA 1DC5A 4CQMD 2QZ9A 1NASA 3EZYA 2HAEA 3WS7A 1R4NA 5CAEA 1O94A 1MG0A 5JCXA 4U6QA 1ZEMA 2X5JO 1UAYA 2VUTA 1QYXA 2DLDA 3NYWA 4P4LA 4JBGA 2XXBA 3IAHA 4LVCA 1XLTA 2EXXA 3DZJA 3ZW9A 3GMDA 4YT4A 4IMPA 3B6ZA 4D43A 1YWGO 3OICA 4R1UA 2EP7A 2HRBA 3IUSA 4XA8A 4EUEA 1K6XA 3JQDA 3LSYA 2XAAA 1I2ZA 1SB9A 1GFSA 3KYBA 1GU7A 3MWDB 1G6KA 4W4TA 3DZHA 3TOZA 3OJLA 6LDHA 4FJ1A 5G0UA 3JQAD 3OA0A 3WR5A 3GVPA 2HMVA 1V9LA 3ONEA 1OBFO 2P9CA 3V8BA 2FPIA 4OXKA 1LUAA 1NXQA 5KWEA 5T64A 1ISMA 2VHXA 3O26A 4BUCA 3RJ5A 1KVQA 2DC1A 1I0ZA 3PQEA 2Y0CA 2J5RA 4IDEA 1H0KA 2ZJ1A 4J1QA 3H2ZA 3DTYA 1KY5A 4FW8A 5G4KB 1G1AA 2B4TO 4G81A 4HXYA 1FDTA 2CMDA 3IC5A 4P8RA 2HQ1A 5JDIA 4L9RA 4OO3A 4R5MA 3E03A 3MTGA 4KUHA 3ZU5A 2V6BA 1YQDA 1BSVA 1J49A 3CKYA 4R54A 3EC7A 1H9AA 2GO1A 2UAGA 3N7UA 1CETA 1YB1A 2I66A 4RVGA 3ETEA 3MJSA 1BGVA 2Y67A 4UUOA 4IMRA 5LCXA 3DBRA 1KBZA 2NTJA 3AI1A 1I3MA 1SEPA 3RUFA 4XQ9A 1PJQA 1ADBA 2D59A 3Q1LA 4WCFB 4FCCA 2IZ0A 3HB4X 1PWZA 2BI7A 4OGWA 1DHTA 5KKCA 3LT0A 1B8UA 1ONPA 3ONDA 4QXMA 2PZMA 5HA5A 2XF8A 1LDBA 1X1EA 1GL3A 3WYCA 1JAXA 2ET6A 1P44A 5CDTA 2EP5A 1X14A 4J9UE 4E13A 2YZ7A 3K8ZA 4QSMA 2NV6A 5A3JA 5T57A 1Z75A 2OZPA 1FF9A 4IGEA 5K6AA 2AQ8A 2X5KO 1EVIA 3Q2IA 3SLKA 2JHFA 3VKVA 4ND3A 3RFTA 1O9BA 1X0XA 4UUMA 1A9YA 2FSVA 3HN7A 5DBIA 5LDGA 1PZEA 2ZYAA 4BNYA 4WECA 4M1QA 4J4TA 3C7DB 2ZYDA 4OMUA 4ZN6A 5JDIC 1TI7A 1V8BA 3S1LA 4HFRA 4CODB 4BO8A 3IJRA 1G0OA 4QT0A 2V6GA 1HETA 1ENZA 3AM3A 3ZCXA 1AN9A 1S7CA 2WJPA 4PLHA 1ZK3A 1HYGA 5IG2A 5CDUA 2VWPA 3QHAA 4F6LA 3D4NA 1NPTO 1XU9A 3FBTA 3D3EA 3F1LA 2OBYA 5L3ZA 1ENOA 4S1VA 3W1VA 3VZQA 1ULSA 2H1SA 4BO7A 3VPGA 3GHYA 3X2FA 4I8XA 3S2GA 4JNKA 3V2GA 3E5MA 4PG6A 3VC7A 3I9LA 4ZRMA 1ISGA 2B35A 1B16A 3MEQA 3EHEA 1GPDG 4GGOA 3GGGA 1AGNA 3TZ6A 3ON5A 4BMSA 3UICA 4J0EA 3HZZA 5G4KA 1PR3A 1Q7BA 4GWKA 1PGNA 1GQQA 2OXIA 3GFGA 2DPHA 3D1LA 4RDIA 4D79A 2DBQA 3GPIA 1N92A 4J1SA 5IN5A 1XGKA 4PVCA 4BB5A 4CMAA 4D45A 1VL8A 2O4CA 1C1XA 4EEXA 5AXDA 1ZW1A 3B1JA 2GSDA 3NEPX 5FI5A 4K6FA 1ENPA 1VM6A 4F45A 5TT0A 2X1HA 1DHRA 5DBFA 5IDYA 1QRRA 3PFFA 2X58A 5I7EA 4HBGA 3GMSA 4YAEA 1W4ZA 3A14A 3RUHA 4XYMA 4R1TA 5KJCA 4Z9XA 1C0KA 2BFMA 1P45A 3QWAA 4K26A 4NFHA 3RKRA 4BNWA 3HFGA 4L0QA 3WMXA 2PGDA 4MVJA 2NADA 1JVSA 2ZJ0A 5ES3A 5TJ9A 3JQ7B 3CEAA 2B0JA 2OBNA 4RF4A 3E82A 3DL2A 3FD8A 5A03A 3AUUA 4LMRA 4D7AA 3ZI0A 2ZYGA 2Q1WA 3QVWA 3WGQA 2OORA 3WSVA 3DTTA 3MTJA 1YGYA 1YBVA 3UGKA 1U1IA 1ZXLA 2ZATA 1PL6A 1GUZA 2O23A 3BAZA 2V6FA 1E3WA 4PCVA 5THKA 3WX0A 2O4UX 5DULA 4AG3A 1GV1A 4BGEA 3ROKA 1LX6A 4LRSB 4G65A 4BGVA 1BG6A 3VZSA 1P33A 4O63O 2NU7A 3EZLA 3DAGA 2E49A 2QRLA 3DXFA 1RKXA 2NNLD 3H7AA 1AE1A 3H65A 4RJTA 2I67A 3C1AA 4GL4A 3IQDB 1HT0A 1RM3A 4DWVA 2Y1CA 4HNHA 4BNUA 5CEEA 2AE1A 1KS9A 2DUUA 2EG9A 5CPBA 3ZNOA 5COBA 1GYQA 3BHIA 3SLGA 5EL0A 5JO9A 4JJGA 4QQRA 1I2CA 4J1TA 1XEAA 4TMFA 2EKLA 4WCFC 2W2LD 3R0IA 3DZGA 5I9LA 5ILGA 4KZPA 4M49A 2B5WA 5AXAA 3A4VA 2PV7A 3FWZA 3I5MA 3MOGA 4IZIA 2QX7A 1ZFNA 3D0OA 3NDIA 4I9HA 2FPPA 3KSUA 2NU9A 1H6DA 1KEUA 3AY3A 3PQFA 3TDKA 3GOHA 2Y68A 2OMEA 4XR4A 1UDBA 3GQVA 4RCVA 1AXGA 3KEQA 4II2A 5BSGA 1TA4A 1A71A 1UXJA 2P4QA 4UVDA 4PGFA 3G3EA 1LJ8A 3FPCA 4DLAA 3LU1A 4NBTA 4B79A 4MKRA 3S55A 1BVUA 1UH5A 2B37A 5B4VA 2CZCA 1T1SA 1ZSNA 2O3RA 1LEHA 2X0IA 3DZIA 1UXIA 3JQ7A 3M2PA 4XEHA 1NR1A 1QLHA 1A7KA 2X86A 4RPJA 4XQGA 3KM0A 1PTJA 3DONA 2CNBA 3VPSA 3GVHA 4A10A 3ZH2A 1EZ4A 4E6PA 1I33A 1GR0A 2FOIA 3BTOA 4QFDA 1DDOA 3M2TA 2PGJA 1KC1A 1WNTA 3NJ8A 1PEDA 3I6QA 1QYCA 2V7PA 3OH8A 3PDJA 1N1EA 3PQDA 3PWKA 4UUPA 2CY0A 3KSDO 3W4KA 4AJIA 4Z0TA 1KETA 5K0ZA 1O6ZA 1HZZA 2AA3A 2J6IA 5I9NA 1VKNA 2WE8A 5EQFA 1YXMA 4P22A 4Y98A 3VHRA 2NU6A 4PZCA 1E3SA 2PTGA 3TJRA 4CL3A 3FI9A 3U9LA 3ZWCA 2O3SA 2X0JA 4UEJA 3OJOA 3QWBA 2FZWA 2D0IA 3EUWA 3L77A 3JQGB 2E37A 3NRCA 1I3KA 1ZIDA 2BGMA 1KVRA 5JO0A 4WLFA 1QV7A 2IYOA 5L4LA 2NQ8A 3PEFA 2HMWA 4MO2A 4HADA 2WTBA 5U1PA 1E92A 1X7HA 3OJ0A 4IDGA 3ZHYA 1MUUA 2B69A 4NDNE 1CJCA 4L8VA 1NBOA 4OM8A 4FD3A 3WIDA 4C7KA 4YJGB 4W82A 1YOVB 3OSUA 4CV0A 3K30A 3QJ5A 1SO8A 2IEDA 2WD7B 3JD1A 1HTBA 3GA0A 4RDHA 3ZWAA 4DC0A 3INRA 5KOIA 2WYVA 1UXKA 3ENKA 2X22A 3ROMA 3ZNQA 3AUSA 1U7HA 4CMEA 4EBFA 2BRUA 3KSZO 5L7WA 1LSSA 3VPXA 4A0SA 2Q1UA 4CLEA 4P38A 2PD3A 4R4JA 1X7DA 4BHTA 3DBLB 3L9XA 3C3XA 1C3VA 2B4QA 5EPOA 4QFCA 4B3IA 5JLAA 3PK0A 4YDRA 1UAGA 3PHIA 5A5FA 3LC7O 1XDWA 3DB2A 5F5NA 1Y8RB 3KVOA 5BNFA 3AM5A 1VJ1A 4INAA 1IHXA 2DBZA 5EIOA 4E2WA 1YS4A 3JQFA 4H3VA 1SOVA 1T2EA 4J0FA 1HE3A 4BNVA 4DC1A 5TJHA 1F14A 1GYRA 1AXEA 1C0IA 1KC3A 1NPDA 1LRKA 2VZ9A 2EJWA 4IQ8A 1NNUA 5F1KA 3R3JA 5FYDA 3OMLA 3BMNB 2NUAA 3DHNA 4LSMA 2AG8A 5A04A 3U4DA 5HS4A 1V3TA 3AWDA 3ZDFA 4GX5A 2VUUA 4CMKA 2DM6A 2H9IA 5TS3A 4CM9A 1JQBA 3GT0A 4JGBA 3U49A 3R3SA 1CF2O 4CMEC 3CZRA 4WOJA 4WLUA 3O03A 1V35A 3DBHA 1MXHA 1IZ0A 2JD1A 3L0DA 4WK6A 3ITDA 4XDZA 1XIVA 5DN9A 4Q3NA 4HWKA 2DUWA 2JCYA 1U3VA 1CQIA 2VNAA 3JCZA 1OZAA 4PZEA 4UVGA 5GZ6A 4YT8A 3ZV6A 4B4UA 3LC2O 4ID9A 3EMKA 4DMLA 2A94A 1ZH8A 5CP8A 3JQ9A 4AJJA 4DRYA 4PLPA 5JAMA 1ENYA 3AFNA 4WEOA 4YJGA 1LQUA 1YOVA 4XJTA 4MVJF 2HRZA 3HDQA 5HRUA 3GNQA 5T6BA 3ZN2A 1JN0A 1N7HA 3OIGA 3JQFC 4G5HA 4JLWA 4JCOA 1E5LA 4PN3A 1DFHA 4KQWA 4D0SA 3JD2A 4BO9A 2QQ5A 1ONNA 2PH3A 3WYEA 5DBGA 5ILOA 5GY7A 3GZ4A 3JD0A 4RVDA 3PP8A 3JQBA 4WJZA 5F1OA 5JBIA 4HY3A 2SCUA 1YL6A 4XCVA 2OL4A 4HX5A 2VOEA 1F17A 3DBLA 2D2IA 4ZJUA 1JWAB 2HO5A 1BW9A 4IS3A 4OAQA 4CM6A 1NQTA 3SXPA 5L53A 1LDNA 1ZVMA 2VWGA 4PIVA 3UXYA 3AUAA 5FF9A 4FOOA 1Y8RA 3ST7A 1EQUA 2O2SA 1AUPA 4RQUA 5JXWA 1J4AA 3CMMA 5L45A 4F6CA 1GV0A 4EW6A 1U2DA 5LC1A 1PR9A 4D46A 1R16A 1DRWA 1UP6A 2IRWA 3AFMA 2FHSA 4MVJG 3I9KA 3WLFA 3BIOA 1IPEA 3ZGYA 2Q46A 4RORA 4Z3DA 3FNFA 3JQ9C 1EFKA 4WEQA 1KY4A 1VJTA 3D7LA 1P1HA 4LW8A 4FC6A 4IY1A 3BMNA 5A4DA 3A06A 3O8QB 1JKIA 4BO5A 2EHDA 2WD8A 2CDBA 1N7GA 4PLGA 4D3FA 1PJCA 1YBAA 3SC6A 5DDIP 1R4NB 2VRBA 1LQTA 4YRBA 4HFMA 4ZVVA 1H2BA 5EJ2A 2EEZA 4MP3A 3JQBC 3RUAA 3B70A 3CSDA 3FNGA 3UAGA 3OECA 3TFQA 2QRKA 1C1DA 2ZCUA 1S6YA 1TEHA 3RFVA 4IDBA 3CXRA 5JMPA 1YONA 4Q9NA 3S8MA 4E5PA 1LRJA 3WWYA 1DFGA 3KXDA 3E6AA 3NX4A 4Y8VA 3PIIA 3ZWMA 4BO2A 5CDYA 3ZWOA 1K5HA 3T7CA 2PGLA 2BKAA 4CQLA 4J1NA 4AJ1A 4ALKA 5KJFA 4UEOA 3RIHA 4M55A 3WICA 4EJ6A 5EN4A 1M75A 4TRJA 4N5LA 1TT5B 1SBYA 2X5OA 3Q11A 1C0PA 2X9NA 4H7PA 1TVEA 5I9MA 3AOGA 4XRRA 4E31A 4WKGA 2HJSA 5ENVA 3LF1A 4Z9YA 5MGBA 2DPGA 3DR3A 4R16A 5AXCA 4J91A 4DPMA 1P1IA 4Q39A 5IXSA 4LN1A 5TSDA 3LC1O 2I3AA 2VWQA 4EI2A 4J6FA 5B37A 1YQGA 3E18A 4BGUA 1P0FA 3HDYA 3UFXA 1B7GO 1QLJA 3V2HA 3ASVA 4UUNA 1B15A 5J23A 1E7MA 3KHUA 4J7UA 1E1MA 3W6UA 2P5UA 3GPDG 4BO4A 4MIEA 1M67A 1MX3A 4FFMA 3HDHA 3NV9A 1YE3A 3NT5A 3OA2A 1PGOA 3H9EO 3I9NA 3I4CA 2GN8A 3A9WA 2R00A 4NNJA 3DBRB 4EUHA 1QYDA 2DTDA 3BZUA 1HDYA 1NQ5A 3FF4A 3ZU4A 4BS9A 3PPIA 4EDFA 9LDTA 2HMUA 1IL0A 3ADOA 1UXHA 2ZQZA 1DC4A 1HF3A 3WGZA 3HHPA 1EE2A 3LK7A 4BKQA 3AI2A 3SEFA 2F00A 4N7RA 1NPYA 1YVEI 5DT9A 1GPJA 2Q3EA 3TF5A 1MA0A 5U4QA 4MVJE 3HWRA 4ONEA 4YJDA 4R41A 4RZHA 2YV1A 1DC3A 1N9GB 1Y1PA 5L51A 2H6EA 4YCAA 3QVTA 4K9DA 1A4IA 5KCZA 1Q0LA 3SBOA 5TQVA 1LDEA 1BTOA 4Q3BA 4PLZA 5H83A 2J5QA 4AVYA 1F0YA 3G1UA 1BXGA 1WMBA 3P5SA 4FN4A 3RCBA 1Y8QB 4IUYA 1NHGA 2FZEA 4MVJP 4RVHA 2NACA 5IN4A 3OIFA 1VRWA 4R3WA 5FEUA 5ER9A 4R1NA 2G0TA 4R01A 4U6SA 4BMVA 1VC2A 1TT5A 1ZXBA 5FWNA 4E21A 3ZW8A 1HSZA 3GEMA 3F46A 3BTVA 3TZKA 1N5DA 5TRTA 1LC0A 4IXTA 1RWBA 2R00C 2X6TA 4FB5A 2VZ0A 2Y1OA 3RJ9A 4YAJA 4K1LA 3WNVA 4MINA 1JKJA 2C0CA 4DL9A 1DIRA 5LDHA 3GUYA 1U4OA 4M89A 1XA0A 3Q9UA 4ND1A 2YQ5A 4B7XA 3L4SO 4I5FA 3FSRA 2IZZA 3PWZA 2PNFA 2EW2A 4OSOA 5A5EA 2PY6A 2YFQA 3AY7A 4S3MA 3HB5X 3L4BA 3EAGA 5G0TA 1LSUA 5ICMA 3U4IA 1H2HA 2Q2VA 2GPTA 1T2FA 1C0LA 3WGTA 2EKPA 3MCVA 2I9PA 2JJYA 2FMUA 3INGA 1BXKA 4AICA 2X7HA 3DOJA 1KIFA 3RC1A 1C1XB 3ROPA 3UUWA 1J0XO 4GVLA 4IDAA 5ER6A 4IQGA 4LRTB 3QWFA 4BO1A 4BNKA 2YHUA 4FFRA 3GC6A 4ZQBA 5F3RA 3R1IA 4QX6A 4YB8A 4DYDA 1JU9A 2NVWA 1E3IA 4E0BA 1D4FA 1KVUA 1LU9A 2P2SA 2XXJA 2HCTA 2PD6A 3NAQA 1Z7BA 4KWIA 2OO5A 4AFNA 1GUYA 1O0SA 2GNAA 2V6MA 4MVJI 3B20A 4HNGA 5AYVA 2VYVA 1FXSA 4BVAA 1P77A 1RJWA 4AJLA 5U9CA 3FPLA 1Z73A 3UHAA 1UJMA 3QSGA 4D42A 2CVZA 2ZTLA 1N9GA 1E3WB 1SC6A 1EVYA 3E9MA 4RVUA 1DPGA 4E5NA 3P19A 2DT5A 4R3NA 4PFJA 3FR8A 3OFSA 4B4WA 4YEDA 4FPXA 1Y8QA 3F5SA 4OOFA 1X0VA 5TT1A 3IOYA 3RUDA 1ZBQA 1AHHA 5HM8A 3FHLA 2GZ2A 1XCBA 3H5RA 1SMKA 3CE6A 4CR6A 4IBOA 3VPHA 2RHRA 4GI2A 4KDFA 4IIUA 1HDZA 3BMCA 3GRKA 3QLJA 3CH6A 1XQ1A 4CMGA 2DTEA 3L9WA 1DLJA 4RF3A 3TOXA 1P74A 4XD2A 5L7YA 2PKQO 2P68A 3ANMA 3E48A 4Y6RA 1HKUA 1VJ0A 1NQAO 4GX1A 2G82A 2QYTA 3ZWYA 1B8VA 3VH1A 2I3GA 3PTZA 3LT2A 3MOIA 3GEDA 1UZNA 3W8FA 1WPQA 3GNSA 3RU7A 3JYNA 3RROA 1CIVA 3ROQA 5G4LA 4BNJA 2BF7A 4XGIA 3D5TA 5CEFA 1LNQA 2TMGA 5GZ3A 2HKIA 5K6AC 1I10A 5MDHA 3DZFA 3QY9A 4DTIA 2RCYA 1HRDA 3ZWWA 4TRRA 5CDGA 4XRGA 5IAAA 5JDCA 4XZ3A 3C85A 3U5TA 4O6VA 4TWRA 3UCXA 2VHWA 2VYNA 5AXBA 1R4MB 4ZD6A 3IIEA 2NU8A 5B4TA 3WGOA 2ZB7A 4GSKA 2GLXA 3UW3A 4WCDA 2UUOA 1WDMA 4EITA 3VH4A 2BGKA 2X0NA 5JE8A 3TQHA 2HMSA 3H3FA 4DPKA 5B1YA 4CM8B 3EVNA 4IDFA 1DFIA 1N8KA 4OHUA 3JD3A 1IZ9A 1XG5A 1P3DA 1QP8A 5CDSA 1P1JA 1DRVA 3T4EA 3ABIA 3K6JA 1F8GA 3WYBA 2PWZA 2VN8A 4Q3AA 4TSKA 4GVXA 5FFFA 3G49A 3L6OO 1MC4A 4YPOA 4J7CA 1T4DA 4R69A 4B4VA 3E9NA 1ISJA 4DQUA 4GKBA 4WASA 3GUCA 2JKVA 2AW5A 3IP3A 2P91A 1O89A 4ZQEA 5JFOA 3BA1A 4CLRB 1EFLA 2Z95A 4YRAA 5JC1A 4CR8A 1IUKA 2G1UA 1UP4A 4UREA 3RBVA 4BNGA 2E4AA 5JDCC 5JCJA 1ZJZA 1T2AA 2O3JA 4OSPA 1GAEO 1ZO8A 3ZV4A 2WSBA 3JQCA 4RV9A 1DXYA 1R0SA 3RC9A 5EERA 4E2XA 1X15A 4ITUA 4BNTA 5CG2A 3ADPA 4CL8A 3PYXA 1ZKMA 2NVBA 1R6DA 3DOOA 5KKAA 4MP8A 1XQ6A 2YJZA 4B8WA 1EBFA 4NG5A 1HLPA 1A27A 1LTHR 1ZMOA 3KB6A 1E5QA 3RC2A 2VNSA 2WWRA 1XU7A 1BMDA 1Y81A 2YV3A 4MVJD 1GEGA 5JPIA 3PFWO 3P7MA 1H5QA 5THQA 4BNFA 1A72A 2I99A 4JBHA 4LCEA 4YYZA 4WE3A 1JDJA 4ND2A 3H3JA 4B8ZA 4I1IA 4MP6A 1PZFA 4AJEA 3V5NA 2Q50A 2CVQA 3GEGA 1MXFA 3PYLA 5DP2A 4CJXA 3H5NA 4TKMA 1SB8A 2A92A 2CD9A 3ICPA 4OYRA 1R4MA 3NDJA 2NTVA 4XB2A 4Z3KA 3AY6A 3S2FA 3DWFA 2Y99A 5JAZA 3G17A 3C1TA 4FDAA 3KV3O 4O0LA 4YJHA 1MC5A 3RUCA 1HLDA 3GN2A 5BSHA 5KVCA 1K2WA 2YW9A 4YVFA 4QECA 1KEWA 5KJEA 3OQ6A 3KO8A 3GG2A 2VUSA 4CM8A 2HJRA 1HE2A 1LBEA 2WDZA 3BMOA 2GDZA 3NTOA 2IZ1A 4B3JA 4ZGWA 1EVZA 1DLIA 2WE7A 2VHZA 2D5AA 4YJFA 4A5OA 4Y6PA 3RU9A 4E2ZA 1E6UA 1HEUA 3TL3A 3KYDA 3IKTA 2A35A 3QP9A 2C20A 3WGGA 4E5YA 2X9VA 1YDWA 3I4FA 3F4BA 4TZKA 3I9MA 4CLRA 3VH3A 2JAHA 1U2GA 5GMOA 4PG8A 7ADHA 1RM4A 4BKUA 5KIAA 1H6CA 2BLLA 4CPDA 3DBHB 2GZ3A 4EYEA 4XDYA 4Q3DA 3ZV5A 1ZSVA 1W0CA 1HYEA 3GRPA 3PWSA 2GYYA 3RUIA 5B12A 1IY8A 2QYSA 4C4OA 4FFNA 4RPGA 2EV9A 5TX7A 1VSUA 3OETA 4DGSA 3RBXA 3FTPA 2VT3A 3AU9A 3HG7A 3LLVA 2ZK7A 3ITKA 4JBIA 2W98A 1CYDA 4I5GA 5A9SB 4Z9FA 4E32A 3RFXA 4R1SA 4MJLA 3WMWA 1OFGA 1XR3A 2NVUB 1E77A 5I7VA 4N5MA 3WFIA 3CUKA 2BELA 5DCUA 5TLSA 4J7XA 4CMCA 1Q0QA 2AHRA 2CDCA 5F5LA 1T24A 1RPNA 3FN4A 4ZU3A 4URFA 1I01A 1SPXA 3F47A 1QMGA 2GRAA 2IODA 3OEYA 4AJHA 4DQXA 4NMHA 1I24A 1L1FA 3HDJA 3PGXA 1HDOA 4NBVA 2GN4A 1XYGA 4EGFA 5CFZA 2W2KB 4MKZA 2DKNA 5CEJA 5BSEA 2ZB4A 1EMDA 4BNNA 3WGIA 1BW9B 1A7AA 2ZIZA 3IS3A 8ADHA 3OQ1A 4B7UA 2NTNA 2QW8A 3INTA 4CMHA 2B36A 3ORFA 4BQRA 4GX2A 3HSKA 2DVMA 1UXGA 3I6IA 3IL2A 3QE3A 4CMJA 3QV1A 2POQX 4Y9DA 4DA9A 4N18A 1UDAA 1IE3A 1GYPA 2FR0A 1DEHA 3DZKA 3G79A 4LISA 1I3LA 1DO8A 2YYYA 1A4UA 1XWFA 2BGLA 3DO5A 4RZIA 1LDYA 2PA3A 4NPCA 4JJFA 4PRKA 3JYOA 4GX0A 1PU2A 4YACA 3U4HA 1XKQA 4NZ9A 1YJ8A 3VDQA 1Z7EA 3VTZA 1HDRA 3Q2KA 2OP1A 2H5LA 4Z0HO 5A1TA 1YH3A 4L73A 3ZV3A 1LDMA 5KVQA 3BTUA 5L7TA 1NP3A 4NK5A 2BH9A 3DHEA 4XWYA 1MG5A 1U7TA 3H9UA 4R5HA 4CM1A 2EIHA 3ZNPA 3H5AA 3NDRA 2FY8A 2JAPA 2PH5A 4BNLA 3U0BA 4BO0A 4ALLA 3WBFA 3IKVA 3MZ0A 2GD1O 1PJSA 2CSUA 3ZU3A 1F12A 1C1DB 3ZWNA 4AJ4A 4FJ2A 4L4XA 3W4JA 1ZK4A 4QO8A 1MFZA 4DUPA 4UVIA 4OXNA 3T7EA 4HFNA 3MWEB 2OFPA 3OJFA 4TRMA 1SEVA 1K3TA 2RBEA 3R6DA 1EDOA 4CQLB 1K6JA 1PL8A 5A9SA 1WDLA 3COSA 1JWBB 2C7VA 4ROSA 4NH4A 1HDGO 1YB4A 3HQ4O 2NVUA 2AEFA 3ETGA 4FR5A 4YRDA 3WIEA 4ALMA 2O48X 3U62A 1Q1NA 4L75A 3GH3A 3VAZA 4RF5A 3NGLA 3QVSA 1LC3A 1PJ3A 4DIFA 3BYZA 2OHXA 1VKOA 1I36A 3NTQA 4FIZA 5CHEA 2H63A 4AJKA 4TVOA 1YJQA 2HK7A 4J9VA 4MVJM 1PJTA 2HDHA 3LYLA 5IDQA 4GGPA 2W2KA 2I65A 2Z5LA 1HDXA 4EJ0A 3PYMA 4E5MA 3NUGA 1G0NA 1GQ2A 2VTEA 2ZTMA 1X13A 1V3UA 1YL7A 2GN6A 3DQPA 3AM4A 1OC2A 4OOEA 2J5KA 1P31A 3KETA 1E3JA 3I9OA 4WUVA 2Q2QA 4YA6A 2VOJA 3HNPA 4H15A 4CM9D 3MJTA 1R66A 4PLYA 2YV2A 4PVDA 3KEOA 1HE5A 3JD4A 1GADO 2DFDA 1Y5RA 3SJUA 3ENNA 3GN1A 2HU2A 1M6WA 3F9IA 4IZHA 4BNXA 3JV7A 3RI3A 4LMPA 3QRWA 5BNTA 2OOSA 4H16A 3DAPA 1GZ3A 1ISIA 1NQOA 1Q2XA 1UZLA 3DHYA 1RYDA 1E1KA 3GAFA 4PZDA 5DP1A 3QIVA 4JROA 3VZPA 1HWYA 1QR6A 3BTSA 4C7JA 5I8WA 5KVVA 1Y9EA 4IXWA 1CERA 2VRCA 2A4KA 5AOVA 1ADCA 4CM5A 1J5PA 4LSWA 1P9LA 4E30A 4WOKA 4I9UA 1JTVA 1UUFA 1MGOA 1D8AA 5ADHA 1L7EA 4ZA2A 2Q1SA 2D4AA 3KOUA 1GTMA 3WJ7A 4II3A 4TROA 1U9JA 4CMIA 4XYGA 5G0VA 2Q1TA 3WG9A 3W4IA 2ZTVA 2DBVO 3BMQB 4OXYA 2NSDA 5IJZA 1E7YA 3RQSA 1D1TA 3K96A 5HS6A 4X54A 1LLUA 3VZRA 5HTOA 3S2IA 1BXGB 5ENDA 2E6UX 3AOEA 4CMBA 1NAIA 3PGJA 2ZKLA 3TWOA 3PLNA 5FI3A 4B3HA 4KQXA 3HN2A 5JAIA 1BHSA 3JYLA 1P1KA 1H94A 1U8XX 2Y1FA 4PLCA 5T8KA 3GAZA 1BVRA 2BFAA 3OF2A 3JQ8B 5TIIA 3QVXA 1WXDA 4WGGA 1EBUA 2EW8A 2Z1MA 3PIDA 4NJOA 3H8VA 5EINA 4A26A 1DJQA 4TKLA 4M54A 1ZK0A 4UULA 3TZCA 3VOSA 1GQYA 3QWIA 4GLLA 3F6YA 1NAHA 1YL5A 3SC4A 1D1SA 3G0OA 1YB5A 4CQMA 2GGSA 4XGKA 5COQA 1U3TA 2Q45A 1JA9A 3GF4A 2YFHA 4E2YA 2C07A 2AQHA 4U7WA 1ZMTA 1WWKA 2AEMA 3DMYA 4IS2A 4CLHA 1DBVO 1WP4A 3F1KA 4MPDA 3ANNA 1VI2A 5H82A 4K28A 4KWHA 3TNLA 1DIHA 1DRUA 1E7WA 2C59A 4GKVA 3PHGA 3AOEC 5F1PA 1UDCA 3I83A 4XX0A 1IHYA 4HUJA 1CRWG 3WQRA 4NR0A 5KNLA 4B4OA 4IJVA 1NYTA 1OMOA 4KMSA 5C7LO 2FPGA 3JSAA 1E1LA 3JQAA 3O4RA 5T8KC 4ALIA 4M8SA 1QYWA 1Q7GA 4F46A 5BR7A 1DJNA 1PX0A 7MDHA 3DFZA 1IULA 4BKRA 4BIIA 2R2GA 2D8AA 2EWMA 2JD0A 3BMQA 4HV4A 4XIJA 3GVIA 2FN7A 4OH1A 2YUTA 4A03A 1PQWA 1B26A 5TF4A 1LRLA 3EY4A 3QVOA 3PXXA 4YWJA 1LXCA 1E3EA 1XELA 5DCYA 2O7SA 3KBOA 4MKXA 3W8EA 1BDMA 2AXQA 2PZKA 3VVCA 4FS3A 5TC4A 1VE9A 5A02A 3AK4A 3E8XA 4JQCA 3JQ8A 1H6BA 3BMCB 3WLEA 4MOWA 2X0RA 3KZVA 1R0KA 2EKQA 3IUPA 3P2YA 1E6EA 1TB4A 4Z6KA 8LDHA 1B14A 2W90A 2IYPA 2AMFA 4IJUA 1SAYA 4XYEA 3TN7A 3GZNB 5G0WA 1DAPA 3L07A 3GG9A 5DOZA 3RASA 1D3AA 4QTZA 1NWCA 2HMTA 3D5QA 4XIYA 4CV2A 2Q49A 1WZEA 3H2SA 1U5AA 3KTDA 4XKJA 2J8ZA 3BHJA 3KYCB 4OKIA 1FDVA 1A9ZA 4GLOA 1W73A 3STHA 3VTFA 4I08A 1XSEA 4PLVA 4A27A 3GDGA 2E48A 4BO6A 5DCWA 4E12A 2FRDA 4JJIA 3KLMX 1QXSA 1JW9B 2B4RO 1SNYA 3Q9NA 4J4HA 4NHEA 4BV9A 5L95A 4YQZA 2YDYA 2JFHA 4CM7A 1EK6A 3UCFA 2OP0A 3ZWPA 3UKOA 3RVDA 5JY6A 4G2NA 3AU8A 4TRNA 4KTVE 1P1RA 1WZIA 1VL6A 4IJKA 2W4QA 1PGJA 3OEWA 2WYUA 3RBZA 1YBMA 3IDSA 4I9NA 4P4NA 5JAQA 1PL7A 1RM5A 3MJEA 4J43A 1UP7A 1ZCJA 3EDMA 3IMFA 4B7CA 4DREA 4QUKA 4ND5A 3WTCA 4LK3A 4ND4A 1BRMA 4AJOA 4DXHA 3D4OA 1PQPA 1PGQA 3K2BA 1K89A 1ARZA 4J16A 4NIMA 3CIFA 3FTNA 1CEQA 1TLTA 3CZMA 3VDRA 4BGIA 3WOHA 1OAAA 4ZQGA 5GZ1A 3L4BC 4N5NA 1PJ4A 4D0RA 3WBBA 2O7QA 4NFSA 3UCEA 4DBZA 5JMWA 5DF1A 4BNHA 2NM0A 1GD1O 3ZNNA 4KTTE 3LQFA 3WGHA 3GDOA 2AG5A 4E5KA 4PLTA 4KP7A 3ZWVA 1O5IA 5TNXA 4XYLA 2CDAA 2VCYA 3L6EA 3OJEA 4MDHA 3AUTA 1F06A 2IE0A 2OGUA 3PJFA 3PJDA 4FSHA 1EQ2A 4RPKA 3B1FA 4ILKA 4Z0PA 1PS8A 3CTMA 2O3QA 3GHHA 1NX6A 4U8GA 5ITVA 1KEPA 5BSFA 1SCUA 2G76A 3CMCO 3K5PA 2C7GA 1GCOA 2J3HA 3GZNA 1WAMA 5KJ1A 3I3OA 1HE4A 5I8ZA 4FGWA 1ONOA 3T4XA 3H9QA 1IYZA 4JIGA 4PLWA 1ZK1A 4BQPA 1AHIA 1NFFA 1TT7A 3E1KA 2EGGA 1LI4A 4NJMB 1ZZEA 3RD5A 1ULUA 4MIYA 1R15A 4OIMA 4DQVA 2WYWA 1N1GA 4FFOA 1Y9AA 4PG4A 5A05A 3NTRA 5L4SA 2VYVD 4U5QA 1T26A 2C82A 4J49A 1JKFA 3D64A 3KYCA 1PIWA 5L4NA 5KJ6A 2EJVA 5KTKA 3F3SA 2LDXA 1MLDA 3WSWA 3ZWBA 3IJPA 2PK3A 2FSSA 5C37A 4D44A 1M6HA 2P5YA 4XJSA 4IPTA 4Y6SA 1ZNQO 3ZHZA 1R12A 2AQKA 2PKRA 4RF2A 3F5QA 1X7GA 3HJAA 5AQ1A 2GF2A 5IZ4A 4YQYA 4O59O 3M1LA 2X8LA 3DAFA 4YJHB 1LSOA 1ADFA 1PZHA 5B4UA 3N74A 4TQGA 3W6ZA 2VWHA 3TZQA 3MJCA 3KRTA 4RQTA 3I52A 4UVHA 4ZRNA 2YY7A 3RKUA 3BMOB 3I9JA 5T67A 3EGOA 1ML3A 2PZJA 5C7IO 1NFRA 4GBJA 2YQ4A 4JX8A 2O2YA 3U09A 2W2LA 5DZSA 5A9TA 1IB6A 1T2DA 1P1FA 3H6KA 4YJFB 4YTEA 3E5RA 1PSDA 4P4GA 1P0CA 2PFGA 4M86A 2DTXA 4WCFA 3TPCA 4YAIA 3HE3A 4L74A 2FR1A 2HK8A 3C24A 3KYDB 4W99A 4W9NA 4FFLA 3GFBA 2J3JA 3EK2A 1PQUA 4O5OA 1RM0A 1M66A 3C8MA 5IFLA 4E33A 5JSFA 1QYVA 3N58A 1DOHA 4BO3A 1YRLA 3MJVA 1NHWA 4CLOB 4DYVA 1YO6A 2Y1DA 1UZMA 5H81A 3RSHA 3UOGA 1TXGA 4KOAA 2IXBA 2A9FA 1NVGA 3DC2A 3SX2A 4AL4A 1FDWA 4BMNA 2Q99A 3NT2A 3TZHA 2GZ1A 5HBRA 4CV3A 4EUFA 4ALNA 5T5QA 3ICCA 1A5ZA 3PJGA 2EGHA 3LVFO 2VYND 4RO0A 3C1OA 1N2SA 1T25A 4UVEA 1M76A 3W8DA 1O8CA 5DNAA 1DIAA 2JHGA 1X1TA 5C3MA 2RH4A 3GVCA 2B5VA 1NWHA 1EUZA 2ZB8A 1I3NA 4NJMA 4NFYA 1IPFA 1NVMB 2VHYA 4DPLA 5JY1A 2J3KA 1V0JA 5IXYA 1LDGA 1YQXA 2Z1NA 2YHIB 1MP0A 4GQAA 1W8DA 1HSOA 2ZTUA 1LLQA 2VTDA 4ALJA 4HP8A 5G0SA 4EEZA 1NVTA 3FWNA 5AVOA 4W9NC 4OJNA 1EDZA 1ZK2A 1OOEA 4BNZA 1H9BA 4BOYA 1BXZA 3M6IA 1Y5MA 4FQ8A 1LSJA 1W6UA 5L9AA 1IOLA 2FWMX 3LT1A 4WLVA 4CM4B 3ASUA 4RGBA 3V1YA 2UV8A 4N54A 2YDXA 4YAGA 1DB3A 1E7RA 1RYEA 3H4VA 4KUEA 2F1KA 3OQBA 4XGNA 4CR7A 4IDCA 4W7IA 5A3VA 2EERA 1B3BA 4CV1A 4WPGA 3BHMA 3A1NA 3S2EA 4RPHA 1HXHA 2ZB3A 1DIGA 5JCJD 2UYYA 4JXKA 3GR6A 4FBGA 4IJWA 4CLXA 5JYDA 5L40A 2NQTA 3FBGA 1MFPA 1GZ4A 4CUZA 3X2EA 1FMCA 4CM3A 1V3VA 1E1NA 2QIOA 4RLHA 3VH2A 3K9QO 1JAYA 3O9ZA 1MV8A 1QV6A 2CUKA 4YT2A 3DBVO 4UAGA 1Q0HA 2C54A 5EMHA 3OP4A 3WFJA 1I30A 1SZJG 3OHSX 2NWQA 4IGFA 2VZ8A 4GMFA 4RVSA 4PG7A 1NFQA 3LZ6A 3ZHBA 1KEVA 4CUJA 5CPFA 4DLLA 4CLOA 5HWSA 1Z45A 3FCOA 4NBWA 3IP1A 3PVZA 2WMDA 4OQZA 4WLEA 4AJPA 4ESOA 1BDBA 3K31A 4FOSA 3WNQA 5BNIA 1K6IA 3GGOA 4R51A 4IIVA 2AE2A 4QO7A 2DFVA 2X23A 1T1RA 4GMGA 4ZQFA 2Y66A 4ZQHA 2C5EA 4GAEA 1OC4A 1LLDA 1GY8A 1HZJA 2W8ZA 4W6ZA 1JLLA 1KVSA 3TRIA 3V1TC 4R9SA 2C2YA 1D7OA 2RAFA 1KVTA 2QRJA 4GH5A 2NLOA 2BD0A 4BKPA 3NJ4A 3QWHA 2C5AA 5C5IA 3HFSA 3D3WB 1WVGA 1E0DA 1PGPA 1T2CA 2LDBA 2X4GA 2YHIA 4J2OA 3WQSB 3Q0EA 4Q3CA 3K92A 1DIBA 4J4BA 4AJNA 1EVJA 1GZ6A 1VSVA 3AJRA 2JFFA 1PJBA 4CUKA 3RUEA 5IF3A 2JFGA 1CWUA 3GK3A 1ZJYA 3GDFA 3DFUA 2QZZA 3RWBA 3FNEA 1ZUD1 4CM4A 4ZHSA 3Q3CA 2CF5A 2ILTA 4BKOA 4ZICA 3VKUA 2AQIA 2BHLA 3BXXA 4TZTA 3VPFA 4KUGA 2FR8A 2IDZA 3OIDA 1V6AA 4DLBA 3GY0A 1QKIA 4IDDA 4DVJA 4JN6B 4RPLA 4PRLA 4U0KA 3DMTA 3JYQA 1EE9A 2VQ3A 4LGVA 2P4HX 1E6WA 2DAPA 1QORA 4UEKA 5KVSA 1ZEJA 3TFOA 3DZBA 1CQJA 4DBVO 2CFCA 3MJ4A 4DIBA 4R68A 1E3LA 1GUFA 2G5CA 3OBBA 5IDWA 4L4RA 4A2CA 3QA9A 1U3WA 3FRJA 3M1AA 2UUPA 4D41A 1CDOA 3I23A 1E7SA 1DC6A 2O3TA 3ANLA 5BQFA 3PZRA 3G1TA 1UR5A 3WJAA 2HUNA 4AJ2A 2BFOA 1NM5A 4RVFA 2PKQP 4CMIB 3UN1A 5JNLA 4KDEA 3TSCA 4IM7A 1B8PA 1F8FA 3GNTA 1Q7CA 3RC7A 2GN9A 4WLNA 4F3YA 1B3RA 1J6UA 1B2LA 4K6CA 1R37A 4EZBA 3DEYX 3ZHXA 1EK5A 1PZGA 3FNHA 2UVDA 4LVUA 1PJ2A 3U4CA 2AEJA 3JYPA 4WNIA 1I2BA 3JQGA 2XOXA 4MIOA 4OL9A 1M2WA 2D1YA 3ONFA 4BB6A 3DMTC 3CPSA 2EF1A 3HUDA 6ADHA 1PS9A 2WEKA 3D3WA 3LLSA 3WTBA 4JP3A 3E9QA 3QQPA 4PG5A 3PHJA 1MB4A 1VLLA 1EUDA 3QW2A 1FK8A 4NQZA 4A7PA 1VPDA 2JCXA 3OM9A 3HADA 2GCGA 1WDKA 4GSLA 2UDPA 4CQMB 1E7QA 2P9GA 3A28A 3PJEA 1PWXA 2X9GA 3GVXA 4OQYA 4YR9A 2WD7A 3H9GA 2Y0DA 4YBZA 4R9RA 2ZQYA 4OKNA 3WDSA 1GCUA 2DBRA 1Z6ZA 3SJ7A 5I7SA 3K73O 1WMAA 3B1KA 2G17A 1T4BA 4D3DA 1HL3A 1U4SA 1LLCA 2C2XA 3RAJA 5BT9A 1B0AA 2C29D 5A9RA 1C14A 4A73A 3WXBA 3NGXA 4O1MA 4FGSA 2RHCA 2IEBA 3I1JA 4J2HA 2BFPA 2DQ4A 5DOVA 3PI7A 4IINA 5IDXA 1XHLA 2HSDA 4BNMA 1U5CA 3D4PA 1OI7A 3JQAB 2Q4EA 2O3UA 4GPD1 1JVBA 5K9ZA 4XQCA 4BV8A 4XQEA 1ID1A 1Y7TA 1EUCA 1WW8A 4NBRA 2PD4A 2Q4BA 1Y6JA 3WWZA 1I8TA 2WM3A 2JCVA 4LCJA 3TL2A 5JC8A 4GWGA 5IZCA 3ETDA 5TGDA 4JP2A 1H93A 4WNCA 1DSSG 1U28A 4J90A 3KUXA 4U0JA 3AI3A 2D3TA 3C7AA 4HKTA 2VHVA 3UF0A 2Y05A 5JS6A 2J3IA 1WLYA 2V65A
chains in the Genus database with same CATH superfamily
5LD2B 1W19A 4MVJH 1UPAA 2WU4A 1YJ5A 3IHTA 4B1FA 1Z8NA 1GEEA 2QG4A 3C7CB 4G89A 3EGCA 5G1PA 3V2UA 1VJRA 1VRVA 4YXFA 3NM5A 3JTMA 1XQWA 4EJMA 2WABA 1LA2A 4ZVNA 2IV7A 5GV8A 3MOSA 1ZVKA 4MUIA 4DBLC 5F21A 5C35A 2JD2A 2AG1A 3F3MA 1TC2A 1FS6A 4NBUA 2IU0A 4KFCA 2AI1A 4ZREA 1W4AA 2REBA 4HFJA 3VVMA 1XEWX 2VF8A 3U40A 2FRVA 3ANXA 5COAA 3ULKA 2QTTA 5JH7A 3O73A 3ZGNA 4TTPA 1S1MA 3O38A 3Q6IA 1HYHA 2GCOB 2AC4A 3WB9A 4W1RA 3KJGA 3OPMA 5G1NA 1NTOA 5CBKA 5LIRA 2GR9A 4HDQB 4EGJA 2Y6VA 2FFBA 5TQ2B 2Y1GA 5KOJA 3FDZA 16PKA 1J20A 3L5OA 1T8TA 1ADGA 3CF4A 4PQFA 4CF5A 3IVAA 3A9CA 1PG5A 4EA6A 1KR2A 2IXEA 1XJQA 2VRCD 2V7XA 3JQRA 4DZRA 5I47A 4NKRA 3NC4A 1PT8A 2BGIA 1H2WA 5AK6A 2H5IA 5IZCC 4G0ZA 2N0SA 5E6SB 4LY3A 2C4VA 5CR9A 1TJ4A 4MI6A 3TG8A 1U28C 4RWZA 1FFAA 3T0IA 3WIUA 2WT4A 1R6TA 1V4BA 5DGTA 3KU1A 4MV7A 2OGSA 5JSUA 1E66A 3NBQA 5BQ5A 2JVKA 2ZJYA 1U8UA 3E15A 3NKLA 4KFRA 2AFHB 2QRZA 3DSRA 5J47A 2FNAA 1N0IA 4BNIA 4PS0A 5H3LA 4QC2A 4XB1A 1GGHA 2CXOA 3UJ9A 1SK8A 1YDEA 5KNCD 5BRAA 4BBPA 4E4YA 2CUZA 1X9GA 5AUQA 4E3ZA 1OJ7A 1UOQA 4PSVA 4WLOA 2LP4Y 3SAJA 1N1DA 1RWNA 1YQWA 4EIWA 2AN4A 3RJZA 4AZVA 2Z2YA 3IAM1 4ZEVA 2CF6A 3RUPA 3LWBA 5K01A 3PFBA 2WDPA 4JIMA 1OLUB 2BHSA 1WQ4A 4F4IA 3FLEA 1FJ2A 4PNHA 2ZZNA 2L69A 1EEHA 2HF2A 2I6TA 4D3SA 3PQ4A 4UU0A 2IXTA 5CIYA 3RNOA 5EQJB 1W76A 3RRBA 2M6KA 4F85A 2RIRA 5ITWA 2PLAA 2WAMA 3M49A 1C9JA 4FFPA 5TPZD 1U3UA 1GKIA 2GVZC 2E82A 4Q3EA 3UW3A 2QHXA 1K98A 4B4DA 1SK9A 3RV4A 3VTKA 4CLDA 2EBHX 2KLHA 5EMKA 3B5IA 1SXGA 4PLFA 2FG7C 5ICSA 2IEGA 1RMQA 4EZIA 2PZ8A 5KWSA 2GERA 4TLMB 3C6BA 3GGPA 4UTVA 3S3TA 1ZGHA 1O95C 2II6A 3EZYA 4HXFB 4P3OA 3TNJA 1DQSA 1UPBA 4YP5A 2HCFA 1XK7A 5F4ZA 4U6QA 2XZPA 2X5JO 4H60A 1U7ZA 2FX2A 4FKZA 2WV9A 4JITA 1IY9A 3ZZMA 4DLSA 2A9KA 3K5WA 2YXLA 4NENA 3CONA 1XNQB 2DLDA 3NYWA 4JBGA 3I04M 3R9XA 2XMSA 1XLTA 4Q3OA 1X92A 5BWLA 2CEAA 1GPBA 4PZPA 2FWNA 1M0EA 1DZ3A 1VXOA 4QL3A 1IOVA 2I7CA 3E2MA 3I2IA 1PYGA 3EASA 3GROA 4R1UA 1YU9A 3BS4A 4IEIA 1Q3HA 4XA8A 2CLSA 4RUKA 4EUEA 2FYTA 1EDDA 2PEZA 2W58A 1TFUA 2XAAA 3JQDA 4GEGA 1SB9A 4UU8A 4EPRA 5EJ7A 1GPAA 3VR3A 1XDDA 4KVZA 4RE6A 3LOPA 1TYEB 1ZMXA 3TOZA 1F9EA 3QBEA 1NZFA 4FJ1A 1K8YB 2QTHA 3VHQA 3OA0A 3WR5A 3NHPA 4KYUA 1GRRA 3ZBPA 1TJPB 2JEZA 4AWAA 4BEBA 3Q7QA 2ZJ6A 2P9CA 1C81A 4V0KA 4N4AA 2FPIA 3OWHA 1QR2A 2WJHA 1ESDA 4OXKA 2DF8A 1L4HA 2FZGA 1LUAA 1W36C 2HIGA 5AW3A 4HLUC 1HR0B 3EGIA 3RC8A 1R8QA 1W1IA 3IT3A 1J97A 3KTAA 4IXMA 1DIOB 2X9LA 4UZSA 4PTZA 1AZTA 4C7BA 1I0ZA 4RA9B 4BQIA 4EZEA 2J6BA 3BD9A 1ESZA 1G3UA 4J1QA 3VGPA 5C8VA 4HGZA 1DS6A 1M5TA 3EB9A 3R7AA 2OV2A 4YR7A 1Y4UA 1FDTA 1V1RB 2CMDA 2ZDGA 1Z35A 4B3BA 4IRXA 3IKLA 5GOZA 3H18A 1VECA 3E03A 4GPEA 2IUYA 2WKQA 2JIZD 3CVWA 4Q93A 1ZGCA 4O8CA 4U00A 3DE4X 1US8A 4B82A 1JQKA 3M4JA 3TUIC 3NHUA 5HIAA 2ODPA 3TDMA 1XPUA 2GO1A 4UJ5A 1U2RA 2KJQA 3LCCA 2EFEB 2D74A 4FONA 4UUOA 3SQXA 4OJKA 1H23A 1JAIA 5LCXA 1SRQA 1C9DB 4WL0A 2NTJA 3MB5A 3BXOA 4JMLA 3RSSA 4CF6A 2FZVA 4A15A 3G8BA 5F3WB 2P67A 1PJQA 2OKCA 2GS9A 1G21E 3QKUA 2XMZA 1YZLA 2JIQA 4PY2A 1J00A 4OGWA 4DKJA 3ONNA 2CBXA 1YZGA 2VP6A 1ONPA 5HJEA 1WBBA 2WBLC 2JLWA 2B7CA 1QIHA 1Z39A 1EJBA 2GYUA 2PUBA 3D6JA 5EJ4A 1JEDA 6REQB 5EIHA 4DZZA 1A7UA 4FBLA 1JALA 1UXOA 2I4RA 4KQCA 3K8ZA 1J39A 3SEAA 3WRVA 4O4JF 2O8BB 1Q20A 2ASEA 2C5HA 2HU8A 1Z75A 3JAWB 2QVLA 3CZ4A 4IVNA 3IEUA 3AKDA 1KSFX 1EVIA 2Z3ZA 3PXEA 4KXVA 5J1TB 4PCUA 2V0GA 5JD6A 2R6AA 1KDRA 1YHNA 1X0XA 1F0NA 2QDKA 3MVEA 3TAXA 5LDGA 5JEDA 1KIAA 3ILXA 2VNHA 4E46A 3F5MA 1OX5A 5IHXA 4J4TA 3EFBA 4ZCMA 1U3DA 1W2WB 2PVSA 5KNBD 3JX9A 4OMUA 5JDIC 1FRZA 4WKPA 3VZCA 4DMHA 1OPRA 3OAAA 1VHWA 1G0OA 3MWDA 4V38A 2OPBA 1HETA 1ENZA 4EX7A 3ZCXA 3FUVA 1S7CA 2WJPA 3DQZA 4O4IB 1QHHB 1HYGA 1ZK3A 4AECA 3TI9A 5LQNA 5CDUA 4F6LA 3T3NA 2R5FA 3FBTA 2C98A 4BVHA 3D3EA 3TLMA 3W1VA 1D2RA 5IAJA 4AS3A 2H1SA 2C9DA 3I64A 4O8ZA 3RO7A 3P9RA 2P75A 4M1OA 2JI4A 3VU9B 3DZCA 3V2GA 2GCIA 4P7KA 3E5MA 1VMIA 1TPYA 4PG6A 4KQHA 2BLNA 2FEKA 4I36A 3WBKA 2PBZA 4FLEA 1E2FA 1SWVA 3V8EA 3GGGA 3CLRD 4BMSA 5HZGA 2V4ZA 3UICA 3ZYCA 4RTRA 4BMZA 1FMLA 1U0TA 4J0EA 3HZZA 4LGYA 3L05A 4CKYA 1KJZA 1PGNA 1QYRA 2W6ZA 2JARA 4DDHA 3TWOA 1SVLA 3DLIA 4ZDJA 3TLGA 4OD0A 4RJ2A 4MCHA 1SKMA 3G5UA 4BRSA 4F4CA 1C3XA 2AN5A 2C3UA 4FOPA 1XDGA 1EWYA 3B7PA 3NUQA 2XUKA 4PEVA 2DOKA 1X80A 2O4CA 3BE6A 3L7YA 1SULA 4I50B 4RETA 3R3UA 5AXDA 3QPUA 3VHXA 1ZW1A 4E5VA 4NBKA 3VKGA 4H0NA 1VM6A 4TTRA 1XQXA 1RQLA 3OZVA 5DBFA 3ZPXA 1E1RA 4RX1A 2BR3A 1AO3A 1KGSA 1TA0A 2E5FA 4YAEA 3OZCA 3UJ7A 3RGGA 4XYMA 4RDCA 4MK4A 1BMFA 3RVKA 3W2HA 4R0MA 1I6KA 5JH7F 4MI9A 1C0KA 1Z29A 2ACEA 4MGYR 1QV9A 1ZI8A 4K26A 1B6GA 1UKAA 2OO3A 1E59A 4NFHA 4K9SA 4BNWA 4D6PA 1NMSA 1T4GA 1YVUA 2XCLA 3MLAA 5EWMB 4EK9A 1UMBA 2ZJ0A 3CISA 2BEWB 5ES3A 2BFDA 2VQSA 2VSOA 1KL7A 4ZALA 3CEAA 4AKSA 4JI0B 1XV5A 4RBNA 1VJ5A 2XQFA 1CRQA 1M1NA 3C87A 4MQ4A 3VSCA 4EBBA 5EZYF 5EJEA 1KRWA 4I4TA 2C4NA 3ZI0A 4K6KA 2EX1A 2WZBA 4HNSA 2OEPA 3HCBA 5EGSA 3WSVA 1H9CA 1O6FA 2Z5FA 3NNSA 3QPVA 1YBVA 5F12A 3UGKA 4X1IA 2ZATA 1E1CB 1D6JA 1GUZA 3BAZA 4HTFA 2WYIA 3OJCA 1NUTA 1GV1A 3VR6D 4AG3A 4OQDA 4C22A 4NCKA 3VJMA 4Z5XA 2JCSA 2NU7A 3LX5A 3Q0IA 3AP3A 4KQGA 4N0EA 5F33A 3T61A 1YC5A 4A91A 1I7SB 2PANA 1RCUA 3ZVKA 2E49A 1XJWA 1UDWA 3UFBA 4H18A 4ZP1A 2NU6B 4PYQA 2C31A 3EVFA 5AHXA 1EU1A 5ERGB 2GBIA 4EABA 1VG1A 4YUZA 2G08A 4AO8A 3PTLA 4HC4A 3IQDB 1DJOA 3HM9A 3G7NA 2YN4A 3JZIA 4LZJA 1L5LA 4DWVA 1U1CA 3PCRB 4DRXA 4HNHA 5B3JC 5A3RA 5CEEA 5DXJA 5LKAA 5BYJA 5DISB 2XLCA 4BQNA 1PT9A 2P40A 3NONA 4L9WA 1TVKA 2MTBA 2EG9A 4I3GA 5CPBA 2NP7A 2IYWA 4LTMA 2EBUA 2QSYA 3KB8A 3Q5EA 2WJWA 4HUQA 1JHZA 2DHDA 2PGIA 4MYRA 4B0OA 1KAHA 3LRPA 1N7IA 2RH9B 4IH9A 2O8DA 4TTJA 1JDZA 2EKLA 4ITVA 2H1RA 2WIBA 2AN9A 3R0IA 5AHRA 5C1IA 1KMHB 2X77A 5HKLA 4AMGA 1YRQA 2XDAA 4M49A 4F5ZA 4ZVKA 1KYZA 3ZIAD 3N86A 2ATXA 4RGYA 3F8TA 3D8NA 3AKYA 3I5MA 1TO2E 1JDSA 4OM7A 4EKGA 1ZFNA 3AJ9A 1I14A 1RI3A 1XP5A 1SWWA 2JGKA 5E0OA 1EXWA 1RRPA 2PFSA 4UTPA 1EK1A 1SKQA 4NZOA 4C0WA 3OZDA 3CO0S 3TDKA 1Y34E 3GOHA 1JSZA 2Y68A 2QT0A 2OMEA 4XR4A 1FTNA 4WI1A 4YJ2F 2Z4TA 3S44A 3KEQA 1G8KA 5BMOA 5J4LA 5BSGA 4OHYA 1TA4A 1A71A 2PX5A 3FCYA 3MXOA 4MKIA 3WYFA 1X9IA 2WIDA 2FW6A 1Z5GA 2RGXA 3CGGA 1VXRA 3H0CA 4D82A 2XITA 2P1ZA 3LU1A 4B79A 1X3SA 3CG0A 3NHYA 4EY6A 4I2NA 2YS6A 4C4ZA 2WINI 4JT4A 2CZCA 1TMOA 1FLAA 1XZJA 2DB3A 2XW6A 3CSSA 4PYOA 1G17A 3OWXA 4DBLE 4F5YA 4OF4A 2AV6A 3EDCA 1T3GA 1W48A 3JQ7A 2WTMA 1PSWA 1AO0A 2K5UA 3OQMA 3KL4A 1Y1LA 4LBWA 4KR6A 4URYR 5JSYA 2G40A 3QNMA 3ZH2A 6ADHA 2BFEA 4E6PA 3KX2A 3D6NB 1CQPA 1Q21A 2FOIA 2FJ0A 2SBTA 1Q1ZA 1P3JA 2VDMB 4QFDA 2F3PA 3M2TA 4D42A 4X1KB 1UWLA 2KWIA 1WNTA 3PDIA 1JGTA 1SH7A 3OH8A 1UMDB 1N1EA 4KLZA 3RVSA 4LYEA 3DVRX 3DD5A 4BPRA 1GTRA 1KETA 2P3SA 4W6QA 2AA3A 2J6IA 1B1AA 3MWFA 3DYIA 1HYBA 2O14A 2WE8A 3ZQ6A 1ZR4A 1QZXA 4HAXA 3UMGA 1ELOA 4R98A 2PUEA 1QZ3A 2J7PA 4BATA 2F8LA 5EUBA 5K3FA 1C80A 2PTGA 3QKTA 4CL3A 3FI9A 3U9LA 1WB6A 2IGBA 3I09A 4CKEB 2X0JA 3V6LA 3G2PA 3OJOA 3DV9A 5AOAA 4Z7NB 2D0IA 2KBFA 3EUWA 3KKQA 1A8PA 2DCUA 1I3KA 1ZIDA 3OT1A 3OSZA 2BGMA 3RS0A 3SBDA 5JO0A 2HJ9A 1AHPA 4TYNA 1QV7A 3MTDA 1JLSA 2PJUA 2NQ8A 5E1MA 3VR4A 4MO2A 4AY4A 3HB9A 4HADA 2P6UA 4QBKA 3OOSA 1X7HA 2EAUA 3IURA 4JZKA 1Y82A 3R9IA 1KK0A 4YC7A 2PSHA 3L0CA 1E1DA 4KMMA 3ICWA 4XSHA 1KMCA 4FD3A 3E35A 2ZIXA 4EAQA 4C7KA 2IXDA 4W82A 1YOVB 2ZTSA 4LHEA 5L3VA 4BB0A 3K32A 1PTJC 3BL6A 3K15A 4CV0A 3K30A 1L7QA 2PL3A 3LH5A 3QJ5A 4G23A 1JLHA 1TYCA 2IUTA 2WD7B 1HTBA 3GA0A 4EO9A 1D2CA 3TLCA 5KOIA 1KEEB 2XHEA 5E6RA 4IV5A 3ENKA 5CXUA 5JJIA 5CM8B 5FBHA 3NTVA 3QX7A 4MCAA 3UAGA 3AUSA 4IZ6A 2CC2A 3X1ZA 1OXXK 3I9V6 2Z5VA 3AVPA 1L4MA 2BRUA 2QZSA 1NONA 2QSUA 3FKSA 4R2XA 4EBFA 3MD9A 4YMIA 2J5XA 4PO8A 2SCUB 5HNKA 4XM0A 2PD3A 1HZZC 1X7DA 1KHTA 1OILA 2BFWA 2YOGA 5DH9A 2EOAA 1O8BA 1XTTA 3C3XA 3LRTA 2DQKA 2HI0A 3BWDD 4RZXA 3B9PA 4XH9B 5EPOA 4QFCA 1Z4IA 2VP9A 4BECA 3BC1A 5JLAA 4YDRA 5ED0A 3LX6A 3PHIA 1JG7A 1R0RE 3AL3A 3F98A 5NULA 3ITNA 5A5FA 2FUCA 3VM6A 4N0MA 1SKAA 4UU1A 2WK1A 1JAZA 2ASVA 3ANYB 3FYSA 3HABA 2DX7A 1ZD1A 3EZFA 3ZQKA 1AVTA 1VJ1A 4INAA 3DOEA 1OCEA 4MGEA 4D3ZA 3HU5A 1VYHA 1RQRA 4B76A 1V3QE 4E2WA 3JQFA 4DCGA 1XRJA 3A2MA 4JB3A 3MW8A 1T2EA 5CB4A 4WZBB 4MDYA 4GRIA 1YMUA 2MSLA 4N3BA 5TJHA 2Y1XA 2YXEA 2IS4A 1L6IA 2QQFA 3BIFA 3L1IA 2ATVA 5G41A 1MOZA 2FZ4A 3M34A 4PQGA 2VZ9A 1OAOA 1RJEA 2W4IA 4D92A 4F3KA 3SF8B 1T3ZA 1YZNA 5JALA 3HKEA 1V3TA 2OQIA 4QGSA 5HJ7A 3G0CA 4GOJA 3ZDFA 5JATA 4GX5A 3NHSA 1G8GA 2VUUA 5TGTA 3CUTA 4ETNA 3EXEA 1A98A 1JQBA 3K2IA 1TTQB 3N5CA 4WESB 1ZHOA 3U49A 5LA6F 1L7MA 2RHJA 3S27A 1CF2O 2HF9A 3ZHUA 4YRCA 5JD3A 2AZMA 2JD1A 1JR3A 1R5NA 5SYMA 2A6PA 1MB3A 3PNOA 2IZOA 4YRLA 5EWJA 3UC9A 1MO5A 3ZCPA 4TM8A 2I7DA 5L3RA 1WKCA 1LBQA 2R3SA 4HWKA 2RD2A 3VKWA 1FUEA 1XAJA 1CQIA 7GPBA 1OZAA 1LI5A 2G5TA 4JFRA 4F0JA 5BR8B 5B7GA 2GJ4A 5DJ5A 4R1MA 3Q7PA 4DMLA 3PR1A 4YJKA 4BVEA 1U4NA 1WXHA 3R0VA 2W42A 1VA5A 2HQSA 3FROA 4MB0A 5CP8A 1TM4E 3EZ6A 5IULC 4DAEA 1MHTA 3K1YA 4D9JA 1I6WA 1LQUA 1R00A 1P5FA 1H8HA 1Y3HA 3EGEA 4P92A 4Q47A 2WIFA 2FWJA 3ASYA 4IGKA 1PK9A 1Z3IX 2PU7A 1JN0A 1N7HA 2Q8PA 2VUHB 3F3YA 3RSZA 3TQFA 4JR1A 4D4KA 1D4AA 2R86A 4OHRA 1F48A 3C3EA 5AIBA 2WZQA 4Y9TA 3JD2A 1XN4A 3TW6A 3H84A 4A6PA 4BO9A 1ONNA 2A9OA 1FFYA 5GY7A 4RPCA 4RVDA 1HBJA 1KXJA 4AK9A 4QFMA 4DNXA 1XMVA 5F1OA 4QVIA 1C4KA 2PGAA 1YL6A 2WPNA 3I2YX 2OL4A 3BD6A 1L8AA 4JHLA 4YP7A 3MFYA 5A5DA 2NO9A 2R6FA 1W49A 4HLCA 4XOIA 2ZGVA 4ZJUA 2HO5A 2JIBA 1YMVA 4OAQA 3P27A 2GPSA 2FPOA 2QJWA 5CW2A 4WTOA 2VDUE 1LDNA 3KUCA 5D87A 4FI3C 4PBRA 2Q3LA 1IQ0A 1N2XA 4PIVA 1EINA 1I4EB 1AGRA 4YAOA 1RZRD 4ZWNA 2H1WA 1PV4A 4O2RA 3HWSA 3ST7A 1IOWA 2B61A 3M8KA 1E2DA 4PZ9A 1JQ5A 4HNTA 1G8AA 2J45A 2GEKA 1MB0A 4F6CA 5AHWA 1RP1A 4GVPA 2FG5A 1GV0A 3NASA 4G01B 4L07A 5EXSA 1DRWA 4CIXA 4D46A 3FPFA 4D3YA 3JWJA 3U4AA 5GJVC 1IPEA 5AVWA 1KF0A 1MAWA 4MV9A 4YRSA 2XRYA 3JQ9C 1VG9B 4KX3A 1USUA 4NEGA 4P5PA 1SFRA 3SYNA 1VJTA 3D7LA 3LQ4A 2C4UA 3P97A 4QRIA 1IMJA 1GZDA 3VAYA 4HYTA 1QG4A 1JKIA 1Q2UA 3GLKA 4WKOA 1IQRA 3MD0A 3G0BA 4ZHQB 2NVOA 2CDBA 3LFUA 4X61A 1N7GA 1C2YA 4D3FA 4JP5A 1SIOA 1XFDA 1WXEA 1E18A 1HMPA 2AH5A 4Y7DA 1MTZA 3SC6A 1R4NB 3MPUA 4I14A 3L6CA 4JI7B 4K9PA 4KO1S 2WUFA 1ZCFA 2IEAA 2R96A 4RFSA 4ZVVA 3TGWA 3JQBC 1NURA 3RUAA 5C52B 3IEVA 1JA0A 2JS7A 1L5YA 1SVKA 3KT8A 4HN2A 1KI6A 4N5IX 1L4GA 4QYSA 2FW7A 2ZCUA 3T1VA 3U4QB 1L2TA 1S6YA 1TEHA 2J46A 2OQRA 2RCNA 3DAYA 3K4PA 3CXRA 4IDBA 3RFVA 1VFPA 1M5UA 2E0IA 1Y3AA 1LRJA 3NTLA 3KXDA 4H6WA 3SX0A 3NX4A 3ZWMA 4E5PA 2XCTB 1O0BA 3EVBA 4M46A 4MQBA 1EB8A 3WAGA 1B76A 5GINE 3CQ9A 1XWWA 1BAPA 1X19A 4TKVB 4HVCA 2CHEA 3FSGD 4M55A 1VIMA 5LZ8A 4HR7A 1TKAA 2QTCA 5DHPA 4AN4A 2XBMA 1OB5A 2HDOA 1TX4B 3BGDA 4GZ5A 1FP4B 1PW7A 2SNIE 1O58A 4TSRA 1C8KA 4N5LA 4F92B 1IC6A 4BRWA 1QUFA 2DR0A 2OENG 2EC5A 3TBHA 3THWA 1SBYA 1VG0B 3B6IA 3FJ1A 2P2DA 4ITRC 2X9NA 3UUGA 3TB4A 4N1AA 1DELA 1IUOA 3RIEA 3T8YA 4BUJA 2R8OA 5ENVA 5A7FA 2HYIC 1SVUA 4Z9YA 1NBMA 3SWWA 4WD3A 1Z6GA 3FVWA 3OKAA 3ZC3A 5K99A 1WX1A 4F6RB 5ISMA 1UBMS 3DR3A 4R16A 1PD1A 1EFDN 4M76B 5J40A 1QAMA 3I62A 4NWIA 3OC6A 3OEHD 4URZR 1P1IA 2CLDX 3L0YA 3LAWA 2IZ6A 8ATCA 1H3EA 2YR0A 3TL6A 2QX8A 1OT3A 3W3AH 1ZUNB 2VWQA 4Y1RB 4KPFC 3HMKA 2EYQA 1DG9A 3W5JA 5IMSA 3E18A 4BGUA 2NO6A 3U16A 1DQPA 4C6RA 1B7GO 1QLJA 4FDUA 1CRPA 5IJWA 3DVAA 1EKXA 2IEYA 3CLHA 5ECWA 2FP3A 3ZUGA 4EHHA 2UZ1A 3FZEA 1JQJC 5J23A 3KHUA 3HP4A 3L3BA 1N32B 1CXZA 5LB2A 2P77A 3H8SA 2VIIA 3AVVA 2WF5A 1MX3A 1KFJB 4RMJA 3SGLA 2BGRA 2F1JA 4U39A 1YE3A 1L5GB 3OA2A 1UT5A 4ZEMA 3HGTA 2A0FA 4G1CA 2GN8A 3A6KA 2QX4A 5JROA 5KSYA 3IIJA 1H8EA 3D8BA 2DTDA 3KOWA 1MX5A 4K8OA 1Y6FA 3BZUA 2V1UA 1U90A 1WW3A 1HDYA 2P8SA 1TKRA 2YYSA 4UFNA 1DBWA 1XZPA 3PPIA 5CT5A 1IHDA 1QONA 1SUWA 4EDFA 4FZJA 2DETA 3NFYA 1UXHA 2YIMA 1ZH6A 4CF4A 5MF6A 1Z2OX 3WGZA 3HHPA 5EWLB 2LKCA 3SFTA 4X65B 3ANSA 3Q7SA 3GLRA 5I51A 3IVGA 3SEFA 3WB0A 1LBSA 1YVEI 1IN6A 4ESHA 3DCNA 1YNSA 3A70A 4B6GA 1MA0A 1B42A 4K9NA 3QFRA 4UNQA 3VR5H 2QMEA 4HDNA 4R41A 3WYDA 2YV1A 4LWPA 1N9GB 1V2HE 2Q5JA 5L51A 1H2AS 3DAOA 4K9DA 3D3QA 3CG4A 1P9WA 1ODFA 2IZ7A 3P9QA 4Q3BA 5H3HA 5H83A 3RVJA 4G9BA 4U2CA 1KP9A 4FN4A 5KNBA 3DP7A 1Y8QB 3ZD9A 4BE9A 1T0UA 1M0SA 3OIYA 5JQWA 4U1RA 3OIFA 1VRWA 3ZGOA 3FAKA 2EP8A 2H5EA 2ZE7A 4GBED 4HDCA 5ALVA 2XUIA 1PJ8A 3LLMA 4K9RA 4U6SA 2B6HA 4BMVA 2YWJA 1WZCA 5EXXA 3I1FA 2B8JA 2QU7A 5E4FA 4UHKA 1P5RA 1G2QA 1N5DA 1OIXA 2AJCA 2CLOB 2KX7A 1RWBA 3RTDA 2X6TA 4WFJA 2ZR9A 1ULHA 2C5GA 1KRXA 3H5VA 2HFJA 3CUVA 3D4BA 1FXWF 2KHZA 5CB4F 1JKJA 3EXHA 2HWWA 5JPCA 1UBSB 1XRQA 3A1DA 1DIRA 5LDHA 1U4OA 2UVPB 4M89A 1XA0A 3QTTA 2RI0A 3Q9UA 1YVPA 3M81A 5KTPA 3F6CA 5SV2A 2LTAA 5DEIA 3AILA 3A1EA 4I5FA 4ZOBA 3FSRA 3AF6A 3K6SA 1T29A 4M9QA 4YRQA 3U3RA 3L4BA 4PF1A 5AP9A 1OBVA 3DC7A 1C4OA 1RWQA 1MBZA 1XMSA 2WLSA 1II8A 2PPLA 5CFNA 1C0LA 3M6VA 4Y0NA 3NP9A 1SKBA 2MJLA 2G9ZA 2JJYA 2VDLB 3G7SA 3V34A 2X7HA 3C3DA 3BXEA 4MA0A 5DB4A 4DLTA 1TYBE 4LXTA 1OH5A 1C1XB 2AG0A 2NIPA 3UUWA 2H1OA 4OQ4A 3OT5A 3W1WA 3W06A 1SG9A 5T4EA 1J0XO 2XMRA 4IDAA 2J0EA 4RELA 4ZVPA 5JRZA 1G20E 4JVSB 2H1CA 4LRTB 5H16A 3QWFA 2P9ZA 5FUYA 3FPGA 4WY2A 3C8DA 2OXEA 4FFRA 4GM4A 1YRYE 1XX6A 4ZQBA 1F8UA 2C92A 4PPYA 3QV2A 4MW0A 4QX6A 4IMJB 1A2QA 2NVWA 4E0BA 2EDAA 1DCMA 2IUSA 3OZTA 3IFSA 4KWIA 4AFNA 2QQEA 3H16A 4NY1A 5FTLA 3RTAA 3ZD8A 1DCTA 4MVJI 3OEEA 1L5HA 2VNJA 5CYGA 2RKWA 3Q3JB 1NX9A 3Q72A 3IDAA 4IMIB 1G6HA 3CPJB 4NEQA 2F4VB 3QU7A 2EX4A 1FSSA 4GOLD 4DR3B 3N9IA 4AJLA 3DOUA 3KKZA 1JNXX 3FPLA 3RV3A 2ZM5A 4P86A 3QSGA 1ITZA 1YDGA 2V7QA 2CVZA 3H9BA 4R7TA 5EQTA 3VDNB 4BAZA 1E3WB 4PHGA 1RRKA 3CCFA 3E9MA 5ECYA 4C08A 3R5TA 4RVUA 1DPGA 2P9HA 2YS7A 2XT0A 5ICCA 1WETA 4QM6A 2FCRA 4PFJA 5FV4A 1N3BA 2XUFA 3OFSA 4B4WA 3LYAA 3EMDA 3CLTC 5F2OA 2R1VA 2V0NA 1HH4A 4URHA 3WK9A 3M6LA 3IYLW 4OHWA 1QTRA 1W96A 3IOYA 3RUDA 1ZBQA 1GNSA 3CLTD 1YQUA 2AGVA 2UUBB 2VG8A 4E4TA 1SCQA 4IBOA 5BPFA 4CETA 1E9BA 2G07A 3C4QA 3G82C 4KDFA 3RHFA 3I5XA 1T5BA 5ALIA 1VA4A 1ABFA 4PQRA 3UPDA 4FCWA 2P6RA 3OZEA 1P74A 4ATNA 4XD2A 2PKQO 3LD9A 3U26A 1ZJ4A 5EJIA 2CFRA 3OBIA 1HKUA 2VAPA 4P1ZA 1JDTA 2FX5A 4GYJA 4KQFA 3PKJA 3UXEA 4XPIA 1IRIA 1B8VA 2OO5C 1R7RA 1UKBA 1XYYA 1ZUWA 4RK0A 2GFIA 4JBXA 4U7GA 3LQRA 4C5AA 4B35A 2WT9A 4BQEA 1SXHA 4V2UA 2ZJAA 4DLUA 4EQZA 1ICEA 4WFIA 3RYTC 5BOSA 5I7HA 4KSYA 1P9OA 3CEHA 4BMXA 2DH6A 1TTPB 3WWOA 4BNJA 2VHCA 1M2OB 1VIVA 3AQ4A 5DYIA 2TMGA 3L84A 5MDHA 3RS7A 1I10A 3GNLA 5A4AA 1IK6A 1P7VA 2E1PA 2VT7A 3DZFA 4GBMA 5DNCA 1RXWA 4BJ5A 1HG1A 2YICA 4TRRA 5CDGA 4B74A 4CF3A 3HUFA 3EDOA 4TL9A 3U5TA 1QX4A 4JI1B 2VHWA 5AXBA 1AX9A 5B4TA 1NMQA 1DQZA 2ZB7A 3JWPA 4WZAB 4R31A 4YUAA 2XYVA 4ZVRA 4K0KB 4HF7A 3B78A 2IV3A 2Z57A 5AVJA 4ZKDA 2QLLA 4S0XA 5JG7A 1KAEA 3O3NB 4YV2A 3VH4A 1QCDA 2JFOA 3TQHA 1G6OA 3CT6A 2HMSA 5HKKD 2ZE5A 3R5XA 5DHAA 3GLFE 1E0AA 4KQ6A 1GSIA 1EH5A 5B1YA 3D7MA 2I7VA 1J1ZA 1EHCA 3GB9A 5ESWA 3S1AB 3TZEA 3K70C 4K81B 3TCNA 3HWWA 4IDFA 3EUFA 4Q4AB 5DWDA 2ZSUA 3JD3A 4FX2A 1P3DA 1QP8A 2W22A 1DRVA 2J0UB 4MV5A 5K05A 3WYBA 3LCRA 4G5OA 1FTYA 4PPGA 2VN8A 4TSKA 4NBLA 4GVXA 4RTMA 4OP2A 3UMCA 5BWBA 1E4EA 2QUZA 3A7EA 4R69A 4DQUA 1ISJA 2F62A 3BXGA 4GKBA 4WASA 1H4QA 1KJQA 3GUCA 3ESAA 4EH1A 1EFHA 1CLEA 2ERCA 2IWRA 3D2AA 3PICA 5JFOA 5IT4A 4QJ3A 1EFLA 1D8TA 5KYXB 1O96B 5JC1A 1NVEA 5KSPA 4CR8A 1IUKA 2XUOA 3KCNA 1EE1A 2OC4A 2J4CA 2PS3A 3FY4A 1H2XA 3OTHA 3OUZA 3FTFA 1ZLXA 3G88A 3NP7A 4UPDA 4BNGA 4UHEA 3GQBB 3BDIA 2XZTA 4FWIB 1N0WA 1ZJZA 2I78A 2OK7A 3UMBA 1AKEA 1VJDA 2XKJE 3L8ZA 4OSPA 1J8MF 3DDWA 2WMOB 1MAUA 3PE6A 3JQCA 4RV9A 4QA9A 1NVDA 3RC9A 4E2XA 1UQRA 4PINA 1NYQA 1Z62A 2FPXA 3B1YA 4ITUA 2XGOA 1N4AA 3R8CA 4E70A 4RM3A 3PYXA 4U2GA 3DOOA 1KRHA 3FFWA 1NLFA 4O2LA 4CQJA 3TTUA 2VF2A 1TOAA 4TXJA 1XVUA 3OTGA 1E5QA 2ANCA 1VI6A 4JU9A 1WZ2A 1XU7A 1WUYA 2JBHA 4LIPD 1P80A 4WK2B 1Y81A 1GAQA 1C1HA 4PANA 4ZANA 1XTZA 1Q14A 4MMXB 1H5QA 4QWMA 3LDUA 1HNNA 5I7OA 2I99A 2AXEA 2POCA 4JBHA 3KQHA 3I72A 1AQLA 1O7JA 4LI0A 1JDJA 2FMIA 4YYZA 1N2GA 2PT6A 1NKTA 3AUJB 3EQ9A 3EE6A 3TAHA 2QQGA 3FWPA 4I3HA 3EGDB 3ICVA 5JNUA 3V5NA 3KDAA 3VR0A 1U02A 2B21A 1MXFA 4CJXA 3B2QA 2PL1A 2WPDD 5JS7A 4QATA 4MW6A 4UW9A 4AD8A 3I4LA 1ZA2A 1R4MA 2JCGA 2NUTB 5E1DA 5KMGA 3THOA 4PFKA 1WF3A 3L5KA 3N2GB 4BIMA 5EIEA 1D0IA 2VK4A 3S2FA 4EWLA 3DWFA 4H0FA 4P34A 1GT91 3G17A 3C1TA 3LJKA 4FDAA 3RUCA 2L17A 3F9RA 4K2HA 3R3WA 5GJCA 3GN2A 2HO4A 4OB8A 1K2WA 4YVFA 5JPDA 3PFNA 1GA4A 2VDJA 4TUYA 4Y6OA 3T15A 5LDDC 5KJEA 5FWDA 1T3LA 1C0EA 1DI0A 1GTZA 2VUSA 3GG2A 3QLEA 3TM5A 1TVCA 1WMFA 4EKDA 5B36A 5LP6A 2DY1A 1LBEA 4R71A 4YNBA 2LR0A 2B20A 2IZ1A 5C8YB 5GQSA 1EVZA 1JHYA 2F3TA 3FGZA 3FPBA 4PNPA 3WRXA 5GIOE 1Y6GA 1SVNA 2JLBA 2IHVA 1N57A 4A5OA 4LCBA 4WKNA 1VGQA 3FZYA 4IFEA 3STWA 1ZZGA 5J2TB 4F56A 2A35A 3MA0A 2C20A 1UJ4A 2OYCA 4F72A 4E5YA 5DGXA 2X9VA 4TWAA 2YX1A 2BFBB 3KE8A 5BYBA 4CTOA 1CJSA 1F2DA 3IE0A 3VH3A 3TXYA 4EF4A 3B2NA 2PPVA 3B1XA 2DP4E 3GEIA 4OA8A 5FPSA 3GP5A 3NHMA 3PFHA 4CNQA 4ZYXA 2G8NA 4TTTS 3V55A 4ENPA 1M34B 5KIAA 4TWJA 1T2UA 2X6QA 1NV9A 4FMDB 2BLLA 2C3OA 4AZSA 3I53A 2GZ3A 4EYEA 4L16A 2D06A 1YCGA 3CKMA 1VE1A 3CCBA 1AMNA 3ELDA 3ZV5A 1ZSVA 1HYEA 1Z0DA 1WCXA 4HQ6A 4FFNA 3DO6A 2ORIA 1GPLA 5BNZA 2AKEA 4WBNF 2M1XA 4BVKA 1BE1A 1EA7A 2PXXA 4JKYA 3LLVA 1IWPB 1JLMA 4N6NA 3AHIA 3DAHA 3OTIA 4KFTA 4ZAVA 1NVXQ 3HSSA 5LQJA 4HVLA 4I5GA 2X8BA 4EB0A 1NRIA 2W2VA 4M1ZA 5H7XA 4LPKA 4R1SA 3LBHA 3Q8MA 3HUTA 1OFGA 5M3BA 5REQA 1E77A 4E88A 3OQOA 1SXPA 3ZS8A 1SVMA 4BX0A 1CUWA 4YMVA 1WLSA 1J8DA 2DR3A 2RJ3A 1Z4MA 2YNMC 3ELWA 3R3YA 5L3QB 2FEAA 4HLNA 4HNRA 5F5LA 1RPNA 1U63A 1X8XA 3HKDA 1WIWA 3LHSA 4JC8A 2V6IA 4ZU3A 1QMGA 2IODA 3HVJA 2L18A 4AJHA 4P0PB 3PNYA 3S4YA 4NMHA 4JBNA 3ZEIA 3B38A 4CN8A 2GN4A 1A4RA 4XW2A 2X4LA 5JZMA 1G3MA 1XJ0A 2NZUG 2MHCA 1U0EA 1MQSA 3BPSA 3KB2A 2H2DA 3IHLA 5C4MA 5CEJA 2YINC 3WGIA 1K86A 4IV0A 1JEAA 1WHSA 3U1BA 3VYUB 2DPYA 4DV0B 2ZIZA 2WU0A 3IS3A 4JXXA 4MNTA 1U2GC 2QW8A 3I04A 1SBQA 1K3FA 2QMUA 3JATA 5TXGA 4TLEA 4BQRA 1B6RA 1W0KD 4GX2A 2DVMA 3F5FA 5HYVA 1UXGA 3N39C 1SHJA 1QQBA 3C98A 2V3WA 4IOJA 4LXHA 4NS4A 4DA9A 1KDVA 1QFXA 1DOZA 3WYNA 1XTJA 3ET5A 3GFVA 4BWVA 1GYPA 2FR0A 4JA0A 2IH2A 4KYTA 2EFCB 2EVWX 2PSFA 4DFDA 4RZIA 1LDYA 4BLVA 4G84A 3SLRA 1AK9A 2NV2B 1FFCA 2JH8A 2I8AA 3C0KA 5CVDA 4KXWA 1PU2A 2GHQA 2GK6A 2QUBA 1XKQA 4GLFA 4YACA 2JAWA 1HDRA 3LFTA 1VB3A 3NBKA 4BTEA 2JGLA 1GTG1 1FXUA 3CZ9A 3G85A 4OVKA 4Z0HO 2LCQA 5IF9A 4DQDA 2NO5A 2YJ4A 3SSAA 2NT4A 2JAOA 3N0RA 5ALFA 3HYCA 2BTQB 4NK5A 1UC9A 1MG5A 4FT4A 4HX2A 4XWYA 3FOAA 3K4HA 1HMYA 1W5EA 3B53X 2WQZA 1TYDE 3YASA 1K3UB 4ALLA 4ZV9A 3MZ0A 2GD1O 2RB5A 2CSUA 3KVRA 2P6MA 5HRAA 3DR5A 1J8FA 3H7IA 4NDZA 4PYLA 3IB6A 2I6GA 4EHFA 1QHNA 3HEBA 5B6IA 4BN5A 4QELA 2DPLA 4EY3A 4L4XA 5FOUA 1ZK4A 3SE7A 1DWQA 3T7EA 2QI9F 4DCJA 1U8ZA 3MWEB 2PX8A 1CBUA 3BIJA 3R6DA 2XWBF 4MCIA 5AKHA 1YK1A 1KZ4A 2H57A 3DKPA 4C3VA 3R5KA 5A9SA 1WDLA 3BGVA 3C3YA 4QEKA 4RSGA 2FPRA 2C7VA 1A9SA 3BSYA 3N2KB 3R0QA 4NH4A 3RLIA 3IR6A 1GVHA 2XMBA 4X91A 5DLDA 3WIEA 4ALMA 4JI4B 3RT1A 2QSJA 1W5FA 3G5LA 2OZLA 1JMKC 5FBLB 4EJFA 1T0BA 3VAZA 4RF5A 1UBOS 3NGLA 1H5NA 1PJ3A 4J7AA 4DIFA 1UBRS 1Z16A 2QV0A 4AJKA 2H63A 4WKBA 5FYQA 3D2LA 1IM5A 4J9VA 5DBEX 1RBMA 1PJTA 2TS1A 3HY6A 5CYOA 4Z8YA 3SR0A 3LYLA 2R47A 3P5BA 4KMRA 2I65A 3QEOA 3CKKA 1YS7A 4BC1A 1E63A 3NUGA 4LPSA 1NLUA 1ONSA 2VTEA 2ZTMA 2JLCA 4QPNA 3C6MA 4NYJQ 3KQQA 1JXQA 3DQPA 3OQIB 3P96A 1SD5A 2FN9A 3P94A 4HWOA 3UFXB 3OG9A 1DQNA 1CJMA 1NBWB 5AO9A