1FTGA

Structure of apoflavodoxin: closure of a tyrosine/tryptophan aromatic gate leads to a compact fold
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
168
structure length
168
Chain Sequence
KKIGLFYGTQTGKTESVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTWNIGELQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNFQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOFLAVODOXIN
publication title Closure of a tyrosine/tryptophan aromatic gate leads to a compact fold in apo flavodoxin.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
total genus 64
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 1995-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ftgA00
1RLJA 4OXXA 3NLLA 4J8PA 4CETA 4DILA 4YAWA 4FGKA 4U7GA 5LJLA 1V4BA 1D04A 4R81A 3ZHOA 1FLAA 4Y9RA 3HLYA 5LBTA 2FCRA 4Y7CA 1YCHA 3OJWA 4C14A 2MTBA 2M6RA 2D5IA 1ZX1A 2Q9UA 2QX4A 4LA4A 1AKVA 2Z98A 3ESYA 3O73A 2N1MA 2KQUA 1DXOA 3L9XA 3KLBA 3OX1A 2A5LA 5LJIA 2Q62A 5B3KA 1QRDA 4XDHA 5JROA 1J9EA 1GG5A 3R6WA 3NHJA 3SVLA 3UXEA 3G5MA 4YQEA 4HEQA 3W7AA 1C7EA 2F1OA 2QWXA 2Z9CA 2MOKA 3ESXA 4M0CA 1FLDA 1DXQA 4U7HA 2HNAA 3W77A 4CF6A 5F12A 4PTYA 3TEMA 3L9WA 1TIKA 2GSWA 1F4PA 3NHYA 2X2OA 1CZNA 4FX2A 1H69A 5ULLA 4Y9UA 3UXHA 3D7NA 3U7IA 1CZUA 3FJOA 4GQIA 1FLNA 1FUEA 1VMEA 2FAXA 4D02A 4H2DA 3B6JA 2KLBA 1X77A 3OWHA 3S2YA 2HNBA 2WC1A 3F2VA 1FLVA 3ES9A 1XYVA 4YAFA 5TGZA 2QMZA 4BMOB 2BZSA 1SG0A 2AMJA 4C0WA 1TLLA 1E5DA 1JA0A 1AKUA 4NLLA 5FA6A 4BMPB 3OX3A 3B6MA 1XI2A 2FDXA 2QR2A 5F51A 3GAMA 3HA2A 2V5VA 5BUCA 3OX2A 3OVMA 5LLDA 1XT6A 2QX8A 4QODA 4GI5A 2FX2A 3FX2A 4FGLA 3QFCA 4LTDA 3N3BC 4C76A 2R96A 3HR4A 1FX1A 4C0XA 1CZLA 2ARKA 3K20A 3NHSA 1FVXA 1YCFA 2FLVA 3NHRA 2X2PA 6NULA 4ZVLA 2XOEA 1KBQA 1FTGA 2B3DA 2FZVA 1WSWA 3W79A 1YCGA 5EMNA 3B6KA 4H6PA 1AHNA 2W5UA 3QE2A 1CZRA 4QOHA 4N65A 2V9CA 4YALA 1RTTA 1YDGA 4NULA 3FVWA 3FW1A 4U7FA 3GFSA 2QMYA 3EDOA 4GR9A 1J9ZA 3OJXA 2BPOA 3F6RA 3NHFA 2BMVA 2RG1A 4PTZA 4ZVNA 4ZVKA 1QBGA 1ZWKA 3NHUA 3NHLA 2QX9A 2XODA 1ZWLA 2V5UA 4PU0A 3KAPA 3RPEA 3KAQA 5EAIA 3O2NA 3NFRA 5LBUA 1RCFA 2QX6A 4QOFA 5EA2A 3GFQA 3OWXA 3LCMA 3TZBA 4YAOA 2ZKIA 4LTMA 5F4BA 2BN4A 4ZVMA 3NHWA 1T0IA 1XYYA 2BF4A 1AMOA 2MWMA 1B1CA 1CZOA 1QHEA 4DIKA 4YAUA 4S24A 5FX2A 4XDGA 1JA1A 1CZKA 3JSXA 5NULA 1RLIA 3TE7A 1CZHA 1DX9A 4N9QA 4LAFA 2OHJA 1AG9A 5FUQA 4ESEA 4F8YA 1QR2A 1J8QA 3FNIA 4DY4A 1BU5A 4QOIA 3N39C 2M6SA 1YKGA 4ICIA 1BVYF 3KEGA 3N3AC 3ESZA 1AKWA 2R97A 3P0RA 4QOEA 4LTNA 1KBOA 2OYSA 3QFRA 1YRHA 1YOBA 1AZLA 1AKTA 1NNI1 3GFRA 1H66A 2Z9DA 3W78A 5B3LA 4QOGA 2HPVA 3F6SA 3NHPA 4HS4A 1OFVA 1WSBA 3LT5A 2FZ5A 1D4AA 2OHIA 4FGJA 1SQSA 3U7RA 1D03A 1AKRA 1C7FA 3F90A 2MT9A 4QOJA 1T5BA 3B6IA 3K1YA 2Z9BA 5A4KA 5NLLA 2OHHA 5LVAA 2FVXA 4N82A 5LMCA 2FOXA 1J9GA 1AKQA 1OBVA 1I1OA 3EYWA 3NHKA 1OBOA
chains in the Genus database with same CATH superfamily
3N8KA 1U2DC 1NQVA 3OF5A 3V48A 3VC2A 4KBYA 5M7EA 3M49A 4A8HA 2BFBA 3LCCA 1DT5A 2FE1A 2ZSKA 3HNRA 4IILA 4OXXA 4QVKA 1SCDA 1U0RA 3R0JA 2NVBA 1E3WA 1H4SA 1ISSA 5BSGA 5J2TA 3GLIA 3QBTA 3VAYA 3ZJUA 4D5GA 4FOLA 3KUCA 2QNBA 1MA0A 2YVQA 1JZSA 4M9SA 4YA6A 3L4SO 1EDBA 1Z3CA 2UYGA 2YWFA 3R5SA 4WLNA 3WGLA 5D3QA 3U19A 4MIKA 4OQNA 3V1KA 3N5KA 2LTAA 4OI4A 5DT2A 3HXKA 5L6LB 3WL7A 3IP1A 1ZESA 6REQA 4YJ2F 4LZJA 4KR3A 4Y9RA 2GPYA 3IESA 3WDSA 5EXEA 2IHYA 3NM4A 1UM9A 1CPYA 3DWEX 3VFDA 2PYZA 2ZI6A 1WBDA 5CM8B 3OA0A 2GXUA 2QDKA 5CYPA 5ALVA 3I61A 3TLYA 3QNUA 4OUDA 1G19A 3RHFA 2GEJA 3CRNA 1XRMA 2NYAA 3ESCA 3PPYA 4LJ4A 5F5NA 2M6RA 3K73O 5D7BA 3M3HA 2ZIAA 3ZBQA 3QUQA 4E08A 5SYAA 2V3WA 4GPAA 4WOKA 3EVBA 5EGSA 3V80A 2FPGA 2Z98A 2PUWA 3O92A 2QM8A 1C29B 2Y68A 1AGYA 2IDZA 1NJ1A 4RWEA 3K7EA 2QRJA 1Z07A 3KXKA 4O2AF 2G9NA 3TJMA 5A2GA 4LJAA 2DU8A 2RIRA 2P0EA 1HE2A 2I6FA 2VXYA 2VP6A 4JU9A 3R8XA 3UKOA 4GSLA 5KKNB 1QRDA 2R1VA 3DVQX 1N2BA 2PO7A 2HDOA 3R7FA 2WWXA 3SS7X 3DMDA 4R84A 4AO6A 4BAUA 4CIWA 3K70D 2P67A 3GLFA 4JSYA 3UJNA 3TW4A 3DA8A 4MVJD 5IZ4A 1GPYA 2O14A 3RNLA 1C3OA 1X3LA 2HA3A 4YQEA 2PLRA 4OHXA 1U0BB 1VP9A 5IC4A 1JALA 4XTRA 2AJLI 1F2TA 1MO6A 3GFVA 3RWMB 2JLAA 4GRIA 1K5GA 5K01A 4DYHA 2PJDA 1UPBA 2NTYC 3PRHA 5HBRA 5C8VA 4WL0A 4I5FA 1SC1A 3QI2A 4LDPA 5EZYB 5K8VA 1QHHB 4TZKA 4FW9A 4LPSA 2ON6A 4OHMA 5JXHA 4C1NA 2O8EB 1L4BA 2AFHE 2Q28A 3T95A 2HUNA 5I7VA 4DQVA 5EQFA 3UO8B 3OHPA 5IEBA 2OV3A 3VR2D 4UNRA 3EDQA 4OBBA 4YUZA 2JGIA 2RGWA 1N6NA 1Y9AA 1NR1A 1JH8A 1RI3A 1SC9A 2A88A 3G88A 2ERXA 2QUHA 2JI4A 2ZJ3A 1L4FA 3LKBA 2BFDB 4OXQA 3R75A 1IK6A 4KXVA 4AZTA 4DIEA 1QHGA 1YONA 3BMXA 1ITZA 4KO4S 1JEYA 4Z4FA 1UMCB 3K9FC 3N8HA 1G1AA 4RMNA 1JECA 2FRDC 1P80A 2JCYA 1RMTA 3CUTA 4FOPA 4IPTA 4DGSA 3NHMA 3RTBA 4LC0A 3SXJA 4EYEA 2EX0A 3ZK8A 4JELA 1LKZA 1BWRA 5JZ9A 2B98A 3W05A 3HWRA 5CBPA 2C4VA 4WNAA 2DJ5A 3KOYA 1E7WA 3KBOA 4KOEC 3GGJA 3DEJA 5HGJA 4RO0A 4E12A 4D9HA 5DWDA 1SXJC 2WD9A 4TS9A 2JLCA 2FAXA 1BN6A 4L9RA 2GHTA 4J75A 1COZA 6Q21A 3U4MA 4TLBA 2BKAA 4ZZIA 1HT0A 2Z5VA 2VBIA 1ZMBA 1S8AA 4FZJA 1CVRA 4NP6A 4HCJA 4UAUA 1RI1A 3QEAZ 3IDFA 1OPXA 2RB4A 3LSTA 4FHGA 4RAQA 4WNYA 1XKTA 1XTZA 1A3CA 1N2XA 2I5PO 3B9PA 5GGYA 5JYEA 1FLVA 2NT4A 3GJSA 3CEJA 4JJ7A 3MCTA 1VBMA 4B7CA 4MO9A 4Y2VA 1WJGA 3Q7IA 2UKDA 2BL4A 2Q8QA 1MRNA 4JI6B 4DG9A 5IFLA 3NIBA 2X6RA 2XHEA 3NC0C 1FFDA 1WW3A 2ZSFA 3COPA 4H3KB 4YRMA 3CE9A 1JDPA 1TLLA 1PT6A 4TX1A 1JKFA 1QDUA 2LCFA 1SZDA 3L7CA 3O90A 3Q5DA 3FRHA 4MWEA 5T6MA 3EMVA 4RSGA 4YYEA 3K70B 4TYYA 4MNTA 5HZHA 3ZS8A 3AM1A 3K4HA 1U0LA 4MHOA 4NLLA 4YJHB 1DEAA 1ABBA 4UXJA 3HBNA 4IIVA 3RUIA 5AVOA 4K40A 1MABA 4LRTB 1P33A 1UFQA 2VC2B 4MQLA 5CJPA 3RJ9A 4ID9A 5H4GA 2RGRA 2Q6LA 4DB2A 3QQPA 3G8DA 1M6YA 4ZDIA 2YTZA 3MJVA 2J4FA 2PQ2A 4IKPA 4NFLA 4EGFA 5JAMA 4AX4A 3H9BA 3EGXB 1Z33A 1B8PA 1IOWA 3GBVA 4ILKA 4M8IA 2I4TA 3GH1A 5MN6A 3D6HA 5BQFA 1XDSA 1GNTA 3F4BA 2YMPA 3FYDA 1PL0A 1IBSA 4RZIA 3OCUA 4RE5A 3H2SA 3DBRB 3AI7A 4BN4A 3MCZA 2XZLA 2ISQA 4G41A 1XRNA 2CCJA 3JVUA 1VTKA 3OF2A 3OVMA 3Q88A 3PP8A 3LNCA 1Z5WA 2FLWA 3U3ZA 2JC3A 2QX8A 5AKIA 1M2HA 2JHAA 2HCBA 2IZ1A 2PKEA 4GQAA 4BP8A 4MV5A 4L0DA 3QWIA 1YASA 1HEYA 1OWNA 1NNUA 3IR7A 1YGYA 5HKKD 1L4KA 2BM0A 2O7VA 4RTRA 1XB2A 3C24A 2J3DA 1J2EA 3UAXA 4KFTA 1WB4A 3ADPA 1O0CA 1NBMD 5H70A 5A02A 3A05A 4J16C 5F76A 1BDMA 5ELMA 4MV9A 4QDZA 4OI1A 1E1MA 1YL6A 1CE8A 5L95A 5AJVB 3TKAA 3FOZA 2WB4A 2LKCA 3GZTB 4J49A 3T1HB 2AKAB 3TX2A 5P21A 3BJZA 3UMJA 3ZQ4A 1BW9B 5ADHA 3EEOA 2Q4TA 1J90A 2XDAA 3DEHA 1XTIA 1YVDA 1ZVMA 3HV2A 4A92A 1KFEB 5DH9A 2GAFA 2FFAA 3H5TA 1YL7A 3AVTA 2QTGA 3AM3A 4S2EA 1CW2B 2W48A 4TLAA 2EWMA 2LV8A 1ENPA 2CVZA 3QLTA 1VGRA 4RFSA 3B6EA 2C77A 4GRDA 3TFQA 3HEBA 1SG6A 3BD7A 4DV6B 1E2UA 1FUYB 5DTMA 1E9CA 1ZICA 2CNWD 3ZOKA 1TF7A 4OJQA 4BNIA 2ESRA 4IUYA 3W79A 2HU7A 2NP7A 2VZ8A 2A0XA 3KSRA 1FSFA 2A1UB 3JWJA 3ZK9A 4NTZA 3EZYA 1UZMA 3P2MA 1XVVA 2HGSA 3I01M 2HSWA 3UOGA 4A26A 4AL4A 4DDMA 1TFUA 4GMFA 4BX8A 1SU7A 1AHNA 4IY1A 1P6QA 4X1IB 2ZLBA 2I78A 4FYVA 3IAFA 1BDBA 1M75A 4YMGA 1Z56C 3JZFA 2XMQA 4ZN6A 2IT1A 1PR3A 3CX8A 2LGJA 5A4DA 4PG8A 1X1TA 4J1TC 2B8WA 1W581 4W7HA 3KL4A 5SZIA 4GPD1 3SIPA 3L6CA 8AT1A 1OJ7A 2PMKA 7ABPA 3DKRA 2VNKA 4UASA 5L3RA 2F43B 2B94A 1QYXA 2BP7B 2XUKA 1PW5A 1KYWA 3C6QA 2B0CA 3N07A 4QOHA 3ZVKA 1A4RA 1W1WA 1YJXA 3GA7A 4LGMA 4B6OA 3V8QA 1APBA 3STXA 4CYMA 2O8VA 1WUYA 2VYFA 1Z82A 5FI0B 2D2IA 1JWBB 3AVVA 5CDYA 1E66A 3ZVRA 1BKSB 4J90A 4RVCA 4FHDA 3CZ5A 1WXDA 4MW0A 1GUDA 4NBNA 1KPGA 1FMJA 2BW0A 4I0WB 2RI1A 4MQFA 3L7BA 2ZPAA 3VU9B 4B75A 4D3YA 1D09A 2IEIA 1U1GA 2DQSA 1JYEA 1BX0A 1MO3A 1X7XA 2PT7A 4YIKA 1SHJA 2IWHA 4E2ZA 1F5SA 5LQDA 2F90A 3BHNA 3HFSA 3HUUA 5B6PA 4PTZA 1AO3A 3AEUB 3RF6A 1JHYA 1ZSNA 1FTNA 3H11A 3VHXA 1DJQA 2B8NA 4NY1A 1D8TA 1MRZA 4XYGA 3T7CA 1ZUD1 4P81A 3V6LA 4URWR 3NHUA 3WNBA 4KLZA 5DM4A 2QN1A 1LTQA 4ALKA 3LQKA 1XDZA 3F0TA 1XU7A 4JLUA 2FJUA 1XL0A 2V5UA 3FIJA 3H5OA 3L6RA 1I6MA 4EEKA 1V8BA 1OAKA 5B6IA 1U7TA 2O5EA 1NPYA 2EJTA 1ECPA 1MMFB 2PXAA 2ZE8A 4GOLD 4UVHA 5E4JA 4AF6A 5I4BA 2ZRPA 4WK0B 5EIBC 4CUKA 1RXIA 2WUDA 2PQ6A 2GD6A 5CT4A 5LBUA 4F4FA 5A4MS 2RBGA 3K09C 3DZHA 3A36A 4U2EA 1F8FA 5KEIA 3VJLA 3I28A 3NC1C 4DCJA 2E6KA 3QHQA 2WWIA 5FEMA 1NW7A 4DMHA 4NV3A 1JLSA 1YULA 2CYBA 3FFWA 1GZUA 1TO2E 1I3OA 1MHPA 2V6BA 2Q5HA 4IRMA 4L8GA 4NNPA 5F1OA 4QULA 4W6ZA 3ZU3A 4DLBA 4AKIA 7ADHA 3WRXC 1LPNA 1QGED 4PPQA 5B7GA 1DCFA 3THYB 3W90A 5IS2A 4C5CA 3MUEA 3KKOA 3S2IA 3GIWA 3PCRB 1J2UA 3VJMA 4C4TA 4H18A 1Z37A 4DCSA 2GBCA 1ULUA 3FWNA 3PGMA 1QHEA 2OGUA 2I1LA 3RFUA 1GZ5A 5D3ZA 5A4FS 1ZR2A 2V54A 4GIBA 3GD5A 3U09A 2OYCA 4S24A 4XM1A 3UUEA 4ZT3A 1SD2A 2J6HA 1KEEB 1PCXA 1QYWA 1A9RA 2H51A 2UYQA 2V8BA 3VC7A 4BNKA 3GOHA 3QU5A 4HDAA 9MHTA 3JD4A 2XRMA 5TQJA 4HNAA 4O1IA 5FAXA 3HCPA 1Z63A 1YR1A 5CHEA 4V0NA 1F8UA 4WZBA 4YIHA 2BLLA 1JTEA 3C4JA 2H0QA 2ZT6A 4L8LA 2QT1A 1KY5A 2YIDA 1OAOC 4MPRA 3D6JA 3PRYA 4QQRA 4R7ZA 3A7DA 1F8XA 4OGLA 1YVUA 5BQ5A 4ESEA 1UWVA 2DUWA 2O52A 2VWPA 3IAEA 1P2SA 1FVOA 1L5FA 1B14A 4AC9A 3LUAA 4OQ4A 4FGWA 3UTCA 1QB8A 5K5EA 3WGIA 1SKBA 3TPZA 5LA6F 2WIKA 3G7NA 4NESA 1ICIA 2UVQA 4PC3A 5TQVA 3DM9B 3TNDA 2I6QA 2RKWA 2YV4A 1OHHD 1B0AA 3RSHA 4CCAA 4TYWA 4GPBA 1DO8A 1JIUA 5A3SA 5CB6A 5LNK1 3PC8A 3Q8MA 2JCVA 4P5EA 3WDMA 3SSAA 5JW6A 1BE1A 1I01A 1RP7A 2I7VA 3SOZA 4MUFA 2DB3A 2OWDA 2Z5GA 3AFHA 3IA7A 4LF6B 1ID1A 4OQDA 4I4TA 3GPBA 4IYRA 3O03A 4ND7A 2DFKB 1L5YA 4RKFA 3DZKA 2P35A 2R60A 3MS2A 3T12A 1VCOA 3IDOA 4IH4A 4N40A 3ZYZA 3PFGA 5JQGF 2J30A 1JG3A 2P1ZA 3QFRA 4J7XA 3ER9A 3LCUA 3CU5A 1ZVJA 1A5AB 1TM7E 1T8TA 3BILA 4HWTA 1EI9A 4R2XA 3A6EA 5IUKC 3ADDA 4TRJA 1FA9A 3RSZA 3QNMA 4KXXA 2XX3A 3EXHC 1NNI1 1PG5A 1YFKA 1JH9A 2HHJA 4Y1EA 4ZQIA 3LT1A 5DASA 2VZ9A 3MA0A 4B2YA 5BW8A 5EP4A 1Q20A 1TM5E 2VA9A 4IIBA 2V4ZA 1I32A 2GARA 1RQGA 2FN3A 1E2DA 4YJ3F 3JALB 3EAGA 2HWYA 1ZINA 4MS3B 4DR1B 1W4ZA 4ZYVA 3P26A 1E98A 1NTRA 3PK0A 3UHAA 1JE1A 5JXWA 1KAEA 5DM60 2C2OA 2LWIA 4YAIA 3HJHA 3ETCA 1GDTA 2PKXA 1U0JA 3F73A 1NLYA 4C06A 3QXXA 2PRYA 5AVZA 1RQ2A 1TTPB 1Z16A 1RQPA 2HA2A 1I5EA 1GPH1 2Y3IA 4CNBA 4Q9KA 4QOJA 4B4VA 4FINA 4INAA 2CKMA 2AI2A 2HBQA 5REQA 4ZI7A 4BQEA 1EWQA 3GFFA 2YJ3A 3G3EA 2NSJA 3EJ6A 4JZKA 3W3AA 5TRTA 3KZCA 1GTRA 2I03A 4KO8A 3HM9A 1SRQA 4MV8A 1OWPA 1VRCA 1E9VA 3MCAA 2XEDA 4YGXB 5LYYA 1X0XA 4GOND 1X1DA 1GU7A 3BL6A 2GWRA 1ZJZA 3ELBA 3G5LA 3UHPA 3IKMB 4WCDA 3VU3A 1Z06A 1Z4IA 4IAOA 3WGUA 3TGPA 3G0GA 5E8RA 2ADFA 5BMVA 4WOPA 3V6MA 4CDGA 1KEUA 4KWEA 1P0MA 2BFCB 4RHXA 4NU0A 1QO0D 3NVDA 3PEYA 1GNVA 3JWGA 3OURA 1RMYA 3KG2A 4JJ6A 3AF1A 1RWVA 4P3NA 5FB3A 1QCZA 4C4RA 4ESOA 5A3RA 2YCLA 2G1PA 2HI0A 2TECE 3LF2A 4NMMA 4UM9D 3AF6A 2GKSA 2XUHA 1B2RA 1FTSA 1QFMA 1V8DA 4JJ8A 4DR7B 4YI3A 3E15A 2G5TA 2I4MA 3NLLA 1AS0A 2BCJQ 5ERGB 2CZQA 5EVJA 3M2TA 1R8SA 2EZUA 9GPBA 3V46A 1GPBA 2Q8NA 3IPLA 1TGVA 4BCDA 4YAWA 3GJ8A 3Q7PA 4EHAA 2JGMA 1EP1B 3F5DA 3GU3A 2A4KA 1PWHA 2DUMA 3OSUA 4P22A 5AK4A 5FBZA 1S0UA 3I9JA 3OLYA 1UINA 4XDZA 3VMMA 3WXBA 5H80A 4QX6A 4ARUA 2VP9A 3DP7A 1ESEA 1P61B 3CR7A 4XJXA 3ET5A 3OPMA 2VDNB 2AFHA 4RESA 3C6YA 2ZS9A 3P2EA 2JCSA 4UDYX 2O6HA 1X7YB 5BQOA 4I3HA 4CKBA 1DXYA 4DA0A 5K0GA 2Q9BA 3UFBA 5IXSA 1PGNA 3A1DA 3CGWA 5HKBA 3C41J 3KZVA 1URPA 5K8TA 1IHDA 5C5CA 8MHTA 4OMUA 4DLXA 3QFHA 3ROXA 3D0OA 1DKNA 1ZSYA 3LYLA 1YU6A 1Z29A 3K2EA 3BL5A 4HDCA 1A27A 5D2CA 5ES4B 1M0SA 4J7AA 4QGGA 1U04A 2N1BA 5THXA 1Y9DA 4ZYLA 1R88A 3OT1B 4OJTA 5LM3A 1O87A 2YWBA 1DNPA 5IMBA 1ACLA 2QTWB 3R5FA 4HLUC 5LZ5A 5JJLA 4N76A 2WU3A 2JHFA 1TEHA 2LIVA 2ST1A 3EIXA 3OLVA 4JA2A 3V3TA 4A0QA 3E22B 5FLXA 3W3AH 4EPTA 1KH3A 1RW4A 3MB8A 4TN5A 4XIIA 4WW0A 2NUAA 3VV3A 4HX9A 4YCBA 3EEQA 4XRRA 1L4EA 1UP7A 4PLPA 1WCYA 4XLZA 1M1ZA 2C83A 1J9EA 4Z7JA 2V7TA 4E09A 4IRUB 1C9MA 2I6TA 2X0FA 3C98A 3NWOA 5DNUA 3JVVA 4GI7A 1JFRA 2JATA 2JLUA 3SCZA 2WTXA 3OEYA 2FUEA 2P6OA 3OQVA 1N8TA 4TWIA 3P4UA 3BGOS 1VKRA 3DVRX 3EY4A 2INGX 4AVYA 1W0KD 4MP3A 1EPUA 5DNEA 3WBKA 1FFCA 5IU6A 2OBYA 3FJYA 2HNKA 2TSYB 2WJHA 3KHUA 4ZCQA 2XEXA 4D8WA 2DQZA 1FYFA 4F72A 4HAYA 1WVIA 1AVTA 3HO1A 2PRIA 3H4MA 3G6WA 3KJHA 4EDFA 3NALA 4CLOB 2ZTHA 1XTSA 3NV7A 1ZU4A 4V0RA 1D8AA 2GM5A 2VHTA 1XO1A 3BZBA 3JD3A 4O2RA 3X1DA 2DFVA 1QE0A 1G6HA 4DFDA 2X22A 13PKA 2GRUA 2GSWA 4LY0A 2H0RA 4NENB 4R1MA 1XZLA 4BAZA 1OREA 5BV1A 1FU4A 2VKTA 1THGA 1REQA 3GZNA 5AICA 2HWKA 2FX5A 1E3EA 3R40A 2H2DA 2P9JA 1WMFA 2FPSA 3JPYA 1DO2A 3EARA 3QXSA 4P38A 5CK5A 2X8JA 1TAGA 3AVOA 5IARA 3ZV5A 4BNGA 4U3JB 2GJ9A 1IHPA 4UNSA 5T7BA 2JIBA 5ES3A 3S27A 4XPZA 1RXYA 2FG5A 1T3LA 4AJNA 2C9BA 2W0SA 1NN5A 5ALPA 3TRJA 5K3CA 1CRLA 3BC1A 3I1FA 4BQQA 2H5IA 1SUPA 4LI0A 3U7IA 4ZYZA 5EIWA 4NCBA 2LPMA 4JUIA 4TVBA 2BHTA 4PHHA 3I5AA 3ETDA 3MOGA 4TL8A 2G88A 4PCUA 4FR0A 3CT6A 7YASA 5MDHA 2IE0A 4UJ3A 3CPEA 1WV0A 4HXGA 2ZYIA 4WASA 5DRTA 1Y8RA 3ED5A 1DC5A 1P91A 4H2DA 4CLRA 4ONEA 2F55A 1I6KA 1KI3A 2D2FA 3CHYA 5EZ6B 3JASA 5KI6A 1W0JD 3PXEA 4WH0A 4MW7A 4BNWA 3NT2A 3WMWA 2XECA 4F91B 3QPUA 1R66A 1WW8A 5ERYA 4YJGA 3UQYS 4BKQA 1SGWA 3BA6A 1YNOA 3C8ZA 3NKFA 2AR7A 3HADA 4DLNA 2R86A 2VDQB 2QD5A 1WV1A 3ES9A 4IIGA 1MTOA 4A1FA 5HSGA 5D51S 5EI5A 2J9FB 5H81A 3WLFA 4ER3A 2BLNA 5JE8A 4LRWA 3A4VA 2O0LA 2V9PA 3AKCA 3BB1A 2IYAA 2WF8A 3NGXA 4OA5A 1KO8A 3O38A 2A58A 1U7HA 2B8JA 1Z4KA 1BEZA 3Q8WA 4M6WB 1SG0A 4MW5A 4KHZA 1IRXA 3VAZA 421PA 4C0QC 4E15A 2GO7A 1CQXA 1OIVA 5LR6A 4ENVA 3PD0A 1FNMA 4IJMA 2FW6A 2PUFA 4OEHA 2HFKA 2X6TA 2P2GA 1UZNA 2QDXA 2ZUTA 4GYYA 5LIPA 1Y6ZA 3A1CA 4EG7A 5CA1B 1C1XA 1GL3A 1UWLA 3RYIB 1SCNE 4HDKA 2GBPA 4LNUA 4N3NA 4YQZA 1JHZA 2AFVA 2AW5A 4RIFA 5FV7A 4PLYA 3TZHA 1RFGE 1AQJA 2ZB4A 2XI4A 4TMTA 1ST2A 2XNKA 3FDXA 2O3QA 3B38A 5JS7A 3BGDA 3IBSA 3WNDA 4BL5A 3UM9A 2HHAA 4F38A 2VZEA 3T9CA 4C7JA 4N4AA 4G5YA 1L5HB 1RXEA 3OF3A 1E92A 4KACA 4D43A 2PX6A 3QBEA 4AJEA 1JHVA 4CW7A 3HA2A 3RC3A 4AJHA 1L4YA 4GH5A 3A4YA 2O3JA 1BRMA 3GI1A 2W83A 3LGAA 4ZAVA 4UBOA 5JBNA 4JBHA 3FG9A 1OH6A 1TTQB 4AKSA 5AM5A 1U5CA 2C2ZA 1KC1A 5EQDA 3O8RA 4C05A 1RMQA 4QIHA 3MUOA 1SU8A 1TKAA 1BYUA 1FPMA 4GBED 4OL9A 4R1NA 5JPIA 3W6NA 5FTKA 1K66A 2GJKA 4MGKR 3D1JA 3QYJA 1ZC4A 2VHJA 5UKDA 5DT9A 1H4VB 4UD6A 4DJAA 4ZI3A 4XVHA 5FFMA 4ZK2A 5HM6A 2GH1A 2YH2A 3LDGA 3VR1A 2CZGA 1S7CA 3WO1A 2J48A 2PTGA 1CUUA 2HLHA 2JVIA 2Z2KA 3GJ3A 2XTNA 5EWJA 2YNMA 4LMRA 1VG0B 3GGDA 3P8ZA 4YT4A 4JR1A 2A1TS 1JR4A 3SSNA 3PQ3A 3V2UA 1Y63A 3H8WA 3U9TA 4KNWA 1TTTA 4MRRA 4YUVA 2W4QA 2F1HA 3D7SA 1QG6A 1JDBB 1K4YA 4AU1A 1KJNA 2ABWA 4ARAA 1RAGA 2J46A 1Q7GA 4RY8A 3K6SA 2EQAA 4I50F 2PSHA 3ZY3A 4CLEA 1KRWA 1S5PA 1X70A 2WJVA 4GE0A 2B6HA 4JQZA 3WK8A 4E2WA 2C20A 3DBLA 3JQPA 4HGZA 2Q1UA 3NUQA 3QQ5A 2CSUA 2ATCA 1ZRNA 2OTCA 2SHKA 1NZJA 3AHGA 3PXUA 4XPIB 3RC7A 4EF6A 3CISA 3G0IA 3FETA 4MVJM 2X41A 3FPFA 3MWLA 4G5QA 3HEAA 1IRIA 4WOCA 4OV6B 5EN4A 3W2EA 4B17A 1RIFA 1ZD3A 4DQXA 1M1YA 2LKDA 3GWGA 3ADCA 2KB0A 4TTTS 2ZATA 1EFDN 1K89A 1Y8QA 4QJIA 4XA8A 1GU1A 1X7WB 3HS3A 3TJRA 3KQLA 1QGUA 1QGZA 1K8XB 3BN3A 1C1HA 1JHQA 2E5FA 2VRCA 4PHGA 5ICMA 1PGOA 3TNYA 3T1NA 3GN2A 1XEWY 2ZIWB 1ESDA 3PGKA 1V5EA 1DAKA 1A8QA 2AJ8A 4UHEA 1YR2A 2R44A 1TLTA 2IEDA 2WINI 4ES6A 2ZM6B 3TZLA 1LB1B 1Y7LA 1LD3A 2LVBA 1KI8A 4WXEA 1GARA 1GO2A 2GJ8A 2DCUA 2HH9A 3H1TA 2Z1DA 1ISJA 1KNXA 3UMYA 1RAAA 2Y0BA 3FDFA 4DF3A 3BWVA 3E3LA 5JBQA 3NBAA 1R4NA 3B52X 5KYYA 1UQTA 1DINA 2RAVA 2PCLA 2FSUA 4CF3A 3K2IA 3WLTA 4UTNA 4DN6A 3K0CA 3IDZA 4FCCA 5KQMA 3M6UA 4J1QA 3TBKA 5LP6B 1VI2A 3U2QA 4MX8A 5BWBA 2JLBA 2XSZA 4LOLA 3UCEA 5I4CA 1SK8A 3VH1A 1MPTA 2PX5A 2WOOA 4R5HA 3RU9A 2BOVA 5J5VA 2FPPB 2GETA 3COYA 3U9LA 2YFKA 2RG1A 4RFVA 4M2LA 1O96B 2OQRA 2XGGA 3ROFA 3ZD7A 1DUVG 2PYDA 4NJMA 2HF9A 3MPOA 2BEUB 5H02A 5LQNA 4YB8A 3AK4A 4IZ6A 2NZVG 2YN4A 4KN9S 1C9NA 3LKDA 4HYTA 5DHTA 2DPYA 2FWAA 3KKNA 5GONB 1JF8A 3GL9A 1NUAA 3I9V1 5AOVA 3TAHA 1V3UA 4Y9DA 1SOAA 1T0BA 2OORA 3CLVA 1GTMA 1YI1A 3AHCA 3AP1A 3F7MA 3GVHA 5CFLA 2WABA 1ZUNA 4RHYA 2JGJA 1YQGA 1F8YA 3GEPA 3NFRA 1MBZA 1TU0A 4CNQA 4BIIA 2QD1A 5JHHB 3GRYA 5KX5F 5FWYA 3IAS1 4DOMA 3ZWVA 5BW5A 2YWRA 1Z3IX 3OZFA 1LJ8A 1UK7A 3V4SA 5IYZA 2EKZA 3QWFA 1KFJB 3MTBA 3O1LA 3T38A 1GQ2A 2HQSA 2REQA 1TB4A 4UDNA 4D4KA 3ZZUA 4BKRA 3M1AA 4TT8A 3JQGA 1SQ6A 4IGIA 4C6TA 1XQWA 2DWQA 3GLSA 2AV6A 3HLKA 4RPKA 2D5AA 4YT5A 1FIUA 3AP3A 5KYTA 1LSUA 3ND6A 3FFXA 5DWQA 5CU7A 3W4JA 2V6IA 3KUKA 3GRZA 4HAIA 3LX6A 1V0JA 1P2DA 4DV7B 2MWMA 5MFZA 2VP2A 1V71A 2B82A 2JAOA 4LVUA 3PJDA 2CW5A 3OKCA 1Q1AA 4EJSA 1CEEA 1OH8A 2DOKA 2Q50A 3DAHA 1OXMA 4HATA 2GBIA 4KIJA 5AUPB 3SDZA 1M2VB 3F4LA 3O9ZA 1MENA 1R00A 4QLBA 1Y9JA 3D6MA 5C8YB 1A72A 4H0FA 5HFJA 4DVGA 1QSGA 3BFVA 3OLZA 3WRYC 2QZ9A 4RD2A 1DJPA 3M6FA 4LZNA 2QL5A 3MF4A 4EB8A 1AIPA 1DEKA 2CSXA 4LAFA 4CT5A 4JYMA 4JK3A 2A30A 4MAFA 4S35A 3MTJA 4G5FA 5AJXA 5JZMA 1FDWA 5EL0A 3T06B 1GVNB 1HNWB 3AWDA 2ZIXA 1T2UA 3CO5A 3ICOA 4K1XA 4OJNA 5BV2P 2OV1A 1RXSA 1Z75A 2ODEA 4JR2A 5JSZA 3DXYA 3RIGA 1P4GA 2J5KA 3WNQA 3PG5A 5HS4A 3OPYA 4QOIA 2WW8A 2IOQA 2QENA 3CW9A 4ALMA 1JEAA 1QR6A 3VOBA 4EJSC 4EA6A 2VDWB 2AOXA 2AWNA 2QXUA 4O08A 5C5EA 4F45A 4TYNA 3U3MA 1OBCA 1TIPA 3W2HA 3JYQA 1Z7WA 5A2QA 4IRXA 2QU8A 5LWQA 1FF9A 4PQGA 3GVPA 3I6ZA 3IEKA 2P6UA 4LWPA 2P0YA 5IAJA 4E5VA 3BH7A 3ZGXA 1AKWA 1ACJA 4JUAA 4KQMA 2JFFA 3O21A 4QOEA 3KSDO 1X7HA 2QJOA 4Q02A 4ZVSA 4EA7A 1MX5A 2IY7A 3EUWA 3R09A 3WK5A 1WW2A 5BR7A 3OG9A 2WMDA 1KP9A 1RC1A 3VQTA 2YJ6A 3W5JA 2AUNA 5KOJA 2I4NA 3STTA 3KDAA 1AF7A 2VJKA 3EOAI 2EZ4A 4I9NA 4LISA 3KT6A 2HLPA 1RPZA 3QE4A 4BVJA 2P9HA 2XB8A 3JQ8B 4YEDA 1HYQA 3IURA 2BFAA 5K3BA 4RC9A 2OCPA 4O63O 3UMBA 3PKZA 4EY5A 2XA2A 1NI4B 2JD0A 2V3VA 5IM4F 4LRSB 5C7OO 3DOJA 3GEDA 4QDKA 4ZVOA 1CIPA 5CNIA 2OCYC 3QWHA 1ZN2A 3WLIA 5KUTA 5JDCA 2BGGA 1SK9A 1DMSA 1RABA 3DL0A 2Y1WA 1VI5A 3MVEA 5B3JC 5FL7A 3CKMA 2HO5A 1FZTA 2BR4A 2FZ5A 2IS1A 4QPPA 2G9ZA 5KWIA 2Q2OA 1CJUC 2WJPA 4NBKA 4PZ9A 4F9EA 2YWGA 3QMPA 3UAWA 1PUJA 3MTIA 3ZGLA 4C3UA 1KJIA 4M0DA 1U3FA 1GA4A 3IL2A 3PDIB 4FM9A 1T9KA 2C7VA 3ETEA 3GMTA 3B6IA 5B12A 1OC4A 1OH7A 5JEDA 1M67A 3C7KA 1JKJA 1W44A 1UPCA 5CD9A 2GEBA 4TV8A 3MFQA 4A2WA 5EJEA 2YWJA 5C0OE 4ALJA 1TUBA 2B6NA 2HBYA 3CB4A 3QLUC 3QVMA 3OIFA 2YWHA 2JEZA 4RS4A 1UBCA 3RK1A 1ZJYA 2HRRA 2EF0A 2ZJZA 1KVRA 1QWSA 1TM2A 1CRPA 1U1DA 1COWD 2GNAA 2NVUA 3ELUA 3K0AB 4OQFA 1JEQB 2VSYA 2ZIZA 3LBHA 3ZWBA 3QPDA 4E46A 1RPAA 2KI5A 4OHVA 1E5VA 3V4ZA 1J2TA 1Y8ZA 3AMVA 2HIHA 5JCJD 1JKIA 1QOQB 3SYKA 3ND8A 3WOHA 2JAQA 2PH5A 3N2KB 5DCLA 1FXUA 1T8RA 1BE8A 2P8SA 2XMBA 2XWJI 3BMQA 1QQ5A 1QX3A 3FROA 4BP3A 1CQWA 1LRLA 4QU5A 2RB5A 4NQZA 4MCJA 2RC6A 1QH8B 2IBSA 2YXLA 4ZDJA 3T1TA 1DMRA 1EG2A 1XLVA 4BO0A 4MINA 1DX6A 4E14A 3GROA 3UA4A 1G1MA 2VJAA 1QS0B 4MQEB 4Q18A 3VNSA 2W43A 3CEHA 2OFWA 5BPFA 4RELA 3QYPA 1XCBA 3KD3A 4CG3A 1IUKA 3U31A 2JAPA 2JRCA 2IY9A 2RK4A 4YY3B 4LYYA 3SLKA 3WOVA 1OLOA 3EGOA 3HI6A 3MS4A 3T4EA 4RJKA 1XGKA 5AHOA 3IPCA 3QU4A 1VSUA 4Y0AA 4HY3A 3KPVA 1XMVA 2Q9UA 4JVSB 1I10A 2PX4A 2QX4A 3BTVA 3FUVA 3R4CA 5AOBA 3RAPR 5KNLA 1A2KC 3ORHA 4GX2A 2VF4X 4ZVUA 4DGQA 4KAFA 3N6RA 4LQ4A 3JZIA 3FTFA 1SCIA 1H1LA 5DRYA 2FSFA 1QAOA 4BQRA 4Q01A 5T8KC 5JXGA 2XWSA 1ONOA 1WHTA 1G8PA 1TXGA 3TGLA 2GRAA 3HWWA 4Q9LA 1G291 1OYWA 1SXQA 3EULA 4PFQA 4JB3A 2OGWA 3NBUA 1YR9A 5L6MB 3C6XA 3AYZB 4KV7A 1BHO1 4KZKA 4AMBA 5ENZA 1PV2A 1D1QA 2BC9A 4I55F 5B1EA 1VBFA 1F6BA 1Z4QA 1GG5A 2W6JA 3KT0A 1PS9A 5J3JA 2PJZA 2PVPA 4OHPA 4A6EA 3TL2A 3UXEA 1RT9A 3EGCA 5HK8A 4G0NA 3IHKA 4TVKA 4U6NA 1T91A 1MKYA 2Q7XA 2Y1EA 3DLHA 4UMDA 3LT2A 1JLLA 1CUHA 2WTMA 3FPAA 2ZSJA 3M6XA 4LKOA 3GLGB 4MWTA 1OH5A 1FLDA 5EKDA 1OX4B 4QNRA 1QVWA 1PNRA 3KWFA 4L9WA 4QT4A 2VTBA 3BICA 4CR8A 3CB2A 4YT8A 1VG9B 3TMAA 1TAQA 2FMFA 4Y9SA 1P1RA 2QTFA 1C8KA 3KOXA 1SIOA 1QO7A 5EMKA 4CG1A 4Z3OA 1UZAA 4HEA1 1XMSA 1YIAA 3G2NA 5ALKA 5FH9A 1W4RA 4ROTA 5K05A 5CLIA 1P72A 1XTPA 4YUAA 4FSHA 1CIVA 3T7SA 4BO6A 1FP4B 3HCBA 4HTFB 2PZLA 1OLUB 4O4LB 3U1TA 1NR5A 3NBFA 1X86B 3PNMA 4PO3X 1MU0A 5JECA 3RG8A 3WI7A 1G5PA 2Q99A 2UZAA 4JKOA 4ARZB 4K86A 5IZCA 3L0OA 2AFIB 2ZT7A 5JZBA 4G4JA 5F77A 2XCLA 2NGRA 4GT1A 4XQ9A 2I33A 3ET4A 4WKCA 5J9FA 5ULLA 4L4XA 1G7CA 1PEDA 1V7PC 3K0FB 3Q2OA 4JYAB 4AD8A 2FEAA 3SQOA 3I6MA 3HCCA 1D2MA 3GNSA 4PWYA 4BC1A 2VEOA 3TW8A 3DXXA 4PS1A 1A76A 3L7NA 4U39A 1DFGA 1QYVA 1RAFA 2OC4A 2Q46A 3S2UA 2DJIA 3VAAA 1KYVA 1KIFA 3BVPA 5CVJA 5F1KA 4ZDWA 5BVHA 3REQA 3V4PB 1TT5B 1LI5A 1S2NA 1MW8X 4EHIA 2JFYA 2LNDA 2OECA 1BS1A 4M1OA 4CM4B 5LXTB 1KDYA 1I7SB 4ZTZB 4TKMA 2QUJA 4IUBS 1P7ZA 2XB2A 4GC9A 5TJ9A 1PQUA 5EVCA 4A03A 3QELA 1XMOB 2WAOA 5JRDS 2QD2A 3GAFA 3HUEA 2EC5A 2Y27A 3I9KA 3JTMA 3LU1A 1FSZA 3FZYA 3GO4A 4L0CA 4LMBA 4K6MA 1PL6A 4ALIA 3ZLTA 2R8RA 4KN5A 5BP7A 1Y4AE 3PUXA 4TYPA 1C30B 4DA7A 4XM0A 5AM0A 3EBOA 3NDRA 4Q34A 4RAOA 2Q3MA 5DBHX 5HJ7A 4R16A 1KS2A 4B46A 1M2NA 2FFQA 3FCCA 3HSYA 1WLYA 4Z8YA 4RU1A 2F64A 2BTQB 4R8KA 2AEMA 2AZ4A 3NYIA 1W52X 1AUPA 1EUCA 1XTRA 4UBKA 4C3ZA 4DIBA 3JRWA 4JOCA 4LHVA 1ZI8A 4HDSB 1P9WA 2AMJA 4C4XA 2KBFA 5KDDA 1Q0UA 1HNNA 2D0OB 2IGTA 2YIMA 3L06A 4QYWA 5DP1A 1JR3D 3EF3A 1TUEA 2YCBA 1WB5A 3ACDA 4NU8X 2W2MA 3NORA 5U9CA 4B87A 1ZOIA 3G7SA 1GAXA 2IVZA 2FEPA 3PNYA 4BFLA 1E7QA 1PR1A 2YZ2A 4EPVA 2D06A 2NADA 9LDTA 4Q3EA 1O6FA 4BFCA 1XQVA 3CRRA 1IY9A 1HLPA 1YSCA 2ZS7A 3NBYC 3O3NB 4TM7A 1IY1A 1YDFA 4B81A 4O4JB 4D3XA 2X14A 2CDCA 4OQMA 4BKOA 1LC3A 4MDEA 2Q8PA 3ZCTA 1G0NA 1H2BA 2FSGA 2V45A 3WO0A 5DX8A 2IXDA 3A6GA 1LPOA 2KPOA 1M7HA 4Q4HA 3K1ZA 4NXMB 3IQDB 4EK9A 3L79A 1N6HA 3MWDA 4KE9A 4RKYA 4FTWA 1V16A 3AZOA 3O1IC 4YK7A 2CUKA 1W47A 3K4QA 1A04A 3LBNA 5E2BA 3AVYA 2HU5A 4GMDA 4RDIA 3RUHA 4CUZA 3KQNA 4OHYA 2W6ID 2GCEA 2PY6A 4BVHA 5B2EA 3SIWA 3KQUA 2ODQA 4JUBA 4P31A 1YBHA 2XD9A 3SVZA 4B3JA 5HP4A 1W48A 4JMPA 1DBVO 2I2CA 2OVBA 2RHWA 3K6KA 3PFWO 4MROA 4ZT6A 4AMZA 1UBNA 2P9TA 4E0BA 1NMQA 1R4ZA 2ZRKA 1BXGB 3H19A 3KQTA 1H0RA 2WJYA 3KUUA 3MYYA 4L3WA 4ROSA 2WF7A 3BB3A 1BGWA 1NM5A 1USGA 4O4HA 1XFDA 4UEJA 2QS9A 1CERA 2AYYA 3FPBA 2HRZA 4CIYA 3ZN2A 2QBYA 2ZANA 3QPCA 1SQGA 4Y1RA 3S7ZA 2FEKA 1RD4A 4QFMA 5AOAA 4F92B 3UFXA 5CIYA 3NHSA 4I9HA 1F20A 1PNOA 2HTEA 2FLVA 1FC0A 1RWOA 2OKCA 4MPDA 4HNQA 3HYRA 4E2YA 3HCNA 5AVTA 3VZRA 1P7CA 3EIWA 4R3UC 4DCCA 1NUTA 2X2PA 1GR1A 5CPFA 1T5DX 4DUYB 1CJSA 1WMBA 1VYVA 5DW3A 1NI5A 4WXMA 2JCGA 4MK4A 1UEXC 4TMVA 1WKVA 2H4XA 3D2CA 1NBHA 2E4VA 1FTGA 1E1QA 2WFZA 3OZAA 4LPKA 3GH3A 5CDUA 1XRPA 2WUVA 1VGQA 1NQXA 2FG7C 4LIPD 5J2UA 4I4IA 1AURA 3TM5A 2HA4A 4BN0A 1ML4A 4EM6A 4TKVA 2O8CB 2OCKA 2JJ1D 3TFWA 3MJTA 3T94A 3NW9A 3ZHBA 1UC9A 1JILA 1HPLA 1JSRA 1RQXA 2W2LD 2VN8A 1POWA 2WYVA 3LC0A 5CW1A 4KR7A 1T25A 3DHNA 2YMMA 5IJZA 3NB0A 4PAMA 3LYHA 1NP3A 3S5UA 1PDOA 3HZHA 1QOZA 3IBCA 5DXFA 2Y0DA 4FQ5A 1ZJ4A 5ALQA 4FU0A 4ZEVA 3KWJA 3K9NA 2JGDA 5BXQC 3L92A 4ZKEA 2L2QA 1MH1A 2ACEA 3FTQA 3IIMA 3LZCA 3GUCA 4MVJI 1V7ZA 5U4XA 4OGWA 3WLHA 1WF3A 2A59A 1NMSA 3G13A 4HUQB 2ZP1A 5K3FB 5T3YA 3HHEA 4C0HA 4S05A 4GOXA 1QORA 4N65A 1T3GA 2UXBB 3MC1A 3NTXA 3NAGA 2ZREA 1YV9A 5EJFA 1VCMA 2R00A 1YA4A 4ENRA 4E6EA 1A0OA 5H0IA 1L5KA 4Y6QA 3UGKA 3FW1A 2PGIA 4B76A 2ORYA 3ND5A 3KK0A 3OTHA 2Z4TA 4ZGWA 5HJEA 1X87A 1T4GA 2BPOA 3GEEA 4FFDA 3NHFA 4RVFA 4RKQA 2P2DA 3LYUA 3QVTA 4RH1A 4CM5A 3CVUA 4I5EA 4R3NA 3AGQA 2G1AA 3C45A 3CSDA 3LHDA 3L6OO 3QPAA 1EFVB 1DOAA 2JA1A 4BRUA 3OE4A 4NHOA 5ALDA 3ROPA 5I9BA 1GKLA 1NDUA 1Y6RA 3T4UA 3FDJA 1NQUA 3PF9A 4V3CA 3MMPA 4ZZ1A 3ESQA 4PYNA 1EXWA 1DOHA 4BE4A 2BRUC 2YHBA 3SDSA 2NSLA 2QM0A 3W2IA 2XCQA 3OQBA 2JD1A 4N01A 5CX1B 5CB0A 5IUNC 2HU2A 4JL8A 1EHCA 4JJAA 3VYWA 4X65B 4KVAA 3DV0A 5TB5A 1QAQA 1ZK0A 4R1LA 4TOIA 4RULA 1Q57A 2W8ZA 3KQPA 4NJEB 4YWHA 3JX9A 4QQKA 5AKHA 4CKEB 5IKMA 1YACA 1LK5A 5LDGA 5L51A 2TMYA 3T5PA 1S89A 2DTDA 4LXTA 1VE3A 1BSVA 3VPCA 2VJCA 1TVEA 3L5KA 5T41A 4CV1A 3NWEA 2CJXA 4ISBA 4GVXA 4MQ6A 4MPJA 4IZIA 1EYZA 4YAOA 5DXJA 3G2LA 3P2KA 3RVDA 3VU8A 1GNPA 5MHTA 5ALNA 4G6ZA 4UMFA 3V8NA 5LOVB 3PIRA 3QKTA 4XARA 4AQ7A 3ICPA 4DSZA 3AERA 3FFBA 1N2EA 4C0AC 1AE1A 3DLTA 2DWUA 3UWKA 4QFBA 4P4GA 1QUFA 3KXIA 5L7TA 3G79A 1VA4A 2VT6A 1GPNA 3LTEA 3PNOA 1OE0A 5BNWA 3WL8A 4H35A 4WXPA 5CLGA 3ZR4B 4BAGA 1UFVA 2BJHA 1SXJD 3U5TA 3D8HA 4IGKA 1HGXA 3EIFA 5EMHA 4HWSA 4KPUA 2IHTA 4R98A 2J3IA 3T9BA 3WV4A 5JT1A 1I7PA 3RVLA 4RTMA 5NULA 1NF2A 2QTAA 2VXOA 4MWCA 2O3UA 4COKA 4NBWA 3X1YA 5BSRA 1Z5VA 2NVOA 4EG8A 4ZEOA 3IAHA 4N9QA 4XCVA 1BH6A 1U4OA 3GLUA 3BXPA 5HHTA 1YRAA 3FCSB 3BKXA 4HQLA 3SVTA 3UJCA 5I9SA 3A0UA 5CEFA 1AQUA 2X6QA 4JQOA 3BRCA 2WUGA 1U7DA 4G07A 4JGBA 5GY7A 4BB6A 3PHIA 4RK1A 5FUQA 3DZGA 3IT3A 2GTIA 3FOBA 4FCWA 4NYJR 1NMZA 4Z5XA 4X7PA 1NURA 1IHUA 2OFOA 3CWZA 1YI8A 1RS0A 3T7JA 1L2TA 3C5CA 3GQBA 4D7AA 1P62B 3MCUA 4ZYWA 2HBRA 3IJRA 4H1TA 3ROEA 1KI6B 1CUVA 3NONA 4MR9B 2IYQA 1MP0A 1B76A 2PV0A 3KEGA 3R9KA 2Z83A 1LV8A 3PDJA 3V42A 3D8NA 3NDIA 2QPOA 3L46A 2PEYA 3E1SA 5GOZA 1UOOA 4B7XA 4CCWA 3GVIA 3WADA 5BYKA 3AUFA 4HQ0A 4LW8A 1JFLA 1H9CA 5IWCA 2XQVA 3DEAA 2YVLA 4I5GA 1JUDA 1TFRA 3I76A 2IDMA 4NMHA 4UCQA 5DB4A 4JJ4A 3EEYA 4LQLA 2F62A 4R68A 4HC4A 3I04M 5AHRA 4ZTBA 4F4UA 1WE2A 2BGMA 4PW0A 1OOEA 4NL4H 4O29A 4B4WA 2FCAA 4DKXA 2PV7A 4LZPA 4LVNA 2OXTA 3BXGA 1S4MA 3ZD9A 1FU7A 4BLQA 1XE3A 3HYCA 1NVTA 4JLVA 5CA0B 1H93A 2GTHA 2M2IA 2VXBA 1ABFA 3ZZMA 3GMSA 4JA0A 3KR9A 4PN3A 2YQ4A 4JXZA 5EA2A 1FDSA 2VYQA 4BTLA 2FWMX 2P4EA 2ZITA 1YR6A 1A69A 1PWEA 3HVKA 3L8CA 4HMOA 4R6WA 4QGFA 5JSKA 4R0MA 2D2EA 2VG8A 3BJEA 1XQ9A 2WLTA 1F2TB 3A3YA 4URUR 4BEWA 3D64A 3FZGA 4C2AA 4ZAWA 2R25B 4UOEA 1XVLA 2JFXA 1P1CA 2XE8A 1X39A 3DAGA 2IKSA 3EEFA 3HVJA 3M1IA 5JO0A 1ZVVA 3UNXA 2VHCA 5IAGA 3C3KA 2H2GA 2P65A 1BFUA 1WVMA 1Z4JA 1P74A 2GCOB 1BXRB 4QDJA 4UXIA 4ZCLA 4EKGA 1CF4A 3CSSA 2VSQA 2I2DA 1FW8A 3FWZA 3N2LA 4JXKA 4W5OA 2NZXA 1EX9A 2YC2C 1HDRA 4QEDA 2UV8A 1RI5A 3D1VA 4GICA 1E1CA 1XWWA 1DWUA 3PXXA 4XKJA 3WQHA 1AO0A 1N2GA 3E4DA 4IVPA 5CXXA 1SXJB 4M7RA 4RDHA 5G3ZA 1DARA 5JXIA 4KE8A 2OL4A 2BELA 5MF6A 1PFGA 4HDMB 4CM1A 4BO4A 1P2GA 2ZAMA 3Q3IA 1GGEA 3SAJA 5KU7A 4MITA 2AG1A 4EEZA 2OLJA 2QNRA 4X64B 1ULBA 3LXXA 3AO0B 2OR3A 2EU8A 1CK4A 4LJYA 4RACA 4RM2A 2WP8J 2JJ2A 1HL3A 4FCVA 2A4MA 2C4NA 3AVPA 5JVDF 3KOWA 3MT0A 3CRQA 3ISVA 1N25A 5HF6A 3IUJA 1T8UA 3OQIA 1QIDA 2GEVA 2NO9A 2ZWPA 4IJWA 1K75A 1XA4A 4BWGA 4OK3A 3U4IA 1EHYA 3D2BA 5GM2A 2AG5A 1KZ7B 2OAP1 5E1MA 1MIOA 3TSAA 2FU5C 2QJFA 4BX3A 2DLDA 1Z2OX 3A1TA 3DEZA 3OM0A 2TRSB 4BVAA 1E3SA 2YV1A 1HC7A 1FFBA 2O2JA 1PLJA 4M8KA 4NBUA 3OZIA 3RYFB 4C7MA 3ECSA 5ALFA 2IUSA 4O2AA 3SWWA 1HWYA 1NT2A 1V1RA 1ZM2A 3HE3A 3T3MB 3I5YA 4QO7A 1XRSB 1K8RA 2F3RA 2O1XA 3B3QA 4M7PA 4BYMA 2PDAA 2XYVA 3G0CA 3MERA 1VHDA 3AB8A 3HUFA 4KNVA 4O1HA 5B55A 4QJ5A 1JHRA 3QW2A 1EZ4A 1N9KA 1ORIA 3S5JA 4EZIA 1XMIA 3JYPA 2NLOA 2V9ZA 4JC4A 4TLCA 1QHFA 2BGNA 4LE1A 1H2EA 2IGBA 2WT4A 1CP2A 3IEPA 3JRNA 2I8CA 1JDSA 2G82A 4YRIA 4OI0A 1KVQA 5KC9A 2QUKA 5IDWA 1TQ4A 2OZLA 4ZOEA 3CX4A 5T67A 2OAQ1 3N0XA 5EOVA 1U02A 4N9WA 1F8GA 2BEWA 3K0EA 1PUIA 3QWAA 3AY7A 4D3ZA 1MHTA 5LDHA 3S1SA 3UT0A 4P0PB 1Z0DA 2ZUEA 4JVOA 4K05A 2HC9A 1II0A 2AS0A 5I8WA 1AUOA 2QP9X 3ZIUA 1Q77A 2JIQA 1FQKA 2ZETA 4AG3A 2VK1A 3I6IA 2AOWA 1N2OA 2E37A 1WXXA 1IY2A 4IJKA 1G7TA 2O19A 2JVKA 1WDWB 4R40A 5EIBD 3LQYA 4H15A 2BMDA 5KVSA 2DG2A 1E3IA 3ACBA 3EGEA 2V1XA 2ZR7A 3LECA 3R3SA 1HKHA 2LE0A 3P4XA 2PUAA 4ENPA 4J1TA 1NUQA 3BOSA 3GF4A 4PSAA 1L1RA 4HB4A 4TL7A 3RFCA 2OLEA 4OTZA 1L4UA 1JJFA 2DPHA 1EIZA 2NV6A 3FPGA 1SZPA 1W35A 4FZ5A 1Q15A 4ZOLF 1ZU5A 1K8YB 3KXDA 4RIEA 2HT6A 3UYLA 4IZHA 1V25A 2PCJA 4LHYA 3A1UA 4ZXPA 3KR0A 5AI8A 2FWPA 4BFZA 1F12A 4YV7A 4F2DA 3V1LA 1BH2A 1D2HA 2CNBA 3QSGA 4Q7EA 1WPQA 3O8QA 3TEJA 4YCCA 4AK9A 3HY4A 4MV4A 2FKNA 1PFKA 3QPVA 4UM5A 4FPXA 3ZGOA 1NVMB 3GT7A 1MJFA 4EG0A 1UZLA 1B74A 1G5FA 2X77A 3OBBA 4O02B 2I9PA 4P0QB 1G21E 2HDHA 2XCUA 1I6WA 5L45A 3X3HA 2VTVA 2W7TA 5EEHA 1F4PA 4WZAB 3O1JC 3PUWA 1ZP6A 4OKIA 5ANRB 1A9QA 3T52A 3NHYA 4RTPA 3MQ2A 2UUCB 4C0KA 3HK2A 1Z35A 2I80A 4HUJA 4AKEA 4NBVA 3RSGA 4H1WA 4UQLA 3WHIA 1CUWA 1PVDA 3EGDB 1AA6A 5MFPA 3BTOA 3GNLA 4IYJA 3DMPA 1Z6XA 4IUDS 1A8PA 5IK2A 4XGRA 1FDVA 1GXSA 1IM2A 1RYHA 1XALA 4TV9F 1UBKS 5BQPA 1MQSA 1S4QA 4YPOA 2JBAA 1DTWA 3H2IA 4OHFA 2X4LA 2BZ0A 3SHTA 1JJIA 2G08A 2F1JA 1PDWA 2J7KA 5ADVA 1HFJA 2IYUA 2PSEA 1U81A 2GAJA 3HKCB 1V8FA 1UKZA 3DHEA 2ACKA 3HRKA 4ND6A 4OA8A 3P0EA 4PYMA 2R8ZA 1QIHA 2Y6VA 1HLDA 2G28A 3BQ9A 2WYIA 3LSYA 2OQ2A 2CFSA 5FR1A 2KLBA 1G3IA 3EAQA 4UEKA 2OHFA 3GFOA 5E6SA 4CCYA 2Z0MA 3WB0A 3D0QA 1AU9A 3TQQA 2BFMA 2JARA 3HA5A 4WN3A 2QLNA 4PG5A 3DDCA 4AZ3B 1HRDA 2PUCA 4IBOA 1A8IA 4MAAA 1FVHA 3A9CA 3LUJA 3VR0A 3ZKWA 4DCMA 1JKXA 3BKWA 4BY9E 2OV6A 2B1JA 1PFYA 1DAOA 1OFIA 3JWIA 4F56A 2X0JA 4KR6A 2JLYA 2TS1A 1RLTA 4G56A 3L7KA 5FI1B 3K1AA 1SWWA 3FMFA 3FN4A 5K3EA 3PVSA 3CZ4A 3S70A 4ZIRA 1D0IA 4MV0A 1W93A 4HAZA 1J22A 2WJWA 4HDNA 1AQLA 4YCDA 1LVHA 2CKDA 1HDZA 1PFVA 1W4LA 2Z4SA 4CHGA 4E7OA 1NBIA 3BORA 3WQSB 1KY4A 5EIEA 4FBGA 1E77A 4CQLA 1W6RA 2ZOSA 4XLTA 2IW1A 1L7EA 3QM1A 1Y9EA 5F2EA 1WABA 4MQMA 2A0UA 5DTIA 4B0PA 5CURA 4CDRA 4XYBA 1HNXB 1SULA 2I54A 4FSDA 3QFTA 5FA6A 5BOSA 2CMKA 1WLSA 3BMNA 1LSOA 5FBQB 1X1SA 1S2OA 2QXTA 3ZQ6A 1JHPA 3E82A 2WYOA 4MXDA 1Q1ZA 3PEEA 1QAMA 3RVNA 3T99A 4ND3A 4CODB 4CI0B 2CNOA 3MT8A 1LU9A 1PE0A 2LZ0A 3FGOA 1SD1A 4JH0A 2Z2JA 1BKDR 4BKMA 4HN2A 5B53A 1KO1A 1XFAA 1STOA 1Y0BA 3DEFA 3PUKA 3N59A 4XIFA 5JMPA 5DYWA 3MINA 1K4MA 2W22A 3IRVA 3EZ7A 3HG7A 1FRQA 1JPNA 4RA9A 2XMGA 3OX2A 3GCGA 3MM4A 1EEHA 4YTEA 5SY9A 4JQYA 4LG1A 4ZCSA 2DLNA 4BJ6A 4GZLA 1PSWA 2R87A 1E4EA 1D0SA 5JXJA 4MRMA 5AXBA 2HZ7A 2VAPA 4EUEA 1NYTA 3GC6A 5K8JB 1R5OA 4ZQGA 1KOLA 1SEVA 3M3PA 5FF9A 5ALRA 5BSMA 3ZVLA 2XCRB 4J0EA 3TFOA 1Z5NA 3NOXA 5DMXA 2PWYA 1EM8A 4LXUA 2Y6UA 4R2HA 4UFNA 3SZLA 3EXIA 3WBJA 2I6XA 2R96A 3W3AD 4R2KA 4UCXA 3N2IA 1SUCA 3PC2A 3EQ7A 2ZWVA 1I1HA 2H54A 3SJZA 3UMFA 4B80A 3KQYA 4Z0TA 1RKBA 1Y3BE 1YCFA 1Z22A 3AR8A 4OAOA 4XYEA 3V8RA 3VDMA 3RVPA 4OHCA 3HB4X 4FBMA 2BBTA 3JAKA 3AVXA 4FD2A 4ESVA 1YVEI 1C2TA 1ZD5A 2ZM5A 3MWYW 3VDNB 2H1LA 2Z8YA 2NYRA 2WTEA 1D4FA 4OREX 3NAZA 5I3ZA 3I4CA 3R6TA 2EFGA 3B3AA 1KSGA 3RC2A 1VHJA 4FOSA 3PUHA 1WSWA 3EG5A 1RHJA 1NVBA 3QIVA 3RCBA 4B40A 3CH7A 2IZ6A 1UK8A 2ECQA 3TRIA 5LL6P 4UDOA 1ZCFA 4OBEA 3L93A 2BYTA 3F4KA 2F1IA 4BRZA 3HB5X 3WWEA 1A8UA 4FXPA 5A9SA 2D59A 3D3JA 3CUUA 3T1QA 5BYAA 4JEIA 1TQ8A 2ZJ0A 3H83A 3TZCA 3HA7A 2AN5A 3F8WA 3KLNA 5HE9A 4AJ1A 5FADA 3VYVA 4B7UA 1K3TA 1RE1A 3QTTA 1XDUA 4N3CA 3B12A 3T7DA 3VSDA 1YC2A 2Z5LA 1D0VA 1RZUA 2FJ0A 5L3ZA 2PUBA 3EXHB 1P5RA 1R0XA 4IO1A 5A6SA 1Z28A 1F48A 1NNLA 2O2CA 1UXKA 1HDCA 1W4CA 2V5AA 3L7IA 4FD3A 4U2KA 3CUVA 5TARA 3ZHYA 4EBFA 3OKAA 5TVGA 4XGIA 3UT6A 4DLSA 1BA3A 3J81A 1BG6A 1I14A 5PNTA 4JLWA 3L0PA 3ZJVA 2I2FA 3AI3A 5I5GA 2GPSA 3GLVA 1RWNA 4I08A 3PB3A 3D02A 4ZZ2A 1OMOA 5JOQA 5KJFA 2QTTA 2HRDA 3I9FA 3VPFA 1N57A 1TMOA 4DLKA 1EBBA 2RJ3A 5G3YA 5LD2B 3EUFA 2P2SA 2PR7A 2JZCA 3ACCA 3K6RA 3RHZA 2AXNA 1DE0A 2VDRB 2C0CA 1THTA 2ATXA 2M6KA 3TQCA 1TAUA 1JIVA 1E20A 2H4ZA 1RP1A 2XNSA 4MUYA 2D4HA 3S40A 4DIFA 5HNKA 1JPUA 1L5SA 3T54A 2SKCA 1RJFA 2BFEB 1HTBA 1NE7A 5JMWA 3D8RA 1OILA 2XA9A 3H2HA 4KN6A 4AG5A 3F67A 5IJWA 1EGAA 1RPJA 4HWOA 4PU0A 2VQDA 3HDJA 2F1RA 2HMAA 3HKDA 2AE1A 3QEJA 4M0PA 5BN5A 1T5LA 3RVSA 4RJTA 3KAQA 1SBYA 4WLVA 4BVBA 4HDRA 4C43A 5BRAA 3CJQA 4CM9A 1OFGA 1R5BA 3E23A 1IHXA 5GTDA 3DPIA 1X7DA 2FQYA 2EP7A 4DADA 2GT1A 2G5PA 2ZYWX 4EJ2A 3PKJA 5HQTA 5ITSA 3ZNNA 3KYBA 4C7BA 2QN8A 3AJ9A 3DOOA 2AW3A 2YDYA 3JQAD 1VHQA 3DE6X 2R85A 1EESA 5HQ3B 1C50A 4LTMA 4QREA 4GO1A 4PLHA 4Y67A 4ZPJA 1TT7A 2WKWA 4HH4A 4B48A 4DDHA 1YRLA 3I09A 2GZMA 4ZVMA 3L7OA 1LW6E 1UF9A 2IELA 2JHCA 1B26A 4K0RA 1JIKA 4MKXA 4NAVA 4UZEA 3USES 4D79A 2GNPA 3DL7A 3OKFA 1U98A 3LBIA 1ZNYA 1II8B 2JFBA 4L51A 4NS4A 2M32A 3SK0A 3ENQA 3AG6A 4ML3A 4RQTA 4Y1GA 4DIKA 2P6RA 1LBHA 3TF5A 1J99A 1ZG3A 5C1DA 5H59A 4EX6A 3B36A 5IVHA 4TM8A 2AQ8A 2HUPA 1ISPA 1G3QA 2QD3A 2ZBPA 3I1IA 4N7RA 5BRJA 4ZJPA 3CRW1 7REQA 2ZI7A 3TIXB 1I7NA 4FFSA 3SFVA 4RA6A 4N7BA 1R0RE 2HXGA 4YV0A 1LFAA 3AEKB 1CZHA 3NBZC 3QOFA 2W90A 1ETHA 4JT9A 4BOYA 4QPZA 2IXFA 1S96A 1J4AA 4KMOA 1YA6A 1NHGA 1ZOSA 1GZDA 2I99A 3IEUA 2AFHB 2I34A 4QYXA 4X8OA 3VVBA 4X66B 5JQGA 4F9FA 2PS1A 1W5BA 1QHNA 1GKYA 1YS9A 2J3KA 4RPLA 1C7ZA 3R3XA 3ZXYA 2NXJA 4CMIA 4G0VA 3L8GA 3S2EA 1XK7A 2H00A 1U2EA 4G25A 3M89A 1YHZA 2WM3A 4F4HA 2O0MA 1X9HA 4MUIA 2DMRA 4NDNE 3UOWA 2PX2A 5BQ3A 1KWGA 1NYRA 1OKKA 3GAAA 2NSDA 1QDEA 4BO9A 4XIJA 4YJ3A 3L4KA 2FPIA 1UBUS 2FW0A 3WYBA 4Q1FA 4X20A 5EZYF 4AI6A 2EJVA 4QE3A 3OMLA 3PQ4A 4KQXA 2I3AA 5CG2A 1ZH0A 2CBXA 5H4HA 3TL3A 2C3UA 2DH5A 4ZCTA 5TS3A 1FFXB 3OO0A 1TZ2A 1RU3A 5ICCA 2OYSA 4L50A 4DXDA 3RAGA 1KR5A 1R6AA 1Z5ZA 3GP3A 5FFNA 4UTPA 2BE7A 2QZ4A 4RX1A 1QG4A 5KTSA 2DSNA 3S68A 1BFDA 1MJNA 1BCSA 5EIXA 3ZHZA 3THXB 5I7FA 5DGDA 1GPWB 1WU7A 1ZN7A 1MX1A 3BXFA 3GFRA 4G89A 1K68A 1WZIA 2HMWA 1TKCA 2XT6A 4LJKA 1CJCA 2H1SA 3RVJA 2BKLA 4N48A 4GD3Q 2R68A 2YYSA 1M10A 3ANNA 2MR6A 3C8MA 3MILA 5D7NA 4JHXA 3SQDA 5B4TA 3N86A 8LDHA 1TJ3A 4KDRA 4DWVA 4MW2A 4RNCA 5F7ZA 3K5PA 2O07A 3W9UA 1XTJA 3IVGA 4MYUA 3T3DA 4ENQA 3JQAB 2Y05A 3UBTA 1GG8A 4OVKA 4IUCS 1W1IA 4KVGA 4WAUA 4C4ZA 4PONA 3IMKA 1KQ3A 1OFUX 1T6YA 4CMAA 2CLFB 1FTYA 3D8SA 1K7XB 2YYYA 3HU1A 4BE9A 4P33A 1GPAA 4KCGA 1OF1A 1L5WA 2A9QA 1W1UA 1W2WB 2QTLA 2Y9PB 5FQOA 1FS4A 1ZA2A 3AB3A 1REQB 5LLSA 3O4GA 3OHSX 1JFFA 1UP4A 1WSDA 3B2EA 3U4DA 4NONA 4QHTA 4JUDX 2RGGA 4DCVA 3GUZA 3HZZA 3QUSA 1AT1A 3PBKA 2JFVA 4Q00A 1PR5A 3EVFA 1ZPDA 4H1UA 2XW6A 2YQZA 4TMXA 1KK1A 1GTSA 3O94A 5JDIA 1CFJA 2P79A 3IFSA 4QWMA 4RPIA 1LQ2A 3JQ6A 3TXAA 3U7GA 1I4LD 1VIYA 1IWPB 3CNBA 3EFOB 4M55A 1T1GA 1VLJA 5DI3A 1I7DA 1A2OA 3OI7A 4FN5A 4LF8B 2RKOA 4GOKA 4Q3OA 3LQRA 1FXWA 1ODTC 1JW9B 1VMIA 2ZTUA 3H4TA 3D6VA 4U1RA 2P3QA 3MQFA 1H9BA 3F71A 1BMQA 2JIZA 3LPLA 4X44A 5DOZA 4OF4A 1FQOA 4ACAA 2Z08A 1AM4D 1D9XA 1E5QA 4MVJF 1A5SB 4MYSA 4N0PA 3PEVA 4DZZA 1KFCB 1A5ZA 5KPDA 2DFNA 3DW1X 1Y3DE 4HFJA 1EFPA 4RZUA 4FGKA 1GQOA 3OFNA 3TCNA 3JARA 4EMUA 1RZ3A 1Z34A 2F17A 1OGIA 5K3AA 1ONBA 4KVZA 4IIEA 3ROGA 2FSSA 4KSCA 1IXKA 1U0GA 3MK31 3K8QA 5G4KA 1TVKA 1Y80A 3L7AA 1N5JA 3V1UA 1DI0A 4X6XA 3EC2A 4OQXA 3HGTA 4BMNA 3KZ1E 1KKLA 2AG8A 4TL9A 1BNCA 1FLAA 1HQKA 1RRGA 1V37A 3NHAA 1Z6QA 2FCRA 2EKQA 1E18A 4LGYA 4B31A 3FPSA 4ENSA 3ZLJA 4F2PA 5H3LA 1SA0A 2JHGA 1OXKB 3A1VA 3B3GA 1EQ2A 4DJDC 3GLHE 3DDSA 4EKEA 4XAQA 4MLZA 4UAGA 4BVEA 3HGQA 4KITB 1I36A 1WULS 5DM70 4G36A 1UDAA 4DPKA 1A97A 1T1RA 3PZBA 2C4MA 2IYOA 3C3BA 1JZTA 3EGWA 3OCZA 1NGSA 4RPCA 1KO4A 2P6MA 1R10A 3BGIA 2PNJA 3FMIA 5I7OA 1L7RA 2VYVA 4JI7B 2XMZA 1MEEA 2XY4A 4LSGA 1MIHA 2OP0A 2A35A 2CJFA 4RTQA 3KQMA 3EQZA 2PFKA 4X6YA 2D5LA 4R2JA 2E5LB 4CN8A 4E51A 5A5FA 1ML3A 3P71T 4ZVVA 4QEKA 4XDHA 4X3CA 1SXIA 4JX9A 2AA3A 1WS6A 1NXPA 3K9LA 3TOCA 4L6AA 3OJEA 4UEQA 2EATA 2G77B 5BUZA 5C7LO 1V1MA 5FUWA 2XVXA 3SVLA 1CP3A 5AM1A 3MEQA 3K16A 1IN7A 1G20B 3MN1A 3OTWA 4DTCA 2EFYA 2F1OA 4WRRA 5ESWA 3T5CA 3A26A 5HIKA 4RTJA 1OWOA 4F46A 1XZHA 3FY4A 4YASA 5JPDA 1GSIA 1N92A 5FIUA 2XB9A 1XZCA 2WOJA 3L4BA 3Q7SA 4RK5A 1LS6A 2WUEA 2NG1A 1I7LA 5JD6A 3MT9A 4CMHA 3II6X 5CLLA 5CB4A 3OLCX 5DM1A 3QH4A 5EWJB 1UPUA 3O0TA 1KJ8A 3M1LA 3TMKA 3WMRA 2Q3FA 3HN7A 4G1FA 4CQMD 3V5NA 3BE5A 4RYDA 2QTMA 5BWNA 4YREA 2HFJA 3MD9A 2GPAA 2GXQA 5FRDA 2WNIA 1TEZA 5FD8A 1CHNA 1E99A 1QANA 2G76A 4GDMA 3TIGA 1H6DA 2YASA 2V7BA 1EWTA 5THKA 5CXQA 5JAQA 2XRFA 4OIMA 1X1RA 1CUZA 2LUOA 4Q6BA 1CZNA 3TE6A 2H92A 2D1RA 1PVVA 4MPPA 4W9MC 1I0ZA 3LP8A 3LLCA 5YASA 4DJTA 2O0JA 2WF5A 3CLSC 3EHDA 2ZIGA 4C4SA 1T1JA 1M76A 1ZNWA 3KUDA 1U3GA 3W8EA 3LUPA 3QLVC 1XXHA 5IC5A 1NY6A 4EMTA 2I7XA 4DMKA 2Q5JA 2IPMA 5IKEA 3C1UA 1GA6A 3BFKA 1VMEA 3R0XA 3WK4A 1SCAA 1J1IA 2C8KA 4D02A 3DEKA 5C35A 1QGUB 2EW8A 3A4LA 4KAJA 4LRYA 4EG6A 4NQRA 2I3ZA 1E2LA 1TQHA 2ZBUA 4PTLA 5ITZB 2G1UA 3VHLB 2XKBA 4Q4DA 3CO0S 2G07A 4GHWA 1QH0A 4S1TA 1NV9A 3MWFA 8ATCA 3K2QA 3KKKA 1QKJA 3ABQB 4BLRA 1Y4SA 3DUFA 4YRGA 3AEQB 2O2DA 3DYIA 4C0LA 2CVOA 1JSZA 1HT1E 5CNJA 1UC4B 2WWWA 1XZKA 3A10A 3I8XA 4XSVA 1NVFA 5AMXA 3GHHA 5CVEA 4JGGA 1QPBA 1CDZA 3E2IA 3I32A 3LXRA 3DZCA 3RLFA 3ZU2A 5JSFA 1EXMA 4EUHA 5I5EA 3ZI0A 4BMOB 2C8LA 1U90A 4IKOA 5BOVA 4NPCA 1UBFA 1A88A 1SAYA 5EIFA 2YKGA 4X7MA 4P0TA 1LZKA 1I2BA 1Z6GA 1HI9A 5FTLA 3F9IA 4XWYA 5KSYA 4OHUA 2OBBA 4QDTA 5HIMA 5JNSA 3GPLA 3WDLA 2IWRA 4TROA 2WYUA 2PANA 1AGPA 3Q40A 3UN1A 2ONCA 1P1FA 5CXUA 4E4YA 2XUIA 4O4IA 4IDPA 1P2BA 4G65A 1DBSA 3GVCA 5D86A 3WWPA 2Z8ZA 4QTXA 3CJRA 1RM5A 2A0FA 3H99A 2A78A 2CXNA 1YZNA 1IG3A 4F5EA 3RB8A 2YXDA 4F8JA 4OSPA 4ZVTA 1TYZA 1SCJA 1VJTA 3DP9A 4KV9A 2BH9A 1RYNA 4IIHA 3LAWA 1Q1QA 2FHPA 4G0MA 4PBTA 4KFCA 1V4NA 1U8FO 1X8LA 3HJRA 5BW6B 1UJ6A 3CH4B 3FDIA 4TS3A 1L5MA 2V5VA 1NT4A 5IX8A 3QMWA 4JBGA 4CQMB 2BEJA 2H57A 3DE4X 4AURA 4BDSA 4HX2A 1TZBA 3K9HA 4FJ2A 3DOHA 3ETNA 1IL0A 4ANFA 4I50A 3B8HA 4QG7A 3G0OA 1EVJA 1A8HA 2W2XA 4LJLA 4RGBA 2XOKA 1RYBA 2SNIE 3D3EA 5JJ5A 1L6RA 1UXGA 3R3VA 4L5JA 4NYIR 3FIUA 2IV3A 1Y7IA 5K4GA 1ISRA 1C7IA 4FFVA 3WLKX 2R8OA 2IXBA 1YE3A 3M4YA 3GY0A 3PQEA 4EFNA 1LPBB 1XTKA 2YY7A 5ELLA 1Q74A 2G5GX 4NFHA 3VI3B 4HWRA 4Q9DA 2IHKA 5CCDA 4ZJZA 3FUTA 1KYYA 1V96A 1WP9A 2ZKLA 3C87A 3FKQA 1HM5A 3I8OA 3LRXA 4LTDA 5HPYB 1QLWA 5E6UA 1J0AA 2WV7A 4KQ2A 3GYBA 3RM3A 5A4JA 1U8TA 1QRSA 4ENUA 4QUJA 4JASB 5CM9C 2J67A 5DX0A 1N6OA 5IJXA 1KU0A 2NO7A 1HNZB 4K9MA 1ILEA 1DBIA 4CCSA 1SVOA 3NHRA 4NBTA 3DMFA 5EJ2A 2MINB 1HL7A 3S1AB 1ZAKA 1IUPA 4E4RA 1HMYA 3WLLA 3KB6A 1M6HA 1Q0SA 4GOJA 4BPRA 3UWMA 3OPXA 4XB1A 1LQUA 2ZVPX 1F4LA 4L8YA 1R0LA 4PO1A 3EYAA 1QX4A 4MJLA 4BPBA 4XJVA 1K5PA 5AJYA 5CDSA 2EKDA 4QGBA 2WHQA 1YL5A 3BE8A 1NULA 5FHRA 4HTAA 4JP2A 5KQGA 1HZJA 3C16C 3L7YA 3BWCA 5ESXA 3OPYB 3SJBA 2BI8A 5G0VA 4DA4A 4AECA 1ETUA 1PBNA 1RJEA 1R37A 1YR7A 2OCGA 4IMRA 3QKSB 4FYPA 1QUEA 3KVVA 5CPBA 3WAKA 2OSBA 2R6R1 3O3OB 4H6PA 4HNSA 5IHXA 4O3MA 1MAHA 1AS2A 2F59A 4Q7JB 1UH5A 1QBKC 1SC4A 4RDCA 5AVYA 4ARIA 4NV1A 2C4UA 3HH8A 2RMKA 1JYFA 4G01B 1ANKA 1T5OA 3PDHA 3UXYA 1KEPA 4S1PA 1L7QA 1LY1A 4BBZA 5JD5A 3U3JA 1JZQA 4QC2A 4YCMA 3QGMA 1MOPA 3VVMA 4R8MA 2YV3A 1U4NA 3WYAA 2OZPA 1VSBA 3ITKA 5IPFA 1V26A 4QJ3A 5KOJB 1YAJA 2B5WA 5CYGA 1E0DA 2V9CA 4YALA 2Z3WA 3I39X 1ABEA 1LVGA 3R74A 4EYGA 4TZ6A 1Z13A 3GUUA 1R6DA 2O2YA 3LUDA 1QGAA 2DHQA 3NO4A 2IYWA 1KEZA 1FMFA 4I36A 4IL5A 2QMYA 2UYOA 4H59A 2FWIA 2Q4RA 4RJ2A 2WWVD 3TCXB 1IBLB 5JJIA 1H23A 3CRMA 1UDCA 1XPJA 1J9ZA 4H1HA 5DHSA 4ZT4A 2IXGA 5FTNA 4Z1MD 1OT5A 1Y5MA 4OSOA 2WTNA 3P45A 4XJTA 2R6ZA 2GWHA 3O9VA 2GR9A 3V7WA 2OB2A 1N5DA 2QNIA 1OAAA 2E9SA 2XF2A 2RHRA 3OMWA 1XZ8A 1MCZA 2JKYA 1DKMA 2WSIA 3CCBA 3FBTA 3PFHA 3NHLA 3T35A 3DF9A 1FSPA 2Q07A 3VPHA 4DYDA 3CR8A 4TQGA 1L1EA 2FUG6 4AJ4A 1UOQA 4Q1EA 3KAPA 1UDRA 3TKYA 5FOSA 5BN4B 2W6JD 2UAGA 3RS4A 4M54A 3NJRA 2Y93A 5EAIA 1UFRA 2YFQA 2NZUG 2DBZA 2J5QA 1AGXA 1EB8A 1KI2A 2CXUA 1U7ZA 2JDIA 1OX6A 3QKRA 3RKRA 3WKCA 1FMLA 2QV7A 2IHJA 3AM4A 4KXFB 3VYRB 1Y4UA 5KHLB 2G4VA 2JZNA 5IRCD 3AUKA 2I65A 1EK0A 1XYGA 2VHVA 1L5ZA 2NPIA 2YFHA 3GFQA 3OCVA 3ONNA 1H94A 5AXAA 3GJXC 4NNJA 1W49A 2H9AA 3SZMA 5L8VA 1HG0A 3QEMA 2BSAA 4MUGA 4JEHA 2X3YA 3QUTA 2L82A 2CLMB 2VXCA 2NUTA 3HP7A 4CV2A 4CEIB 3GZJA 2BN4A 5KSZA 5J1SB 1E0JA 3D8TA 3KPWA 2QVXX 3CS3A 3KEOA 3RBAA 5JNTA 3F74A 4JVNA 1GZHB 4BVKA 1F0YA 1XYYA 2BF4A 2M1ZA 3OE7A 1AMOA 4Z4CA 1Z5PA 3LXMA 1NXVA 4QPCA 5EHZA 5AXDA 3OUTA 1Z6AA 2OENG 3N28A 3WK9A 1FNSA 1XLUA 5FLKA 2OQVA 4HN9A 1IAQA 2XE7A 4XDGA 3EOBI 3W9SA 1CZKA 1NKTA 5FA5A 5BURA 1KRHA 3KKEA 1VB5A 3SKVA 3ZDAA 4X61A 3CH6A 2X86A 2GM3A 1QU3A 1R2QA 1IN5A 1RPNA 4IIJB 5KNDA 1WY5A 4B8WA 3ERCA 5CBKA 1GDHA 2FSVA 2QD4A 3D7RA 5AK6A 3ST7A 1C0EA 1HZZC 1YQUA 2ZYUX 2OHJA 3BL8A 1XZMA 2G8LA 3MJFA 2ZI3A 4TMFA 3UVEA 2VL7A 1BFKA 4BJ3A 4C08A 3G9UA 4REQA 1HA3A 2H17A 1XZFA 3GFTA 1LRJA 1HE4A 5HEKA 5FPQA 3VHRA 3X1KA 1PWYE 2AYZA 4HPJB 2C94A 4IQ0A 2QTVA 4KYIB 1EXVA 2GJSA 3PIIA 1ZITA 3DT6A 4DR2B 2NO5A 4EKNB 1BHJA 4J1NA 5IM4A 4J0JA 5IASA 1ZW6A 1S9DA 1PT7A 4J29A 3PR3A 5C8ZA 4W5WA 5GV7A 1SR8A 5TGTA 3ESZA 4XQEA 3SXUA 5GV8A 3NIFB 5G40A 5FQNA 3CUWA 2DHEA 3ZCUA 2O8FB 4BNDA 2CNDA 2W98A 1L7DA 3CVYA 3BIXA 2PJRA 1VOTA 4NDZA 1A9TA 4HGQA 3I05A 5FWXA 4HNTA 5K20A 1G8SA 2X23A 2WKQA 4RV4A 2Z43A 1BQ3A 1Q17A 2B37A 2WJ6A 5DCUA 4F21A 2HXSA 3N2ZB 3GG9A 3VOTA 2CF6A 3OE5A 3X1ZA 2PKQO 1BS9A 1G4UR 3FRJA 4M1TA 1MC5A 1GAEO 1DDOA 3QMVA 4JNKA 1UXHA 1HBJA 1OYYA 3GUVA 5G0TA 4AY3A 4RVHA 5EIHA 3GXOA 1WBJB 1T9BA 1WF6A 2Z9DA 4Q1VA 4ZU6X 3CURA 3U44A 2RGXA 1E32A 3KEMA 1N8NA 4PX3A 3KM0A 4Z49A 3ONFA 5EKTA 3JCZA 3DTVA 4XD7A 2AN1A 1PX2A 3UB2A 3HJCA 1C4XA 1G17A 4QICA 4QOGA 4BNFA 5KAPA 1LRKA 1Q91A 1GGHA 2R0QC 3HBFA 4Q9JA 1OTXA 3EVCA 4E2FA 1BJKA 1X1AA 4BUCA 2VTBB 2JGRA 3NBKA 1R3UA 3FNRA 1C4KA 1XCJA 3PQFA 3EZ6A 4H4DA 5LKAA 5AI4A 1FY2A 5HCNA 2R7KA 3AONB 2OOKA 1TIBA 5KCZA 2DYKA 1VKHA 3GLHA 2WWHA 3VPAA 4ACBA 4IO0A 2ZAIA 3D3NA 4ASUD 3SLRA 3TK1A 2J0SA 4OOEA 1QIKA 1NJ6A 1V45E 3VU0A 5KNDH 3FBWA 4L4RA 3TUJC 3SYTA 3C3WA 2IYPA 2JFQA 3AVUA 1XNHA 1DRWA 2CXSA 2HF7A 3BMCB 1ZGGA 4KXQA 2MYUA 4BCBA 5E3IA 4Z9YA 4CKWB 1F38A 5NLLA 5T4FA 3ZWNA 3IUQA 3R3YA 4G0YA 1FK8A 3P96A 5TPZA 3A9VA 4OMDA 4W7SA 2C92A 3VTKA 2AN4A 3A6KA 3GDFA 4CDMA 4KQCA 3BAZA 1XZPA 2XUAA 1NXWA 3O26A 4MV6A 3WKAA 3NEPX 1I1OA 2ILTA 3PJRA 3H9GA 4J0QA 4UM8B 3BSSA 1YBFA 3U39A 3AIOA 5IABA 2C1ZA 1UANA 2A1IA 1TU3A 1B8VA 1XDWA 2FMIA 2PQ0A 4MKZA 4PC7A 4D46A 5CCEA 3DDHA 5BYBA 2G9UA 1OTHA 1F2UA 2GHQA 4OUKX 4ER5A 4Z4QA 4WUVA 2GZDA 3C5HA 3FTNA 3L8YA 2ZCVA 1T9GR 3T1VA 3LL4A 4J91A 5ABPA 4W5HA 3TZKA 3R5JA 1U3TA 5CA1F 2I2BA 3C39A 3O3CA 1DDIA 2JCBA 5LYJA 3D4BA 3T4PA