2WA1A

Structure of the methyltransferase domain from modoc virus, a flavivirus with no known vector (nkv)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
248
structure length
226
Chain Sequence
GICSSAPTLGEIWKRKLNQLDAKEFMAYRRRFVVSRGTAKLAWIDERGGVELKGTVVDLGCGRGSWSYYAASQPNVREVKAYTLGTSGHEKPRLVETFGWNLITFKSKVDVTKMEPFQADTVLCDIGESNPTAAVEASRTLTVLNVISRWLEYNQGCGFCVKVLNPYSCDVLEALMKMQARFGGGLIRVPLSRNSTHEMYFVSGIKNNIMGNVTAVSRQLLKRMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords NON-STRUCTURAL PROTEIN 5
publication title Structure of the Methyltransferase Domain from the Modoc Virus, a Flavivirus with No Known Vector.
pubmed doi rcsb
source organism Modoc virus
total genus 80
structure length 226
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2wa1A00
4HGYA 1UFKA 1IM8A 7MHTA 1D2HA 3OCJA 3QOWA 2WK1A 3JWGA 3P2IA 2ZIGA 4LG1A 2I7CA 1SQGA 3HCFA 4AZSA 2O57A 3K0BA 4WVLA 3E05A 4RYLA 1M0EA 4C4AA 4DKJA 3NDJA 2CWWA 2OKCA 3TR6A 5C1IA 3NWBA 3P71T 3C6KA 1RJFA 1OR8A 1EG2A 3P2KA 4R8SA 4KRGA 4YUWA 3HP7A 2NYUA 5EMLA 4E30A 3UJBA 2C7QA 2VDUE 4PGGA 3M6VA 1QZZA 1RJDA 3VYWA 1RI3A 3MAGA 1I4WA 1KPGA 1SUSA 2G70A 4GBED 5FQOA 3THSA 2QM3A 5FQNA 5K0LA 5DXAA 3TOSA 5DSTA 5EG5A 2AOVA 3FUTA 2I9KA 3FRHA 4X1OA 3G2QA 3KQOA 2P3LA 2CMGA 3SMQA 3OE5A 5DM2A 4KDRA 3BGIA 1VP3A 5CVUA 5FUBA 2GH1A 3LPMA 4U7PB 3GGDA 1P39A 5T67A 1KPIA 4KIGA 3EEYA 5DM4A 1XDSA 1U2ZA 2OY0A 1VPTA 3QV2A 2HWKA 2YQZA 3TPZA 4P7FA 4HH4A 4R8RA 3T0IA 4RTQA 2IBTA 1TW2A 2XBMA 1B42A 3G2MA 3MGGA 1BC5A 4G56A 3UZUA 3G8AA 3ELYA 3P8ZA 2Q41A 3KQMA 4E2YA 2EJTA 2ERCA 2AN5A 5FA5A 5HIKA 4C07A 2PLWA 3E7PA 3P9CA 2PSSA 5KS2A 3VC2A 3OU2A 1AQJA 2I6GA 2Y1WA 5CCXA 2PVCA 2AVDA 1G60A 4GF5A 1YZHA 4XUDA 2VS1A 2B2CA 2K4MA 3BWBA 4Z2YA 4RTKA 2G72A 2HNKA 3NVKI 3HNRA 1RJEA 2JH8A 3PFGA 1P1CA 3ELDA 4LWOA 2ZZKA 1R8YA 1JQEA 2PX4A 1YZ3A 2P8JA 3TLJA 2C7OA 3FRIA 3I53A 1X1BA 1NW7A 3HVKA 4RTRA 4ER6A 2PX5A 5ICGA 3PS9A 2G1PA 4BY9E 2ZIEA 5CVEA 5FADA 3UJ8A 3ID6C 3LDUA 3SGLA 1SKMA 2P35A 3AWIA 5DX1A 4X61A 2P3OA 4OQDA 4DM3A 3BZBA 4KIFA 5FULA 5FTWA 3GRRA 2P40A 4CKBA 3LSTA 3TMAA 5DX0A 2JJQA 3ELWA 5GM2A 1AV6A 2GPYA 5HIJA 4GEKA 3VC1A 3OE4A 3DMHA 4OA5A 1NW8A 1EJ0A 3TM5A 5ERGB 3EVEA 3AXTA 1R6AA 5DTQA 3BWMA 3GIWA 4RSRA 5K0NA 5DPMA 5M5BA 2YXLA 3MERA 2FK8A 4GOND 3A27A 2Z6QA 2IH2A 2ONYA 4MWZA 4GC5A 1G38A 5K0JA 1JG4A 3F4KA 1JQ3A 3EMBA 3EVGA 1UWVA 4RVHA 5CVVA 3FPEA 4RTJA 3CCFA 4R05A 3E8SA 3HCBA 2PWYA 3KQWA 3A25A 1L3IA 1XJ5A 4DQ0A 2ZIFA 2O05A 2EFJA 1VE3A 3GWZA 3KR9A 2FYTA 1NW3A 3DTNA 1RI4A 1O9GA 3MTIA 1NBHA 3L8DA 3EGEA 4KW7A 4PIMA 4ER3A 2QRVA 3NW9A 3RODA 3T7SA 2A14A 2OZVA 2ZWVA 1R74A 5GP1A 1KYZA 3CVOA 2IIPA 5EMMA 3BT7A 1G6Q1 3HCCA 4BLWA 3G5LA 3TM4A 2QYOA 4XUEA 3V97A 1FJXA 3D2LA 1RI1A 3IEIA 3KQVA 2AN4A 4JXJA 3C6MA 4QVKA 4A6EA 3UJCA 1QAOA 4RVGA 4BP3A 4NECA 3TRKA 3SXJA 4RTNA 3A7EA 4F85A 3EEOA 1BHJA 1WY7A 2ZBPA 3AXSA 3IYLW 5EIFA 4E32A 4GOLD 2YTZA 5BXYA 5KQSA 4GC9A 1IY9A 2PKWA 1N2XA 4DZRA 5KQRA 3ELUA 1YB2A 4RWZA 1EIZA 3FUXA 3OU6A 3R6TA 2JHCA 3DXXA 3UA4A 4EKGA 1D2CA 1R18A 3U81A 3EVZA 4PYQA 5GOZA 5DWQA 1FPQA 5LQAA 5BP7A 1KYWA 1MJFA 3DH0A 4LECA 1VL5A 4KVZA 3Q87B 4IWNA 3FYDA 5K0GA 5EQJB 1TW3A 5KYGA 2ZFUA 1IXKA 1VBFA 3FTEA 1JR4A 1N7JA 4QTTB 2O06A 3KPWA 4M38A 4U7TB 2AN3A 3KR2A 3THRA 3BGVA 4EK9A 2UYQA 1WZNA 5CCBA 3HA7A 5EC8A 3R0QA 2VP3A 3S68A 3HCAA 2NXCA 5HZMA 1UIRA 4OBXA 3GCZA 3PB3A 3HVIA 1Z3CA 1QAMA 3B7PA 4OA8A 4X63A 2YR0A 2OBFA 2EX4A 1KHHA 2H00A 2CL5A 4PYLA 3KHKA 3P9IA 2NP6A 1P1BA 3FPHA 3KPVA 3GRUA 3OZRA 3TKAA 4DMGA 4AZWA 2FHPA 2VDVE 2ZTHA 3EGVA 2FK7A 2OYRA 5IKMA 4FP9A 2PT9A 3MHTA 3EVFA 2P1DA 4QPPA 2AOTA 2BM8A 2XYVA 3AY0A 3B5IA 2B3TA 1DL5A 5GWXA 4CKCA 3FUUA 5LQJA 3DP7A 4YV0A 2IFTA 1JG1A 4QVGA 1JTFA 3MB5A 5LR6A 3OFJA 1JG2A 4B17A 1I1NA 1L3CA 1VP9A 1F38A 1SQFA 1ZGAA 3M6WA 4RTOA 3EVAA 4DCMA 5K0BA 4YUZA 3LCVB 2CKDA 2VDWA 3DMGA 2H1RA 4YUVA 5F2NA 5EMJA 5HOQA 4QDKA 4E70A 5HILA 2Z6UA 3CJQA 4PYOA 2NP7A 3TFWA 1T43A 1PJZA 1HNNA 1V39A 5FWAA 4FSXA 3HA3A 3GO4A 2XYRA 4M36A 3FYCA 3MQ2A 4RVDA 3GXOA 4A6DA 4C04A 3P9NA 5K03A 3NTVA 4BLUA 2ZBQA 2PGXA 1NV9A 5FWDA 5KVAA 3I9FA 2BH2A 1M6EX 3SSOA 1NW6A 3LCCA 2O0LA 3ANXA 4PCAA 4ER0A 2P3QA 2ZZNA 3RW9A 5K0FA 2GLUA 3B3JA 4MTLA 2XVMA 3PVCA 5K09A 4CTJA 2YX1A 4P58A 4PCLA 1XDUA 2ZZMA 3HCDA 3HVJA 3AJDA 5K0EA 4FR0A 4HSGA 3EVDA 5HEKA 1YFLA 4QQNA 4FGZA 4MHTA 3UBTA 3I5UA 1QAQA 1VIDA 3HM2A 4XCXA 2NXJA 3DULA 4BLVA 5BW4A 1ORIA 3C0KA 3IHTA 2YXDA 5E1OA 4PYNA 4AUKA 1DCTA 4RVFA 3DLCA 5FCDA 1R00A 3LCUA 4BP1A 4YUYA 1SG9A 2O07A 1H1DA 4O29A 3REOA 4DCGA 4RTPA 4DF3A 3PX2A 4ISCA 1KR5A 1EAMA 3UFBA 4V0QA 3M70A 1ZG3A 2GA9A 4EKIA 1G8AA 2AZTA 2PXCA 3IV6A 2ZLBA 4IV8A 2LD4A 2HTEA 1NW5A 3FPFA 4AZVA 3DR5A 1Q0SA 3A4TA 3DXZA 2EG5A 3KQYA 3M6XA 1AQIA 4ATNA 2OB1A 2HMYB 2G8NA 2QRVB 3EPPA 4RTLA 4GQBA 5T6BA 9MHTA 3DLIA 5LQRA 2IPXA 1XCLA 4HRAA 3OFKA 4E31A 4E2XA 3SX0A 2C7PA 1NT2A 3RIEA 3PLAE 5DXJA 2H11A 3FUVA 3GDHA 3P97A 3V8VA 4POOA 1KIAA 2ZSUA 3SR4A 4F86A 2AOXA 4AX8A 5FA8A 4PNEA 4M7RA 1Y8CA 3G5TA 1FP2A 5ICFA 2YUIA 4OX9Y 3EGIA 3ORHA 2NNWB 3SSNA 3TQSA 1TPYA 1PRYA 4L7VA 2JH9A 3BXOA 2AVNA 2DULA 2EJUA 3FTDA 5K05A 5GIPE 1N7IA 5EGSA 3FTFA 2ZCJA 2CMHA 4PWYA 5U4XA 3P9KA 3GRZA 2BR3A 2N47A 4P7KA 5CM2Z 3SVZA 5LQKA 1M6YA 5E1BA 4PINA 1YFJA 3BKWA 1G55A 2NXEA 4FS8A 5EKXA 3G7UA 5DT2A 2OB2A 2GAFA 3G2PA 4CXMA 4EQZA 4KDCA 2WA2A 2ZWAA 3C3YA 3GRYA 3X0DA 1ORHA 4CWAA 3GNLA 4PYIA 4QPNA 3T7RA 3QOXA 3UWPA 3EVBA 4E33A 3KQQA 3O4FA 4YV1A 2UZ4A 3B3FA 4C06A 8MHTA 3JWJA 3PTAA 2ZULA 2FPOA 3A7DA 3MTEA 2UYOA 3BGDA 3VSEA 3HTXA 3M33A 3PFHA 5EHIA 4PGHA 2JHAA 3DOUA 3M6UA 5DSXA 1G8SA 5CIYA 1D2GA 3DXYA 1MHTA 2AOTB 1NE2A 4V0RA 2YVLA 1ZGJA 5EOVA 5G02A 1KXZA 3BUSA 2IP2A 3LECA 5IH3A 3T7TA 5GIOE 2BZGA 3K6RA 1L9KA 2QE6A 3TKYA 5HFJA 3FUWA 2VZ9A 5ICCA 4PYKA 2IH4A 5DTMA 2R6ZA 5E1DA 2PT6A 3OZTA 4F84A 4YUXA 5FHQA 5ICEA 2HR1A 4IKPA 3KPUA 5LSAA 3ERCA 2NXNA 4K6MA 3R9XB 4OQEA 1JG3A 3UJDA 1VLMA 2I62A 4CKEA 5HIIA 3LX6A 4Y2HA 2AR0A 2Y1XA 4CTKA 4FSDA 1X1AA 3LBFA 5CVJA 2ZVJA 2WA1A 2BM9A 1NBIA 2BR5A 3R3HA 1EJ6A 5B1SA 3LDFA 5EPEA 5JUWA 4XUCA 2PBFA 2AS0A 5DTRA 3LL7A 4P7GA 5K0CA 5P8WA 3OZSA 3PX3A 3GJYA 4KWCA 1SUIA 2BR4A 3NVMB 4HC4A 4UOEA 3KQPA 5DM1A 2PXXA 1X1CA 1YUBA 1ZQ9A 2E5WA 3KQTA 2ZW9A 3LHDA 1O9HA 2UYCA 3O31A 4GOMD 4QTUB 5LQCA 4RX1A 3PT9A 2AOUB 2B78A 3LDGA 1FP1D 3KR0A 3LKZA 3LKDA 3I58A 2C7RA 4Y30A 3EMDA 4E2WA 10MHA 1XCJA 3BWCA 3FTCA 5E1MA 2HV9A 1RI5A 4GUAA 2OXTA 3H2BA 3UJ6A 5EKUA 5HIMA 5C0OE 2QY6A 1WXWA 3JWIA 3OU7A 4P7JA 2DPMA 2AOUA 2IDJA 3CBGA 5CVDA 3GRVA 5F2KA 4X60A 3MCZA 1XVAA 5EZSA 4PYJA 4YMGA 5DX8A 1BKYA 5F2OA 1NV8A 5FHRA 4C03A 4ER5A 1XTPA 5BW5A 3BWYA 5D1HA 4RTMA 1INLA 1Q0TA 4X41A 2IBSA 3G89A 3MCTA 3NWEA 5LQUA 3KQSA 4PIPA 2ADMA 5DRTA 3ER9A 3GU3A 1BOOA 3LBYA 1XXLA 2ONZA 4QDJA 3DMFA 1F3LA 2YXEA 2F8LA 2ZBRA 3KPYA 3BKXA 3FPJA 3HA5A 3Q7EA 1YF3A 1JQDA 4OBWA 4YV2A 5E8JA 5K8VA 2FRXA 3UJ7A 5E9WA 3E23A 1RI2A 1WS6A 2PWPA 3OPNA 4ZTBA 4RTSA 3HEMA 1HMYA 1X19A 1XDZA 1FBNA 2B25A 3UA3A 4DA4A 4R6XA 3EVCA 5K01A 5H02A 5EEGA 2OPBA 4MQ4A 4PYMA 4WXHA 5C9ZA 5LQNA 4GOOD 3DUWA 2OO3A 2IDKA 2B9EA 3I64A 3SM3A 3CKKA 3CGGA 1X1DA 2P7HA 2XYQA 3NDIA 4HG2A 4IV0A 2JG3A 5E9JA 3UJAA 5E2AA 1WG8A 1DUSA 5EIWA 3UJ9A 1NKVA 2GB4A 1EQAA 2PJDA 1O54A 5E2BA 4FT2A 5EHGA 1KPHA 3KPJA 4C05A 1KP9A 4E2ZA 5CD1A 5MHTA 3CJRA 4HGZA 4LWPA 2P41A 3KU1A 3SSMA 1JSZA 1ZHFA 2G71A 2IH5A 2GS9A 1WXXA 4FZVA 1RJGA 3JWHA 3LGAA 5DLYA 5GINE 3G88A 2AOWA 3C3PA 1QANA 3FPGA 5D1NA 5EEHA 5EVJA 2R3SA 3B89A 2ESRA 3KKZA 2PV0A 4FT4A 3HCEA 3M4XA 1ZKDA 5E9QA 5EZQA 3NJRA 4R6WA 4ER7A 4QQKA 3ER8A 2PY6A 2PXAA 4HTFB 1QYRA 1I9GA 4AZTA 3A26A 2P7IA 3P2EA 4YMHA 3CJTA 3G8BA 5T64A 1SVUA 2FCAA 3B3GA 4RV9A 1L1EA 1JTEA 4EMSA 2IGTA 4HTFA 2XVAA 3WSTA 1L3BA 1R8XA 5DRYA 2Z6AA 4H0NA 4M37A 3ME5A 1JSXA 3CC8A 2KW5A 3R24A 5JR3A 4MIKA 4PONA 5E8RA 1AF7A 3G2OA 3NMUF 3FZGA 4EVIA 2ORED 2V74B 3KR1A 1P91A 5CUQA 5DM0A 5EMKA 4C08A 2UYHA 2PX8A 3O7WA 3HVHA 5GM1A 2V7EA 2JHPA 1VQ1A 2PX2A
chains in the Genus database with same CATH superfamily
2WVAA 4B2IA 1NNI1 3I92A 4TKLA 3K09A 3UANA 4HRYA 2K5UA 3PHIA 5D8DA 4LMAA 1ZIOA 2QMOA 2I3BA 5HZHA 5E4TA 3RIYA 4P0TA 3K9FC 1E1KA 1Z88A 5IW8A 1C7QA 3AB3A 1GG2A 5CDUA 3AU8A 1JDTA 3OZEA 1ZOSA 4N8EA 5IUKC 5BSGA 2ZUDA 5JW6A 4CG0A 3NCTA 4LK3A 5FBRB 4BNTA 2NYUA 2WSBA 3NAGA 3LJKA 1N77A 1LPMA 4RQTA 1U2EA 3LQ2A 1E3SA 1RI3A 3SS9X 4D9IA 4LC0A 3NXKA 2HLNA 2B34A 2AOVA 4DBZA 5J40A 1PVOA 1O6ZA 3RUHA 1ABBA 1P3DA 1JH8A 1Z0JA 1E58A 1T5HX 2CJFA 3JY6A 4XVHA 4DG5A 2C20A 1CQWA 2WUFA 4RESA 1YSCA 1ZUNA 1KZYC 2HH9A 3OURA 1W2GA 4TWAA 3D5QA 1KPIA 3ESQA 3FVVA 3KXLA 1J0BA 2CEAA 3OLWA 3AV3A 4CVNA 3FPKA 5EJ5A 2DUUA 1U90A 1Z4OA 4ZALA 2Z6AA 1DQZA 5JIBA 1EMDA 4RTQA 4D5EA 1HKUA 4L7QA 3VNAA 2WTAA 5KBYA 3K94A 3IODA 4M49A 1VIMA 1Q3HA 1SUDA 3LC2O 3IA7A 3RK4A 2IPNA 5EJGA 3EXG2 2AN5A 4O6VA 3RSCA 3UHPA 4AUNA 2FMTA 3BJIC 4DXHA 2BKVA 3T94A 3QUAA 5EWLA 1NVMB 4WEQA 1LVHA 1YKSA 2DKFA 3DE0X 1FLVA 3AFGA 4XX0B 2Z9BA 4YRGA 1HEIA 2WZQA 4WFKA 5E7MA 4KQEA 5HMMA 2PUDA 4AJNA 2ZR9A 1LBEA 1K4MA 1VE9A 1KI1A 3O4IA 1UMKA 3A04A 1LI5A 3DFMA 1JDVA 5KTMA 1KYYA 4RTRA 2FWBA 1PLJA 1TZMA 3GJ6A 3DE1X 2QUKA 3GAFA 4PR3A 4UNQA 1E3TA 2ZS8A 3KLMX 3EH2A 2VPPA 2P3OA 4RKEA 5LD2C 3UB2A 3BZBA 2C5EA 2GM9A 2FUNB 2BZ1A 3NUQA 4JGBA 1SKAA 1ODCA 4M21A 1O1YA 4MB0A 1TM1E 2P40A 2ID8A 1U0HC 4RPIA 5HUJA 4TL9A 2BMFA 3NIWA 1CJBA 4D6PA 1M10A 2Y67A 3DQZA 5TPWB 5H5JA 1VB3A 3K9QO 4RL4A 2V7VA 1PQWA 3EN0A 4G09A 4RANA 5IKOA 3W0LB 1TVMA 5F51A 1FDVA 3L8HA 4F5WA 5M5BA 3QX3A 2CD9A 3WWOA 3ZW8A 4GOND 4HWGA 3X43A 5C81A 5ADWA 5A05A 2BSQA 1XMOB 3DD5A 2ACEA 3K2EA 4X85A 4A73A 1SKYE 1NJ1A 4LTMA 5EHXA 2C95A 3F7MA 3VC7A 5BNIA 4LEIA 3DQPA 3EVGA 4WKNA 4AKHA 1UPCA 1TLFA 3OIUA 4OH7A 4DRXB 2XW6A 3NOQA 2IY9A 3SJAA 4ERNA 4D6XA 3A4MA 4GI3A 1EUCB 1TJNA 4KQMA 5F4BA 3NYQA 4Z49A 2AA3A 1JFLA 4NONA 5KINB 5JAMA 3C85A 2JLUA 4XDGA 2QW0X 5I7WA 3L79A 3WNZA 2BAGA 2GMWA 5JVDF 4YAOA 3T7SA 2BCGY 4DLKA 2YWBA 1KBOA 3EVNA 3GPIA 3L3BA 1XCGB 5DULA 5HPYB 5JFGA 1YC2A 3QMMA 4L4SA 1GGVA 2QYOA 4WUVA 4BAUA 2C9MA 1RI1A 2XDQB 2VAMA 3EGXB 4AG3A 3AYZB 4WLEA 1QAOA 5H9WA 3JQGA 2O50A 3D4IA 2IYUA 3C2QA 3VU8A 1Z0FA 2JRCA 2BPOA 4PN7A 1CR6A 3IYLW 1Z28A 4M0CA 1MO5A 5J4VA 1VJ1A 2OR3A 3A1WA 5JBNA 4GLLA 3JQAD 5GV7A 1EIZA 2WC1A 5EQDA 3GEBA 4D4IA 3DXXA 5B36A 5ELLA 3U81A 1PGQA 1WV1A 3GD5A 2GETA 1YVEI 3FOWA 3S7ZA 5AJVB 3I2YX 4D8WA 2GXUA 4XZ3A 3VO9A 3BF7A 1VBFA 3F6RA 2E1PA 4EMBA 4RF3A 2G06A 4EMUA 1QUFA 4U2BA 3VR6D 2HLHA 2VBFA 4Y6QA 1XQVA 2B6NA 3RVRA 4B6EA 5F33A 1ETUA 1U6IA 2OPHA 1BWSA 2PFKA 2O8VA 2WD9A 4KQIA 5BUSA 3F9IA 2IXEA 4LE1A 4B80A 2NZ2A 2PMBA 2YV4A 3QJYA 3TIFA 2X9VA 4FFSA 4OB7A 1BQ4A 4IIXA 4E7PA 3PB3A 3EY9A 4X63A 1XX6A 3COSA 2C9CA 3KELA 3MBIA 2EX4A 4LOKA 4TTJA 3TSYA 2E4WA 5CB4A 2VP9A 1WETA 2DFPA 3CGWA 3I9LA 4OK6A 1WP9A 3LQQA 1QVRA 4RKFA 1RWMA 2V6JA 5F3RA 4IHQA 4UFNA 3ILYA 4OQPA 3MHTA 1JV2B 4FHFA 4JDUA 2P1DA 5B3JC 4YRSA 1EP2B 2IXTA 3IDSA 2YW2A 4UCXA 2ODTX 1GFIA 1X13A 4RTLA 1Y8ZA 4QGFA 5J4LA 4BFXA 2O8CB 4QBKA 1ZXXA 5EESA 3WMRA 1VHWA 3ESXA 3M6WA 4FYWA 3U4HA 3NVAA 2Q7XA 3HDVA 5HYVA 1JSCA 3DMGA 4MPPA 1Y0BA 4B3IA 4ZO7A 2ETXA 1L7RA 1A9XB 4ZI7F 5FNVA 4G1EB 1V39A 3VR6H 1P61B 3KC2A 2C99A 1NSYA 3TTUA 1UXOA 1H65A 1XAJA 4C3UA 1C8BA 2REQA 1DARA 2HHAA 4KTVE 2LGJA 4K9QA 1NV9A 3PDUA 2PZEA 2WZCA 4GICA 1GGKA 3TQCA 5KVAA 1W1IA 2IK8A 2Z1DA 2IQ5A 2GZRA 3CLUD 2HADA 1R10A 5D5QA 3PYXA 1TC1A 2WIFA 3B53X 1CQIA 4IEIA 3U3ZA 4YDQA 1NVXQ 3NPAA 5JZSA 3NORA 5IYZA 3WGJA 3T15A 1PFYA 2GD0A 3QSYA 3OQVA 1FOEB 5B4VA 4E3ZA 4XQEA 4LI0A 3S2GA 1LPPA 2CE7A 4CI0B 2IYNA 4F4UA 4HEQA 4EG3A 4UULA 1D2AA 1GXSA 1MX5A 3WIOA 1EA7A 3KTAA 5FOUA 4EI9A 5FOTA 3QVVA 1ABEA 3FVRA 1WRBA 5D3MB 2ZOSA 1KOGA 4Q3OA 3AHDA 1ACMA 4UVHA 4DABA 2XLCA 1VCIA 1ZNWA 2O0MA 1OC4A 4TS9A 4NJOA 4LRQA 4PFJA 3JYOA 5CYPA 4ZCQA 5IS2A 4JA0A 1MNAA 1RRKA 1S8NA 2XNDA 3IOYA 4PLVA 4X45A 4AY2A 2CFSA 4RBNA 1PJTA 4JITA 2Q3LA 3C4QA 3GLIE 3B9QA 3L05A 2AMLA 1RLOA 2VDOB 1TQ8A 2W22A 5IT4A 1XL0A 4D97A 1DTSA 1ONPA 4HQRA 2BVNA 3FROA 4R1OA 2PRIA 1XRRA 4TSFA 2CK3D 3KYJB 4AJ4A 4JVMA 3W90A 3PHCA 2I6QA 4HYYA 3DMNA 5FPQA 5BRJA 2XX3A 2C2GA 1H0HA 3A9SA 4F2WA 2YIDA 3BMXA 2DU8A 3NFRA 2DH6A 2AJCA 2RI0A 5J2UB 3D6NB 1S2MA 4AM8A 4TWJA 3W8EA 5A4IS 3HUUA 1VMEA 1Q50A 1RT9A 3NHWA 1E9RA 1D04A 3P97A 4GX2A 2ONKA 4KYVA 4YHBA 5DCLA 4EUSA 2BEKA 5IVHA 3QHPA 4AX8A 2J9YB 4DQVA 1U0NA 3NOOA 3AQ4A 3AF3A 1Y8CA 1EHYA 1UKVY 1ZBQA 5BSUA 1HRKA 4PE5B 3SZ3A 1V5IA 1RCFA 3EGIA 3PQCA 1QIMA 4RC9A 4OD0A 4EYGA 5IFLA 4S24A 2RB5A 3IVMA 5TEWA 2WYHA 3GF4A 2DX7A 3FKJA 2HF2A 2Q0QA 5JISA 3BM5A 4IINA 4YDSA 4ZMRA 3OJFA 3UENA 5TMBA 4P7KA 3ZLTA 5CLHA 421PA 2YQ5A 2WM2A 3DFFA 4DCVA 2I91A 2J6CA 2XVYA 3H2GA 4AJJA 9GPBA 2YDYA 1VJTA 2QMQA 1P0MA 2WJJA 3GEDA 4OHWA 4R3UC 3M5WA 4CL2A 1UC4B 2ATXA 4K9DA 3M81A 2Y2VA 2F6RA 2WWVD 4B0OA 5LD2B 5E6RA 4LGMA 1ZCAA 4KWEA 4QJ5A 1JGTA 4LZOA 2BEVB 2E37A 5IFKA 5DCWA 2YVKA 5BV2P 4RW0A 5EA2A 2I3GA 5L3QB 3LLSA 1XVIA 4H17A 2VYND 2ZUUA 5FWYB 3RC8A 2AUMA 2XNJA 2NACA 3BWVA 4X95A 5DSZA 1NGSA 3SK0A 3AM1A 3HTXA 3WJ7A 4GGMX 2H54A 2PZFA 3A6EA 1NLFA 1YOVB 2JHAA 2ZAIA 3DOUA 3LL4A 4MUMA 3SYNA 4C6RA 1SC4A 3EX7C 5A9SB 5L3RA 3THWB 2AZ4A 4DA0A 1I4DD 3LK6A 3OPXA 5HK9A 3MMNA 3R7LA 2VJPA 3FUWA 4JU8A 4ZO6A 5CA0F 1DXHA 2XRYA 3IDZA 4PZCA 1ZO8A 3KOYA 1DAMA 3AERA 4MIEA 4AVYA 4DA7A 4ZIRB 5FFMA 3WIEA 1QFYA 4D6YA 2LP4Y 1JYFA 5C35A 1B6RA 1LRLA 2C2YA 2WG2A 2I6FA 3WLPA 3PEUA 4CKEA 1M6VA 2QLLA 3OC6A 4JBIA 4OAQA 1BNCA 2P9YA 5BQFA 4E21A 2VJDA 2C4HA 2AFRA 2AHRA 2BR5A 3OKPA 4HEHA 2DHQA 2XZTA 4M1TA 5JUWA 2A78A 4O33A 1YULA 4ND1A 2PCJA 1GJRA 4K9SA 4LV8B 4EG8A 5A4DA 4ZVLA 1H05A 3BPSA 3OZSA 2H1LA 3BFJA 1Q1EA 1MDFA 1W0JD 2ZUWA 3GEIA 3PUJA 4QXQA 3UUFA 3CLUC 5BOSB 1VXRA 1N34B 1WB4A 4IDGA 3SZLA 2HMAA 5DXFA 4B6RA 2XXAB 4FS3A 4DEXA 4M1WA 3TN7A 2WWYA 4MUIA 1XTKA 4GQAA 2IF0A 3GVCA 3AVXA 1F0KA 3GBPA 4LN1A 3RBXA 3ILHA 1M54A 1YZYA 4O2AB 1HC7A 3NBMA 4HDCA 3VAYA 3AP2A 1QP7A 4LVUA 3TMYA 3COVA 2Z9CA 3AHFA 2FEKA 1IBMB 4PYJA 3N0TA 1N6LA 1DKOA 4KP7A 4WBSA 5DX8A 1NV8A 2XKJE 2HMVA 4KUEA 4Q12A 3G68A 3HO6A 1LS6A 1L5WA 4BC1A 1JU9A 4I9HA 2R5NA 1P62B 2QUZA 5DRTA 3VU9A 1T25A 4CKYA 3FWZA 2ONZA 4F4CA 1EP1B 3PC8C 2OL4A 1ESDA 4JVLA 1ECGA 1II0A 3U7QB 2DCUA 3QF4B 3WLEA 4TZ6A 4KLRA 1YF3A 1YR9A 4YV2A 4OHXA 5AVTA 3SMVA 5E8JA 4PNZA 1QXSA 2J6IA 2Z8ZA 3ZWOA 1TM4E 3WBKA 4D0SA 1WS6A 4Q6BA 4C4SA 5KJFA 2F9FA 2G0AA 4LDRA 1E79D 1LX7A 3C5CA 2OCXA 1X19A 3M5CA 1SD2A 3PF9A 4J6FA 4LRTB 4X8LA 4CMCA 5LYJB 1FNNA 3REGA 4R5HA 4PTYA 1Z0DA 4ITVA 2DFTA 3KLOA 1UL1X 1VL1A 2NO5A 4RZUA 1BE1A 3AF0A 3ZZ0A 1F9AA 2IIQA 4NSNA 3SC6A 3ZPXA 4ED9A 5LZ2A 1KK3A 1ZJ6A 3NDIA 3X1YA 5JZVA 4JR0A 4Q02A 3DVAA 5EIWA 521PA 3UJ9A 2XXJA 3QLUC 3VH1A 2I33A 3IBCA 1O54A 4C22A 4LJYA 1DOZA 2J5XA 4P4SA 5ENZA 3KPJA 2WHPA 3WC4A 3IPAA 2AEFA 3O94A 4DJ5X 2LZ0A 5KSWB 3MC1A 2YVAA 2GILA 4LWPA 3MCUA 3Q3JB 2HTFA 3C39A 1HLPA 1R0KA 1O77A 1YDHA 3OAAA 4BQFA 2PZKA 5J5AA 5L45A 3LFTA 3EIOA 5DGCA 1J2TA 3RC9A 1I2MA 3U44A 4EGQA 5H3LA 1LQUA 3QSGA 4OHBA 3SGLA 4JOBA 4M22A 1Z5WA 2YWRA 2DPHA 2ECPA 5DJ5A 4KOEC 3K9WA 3Q3GE 5EJ6A 2RG7A 3JQQA 4I8XA 1X7ZA 1T2CA 3FF4A 2HIMA 4LX0A 4NH4A 4X20B 5SZJA 2PUCA 2IL1A 4ZGWA 1Z45A 1WP4A 5G41A 2ZJAA 5T64A 4C4OA 4BVAA 1XQXA 2JFOA 1SCQA 1NBME 2NZ8A 1BW9A 4JC0A 3OZ7A 3H2IA 1IVNA 2A5FA 5JV5A 1EFVB 1K68A 2FPXA 4ZV9A 4TM8A 2XAAA 3M34A 2FKAA 3RYFA 1DIAA 2PNFA 4QODA 4E5VA 1NXTA 7YASA 3FZGA 1SCDA 1P91A 1OTYA 1U9YA 4AZ3A 5IVDA 1QH1A 5FX2A 1H4QA 1D0IA 1LDEA 1JDPA 4Z4QA 2G36A 1NP6A 2ZAMA 1EK6A 3DLPX 4HNAB 3HR4A 4URXR 3O9MA 3DG9A 2RGBA 3RM3A 1JJFA 1E5QA 1YCHA 4RWEA 2WSSA 2QP4A 3HCFA 4RXUA 3SR3A 2Q6LA 2WU1A 1ZMBA 3RAGA 1DGQA 1CT9A 3JASA 4UCQA 5ALUA 1TZKA 2Q6TA 4B44A 4S0XA 2WSYB 4PCUA 3CRRA 3STHA 4BB5A 3W8RA 2Q5HA 3AEUB 2J32A 1JECA 5HF8A 2NO6A 3WQSB 3IPXA 4OREX 3RK0A 3KX2A 1TUBA 1KAQA 4OQNA 1L7QA 4AYTA 2D1QA 3I6QA 3PENA 4IDCA 5H3CA 2I3ZA 3VYWA 5IVPA 1SBYA 2IXGA 1CIPA 3EA4A 3FHOA 3PF8A 3M0EA 4PZEA 5ESWA 1E8NA 1MR3F 5TT1A 1AXRA 2WHRA 3GZNB 1P3JA 3DUFB 4XLLA 1JNYA 2GTHA 3OIYA 1NZJA 3NJ4A 4X1OA 4DIKA 1STOA 1X92A 3GCDA 4QYSA 5F7OA 2J5RA 1N2BA 4UUAA 3RVLA 1SXJE 3FVTA 4WNAA 1M2EA 1P39A 3EOBI 2R6CA 3JATA 5F64A 2UZAA 3W6NA 3MWDA 3L7IA 2JIMA 1JEOA 1UOOA 1EM8B 1FTGA 2YOHA 3QV2A 5EWMA 4BNLA 2ZRIA 4L3VA 3D0OA 1Z35A 5CNJA 1MC5A 1VSBA 1ZW6A 5D5PA 3ZXIA 3OEWA 1J24A 2IOHA 2Z2YA 1ONSA 5FI3A 1F7VA 3H7IA 3D0RA 1K6MA 4NULA 1M0SA 2LCIA 2NO1A 4BLPA 1NJFA 5HIKA 2E21A 3UG7A 3ITKA 2PSSA 4H9GA 4F71A 4G85A 2AN9A 2CV2A 5AHXA 1G60A 4DV4B 2MU1A 4KFSA 5F76A 3AGPA 4FYIA 3ZGXA 4PLCA 1Q16A 1AGNA 1BFUA 2FU5C 2RGXA 2ZVDA 3JX9A 1CD5A 2W2KB 1TC2A 4TTQA 5AW3A 3TLJA 2YHIA 3F2IA 1X1BA 2YJNA 1XNJA 3IT3A 4LSZA 4O5OA 2J30A 4UFOA 1JMYA 1HZZA 2NSHA 4FLEA 3UJ8A 3AKZA 1U7TA 1WF3A 3OLXA 3PD1A 2AXQA 4RK7A 4ZANA 4C7OB 3ZDBA 1T9CA 1THMA 1UMCB 4PSUA 3LUAA 1KDPA 3K4QA 4Q7QA 1HH4A 4HGNA 3OPYI 3QG5A 3A31A 4TVOA 2AR7A 2AIRA 1WDWB 3HQ4O 4OEHA 4CG3A 1R9GA 1I32A 2QI9F 3AUJB 1U8FO 2FUCA 3DMHA 4BEBA 4EHFA 4DC9A 4D46A 4FE4A 5F73A 4OHPA 5H0IA 1YZLA 2IZ6A 5ERGB 4JJFA 3U40A 2PEYA 3E7FA 3GH1A 4FINA 4OI1A 4DJAA 4J0QA 2Z5GA 4M8SA 3ETGA 4ZICA 3A9RA 4B3CA 1V8PA 1DO0A 1EVIA 4QELA 3DLHA 1N33B 2NO0A 3VH3A 4OV6B 2GWHA 3HPRA 1TJ5A 5FTLA 5LL6P 1QVWA 1ZS9A 5K0JA 4F6RA 4HXYA 3KUUA 4YP0A 2F00A 4JI1B 1KNXA 4HB2A 4R05A 4YJ3F 3C7DB 1E7QA 3WRYC 4DMUB 3AHEA 1AOXA 1L3IA 1RXUA 3EF1A 3C3XA 4DR3B 1QH8A 2UKDA 4KDEA 2CVQA 2FSGA 1NW3A 5DNYB 3EEQA 3D2BA 4TWBA 3V7YA 1XNRB 4XRRA 3EGEA 1Q5PA 1PNQA 5CT6A 4FDAA 3EMVA 3CW8X 4OGFA 3UH0A 2QRVA 3DB2A 2DUNA 1L4EA 2CVPA 2J9XB 1QR6A 2ZWVA 1DAFA 1S4MA 1EFUA 1CE8A 2ECKA 3C1UA 5TT0A 3CVOA 2PRYA 2YRFA 5EMMA 4E1AA 1I0LA 4BLWA 1NIPA 3T34A 4JBWA 3F98A 4OO3A 4DUGD 5JQWA 3U5TA 2AG1A 2I22A 2ZRGA 2O7RA 1UPBA 2FN7A 3V9AA 1GPNA 2RIRA 3KLNA 4E5NA 1UKAA 3JQBC 3A1UA 2AHOA 4Q24A 1ES9A 3O3OB 4OXQA 4LNUA 1OCEA 3A7EA 2QQ5A 3B1WA 1P18A 5KIAA 2B8WA 1W35A 2GBLA 1JNXX 2R5WA 3Q0TA 3RFVA 2GYYA 1H9CA 2PKWA 1ORDA 4O3MA 5IXSA 2ECOA 4LV5B 3F6YA 3A6PC 3RV3A 3ZVLA 3EGOA 2W6JA 2OXEA 3FKQA 4ZAYA 3VBEA 4HTAA 1RU3A 5KOHA 3RVQA 3A11A 3I2FA 1Z62A 4NDNE 2RMKA 3BSFA 5ANRB 3R0ZA 4ZEWA 3T5MA 2FMHA 1AKMA 4I1PA 4DMLA 3MUEA 2ZFUA 3W79A 3QIAA 3M2PA 2OAGA 4Q00A 5EKTA 4QTTB 1AKVA 2BI4A 2OORA 1GR0A 2X1LA 2AN3A 3LBAA 2HB6A 3QKTA 3K70C 1SB8A 3PQFA 1EXWA 1S2IA 3L8ZA 3QFTA 4MYRA 3WMFA 2A5LA 5C2JB 4C4TA 4LZZA 1ISPA 4ZYZA 1YDFA 4OMDA 1ULTA 1V5EA 2B83A 4AX4A 1UIRA 4BVGA 4IKEA 3C43A 1JX6A 2PD4A 3L1VA 1ISJA 1MW8X 2GESA 3IQZA 3F74A 1ZGZA 4R2IA 1IZ0A 3M9LA 4W7HA 4ZOLF 1F8FA 1OLXB 1X2BA 4U5XA 4AZWA 2B1GA 4KAAA 2OYRA 2AN1A 3E27A 2AOTA 1SC6A 1XRSB 2WKRA 1ZR2A 4CKCA 2IHJA 2ZIXA 1J2JA 3OT1A 4ZQFA 4XARA 4ZYXA 2Z56A 1VHTA 2ZIVB 3ML1A 5BRNA 3UAOA 5A2GA 1ZMRA 3IQWA 3OFJA 1J1UA 2PUWA 3L01A 1B8UA 3BDIA 1L3CA 3EY4A 4Z8XA 4CM9A 1SQFA 1ZGAA 1K6XA 1Q0QA 4E09A 4F45A 1HPLA 1CTQA 3U7RA 3WBBA 4BHTA 1Z75A 4WECA 2PH1A 4UPDA 2FOLA 4JR1A 4DREA 2RB4A 4ID9A 3O0TA 1W47A 4WADA 4UPEA 2FEMA 1DUIA 2XYRA 1Z38A 4Y2VA 2CV1A 1ZD3A 1TF2A 5KKAA 1BVYF 2QRMA 2E9SA 2IUUA 4OQYA 4YPVA 1NI3A 3IESA 1PX0A 2QR5A 4RY2A 2ZXUA 5JD6A 1UP6A 1CNFA 5KQPA 2BH2A 1SR8A 2F17A 2R6DA 4QSMA 4UHCA 4FFBB 3IB6A 2DWQA 3LBIA 4M0UA 2YYAA 2F2TA 2YWEA 2OAEA 3T5DA 3UJ3X 5ABPA 2Z09A 3LQKA 5JS6A 5K1ZA 5CX1B 5YASA 2HO4A 4OU5A 4UZFA 1QV9A 1IU9A 2JFZA 3D7SA 1V26A 4HL6A 4BUJA 5TQ0B 4FR0A 4UXIA 2CLEB 2VK1A 4V39A 4MHTA 2X0IA 3L6OO 2C5FA 4HDKA 4TYQA 5LQSA 2CCJA 3NT4A 4ND8A 2IW3A 3GUZA 4J49A 4C87A 3Q8LA 3CF0A 4F6LA 2XTNA 1XJQA 1L4BA 3GPDG 1M72A 2BBWA 2GVNA 4JB0A 3UVEA 5K6TA 1UPAA 2K7ZA 5ALEA 3R3VA 3O8OB 3RTDA 4E6EA 2AG8A 3PC6A 1KO7A 1GL7A 1ZN7A 1CY4A 3FZYA 1XF9A 5DWDA 4IV8A 2IYRA 4P38A 4QOFA 2DM6A 2VZLA 5MFPA 3DTYA 3RAFC 1KC1A 2ZT6A 4KYUA 3GRKA 2WJ6A 5C4MA 4S35A 4GX1A 2XVZA 4RGYA 2QKYA 4MB6A 4JBXA 4JN6B 5IKEA 3P0IA 4REOA 1R6XA 3H86A 4XJSA 4YI3A 4RZ3A 2EFDB 2V3WA 4M87A 4C0KA 3SX0A 4Z7QB 1FVXA 2VP2A 4DSUA 4KHPB 1BA3A 2H08A 2YINC 2EOAA 2H11A 2C42A 3EZXA 5CURA 5HKKA 4B85A 1C2TA 5ER6A 3UWSA 4I1UA 4TYPA 1T3LA 2D1SA 2OCGA 3QVSA 4BAGA 2PJZA 2WMYA 3G5TA 3DM5A 3W06A 3FVQA 1SWVA 3K0FA 2GT1A 4FI3F 4L8WB 1V6AA 4E94A 3EXHC 5T4BA 3PVSA 4A5SA 1YUMA 5F78A 5DYIA 3LWBA 2CMHA 2DE0X 2EBWA 3AQIA 3P9KA 5JJBA 2H7VA 3P2MA 1GITA 4EHAA 4DSNA 1CK4A 4MWTA 2ZRLA 3EWIA 1G55A 1YRAA 4FS8A 2P6MA 3TQIA 3G7UA 5JJKA 2OB2A 1F12A 2E3JA 3PGKA 4L95C 5IMBA 1M6WA 1V48A 2QTZA 5CFRA 2V54A 1LWOA 4B3MB 4MR7B 4C7JA 1FQJA 5KJ6A 1KK2A 1DZIA 2D54A 3ETLA 1YB5A 2EBFX 4BXOB 1BE8A 1KRHA 1TNDA 2JGMA 4FN4A 4UHFA 3V00A 2IYVA 3QOXA 4M0KA 1XCPA 4KU4A 1KYQA 1M1YB 2Q50A 1BMFD 1P0IA 4BB9A 2RGGA 3I1IA 2GN8A 3ORFA 4L73A 4V03A 3BMQB 3OOYA 2GN0A 2I4MA 3AHJA 3O21A 3OE7D 5NULA 1ZXBA 3TRFA 5DNUA 4KREA 2FEWB 2Z58A 3P9QA 4NCKA 3SLKA 4EPXA 4GP6A 2JCSA 3ORSA 1EZ1A 4LSMA 1R88A 1QTNA 3W3ZB 3IUSA 3FSGA 4GBGA 3G82C 1FZQA 1RZRA 4MS1B 1K6JA 1NHGA 2LTAA 3UWDA 4BMDA 2VHUA 1N2EA 1VRVA 2ZAGA 5HF9A 1XRNA 3OPQA 3ZBTA 2PT6A 3LLUA 4J1QA 4KO4S 1RYYA 1L4NA 3LUJA 4HGQA 1JIJA 2I62A 2TECE 4IGIA 2R6JA 5AVRA 5JCOC 2C97A 1SC1A 3OECA 1EA5A 2AL7A 2AFIB 2CBXA 3TDKA 1CUUA 3E03A 3IIIA 2EZTA 4YEDA 3QXSA 5BWCA 3AKEA 3INRA 3PX3A 2BFEA 4RDIA 4TWRA 5ES3A 3BL8A 1F3OA 2GSDA 1NRJB 2A67A 1G7RA 4HYQA 3KQTA 1XKLA 3W4KA 2A1UB 5DT9A 1ULSA 3E4DA 1JR3A 5GGYA 2XB2A 4F4HA 1MJGA 3KTDA 4RX1A 3UMYA 2VBCA 2XNKA 1VHDA 4FPXA 2C7RA 4TKUB 3UBMA 3C16C 3NC0C 1XQWA 1N32B 4PRZA 3V4RA 1YAHA 1ZIPA 3A3NA 5C0OE 4WXMA 2VL7A 1UBNA 3SICE 1QGZA 4YLEA 2RBEA 4B8WA 2RHWA 5CFZA 2JFNA 3SXUA 3PUZA 3QEMB 4N12A 1XTPA 4CU5A 1TK9A 2VR1A 1DEXA 5JWHA 1OI3A 1IVYA 3IKVA 2Y05A 4IGKA 3FDZA 3WB2A 5BN5A 4JWTA 3DO5A 1R9MA 3CRVA 4H7HA 4JS0A 2IKQA 3PNQA 3V1TC 3ZUGA 2ZE5A 5JY6A 4CDMA 1QS0B 3AI7A 3O73A 4FFRA 4FYYA 1XLTA 4RZHA 3E84A 4DNFA 4AURA 1WHTB 5EZ6B 2PU7A 4XGRA 2QTCA 3KUKA 1ZRNA 3PYMA 3RS4A 1YHYA 4BC0A 1KMHA 1GFSA 1OVMA 1TAHA 4HBGA 4NJEB 4QUBA 5HNKA 5JCJD 2FN9A 3FCXA 1G8HA 1K9SA 1Z8DA 4G5QA 3N07A 3UICA 2OGTA 1U2QA 3K16A 3Q7TA 2YKGA 4WXHA 4CODB 3AKDA 2VA8A 3RC1A 5LNK6 2YC2C 4KE7A 3EOZA 2CZQA 1DAIA 5D01A 1NSFA 4N8SA 2R1ZA 4KUHA 4D0GA 3GP5A 3H0KA 3DKRA 4R1NA 4UJ5A 4KIWA 3PDIA 3K0AA 1HQYE 4D80A 2OVFA 3NHLA 2I2WA 3AHCA 4Y6SA 4FKBA 1S2GA 3HI4A 1LLUA 1UDRA 1Y48E 1A2KC 4MINA 4DHWA 2ZSIA 1YKFA 5CXQA 2YHUA 1RS0A 3WKBA 1IHXA 3ZV7A 1IB6A 3I6MA 4HF7A 3X2SA 2Q2VA 4Q1BA 2ZJ1A 3AIKA 5I8ZA 2B20A 2VIIA 3GJRA 3FPGA 4NPAA 4B4OA 4O1IA 3AM3A 5EY5B 4K9LA 2ZUEA 4E6PA 3OKFA 5BVGA 2JLZA 1AQLA 5BV1A 2CL0X 4OK5A 2W0SA 2J4CA 1FU7A 5C7IO 2JGLA 5E7JA 1L5VA 3MJTA 3GV0A 5K0TA 2NU7A 3NCHA 3U37A 1B00A 2O9JA 4Y1GA 2C29D 1Q0RA 3TVTA 2I66A 5K6AA 2NUPA 4O4JF 3CS3A 2WTNA 5KYXB 2G63A 5DNEA 3ZS8A 5A6SA 1E77A 2XCRB 2XQGA 1NVWQ 1YJAA 4XD7D 2O7NA 3EA5A 4WV3A 5IDVA 5C80A 3KYBA 5DM0A 5H4GA 4JXXA 3LI2A 2JLYA 3VHXA 3EFOB 2PX8A 4KNWA 2IA5A 4GMGA 4C0HA 2C7QA 1HNZB 1UFKA 5D3KA 2XRZA 2QN3A 2CJWB 5DBEX 1HT2E 4LMPA 4ZVOA 1N6PA 1A7KA 1XTUA 4LBZA 1YRYE 4ZO4A 5IT5A 4LDNA 5CJ2A 2BD0A 4YK7A 3WHLA 1S3IA 4AZSA 3EXIB 1M0EA 1RTKA 2HM7A 4IL5A 4DKJA 4RABA 1NXSA 2IWHA 3UK1A 2HMTA 4LVOA 2B4QA 4CIVA 4QWWA 2BN4A 3CO5A 5ADHA 1ZGHA 3PTLA 2QUJA 4F91B 4F9EA 1CJCA 4OI0A 3KVOA 1U7UA 1Y9JA 4TRJA 4B87A 2BGMA 5JARA 1BYUA 3FKSD 3NTLA 3TOXA 1O97C 1XA3A 1SFRA 3M6VA 2C1ZA 4KE9A 4F1JA 3QEAZ 2FFRA 1KQOA 2X2EA 4HPWA 3H2YA 3CB2A 3IHLA 4UD6A 2HK7A 5DSTA 4GPAA 3TQHA 2JAOA 3JVDA 1BHSA 2J3JA 2FPMA 1L5NA 2WWGA 2ZQYA 3CH4B 1DX9A 1KXJA 2P3LA 1UDWA 4PTZA 2XMBA 3SMQA 3TW0A 3JAKA 3HH8A 1F1JA 5A6VA 3OJOA 4CL0A 1YMVA 3DE5X 1G4HA 4ARZB 2XZDA 2VNJA 3A6JA 3F71A 5BYBA 3EXHB 4FD3A 4B3DA 4DLYA 4XIIA 1JR6A 1RPAA 4W9RA 2QZ4A 4TV8A 3W9SA 4RJIA 2XBMA 4WZAB 3ZDAA 2R8EA 3KEMA 3N05A 3ZU3A 1DC4A 1JFFB 1OPRA 2CJXA 2ZYGA 3RTAA 1PEDA 3FLAA 1T0BA 4LDAA 5KNCD 4E2FA 3WB0A 4IWYA 1MUUA 3BH6A 1LBIA 2ZTVA 3U49A 4A92A 5AVVA 2PKCA 4JENA 4RXTA 1JILA 2YNMD 2I29A 3C3KA 3BWBA 1E8MA 3PR1A 3V2GA 4AXXA 3BDAA 3VKFA 1IN7A 3WDKA 4LWQA 2ZYVX 2ZE6A 1EE1A 1P1FA 4IOKA 3ZYZA 2H0QA 2HCTA 3GL9A 4H0CA 1XA0A 2PX3A 2RHHA 3ZJYA 4R8LA 1V1RA 2E4UA 5KYWB 4F3TA 1RM3A 2G83A 3KCQA 2EGUA 1NN0A 4K2AA 4OG2A 4HPXB 4YECA 5GONA 5F1KA 1K7EB 5TGTA 2W58A 2DR2A 1LK5A 2NV6A 4U2KA 2OCIA 3HJCA 2XOEA 4S1VA 1JDSA 5DX0A 3QEJA 4Y1RB 2FRVA 3NU1A 5EQTA 4KUGA 3G2HA 1QK5A 2B94A 3QJ5A 3NTOA 1JEEA 3VR1A 3MM4A 5DTQA 4JUAA 5K0NA 2GD6A 2X2PA 1ISFA 2CMKA 3QVLA 2RHBA 3FCSB 5SYAA 1DJNA 2CL6X 3LXUX 4F72A 2EP7A 1NUQA 1T5IA 4YDRA 5KNCH 3DLBA 1WR8A 1CV2A 4P4UA 3U0BA 3NQ41 3ZWKA 4L27A 1U3WA 1G8KA 1CDDA 1NKTA 2H7YA 2NPIA 3QJGA 4LYEA 3QITA 4DMCA 3WWYA 2AV6A 1FRVA 4RLQA 2R65A 2VTBB 2AF4C 3ONFA 3RADC 2B37A 2BWJA 2JIPA 2ZIFA 4FQ8A 3VZDA 3HZOA 4QATA 2HOQA 4H7IA 3IUEA 1F2TA 2R25B 3CVJA 4JEIA 2NU6A 5JJ5A 1L4MA 4HXEB 5TQVA 4BIIA 4IUCS 5JYDA 1T9KA 3T7EA 2J9FA 5AK5A 3RIMA 2IV2X 3LHFA 3ZWXA 1EQUA 3GYGA 3UFBA 3F3MA 1UBTS 2WHEA 5ELMA 1KZHA 2QY9A 4EWLA 3TGPA 3LZCA 2Q6IA 4AWBA 4RJ2A 2DKNA 3MJEA 2J9GA 3QE0A 1I01A 1H8HA 3SHWA 3H2SA 4Q34A 2E4XA 4K6FA 1WW2A 4F85A 4DJEC 3FJYA 1QP0A 5LWHA 5HM8A 1KYXA 5F21A 1C80A 2IUYA 1SOWA 4D96A 4MK4A 2ZI9A 4LYFA 4P08A 5FIUA 4MEAA 3OLVA 2ZXFA 5HCUA 1D2CA 3FNQA 5EYPB 4MEJA 5GJCA 1KZ7B 3CZCA 4KNVA 4MEBA 3FSRA 3EW9A 1ARZA 2CLCX 3Q87B 1X39A 2P2DA 3FYDA 3IR6A 3O4GA 4IDQA 3H4MA 5EQJB 3BTUA 4NLLA 4P53A 1VHQA 3SC3A 3FTEA 1GZ7A 3JWEA 3KPWA 1B3RA 4PVCA 1VBKA 2A4KA 3Q85A 4UDXX 4MQFA 4MCIA 1DWOA 4ZAFA 2YZ2A 1RWPA 2XLBA 1OFVA 2A92A 3L4BA 4WK4B 4M9CA 5EXXA 4A2QA 4B83A 3OUUA 5IU6A 1M0WA 4L9RA 3E70C 4HYTA 3HCAA 3HYRA 1CFZA 3LPDA 5KX5A 4NZ9A 2AKEA 4ZT7A 3AUTA 3ED1A 1C4XA 1CZLA 1G2PA 1LFDB 3QV1A 1OD6A 1G7SA 3GGJA 2XOKD 4IXNA 3ONDA 4Q47A 5K99A 1NSTA 1I3KA 1D2NA 2FPSA 3CT4A 2GZ1A 2JATA 3LCMA 4D3ZA 3M4ZA 4F56A 3FPHA 1J20A 4JX9A 2R44A 3EGVA 2QDXA 3MJCA 5A1TA 4BX2A 4R7GA 2C4KA 1QMPA 1SK8A 2NUBA 1AY0A 2DUWA 3LTEA 3V33A 1G6HA 1GCOA 3DFZA 2X40A 3OQ1A 3IAUA 4KE6A 1UP7A 3U3RA 2QMZA 5I4KA 4RULA 1YGPA 1NTRA 1RBMA 1TECE 2HK6A 1AKWA 1EFPA 4N01A 1I7SB 1Z2PX 2FJ0A 2FPWA 2IOQA 3QGMA 1AZWA 2CKDA 4QDKA 4E70A 1SKQA 2NP7A 2W11A 3ZEAA 1E5XA 5BVHA 4YMVA 3O95A 1Q7GA 1DIHA 1WPGA 3G6KA 5SZHB 2D59A 4A0QA 5CT8A 3P9NA 2J48A 4OIFA 3RU2A 4BLUA 4AQDA 1E7SA 2ZBQA 1SXPA 2IS6A 3F3KA 4TKMA 5EPOA 2CVHA 3UMFA 2ISCA 2PMDA 4XFJA 4LMBA 2J1LA 3VR2D 5CXXA 1P8AA 2E4VA 4I81A 5DLDA 3H9GA 3O1LA 1G8FA 1NUTA 1AHHA 3H0EA 4HK4A 5FTMA 1XMJA 1D4ZA 4ESEA 2H2GA 2GGSA 3ACBA 3ON5A 3AILA 3WFJA 1VPWA 1NMZA 2RH9B 3FPSA 1N3YA 5K45A 4XH9B 1WX1A 2ZQ5A 1CNEA 1UZUA 2WYOA 4UOQA 3AHHA 5HMLA 5LP6F 4ZARA 4GNRA 1ZD5A 5I4BA 2JIOA 3FCUB 2IX9A 4EB6B 5A1JA 5C8XA 5FUMA 4EJ6A 2IUFA 2O5VA 2MINB 3CUKA 3DLCA 1QHHB 1XCBA 4U39A 5CU7A 3V4SA 2BZSA 1Q1AA 3QUBA 4II3A 4HVTA 2HHLA 4EYQA 5JNVA 1E32A 1VE1A 4RTPA 4O29A 1LSJA 5DTIA 5DHUA 1JVNA 3T3GA 4AJIA 4OSPA 4ISCA 1EX7A 3C6BA 3HKDA 1RWOA 3KYDA 3HJBA 3EZ9A 1EEXB 2Q3JA 3EPKA 3NHUA 1UIMA 4CV2A 1Q83A 4DQUA 3FR8A 1YIOA 3IAFA 1EVKA 4MMYB 4YJGB 5BPHA 4IIFA 3TLZA 2BFOA 1PSWA 1W52X 4G0QA 1GGNA 3OEHD 4WJKB 4LJ9A 1WD5A 4W8GA 4ZVSA 3RYHB 1ZRSA 3NRJA 1PTJC 1SIOA 3M6FA 3DLIA 3GLSA 1YZQA 4NHEA 5LQRA 3LC1O 1XYVA 1XCLA 2V4ZA 2DBYA 3GQBB 4K9NA 1TU4A 1BDIA 3OMWA 3WBFA 1SM4A 2X6RA 3NKVA 4EZBA 5CVCA 3S1AA 4WLNA 2DT5A 3C6QA 1N7GA 3OFNA 2G67A 4I6EA 4F86A 1U7PA 4CLOA 3SIPA 2MYNA 3K5HA 1E2KA 1GY8A 2DSNA 1KH2A 3HBNA 4KFUA 1Q57A 1U3GA 4EO4A 3RV4A 1I7LA 1I5OA 5HJ2A 4NCIA 1NBMD 3DHNA 1GGFA 2B82A 1QQTA 1CUGA 1G5FA 1Y6QA 3RRYA 2WI8A 4ETIA 3C8UA 3R09A 1T6NA 3GIDA 2GI4A 3OETA 4IQ8A 5AK6A 1DKPA 3C7TA 2XMQA 2ZBFA 2QR3A 2FXVA 3GFBA 3DDWA 2D5AA 3L7LA 2PH5A 4DA8A 1LNQA 1FS5A 1SBHA 5ED4A 3CZ4A 4CTNA 3CCBA 3N0RA 3IAEA 1OGYA 1PEKE 4XOIA 3LTNC 2WFLA 4EQZA 1AS2A 3EFHA 2IT1A 3DOIA 4YYEA 1JQKA 1UM9A 3LVFO 4B1FA 3CSUA 1W87A 1O08A 1O8BA 1VKHA 2J0SA 3GNLA 1C2YA 4ZXPA 1P4RA 4OAPA 1JP7A 3UWPA 1E1CA 1ZI8A 1QFJA 1L7EA 3I9OA 1FMJA 2CNKA 4AB1A 2CVFA 1EDOA 2GEFA 4IDBA 1TJ3A 4LXUA 5EFOA 2WWRA 1ADCA 3WFZA 1E9CA 4DNXA 5JH7A 1LLQA 1HEUA 2UVPB 4HX2A 3E58A 1A8PA 3A1SA 3G2KA 1RSZA 5DSXA 2AI3A 1GNRA 4M0DA 4YHHB 2XWPA 1CUIA 4FEGA 4YCJA 3WS7A 2AUNA 3ECSA 4L0QA 6AT1A 1NOIA 2X42A 4YMUA 1PHRA 4RADA 1L9KA 1Y3HA 4IJMA 4AY5A 4E4YA 3ISVA 5EJ2A 3MUOA 1EVZA 1DXYA 3RH0A 3WYCA 2ICAA 1M1XB 2JAWA 1QVVA 2HXYA 2KI5A 3BK7A 1GNVA 1YBFA 1U2PA 3GUUA 5LSAA 1U81A 3QYAA 1G98A 3C4JA 3E1KA 3OQHA 3V3KA 1O58A 3ZHSA 4FDLA 3T4UA 1QHGA 1SXJD 2AR0A 2LCFA 2Y1XA 2ETVA 4MCHA 2GF9A 2E1RA 3HKCB 2CNWA 4JKOA 5JFOA 1Q12A 2I6SA 1NBIA 3AFHA 3NLLA 1EJ6A 2VWQA 3FMIA 4M1YA 4OU4A 5EPEA 4LFCB 3RASA 3WGUA 4LOLA 5B4TA 4J0EA 1V2HE 4N40A 1FIUA 4EI8A 1ZM2A 4K6GA 2CBGA 3HWRA 3AVWA 4CYMA 3E6AA 4NE7A 5I7HA 3HZZA 3NVMB 4LXTA 1N5KA 4WOKA 2R1VB 4ROSA 1YUBA 2J4FA 5DM1A 2X14A 4OM8A 1P5ZB 2WD8A 2VT2A 2CLLB 1X2EA 1GPMA 3SHTA 3D5TA 1GTZA 5JSYA 4OB6A 1DELA 4NCHA 2E87A 2OWDA 1YACA 4C0BA 3EMDA 5KVQA 3KQKA 3B6ZA 3NNSA 4GUAA 4Z99A 3H2BA 1QG4A 2VAXA 4R1LA 4H7DA 1K9VF 2G76A 1J5PA 1H2FA 5KQLA 2OEPA 1PSZA 3OT5A 3QPUA 5AVOA 5BXQC 3UHAA 4YMGA 4KPUB 4RIEA 3RTBA 1KNQA 4MW7A 4C03A 2YZNA 2D74A 2A9OA 1P2UA 3HJAA 4IV5A 4JKIA 2ZT8A 1QX3A 4HS4A 3I62A 5AW4A 1QCYA 2KSQA 4EO7A 2OFOA 2XCIA 3RYTC 4N4AA 4AWAA 3GFFA 3GBSA 1AK9A 4Z3DA 1P7VA 1CF9A 1YCFA 1YA8A 3ZY5A 4BVKA 4QM7A 4P93A 1IOWA 3DOFA 2CXHA 3HDJA 4HNUA 4XX0A 3PPXA 1P0QA 2ZUSA 4M1MA 4BO9A 5LA6B 1F0YA 4HY3A 4L0DA 1YJBA 2G5PA 2A59A 2PGNA 1CY7A 1G3RA 4JI4B 1AXGA 2ZI3A 3KE9A 3JTEA 4FOOA 4MVJF 4RZIA 4BKQA 4JBNA 3U4QB 1M34E 2J09A 1F51E 2H7XA 4PNHA 3CPEA 2OG2A 4B34A 3HDHA 5ICSA 3HB7A 4MQEA 3SG0A 2XUDA 2F90A 1D4AA 1TEXA 5IBPA 1ZQ1A 1GRNA 2P91A 1P77A 1E4OA 4ZC8A 3QW2A 4HX9A 3CT6A 3PUWA 1FDWA 1Q84A 3UJAA 1RLJA 4QPCA 1E9BA 1R0YA 3GGPA 5AVJA 1O94A 3O4RA 2RHDA 4KAFA 4PHTA 1M2WA 1A2BA 1SVLA 3HB9A 5TPWA 2XYHA 1KQNA 3CLTC 2GXQA 4RZSA 3EHEA 4Y6GB 4BO5A 4C05A 4A10A 3KQNA 3R9WA 4XWOA 4ODIA 1VJDA 4V0KA 1MG5A 4JT2A 4B7XA 1V16B 1ZHFA 1ZK2A 1B4DA 3KVNA 1R12A 3EEIA 4ZK6A 1MRZA 4FFMA 2PSDA 4REQA 3NBZC 1UK7A 1Y7LA 2BGLA 1G42A 1H3FA 3GARA 3KB1A 1B2LA 5EUCA 5ITZB 3L7DA 2DFVA 3T7KA 3L0OA 4I5IA 3OQPA 5E9QA 1E4YA 1VC2A 2G6BA 1NP7A 4HDOB 4QQKA 3PQ6A 1FVFA 4OCZA 4XJVA 1MH9A 1KJ8A 1U5CA 3FB1A 4X8MA 5BQOA 4AL4A 1P1IA 1EUCA 1I9GA 1S9DA 2H51A 4ASUD 3VNVA 1NC3A 1IH8A 4R9UC 3G8BA 3B1FA 3T7AA 2ZJ6A 1H1LB 5DN6A 5JECA 3ADPA 4FHZA 4L4ZA 3RHFA 3F96A 3UC9A 3L43A 3HFJA 1FRNA 1O7JA 4D9KA 3SCZA 1SCIA 2QTVA 2Y1DA 2Z6VA 3W8DA 1RQPA 4TKVA 1REQA 3H99A 4R83A 6NULA 3EGXA 3G2OA 3QVGB 4OY3A 1NQVA 5JY1A 1KQGA 1PQ4A 1QH9A 3U9TA 1E6CA 1NXVA 3NTRA 4A2PA 4DSTA 5CUQA 3ESYA 3H65A 1BX0A 1AGXA 1E20A 2HC9A 4GRIA 3ZHYA 1NVBA 4G2NA 4IJVA 1I14A 3MFYA 2O2GA 3U7GA 1LLFA 5KCZA 1FFYA 1J7JA 3AIIA 1WBBA 1AKYA 1TX4B 5HCNA 3GDGA 5CVTA 2LUOA 2ZIGA 3NT5A 1ZCZA 5L9AA 4D8XA 4UBOA 4RPGA 4D3YA 1BE6A 4WVLA 4EFDA 4GOKA 5FH9A 1PS0A 3QQPA 5ERYA 1XNQB 2YQ4A 1XALA 5MF6A 3DVRX 1OR8A 1R5BA 4G9BA 3M49A 3MPOA 2JAXA 1MG0A 1UCFA 3DJFA 4FFNA 4M0LA 5EMLA 5FBKA 4D3FA 1Y1QA 5J23A 3JAWA 4GYYA 2XKAA 3CF4A 3VJKA 1WSBA 4KBGA 2D1TA 3OLZA 4J76A 2HHCA 5K0LA 4Z9AA 5FQNA 2ZCVA 3AUSA 5LMNB 1ZPDA 2B21A 2FZKA 2HIHA 5AD1A 3QE9Y 5AKYA 5ALHA 2BOVA 2QW8A 2V3CC 2F3QA 2JPDA 1JDBB 3QKSB 3BGIA 2OXRA 4BKPA 3T3OA 2CLOB 1QO0D 1X0XA 2GH1A 2OHFA 2PZBA 4H27A 4U7PB 5A9TA 4Y2SA 4YV1A 5LM3A 2VATA 4W5TA 3B60A 4Q4HA 2WNSA 4HDSB 4R2XA 4A0GA 3ITNA 1IYZA 5ALMA 5A5DA 1CJKC 4CHTA 3N74A 2HWKA 3B7GA 3I83A 1SXHA 5JE8A 3CR3C 4ECEA 4L6CA 4RSHA 2ENWA 5LBIA 4Q82A 1AMUA 3S29A 1CR2A 2QVYX 3QTBA 4S1PA 1HXHA 1E98A 2O8CA 3CVVA 3W5IA 4EFLA 2KPOA 3GK3A 1C9JA 2M1XA 1D6MA 4MKFA 4RF2A 2C00A 1C0PA 4ZHQF 3CUUA 1I33A 1TYCA 1ZK4A 3EZNA 3MTAA 4FLFA 4J9VA 1L1FA 3TAUA 3WLIA 4BJ6A 4PO3X 3R5HA 1BMQA 2I6GA 4HEA1 4ZAVA 1MEEA 3RG2A 1EWVA 2QVLA 3IRUA 1AUVA 4MUGA 3F7OA 3VZSA 3CNLA 3CZQA 2JGDA 1R8JA 2O3JA 1VI2A 4JIMA 3MMXA 5DYYA 1Z4PX 3JYPA 3ELDA 2QXUA 5CLFA 1BCRA 4JQZA 4Y8VA 1Z8FA 3SBOA 4MP6A 4UVEA 1H85A 2PX5A 4ACBA 3GMSA 5JEEA 3OX1A 2HL6A 4NWIA 1U8TA 4RJKA 1L1QA 2ERXA 3AESA 4XWGA 1SKMA 2IPLA 3QELA 3VISA 1BGXT 2HUNA 2AQKA 1QE3A 1RCTE 1VMKA 2VCEA 3JR7A 4KLCA 3DQQA 1U3VA 2WPDD 4G1CA 2GPYA 2IEIA 1T3ZA 4L8VA 4LXGA 2XF2A 3O38A 2JIQA 3QX8A 3VV3A 2J0QA 1DB3A 1RMQA 2RHMA 1V35A 5FBVB 4X0EA 1J2UA 1PYGA 4J6EA 3TEJA 2YXLA 3DEYX 1GO2A 3IIKA 3PFKA 1M2OB 2G1UA 4NJMA 1RIIA 3WGZA 1P44A 3CNOA 3TMKA 5AESA 2G4VA 5CCEA 2GX6A 5D00A 4JB8A 1MA0A 3DL4A 1D07A 3HBJA 1P60A 3PNOA 3SPXA 4R2HA 1IZ9A 3GZTB 4RJJA 4RVHA 4X1IA 4A16A 4RS3A 2JJ2D 4RTJA 2QD1A 4MA0A 4GRAA 3SF8B 4DG8A 3KKNA 2CYAA 2GHRA 3LAWA 3LXXA 1XZ8A 2N3ZA 3KR9A 4HLUA 2CF6A 5A4KA 1H2RS 3V1NA 4YYZA 4GXTA 3TTTA 3RYIA 3V80A 4ZQIA 3C7AA 2EARA 4KODA 2A5JA 4KI7A 3DLAA 1V9CA 2YWXA 1O0SA 1Y5IA 4IRXA 1Y3BE 2RGWA 3R5TA 4NZYA 1Y9ZA 2B7CA 2IYSA 2EWMA 3K4PA 5IAKA 5IM4A 4BO0A 2AH5A 3TOZA 2YUTA 4XUEA 1NF9A 4JT4A 3UJHA 2WJHA 3I8OA 4ARCA 2EG9A 1U5BB 1ZFNA 1XWWA 4GAEA 4BFUA 4ZJPA 5EAIA 4LRYA 4D0LB 4IMRA 4G86A 2BONA 4TVKA 4DCUA 1M74A 5A4MS 2V45A 1DBRA 1UAAA 1NPTO 2QPAA 1AA6A 2QMYA 1B8NA 3FOZA 3DJYA 5M7EA 1Q95A 1WY7A 3DONA 3O2JA 4FZRA 4Q9KA 5EIFA 4BPBA 5KWIA 5AW0A 4OATA 4PX9A 1VE5A 1N7HA 3E53A 1NYLA 2ZIAA 1N92A 3V8EA 2ZB2A 4TMWA 2C3MA 1OROA 1JU4A 1NE7A 3BERA 4P9NA 4IZ6A 1RZ3A 1FPQA 1YB7A 4QT4A 2JLVA 2X5JO 5FV4A 4JYZA 4KVZA 3RJ5A 4P31A 1F06A 1JI3A 4DSOA 4BO3A 1DKLA 4BQIA 4PRKA 1TK2A 3F4LA 3Q15C 3G5AA 2VF7A 5ELXA 2NSJA 1ZOLA 4MWEA 1Z6YA 1QHFA 5FR2A 4R3NA 3FYHA 2NXCA 1QRUA 2BEVA 1RBQA 4OBXA 5BO5A 4U7GA 4M9RA 3ND9A 3HVIA 4L08A 5L3QA 3RO7A 2OG1A 1A4UA 2YR0A 5FKJA 4KX3A 4L02A 5FWYA 1RVDA 1QQBA 1E0AA 5FAKA 3MQ4A 5KVCA 1PQUA 3BEDA 2OMKA 4HUQB 1XD9A 1EJ2A 3W6ZA 4N82A 1YOVA 2FZLA 3PGVA 3AI1A 4KCGA 3O4VA 2Y0EA 1V8DA 2C7GA 3O26A 3THWA 1NBEA 1CDOA 3Q2KA 2DH5A 4EX6A 4QUIA 3DP7A 4NKRA 1FSFA 1JG1A 1ZOPA 1XG5A 2PYZA 4Q15A 3A3PA 2FWIA 2VEDA 5J59A 3I0NA 4BATA 5BUCA 4P8RA 3K6SA 3GLGB 3IDOA 3P5BA 3S5JA 1LW6E 4DJJA 1BSVA 1A82A 5AM4A 4DCMA 1ULUA 1JDNA 2WMDA 4FW9A 4M89A 4TLLB 3JS5A 3CJQA 2YMMA 5T4EA 5BWLA 3KEQA 4FSXA 1F4PA 1ZIYA 4UUPA 3TZEA 4ND3A 1JEAA 3MQ2A 1MO2A 4Z3OA 3MOSA 2IHTA 3VGJA 1VYUA 5KYNA 2M98A 1M1ZA 4IYJA 1L5ZA 2SICE 5FWDA 1U1IA 4NBWA 1MFZA 3SHFA 1G5RA 4YAGA 2XQKA 2P79A 1DRWA 5GZ3A 1YBVA 2H18A 1CZUA 5BOSA 1W34A 2XMZA 3C8HA 4MYUA 4CNBA 2SCUB 1J90A 2H5IA 4R40A 2XXAA 3TTWA 2I87A 5ENDA 3EF0A 3A9TA 1SIWA 5SICE 3GLQA 4CTJA 4UEQA 5K09A 2YV5A 4P58A 5CMLA 2J33A 5KU1A 4J94A 5F23A 4CEIB 1RXIA 4R8VA 1J9ZA 4HQKA 5IULC 4QQNA 4DV6B 4IG4A 2ZIZA 1I13A 3UBTA 3QY9A 4OBBA 1WEKA 4G8DA 2RKBA 1ZA2A 2JIDA 4RELA 1VYVA 3DULA 3C0KA 1NVFA 2R00C 3G0DA 3QBVA 1CB7A 3K09C 3I12A 3B12A 2EWVA 2PYIA 4FZ3A 3F97A 2Q62A 1FXWF 3OZVA 4UOZA 2VT7A 4W5HA 6YASA 4MRRA 2R8OA 2O2DA 1T0UA 1NJSA 4IIEA 5K0ZA 1AU9A 1OBHA 1T1SA 3MCVA 2RHLA 1BU8A 1DEAA 1R37A 1J8MF 2LWIA 5BMVB 5AOVA 4MKRA 3D3WB 1AUQA 1WCYA 1ESCA 1YB4A 1NVDA 3A4TA 3GRAA 1HTWA 2EG5A 1MT0A 1VB5A 2NO4A 3FWPA 4HN2A 1CBUA 1TMOA 4RSGA 4N7RA 2GM4A 3ZZ1A 4BS9A 5LYJA 3ZCPA 221PA 3RUCA 2Y6VA 1B8OA 1N3IA 2C4TA 3K35A 4E2XA 3F46A 3KD3A 1D8TA 2FTKE 4IOLA 3M8KA 3FUVA 3IMEA 4LXXA 2D3TA 1PSDA 4W5NA 3SQMA 1P5RA 3E1SA 3UXEA 2AZMA 2MSCB 5JO9A 5JATA 5KNBD 3GDOA 2AE2A 4DT1A 1E4EA 2CLSA 3E1GA 4BEVA 1X8KA 3NZEA 5AKLA 2VCYA 1ISMA 1M8KA 2AVNA 4RPJA 1NYRA 4A0FA 2DULA 3DWFA 3FTDA 3KVRA 4H0FA 1TO6A 4YX9A 1D4FA 1CG6A 1OZAA 2N47A 5C1BA 1F2UB 4EKDA 1E7RA 1U6KA 2E4ZA 4CM6A 5LQKA 1P73A 1UKEA 3D7MA 1UZAA 2H4YA 2FMUA 3K6JA 4ROTA 3SQOA 1QB7A 3T35A 5JZBA 2ZU6A 5DNDA 4Q3NA 4LJ6A 4US0R 1S02A 3D1VA 4KFCA 2FG5A 4TQ9A 2QZJA 4X20A 4H60A 5ALTA 2J0VA 3S27A 3C3BA 3PI7A 1RLMA 1AG9A 3G0CA 1PLKA 5AI4A 4PYIA 3JVEA 1O95A 3LLMA 4HQLA 4E33A 1KRWA 4B7ZA 2DLDA 4EUFA 1QLWA 4G0YA 3ZCQA 2ZRHA 4UMVA 1GZVA 3ZHCA 1PYOA 3REQB 1H0RA 4YQYA 1JWLA 3UPUA 1C9MA 3VSEA 5KNBH 5AKGA 1T0JB 3IJPA 4NOJA 1K75A 3K2QA 3WAKA 4ARUA 2HBYA 4ZAZA 1FMCA 3VYUB 2FEXA 3Q9LA 1W4ZA 4KXLA 5G02A 3P26A 2YDXA 1P4JA 3K6RA 4XE5A 5FLKA 5BSRA 1HDZA 4EJMA 2C4VA 4D9CA 3ZJ5A 4HWKA 3OG9A 2EW2A 4F4FA 1BGWA 3NEAA 1X8JA 3I2KA 4YTEA 1RVV1 3WSWA 5IN4A 1W0KA 1P45A 1Y42X 1P4SA 2Q3FA 4N0QA 3R9XB 4I4LA 4I55F 2B5VA 2KYRA 2E5FA 4M0PA 4PX3A 4RPCA 4Y2HA 2YWFA 4M46A 3RFFA 3ZH9B 3INNA 4EUKA 2ERYA 4PC1A 3B51X 2RE8A 3R3HA 2TSYB 4MAAA 1CUAA 2CLIB 3AEUA 4NFYA 1N36B 5KYKA 3E5RA 3C48A 1A7UA 1I9CA 1WTAA 4FYKA 2YV1A 3REFA 3GUHA 1VA5A 3LXRA 4CGYA 1G19A 5JJLA 1MFPA 3G7NA 3DZKA 4TXJA 3WYEA 1G2OA 3DUFA 2W98A 1FP1D 1Z4JA 3KR0A 4NY1A 3Q7IA 4YJHB 1QE5A 1R0SA 4YJ2B 4GMXA 4HAXA 3DYIA 3NDBB 2XNCA 2OMEA 5EKUA 1I6LA 4ND5A 4LDQA 3OU7A 2C31A 1C41A 3BSSA 1U28A 1XKXA 5K20A 4O4IF 4OB8A 1G5HA 3N3BC 4U6SA 1UOPA 2CFRA 2APJA 5CH8A 1PVVA 1F5NA 4AQ7A 3BQMB 1HGXA 4KQHA 1IM2A 3ZDYB 5BSMA 3A9CA 2ZWPA 3KJQA 3DCYA 3EULA 1D1PA 1C14A 4IDHA 5E0OA 4M1KA 2O8BB 3KSDO 4ZODA 3L5OA 1P7CA 5TS3A 4CGZA 3A6GA 4BP9A 1RR6A 1XVUA 1BOOA 1ZU5A 2EEPA 4P4GA 3UATA 1G7CA 3E35A 4R2WA 3RUIA 1FE8A 1HX7A 2A5DA 3K0EA 2E82A 4GLFA 4FFLA 2DZDA 2HQBA 3KTOA 1QSGA 1RI2A 1WW3A 2WKWA 2ZIWB 2GLTA 1U7HA 1J99A 4GRDA 3ZK9A 3O74A 1Y8RB 4A0RA 3HCOA 5H02A 5E7QA 5LZ7A 4QYMA 1BDMA 1DXOA 4UE3S 4C7OA 2K6GA 1GZUA 2B9EA 1J9GA 3HL0A 5AXBA 3V48A 4NI5A 2I9PA 2JFGA 1LC3A 3IIMA 3PA8A 4J75A 2YV2A 3U4DA 1SU8A 4L3OA 4BZWA 1DWPA 1EQAA 1VFNA 1Z08A 2BM0A 1K3TA 2PJDA 4NS1A 1JE0A 4HDQB 1A2OA 1EGMB 1P6UA 2O4UX 2AK2A 2QP9X 3Q11A 1CUYA 2Y1OA 1LRKA 3NBKA 2HRCA 3Q9NA 1BDJA 4W7IA 4NENB 1NT4A 3IIEA 2P41A 4AROA 4TUYA 2G71A 5IAJA 4Z53A 4BKOA 3H1AA 4IW3B 1GGEA 3QVKA 1QGOA 3PR3A 5G4KA 5HA5A 3SKVA 5G1NA 2IOFK 2AOWA 1DQYA 1K08A 1QANA 4C2UA 4BWGA 2PV0A 4MRAA 1FLAA 2QM7A 1Q1ZA 3M4XA 4TV9A 2WM3A 1NL3A 3G9ZA 4MVXA 3B8EA 1MRSA 3CINA 1OHHD 4URFA 4LQ4A 2Z5LA 3ZY3A 1JB1A 4RACA 4HQOA 1WUKS 1CULC 2C2XA 4RPKA 5D3QA 2PFSA 2CSUA 3IE0A 1XXHA 1SVKA 2R2GA 5DI3A 4DEYA 4W5QA 1MKYA 3L4KA 1MAWA 1TYBE 2WKPA 3NHYA 4KZKA 4ZCSA 3FBGA 3AJ8A 2HT1A 1ZSVA 3EHDA 2H07A 2C9DA 2R1TB 2VDNB 3R0VA 4K46A 4LZJA 4JJGA 3Q6NA 3ZZUA 3PQ4A 1U65A 5JAQA 5JC1A 2XBLA 1I2ZA 3DE3X 1KC3A 2X13A 4QYWA 1PG0A 3W2TA 4QNNA 3IAS1 2X0DA 1QQ5A 1AUXA 2F1IA 1FPMA 1JPUA 3CTMA 4MRPA 2DT8A 4R0NA 1KOLA 1U0LA 1QKKA 3IQHX 2GRAA 3ILVA 1KHTA 3BA6A 5DHQA 2CSXA 2WK1A 3PC8A 1W4BA 1AKRA 4LG1A 2GRUA 1DNPA 5DLQC 3NWJA 3DE6X 2SHKA 3B52X 4XTCS 2G25A 1IEWA 2QUBA 2VP5A 4Q1AA 5CG1A 1RPTA 3TR6A 2ODPA 1GQYA 1SUAA 1D7OA 3FNBA 3UV6A 2JFVA 3A4LA 1E92A 4PFKA 2E4YA 2L42A 1PJ8A 2VO1A 3I2JA 5G1PA 4GX0A 1H6DA 3N2NA 4O4HA 1M73E 4PM4A 1VJ0A 3OCWA 4R2JA 4EARA 5J1SB 1SUSA 1C3LA 3VOAA 1OWPA 2PTGA 2ZUCA 1JKMA 4BCCA 1B6GA 4F3YA 2Z8XA 3KQOA 3I0ZA 3QLUA 3W5CA 4YJKA 3W7AA 1ST2A 1IC6A 1O0CA 3S2YA 4K0RA 1YGYA 4KLNA 4N1AA 4WVFA 3PGLA 4RCVA 4UBMA 2QTWB 2O2HA 3O1HB 1A9TA 4PZAA 1CR0A 4A91A 1KO4A 2H29A 4BBJA 3AW8A 2UVQA 1KJWA 5JNTA 3SHOA 1QIIA 2ZQZA 2QX7A 4FDMA 5JLAA 3G2MA 2VK4A 4RD1A 3K9BA 5DP2A 2JI6A 1E61A 2GARA 4MVJH 4QREA 5EWLB 3T0FA 3P8ZA 2OGZA 1L5YA 1PNTA 2XGSA 5EZYA 4CDNA 4QLOA 1GAQA 2V3VA 2WIDA 3OAAD 1N2JA 3PITA 3WLTA 4HGPA 1RZVA 3SDZA 4QDUA 2C59A 3F6EX 3PJGA 2A0FA 2O8DB 4XUDA 1RYFA 3OQ6A 1PL0A 2HNKA 3I1YA 1N2CE 1SB9A 3E8XA 4AN4A 1J0DA 3Q5GA 3PJDA 5IP5A 1Y5MA 1OKKD 5FPSA 2PLRA 2D4AA 4UZEA 1QF9A 4ZYYA 3X1KA 4IDAA 1U0GA 2Q46A 2DLCX 4UTOA 4I1SA 4BY9E 1G41A 4YT2A 4NZPA 4QJ4A 3QZUA 2XQJA 1JBQA 3N59A 4DLUA 4KQKA 4X61A 3S6JA 2ZBUA 5KOJB 5LMZA 1MRNA 5ALJA 2K87A 5B4UA 4H3VA 4JYPA 3KK0A 1CQJA 3QFHA 3OE4A 3C45A 2ZSFA 1LW7A 5JSZA 1F1BA 3F6PA 4LJ7A 4MMXB 4X91A 3ILSA 4HWSA 3ZLBA 4BQNA 3IBSA 4HDNB 2Z57A 2GEBA 2F9MA 3I39X 4LHXA 3RCBA 1XEAA 2FK8A 5IJAA 4CCSA 1Y7PA 2AMYA 3ABSB 5ILQA 4AG6A 1E5DA 3K9HA 1PCXA 1GNSA 2QRUA 1UQUA 2ONYA 2ZUBA 4JCCA 2I5PO 2N75A 2F1HA 2ZB3A 3ZQKA 4D4JA 1WB5A 2WSSD 4CL8A 4CTMA 4GLJA 1WU7A 3DCNA 1UWVA 3OUZA 3TLBA 3OQNA 1NJGA 5IBRA 4JD5A 1C3XA 1ODIA 1T6YA 1CU1A 3R3SA 1M2GA 3K5PA 2CLFB 1OJLA 4F1KA 1KMCA 1JHMA 3W34A 1UT6A 4DLVA 2QLJA 2FN8A 5KTYA 4LZLA 1GPH1 5TS2A 2P9CA 2V55B 1H23A 1V41E 2DOKA 4COKA 2H6EA 3M3HA 4MQ6A 2OC9A 5AKKA 3E2PA 4XSGA 3SDBA 1AF4A 1Y81A 2C94A 1X3SA 1NR1A 5AXCA 4HSEA 2JA2A 2O6HA 2W2LA 2RJNA 4NV0A 5T7BA 3V97A 1DS6A 1M3SA 4P3OA 3HYTA 2HF7A 1YWGO 4G5HA 3PFBA 4LYYA 2XZOA 3LT1A 1A8HA 3HBAA 2D7JA 1A04A 4G67A 1XRMA 3NG1A 1J8FA 3OICA 1KEUA 3ENKA 4UM9B 3ELUA 3PQ2A 4C1BA 5DWVA 1UXKA 3AR4A 3IPYA 4Y0NA 5KDLA 1SELA 3K9GA 1CVIA 4GI7A 1HG1A 3GLHB 3VDNB 4RFVA 5BP7A 1G0NA 1NNUA 3DH0A 4LECA 1RM0A 3KVYA 4NU8X 1MX9A 1Z36A 2HA3A 5D3ZA 3WBJA 2XDWA 3VSBA 1WVGA 1H93A 2QE7D 3LLVA 5BSHA 2QIPA 2GAOA 1EU1A 4M3NA 3SVLA 4E5UA 4MR7A 3H1BA 3M7IA 5CB4B 2HWXA 2IY7A 1Z5ZA 2JS7A 2NNLD 4Q3EA 4ZEXA 4BXOA 4X66B 1M1YA 5JPDA 1G3IA 1RYBA 2OILA 2HFJA 2FWNA 1R50A 1G3QA 2H00A 5E6SA 3PEEA 2Q0XA 2ODAA 2XJ9A 3KHKA 3UV7A 5HS4A 1H3NA 2CVOA 4UC0A 4XLZA 4DLNA 2AQ8A 3E4CA 3GRUA 2QVZX 3JVUA 3FAKA 3RSZA 4QOIA 4DMGA 1QRSA 1OOEA 1L6RA 4ND6A 5LNK1 4X3CA 4QPPA 3KWJA 4M83A 1YB6A 4UHKA 3EIEA 3OH8A 5E3HA 1AT1A 5CAEA 4B2PA 3PUIA 3R7WB 1GT91 1DOAA 3C3AA 4BFYA 1EWRA 1QJCA 4QVGA 1T2UA 4QEDA 2HD4A 3ADOA 5FNVB 4ZCRA 2IPOA 2VAWA 1VP9A 1ZUWA 1X42A 3FI9A 3GJZA 3K8YA 3PNVA 1RJ9B 3MFQA 4GE0A 1CVLA 1FYXA 4G65A 2UXBB 1VPDA 2J3QA 3ZE1B 2IYXA 1N8KA 3G1UA 2WHYA 2FZVA 1U2DA 4W6QA 2WE8A 2FQ1A 4EW2A 4NQZA 1E0SA 5C5DA 1NOKA 3V1UA 1QE0A 1L5SA 2ODBA 1QYIA 5I01A 1G5IA 4GP9A 3JPYA 1MEJA 1EZZA 2DTDA 1CZOA 2XCQA 5HDQA 1CQIB 4EL5A 3DNPA 5CT5A 3BF8A 1Q3KA 2X5OA 3QWAA 1K5HA 3TLGB 3ODPA 1APBA 2O0LA 3ANXA 3L1UA 2A1UA 4R1TA 4ZCIA 1YKGA 4MVJG 2WIGA 1JIKA 2YN0A 4KXXA 4RNCA 2XR1A 2Z2KA 4Z9YA 3OFVA 4BDSA 5MFZA 3S2FA 1GXSB 3LA8A 3SZUA 2OCPA 3I42A 3KTAB 2QRGA 4MCJA 3JQFA 2ZZMA 1JZQA 1S5PA 3BXXA 1SO8A 3KZXA 3M89A 4RKRA 2IS1A 3KHTA 2XB9A