1FTGA

Structure of apoflavodoxin: closure of a tyrosine/tryptophan aromatic gate leads to a compact fold
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
168
structure length
168
Chain Sequence
b'KKIGLFYGTQTGKTESVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTWNIGELQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNFQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOFLAVODOXIN
publication title Closure of a tyrosine/tryptophan aromatic gate leads to a compact fold in apo flavodoxin.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
total genus 64
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 1995-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ftgA00
3P0RA 1AKTA 4M0CA 1OBVA 1CZNA 3HLYA 2MTBA 3L9WA 5FUQA 2KQUA 1CZHA 1C7FA 3ESZA 3GAMA 4PTZA 3NFRA 1T0IA 4FX2A 4XDGA 3OJWA 1KBOA 1QHEA 1SQSA 2BF4A 1V4BA 1XT6A 4H6PA 2OHJA 3F6SA 1CZRA 4GQIA 4CETA 1H69A 3K20A 4QOIA 4YAFA 3F2VA 3EYWA 3NHKA 1CZKA 3NHJA 2BMVA 1AHNA 4QOHA 1ZX1A 3W79A 2M6SA 3ES9A 2M6RA 1T5BA 3O73A 1AKVA 3LCMA 2Q9UA 1RLIA 3SVLA 4H2DA 1XI2A 3B6MA 3OJXA 3U7RA 1YOBA 4PTYA 4C0WA 1D04A 2X2OA 1YRHA 1D4AA 1BVYF 1FUEA 1OFVA 2MOKA 2OHHA 5EMNA 3FX2A 4S24A 3GFRA 4C76A 1C7EA 4QOGA 1FLNA 4Y9RA 1DXQA 3FNIA 2Q62A 3R6WA 4HS4A 3JSXA 4LAFA 3W78A 2X2PA 1AKWA 2R97A 4BMPB 1X77A 1AKRA 2BZSA 3GFQA 2FZVA 3S2YA 3TE7A 2FVXA 4ICIA 4DIKA 2Z9DA 3EDOA 2XOEA 4LA4A 2ARKA 1FX1A 2Z98A 2V9CA 1E5DA 2V5UA 1J9ZA 4C0XA 4PU0A 2R96A 2FCRA 1GG5A 4ZVNA 2BPOA 1YCHA 4QOJA 3F6RA 3OX3A 1DX9A 2WC1A 1FLAA 5FA6A 1J9EA 5JROA 2FAXA 3RPEA 4N9QA 5TGZA 4LTNA 3QFCA 2RG1A 2F1OA 3NHSA 1DXOA 5LJLA 6NULA 3F90A 5LVAA 2HPVA 4NLLA 4YAUA 3FW1A 4N82A 2FOXA 4ZVKA 3N39C 2XODA 3KLBA 1TLLA 1KBQA 2QX9A 1FLVA 1SG0A 4GI5A 3NHRA 1D03A 3L9XA 4QOEA 3G5MA 4QODA 1J9GA 4FGJA 2QX8A 3OX2A 1B1CA 2HNAA 1AKQA 3QE2A 2QWXA 2OHIA 3ESXA 1AG9A 2OYSA 5LMCA 1OBOA 3KAQA 1CZUA 3NHPA 3NHWA 3OX1A 3NHUA 4GR9A 4FGLA 5F4BA 1NNI1 4ZVMA 3TZBA 2A5LA 5ULLA 3W77A 1CZOA 2HNBA 1WSBA 1ZWKA 1WSWA 4HEQA 4OXXA 3W7AA 4N65A 4XDHA 3QFRA 1YKGA 3HA2A 4ZVLA 3UXHA 1I1OA 4Y9UA 1XYVA 4Y7CA 2W5UA 3NHLA 2B3DA 2FLVA 5LLDA 1RTTA 3K1YA 4FGKA 1J8QA 3B6IA 1YDGA 3B6KA 3NLLA 5LBTA 3HR4A 1FVXA 2QX4A 1ZWLA 5F12A 3KAPA 4NULA 4DY4A 3OVMA 1AKUA 5A4KA 2QMZA 2FZ5A 3B6JA 2Z9BA 4YAWA 1AZLA 4YAOA 3TEMA 2AMJA 2QR2A 1RCFA 3LT5A 1QR2A 4U7FA 3OWXA 1XYYA 1AMOA 3NHYA 2FX2A 2ZKIA 4QOFA 2BN4A 4D02A 2KLBA 3GFSA 5NLLA 2QMYA 4F8YA 1YCFA 2Z9CA 1YCGA 3D7NA 1CZLA 4LTDA 4YQEA 3N3AC 3KEGA 3FJOA 2MWMA 5EAIA 1F4PA 1TIKA 4C14A 3ESYA 5FX2A 1JA0A 4LTMA 3FVWA 1H66A 5F51A 4BMOB 5B3KA 3N3BC 5BUCA 4J8PA 5B3LA 3NHFA 1VMEA 4R81A 4U7HA 4U7GA 2GSWA 2FDXA 3ZHOA 1RLJA 4ESEA 4DILA 5NULA 1QRDA 3OWHA 2D5IA 4YALA 1FLDA 5LJIA 2MT9A 1JA1A 1BU5A 2N1MA 5LBUA 5EA2A 2V5VA 3UXEA 1FTGA 3O2NA 3U7IA 2QX6A 1QBGA 4CF6A
chains in the Genus database with same CATH superfamily
3CO0S 3A9RA 1OFHA 3S7TA 3TMKA 4V1CI 1R4AA 1KVUA 4MS3A 3D2LA 3DTNA 3D1VA 4IUBS 2R68A 5F2NA 1SB9A 2GDZA 3N8IA 4MUEA 3I6IA 1B8OA 1QFJA 3IE2A 1SO8A 3MD9A 1VG8A 3CNBA 4QYXA 5LR6A 3RADC 3BRWA 4F46A 2NYAA 1SVNA 2ZRHA 3E1GA 2DJIA 5KYVA 4BGVA 4PBRA 4DDUA 1P2DA 2BM1A 3KM0A 3V7YA 2PWBA 1D09A 2NSDA 1H1LB 3P52A 4BNDB 5JTTA 3WSWA 1GQFA 3C3EA 4OLFA 5CBPA 5JJIA 2PD3A 1SXJD 1URPA 3I53A 3PDJA 4WUVA 2G9QA 4JIMA 4J76A 3OM9A 3SZUA 1IXKA 1RAEA 1S8FA 4DLAA 3R23A 3H0CA 4YUAA 5JJBA 4C4OA 4CKBB 4EAAA 1XKTA 1Z22A 4A6DA 4NBNA 2O0LA 4CDRA 4NV3A 2HHJA 1JVSA 4FLFA 3DEJA 1G21A 3OCXA 4V2IA 4GDFA 3IBYA 5CFZA 5JMWA 1UBHS 2QD4A 2ZRDA 4DMHA 4TMXA 2EFHB 3BK1A 4D9BA 1PHRA 1U2RA 5LYJA 3ZC3A 1J2EA 3IT0A 3QKRA 5T6MA 4N47A 4EKEA 1ZCFA 2BZ0A 2C4KA 4G0YA 4RD4A 3N05A 4XB6B 2GYUA 4L07A 4Q6BA 1XTUA 1R6TA 1GU7A 3DFUA 4BX9A 3OQJA 5CG1A 3T1TA 1G8JA 2PK3A 4X65B 4AI6A 2LRHA 4ZQFA 5LLTA 1PFKA 2HU7A 3QMWA 3UATA 2QS9A 4WESA 4RJLA 4Q9NA 4QO8A 4TTTS 3GHHA 4BDSA 4OHYA 2C4NA 5CXSA 3EXHA 4HGZA 1P1RA 3TQQA 4XWYA 1QVVA 1CB7A 4ETIA 5JYCA 4C6HA 1NTOA 3MLAA 4YP1A 1NVEA 3LYHA 5FL7A 5ELLA 3AHEA 3EYWA 3IRVA 2FFRA 3F3YA 5BQOA 5B2ZA 3EHDA 5KAPA 5AESA 1SY7A 1L8OA 3N07A 4O4HF 1HR0B 3VKGA 1KZ6A 5I7UA 3NHJA 4LRTB 3F4KA 1W44A 5FIUA 1HI9A 4RGVA 5FLXA 3DC7A 2XTNA 4PHGA 4CDMA 3OCUA 3TL3A 4B7UA 4L78A 2OC9A 4CMHA 2RBKA 5LZ7A 1LPOA 4GS5A 1AUPA 1KGDA 2VYND 1J0CA 2M6SA 3WX0A 1IRXA 1QIJA 1QHGA 4IFTA 2O8BB 4PG5A 1U8TA 3LSTA 3S4YA 4KX5A 3U9SA 2JGLA 1W5EA 3FUUA 5AVZA 5KNBD 1RQXA 4WOCA 2PLNA 3A1VA 1W9HA 2J6HA 3VYTB 1E8MA 1H8HA 4L8LA 4F85A 4F9GA 2L42A 5AW0A 1UM9A 2PMCA 2QLBA 3V8QA 4AJEA 2V6GA 3M1IA 1P9RA 1QHHA 1YV9A 1X8JA 2V6JA 2X2OA 4UREA 3WI7A 1K6JA 1T1GA 1GPH1 3BE4A 4ARVA 1T1JA 9LDBA 2HK8A 1D2RA 4JBGA 3JAMA 3Q7QA 2EBWA 4N48A 1E60A 3DZKA 3K8OE 4MB6A 1CWUA 2QRKA 5FFFA 1CQXA 1UK9A 4GEKA 4I9UA 4GKJB 1ZUNA 4IVNA 3PEUA 3AJEA 3QEMB 3FNIA 5HQ3A 4C29A 5K7SA 3AUAA 2ZWIA 4UQOA 2G76A 3RVKA 3ZX4A 4LAFA 4MVCA 4IOLA 1T5HX 4G1MB 4NATA 4MOWA 4AMUA 1GL7A 1NSFA 4RNDB 1A5TA 1G8AA 2ZRLA 3QXGA 4KLNA 1NX6A 4ND1A 5F1KA 4EW2A 3PXEA 4Z7OB 4LWQA 2FGJA 3DNPA 3V2HA 5ABPA 4DR6B 1C4KA 4ZOBA 4Z9AA 2W4QA 4CTOA 3NRCA 4Q03A 3VR5D 5ED4A 1OH8A 2JAUA 1EWTA 3HH8A 5A9SB 5JCOA 4DL9A 2W37A 2FDRA 3EXIB 4JT2A 3L4JA 3OF2A 4WLFA 1Z08A 1ULZA 2YHSA 3L7KA 3QW2A 4OP2A 1TK3A 3THXA 2HWYA 3AIOA 1TCUA 5KWIA 3TO5A 3ZDFA 4E2FA 4WOPA 4P5PA 4JJKA 1PKEA 1ADBA 1JIQA 2XUZA 3E9ZA 4KSYA 2O4CA 5J1SB 3SQWA 2XUFA 3PG5A 5LOVB 4TV9F 1LDNA 4M99A 1Y6ZA 4GVLA 4B3RB 2P9FA 3I52A 5FWYA 1PW5A 5I47A 3PLRA 5IHPA 2OBBA 2CDBA 1HMPA 4QGBA 4UBOA 1WETA 2PX4A 3T9FA 3F6RA 2H1IA 3QV2A 5DSXA 5EP4A 3JYLA 3IERA 3DE6X 3FVRA 1YL7A 3QFSA 4G0WA 3IAAA 4MULA 3CFYA 5AI6A 2BZ1A 2PGXA 3WK4A 5CD1A 1JN0A 2AJLI 2PTHA 4OQNA 4LCBA 1DWPA 2AHOA 2DUNA 1FRNA 5BORA 2V1UA 1KORA 4BNMA 1M54A 1LX7A 2C9MA 3E23A 3IA2A 2F1OA 3N0XA 3KU4A 2YZ7A 2VDWB 1M2HA 1ULUA 2WM3A 4L76A 4I4LA 2PMBA 5SZIA 5JZ9A 1M76A 3TLKA 4DGSA 2O48X 2AG6A 2Q0QA 3GVXA 5ECYA 1QGAA 4ZCIA 3K4QA 2H7CA 2H48A 2VK8A 1NASA 1F38A 2WYOA 4D9EA 4DMRA 4ZZ1A 4HCJA 2WE7A 3SJUA 4E13A 2QN9A 2HJGA 3QA9A 4KO8A 5DMXA 5F7JA 2DTXA 2PWYA 2DP4E 1Y5MA 1EINA 2W22A 4N7RA 3VDXA 2W6PA 5K6RA 4PX2A 1N1GA 1UBGA 5TF0A 5DSTA 3SZGA 1RKVA 3BB3A 2ZU0C 3LXMA 3NEJA 4XFDA 2MHCA 5EUBA 4TOIA 5TEVA 3WL5A 2P4HX 4DG8A 4BO5A 4D0NA 2R62A 2FOLA 4XM0A 5TT0A 2A9OA 3EFEA 4IGIA 4QPCA 3RASA 2C2OA 3L0YA 3M6FA 2CVFA 3OQIA 1RC1A 2CYAA 5EKTA 1NVBA 4LXGA 4E0BA 2ZJFA 1MQ9A 1VM6A 1W85A 1DE0A 4K28A 1HE5A 1U8YA 1KP9A 2B5OA 2V58A 3D3EA 5AUNB 5TARA 2WUGA 4UTXA 3THYA 3FGOA 2W2MA 4LYDA 3SS8A 3OZCA 1Y98A 4MIEA 2GXAA 4XGKA 3WGIA 1EYZA 2FX5A 2XXJA 3PF9A 2O8EA 3IA7A 1E6UA 3KDPA 5EZ6B 1EFCA 1R0KA 4RMNA 5CNIA 3U0VA 4BVLA 2QW0X 1WUKS 3GEEA 3P9IA 3A58B 1XLTA 4AG3A 5ALDA 1SUFA 2HTFA 3FLBA 1IDOA 3ACCA 3H3JA 1FFXB 2EX1A 4HBZA 2R8ZA 3V9AA 3ZI4A 1GGFA 4F4JA 4ZQGA 4CUJA 5JHGB 1WSDA 3UGJA 4FWTA 3P2OA 1YNSA 5EE9A 5I3CA 2ZIAA 4CRWB 5F64A 2B21A 1VMKA 1MA0A 2JW5A 5IK2A 3HZZA 3TKLA 3RBXA 5HR5A 2OOKA 3IHKA 3LPMA 3L46A 1E2GA 2JRLA 1IOZA 1E9DA 5FNVF 5H3LA 3G2MA 1LJ8A 1M8FA 1O95A 4LSMA 2XHZA 4TN5A 2OORA 3EVDA 1WF3A 5COAA 4HZUB 5JZBA 3C5EA 1XTQA 4FLEA 3SEZA 4HQNA 2IOFA 2BFDB 3MGCA 3VR1A 1J5EB 4BN4A 3AR4A 4ZAFA 3VPDA 1IEXA 3T1HB 2Y27A 1OX5A 2R7NA 2YFKA 2GB4A 3R3ZA 4BN0A 1PEAA 3U3KA 3F47A 1W1UA 5CLGA 5E6SA 4DA0A 1FFHA 3ODGA 1JUDA 3IKJA 3HDGA 1BXGA 2YZNA 1H0HA 4MS1B 1CHNA 2GEJA 5FCDA 3UPDA 4BXOA 2NM0A 5BMVA 3ZHYA 5CDHA 2HCFA 5JSUA 3TG8A 1S3GA 3AUTA 4WN9A 1VRCA 2JGFA 2WD8A 3CTPA 2XQJA 3FUTA 2P35A 1II9A 2A5JA 4JJ6A 4LE0A 4RKYA 2KSQA 3HFGA 4V0NA 1QYXA 3RUHA 1G8FA 2J5BA 3K0BA 4MAAA 2O7NA 3AY7A 4XGRA 3V4ZA 3ZW7A 3OLZA 5HJ7A 1S1MA 1SVOA 1MRZA 1ULBA 1NP3A 4DA6A 3EGWA 5DE3A 4FI3F 3TRKA 2RG7A 1E62A 5EXDA 4P9NA 4ZVLA 5HPYB 1TADA 3ESRA 3O91A 1RS0A 4YAGA 5K4HA 5DOVA 1B2LA 1U28A 4LGMA 5IWAB 2B3DA 1J2YA 1UJ4A 3EEQA 3UT5B 2PFGA 1Z06A 2W2NA 1OI7A 1TO6A 1GGKA 1X8LA 4DM7A 3LPCA 4B3MB 5HCUA 5EJ9A 1TM7E 3TH5A 1QFMA 2P8JA 3DC2A 4F2GA 2B5VA 3ZJTA 2YW2A 4W6ZA 2I6QA 3DONA 4QUGA 5AM2A 1H0KA 1RMYA 1WRBA 2PANA 4JMLA 4DLWA 3MA0A 2EWWA 1HQCA 3EIFA 4E1AA 5BNZA 3RSLA 2JVIA 5ELMA 4EITA 4ZDIA 1M5RA 2R6FA 1SQ0A 2PSSA 3HJCA 2XCIA 3JQ8A 4TWIA 2EQBA 4XYGA 1EFPB 1UXOA 2IYTA 1RM0A 4B6RA 2EJTA 3PGVA 2WKRA 1FYXA 3EW7A 4YUXA 2VPIA 3E8XA 2A35A 4NPHA 3QKWA 1Z68A 3CLTD 1N2SA 2EC5A 4HDSB 5JTUA 3S8EA 4P4SB 1WF6A 1GPNA 1M0SA 1UBFA 2QE7A 2AUNA 1HURA 2LD4A 3OVMA 2QUJA 4TKUA 1OKKA 3TJMA 5B6IA 1J49A 3V8NA 4HOYA 3KJZA 4N39A 2H2IA 5CLIA 3T3OA 1CBUA 3CHYA 4GX2A 2CHEA 4MH0R 4RIGA 4L8YA 2IIBA 2II6A 2ZB3A 4D3FA 3DP9A 4ENPA 1QK3A 3A6EA 4MTCA 4R2IA 3HCBA 1GRRA 1NT2A 3RF6A 4OSEA 1Y81A 4O1IA 1ZICA 1G291 1YZLA 4D4GA 1XZPA 4CEIA 4P4GA 5DN6A 5A6SA 5FLKA 3ERCA 4GMXA 3KYJB 4FR0A 4R5MA 2QRUA 4NVRA 3BWMA 3DOOA 1ZI8A 1EE1A 4KACA 2C92A 2X5JO 2R5FA 2DFLA 4OG2A 5L4LA 2XHEA 4N3NA 3NTQA 1HKHA 4RESA 3ZS9A 5JNLA 4CNQA 1J2RA 4WPGA 3PDIA 4POAA 2G1KA 5L3RA 2VPWA 2JD0A 4D96A 2AC4A 4ZREA 4X85A 1SKAA 1GZVA 1Q11A 3I6YA 2RH8A 1GYPA 1JQ3A 3EZ7A 4PYNA 4YUWA 3OZDA 3OPYA 2GM9A 1NKVA 2AXQA 4QELA 2Q5EA 2ZB4A 3B60A 3C48A 1KOGA 1JU3A 5FORA 3V3KA 3A0RB 3L8GA 4MICA 2JDIA 2GM4A 3V8RA 3ETEA 2GFQA 1JSXA 3T41A 4AKGA 1XK7A 1L6RA 1VXRA 1CQPA 2AF4C 5ITWA 2F3TA 2HBZA 3DWEX 2XVXA 1MABA 4Q9HA 2I6TA 3KVVA 1ECBA 1USGA 1A1VA 4Q66C 1HH4A 1HQYE 1JAXA 1NOKA 2C20A 2BLLA 2FU5C 1RE1A 3DL2A 2M6LA 2NUTB 4EARA 5LXTA 4F93B 2ZG6A 1XZLA 3M6AA 2W93A 2C9CA 2NV0A 4UZFA 4PC7A 2QMUA 2YC2C 2AZDA 3KJHA 4MYSA 4XJTA 5EE1A 1J09A 3NWPA 3VISA 3NKVA 4DNQA 4MQ5A 1T2EA 1Z18A 1X14A 5IJZA 3MMZA 3IVAA 3OHSX 2CVHA 5BUCA 3ECSA 1DTWB 1Q3KA 1QK4A 3T1QA 2YUTA 5EIAA 1P81A 5C8YF 3A3YA 5K0GA 5I4CA 1ZI9A 3FKSA 3RHSA 3D8NA 4FE7A 4TVKA 3PFWO 2ZR8A 4P4TA 4RY8A 1VKZA 5DBGA 3K31A 3AFMA 3SIWA 1KSFX 1RXCA 5TJ9A 1Q14A 5IH7A 4KZPA 2PCLA 1XXHB 2VSXA 4II2A 5T41A 4L74A 2IS1A 4KQXA 1H0RA 5BN3A 2AMFA 1R4NA 4KI0A 4RF5A 5G3YA 3ROQA 3WP0A 3R5KA 1XAGA 2YVUA 4QTZA 2H8GA 2ZJZA 3W9UA 2YIDA 3O38A 3KR9A 1KDVA 4OFBA 5HTKA 4BEBA 1QGUB 1LLFA 4BNUA 1O5IA 1I7PA 3LKVA 2OCGA 5BPHA 4CM5A 4KR9A 3GL9A 3K5HA 5IFKA 4P0PB 1GUBA 1G42A 1ZVQA 3AYZB 4GDMA 4KLCA 4ZOLF 5D1NA 3M5WA 3L49A 1YIAA 1CUVA 1M74A 5LBUA 1CQJB 2FSVC 4ZIRA 5H16A 1YZKA 3CR8A 3G2PA 1TKAA 1M1YB 2ZPTX 3NYWA 4GYJA 1BHJA 2B4TO 4D80A 1LLCA 1FTGA 1SCQA 4YYZA 1N2IA 1RI1A 3BRWD 3PITA 3NBYC 4I1YA 5DGDA 4NR0A 4CTJA 4HN4B 4MAMA 2XMCA 3HVIA 3RIEA 1VHJA 5B7GA 5CDSA 1ILEA 3PFHA 2LVBA 5IJ9B 6GPBA 3KL4A 5D7NA 4UM5A 1PZHA 4RAOA 4OGLA 2HWWA 4MVJE 4KNVA 3SYNA 2XA1A 4UE2A 5FAXA 4YRRA 2WSBA 4UDNA 4DR3B 1T2FA 3GROA 1WP9A 4PHFA 1JVNA 3ASZA 3HCPA 5ERYA 1VBMA 3RC8A 3TDKA 4ZP1A 4QPDA 1OBFO 2DECA 2DSTA 3M82A 3LX5A 5AVSA 3O03A 2J85A 3RKSA 1B23P 4QSMA 3INYA 2QRNA 3AFOA 2WWXA 4B46A 1X1AA 3DOJA 4R2LA 4W5OA 2C9YA 3SE7A 3KV3O 3HDQA 1L3IA 3MS2A 1IWBB 3QELA 3SJ7A 3H0KA 1EIWA 1FMFA 3IDSA 2PAFA 3JQ6A 3AV3A 2IDJA 2WJ6A 3GPCA 4CQJA 3ZLJA 4BX0A 4J7AA 4KYUA 4JOCA 4XQGA 1UZMA 4N5IX 4M7WA 3OEHA 1T5IA 4JNCA 2EOAA 4UE3S 4FX2A 3HKDA 2RJOA 1ABEA 1U8ZA 4Y0AA 2WHRA 1GNRA 4MR9B 4NOMA 1CJUC 1TJ3A 1ZRSA 2JC3A 5CTAA 3IE1A 1S3SA 3B78A 3OIFA 3OTIA 1Z5GA 4FGZA 3RV3A 5HW0A 1MFZA 1QVZA 4HWPA 1E1DA 4FE4A 3E53A 5KTRA 1JEAA 2KS6A 4BRZA 5DBIA 3DTVB 1P0PA 4PIVA 1OV4A 1UOPA 3KUCA 5FL7D 5JSKA 1XLUA 5AIAA 4WASA 2G17A 1J5XA 2MMCA 3DB2A 4GOMD 4IX9A 4B83A 1Z0SA 1JBEA 2FPRA 1ZFNA 3GQBA 2HJVA 3UK7A 1BGWA 3INGA 1NQVA 2A1UA 2OHFA 3NFYA 5G4LA 4H35A 4WW0A 3G9UA 1DOZA 4TUYB 1W30A 4H6PA 3SFVA 4BO3A 4GPZA 4C7JA 4KRFA 4ZAWA 1M73E 2XUHA 1XFAA 3KQKA 1HV8A 2GPSA 3HKEA 4NFYA 2NU6A 5GAJA 5BXQC 4YAFA 3RO7A 5IVPA 2FG5A 2XB2A 4R1NA 1OXMA 2V55B 3IYLW 3UQYS 4IPTA 4HVLA 4UPVA 4OQEA 5IKMA 2UU9B 1G5IA 1O8CA 2I4IA 1O0BA 2Y1GA 1N9GA 1SIOA 2A7QA 5LQRA 1H8HD 2YY6A 3DMYA 5D3MA 5IYZF 2UYQA 3ZWWA 1W4CA 4QM7A 3CN7A 2Y6UA 1JILA 3E0QA 3ROPA 3UMSA 4REMA 2RHWA 3UK2A 1YI0A 1SCBA 1F2TA 2DU8A 2V7GA 3E3OA 1UJNA 1AD2A 1I24A 5TMEA 2C96A 1UKVY 4FDMA 1MNQA 2A0KA 2DR2A 1H2FA 2VP6A 2W6ZA 1E5LA 3H4MA 4C89A 2UUAB 1U0JA 1S7GA 2JVKA 3RIGA 1EGQA 2H1VA 4F5WA 4BKOA 2D2XA 1D4ZA 3EBLA 4ZI5A 5AR1A 1JMKC 1CUHA 1MQ8B 2PBLA 3HO8A 3M6WA 2EQ5A 1L4NA 5B1DA 1YJ8A 3ZWOA 4MHOA 3HM9A 3HVRA 3JQ7A 3PJRA 4PZPA 1XPUA 4FBMA 4E30A 4RS4A 2ZDGA 2F3SA 2WU4A 5H82A 4TKLA 2ZUWA 2N47A 1SBYA 3ELYA 4R8MA 1FDIA 4PZUA 3PC7A 3W2IA 4TMWA 3ZQUA 5HM6A 2W8ZA 3N2KA 1EE2A 3GZ4A 2Q6LA 2P3QA 3PRJA 4I1OA 3ZTWA 3B5IA 5IAOA 1G60A 2AN9A 4LY9A 3T15A 4Y9RA 5KTNA 1X7XA 2QV7A 4B32A 5JV5A 4B6JA 2AZTA 3OQHA 1AGRA 1N0IA 5DK4A 2VAPA 4Q4HA 2C4VA 3R6LA 4HGQA 2DY0A 3K2QA 2GBLA 4Y1EA 4WKNA 1G0OA 1FYVA 2GEVA 2PEZA 3A9SA 3CZPA 3HHEA 3SDBA 4BGDA 1QO0A 1AKRA 1XQ1A 3CBQA 4HX2A 4QJIA 3SKVA 1R3UA 4MGKR 3FYDA 2JS7A 3DZJA 2OLJA 1ACMA 2W6MA 1QIDA 1C0KA 4J91A 2G07A 1R8XA 2PYZA 4X6UA 3AHHA 3P0JA 3FOWA 2Z2XA 4CQMD 4V2UA 1EB9A 4DEXA 2H57A 5A4JA 9MHTA 2GESA 4A0RA 5ENDA 1NJ8A 4O4JB 4UVEA 5KVVA 4R1UA 5E9JA 1JIKA 2Q4TA 1Q1AA 2BKEA 3BRSA 2RGRA 2JLXA 2X7XA 3T54A 4LQCA 3UHOA 2IZZA 1ZG3A 3PGJA 1WMDA 2P6NA 3RRJA 1PS8A 1DRVA 1RXWA 2DTDA 5F5XA 3RIHA 1OA0A 3L06A 3UF0A 4D25A 4ZARA 1Z6XA 2Y1DA 2WHPB 1APBA 1GKLA 3MTGA 3B1ZA 1HZZA 4CM8B 2WK1A 1C1XB 1OFUA 1T0JB 2OTCA 1KMIY 1DC5A 3ZEIA 4G4SP 3IEIA 4HTFA 1VSBA 1MV8A 1FNNA 4LK3A 3H9EO 5CEJA 2VNJA 2GBLC 1Z6QA 4P8RA 2V4ZA 4CUKA 4ND8B 1JKJA 1Z45A 1VLHA 1CERA 4FP9A 3HYCA 3QBDA 2G40A 4G09A 4LYJA 1PX2A 5M34A 4GI7A 3TLZA 3HB9A 3WIOA 4BNJA 4CV3A 5KNLA 3EZFA 4O02B 1Q44A 3LX4A 5KUTA 5EJ8A 4ZOCA 1F6BA 5DWDA 1IWOA 5JZVA 1MDFA 2KYRA 4TXLA 4EABA 2NXNA 2QAGB 3SIPA 3ZVKA 1RCUA 3TGPA 1FB5A 3V34A 3U44A 1QBKC 1B0ZA 3TQOA 3IB3A 3FB1A 4EBFA 3EUWA 2HM7A 3T7CA 1IM2A 3CLSC 3EZ2A 3FAZA 3I2GA 4HMOA 3T7SA 2CMKA 4HRXA 4YCLA 4UULA 1H94A 3D2CA 3DOUA 4K88A 4Q9AA 3W3AH 2RGEA 5DCUA 1KRWA 4RZSA 5DP1A 1YTUA 3ZVMA 1CUBA 1U0HC 4RUKA 4LFCB 2HSZA 3LIPA 3F1KA 1XU7A 4CM9A 2XGSA 2RGGA 2PVPA 2GD2A 1I1NA 1EVQA 4Z99A 4DUPA 4LSWA 2H85A 5J4YA 3QEJA 4CYMA 3UV7A 4ZVSA 2W42A 2PH3A 4Z2AA 5CH8A 1YZHA 3MTAA 4YGXB 2EL7A 4RPGA 3LF2A 2H11A 3DT6A 3RBZA 2WYVA 1NVVR 5HK8A 1EFKA 4FHZA 3W05A 3VXKA 4U5QA 2Q4EA 3WJAA 3AUSA 1T8YA 1Q0LA 2OC4A 1IWPB 3E5HA 5IK2D 4M88A 3W9YA 1D4OA 3T5TA 1E63A 1VBFA 3HJRA 4R4JA 2VAXA 4ZCPA 5ERXA 5K3BA 4YRNA 1O95D 1US8A 2O8FA 4QODA 3G1WA 3M3DA 5AVJA 1DHRA 3ZCTA 1CY4A 3BWCA 1ZH8A 3CE9A 3O5AA 2ANBA 2HNAA 3HABA 4HAZA 2GCEA 2IF0A 4PZLA 4I5GA 1XMJA 2QG6A 3IVCA 5JMOA 2J9FB 3EQZA 2E4UA 3R1IA 4RS3A 3VNRA 1T4MA 2VT6A 3DE2X 3G8BA 4KFSA 4D9FA 1GQ2A 1P18A 3DE4X 3OIVA 4MWDA 2OYSA 4Y1RA 3WQRA 3G0HA 1SOMA 3T1OA 2QYSA 3EBPA 1RXVA 3D6JA 4AO6A 5BQXA 3LC7O 5EZYB 1C50A 1B2RA 2HPZA 4LJKA 2OBYA 4JJ8A 1RD4A 4C5CA 1MW9X 4I6JA 2R2GA 3NHWA 1Z16A 3TSWA 2XD9A 4JLAA 1PZFA 2QD2A 3BSFA 4W1PA 1PP4A 1R0RE 4NCAA 3UJ9A 4K6KA 5J5VA 2IYLD 1L7MA 4ID9A 1TAQA 3SX2A 1C0IA 4IDGA 4DMGA 1SQ5A 1GZ4A 4FGLA 4K9OA 3AF5A 4ZEOA 3TKAA 4K6OA 4D3YA 3JATA 4OXNA 2JI8A 4NABA 3IT2A 4G3XA 3I9LA 2JI4A 1R00A 1U90A 1XDSA 1UKBA 3PDCA 2FF5A 2ID8A 3GDFA 2FSFA 2P11A 4R41A 1ZLXA 5DIFA 4G5HA 4F9EA 3ZHQA 1XXLA 1BCSB 1MLDA 3MCUA 2I2FA 2O8CA 3DDCA 3I5MA 4Q1FA 5JECA 1Z3IX 4ARUA 1X7ZB 2X0NA 3WWOA 3MQFA 2Y1CA 1FFBA 4EOGA 1QXSA 2AXPA 2ZUUA 5JADA 2BGWA 3KV1A 2JFFA 5DV9A 4LJSA 1N77A 1UUFA 3W7AA 4BEVA 1L5RA 1KARA 2UVPB 3EGOA 4Q6WA 4R1TA 1UDAA 2GF2A 1J7KA 3TXYA 4QQKA 4RU1A 2DPYA 2VWPA 4EI9A 5L4SA 1LQ2A 3GMSA 3ICVA 3TW8B 2DRIA 1V8PA 2KX7A 2OWEA 5JMTA 4HDCA 2YJTD 1MP0A 1NX9A 4M0DA 4UM8B 4HNVA 1R4MA 4DAEA 1WMFA 1RT9A 4FSDA 3VNVA 2VJDA 3RVSA 5K6AA 1XZKA 1WEKA 4YECA 2HADA 1LPSA 2G83A 5LLDA 1PSWA 5FWXB 2X9VA 2YMPA 3BFKA 1D2GA 2FHPA 5K3FA 3FOFC 1KZ9A 1H6AA 4DQUA 2Y2VA 4PLWA 5JE8A 221PA 3OZFA 1U3GA 2E4AA 3WFZA 4LYAA 5DRYA 2FUEA 4AIIA 5LUAA 5J4VA 3N2NA 3BH6A 3TXAA 2P9BA 5ILGA 5ADWA 3NBAA 4O33A 2G77B 4RIHA 3O4FA 1XD9A 5E8RA 3UJPA 3TZLA 2QE7D 1NG9A 1QK5A 4OGGA 1GILA 3IPLA 1X87A 5EVJA 1OKKD 4QYSA 4CKEA 4PC6A 6REQA 4BASA 3TNDA 3MLEA 3HWWA 2CSUA 2WQZA 4J16A 3G13A 4UMEA 2WVGA 5DGTA 4ENQA 3BMCB 3AW9A 2Y1FA 4FPXA 1HDRA 2G5GX 4JD5A 3FFBA 3N9IA 1ZBQA 2AFIB 3EN0A 3WTCA 5FA5A 4F3KA 4ZMSA 1FL9A 2VP9A 3AINA 4NULA 4HEHA 4HT3B 4TVOA 2JJ2A 1OGYA 3MCAA 2O54A 1QDUA 1JSRA 2GJKA 4TXHA 3LWBA 3RREA 1RJEA 1KPGA 2RAFA 3B7PA 2ID4A 3H5IA 4EB6A 5JVDB 1OPRA 2Z58A 1Q6YA 1F12A 3CRNA 3F0TA 3FPGA 3R6GA 1TDJA 2Z9BA 3U7FB 1JQLB 1XTZA 2I7VA 5BN4B 3T94A 3ACDA 1R8SA 1Q1EA 1REQB 3ZZMA 1B0UA 3QEKA 3OKFA 4YQFA 2CLMB 3HBJA 3JZMA 2ZB7A 3WV4A 2NTEA 4K9KA 2O57A 1K1EA 5ALXA 3FI9A 4C4PA 1NXXA 621PA 3QXXA 1I4DD 2C29D 1EAMA 1L8QA 4GP7A 4MRMA 4ZAYA 4S1NA 4CODB 1BKDR 4NTZA 5IVKA 1M2VA 1EAYA 1SBCA 4LZZA 1C80A 2Y0CA 1KMHA 3H6HA 3ZDBA 4W1SA 1N0UA 3FF1A 3TSCA 2QNRA 4TYMA 4D02A 2QORA 4R8KA 1Z4IA 1RWNA 2GNAA 3W5HA 3UGQA 1D6MA 1UOEA 1W94A 4WJZA 2C84A 5JYDA 1I4WA 4P4UA 2CXTA 1PZXA 3KQVA 3FCUB 1U02A 1JQ5A 5AOCA 4BP3A 3WGTA 5TPZA 3WLNA 2WB2A 3CVXA 2WUFA 1TM5E 3CCCA 4EPXA 3GLHE 5U1PA 5CD9A 5CFQA 2HJRA 2Q3CA 3CEMA 1E3DA 2D06A 3T7DA 3JZFA 3CJQA 1F8UA 2ATIA 4BQSA 5I7WA 4I50F 5JAUA 1P3DA 2MCFA 3WWZA 5JXGA 1DAOA 4UEOA 4MA0A 1CQIA 3FKSD 2AFVA 2PKQP 1V4VA 3EEYA 4QGAA 1NW4A 4TWBA 1NF2A 4ACAA 5DM1A 4RETA 2W6OA 4NECA 5LKAA 1IQUA 1MJGM 3C3YA 4UUOA 5HUHA 4NWIA 5JHHB 4BQNA 3TZ6A 1Z4OA 1N5RA 1N78A 1HUQA 4XB1A 1RP1A 2GHQA 3ER6A 3CVJA 5DM4A 4JLOA 5TVGA 3SIRA 2BBTA 3LQ1A 3M34A 3TINA 5AUPB 5K8UA 5FI3A 1E66A 2WJ3A 2VJNA 3B9BA 4JJZA 5HWSA 5FI1B 3QU9A 5HFJA 3ZLVA 4ESHA 4AROA 4QVKA 1I6KA 1QYVA 4J0QA 4PCVA 1IHOA 2P3SA 1T1IA 1FPQA 4E3WA 3X2SA 2JIBA 4EX6A 3ZHSA 4OL9A 4L7VA 1KEKA 3MFYA 1J99A 5FHQA 3K96A 2CLSA 2C2HA 1HT1E 3JWJA 4N3GA 2YWGA 4A91A 3Q10A 2IYYA 4QUAA 4O8CA 2GPTA 3KXPA 5HGJA 1GD1O 2BKAA 2CXPA 3E82A 5KVQA 4I7EA 5CLQA 2AG5A 2F59A 5NULA 4F3NA 5J4HA 5EKXA 3WB0A 1F2DA 2VT2A 2ZJ7A 1HFKA 3S68A 4BJ1A 2FQXA 4M1TA 4QDTA 4A23A 1JHOA 3KU1A 1FTSA 3F96A 4AC9A 5IF9A 5IM4F 2B4AA 2VJLA 2YWEA 3LVRE 5AQEA 4MB2A 4EA7A 1WXFA 2GHTA 2RGAA 3TUJC 5B1YA 2HU2A 4BNGA 2WT8A 4DVGA 4R3UC 2IKQA 5E7IA 1F4LA 3LXXA 3O4RA 1AQLA 2I8LA 2QTCA 4IXNA 3G8YA 3GVCA 3Q1LA 5FPPA 4DXDA 1XKQA 4JI3B 4MI3A 3EX7C 1Y7TA 3C24A 3DE7X 3G7UA 3EPJA 3WNVA 2D62A 2JAXA 3I01M 2WWIA 2DAPA 3U9TA 2OAP1 1XPRA 3PPWA 3W5SA 3L1UA 3VI4B 4YNBA 3CH4B 1HA3A 2ZYAA 2V7WA 1UMCA 3N76A 3NOQA 3DWFA 3K9CA 3QKTA 3TKYA 1YXMA 3GFGA 3A9VA 2Y76A 2FX3A 4ZZIA 5KB3A 4JLUA 3AIMA 4BLSA 3U6KA 2OXCA 3MSXA 4J29A 3N53A 1XNQB 2E7ZA 4YRDA 1U0RA 3OCJA 1OXSC 3OEHD 4IMIB 5AHOA 1NI4A 1A7UA 5L4NA 1E2IA 5KMGB 3V3TA 3PR3A 1G19A 1WSAA 1CY7A 2SCUB 3AEQA 1KY2A 3A6DA 1ZN8A 1I36A 1SOUA 2J0VA 1X7GA 3S81A 5EP2A 2JATA 3BD7A 3ESAA 4LXTA 3CKYA 4IRUB 4IQGA 4EJSA 1R0YA 3LUDA 4GSYA 5ALIA 5B3JA 5LD2C 3WRXA 3ODPA 4QDKA 1U0LA 1VYHA 4DCVA 1YT5A 4X62B 4MVJP 1Y3HA 1IBMB 1RPJA 3A4VA 4I4TA 1LBEA 3GXBA 4QGGA 4RZXA 4EK9A 3QUCA 5BR7A 1WZIA 1Z8HA 2C07A 2I2XB 2GEKA 5CM9C 1AV6A 4Z3KA 3JR3A 3TQRA 3DZDA 3K1AB 4BLQA 1C3LA 3X1WA 1RQ2A 5EWJB 3GMIA 3LT0A 4JL8A 3AQIA 3USCS 3R20A 2IH4A 4DLYA 2EZ4A 1GCUA 4UUNA 3ORFA 4B47A 4WBNB 5C32A 4KVFA 5BNWA 4HUQA 3K2EA 2E4VA 4ZAZA 3TQTA 3AV0B 2DUJA 3PQEA 1NF3A 2DCMA 1X80B 3K0FB 1PSZA 1NAHA 1YDWA 1Y3IA 2E87A 2ID7A 3NU1A 1UFOA 2LP4Y 3JQAA 2NN3C 3MC1A 2JLAA 4IRXA 4HVTA 4TMFA 4TTSA 1MX5A 1RU3A 2P6PA 1OAOC 2PZBA 4YMSA 3T7RA 3C3DA 1V71A 3CH6A 2IEDA 9ABPA 3EVGA 2O2HA 3E61A 2JGRA 3EVAA 3NAMA 1JI3A 2FMHA 1WO8A 3N7AA 3QYJA 1RJFA 2A3NA 2EJWA 3KYDA 1B74A 2ZYVX 4JBIA 4EF4A 4R69A 5KSZA 3TIIA 1G8PA 3ZY4A 2ADFA 2ENWA 3U7GA 1K4KA 2YYSA 1S9HA 3ONWA 2CB9A 2J0SA 3MIIA 4P3OA 3BPSA 1P17A 1QIMA 4DEYA 2FFHA 2GMWA 1P4SA 2A0YA 5EJ6A 4CFYA 1TMOA 3SKYA 2C31A 1QDLB 5BNIA 1GTMA 3CRRA 3RU7A 2CJFA 3BS4A 4RH1A 3T3MB 2DQKA 2UZ1A 5EHGA 1OLOA 1OT3A 2IHKA 4C0BA 4CF7A 3BB1A 4XOUA 4ZVPA 3H05A 4QJ3A 5ALKA 4JJEA 5AKYA 1R0LA 1U0TA 1M2EA 3OLXA 4JLPA 1UWVA 2OV4A 2AOXA 3C4VA 5KTOA 2W11A 4KE7A 3LA6A 5F3RA 1PR4A 5FYQA 5HBGA 5D3ZA 4NEQA 4CLHA 3SHTA 3OZWA 4RJIA 1V1RB 1Z34A 8ADHA 4HTAA 4NZNA 1F0PA 2O2CA 4C0WA 4DLZA 1VIDA 1QRSA 2W48A 3D59A 1BE1A 1S0UA 1RWPA 3BZWA 4DA9A 2O2JA 3A6HA 4KIWA 3Q3EA 4R9NA 3ICEA 1SCUB 1QJ4A 3N8KA 4UCFA 2NSLA 1Z12A 1CTQA 4NJMA 4HRAA 4RVFA 3Q11A 1KVQA 1QGZA 3K5IA 4GR4A 3WSTA 2K6GA 3TWOA 4PLYA 5HP4A 2FPUA 3OPNA 1N4DA 1T2VA 3P9YA 3ADCA 1OROA 4E07A 4AMBA 3SIXA 3ROMA 4INAA 1CVIA 3STYA 4BJ5A 3S3TA 2GVNA 3BH0A 5G0TA 2B1IA 1GG8A 4OL0A 3F97A 3WNBA 2IVZA 3S2GA 1POXA 2IZ7A 3BDIA 5K03A 1PD1A 1SU6A 2J41A 3GU3A 3P96A 1JKFA 4G5QA 3ROZA 1XKLA 2FUCA 4ZT2A 4D6YA 3OCWA 4WK4B 3MRTA 2BZSA 3S2YA 3OZXA 3WYBA 5FADA 2QT0A 4LZPA 1CP2A 3T95A 4BNKA 4D9HA 1MC1A 3CUWA 4JY7A 4OJTA 3TVDA 1SQFA 3GLQA 3TW4A 7YASA 2R1VA 3D3WA 3OD1A 1KSGA 2AH5A 2QTFA 3WK7A 4KR3A 3H7IA 4NV0A 1NVAA 3LT4A 4NIMA 5I4BA 4TL6A 4DUYB 4ABTA 1C2YA 1QH9A 2FFAA 3HU2A 4L6IA 2P77A 4UXJA 4DXAA 4LX0A 4QYMA 3UICA 2JJMA 1S2LA 1TCAA 3ZWDA 2ZYHA 2OG1A 4FU0A 2RK3A 3GQVA 1OIXA 3K7EA 2YYAA 1WCIB 3WG9A 2ZB8A 2OFFA 1EK6A 1VI6A 2BHNA 3HY4A 3BGIA 1D6NA 5DMHA 5FPSA 5FTNA 1OLXB 4YIHA 3VHXB 2Z98A 1BGXT 5GPBA 2V5UA 2WD7A 3Q8LA 1J9ZA 1LPNA 3BH7A 3ND7A 4X20B 2QPOA 2CXRA 5K45A 3IV7A 2C58A 1QIHA 4XQEA 3TCXB 4CTMA 4YR9A 3HRIA 3L82B 1BYUA 3IAXA 3IO5A 4YP5A 3ANXA 2PN1A 5E9WA 1V95A 3MWFA 4MDFA 4KQ1A 3VVBA 3PUVA 5J2TB 3DDOA 1G5QA 4QBFA 5JNUA 2Z6UA 3F5DA 5IS2A 1GPUA 1UBNA 1W5TA 4RELA 1KVTA 3W2EA 5KX5F 4IHQA 3S2ZA 2QE6A 1NLZA 3E3LA 4FFNA 4R98A 1TE2A 4W5QA 1L1FA 3DBHB 4S35A 4ZRDA 2CL0X 4ZQBA 3DDNA 4FNMA 5TGZA 3BUSA 3FYUA 1T2NA 3FMGA 3JY6A 3UAYA 3UCEA 3U62A 3UMJA 4RIEA 4BN5A 2Y92A 1DSSG 4YDQA 3MJSA 4WINA 2WKWA 4DDVA 3QXHA 2AT1A 4ZI3A 3A1UA 4LRWA 3I39X 5LJLA 4MLPA 4B4VA 2FTKE 2O7VA 1KEPA 2BEUA 1UAYA 1YOVA 3SHFA 5LVAA 4NE2A 3T38A 4YAUA 4DR4B 4ILKA 3ILHA 5DISB 4S1PA 2ODBA 1L5VA 4Q3NA 3GZTB 4Z7NB 2H4HA 3AKZA 4ALJA 1B8PA 4Z0NA 1MVLA 5JPDA 2OAGA 2QNBA 5JQGB 1AOXA 1TT7A 1W4RA 2GVZC 1U7ZA 1VDZA 5CIYA 3BILA 1Q22A 2P9ZA 3RTCA 4DANA 2HUNA 2HK9A 1BQEA 4FSXA 2HPAA 4DWJA 4FILA 3IX7A 2ASEA 1X1SA 1Z75A 5HZMA 4ZGBA 4Y0NA 5FBLB 1G7CA 1JWBB 3LCJA 4IXMA 3VDRA 4D97A 4OBEA 1QUEA 4KQ2A 1DWOA 4B3DA 2IWRA 1GRCA 4RORA 3PNOA 4J0GA 2LCQA 5BVGB 2YFHA 4OJYA 5DNAA 2C9BA 4OHKA 3I2HA 3B3FA 4NZOA 4QUJA 1D03A 1U5CA 2UKDA 3FCYA 1PQUA 2HLDA 2PGOA 1WU8A 4X1OA 1BOFA 3ET5A 4P32A 3KD3A 2BFPA 2ONCA 1YKSA 2W43A 5DDIP 2VTEA 1YIOA 2QUAA 3O3NB 3SJAA 4B4WA 4J1SA 4OATA 1GZ5A 5LA6A 3ND8A 4Q1VA 3WGGA 1G4UR 3OX2A 3RS8A 1B1CA 1KOJA 4C04A 3L5OA 4MYHA 5DI3B 5CG2A 3FTNA 3KHTA 3FOBA 1XVLA 4HR7A 3HVKA 5B12A 1PT6A 4QT0A 4O1MA 5KWJA 4CMEA 2XXBA 3B1VA 2C7OA 1JZSA 5LCXA 2JI6A 3EZ9A 5IVHA 1AXRA 1AKYA 1PS0A 4RHFA 2C2BA 1V96A 4EH1A 5LMCA 5IASA 1GR0A 2ZYRA 3P0IA 5J2TF 1CIVA 3T4EA 3JRWA 1E1YA 3VOBA 1XMXA 2GZHA 1JJFA 2OM6A 4QBIA 5EEGA 2EXXA 2PT5A 2V4MA 4IJVA 2Q0SA 1Y48E 2R7LA 5I7SA 3OZEA 1H2HA 2OAQ1 1T3HA 2NSHA 3R24A 2YVQA 3G2LA 5HMMA 2O07A 5I8ZA 4B43A 4QQFA 1GCOA 2IX3A 1DG3A 1XDDA 2JHAA 5H81A 1WKCA 3QPUA 4IG9A 4KAXA 3UM9A 2I8CA 1FRQA 1XBTA 2FUG6 3ACBA 2AMLA 4XRRA 2ZITA 3P0EA 3RRZA 1ISFA 3CLHA 3LT1A 4O5AA 3GLSA 1YRLA 1B76A 4OUDB 3U7JA 1PUIA 2HNBA 3QWAA 1ZK0A 5DU2A 2G7MC 4PONA 1RNLA 2FFBA 1V1JA 2RJNA 2TMDA 3LZDA 5E2BA 1W7AA 3LRPA 3T5GA 1JG4A 3NBQA 3TAHA 3EARA 4MINA 4CMEC 2BV3A 3A1DA 1RRVA 2OFPA 4AJPA 5I5GA 3G0IA 4LJ5A 3F7TA 4PXSA 5CT4A 1JKIA 1SU8A 5I7RA 5ED0A 2XZDA 2ZR7A 1YFLA 5JC8A 3AHIA 5ALFA 2O7QA 4RVGA 3NB0A 1ZD9A 3KOYA 4AVYA 3HA2A 3ZYZA 1YA6A 4BZPA 2NO0A 2ZE6A 3BSSA 4Y9UA 1KI9A 2B69A 2BGRA 2GN1A 3JCZA 2B3TA 2DLDA 2PG3A 4IKEA 4UNSA 4XX0A 1E8DA 2BHTA 2KMLA 4AJKA 1FFWA 1LBTA 2HK7A 2DHRA 4REQA 3UB3A 2VWHA 4G5RA 4UOEA 4TKVA 5CA0B 2G28A 3DULA 1OJ7A 3AONB 5EUCA 3RKUA 3GG9A 2H29A 2YN0A 3NNDA 4FGKA 4V38A 4KZKA 4EB8A 4E7PA 1A9RA 5DTIA 3FTEA 4ZO4A 4CI0B 2JJ2D 2XNKA 4OHRA 3L1IA 2PUGA 1RSZA 2J9ZB 1N36B 2CHUA 2C9OA 2CFCA 1THGA 3R7BA 3DE0X 1QS0B 4MQFA 1ICEA 2H06A 3C14C 1GAQA 2VZ8A 1DTSA 5A3RA 5LP6A 1NN1A 5KOHB 4K2HA 2BUBA 1CJSA 3LQRA 2ODAA 2X76A 5EPEA 3VJRA 1KTIA 5KTSA 5E1BA 1YC5A 1E1QA 3PPXA 4TYPA 2RGCA 2DBQA 4OKIA 1VJGA 1D3AA 4O5OA 5DWQA 4BFYA 2DLNA 4EL0A 3DL4A 3RK0A 1M1ZA 3JWGA 4F72A 3D8RA 1NGSA 1D0SA 3ML1A 4OJMX 3D0QA 2HZ7A 3TTXA 2QMZA 3DZIA 5I7EA 3C4JA 4RMHA 3FTDA 5L9AA 2CV1A 1I3CA 3UKDA 3CLRC 2YQZA 1M1UA 4O4IB 4S05A 5TEWA 1JXMA 1MPXA 2O8DB 3OOYA 1P7PA 1N8NA 9LDTA 3SPXA 4FFVA 4BVAA 3QV1A 2PL5A 2R44A 2ZIXB 3REQA 5TPZD 1PR9A 1N7JA 1SXPA 1CUWA 3FWHA 2RK6A 4I6EA 4NOJA 5K3OA 5TIIA 1RR6A 3O26A 4UD6A 1LV8A 4ZO6A 2YW9A 3QJYA 1W2WB 2VK2A 1WZEA 4X90A 3AB8A 2EKZA 4TMYA 1MEOA 4Q00A 5B57C 2ERCA 4FYYA 2IS6A 1BYIA 1Z15A 4FVTA 1L5FA 2YH2A 2ICAA 2I33A 3IUQA 1CHDA 4LBWA 2VPYA 2PR2A 4M9ZA 5GZ6A 3GFSA 2A0WA 5M3BA 3TPZA 2RAVA 1XKXA 2BEWB 4OBWA 5JSHA 2I7DA 4P35A 4I1SA 3EPPA 4YN3A 3LCCA 1L3BA 3GEIA 3ZU3A 1IUOA 1G3MA 3G8DA 4BFTA 3AU9A 4DB4A 1EXWA 4DLKA 1Y6FA 2QVXX 5JATA 5LQUA 1KP2A 1I3MA 1H2ZA 1SCDA 4RFLA 2FKNA 3KTAB 1MKYA 1BCRB 1EZ1A 1X3LA 2R1UA 1X3SA 4DIDA 1NMSA 1U9YA 4M1WA 4CIBA 4MW1A 1KAQA 5IUKC 1CP3A 4W5NA 1ZXXA 3IR5A 2G70A 4R1MA 5U4QA 5JAIA 4F4FA 1GNSA 4C4YA 5IFLA 4DA4A 1TQ4A 3QH4A 1U9IA 4MJLA 4WCFB 1ISMA 2OKCA 5D7BA 1MO2A 1YR2A 3ABIA 3C0KA 2X13A 1ZMBA 3HMKA 1XTVA 3OLYA 1N6RA 4RHEA 4IV0A 3U2QA 3WGVA 1BW9B 4V1CB 1LU9A 2ZSHA 3KLMX 2OUKA 4GYYA 2VDPB 4PNPA 3LUPA 4XPIA 3ZK8A 5CLFA 2FFJA 2GFHA 3BICA 4QXMA 5CRIA 2J9XB 2J3IA 4FYPA 5KYKA 1LPBB 1V9LA 3IV9A 1ZH6A 1S89A 3NHBA 2ZRGA 4DRXB 3RVBA 4JB3A 1A2BA 3QLUA 1RLJA 5E0OA 2WIFA 1CS4C 1RHKA 1UKZA 2O6LA 3V6MA 4MV8A 2ZWVA 4F97A 4OXQA 5A5DA 3DT8A 3ZQ4A 4ZZ3A 3Q0EA 3IJPA 4KQJA 4M6WB 4ZO8A 3BKXA 4DR7B 1G20A 2E6KA 1G8MA 3ZIUA 2YDYA 1USIA 4LG1A 1YJAA 2WU0A 1X1RA 1VECA 2ZFUA 4JEIA 1V5WA 1W25A 2WOOA 2XSZA 4NBKA 5EXSA 2ZSJA 1O3YA 1YA8A 2EZTA 1NJFA 1XLVA 1SRQA 2FPXA 4Z4IA 3GZJA 3HZHA 4R2KA 4YO7A 2WAMA 2FPWA 1MDBA 2J4CA 1DVRA 3WLFA 4GWKA 5AK4A 3D7LA 2FEOA 1PJZA 1VRWA 2QVZX 1DBVO 2PX8A 3EF1A 1Z29A 2E5WA 4FMBB 1N3IA 2RC6A 1H1TA 3OJ0A 4HNHA 3WB9A 2M2IA 3QG5A 3K0AA 5T3UA 2NZ2A 5FLYA 1YS6A 1U8AA 2I9PA 1GVHA 4K26A 1J22A 4M9UA 3EC7A 5T8KA 1WKVA 3QLUC 1PR6A 3WLAA 3MW8A 3HCFA 3L40A 4AFNA 3KFXA 2C8VA 3CN9A 4H27A 1O94C 3CBGA 3QHQA 4V0LA 1ABBA 1KK1A 2A6PA 1QUFA 3RK4A 1E5QA 2EWVA 2ANCA 2HDNB 2QLTA 3DMPA 3LBHA 3QVGB 5IH3A 4ZZ0A 3EHEA 2GK4A 3AESA 3ZE1B 4AUMA 4U0JA 4EVSA 2IUFA 3ENKA 1TT5B 1KQPA 2NUBA 1XRLA 4QGFA 4RVOA 1ZZEA 2Z4TA 5EPUA 2H7VA 2AJBA 4OI4A 4NI5A 1Z6AA 3KOWA 4D43A 1J1UA 4PLHA 2FWRA 5JY6A 4HL6A 3CT4A 3H65A 3JQAD 4RMGA 4M38A 1A8QA 4M0LA 1QRRA 3EULA 3WDLA 3UPTA 1E3IA 1DEXA 2NO6A 1BXRB 2ZDHA 4B2PA 4D4MA 1BS2A 4O0MA 3ER8A 1E6EA 4IMPA 5BT9A 4QUBA 5GVSA 3D6MA 4FS8A 2RHBA 3FCCA 3EGVA 3FHJA 2OZLA 2H0RA 3INRA 4NARA 1J70A 4IWXA 4NCXA 1RQ7A 3ZLBA 1AN9A 3A4TA 2QZ9A 2B2XA 4AM8A 4EKIA 1JHUA 5FQOA 3TTVA 4G56A 4BLWA 1U7HA 1Z8DA 1YS2X 3TCNA 1TVKB 1Z2OX 3CR3C 2O2DA 4FI3C 1MB3A 2VYQA 2Y9MB 3AY6A 4BGEA 3WNDA 4X7MA 4Q93A 4I36A 1EA7A 1KI8A 3BKWA 1IK6A 3DXFA 1MRNA 2JGEA 2CMHA 2W6IA 3GAZA 4XIYA 1JIVA 4IEIA 1OILA 2ABWA 5DTMA 3RS9A 3DKVA 2HV9A 3M6IA 5FT9A 3REGA 4C7KA 1VMDA 1FXWF 4EG0A 1FJXA 1H69A 3RUAA 3C15C 4WH0A 1EUCA 1F17A 2P2DA 4G41A 7REQB 2ZSBA 2PJRA 1P5JA 3QSGA 1ORDA 1M1NA 1V7QA 1UPFA 3KBOA 3PQ5A 3LL4A 3B89A 2W6NA 1ZGBA 5H3HA 2D7CA 3HBMA 4ABYA 1N7GA 4R16A 1PLKA 3I42A 1CZKA 4I9HA 4RK0A 4MITA 1FYEA 4CM3A 4AS1A 1K97A 1FMTA 1CF2O 4OOEA 1J25A 1PR2A 4HF7A 4GQAA 4ZT7A 1BA2A 2BVNA 4H1VA 1UDXA 2L82A 3QVXA 2X19A 4HWOA 5HCIA 4QOHA 3L8YA 1H6CA 2DFVA 2HD4A 1G59A 1L9XA 1BMFA 1RYBA 4JYBA 1G18A 3DKPA 3ES9A 4FYXA 4L2IB 3UJBA 2JF0A 5JCJA 4YJHB 4WXEA 4B73A 1L7EA 2XMGA 1RYNA 1OD6A 3E9YA 3GH3A 2A3RA 3GT4A 5AXDA 1GPKA 5A5GA 1M83A 4LVUA 5KDLA 5K8IA 4MI1A 1WQ4A 4TS9A 4HB0A 1BJTA 5HGXA 4AZ3A 4MHTA 1R9NA 4DVJA 4C4RA 1TQDA 2VQDA 1UZLA 4C6TB 4IP0A 5T8KC 3BTVA 3ELWA 2FR8C 1BJKA 2FW7A 1AO3A 3RAPR 5JZOA 1PT8A 1NW9B 4ZAGA 5FEMA 4AG6A 2MOKA 3TZEA 3DTYA 2G9NA 3CA8A 2ZJ8A 3B1KA 1FXSA 1UM8A 3SSMA 1T3ZA 3PQ6A 3LI2A 1MUUA 2WYIA 5JLJA 3OCYA 1EIZA 3THWA 4B80A 4C7BA 4M36A 1WOMA 1ZESA 3X1MA 3LWZA 1R18A 4KXNA 3J81k 1Z9BA 1PV2A 2FUNB 3OEYA 4OJKA 3DKRA 2PXXA 3WKDA 3NNSA 4YJ2B 3HXLA 1R3DA 4MLDA 1PU2A 1ZH4A 4I5IA 4R5HA 4Y6LA 1W1WA 5JD5A 1EUYA 3DBIA 3ED5A 5CTJA 2ZYTX 2Z2JA 4RCYA 1G5RA 2ORED 3DO8A 1GHTA 4A6PA 4DLVA 5FWNA 1AMUA 5EOVA 2IH5A 2PNFA 1WD7A 3H2KA 3IOCA 4ICIA 1SU4A 1JDZA 1Q12A 3DDHA 4X93A 4Z9YA 1JLLB 3DMHA 3CZCA 3B53X 4O0LA 4QGHA 4WXRA 4DDKA 3I9FA 3PQFA 2OV1A 3CURA 3ROFA 4DYHA 4DNFA 3CCBA 3MUNA 3PCTA 5D2CA 1QTQA 3QJGA 3ILSA 4IDNA 3K15A 5DYGA 1I1HA 2HY7A 1YRBA 2DUMA 1NT4A 1V8BA 3QNUA 1ZSNA 2Z83A 2ARKA 3JPYA 4KIGA 3V4FA 4Y1GA 1E89A 1QIEA 2O0MA 4E6EA 3ADDA 1I14A 2APJA 4BC0A 2JCYA 2WZDA 2FRVA 3GCDA 4PG7A 5GGXA 4DWOA 8OHMA 4IDBA 4P08A 2YWBA 4Q7KA 2OESA 4ZJPA 5T4BA 1Y7HA 1UJBA 4NU5A 1HPLA 3AGPA 3EOBI 5DHAA 4ZTUB 3GUVA 2CV2A 5AVUA 4JKYA 2JLBA 4MPRA 5F52A 2NOAA 3UMFA 1CT9A 1R15A 1X94A 2DERA 1GAXA 5CM2Z 2BTQB 5CUQA 1N4AA 3OAAA 3GDOA 2GM5A 4YT5A 3IEXA 4JP8A 1UOOA 4URFA 4ZYVA 3HEBA 3MIZA 1KPHA 1Z3CA 1MEJA 3OHMA 3V4VB 4CHTA 2X4GA 3IXMA 1UC8A 3U4CA 1EDZA 5DXJA 3HUDA 1G63A 2B4QA 1GRQA 4L9SA 1DAGA 5CH5A 3EDMA 2VOEA 3PFKA 4JI5B 1Q7TA 1EVKA 4DLRA 2ZOSA 3JWIA 4FKBA 4X44A 4F4DA 3JZAA 1RRPA 5FHRA 3NHSA 3U80A 4QQ8A 5H4HA 3SDZA 2VAVA 4G25A 3T4XA 3AERB 2JAPA 3FIJA 1ECLA 3MMSA 1IZ0A 2LNDA 1FBTA 2I7XA 2XX3A 1F0YA 2IODA 3WZMA 4J0EA 2DT8A 4L0MA 2BMJA 4CQMB 1EQ2A 4AX8A 1AF4A 1VDMA 2OQ2A 2IBSA 4JSTA 2WWGA 3I2KA 2CF6A 2HLDD 3KVYA 2D00A 3R3HA 4XW2A 3NYQA 1T3LA 1QGDA 4PX9A 5HXAA 1VCNA 2P4UA 3MXOA 4WZAE 5A5VA 4WKPA 2VZ0A 5DGXA 3VYUB 1CJKC 3SC2B 4C7XA 1EHYA 1ZM2A 4XCXA 1H65A 2CL7X 1J2TA 3AKEA 3I6MA 4JEHA 4UVDA 2B6NA 4HDQB 3M3PA 1R66A 1TLLA 1KYXA 3AEKB 3MS7A 4YAEA 2CKDA 2EAUA 1HQKA 3CUSA 1P4JA 4BAUA 3A9TA 3MRXA 1OFUX 4HZGA 3RHZA 1H42A 1FTQA 1T43A 1B3RA 4G6ZA 2PBZA 4IZIA 1M34B 4BAZA 1QIIA 4WVFA 1Y5RA 1ORTA 4I1VA 1V37A 1Y1KE 4EB3A 1E9SA 4EFLA 2C7VA 2VCEA 3QJ5A 1GUDA 3HJHA 1XVUA 2JGMA 1QSGA 3GJ8A 2C42A 3ICWA 2ISCA 2ZBQA 3Q8WA 4L8GA 1XZJA 1U4OA 4PZCA 2BCJQ 2HSEA 3GYBA 3K73O 4J43A 5SY9A 1F0NA 2HPHA 5JH7B 3OICA 4M46A 3TIFA 1NYQA 2B0JA 1EP3B 2ZETA 1Z8FA 3NKFA 4BOYA 4A27A 1ZN9A 1X42A 3L77A 4F2PA 4C1BA 1AKQA 4E46A 4FYMA 4IIYA 1N5MA 1PFGA 3I4FA 2H7YA 2P4SA 4NJEB 4ZVQA 2KW5A 2A30A 3COJA 4RA9A 1DQPA 3ZVLA 1OMOA 2WSSA 1AG9A 4F06A 2NZYA 2I34A 2A5FA 3OCVA 4HV4A 3H75A 2XMZA 1XQ6A 4KIJA 1VPLA 4MV5A 4CU5A 4JB2A 1QP4A 4AUKA 2AYXA 3K5WA 4BKPA 1WB4A 4MWBA 1R5OA 3BCUA 4ZU6X 3BORA 3NBXX 2IV7A 3ZZ1A 3HA5A 3IPYA 3D8UA 4TRRA 3RSHA 3HGTA 3V1KA 3C6XA 4L3WA 1N5IA 2B1RA 2IFTA 3T5AA 1SOAA 5CX1B 2ZYWX 4DSOA 3AFGA 4GC9A 4JJ4A 2B1GA 4V3BA 2ZM5A 3QX9A 2FE4A 3BIFA 2PVCA 2XRFA 4WFQA 2ZE5A 1THMA 3KFVA 4EZIA 5F7XA 5F1YA 1CD5A 1JH9A 1HETA 4GOND 2J4DA 1OWOA 1CU1A 1Q0PA 3DAYA 5JJCA 4GVPA 2P1RA 1K9SA 2TMYA 1FDSA 4ND6A 3ADPA 3PC2A 4WZBB 5HSGA 1FBNA 4G5FA 1MIHA 4RNCA 2ZUDA 4CDGA 1EVEA 1LA2A 2V45A 1XWFA 2JVJA 4INZA 5AK6A 1MTOA 4DFDA 2BYTA 4PQGA 4EQ6B 1FU8A 2RGNA 3CW9A 3GT0A 1MO5A 4BGUA 3GPLA 1DELA 2EYUA 4BNFA 1FUKA 1A71A 3LP6A 1AXEA 4QATA 3Q1KA 4Y30A 1N6NA 4V0OA 5FOWA 3ETGA 1MN6A 3K09A 4XD2A 3ZH2A 3ZYCA 2WF7A 5HKKA 3JYQA 4NAUA 4I6GA 4D81A 1FSZA 2HA0A 2MINB 5DLQC 3ZDCA 1ZIXA 2OD9A 1H1LA 1Y82A 2BGUA 4BNDA 4LOIA 2XD4A 5KJ1A 2WDZA 2FNAA 3NT4A 4Z8XA 3WK6A 3ZY5A 5M29A 2FE1A 1WV0A 2I1WA 3AG5A 2BHLA 2IP2A 1E1QD 4IMJB 4AULA 4YMTA 2A58A 3D0KA 2PO7A 4DC1A 4CKBA 3WYDA 3F9RA 1SIBE 3JD2A 2PXCA 3A3PA 4BKRA 4B4UA 4E70A 3I2JA 1UINA 2F1HA 1ZM4A 2XIQA 2QVGA 4J07A 1ZPDA 2ZRAA 4H6VA 1MR3F 3WVNA 4F8EA 3GRYA 1NW7A 4ZC1A 4MUXA 3H1AA 10MHA 4C0JA 3ZIAA 1GUYA 1RBZA 1ISHA 1VYTA 2GJ8A 2IJGX 3BWYA 5HUJA 3BN3A 3VI3B 5JNVA 3NIWA 2REOA 2X15A 5CB8A 4DARA 1FUYB 2Z2KA 5ADUS 4RE6A 5BN1A 3W6PA 4BX8A 1WM1A 4QUHA 4M1EA 4YJ3F 4JJGA 2ECOA 3I8SA 3F3KA 2BGTA 1XAIA 3CW2A 4MHSA 1C0LA 4P92A 2H0AA 3J80A 1IZ8A 1YI8A 2XUGA 1DKPA 5FV7A 4A03A 4RHCA 3EPHA 1CK4A 4CL2A 1E6MA 2C7GA 1PBNA 2CNWA 5FFMA 3IOMA 4BRUA 2DCUA 5DPMA 2XYQA 3P2MA 4DS3A 1SQ6A 1U3TA 3R0VA 1TZCA 3EZGA 3C8ZA 5K8LA 3CPJB 4CIYA 4RTLA 3KJGA 4K0RA 3R7FA 4YMGA 2BI8A 2R8XA 4FOOA 4Y2JA 2VN8A 3QU4A 5ALPA 4GO1A 1XEWX 5CJPA 3TEMA 1D6JA 1C3XA 2CNNA 3Q3HA 4PQYA 1QRAA 4V0ME 1KI3A 2IEAA 5G0SA 3DLPX 4S12A 3BQMB 4X1KB 2PJDA 3W8EA 3AC0A 4KSCA 1Y7IA 4TWJA 3FUXA 4YMWA 4EHIA 2Y67A 3KSMA 1O1YA 3MCWA 1VPTA 4HQFA 4YXWA 3T4PA 5MF6A 1E9RA 1TLTA 3I34X 1TTTA 1Q77A 2WILA 5EMKA 4G9EA 2O8BA 2F9FA 3G2OA 4JYPA 4CLOB 1A4IA 5EJ2A 1SC4A 2X8JB 1NVUQ 2WIAA 1YCGA 2NVBA 4IY1A 3SZ3A 1P4AA 1MEEA 2HQBA 1WQ3A 2ZATA 3IR6A 4DMKA 1Q95A 3PJFA 3FYCA 1PJRA 1GQRA 2JZNA 1PR5A 1L5YA 3KT8A 1QKKA 1BDBA 3BGWA 3FWZA 3KCNA 4FCWA 4YHBA 2WLTA 3VDQA 4WJLA 5I9IA 1YH3A 1WXXA 3L7YA 3JTMA 1Y5IA 4LNAA 2JFVA 2JK1A 1M6NA 4X64B 5IJ0B 4BQOA 2JZOA 2ZXEA 4HPJB 1TTQB 3MCVA 2XITA 4GPBA 4K9MA 2IYUA 2MSCB 3OZRA 4X61A 3SU8A 4XM2A 4AXXA 5B6PA 3QEMA 4QUKA 1AE1A 5CFLA 2Q4OA 2X3UA 1LI4A 4JT9A 1ZM3A 2C0CA 1U3DA 2PZKA 1ODKA 3AL0C 5ER9A 2GXQA 3SSAA 1H4QA 5CYFA 1ULHA 1J0AA 1JKXA 3VH4A 1G38A 1S8AA 2PZJA 3NHFA 4PNZA 4XSVA 1HTWA 4BFWA 2XSZD 4D56A 1QYWA 3GRKA 5BRJA 3EGIA 3FHCB 3IELA 3IR7A 4R81A 5JXWA 3IP1A 1G0NA 1O87A 4NU8X 5LZ5A 2PUEA 4OHFA 1ZIOA 3RS5A 1X15A 2Q0HA 1GADO 1RLTA 2ZBUA 2P3LA 2YYZA 2ZYDA 5FPHA 2IL1A 4ALMA 1WZCA 5CA0F 3OP4A 5C51B 2ZAMA 3JWEA 5FTWA 4FFOA 2VEOA 1NI5A 2VL7A 3HBFA 2X0RA 2GZ2A 3EXIA 1E3JA 1S96A 3HRHA 3PUJA 3ZKAA 1LGYA 3GGSA 4RVCA 5CA1B 4K87A 1ZHFA 5FOUA 1T9DA 1GN8A 5JDIA 2IHVA 4I4IA 2TMGA 3H5NA 4D4LA 2I1LA 1UPXA 2BMFA 2HCBA 4HLNA 2HL6A 4BEJA 3L4KA 3CYFA 2GHIA 4LUCA 2HF9A 3F8WA 1ZGZA 4HN9A 5BQ5A 4EFMA 2WUWE 2KWIA 5F73A 3EMBA 1JFSA 5LOVA 1QMGA 2AFHB 4F12A 3FRJA 4G0PA 3R5XA 3DVRX 4Q3DA 3R75A 3S6JA 1ISJA 4EYSA 3E81A 4C0HA 2O2EA 3LAWA 2WABA 2FPIB 1G6KA 3ORSA 4URYR 3UWSA 3V00A 2C97A 3RFVA 4RTNA 5SZJA 3U7IA 1R12A 3RW9A 4PG6A 3G1TA 3GELA 1NATA 1D1PA 3MBOA 1XZFA 2LPMA 1QLWA 2WPDD 4DQKA 2H2DA 2D1RA 4ZDKA 3LO8A 2EDAA 3MHPA 2HWKA 1P77A 4L9WA 4RY2A 4RTOA 1A04A 3W1EA 4EW1A 1TU0A 1VPDA 3KZ1E 5EUQB 3I9MA 3PA8A 1AKEA 4Z9FA 1BRTA 1P29A 2VDWA 3D1LA 1PEDA 3HP4A 2XQIA 3NCHA 3NYIA 3DFMA 4OYHA 4PSCA 1CQWA 3TEFA 1HDZA 3R6DA 4GMGA 1P5RA 4I8XA 3BGSA 1OZFA 2TS1A 2XTJA 4DIUA 2C98A 1VHDA 3BE6A 2CBZA 2L0XA 4X7RA 3LBAA 3LXRA 4CMIB 3M5DA 4MP8A 4OO3A 1Q7BA 3HB0A 2XT9A 3GGCA 5KJFA 3ETJA 5DW3A 1DKLA 1XCLA 4E32A 2NUPB 3K0SA 2RDMA 2FH5B 1R50A 4C3ZA 2YWDA 2DZDA 1V6CA 4G89A 1TQ2A 2W0MA 3K9WA 4KWCA 2H3EA 2W6ID 4HFMA 2P3OA 3QYAA 1RQNA 4AJHA 4JROA 4DKJA 3DG9A 5AVWA 1I2AA 5IBQA 1RI4A 4M1SA 4ASUA 2F8SA 1BWSA 3K70D 2XRYA 4H0CA 1UDCA 3OPVA 4TV8B 3OJOA 4UASA 2HBQA 3OM1A 5MDHA 4KXVA 1GA1A 1XA4A 1Q83A 4A5OA 1ORHA 1U6KA 2W98A 4YT4A 2KHZA 4MVJI 5JEDA 1YZVA 3QVVA 4NCHA 3OM8A 3F6SA 3IQGX 3VVLA 3AUXA 1JYEA 5EGSA 3WLLA 2WSYB 1OAAA 3RG2A 1USWA 3UMMA 3D8SA 4NXMB 1FFXA 4M9SA 4MVXA 3L0CA 1GCGA 4MEBA 4Z4FA 3DOEA 4WV3A 3KWMA 2EEPA 4UE6A 3F6PA 1EHIA 3O1LA 4L4UA 4EATA 5JCJD 1VBKA 1L4KA 1PLJA 1GL6A 3TFWA 2P2LA 2X0JA 4U0KA 4BV9A 1N75A 1OU4A 4UBNA 4F2DA 4Y2TA 1GRVA 1K8YB 2OB1A 3L7JA 4JLKA 3UXMA 4XWOA 2NQTA 5AIBA 2ZK7A 2YRWA 3AJ9A 1F20A 1NN0A 4HZUA 1MXHA 1YASA 2ZRPA 4ND3A 4ZI7B 1XDWA 2BFDA 3DMTA 1GSOA 2X23A 1ZMRA 3L43A 5L6MB 3HL4A 5AKIA 5J5CA 4ECAA 4DSAA 1G2IA 4EBBA 2Q28A 1SOVA 3LDUA 1O96B 1GGEA 1K6XA 2M6RA 1UPBA 1RAHA 2B83A 1AKVA 4H7FA 4RPHA 1PYDA 2Q9UA 2I29A 3ENQA 2C4UA 2QTHA 3FNQA 4MS1A 3OUTA 3QUBA 4LHWA 3PQCA 4D82A 1N5OX 1A5AB 4QEZA 2VO1A 3L6DA 3LYAA 4B2YA 4D9JA 1R9JA 5AI4A 4RZ3A 2GFIA 3DDUA 3QPVA 5J23A 1U8CB 2J46A 2QD1A 4UM9D 3PBKA 1XZ8A 4FJ0A 5G1PA 1EVYA 2X40A 4EKYA 5AYVA 1Y6RA 3MJVA 4L3OA 4UJ5A 4AUEA 3LK7A 4A73A 3UOWA 2Q5CA 1BVYF 4MP3A 2NZXA 1N6LA 3KQYA 1XNGA 1QTIA 3S5UA 3WLRA 3WV5A 5C3UA 1IIRA 1B6TA 1S5PA 4ZGWA 3L0BA 1NOIA 3OY2A 1MB9A 3TD9A 1XNRB 2F8TA 3UCFA 1VJCA 1HTBA 2P2SA 2WHEA 3AVOA 1Q3TA 5CJJA 1TNDA 1X1TA 3PFNA 4EPRA 2VUSA 3ANSA 3BD8A 3KTFA 4GXTA 4JBXA 3K9GA 1J0DA 2ATXA 2J45A 3W5IA 2AKAB 5IJAA 4A4DA 3UT5A 3LC2O 4IHJB 1Z2AA 3GFPA 3BDVA 3ZGVA 1SZJG 1NOJA 5DNUA 4UW9A 4E5YA 1W19A 2D5LA 3MBIA 4HH3C 4HLCA 4UHFA 2WG2A 3EJ6A 4EUHA 1Z0JA 1HE2A 3A6ZA 3UW1A 4RA6B 3UAWA 4PVCA 3QVLA 1OC2A 1NM5C 3WIDA 4GP9A 5IM4A 1NR5A 5DM70 3F73A 4IVPA 3NUZA 3TRIA 2XOEA 4JZKA 1B00A 3SZMA 2ZYGA 3PYLA 3DCNA 2VPXA 2XUAA 5CFPA 1EFPA 1KKLA 2F9LA 4WXYB 4YJFB 3TL6A 4CLEA 3OAAD 3BXFA 3HU5A 3HXKA 3LX6A 1FEZA 2BFWA 2ONJA 2WWVD 3RTGA 5JSYA 3AG6A 4B4DA 3BCRA 3LF1A 2HB6A 4LDPA 3KPUA 3RVMA 1FW6A 2EJVA 3D31A 3GIDA 5DW0A 3MMPA 1ORVA 1VA4A 3HADA 4HDSA 4P4SA 5E9AA 3I92A 1LS1A 3LU1A 3QUQA 5FPYA 5LPNA 3K4HA 3BOSA 3HFSA 3N87A 3JYOA 5BP7A 1XU4A 4D8VA 5JSZB 2R96A 3HU3A 1P31A 4NFLA 1F8FA 2X1HA 1VJRA 3LKZA 2TSYB 3EAQA 5HRUA 1K5PA 5IKEA 1PAUA 3WB2A 5CEEA 4M55A 4X7BA 3OF3A 3R5HA 4FNAA 1QORA 1R16A 1OLUB 2R66A 1FLAA 4KDEA 1N8SA 3AOEA 5ALJA 2O5EA 4OP1A 2ZRFA 4X3CA 2POQX 4XIGS 4E2XA 3KWJA 2YWCA 4N6GA 4MRAA 1K0FA 1L8LA 3UAXA 1T34A 2MMGA 4OQMA 4LV6A 4BUJA 2FRXA 3H9UA 3SLKA 4WCVA 3PQDA 5LYJF 3QFCA 1A9SA 2EZUA 4O3MA 3Q7IA 3E0XA 4AJIA 4A8JB 2QT9A 2YN4A 4BVKA 2O7SA 3UUEA 4YCCA 2QRMA 2LKDA 3W90A 4DJDC 3U81A 4Z4HA 2PZGA 6NULA 3O3MB 2RI6A 5BQ3A 2C2GA 2OSVA 3C70A 2I4TA 3EIWA 3FMPB 3UMRA 2RCYA 4QPJC 1JLSA 1UQRA 4LOHA 3K3PA 1DC3A 4ZU3A 5CB6A 5BYKA 1YFJA 1NXOA 1H2RS 3LKDA 1QFZA 4BNVA 3O2QB 2B61A 2EFEB 1QDEA 4IWNA 1TPZA 4KO4S 3BA1A 2PUWA 1SC1A 3L7AA 4MW7A 4X92A 1UANA 2NUTA 3IUNA 4G1CA 1E92A 3T7AA 3FDFA 2FZLA 3U3OA 1BWPA 1KDPA 3AOEC 3IULA 1XL0A 4Y2QA 4KI7A 1NUUA 1VE6A 5F21A 2JLZA 2WSSD 3M1AA 1VE3A 4A2CA 1ZRNA 2CL6X 2DBRA 3BMOB 4TS4A 3KWLA 5CAEB 1KO4A 5IYZB 1PJQA 2AV6A 2IZ6A 1ZI6A 2Y1LA 3DPSA 1DTWA 1T36B 3UWMA 4V0QA 1XQWA 3WQQA 4CT5A 4Q3OA 1D2NA 4RH3A 1VL5A 4QM6A 1JF8A 3QHPA 1J23A 2H6EA 1W49A 3BGOS 3GLTA 4NYMQ 2Q3HA 3UZUA 5FWDA 3UMYA 1FTYA 3CR7A 5D6NA 1SHJA 4YJ2F 2OHIA 3SAJA 2CV0A 4I4NA 1XXHA 3QBTA 3EGXB 1I9CA 3KKOA 3PHIA 3U3MA 3WE7A 4OREX 3K9LA 4O4LB 4R8RA 5AKKA 4KYIB 1GT6A 4ZGGA 2CEAA 4GP6A 1R8JA 4RFVA 4N0EA 2FXVA 1USUA 2H4FA 2ZT8A 1PD0A 4PFQA 4B74A 3W5CA 2MR6A 1CZUA 1QGUA 4U2DA 3DW3X 5FTJA 4D4HA 1XZNA 1LKZA 2H9AA 4Q19A 1WABA 4J2TA 2NV6A 1KXJA 2I7TA 2RGYA 3I37X 1JG6A 1JLKA 1OHHA 3I3SR 4B8ZA 4OIMA 3T6KA 3O94A 4HQRA 2Q2OA 3ZE7A 3LBYA 1RZRD 3LFHA 1DCFA 3NWBA 2FPKA 4ESOA 1CQJA 2EIXA 3JZIA 4J4HA 5DX0A 4AYWA 1UC9A 4P2GA 1M1YA 2A4MA 4MUHA 3GNQA 1STOA 1LC0A 3HP1A 1ELOA 4HX9A 2FSIA 4M7RA 2I4NA 1UMBB 5HKKD 3EF0A 1TZKA 2P62A 2VBIA 1SVIA 4YTEA 3VNQA 3GEGA 1LI7A 3H1PA 3VPAA 4B6SA 3HRKA 4JUAA 5IJ9A 2R0QC 2VAMA 2VJMB 4H17A 4KODA 1I5OA 4LHSA 4O25A 5IJXA 3A0UA 3G8AA 1JQBA 1WA5A 2QTVB 2P75A 4N18A 1Z5OA 2AOVA 5AW3A 3PNVA 4KQCA 3N7TA 3KE8A 4N5DA 3VV2A 1WBDA 1P1FA 1UXJA 1Y33E 1IM5A 3ABOB 5C31A 2CFSA 2FF7A 5KKCA 1U0EA 4BO1A 3ZDAA 4E11A 3EXFB 3UH1A 5EHNA 5B5SA 1RKBA 1OH5A 3UQZA 2HMVA 2X8BA 2JKVA 4NPAA 3QVKA 1ILWA 4QHSA 5TV2A 1T9AA 2WHXA 2IEZA 1ZNYA 3OE5A 4K3VA 5DYNA 4NAVA 1NF8A 5E38A 3ZIAD 3IL2A 3IAS6 1AHHA 1GG2A 1ZA2A 3PL5A 2PA3A 2LBPA 3TFQA 1QYRA 3HI4A 1C9KA 2VK1A 3ZDDA 2PM8A 3ZGXA 2R86A 2AKEA 1MJFA 1TFRA 5HJ2A 3H5LA 5MGBA 2VF7A 1EVZA 1NBHA 2I6FA 1KFJB 3VC3A 2OQIA 4ML3A 1K86A 3K1ZA 2ERXA 4KFUA 4MR9A 5BMOA 3HC7A 4N76A 3GCXA 4XR4A 2PH7A 1PV1A 1U7DA 4IDOA 4OK3A 2CNWD 1KDYA 1T3TA 3NYRA 1E2LA 2JK0A 1VMIA 1T24A 1WX1A 1QG0A 2AFRA 4E6PA 4G4JA 2I91A 3DTVA 1F2VA 4XWWA 1ZWLA 1Z0ZA 4OHUA 2AR7A 5FBKA 1TRHA 2BGGA 2CJPA 1QO7A 3LUKA 4IJKA 3AX6A 2WG1A 3CLKA 3HYSA 2RIPA 1GU0A 2PRSA 3WLKX 3ZXYA 1K9VF 3DLAA 3M9XA 3AR5A 1RFGE 2ZBVA 1E1KA 4RBNA 2FRDA 1XC7A 1YDEA 3CPEA 3K1TA 3QRWA 1BHO1 1LSJA 2EIHA 1PR0A 2W2PA 3GLUA 3NH9A 4ZT6A 2JKZA 1Y8RB 3I9JA 3B48A 1J39A 1FUIA 1LF5A 2QP4A 3D6VA 3O8BA 4OJNA 1QKIA 1YK1A 4A9AA 4DV7B 3SQXA 2PRYA 2G4LA 2QLNA 1JRLA 2FG6C 3CX3A 5AH0A 2PYDA 3K92A 3ZWQA 2IUSA 5JH7F 2YNMA 2FLKA 3S28A 1NKSA 3ETDA 3U39A 5KVAA 5KSWB 1F06A 2XE4A 2NTVA 2OLEA 4Y2PA 4CBVA 1Z36A 4G84A 4MMZB 2H5IA 1IHXA 4JLBA 2FJUA 2HSJA 1VJ1A 2QR2A 3PX7A 1U1CA 4BVBA 1KQGA 4RPLA 3VO9A 5DNDA 4LOKA 2IU6A 5ALEA 3P5SA 1Z82A 3QLJA 3O95A 4OLJA 5JJKA 1CV2A 1N2CB 1P2SA 3RIMA 3S1AB 3A6JA 4IIBA 2H1WA 3BF7A 3KX2A 3LPDA 1N25A 2QRVB 3WISA 1K7FB 4EF5A 3Q2IA 1LQUA 4QDZA 4EQZA 5KOJB 2JIMA 2OL4A 4JU9A 2OCAA 3VNUA 1MU0A 3WK9A 2GRUA 5FR1A 3O83A 3E9RA 3L7OA 3RR2A 4EO4A 2V3WA 3B3AA 3CKMA 4EUNA 5CXQA 3S99A 2BFCB 2OBLA 3WJ7A 3GFOA 4A0QA 5JFGA 2B37A 4KU4A 4B3BA 4W9MC 1T2AA 4R1PA 1DKRA 4MQMA 3UA4A 3RKRA 4CCSA 1FY2A 3H5OA 1ZISA 3DDZX 2ZIVB 4R1OA 5JALA 1JT9A 5I9BA 3BXPA 5HTOA 1EQAA 3NONA 4C14A 1VI2A 2A1TS 2IHUA 4EECA 4Z4QA 3HJGA 1W0KA 4BXOB 4EHAA 2Y1KA 1JB9A 2AI1A 3MELA 5BR8B 2ZRCA 1BAPA 4AD8A 4YJKA 4F3YA 1SZCA 2QL6A 3EQ7A 4Y98A 2ONYA 2L17A 1OWMA 3JASB 5DHPA 3COPA 1KK3A 3R7AA 4ZXPA 2RI1A 3KVRA 1FNSA 4MVJD 1ZJ4A 1E98A 1O2DA 1CUDA 5CNMA 5E7QA 5B58T 3T3PB 2GZRA 5JYBA 1GIAA 1DRWA 1ECPA 5HE9A 3AIIA 3Q72A 1JBQA 4DR2B 2V54A 3CEPB 3G2IA 3VNAA 4Q7QA 2BDEA 3F71A 4G5XA 2WIGA 4XWKA 4HZIA 3EFOB 3Q15C 1TEHA 3WLJA 1VKJA 2FSSA 5J2TA 2XMRA 1J33A 2ZSAA 4RKFA 1Y9ZA 1E8NA 2NU7B 1D8AA 3LUAA 3NRJA 4MVJG 4UCXA 5IBPA 1T3GA 1ULAA 4LJRA 4L5BA 4TROA 5K3DA 5ALWA 1XELA 3RABA 3WLQA 5LDDC 1DO8A 4DJAA 3X1DA 1QP0A 1M33A 3SICE 2J6IA 1I94B 3MTBA 4RPCA 4YRMA 5BMVF 1ODJA 3GRUA 4WLNA 4YUZA 4IBOA 4B4OA 5FULA 1N32B 2Z5LA 4O4JA 4RY0A 1BWRA 2P4EA 5BSTA 3M4XA 3A7DA 2QGZA 4KMSA 2BISA 1QONA 1GAWA 4GH5A 1RZ3A 3A1FA 4EJ6A 4IV5A 2Z95A 2PX3A 2ACEA 5A71A 1KS2A 4KJXA 4GMFA 1BU5A 3K2IA 2VQ6A 4G8DA 4ZODA 4IILA 3G0DA 2IPOA 3ABSB 4L95C 2FZ4A 2WHPA 5TVKA 1R6AA 1ZK3A 2HDWA 2HFJA 3MJTA 4CM8A 1C1XA 5I9MA 4X84A 4H0FA 4HAYA 1VA5A 1SAYA 3WYEA 3ZX5A 4TZ0A 4E5MA 4NL4H 2B0CA 1SUAA 2JGAA 4MV3A 2VQFB 2VRCA 3BERA 2GK7A 3E9EA 4RQTA 2YMQA 3LVQE 3HK2A 3I2IA 4ND8A 1V5IA 2DB3A 4IDAA 4BWFB 4LY0A 3M2PA 2X2FA 3OOEA 3ZV5A 2VTBB