2WA1A

Structure of the methyltransferase domain from modoc virus, a flavivirus with no known vector (nkv)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
248
structure length
226
Chain Sequence
b'GICSSAPTLGEIWKRKLNQLDAKEFMAYRRRFVVSRGTAKLAWIDERGGVELKGTVVDLGCGRGSWSYYAASQPNVREVKAYTLGTSGHEKPRLVETFGWNLITFKSKVDVTKMEPFQADTVLCDIGESNPTAAVEASRTLTVLNVISRWLEYNQGCGFCVKVLNPYSCDVLEALMKMQARFGGGLIRVPLSRNSTHEMYFVSGIKNNIMGNVTAVSRQLLKRMEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NON-STRUCTURAL PROTEIN 5
publication title Structure of the Methyltransferase Domain from the Modoc Virus, a Flavivirus with No Known Vector.
pubmed doi rcsb
source organism Modoc virus
molecule tags Transferase
total genus 80
structure length 226
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2wa1A00
1JG3A 1P1CA 3AJDA 4MQ4A 5GIPE 4E2WA 2IPXA 1N2XA 3DOUA 2Y1WA 1YB2A 2ZTHA 2NXCA 2OXTA 2FPOA 7MHTA 2GPYA 3FUTA 2P35A 3G2OA 2EG5A 4DKJA 1WS6A 3B3GA 4GEKA 4X60A 1G8SA 3MGGA 4POOA 2PX2A 3KR1A 2UZ4A 5EIFA 3DLIA 3HVIA 3KR0A 4DMGA 5DT2A 1KPIA 4AX8A 3FPFA 2WA2A 2GAFA 3GRVA 4Y2HA 3KQQA 3G2QA 3NWEA 5D1NA 1WY7A 3EEYA 5HOQA 2P7IA 3SM3A 2QYOA 3KQPA 3KQMA 2PJDA 4H0NA 1BOOA 4AUKA 3GU3A 1B42A 3DLCA 2YXDA 1FP1D 2P41A 2NNWB 2JH9A 3FYCA 4KIFA 5F2OA 2ZLBA 5FADA 1MJFA 3SX0A 3UA4A 1X1BA 2AOUB 2O57A 4P7JA 3P8ZA 4X63A 3IV6A 3F4KA 4GBED 5E8RA 2PXXA 3HVKA 4G56A 3BT7A 3DXXA 2G8NA 2PKWA 3G2MA 5T67A 3NTVA 4GOMD 5LR6A 2XYQA 4WVLA 3HEMA 3UJ6A 5DSTA 5LQCA 2HV9A 2CL5A 2G70A 5FQOA 4RTJA 3O7WA 1QAOA 3BGVA 1KHHA 3HNRA 3NDIA 3NVMB 2ZBPA 3QOWA 4X1OA 3T7TA 4E30A 5HIJA 3HA7A 2EFJA 3Q87B 3OCJA 1WXWA 5C0OE 4PYIA 5LQKA 4C04A 5EMKA 5DWQA 3R3HA 3PFGA 1AV6A 1NW3A 1VP9A 3FPJA 1TW2A 5EMMA 5D1HA 3HCAA 2AN4A 3G88A 4CKCA 5JR3A 1G38A 1BKYA 2Z6UA 5EKUA 5EZSA 2PVCA 1EG2A 4P7KA 5B1SA 1P39A 3HP7A 3B3FA 1P1BA 3GJYA 4YMHA 3ER8A 4KDCA 3G89A 1OR8A 2R3SA 5LQJA 3R24A 5KQSA 3CVOA 3LDFA 1ZKDA 3X0DA 1D2HA 3THSA 2IH4A 3KKZA 3P9KA 3TR6A 3DR5A 3EGIA 3MTIA 5LQRA 3DMGA 2CMHA 1DL5A 4LECA 1SVUA 5P8WA 2B78A 4GOLD 1N7IA 5DTMA 1YUBA 4PYMA 3FYDA 3REOA 3M6XA 4E31A 2EJTA 1ZQ9A 4OA5A 3JWHA 2OYRA 3KU1A 3FUXA 3BWBA 3H2BA 4P58A 5DM1A 1XTPA 2Q41A 3DTNA 3E23A 2FYTA 5H02A 5HFJA 1R18A 3OU7A 3G5TA 3LBFA 1JTEA 3UJBA 2UYHA 5HEKA 2O05A 3OZRA 3T7SA 2P8JA 2XYVA 1G6Q1 3PX3A 1RI1A 3U81A 3I64A 4DA4A 1X1CA 4MTLA 5FWAA 3G8BA 3MERA 3PX2A 4PYKA 3FUWA 3FRIA 1XXLA 4GQBA 1VIDA 2HTEA 3A26A 2AR0A 1EJ6A 3UJDA 4FP9A 5E9JA 5KVAA 3EEOA 2IDKA 4FR0A 3SVZA 3UZUA 1YFJA 2KW5A 2C7PA 3C6KA 3KR2A 4AZTA 3OE4A 3HCEA 3TLJA 2GS9A 2Z6QA 5DRYA 1VPTA 3G8AA 3LBYA 4A6DA 1VBFA 1FPQA 3E8SA 1JG1A 4BLVA 2YVLA 2YX1A 3O4FA 1X1DA 2I6GA 2B9EA 2IP2A 2P1DA 3TFWA 2JJQA 3K0BA 5EVJA 3DP7A 3R0QA 5BW5A 2P7HA 1QAMA 4ISCA 4RVDA 3IYLW 3LCUA 2PLWA 4PYOA 4PGHA 3CCFA 5CM2Z 4R8SA 2B2CA 2H11A 1P91A 2ZW9A 4FS8A 3DXYA 2JH8A 4B17A 1JSZA 2VS1A 3UBTA 1G60A 4RTQA 3PLAE 2ZCJA 5CVDA 2GH1A 4MWZA 3EVBA 1ZG3A 2IDJA 5IH3A 1I1NA 10MHA 1EIZA 4RTPA 5E1DA 5HIIA 2ZBRA 1I4WA 4GOOD 5ERGB 4R6XA 3TM5A 2CWWA 3P2KA 3UJ7A 1M0EA 5EEGA 4KRGA 3TQSA 1TPYA 2ZIFA 5GWXA 1L9KA 3B7PA 3LX6A 1XDSA 3LDGA 2HR1A 5EZQA 3JWGA 2P3OA 1ORHA 3ANXA 4RTLA 4QVKA 4QQNA 2OB2A 4GOND 3PVCA 1NE2A 3CKKA 2PY6A 1RI5A 2FHPA 4RX1A 3UJ8A 1JG2A 4X61A 4C07A 4HTFB 1SQGA 1SUIA 2QRVA 1F38A 5GP1A 5DXAA 2NP6A 3AWIA 4IWNA 3ME5A 2IIPA 1RI2A 2PGXA 4F84A 3DUWA 1NW8A 3A25A 3ERCA 4V0QA 1O9HA 4HH4A 2IH5A 1UIRA 3KR9A 4GF5A 4RTNA 2C7RA 3GRRA 1RJGA 3EVFA 3P9NA 4E33A 3QOXA 4CTKA 8MHTA 3ELWA 3MQ2A 5K0LA 2H1RA 1NW5A 3AY0A 4OBXA 2FRXA 3M6WA 3DULA 1EAMA 1G8AA 2UYOA 1QZZA 3FZGA 5F2NA 2OKCA 3HCFA 2BR3A 5CCXA 2E5WA 1IY9A 4HGZA 2ZWVA 3EVDA 3IHTA 3MB5A 4FT4A 4BP3A 1RJFA 4CKEA 5CD1A 4BY9E 2FCAA 3P9IA 4RSRA 3R9XB 2XBMA 5EKXA 4ER0A 2AN5A 2A14A 2AS0A 5GM2A 3DMFA 4RYLA 1YFLA 4GUAA 2H00A 2G1PA 5EMLA 2QM3A 4IV0A 4E2XA 4QVGA 2R6ZA 2B25A 4YV2A 3LKDA 2V74B 1AF7A 4EMSA 2UYCA 1Q0TA 3B3JA 3HA3A 5BP7A 3E05A 4PYQA 3LCVB 4P7GA 3TM4A 4O29A 4KW7A 3TOSA 1KXZA 4FGZA 1SG9A 5DX0A 2P3LA 3I53A 4ER3A 5CVVA 5EQJB 4AZWA 2QE6A 1VQ1A 4PCLA 2JHCA 5E2BA 1F3LA 1NBIA 3LECA 2QRVB 4PIMA 3ER9A 2WA1A 4F85A 4KWCA 3EGEA 2QY6A 3OU2A 3DXZA 5E2AA 3AXSA 5BW4A 1AQIA 1NKVA 2AVNA 5K0JA 2OB1A 2B3TA 3LCCA 4YUZA 2NYUA 2XVAA 2AOTA 4IV8A 1G55A 3G5LA 3BZBA 3KQSA 3DH0A 1VL5A 5EGSA 4E32A 5FTWA 5ICEA 3UFBA 2XYRA 2PBFA 1R8XA 3KPJA 3HTXA 1DCTA 4RV9A 5K0EA 3GDHA 2VDWA 2ZZNA 3GGDA 3CBGA 1WZNA 3GRYA 5CCBA 2AOWA 5FHRA 1XCLA 3M6UA 3LHDA 2Z6AA 5K0GA 3ELDA 5HILA 5GIOE 1BHJA 3OZSA 1INLA 4C03A 4YUVA 1AQJA 3A4TA 3KQYA 3C6MA 1SUSA 2PWYA 5EHGA 3C0KA 2UYQA 2IGTA 2O07A 1M6EX 4AZVA 3TKAA 4RVHA 1QAQA 3TKYA 3THRA 2YXLA 3LKZA 4PYLA 5K09A 3MCZA 1FP2A 3EVGA 5F2KA 5FCDA 4RTKA 2FK8A 3CGGA 2VP3A 3G7UA 3GCZA 3I9FA 5EOVA 3EVAA 2ERCA 2PT6A 4RTMA 2DPMA 1KIAA 4RTRA 5DLYA 4R8RA 4BP1A 4C4AA 1KYZA 5FWDA 3B5IA 3ELUA 5DX8A 5T6BA 1QANA 4KIGA 4PINA 4M38A 2XVMA 5CVUA 2ORED 2PX5A 1HMYA 1PJZA 1JR4A 3A7DA 3M4XA 4QPPA 1D2CA 2FK7A 2G71A 1JG4A 1Y8CA 1N7JA 4M37A 5K0FA 3VC2A 1XDUA 2C7OA 1O9GA 3NMUF 3JWIA 2VZ9A 4ER5A 4HRAA 3FTCA 3T7RA 3HVJA 3ELYA 2AOTB 3VC1A 2EX4A 2GLUA 3VYWA 2HWKA 3RODA 3HCDA 3O31A 2ZFUA 4MHTA 4R6WA 3RW9A 4FSDA 2HMYB 4RTOA 3EVEA 4BLUA 4YUYA 5ICCA 3KPVA 3VSEA 3BWYA 2AZTA 3NWBA 4PYNA 5DTQA 4QTTB 5HIKA 2OZVA 1PRYA 2ZSUA 3D2LA 5FA8A 3KQWA 3TPZA 1V39A 1YZHA 1NW7A 4DM3A 4YMGA 5LQAA 4F86A 2OBFA 3DMHA 3EVCA 4M7RA 2AOUA 4QPNA 3SGLA 2JHAA 3LL7A 2LD4A 5DTRA 3C3YA 4QDJA 2IBSA 4FSXA 4YUXA 4M36A 2NXNA 3BXOA 1BC5A 3CC8A 1JQDA 3GRUA 4P7FA 5EPEA 5GOZA 1YF3A 5DRTA 4AZSA 9MHTA 4EKGA 3P71T 3PFHA 5K0NA 5M5BA 2O06A 4RWZA 1JQEA 4U7PB 2C7QA 1X1AA 4XUEA 3P97A 1RJDA 3FUVA 2OY0A 3BUSA 3FUUA 2ESRA 4HGYA 2BM9A 2PV0A 1DUSA 4EQZA 5CIYA 3V8VA 3NVKI 2O0LA 4PONA 5EMJA 2DULA 3AXTA 5DXJA 3OE5A 4ZTBA 2YXEA 1RI4A 1R74A 2GB4A 3KHKA 3MTEA 4E70A 3BWMA 4EK9A 5LQUA 2BM8A 1KYWA 3MAGA 4PGGA 2ZIEA 3L8DA 3OZTA 5CUQA 2PX8A 4PCAA 5DM0A 1Q0SA 3CJTA 1JTFA 5FQNA 2I7CA 2WK1A 3BGDA 5KQRA 4LG1A 3OPNA 3P9CA 4PNEA 3EMBA 2Y1XA 1SQFA 2IFTA 1NW6A 5CVJA 3GRZA 3CJRA 5EEHA 4C05A 1ZGJA 5DM2A 5MHTA 2ZULA 2OO3A 4ER6A 1KPHA 3SSMA 5HIMA 4DCGA 3FPEA 2IH2A 1T43A 4BLWA 5BXYA 1XCJA 3OFKA 5GM1A 1Z3CA 3TRKA 1VLMA 4HC4A 3IEIA 2JHPA 1MHTA 5C9ZA 5T64A 4UOEA 3ID6C 4DZRA 2NP7A 2AN3A 1RJEA 2IBTA 3HA5A 3KPWA 1R8YA 3M33A 4PYJA 2YUIA 1KR5A 2ONZA 3A7EA 3JWJA 4KDRA 3PS9A 2CMGA 2ZWAA 4FZVA 4XCXA 1I9GA 4R05A 3UJ9A 4CTJA 5FHQA 2ONYA 3KQOA 3GXOA 4XUCA 2YQZA 3BGIA 3KPUA 3FTDA 3LDUA 1FBNA 1D2GA 3ORHA 4A6EA 3M70A 4YV1A 5E1MA 1XJ5A 1WG8A 4IKPA 2ZZMA 2EJUA 2ADMA 2PT9A 3G2PA 3FTEA 5ICGA 4OBWA 5E1OA 4LWPA 3EPPA 5JUWA 1NV8A 3UJAA 4LWOA 5KYGA 3HCBA 3SR4A 2AVDA 1VE3A 2HNKA 3KPYA 4GC5A 4OQDA 5EIWA 2ZZKA 3M6VA 5K03A 4OX9Y 3BKXA 5DX1A 4JXJA 2BH2A 4DF3A 4X41A 4V0RA 5K8VA 5GINE 3MHTA 2P3QA 5E1BA 4PIPA 1UFKA 1L3BA 3GNLA 1XDZA 4E2YA 3T0IA 5FUBA 3PT9A 3I58A 1QYRA 3EMDA 2PWPA 3Q7EA 3GIWA 4DQ0A 1ZGAA 2G72A 1NBHA 3LGAA 4EVIA 5U4XA 2ZBQA 3HCCA 3E7PA 4QDKA 2CKDA 2YTZA 5EC8A 5LQNA 1YZ3A 4HSGA 1HNNA 4RTSA 3FTFA 2VDVE 3BKWA 3UA3A 3UJCA 3PTAA 5E8JA 1NT2A 3PB3A 1ZHFA 3SSOA 1H1DA 4WXHA 3OU6A 2I9KA 3QV2A 4K6MA 1R6AA 4OQEA 5K05A 5DM4A 3LPMA 4U7TB 5K01A 1XVAA 2YR0A 5C1IA 1RI3A 3EGVA 1U2ZA 3HVHA 2PX4A 2I62A 4C08A 3NDJA 3FPGA 4CWAA 4YUWA 3HM2A 1FJXA 2BR4A 3P2EA 5DPMA 5HZMA 1L1EA 3GWZA 2VDUE 5FULA 2JG3A 5K0BA 1NV9A 4HTFA 2OPBA 4CKBA 1IM8A 1TW3A 1KP9A 2GA9A 1M6YA 2PXCA 5FA5A 2NXJA 3S68A 1SKMA 5E9WA 4PWYA 4RVFA 4FT2A 5G02A 3WSTA 4ER7A 3OFJA 3B89A 2BR5A 4Z2YA 3A27A 3KQVA 4DCMA 4Y30A 5EHIA 1IXKA 2PXAA 3FRHA 4L7VA 4QTUB 4YV0A 4HG2A 4QQKA 1JSXA 5IKMA 3BWCA 3NW9A 1UWVA 2NXEA 4OA8A 1WXXA 3I5UA 5E9QA 3GO4A 2AOVA 2BZGA 3MCTA 5CVEA 3EVZA 3NJRA 2PSSA 2AOXA 4EKIA 2ZIGA 3UWPA 2P40A 4E2ZA 1L3CA 1VP3A 1ORIA 3C3PA 1EQAA 5ICFA 3SSNA 5EG5A 3SMQA 3R6TA 3FPHA 1KPGA 5KS2A 2K4MA 5LSAA 3KQTA 3CJQA 4KVZA 5DSXA 4C06A 4NECA 1O54A 1R00A 1X19A 2V7EA 1L3IA 3RIEA 3P2IA 2ZVJA 1JQ3A 5K0CA 3TMAA 3LSTA 4CXMA 4ATNA 2N47A 4MIKA 4GC9A 4XUDA 3SXJA 3V97A 1EJ0A 3K6RA 2F8LA 4RVGA
chains in the Genus database with same CATH superfamily
3JAWB 3CRVA 4OOFA 3R1IA 2NO1A 3DYVA 1QGOA 3IBFA 3G5MA 5CW2A 2EFEB 2WKSA 2YFHA 4DKJA 2O2CA 4TMTA 3SIPA 1FVHA 4HBZA 3M34A 4TTJA 1VLQA 3IVXA 5B3AA 5C8YF 4FYIA 4Q9IA 5BN3B 2UZ4A 1JV2B 2I6QA 1PR1A 4LQCA 3QKIA 4TQAA 5F76A 2I91A 3DAPA 4OHMA 1GG2A 2B30A 4XOIA 1A8SA 5ALLA 1WXHA 2QG4A 4NHEA 1FIUA 4KACA 3AHFA 3EOAI 1XHEA 1HFWA 2PJDA 1D4ZA 4F72A 3ZNPA 5HZHA 3RYIB 1UODA 5BV0A 5K99A 2IOQA 4TXJA 4MKGA 4FM9A 4H3KB 3SHOA 2IZ7A 1WQ4A 5J2TA 1WMEA 1KGSA 2PQ0A 4XR9A 1W93A 4B47A 2G5GX 3E70C 1PLLA 4AJOA 4QATA 5AK3A 4YXWA 2AYYA 4UHCA 4WAUA 4IUDS 3VI4B 3NTVA 2XMDA 2WMNB 3LQ2A 5K5EA 3DEKA 1XTIA 3QWFA 4IJMA 4F3CA 3I62A 1EK1A 3NQ41 5J4KA 1IZYA 3HNRA 1C3LA 3CVWA 4XSVA 5BMVA 1EFRD 3K1YA 1NQOA 3SS9X 3J81k 4GMGA 2BMVA 4ZVSA 1GL3A 2ZCVA 3JQFC 1KVRA 1ZIOA 1ZLXA 3OOHA 1FUEA 3IX7A 4WJKB 2XA1A 1JJIA 3NCHA 4HI0E 5HWSA 1V1RA 3DE0X 1FW8A 3RS7A 3EIEA 2G17A 3HCAA 4RVSA 1DBVO 1P2VA 4P31A 3U9SA 5K45A 3MJTA 4GVXA 2Z6UA 2H8GA 4G4JA 2JFBA 3FNHA 3PU6A 4KBFA 3AOEC 3I8XA 5KINB 1YQGA 2HK8A 3KEQA 3KYCA 1VE7A 4XH9B 5CLHA 3OIDA 4JQSA 5G1PA 3OY7A 2KS6A 4NQRA 1NZJA 2ZI4A 5U4QA 5EXDA 3O8QB 1E2HA 4QQ8A 4B0PA 2ZQYA 1D6SA 4LAFA 2O0HA 3USCS 3FX2A 4ENPA 3VC7A 1QHFA 3MUEA 2FWJA 5KYUA 2XQIA 4AW9A 4JMLA 2PO5A 3OT1A 1YUBA 2OILA 4EDHA 2HADA 4IINA 4WESB 2DRIA 5LB4A 5JCXA 1E3SA 2WNIA 1Q84A 4OHPA 2FOIA 4JEUA 1X13A 5SY6A 4LTDA 5REQB 4CF4A 1ZVMA 3WHIA 2XUQA 1HR0B 2FN3A 1IRIA 1K9VF 2YWGA 1MR3F 3A6ZA 5FV7A 4D80A 2YKGA 2O05A 4RLSA 1MDFA 1Z4QA 3OTHA 3BGWA 1VPLA 5IT9A 1Y1PA 3M4JA 4JA2A 1X1CA 4EL0A 3FFAA 4C43A 3MTQA 1CETA 1KO1A 2I8CA 3I12A 3DV0B 2W2KB 1AS3A 2PL3A 2Z6VA 3AYZB 3KVRA 3A26A 3O3CA 3PE3A 4ZYVA 3M8KA 3JVDA 5AYVA 2HIMA 4F8JA 4EYQA 2M32A 2IUUA 3ZWVA 4TVBA 1P3Y1 1SVKA 1UWKA 3VJRA 2IYEA 1RMYA 1N3IA 3MUNA 4H3HB 4OJMX 2O8CB 3NR2A 4BB5A 1PV2A 3EFOB 4ZRNA 1SVLA 2JJMA 1MH9A 3WX0A 4GYWA 1T36B 4NIMA 2O2JA 1YCGA 3O4FA 4JC5A 1KK3A 2HMAA 1LEHA 4G07A 1SHZA 2BJWA 4DT1B 3OICA 3RUAA 1Q20A 2I55A 2UXDB 5SYMA 3W2TA 4GPTA 1MTOA 3LHKA 3AR8A 4KWIA 5E6SB 3X1ZA 4DY4A 4LJRA 3GNSA 4EUSA 1S7GA 4FS8A 5JBNA 4ACBA 4NARA 1E4OA 4ZDWA 3OUTA 2X3FA 2ACWA 3IUJA 4M1YA 4ZA2A 2KX7A 4J07A 2I3ZA 3L84A 3IP9A 1AKTA 2UUPA 3GAAA 2FSFA 3JX9A 4PGAA 2NU7B 4GQIA 1JKJA 1LV8A 1QYXA 1YQQA 4GT1A 1OC4A 4L6AA 5SY4A 2DPLA 4Y2YA 3SJAA 3FW1A 1G7TA 1ZMOA 4RV4A 3R0XA 4B4OA 5ITSA 1X7YB 1MENA 2NTVA 3CNEA 3O90A 4P4UA 5AKHA 5LA6F 1ORHA 4MKZA 1SQ5A 4FJ2A 4PG7A 3WLFA 2FMKA 3QTLA 3OO1A 3PC2A 4E4YA 3UJ8A 4RIGA 1ZOIA 4B2IA 4NOMA 1IJKA 1F38A 2AFHB 4PCVA 1JXOA 1DT3A 3KC2A 3O4HA 4NULA 4UARA 3CUEF 1RHKA 4G9BA 1ZJWA 1CJVC 2QI9C 2XMRA 1ZD3A 3JU3A 4ND5A 4CODB 4E4TA 2Z2XA 1JIXA 4MOWA 1B6GA 1RYBA 4HDNA 4G24A 3KSUA 2P6OA 3MQ2A 1FU8A 1MOZA 4LHZA 4QPZA 1RYHA 1H23A 4KB5A 3TE6A 5JAMA 1SUWA 4GLFA 5JTTA 1EAMA 4WBNF 3T5PA 1G5IA 1C1YA 4RQAA 1MB9A 5JS7A 1G21E 4F7DA 1R0XA 4CUKA 5CCXA 1O89A 1IM2A 2GM9A 4GM0A 2ZWIA 1MOSA 3E81A 1TCVA 4G1EB 2QXYA 4OYHA 4Q47A 5CP8A 4BP3A 5J47A 5LMCA 1BVHA 2LUOA 5DK6A 4HQKA 1ABFA 1CVLA 4MJ7A 2WI8A 3HUTA 2HI0A 2R47A 5FBLB 2W6JA 5EAIA 2G1PA 4HFRA 1XROA 2VJMA 3LYAA 2E4ZA 5CX4A 5I4BA 2HXGA 5EJGA 3VAAA 4I14A 2Q9UA 4BBJA 3AKZA 4FYJA 1KP2A 5IDQA 4H3SA 1SOUA 3TIFA 4Z0HO 2P5TB 3CLTC 2X0KA 1GPAA 1MAUA 1ZL0A 3QMWA 4MRAA 4M0EA 1DLJA 4P7GA 1AIPA 5E4YA 4F96A 3N2ZB 5D3MA 3HYTA 3TJRA 1IFXA 4IY1A 4JELA 2JGKA 3R74A 4IHJF 5ALNA 3VPBA 4UEKA 1VPEA 5I51A 4BAGA 5AW0A 3N0XA 4KAAA 1D7AA 4N0EA 5ALZA 4DC0A 3KZ1E 1C9EA 3AW9A 1F3LA 1NBIA 3GJSA 1DPGA 3KZOA 4N8SA 3VO1A 2IHTA 3WBBA 1GVNB 5KIAA 4LYJA 3V9PA 4F85A 3WRYA 4YRCA 1JHZA 5JAPA 3R7FA 3L0OA 3IDOA 1MO6A 1T3HA 4BNKA 1EVLA 2OB1A 1SKAA 1G5HA 4CM5A 5F5XA 1ODFA 4NEHB 2G83A 1P9NA 2HWXA 4LC9A 2FF5A 2Q6IA 2GERA 4MUEA 2ZJ7A 4L3VA 3MOIA 4FZRA 2OXTA 1JDBB 5HUHA 1TYEB 4TLAA 1D8AA 2JLQA 1XMOB 2UUCB 4M53A 4UASA 3LXMA 1YVUA 2PSDA 4YFVA 3BULA 3ANMA 4PNZA 2ZZNA 1WDTA 2DY1A 4QE3A 2IXAA 5FHRA 4CKEB 1J06A 1ZMRA 4Q37A 5F7JA 5CAEA 1VL6A 5JASA 3CLVA 2JATA 2I2DA 1NT4A 5I7AA 1ULAA 5JSZA 4ZC8A 1XTSA 1YU9A 5CLIA 3T1QA 3B1VA 5AKYA 4ETMA 1SU8A 1RKVA 1V6CA 3S99A 3P19A 3C6MA 4LRXA 2PWYA 4QTXA 4DQXA 1ZD5A 3DE6X 2O07A 3GFQA 1F2TB 3C5CA 3NV7A 3RRFA 3IVCA 5E9AA 4N0QA 4QEZA 5LIPA 1ZR4A 4WDQA 3EVGA 4DCUA 1KFBB 3K0EA 2YW9A 1J23A 3IIMA 1PG5A 4HB0A 2ERCA 4D26A 3JSAA 3HKDA 4U6NA 5DLYA 3AUSA 4J3NA 4CU5A 3W1WA 3PNMA 1CRZA 4MS1B 3EZNA 5KJ6A 1AKEA 1CZLA 4I81A 3B6IA 1FYXA 4NJMA 4CLHA 5JISA 5I5EA 3C8MA 1HZZC 3KETA 2P0AA 2W0MA 3SLGA 1L8QA 5FDFA 5KQMA 3ICQB 1TVCA 2R8XA 3JWIA 3FTPA 1R0ZA 2OP0A 4EO4A 1P1FA 1C81A 3GOQA 1KFCB 3ZV6A 3TNFA 4JKOA 2IXEA 2JJ1D 3FWYA 1Z2DA 1YRLA 3PXXA 3BJEA 4OJTA 1LPNA 1L7XA 1Y1KE 2P9YA 4ACAA 2QLTA 1PTKA 1V8BA 3AQ4A 5MGBA 1BXRA 3EK2A 3K4HA 2PBLA 4G84A 2AZTA 2Q49A 2QUKA 1RVDA 3E3OA 4PW0A 1B6SA 1WXQA 3JQAD 2RHLA 5FA8A 3KQWA 1E2GA 1JFFB 3T3MB 4UNNA 2GBLC 2AOUA 2OXRA 1ZINA 4M0CA 1KY2A 3ETGA 2QP9X 1Z4NA 3G0OA 4XRRA 2GDJA 4F5ZA 2F48A 2BHNA 2GCEA 3IDAA 3T5AA 1GYRA 3P71T 4ZV4A 1BRTA 1T6ZA 2VLBA 4LHXA 4V0OA 4WCFB 1QUEA 1GT91 4A8JC 1ZZEA 2C3MA 2D5LA 2RKOA 5AHWA 4KNVA 2II6A 1KC1A 2AG8A 1EB8A 1GR1A 1ZNXA 2BM9A 2XMZA 2ZXEA 4HDCA 4MQFA 4MYHA 5BNFA 3U0BA 4CM4B 2YL2A 4IJKA 3BB1A 2P69A 1ITZA 1UBMS 1CNEA 1WSAA 3VDXA 4G8BA 4MUIA 2OV2A 1SEVA 2X15A 3BWMA 1RHQA 2POCA 2QD4A 3EH2A 3PD7A 3MAGA 1CS0A 4W99A 4BO2A 4EK9A 4ZDIA 1BFKA 4Q48A 2M6LA 3ZY4A 1U94A 5L6LB 5EZYF 3J80A 3GLVA 1EKXA 4PWZA 3W1EA 1G8PA 4IDPA 2QRMA 2WT8A 4PNEA 5DMHA 1QVVA 3HBFA 4JLVA 1QYVA 2COKA 5BQOA 4C05A 4K46A 1KI2A 2C88A 1ZGJA 1VJCA 4ZARA 1AKVA 2C84A 2OECA 3HS3A 1QVZA 1T43A 3P2MA 4MW7A 3DBIA 4L27A 1OLUB 4G65A 2NUAA 2PTHA 3RHZA 3D5QA 5IUNC 2OQIA 4FNAA 3JTMA 3OETA 1SUCA 3H2SA 3DJFA 1L7MA 4P81A 1CZNA 1LQTA 4A3SA 4WOKA 4N82A 5L7TA 1V96A 3CPEA 4LJ4A 3A4LA 4BNVA 1KEPA 2ZWOA 1IHDA 2GD2A 1J5XA 1P4RA 3SBXA 3CVVA 1EFAA 2D13A 3ZN2A 4RIIA 1XQ9A 4PYJA 2GX6A 4Q7LA 1I32A 1C7QA 4G63A 3DBRB 1MQSA 2ONYA 2AE1A 1UEXC 2YQZA 1SB9A 1CG6A 1Y4SA 3FPBA 3V2HA 3MPUA 4WZZA 2QP3A 1IVNA 5B7PA 3C3DA 2R11A 4QGFA 1ZP6A 4KR6A 3P0JA 4C6HA 4YV1A 3IHWA 2IUYA 3HBNA 1Z4PX 4URWR 4JQCA 3CVUA 3RH0A 4INOA 1HE3A 5D5PA 1OFGA 2H1WA 5P21A 4F21A 1E6EA 3K9FC 2FPXA 3PGA1 4OFXA 3P4UA 4OX9Y 4XA8A 1NLFA 3PPXA 3VHLB 4DGQA 4F4HA 3FKSD 3QEOA 4DF3A 2BH2A 5BVGB 2AEEA 1J2EA 1NVVQ 1L7NA 2GSWA 4G5RA 4PIPA 4B35A 3HV2A 3MHTA 3OP4A 1EM8B 3ZHXA 4ICIA 4RZ3A 4NFHA 1K7YA 5CYPA 2H1FA 2X5KO 5E4FA 3PNBA 5G4KB 2ONCA 4WJZA 2AYXA 1PK8A 3LGAA 2F4NA 4WINA 4C4SA 1J99A 4ITRC 2O8EA 2VHCA 4IIJF 1ZVJA 2QROA 4OGLA 4O3FA 5FRDA 1Z13A 3PC8C 3T52A 5LQNA 2LR0A 1SVWA 3C3EA 4BRWA 2IHNA 1E3QA 4BNHA 1MFPA 1KZ1A 3BKWA 3G9QA 3I28A 4IRMA 4MPDA 3BCUA 1XTRA 4JZYA 3SSOA 3UB4A 3WADA 3B38A 2W4MA 2XRFA 2CB0A 2JD0A 2VHQA 4ENQA 5KSWB 3HXOA 4RKYA 3EG9B 3LUBA 1OI4A 1KDOA 1YMVA 1QJ4A 1MXHA 4LWQA 1K98A 3AP2A 2VXCA 1X87A 5AUOB 1OU4A 2DX7A 4JI1B 3OM9A 1CEXA 2FQYA 3RS4A 1X1RA 3FTNA 1R50A 3GK3A 1AY0A 2BHSA 2EL9A 5FTKA 3F7TA 3SE0A 3ZKWB 3B1YA 4D2IA 3RT9A 3RVNA 1SKMA 2AZXA 1M6HA 2XXJA 4NMHA 5KNBD 2RK3A 2DMRA 2ZPUA 3GH3A 3LK6A 1SO8A 3A36A 1P3JA 2H0QA 3A31A 4IG9A 4HVTA 1N6HA 5LIRA 1BIFA 2WIAA 3IAFA 1IE3A 2KE5A 3NBXX 3NC0C 4JHLA 5JALA 4ZCSA 3IE1A 1VYHA 5B3LA 1GZ7A 4D9EA 4LDNA 3DFIA 2Q4EA 4KLRA 1KJ8A 4EM6A 2O8FA 1SAYA 1NQAO 1RJ9A 3DO8A 4UAUA 2AOXA 2P0EA 4M49A 5HDQA 2LP4Y 4BS9A 4Z4HA 3EPHA 5DHQA 5FWXA 1PE0A 4K0RA 1R0WA 2D0IA 1E5LA 2VXBA 1USWA 2IHKA 1NJSA 1E8NA 1UBHS 4Y2GA 5FR1A 3WAKA 5GV8A 4FNGA 3SYMA 2JGDB 1B1CA 4XQ9A 4NCJA 5CD1A 1SXJC 2FZVA 3M7IA 4PPYA 2DTEA 1NVBA 1RAGA 1CQZA 1E1RD 2H06A 3GC6A 1IZ9A 1YNSA 3LSTA 3CNOA 1EGMB 2ZIXB 3T15A 3H8WA 5IX8A 1E1KA 1FS5A 1P19A 2J67A 2ODAA 4G5SA 4WV3A 3K6RA 4XIYA 2F8LA 3RQIA 2AXQA 4RVGA 4WWHA 2CVZA 2YFKA 5HCUA 2O52A 3WYBA 4A26A 1KKUA 2PQ6A 2NXCA 3V4PB 3A14A 2H6EA 4TYQA 3PNSA 2P6NA 3I01M 4UAJA 5IULC 2VAVA 2ZIZA 5JD4A 1M67A 3UGTA 4EMTA 5I8ZA 4LCEA 3VSAA 5JI2E 5HS6A 3TH5A 2Q4RA 1K6IA 3GCGA 1S96A 1ZI9A 2X3YA 3GPCA 4MIEA 3W5CA 3ONNA 4K26A 2WWVD 4AX8A 1Q3KA 1G3IA 1YK1A 4GDMA 4LXXA 3IKLA 3JZMA 1PWYE 2PFGA 1AUQA 1RWWA 2HNAA 4NBNA 1JAXA 1Y9EA 1YCHA 4LMBA 1OVGA 1D07A 4E21A 5AIBA 5K0TA 4AUKA 4AKIA 1UJ2A 1B42A 2C77A 1CULC 1OCEA 2WUVA 2WYWA 1Z37A 3SJUA 3THWB 4NBSA 5F2OA 4F2GA 1EK5A 2JIBA 1EBFA 5IYZB 3AM4A 2X9QA 3BIJA 4TSFD 1SQ6A 4E2FA 1SCBA 1P4HA 2D4AA 1YRBA 2PXXA 1GU7A 5JAQA 3WQBA 2BHRA 4N5DA 3HVKA 3O1LA 3H11B 4G56A 4F9FA 2GWRA 1B8NA 4LYAA 2CD9A 2D2IA 5JPIA 4DMCA 5M04A 1S02A 2ZVQX 3HEMA 4EJFA 4OP1A 1GFZA 2WWGA 1ZUNA 2JNWA 3FJOA 1NW4A 3STTA 2F1IA 2Q4BA 5DNCA 2OV3A 1LK5A 1O8CA 4DV1B 4CLOB 5HIJA 1ZSNA 1Y1SA 3OKPA 3QPAA 2IS2A 1E2PA 1W581 2O50A 2JFOA 3U7GA 1H4VB 3UWMA 3VKHA 4K86A 4B43A 2RHHA 3F6YA 4E15A 2E2WA 3RYCA 3LUGA 4LHYA 4GLOA 4MV6A 4FYMA 3CZAA 5FFNA 3INGA 5K2MA 2Y9MB 5ALUA 3TQFA 3ZGYA 1N3BA 4L8VA 4BGUA 1ESMA 4G9EA 3SHWA 3U19A 3G89A 4JHXA 2XAUA 2OL4A 2MIIA 1DO0A 2EBUA 4Z4EA 1EWVA 4R1SA 3NAMA 2AWOA 4DREA 1UR5A 3ANYB 1DBQA 4F97A 1FFSA 2AI3A 2CVQA 3PENA 4V39A 5I45A 5EHXA 4QHYA 4E5DA 2XW6A 3C3WA 1Y1LA 1VB3A 1Z0UA 4E7PA 1XEXA 5DTMA 4EGCB 2R86A 2VN8A 3DA8A 2JFQA 3OBBA 4DLPA 2NUPA 5KQPA 4MNTA 2FP4B 2Y1LA 2CNOA 4NAHA 3NHMA 3SOZA 1SBNE 4NU0A 3BWBA 3ENNA 4XVHA 4GHWA 3SX2A 2AUMA 3SG0A 3TB6A 2J31A 1R18A 1JTEA 3KE9A 4FMDB 4NBKA 4PPFA 1G8HA 1SBZA 2BGMA 3ROEA 3JATA 1G6Q1 4LOLA 3ESDA 1J00A 4JJGA 3MXOA 5TS3A 5HJEA 1P6UA 4YQYA 3VKGA 2VPTA 2WD7B 3HKCA 1KR2A 3AIMA 3MCVA 3RJTA 4KUHA 2EOAA 3GEGA 1KQNA 4FOLA 4IJQA 4LX8A 3N9IA 1R4MB 1VCIA 3BRWA 5MDHA 1YA6A 3SVZA 1YFJA 2VK2A 2WHPA 3PFBA 3N53A 3E8MA 2Z2JA 1QU2A 1J56A 5AUNB 2ZE6A 2GS9A 3GRFA 3TZKA 1JNXX 2A9FA 3E7XA 1C4KA 2C4HA 2IODA 5IMSA 3HVRA 1E3MA 2QW0X 1JN0A 1SIBE 3F71A 3BD7A 1H0KA 2LW7A 1Y1QA 4L51A 4ON9A 3D3KA 1Y7HA 2YVLA 4I99A 4I50B 4KIUA 4ZU3A 3U40A 1T1EA 5CA1B 4Y9SA 1SXHA 5EQFA 3I32A 2X2OA 4PEVA 4D5GA 5JATA 3R0QA 4FFRA 3C98A 4XGNA 5T6MA 1ZXBA 4RVDA 4Y2RA 1X15A 1WUYA 2HA5A 2ZT5A 2GAJA 3U3XA 3QWBA 1XAJA 2BEVB 4R7ZA 4EG7A 4XB2A 3LFHA 1V6AA 3ZWBA 1Y5MA 1E2DA 3BE5A 3D6NB 3ZEIA 4GEGA 5AW5A 5B58T 4MWZA 3H3XA 4BFTA 3ANLA 4AJPA 4BJ5A 3X1DA 4L0QA 3BEOA 1G8MA 3NOVA 1V7QA 3OIGA 4ALKA 4B7CA 5A0FA 4DNOA 2A1IA 4RGBA 5KYNA 4FE4A 2SBTA 3P2KA 4R1NA 5EUBA 1D0VA 2E4XA 4Z4CA 1SKYE 2WFAA 3INNA 1C0PA 5AO9A 4NCAA 4MVJI 4GMHA 2I29A 1Z2NX 4JIMA 4B09A 1AUOA 1US8B 2B92A 4FKBA 4G01B 3LXUX 1R15A 3CTPA 3FI9A 3TZHA 3EEOA 3L7MA 1Z22A 1U65A 3MAJA 2V65A 4RSHA 4YT5A 5FT9A 5GADl 2BFPA 2X22A 4HNSA 3ZVNA 3HJFA 4RCYA 5DW3A 2GRUA 3D6HA 3UICA 5ES4B 2C9BA 1W5AA 1D5CA 3GCWA 4PVDA 1FY2A 3RSGA 2NP6A 3N39C 3WWZA 3ERCA 4MA4A 4CI9A 1ZJ4A 1C30B 5C37A 1JJVA 4GF5A 2A9RA 1QPBA 3E5HA 2QN3A 2VP9A 2Z57A 2OWDA 4DLRA 2JGIA 2VJLA 2GESA 3ETNA 1VGVA 2VNSA 3PUKA 1GADO 2PU5A 2H1RA 2NPFA 1OYVA 3WHKA 3FE2A 3M3DA 1RQPA 3VTZA 3BN3A 4BNJA 1T25A 3PUHA 3TOVA 5B7NA 1G3UA 1RWMA 2IEAA 2H48A 4JWKA 2YMQA 4LRYA 1V5IA 3FFWA 2HSGA 3F7MA 2BR3A 5BN5A 2QY9A 4HT3B 5EWMB 3CCBA 3Q5GA 1T4CB 1UOPA 1XZGA 4L4XA 3LW8A 1UFOA 3KTDA 1XOIA 1YHZA 2A2ZA 4AT1A 4JGIA 3IKTA 1FTWA 4RSRA 1NYQA 2XF2A 3PVZA 3NLLA 4MWOA 1V37A 2PGIA 4BQPA 4HRVA 2VJCA 2PSFA 4RY2A 1CYDA 1E3WA 1QF9A 1FDOA 3SOPA 1RW4A 4NATA 3LQYA 5BXQC 2R6HA 3AJ9A 4H1VA 5HQJA 1QZTA 4J1SA 3T34A 2CXOA 1DTSA 3DKRA 1KJJA 4J76A 4ARAA 1XF9A 2C58A 1G5PA 4M0PA 2CXSA 4ZVTA 1T2FA 3E4CA 2NV6A 2OGWA 4Y6GB 5FLYA 1G3MA 1UKCA 2NT3A 1EP3B 4DHWA 4DYHA 5PGMA 5JV5A 2F1KA 2YWRA 5K8JB 4QLOA 3OY2A 3OF3A 2H2WA 1B1AA 2ROQA 3AHJA 4FIDA 3ER9A 4MLCA 3P27A 1SHUX 4LV5B 1JFSA 5C5IA 1BCRA 2J3MA 2PZMA 1GXSB 5ECYA 1KO7A 3HI6A 1JBEA 1THMA 3ZY5A 1QCZA 3PE4A 3D64A 4EY4A 4AXBA 1ULTA 2CCJA 1RR6A 1OU0A 4I08A 4JU9A 3CF6R 4TYYA 4JVNA 1TUGA 1E2NA 1VL5A 5AHRA 3R5XA 1P8JA 3UFBA 4CVNA 1H2AS 3V55A 5K0EA 1D4OA 3TUIC 5C7YA 1FYEA 1NLMA 3UHOA 3CBGA 1N2CA 2VPIA 4GPAA 3VOTA 4CBVA 4EPVA 3LNTA 1W29A 4YCAA 4D46A 3TSOA 5CT8A 3OQJA 4O2BB 1BHJA 3GT4A 5BO5A 2SICE 2X6QA 4MHSA 1UDXA 3ZGOA 4C03A 4JBXA 3DF7A 3R7SA 3SDSA 4QYXA 2D1FA 2N0SA 1YXMA 3L0DA 4PC1A 2ZETA 3ORRA 4CL3A 4H7HA 1T8YA 2J30A 4RVCA 3X1MA 2LRHA 1PJQA 1EFVB 1PYGA 1TF7A 2AFRA 1ZXLA 1OA1A 2DSNA 2OD9A 1Z0IA 3FKJA 4MPTA 4X44A 4WZAB 4BAZA 4CQMB 1S8NA 2XBLA 2YXLA 3LE8A 3MT0A 3OZUA 4Q9HA 4NZNA 3L6DA 4HDSB 4B7ZA 3G7UA 1P3DA 2CYBA 1CRLA 5H81A 1MP0A 1NBWB 3VZCA 2GJKA 2CMKA 4BP1A 3UMRA 4CGYA 2Q3HA 1Y5IA 3MILA 4K9LA 2N75A 3LUPA 3V1TC 1JT2A 2YV2A 2ZRGA 5CVUA 5EJ8A 1ODSA 2JL1A 2OHVA 4FX2A 5EJFA 2YZNA 1V5WA 1VSTA 5GMOA 3SLKA 4ENUA 3WGMA 4OXXA 1JG4A 1OXVA 3COSA 5C1PA 2VT6A 4WCDA 4HADA 1XDUA 4WXYB 2NO7A 1EXVA 4J0KA 1AHHA 1TVKB 2EX4A 5K20A 4EA8A 3AY7A 1O3YA 1XA0A 3CRZA 2C5FA 5JH7B 4NMLA 2I87A 1Z36A 2X0DA 2XMGA 4ARSA 1QHHB 3CR7A 1QP8A 4KL8S 1YVDA 2HCJB 5GVSA 2RHCA 5K6AA 1MZPA 4EYOA 2JLUA 1BRMA 4K87A 4ZAXA 3ZBPA 3AIIA 1YJ5A 2Q3DA 1K6JA 2ZSUA 4UHKA 3RYIA 3L7NA 3RAJA 1YZHA 4JUDX 3H8VA 2VHZA 3MELA 3MUFA 3WIVA 1CVIA 4CEJB 2AF4C 3E27A 3VSDA 4C0BA 1Z5GA 3OEYA 3F6SA 3PWTA 3MG9A 1XZ8A 2NT4A 1R66A 4KLZA 1V9SA 3FWNA 3QJYA 5LYYA 3KT0A 4KX5A 5A4AA 1LPMA 3FSRA 2O06A 4NE2A 3C3XA 4FHGA 1JMYA 1XGKA 1L4GA 3AO0B 3LK7A 2R6R1 1LF5A 1NXXA 3MM4A 4ZOEA 4KSCA 4YRRA 1RJDA 3T3DA 2V6FA 5AI4A 4ABTA 4DMUB 1QCYA 4Z3DA 3CMMA 1QG2A 1DUSA 1UMBA 2C99A 2DUMA 2E21A 3NVKI 1T8RA 3NYWA 2HSZA 4JT9A 4RA6B 3JQEA 3MFQA 3V8MA 2RGBA 4P0PB 1LPSA 1VHJA 2CNWA 5H68A 2GB4A 4HR7A 1ECLA 1VLLA 3WYAA 1F17A 4YMUA 3GP8A 1R6VA 5JCOA 1M2EA 2RGDA 4OQLA 1XHFA 1NC3A 3IPAA 1CZKA 5EXXA 1B16A 3C8UA 4DARA 3KUDA 4P4NA 3D0KA 4ZU1X 1TTQB 2X58A 3RYHB 4RD1A 2I2XB 3BDIA 3EZ6A 4IBOA 1W6UA 2EW2A 1WZEA 4OOEA 3I6YA 4MKXA 2GHIA 2XE4A 3JAKB 3OFNA 3HL4A 1AZSC 1NN1A 2DPXA 2XTJA 3CT6A 2Q1YA 4JUCA 2HREA 4A27A 1EIWA 1PQYA 2CL7X 4RCVA 4I9HA 1QGUB 4US0R 4YJ3B 2QNIA 4XAQA 1F7UA 1Z5WA 5BXYA 3JQCA 2BAGA 4RA9A 1DXHA 4GZLA 5ARBA 3CBQA 2PUEA 5REQA 1LZLA 1RP1A 4HEA1 4BNWA 1XU7A 2FW0A 3Q8MA 1L0BA 1TUIA 1Q21A 3H2YA 3R40A 3DEZA 4K1XA 4L07A 2QTGA 3AI3A 3OJ0A 1Q95A 3BOSA 3HA5A 3RBZA 3W8EA 4C2BA 4BMCA 4JJFA 4BP8A 4CN8A 4RSMA 1P1IA 1LJUA 4I55B 4AQYB 3NDRA 1O87A 1NR5A 2NU6B 2UVPA 1AQ6A 2YHIB 3DKVA 3B7GA 3WIOA 2WG0A 3DV0A 4JEHA 2WABA 4FYXA 1GPNA 3S2ZA 2QVYX 3RD5A 4TV8B 1YULA 4C1BA 5KHOC 1TZBA 4JENA 3ONDA 3OJWA 4FHCA 1E4EB 4F4FA 3LW7A 5H1YA 1HPLA 1C7FA 1HYGA 2QP4A 3IQEA 3ZE2B 1AQUA 2O8CA 4WZAE 1LB1B 3OE1A 1ZNWA 5AVRA 2J7KA 3OM1A 5K03A 4C88A 1NYLA 5AKEA 5BV8A 3H5OA 1CV2A 1J0CA 2C4TA 4MVJA 2JKYA 2IYAA 1LUAA 2I6TA 3TLYA 5AHXA 4EEKA 2FWAA 4DT1A 1ZK3A 2WVHA 4DCPA 5CFPA 1L5HB 5AI0A 4BNIA 3WWEA 5E6SA 3Q7EA 3ADBA 2ZUFA 3KIPA 4LQLA 2JCVA 1G1MA 2FF7A 4GP7A 2IP4A 4MWBA 3KFLA 5DWDA 3F6PA 1LI5A 3R6GA 1YZ3A 4GWLA 3UA3A 1UDAA 1V47A 3I9OA 3FBWA 4D8VA 1QO0D 2AG1A 2WJVA 4L57A 1IDN1 3BF8A 3VO9A 3VR4A 4K6MA 2NU7A 2H3EA 4JWTA 4PRLA 4TUYA 3ZWNA 1GFSA 5TSDA 4U7TB 1PQPA 4WFQA 5CDTA 2GM3A 1RI3A 3V4ZA 4HRYA 3BMNA 3D8NA 1X7YA 1W2WB 3O73A 3MJHA 4MK4A 4HZGA 4R3NA 5IM4A 1WPXA 3Q12A 4K3VA 4V0ME 2IYVA 4MEJA 3E82A 4MB6A 2LIVA 1SR8A 2OC9A 4ZK6A 5HZMA 1KAGA 1Q0UA 5DP2A 5K51A 5IWCA 2VEOA 3B1ZA 1JA9A 1TYAE 4IVPA 1ZISA 2AFHA 5L3SB 2H07A 4IQ4A 1LBTA 2F8MA 1Z6TA 1LX6A 1J1ZA 2WF9A 4N76A 4MR8B 3D31A 1PEDA 2QQFA 4Z2YA 5JPDA 4IUBS 3AVYA 1X70A 4L7VA 1UDCA 2XMQA 3OLCX 2BCJQ 2XI4A 7REQB 5AM2A 2HDOA 2F4VB 2RFLA 1CF2O 4FDUA 4OJYA 1G4HA 3MLAA 5EXEA 4PHFA 1M2VA 2A0KA 2O1WA 1GNVA 2XGGA 3MC1A 3R8FA 1FS4A 3NYIA 3C3PA 1AZLA 5ICFA 1ZU4A 3S3TA 3LIPA 3UGKA 4MW1A 4GI3A 3LXXA 3FCSB 3N3BC 4JUIA 1LSSA 4EVRA 1X19A 2GFHA 4PNPA 2VR1A 1ZBDA 2GZ1A 4ID3A 5KMGB 4UULA 1Z08A 2R4TA 4MIKA 1YUNA 4MR9B 2BV3A 2WD9A 1UBJS 2EKZA 2VUHB 4MGZR 3ZWPA 1Q1BA 1PT9A 4MQ4A 2VNJA 5E95A 1ZGZA 3PUVA 2BM1A 4AX4A 4TWAA 4DNXA 1U1FA 2GYWA 1QIKA 2EQAA 2HU8A 3STVA 3FPLA 1EFLA 2XDQB 2V1UA 1KVTA 3KK0A 3PPYA 1W49A 1PFQA 1UKAA 2CYCA 2PRKA 2Q5OA 3JWEA 4HLCA 3LKVA 4B3FX 3EZ7A 4G0VA 2CHVA 2WA2A 1X1TA 1U9ZA 1L5FA 3VU3A 4RZHA 4D4LA 5J23A 3WGTA 2GZAA 2QM0A 1SG6A 2D1YA 1K6XA 2NXWA 3KHTA 4YRLA 4D0SA 4Q9NA 4MI3A 1HLFA 2NNWB 1GQ2A 4O1IA 1YBFA 3V4OA 4K5QA 3KCQA 4DZTA 1FFCA 4IPTA 4B3XA 1EWKA 1GLVA 2O48X 4JX8A 3BRCA 3I6ZA 4PSKA 2BGKA 4BKRA 3K09C 3IQWA 4XCVA 3NT2A 4JLPA 4QGAA 4Y0AA 1KWGA 3BT7A 1GDDA 1YIOA 1DIHA 2A67A 2G8NA 3H5VA 5FWNA 2PANA 3UJ6A 3OWOA 4CCAA 3HJHA 2G70A 3GI1A 1KGDA 1Q7TA 2PD3A 3FVRA 2I3GA 5IBCA 5KPDA 3NDIA 1UJMA 1TKCA 3H1EA 4Y2QA 4CMEA 1A4XA 1FJHA 1U8EA 4COOA 4YRNA 1D2MA 3GLFE 1DBRA 5SZIA 1UBNA 2FMTA 2JDIA 2B4AA 4IKOA 3T9BA 4UE2A 3F1KA 4Q3OA 3W7BA 5DM60 3M6FA 1WEKA 2M1XA 3U7HB 3KUKA 1F1BA 1XQWA 1TM3E 3C16C 2QTNA 2VCHA 1BAPA 3ZS9A 5JCPA 4Z4QA 1RXEA 3QSGA 1C4XA 1LRJA 3ZHCA 1RM3A 4X8OA 1Y4ZA 2I99A 3GJYA 2JASA 4NNJA 3FDIA 4CM8B 1GPKA 1ULZA 1MX3A 1OR8A 2R3SA 1HXHA 2G0NA 1NU6A 1W9MA 4OUKX 3AETB 3EMVA 1OSNA 1ND5A 2VAPA 3KKZA 4MW4A 3C7AA 5KYKA 1GRCA 3PR2B 2XMPA 1R4NB 1GLNA 5LQRA 4TL7A 1A88A 3IDFA 1BX1A 1FTGA 1HORA 2CW5A 1K5GA 3FMIA 3FYDA 3K9NA 4AM8A 2VO1A 4OA5A 3JWHA 3BIWA 4IZOA 3W3ZB 1XPJA 4ZO6A 3KBBA 4EA9A 3V8QA 1J39A 1T5HX 1IHUA 2FYTA 2H1IA 3E23A 4EJMA 1TJYA 3RSQA 1U90A 1WVIA 4OUDB 1JFFA 1A9PA 2A9VA 1ZVVA 2HHHB 3TLEA 3MHPA 3PPVA 5I9NA 2OMEA 2DY0A 4NZ9A 4ZCTA 4EH1A 2OAEA 3BXEA 2OCDA 1KQFA 1XK6A 1XVVA 4WOPA 3UJDA 4PQFA 2DETA 1NSYA 3R3UA 4B4WA 1VYUA 2QTCA 3KZVA 2VBGA 3GFSA 3OURA 5E6RB 5CJPA 5ADWA 4JR1A 5GQSA 3RE1A 3FAZA 5CLFA 1PK7A 4M1ZA 1FQKA 3C14C 3C5EA 2M9MA 1JQBA 4CM4A 1GUZA 2A1UA 4HQOA 1ICIA 3ZHQA 3DUFB 1U3CA 2DWCA 1BG6A 1N6RA 4AJIA 1AO0A 1BDJA 3Q3GE 1KQ3A 1NBAA 2YX1A 1W0JD 4DV2B 4FCCA 4RPHA 4EGJA 3INRA 3D2BA 1RRGA 5DYGA 3SZGA 1BO6A 5DJ5A 4PZZA 2RCNA 1RLOA 4FZ3A 4PO9A 3IYLW 4RH1A 1ISMA 3ZJUA 4OMUA 1KJ9A 1N32B 5EN4A 1NBMA 2B2CA 3H0EA 1HV8A 5C8YB 3SHQA 3HFRA 1HL3A 5JS2A 1UJCA 3IEKA 1QLJA 2VOJA 2ZCJA 3RUFA 1H22A 1XQVA 1KSFX 5IT5A 3EVBA 2B1GA 3DMNA 4R2KA 1JXMA 3AUFA 2CUZA 3QI7A 2FFRA 2OHHA 2XR1A 5E1DA 3RVBA 3ZCVA 2EZTA 2FWRA 4BB9A 4GOOD 4N3GA 3QJGA 4WLOA 2ZK7A 2HEGA 1Q7GA 1ADBA 2B83A 2GZHA 1AKNA 1TPYA 2V9ZA 3CWZA 3C48A 3AUUA 4L9AA 2AC2A 5EZQA 1FBTA 1XKXA 2R44A 2XX3A 5ITWA 3GP3A 2X9VA 2NO4A 3A2LA 4ZO7A 1CB7A 3OF2A 3X2SA 4M1MA 1L8AA 4ODIA 1GT6A 1NQXA 4RF2A 3RKRA 4CKBB 1N6IA 3ACCA 4Q34A 4PZCA 3CW8X 3SHTA 3AEYA 2HK7A 1X7ZB 2C4MA 2WMYA 4WZ6A 4JI0B 3JQGB 3E9RA 3KELA 4E46A 3P2YA 1A8IA 1QH0A 1R9MA 4ZYTA 2NM0A 4I5GA 3UV6A 1M72A 3QLTA 2Y67A 2HHCA 1I1QB 1O97C 3DZIA 3ELWA 1OT5A 2XUZA 5K0LA 3G6WA 1C4OA 1K7SN 4KV7A 1I2ZA 4H08A 4E14A 4NENA 5SV2A 5LM3A 2WHQA 1QZZA 3CH4B 3DTVB 1AF4A 3E18A 3ESYA 4WOJA 4X54A 3ZJTA 1Y63A 2XUHA 3MK31 3DEJA 4B33A 2B1QA 2JRLA 5EUQB 1QIHA 3WLHA 3SQDA 3CNNA 5A5VA 3V2IA 4R81A 5FOQA 2IXDA 4ER0A 4KE7A 4PY2A 3AKYA 1EM8A 3A6JA 1OXBB 4UUOA 4DYVA 2IDMA 4ZEVA 4TTPA 5EIXA 2W90A 4PF1A 4EY5A 1YH3A 4RJ2A 4TT3A 4FNOA 2AG5A 2HK6A 1XTUA 4BQIA 2XVXA 1HG0A 1KK0A 1LZKA 4RL6A 1J2TA 4TL6A 5AI9A 3AP1A 3KQKA 2IYWA 1SHJA 3AHGA 5T4BA 2PZFA 2VJQA 2IYZA 3AF3A 3L8MA 1ZK1A 3TVTA 4Q3DA 1F8UA 5JJCA 3TIVA 1U1IA 5KWEA 1MW8X 4CIWA 3FLEA 2HWWA 4RH3A 1B43A 2I4NA 1BQ3A 4LJSA 1ZKMA 3DWIA 4O0MA 5JANA 1XVUA 4D9HA 2WVJA 3FA2A 4C87A 3EGEA 5JSFA 4FXOA 4DTIA 1H94A 3WDLA 5CEFA 1AQIA 1HMPA 1MF7A 1NKVA 2CE7A 3FROA 2NPIA 3JYQA 4M9XA 1CXZA 3VO8A 2HSEA 4IOLA 5C3MA 2NQTA 2B3TA 2Z2IA 4Q05A 3DKKA 3SXUB 3K1JA 2NYUA 4YDRA 3ZKWA 2FMIA 1G55A 3QUQA 1AC5A 5BSMA 4LE1A 5BQXA 2NZJA 2JGRA 3TZEA 1QNFA 3ED5A 1P0CA 3ZCXA 1ZLYA 4HYYA 3X44A 1CQJB 4L2IB 1T35A 1L4HA 4YT8A 2VDWA 4GVPA 3GGDA 4MWCA 4ZIRB 5A4MS 1KERA 1WZNA 2DWOA 2VDOB 5BMOA 5KDOA 1TGYA 4J75A 3K5WA 4TRNA 1BTOA 2WUGA 5JT1A 3FYUB 5GIOE 4FEAA 4I4TF 4YGXB 1NBEA 3H19A 3MBOA 4RH0A 3W6UA 4AZ3B 3SJBA 1YUMA 2E5FA 3BYZA 5EXPA 1KH1A 5EL0A 4FUQA 1H3FA 4H9GA 3LC1O 4XOUA 1LNSA 3I9V1 1NM5A 4S1TA 1FW6A 4RMIA 4AUEA 3Q9NA 2QTVA 3UK2A 3W2GA 8ADHA 2BFEB 3QFTA 3DDNA 3SXPA 4S1VA 1IN6A 3EVAA 1S4MA 1WDLA 4EX7A 5C1BA 4CL0A 1NQWA 2ZIXA 3Q41A 4RHTA 4C89A 1KDPA 1F7VA 2D6FA 2FR8C 5IUKC 2R96A 1MABB 1QANA 5G0VA 1BJKA 1L8OA 1E1LA 2EKLA 3BRQA 4M38A 1HE1C 2N46A 5TQ0B 2RHOA 2X0RA 3NP9A 2DQ4A 1NP7A 3A7DA 5CLLA 3GJZA 2ETVA 5D00A 4C4YA 3RFTA 3F3MA 3GUUA 4J2TA 1ZH4A 4FR2A 3ELYA 3VC1A 1JDUA 1UZNA 2GLUA 4G4IA 3TW8B 1U0HC 3II6X 3VJMA 1IVSA 2RD2A 4U4AA 4EIWA 2EERA 4MHTA 1C2YA 1VMAA 2GFQA 3IP8A 1TCUA 2EZUA 3AQIA 3OZIA 2CJXA 3KQUA 5I01A 4PYNA 4FK8A 4WTOA 5DTQA 5L3VA 3CG0A 4I66A 1JHMA 4M88A 3PYXA 5EKSA 3TPZA 1J42A 2C4VA 1NW7A 1T9BA 2CSUA 4DM3A 2AXPA 3UMJA 4XXHA 1Y3AA 5HUQA 2DH6A 4YI3A 1YHYA 2UXCB 3IERA 1Z5NA 3C3YA 3AEKB 3KLNA 1M34E 1VZ3A 4LJ8A 3JR7A 4XGQA 3DCIA 4WBNB 5GOZA 5JSKA 1V9CA 1GAXA 2O8BB 1UBRS 4AZSA 2JCSA 1LWNA 3UBMA 1WCWA 1ZBQA 1OW3B 1Z16A 2D7CA 2VWPA 4Q9LA 4C5BA 3EGWA 2O2ZA 4B83A 1Z35A 3AHEA 1MX1A 1RC0A 4QGGA 2P5YA 4KZPA 2MSCB 1XZCA 4L5AA 4WPGA 4JQYA 3L06A 4MCAA 5LLSA 3VU9A 5J3JA 2PR7A 5KYWB 4CLOA 4PPGA 4QUKA 3W0LB 5EJEA 5KJ1A 1N8TA 2VEDA 1P6QA 4DIFA 3LI2A 1K2VN 4GZMA 4PONA 1NFFA 3QXHA 1K5PA 2HF7A 1TF2A 3ASYA 2GCNA 3NJ4A 4QEDA 1AZTA 1SWWA 1SKBA 2OO7A 1T6YA 1BD4A 1GTMA 5AR1A 3WWCA 4X45A 4L4YA 4PGGA 5ENZA 1ZNZA 3D8BA 3E2IA 4BPBA 4OPMA 2EG9A 4WRRA 4IHJB 3AUTA 1UEJA 2ZTUA 2K7FA 2GILA 4K9RA 1IN7A 1ZD8A 5DHFA 3EMBA 4EHNA 2CFOA 4OXKA 3CJRA 2A0UA 3OQHA 1BKDR 1MAHA 2Q9CA 5CGQB 4OCZA 5TGDA 3RAEC 1K68A 4H6PA 5B7QA 3K3PA 5HKLA 3SSMA 1UBCA 2JEOA 3FYTA 5SZHB 1NPDA 3MTDA 2OCAA 1N8NA 3FG9A 3SP1A 4ZMSA 1T9DA 5JROA 1ZA2A 1WF6A 2WKPA 4E22A 4PZLA 3PBKA 1BU8A 1RXIA 1MO5A 4CM9A 1C9DB 5G3YA 4DCVA 2FP4A 2YN0A 2AIRA 4JYZA 1TTTA 3K0FB 3LGSA 5IZCA 1XIVA 4RVNA 2FG7C 2JIPA 3CFYA 5C9ZA 2QBYB 4IHKA 1R0KA 4PZ0A 2A3NA 3ID6C 5BW6B 4B3IA 2JGAA 1ADGA 1YWGO 2AN3A 1P5JA 3M33A 3A04A 1LBIA 2QMZA 3A7EA 3JWJA 4RY9A 3KM0A 5DTJA 2CMGA 4D96A 2B35A 4DJFC 3RHSA 5EJIA 2VDNB 1E1DA 1ZAKA 5KREA 4LV8B 3BGIA 2ZVDA 1GEEA 1KEUA 3FTDA 4JX9A 1QLHA 2YWCA 2ZAGA 2ZUVA 3WQQA 1KI1A 4DNFA 3P9PA 4H27A 4CGZA 4O1MA 2PYZA 5KNDD 1QFMA 3EF0A 4A6EA 2HDNB 2JFPA 4KWHA 3ND8A 4GLBA 5K4GA 1MO2A 2PYIA 2Z08A 5IFLA 1PZGA 1SOMA 2EJUA 3KD3A 1GGVA 3L7DA 5IH7A 2IOHA 2WWTA 4Q4JB 4LWOA 5KYGA 4GRAA 3RVOA 3SR4A 1JEYB 5AWFC 3FHLA 5G1OA 2OGUA 5A7HA 3T7EA 1IWBB 1FX1A 4JR2A 2X8LA 1K8RA 4HHEA 5FNZA 5IUJC 2QVXX 3GT7A 3KZXA 3S5JA 4KXYA 2CZCA 3WNZA 2UXBB 2GEFA 1KYQA 2IEYA 3L01A 2G72A 1NBHA 2IK8A 3DFZA 3IAUA 2EP5A 3B2QA 3OQIB 1X39A 1O96A 3FSEA 3VPXA 3W9BA 3O8OA 4QDKA 3DEFA 4WJLA 3RS9A 4DEYA 2D2XA 2OO5A 2VDVE 1DJQA 1V41E 2JI7A 2C29D 4NXNB 3ZE0B 1CUHA 1NMZA 4KVAA 4EVSA 2FGJA 3V2GA 2H9IA 4M55A 1FUIA 2J3DA 3CURA 4MW9A 4K6HA 4P33A 4ZT2A 5AXDA 3RTCA 3FOAA 1Q3TA 1LLDA 3FPGA 3PI6A 2WPDD 3WRXA 3UQYS 5T3YA 4E07A 3AVUA 5J2TF 2ADFA 1VKHA 1ORRA 2NYRA 2ODWA 1BQEA 3ENQA 3PEVA 4PAQA 4E5UA 2ZJAA 1FX0B 3OPQA 3VVCA 3WSTA 4GPEA 2XZOA 3AEQB 4KYUA 1XRRA 3B6MA 5FO1A 1C30A 1UPAA 2DTXA 3A27A 2DQKA 4IS2A 3PFWO 3FVWA 5BSGA 4A03A 5KJCA 4Y67A 4R9UC 4QQKA 3IL2A 4Z3KA 1COWA 4GP6A 1C3JA 2NU8B 5BMVF 1VPDA 1WQ3A 2AUTA 3Q8XB 2BZGA 4OU5A 4FFDA 5AM4A 1W4CA 4M1SA 3EVZA 5IHXA 2HHAA 3W5JA 2JANA 2AJBA 5JRZA 1OH6A 3DOFA 1W96A 1T5OA 1VP3A 4PZ9A 1SD1A 4MW0A 1EQAA 4NU5A 1G0OA 1CUUA 2G88A 4MVJH 3IXMA 2KHZA 3A9RA 3A70A 3RLIA 3PFCA 5JW6A 1AHNA 2K4MA 3EZGA 1JMVA 2FWIA 5AJTA 4C0JA 4Q18A 1XLUA 2V7EA 1E96A 2F1JA 2GBCA 2ZVJA 4MLPA 1CJCA 2HDHA 4J49A 4XWKA 3TIXB 2B8EA 1CJTC 1UC5B 2ATIA 4XVRA 4CXMA 4KOEC 1FDRA 4EI2A 1OB5A 4S24A 2BKAA 2I6SA 1EJ0A 5HKKD 4M9QA 3TX2A 4C01A 3JD3A 4EW2A 3ZDCA 3H42B 2PAFA 4WQMA 2O1XA 3ROZA 2PD6A 3N5KA 1YOBA 3S7ZA 4KUEA 3WTCA 1W48A 4E2WA 2G5CA 1WSBA 5IHPA 5FORA 2DF8A 3QVSA 2FPLA 3VR4H 4DUYB 4CDRA 2G77B 2ZOSA 1FTSA 4L4UA 3KJFA 4YFYA 3W7AA 5L6MB 3B3GA 1PWXA 3KZMA 3L6OO 1ZWKA 1U99A 3DE3X 3A06A 2VK4A 3I72A 4HF7A 2WM3A 3AJRA 2XB8A 3LT4A 3BSSA 4MI6A 2X76A 3WGLA 1AVTA 1GPWB 2XYPA 5D1NA 3KWFA 3QLJA 3TR0A 3BIFA 1GXSA 4KQCA 2RJOA 4O2AA 1YBVA 4S12A 3OCYA 2P6UA 1HC7A 4GR9A 2O2IA 5DBIA 5PNTA 1EYZA 2I54A 3UTCA 4KIFA 3WAGA 4RHFA 4JP8A 1QV7A 4X20B 4IEEA 4U7JA 2XD4A 3V46A 4KYTA 1W5EA 3K8YA 4GBED 3DXFA 5HF8A 4IKEA 2IKQA 3FR7A 3U62A 1YC5A 3G2MA 4CIVA 5LXTB 1GA6A 1HDRA 2XA2A 4BATA 1HM5A 4QNRA 5HZGA 1T0HB 2ZSHA 3CISA 3RSZA 5HPYB 4LCBA 1QAOA 1H05A 4GPD1 2QAGC 4CETA 3PTLA 4E6PA 1AB5A 1P9RA 2HRRA 4G09A 3J7AC 3U1VA 1RQRA 5B3JC 3G9TA 1QWOA 2QX7A 4G2TA 4K9KA 4W5JA 1WXWA 3RAPR 4OX9B 1EFVA 3Q2KA 3BFXA 4GO1A 2YNMA 4XEHA 3FSGD 5JBQA 1E7QA 1ZA1A 4CQMA 3CZCA 3FPJA 1G20B 2C2MA 2NOAA 4HDSA 4IIJB 3CZRA 1G38A 4DABA 1GUBA 4NDAA 1U81A 2WD8A 5IT0A 3WIUA 2YS7A 4MHOA 3L8ZA 3EWIA 4A1OA 5KQSA 2XHEA 3PXGA 2J33A 3VKWA 2ZYWX 2PHZA 1ZKDA 1UC8A 3RT7A 3RIHA 2O5VA 2V45A 4N8DA 3P9KA 4UTVA 5LL6P 2W6NA 4I8IA 5K3AA 4LY6A 5EA2A 1NRIA 1QKJA 4AJKA 1G19A 2W48A 1NYTA 3IGFA 3LOUA 4X1IB 5DFAA 1I0ZA 1CY0A 2HPHA 3GQBB 5EJ5A 1DKPA 5JH7A 1SUDA 1UC4B 1V5EA 1XJQA 4N9QA 4EPXA 2OXFA 4CM1A 4M8KA 3RFXA 2GTHA 5TV2A 3H2HA 1A3CA 1JVNA 1FUKA 4Q82A 3RS2A 3HY4A 3LFTA 1GA1A 3LBFA 4HGPA 1JR6A 4LRQA 1SXJB 4QKQA 2MJLA 1ESCA 1OXTA 3AZOA 4EX6A 5FLXA 2DCUA 2G07A 1TCBA 3QEJA 1FL9A 4FHDA 4F8EA 3H3FA 5I4IA 5CT5A 3HB1A 1YQXA 3K6SB 1CUAA 3MERA 3V48A 5BYAA 4MV1A 1E79A 3USZA 2EBFX 3IEVA 1XZHA 4BKQA 3W6OA 4MVJP 3KP1A 3T35A 1MB4A 2GZMA 3P45A 2IDKA 3O84A 4DGSA 4AS1A 4CW7A 3C6KA 3L9XA 1R0CA 3OE4A 4FZ5A 1R3DA 4MQ5A 3TLJA 1B2RA 3TZ6A 2PQ2A 3HVUA 3ONWA 5A4FS 2I34A 5KDDA 1QMGA 3A3PA 3VR2D 2Z6QA 1E6MA 1GPYA 1PBNA 4YJ2F 4CIYA 1VPTA 3I2KA 2SKCA 3KXKA 3Q85A 1UBFA 1M73E 3KTFA 1SUBA 4HFJA 1U7UA 2FSPA 3R4CA 5EE3A 5I3ZA 2YZ2A 2FJUA 5M34A 3FVTA 5DN9A 3W77A 3NOOA 4MTCA 2R9VA 2CB9A 2PH3A 2RHTA 3G1TA 4PAMA 5BW5A 1R6XA 4AURA 1BW9A 4UFPA 1KMMA 1KTIA 3DO6A 4DUGD 2CLIB 1T2CA 4CV1A 4N1AA 4HDKB 2GN4A 1DRUA 3TRDA 1IBSA 3L6RA 1T0UA 4HDMB 3SZ3A 3PLAE 4AG3A 2Z09A 5CFRA 1JHYA 4U00A 4II7A 2QMYA 2Z2ZA 4M21A 3EZFA 3GJTA 3JAKA 3RASA 3TMYA 4ENSA 5AVVA 3OX4A 1Z34A 4INZA 1RXWA 4YDHB 3WDKA 1QGUA 1M0EA 4YJ3A 5AQ1A 4FYHA 4X95A 1NONA 2ZG6A 1O6GA 3OCWA 4JK3A 3AF2A 3K2QA 3I37X 4HD8A 5DHSA 2AF3C 2X9LA 2E4UA 3UMBA 1ZHHA 2BMJA 2GUGA 4QVKA 4NI5A 4QQNA 5CYOA 2OB2A 3QLVA 4RM3A 4X8LA 1NE2A 1V2HE 3FLMA 2J6CA 3OEEA 3RRJA 2QRJA 2YRWA 3MBIA 4A8TA 4E1VA 2XTAA 4NBTA 3WJ1A 1V4BA 5CNIA 3X2EA 4MUXA 4D9FA 3AWIA 2B7CA 4IWNA 2IIPA 4C4RA 3GJ4A 3TCNA 1XU4A 3EXG1 4F84A 3WRYC 4A5OA 4RPCA 2QRKA 4QAJA 4FGLA 4X3OA 3KKKA 5C32A 4QFBA 1K3FA 3DW3X 1M2WA 3PUZA 4YAKA 1FC0A 2DFTA 3DHNA 4TV8A 2ZB3A 2HU5A 4WLVA 3ZJYA 4NKRA 1E4EA 1IN8A 3VVMA 2KBEA 2BKEA 4JN6B 1LF0A 3UK0A 2Y1GA 1YKFA 2W2LA 3CT4A 2XEXA 1FQOA 5C8ZA 5FOVA 4REMA 5F2NA 3U5TA 1IY9A 1G20E 1JHXA 4DEXA 3SCZA 1DAMA 3CQ9A 2Q0SA 4CI0B 3CW2A 3B6ZA 5BWNA 4IX1A 4Q21A 2YVUA 3QHPA 4FXPA 3LP8A 4ETNA 3DTVD 3H6GA 5JZOA 2XCQA 2ISQA 2W2MA 3NT4A 4GUAA 4GR5A 2V9CA 3LT2A 2JFNA 4JC4A 4LBZA 4MZXA 2HF2A 1L5HA 3VR5D 3DWEX 3F4BA 4CMCA 1SK9A 3R41A 3H65A 1GILA 5ALWA 3UIEA 4IO0A 3EPLA 1NJ2A 1PHPA 1UK8A 3GYBA 1E2FA 3OP1A 2IXFA 4J1TA 4PSDA 1OASA 2IY7A 5BV7A 2BN4A 2X7XA 4ASUA 2BE9A 1CD5A 1CX9B 3TKLA 5IFKA 2NAPA 4AO8A 4DDVA 3LUAA 5A5GA 4R4JA 4FN5A 1VLZA 4YMSA 1SIUA 2JHCA 4WEOA 1A4IA 2QRVB 3A1DA 4PIMA 1ZNYA 1LKZA 2H1SA 4KQIA 5DIFA 5TE9A 1GNQA 2ZTLA 4H6XA 4F2DA 2J08A 4GI1A 3IT2A 4RYDA 1QH1B 1UQRA 4HNTA 3CX3A 4CMEC 1YJQA 2LDXA 2JI9A 3C6ZA 1I4TD 2GD0A 4F4DA 1RAHA 2PMEA 4L9WA 1J6UA 4JJAA 5LJIA 4GGPA 1DWPA 2AOTA 2XE6A 4RABA 3TB4A 3BZBA 3HDVA 5L3SA 2OVBA 1IL0A 1USUA 1F6WA 2A9JA 1Z07A 2ES4A 3KPJA 2ZUSA 3QWIA 4PLPA 3WWPA 1LPAB 3ZJVA 1XFAA 4ZAVA 1L5MA 2AMVA 1H9CA 3NVDA 4EUEA 3OFVA 5BWBA 1J7JA 2PEZA 1FNDA 1NF8A 1YZVA 2HAEA 2Q45A 2ZUWA 3BXZA 3JS5A 5E4JA 4AJLA 3U4QB 4H17A 1G42A 2R5NA 3PHJA 4BX0A 1YFKA 4MWGA 1X80A 2IS4A 4XQGA 5JXGA 1JPVA 3ADPA 1N75A 3ANSA 3GA0A 4LXUA 2OFPA 1V3TA 1O03A 1DIRA 3QOFA 5DOVA 5E2IA 5JECA 3M6AA 2UV8A 3DVLA 4YP7A 2Z4SA 4HWSA 4WKBA 2X4LA 2COUA 2FW9A 1DRJA 1DS6A 2H2HA 2Z1DA 5FCDA 4E1BA 2K87A 2VP3A 3G3EA 3SM9A 1QGDA 2AGVA 1T3LA 1I6LA 1PLJA 3ECSA 5THQA 3WK5A 5BNWA 4RTMA 1GGFA 5MFZA 4GE3A 2J3HA 4BMXA 3K0KA 3D9QX 5KYTA 4F6RA 2AQIA 3DHVA 2DSTA 2KYRA 1PJBA 1ISGA 1XZIA 3ZBQA 2DFKB 2OUIA 1M2KA 4OD0A 5E7IA 3TG2A 3TAXA 3VU8A 2W6QA 3OQNA 1E98A 2LWIA 3L1KA 1NKSA 2GYVA 1PEAA 3L7CA 2G71A 3WISA 5A4JA 4QZVA 3VC2A 4U2FA 2XDQA 1O9GA 3DL0A 1N5OX 4YYZA 4P9NA 3HVJA 1U2PA 3OCCA 3LBHA 2EJBA 3QELA 3SQOA 3RODA 2OXCA 3SPXA 1VECA 2H0RA 5HSGA 1V9LA 1THTA 1SVIA 4FSDA 4GKVA 2JIZD 2WV7A 1EX1A 2VATA 1Y9AA 1I2BA 1Z88A 1QQBA 3GNQA 1CRWG 3FWPA 2G04A 2GXQA 3Q3EA 3FBGA 4J0HA 4K9PA 3DMHA 3IBYA 3LCRA 4R16A 3AM1A 1UXOA 2OBXA 3ICOA 3CRRA 1U80A 5IJ0B 2Y05A 1V4VA 4G5XA 4OHZA 4I1IA 4L16A 2WP0A 5TMPA 3L7YA 4L78A 3WWYA 3L43A 1EK2A 1JQEA 1MNQA 1YR2A 2F64A 3JPYA 5ALEA 3HSYA 4PHHA 5IN4A 4XFDA 5D51S 4DY6A 1REQB 3OEHD 1HG1A 1ADJA 3ET5A 2Q46A 1PIWA 1W73A 1WMBA 1LBSA 2PV0A 1OI7A 4PAGA 1QBKC 5KWIA 4UKDA 4ZQCB 1UMDB 4FIZA 4HGRA 1KI4A 1Q1EA 4I9NA 4J4HA 3ROPA 1Y42X 2H2AA 3AERB 2E6KA 5MN5A 2P2LA 2WIDA 3QUSA 4KE6A 1QV6A 3KHKA 3A1EA 2WHXA 2H5EA 3GG9A 4DQUA 3PUXA 3ZCSA 2RBEA 5JMWA 2XSZD 3M9XA 1SUFA 4G1CA 4MMYB 4TRJA 5FIUA 1JTFA 1YBHA 2CL0X 2FRDA 1SRQA 4BKMA 1RZRA 3AR2A 2Q5FA 4H2DA 2R8OA 4D8TA 1NF3A 3AETA 2XUJA 3SYNA 2CV0A 3JYNA 4M9SA 2BEWA 3EUEA 1OXSC 3SS7X 4QUEA 1GZVA 3WJAA 4WXRA 2ZJ0A 4FB5A 4MPRA 1XX6A 1R4NA 4YMLA 3AUXA 2OV6A 4QLBA 4Y1RA 5JXJA 4X6XA 3L6BA 4EHLA 4Z4GA 3OFKA 3UK6A 4K9SA 5B30A 2ILVA 3SZUA 1J8FA 1JIJA 3RM3A 4UE6A 3Q8KA 2UZ1B 1QV9A 3CN9A 4LXTA 5BN4A 2FQ1A 4RULA 4OSEA 2X1VA 5HM6A 4OUDA 1DCFA 2QL6A 3HZOA 4EPWA 1NHWA 2F8SA 2MYUA 3RU2A 4R05A 3C1UA 4HH0A 3T3GA 4RY0A 1W4LA 2FPGB 1Q57A 3Q7PA 4NYJQ 5CFMA 1EWRA 1GCAA 2QN7A 3AB7A 1WG8A 4QVIA 1CFZA 3BCRA 2VH5R 1NN5A 4FYPA 1FNMA 4FGSA 4JLNA 4L4RA 1Q2UA 2VYVD 1IHOA 2TRSB 3PQ7A 4Y6QA 1VE3A 3DUFA 3MS4A 4GC5A 2OV4A 3RIGA 2ZZKA 3M6VA 4EZEA 3I5YA 2QPOA 3DGEC 4JL8A 4X41A 3CLKA 3BM5A 5EP3A 4GYKA 4EAAA 1M2GA 2CJWB 1JDSA 3AEXA 3Q98A 4F7WA 4IHAA 3MB8A 4C6SA 3BZWA 4XW2A 2XLBA 2ZAIA 4ZALA 1Z47A 3S1LA 4JL5A 4S0ZA 4BMZA 1LW7A 1QH8A 5B2EA 1HYEA 1NZFA 2GSDA 5C8YA 2FMFA 3PRJA 1NA5A 3UATA 2Y77A 5COAA 3KEFA 1IN1A 4K28A 3PA8A 4G2NA 4XQCA 2JD2A 4XJXA 2I8AA 2J1LA 3DFFA 4A2QA 5BYKA 2D0PB 5DSZA 1JA0A 3ILSA 2XOXA 3K15A 1EB9A 1DP4A 5AW4A 1LDBA 4OQEA 3TZBA 3G2KA 2OPHA 3CEJA 2SKEA 4IXDA 4XLTA 3NHSA 4W63A 2V9PA 2Y93A 3EGVA 1L7DA 1M1NB 1QTNA 1G18A 1GCIA 3EQ2A 3R6LA 4EUFA 3LLCA 5ABPA 1RS0A 3ZE9A 4IDQA 3JQFA 4OP2A 1I2AA 1YBAA 3MINB 4U7GA 4A91A 1ZW1A 2OA0A 4URFA 3KUUA 1QQ5A 3DO5A 3GWZA 4OKNA 4CEIB 4WGGA 3BERA 3LLVA 1QIDA 4CKBA 2CY0A 2FUEA 3CUWA 3HPQA 2Z9BA 3IP5A 3WWDA 4ALIA 5MGNA 3NM5A 3FGPA 2R1VB 1IK6A 4XEUA 1JG7A 2H1VA 3TD9A 3RUIA 3AOEA 5HS4A 4OK5A 1X1QA 4B31A 3W8RA 2D1TA 2QQGA 2YUTA 1N2SA 1XMSA 3TLGB 1YZQA 4XWWA 4Q1AA 2HN9A 2P9GA 5E9QA 1PU2A 1Z0KA 1K6EA 1VRWA 4Y2JA 6PFKA 1NLZA 2A8YA 2HM7A 1BN7A 3K0AB 2YMLA 4W9MC 2G28A 5JTUA 4JFRA 2OGSA 3RT1A 1CJMA 3BK1A 3QFSA 3EXHC 5GONF 5DZSA 4YCNA 4M60A 4D9IA 3HTXA 2VJYA 2NSHA 3NBUA 4U7DA 4KVZA 3AVXA 4ZI5A 4Q39A 5K0CA 4X0EA 2POQX 2VJOA 3MMSA 4YECA 1H1LB 1AUVA 4J0GA 5EZ6B 1VIVA 3V97A 4CMIA 2UYYA 4FEGA 4ROTA 3TZLA 5EYPB 4UNPA 5AK4A 2H7YA 2DHCA 1U5AA 4JBYA 2CLEB 4DILA 5C8VA 3QENA 4HWPA 4W4TA 4DCJA 3ETDA 3C70A 7MHTA 4B40A 1Z73A 1ZOSA 4JLUA 3ILVA 2EG5A 2YVKA 1WS6A 1RYEA 1U3UA 2X77A 1WZUA 3HA2A 3PQ4A 1II0A 5BR8B 1RT9A 4KYVA 2WKRA 4BFXA 5JRDS 2FV8A 4DMGA 3QP9A 3TDNA 4G1BA 2A59A 2HCTA 2JEZA 3GGGA 3V1NA 3I0MA 2CNLA 2GXSA 4Z6KA 1RKXA 1DX4A 5DCWA 5JCJD 3DMDA 3W8FA 3H4MA 3K9QO 1EP9A 4XJSA 1EWYA 1TD9A 2NU9B 1H0RA 1DEAA 1L5YA 1Y8RB 3SXUA 2JH9A 4ARVA 5IASA 3RG2A 421PA 3AGPA 2QVZX 4XD7D 1N9KA 1Q1NA 1DC8A 3QSYA 3TL3A 4XE5A 4EMBA 4PG6A 3ZLJA 4RLHA 3UWOA 3L1UA 2L18A 3FRJA 4ZVPA 1RFLA 1JXQA 1ORTA 4QDTA 4ZIRA 2L0XA 1UCFA 4DR4B 2J9FA 2PUTA 1OUMA 2WSBA 1UXHA 4G5FA 3FYSA 4UUQA 4AZ3A 4K7JA 2H7CA 5AM5A 3T12A 1KHHA 1E9EA 4DBLC 1XTTA 4UQPA 4OXRA 3R0VA 1KO8A 2BGTA 1DC6A 4KEAA 2VJBA 5HF5A 5H16A 5K3BA 3FOWA 2QL7A 4X8MA 2Q8NA 5DH9A 2H5IA 2IHYA 1UFQA 3IP6A 4C04A 3O75A 5K1ZA 5LP1A 1N57A 3JQ9C 2C1ZA 1FFWA 4C4PA 1HLDA 1WLYA 3CE6A 3DS8A 4MKFA 1WMFA 3BE6A 1GRNA 3ECAA 3V1KA 3EAFA 5TQVA 1WOYA 1BKYA 3EQ9A 1J0DA 4L5JA 1CLUA 4H7DA 5DKFA 4D97A 3GL9A 3K6KA 4OHUA 3A3OA 3ZDXB 3VVBA 2YN4A 4C4XA 1MABA 3DFKA 4QBTA 1JJ7A 1I13A 3TW6A 4PR0A 3HNPA 3W3AD 4AY6A 1NN0A 1D2HA 1ZIPA 2J32A 2KMLA 3WGYA 4EARA 1TKAA 3C7CB 1XK7A 1M6WA 1TYCA 5COQA 2FLWA 4MP3A 5EPUA 9ABPA 3NTLA 3Q72A 1QOZA 2XWQA 4KE9A 1TT7A 1QXSA 2F3TA 5P8WA 4LECA 4XR4A 1O95A 2HLHA 2C8KA 3PGJA 1KJIA 2DUJA 3TW8A 5E7QA 1QYWA 4IDBA 5T4FA 5WRFA 2B5VA 5BWOA 4ND4A 4MV5A 1SNYA 1J5PA 1E5VA 3T7AA 4P58A 2J6HA 2X1HA 1IONA 2VDPB 5AVYA 2I4LA 5H02A 3OTOB 4FMPA 3SEFA 2A9QA 1KYYA 3QU2A 1EG7A 3RLFA 3RR2A 4W6ZA 5C1DA 4KPEC 3P7MA 5F33A 1FDWA 5F7XA 3PQCA 3EBOA 4B8ZA 4WBNA 1PJRA 1MEOA 1ZK0A 2E1RA 1Z06A 4R98A 2EGUA 3O8DA 4PLYA 3FNGA 1PN3A 2ENWA 1MB2A 5E9JA 5HKOA 4R84A 5FNVB 4GM1A 1F14A 4OJNA 2J4DA 2BT4A 3KR2A 1OXUA 4D4JA 4YLYA 3OTIA 3LC0A 4GMXA 3M6LA 1V1MA 3EASA 1M9NA 2B6HA 1IQRA 3T8YA 4JNKA 4D02A 1H4SA 3QTTA 4KDEA 2Q28A 4G36A 2XOKA 4FDLA 1YTLA 4CMAA 3O4RA 1WCV1 5FPHA 3OZCA 3PGMA 3O4VA 4UM7A 3C3MA 5FL7A 4TTAA 2P9EA 3VX4A 5FO0A 1JEAA 4NYJR 3GUVA 1E62A 3TFQA 1P91A 3JYHA 2GPBA 4IH9A 2X2FA 2OLJA 1FMLA 3G8DA 3M2TA 3UBTA 1ZUIA 4MYCA 1A2KC 5KQGA 4Y7DA 4QIHA 1BDBA 4PFJA 1VB5A 1YZFA 3U1TA 2YY6A 3CWQA 3I05A 4I8XA 1T5LA 3BWXA 1LLCA 3UMVA 4CHGA 3WJ7A 1SRRA 2HSJA 1A9RA 3Q5EA 3TVDA 1HQYE 1L5LA 1AKYA 4X65B 2JF0A 2PZGA 3LPAA 5DV9A 3HYRA 2R97A 3LX6A 3QI2A 1C8KA 4US1R 4FE7A 2HR1A 3L7KA 2BGUA 1WVGA 1IZZA 1WXEA 3DTTA 4QGBA 2QBYA 1SOVA 2RGYA 1PT6A 1SG0A 4P3XA 1JHQA 5LZ5A 3GLGB 1RI5A 1U31A 2FHPA 1HFEL 3PXAA 4J2HA 2Q4DA 5DXAA 1H3EA 3ILYA 5LC1A 2QYSA 4C0LA 3F4LA 2ASVA 1M6NA 5FBZA 4DR5B 3I04M 4R9RA 4I19A 1WUHS 4FYWA 3HADA 8MHTA 4D8UA 2W6ID