2WA1A

Structure of the methyltransferase domain from modoc virus, a flavivirus with no known vector (nkv)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
248
structure length
226
Chain Sequence
GICSSAPTLGEIWKRKLNQLDAKEFMAYRRRFVVSRGTAKLAWIDERGGVELKGTVVDLGCGRGSWSYYAASQPNVREVKAYTLGTSGHEKPRLVETFGWNLITFKSKVDVTKMEPFQADTVLCDIGESNPTAAVEASRTLTVLNVISRWLEYNQGCGFCVKVLNPYSCDVLEALMKMQARFGGGLIRVPLSRNSTHEMYFVSGIKNNIMGNVTAVSRQLLKRMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Methyltransferase Domain from the Modoc Virus, a Flavivirus with No Known Vector.
pubmed doi rcsb
source organism Modoc virus
molecule tags Transferase
molecule keywords NON-STRUCTURAL PROTEIN 5
total genus 80
structure length 226
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2wa1A00
2V7EA 3P9KA 1T43A 2K4MA 3P9CA 5H02A 3OZTA 1AF7A 4PGHA 4B17A 5K0JA 5EOVA 2GA9A 3BKWA 5E8JA 3UA4A 3JWIA 3DR5A 4E32A 1OR8A 3ID6C 4E2XA 4DMGA 2AOWA 2HWKA 3NVMB 4FT4A 5D1NA 3LL7A 3BGVA 5T67A 5EEGA 4PNEA 2XBMA 3DMHA 1NW6A 4A6EA 3D2LA 2XYQA 4X1OA 3AXSA 3ER8A 3G5TA 3OU6A 3FZGA 3HCBA 3PX2A 1L3IA 3PS9A 1QYRA 3NTVA 4BP1A 4YMGA 5JUWA 1SQFA 3G2MA 4BP3A 1JG3A 2B3TA 2IP2A 2YTZA 4GUAA 4M37A 5K0FA 5LQRA 2JHAA 5KQRA 2AOXA 4ZTBA 1X1AA 4RTRA 2P7IA 2IPXA 5EMJA 5LQAA 1DCTA 2G72A 3HP7A 2UYOA 4OX9Y 4RVGA 4E31A 2GB4A 1YB2A 1YUBA 2AZTA 2ZSUA 3QOXA 1AQIA 1XCLA 4F85A 7MHTA 1QAOA 1G38A 3GRYA 3CJQA 4FP9A 3FTFA 5EZQA 2IH2A 4V0QA 2Z6UA 3LGAA 4YMHA 3KQPA 1WY7A 5KYGA 2BR5A 5FUBA 4AX8A 2PT9A 3FUTA 3LX6A 2JHCA 3FUXA 2AR0A 4JXJA 1P39A 3EVGA 3G8AA 2UYQA 3LDFA 4OBXA 5EQJB 2BM8A 5E2AA 3EVZA 2IH5A 3L8DA 2NP6A 4A6DA 3MHTA 3A25A 1SG9A 3HCCA 5E8RA 1BOOA 3CJRA 5K0NA 2OB2A 1L3BA 3B3GA 4GOOD 1SVUA 3BWCA 3G5LA 4OA8A 4P58A 5EMMA 4MQ4A 3KQMA 3GU3A 3LCVB 1EJ0A 4ATNA 4CKEA 3LDUA 3ELWA 3P71T 2ZCJA 3HCEA 4KIGA 3PFGA 5U4XA 4E33A 1VIDA 4KWCA 5IKMA 1RJDA 4OBWA 5EVJA 3NJRA 3HA3A 3KQOA 3NWBA 4YUZA 3NMUF 5KVAA 1ZGAA 3GRRA 2F8LA 4QQNA 3KQVA 3VSEA 2IGTA 4AZSA 2IFTA 4M38A 3FTEA 2XYRA 2BR4A 4AZTA 2R6ZA 3NDJA 1MJFA 3G2QA 3T7TA 1R74A 1AQJA 2ZBRA 2OY0A 2EFJA 3A27A 5FWDA 4GOND 4GBED 4EK9A 3DXXA 2UYHA 3OE4A 1FBNA 3ELUA 1KXZA 4FZVA 2AN3A 3RIEA 3ANXA 4U7TB 3PX3A 4GOLD 4FS8A 3PT9A 5GINE 2P8JA 4YV1A 2AN5A 4CKBA 3P2KA 3VYWA 2ONYA 2VS1A 2ZW9A 1ORHA 3HA5A 1HMYA 2ERCA 5HZMA 2UYCA 3ER9A 2YVLA 2YQZA 1EQAA 4RTOA 2O07A 2FK7A 1NW5A 3K0BA 3KQQA 5HIJA 4NECA 2OXTA 5BXYA 1ZKDA 2OPBA 4HRAA 1YZ3A 4Y2HA 1Z3CA 1WG8A 3C6KA 5CD1A 5GOZA 1VPTA 4LWOA 3RODA 5EIFA 1BHJA 3HVHA 1XJ5A 4O29A 3TRKA 5GP1A 2ZULA 3DULA 1TPYA 3IYLW 1X19A 1X1CA 5EKUA 5LQNA 4RVHA 2ZIEA 8MHTA 3GNLA 1VBFA 3I5UA 3P2EA 4MWZA 4KDRA 3E23A 2AOUB 3G8BA 3KPVA 5E2BA 5LR6A 4C03A 4LWPA 1NW7A 5HEKA 4DQ0A 4QDJA 2H1RA 4XUCA 3KQYA 2VDUE 2Y1XA 2VP3A 3FYDA 2HV9A 3UJ9A 5GWXA 1N7JA 3SGLA 3R0QA 3O31A 4KW7A 1M0EA 2DPMA 4CTJA 4YV2A 5F2OA 2FCAA 3B3FA 5DM2A 1PJZA 2CKDA 1TW3A 2FHPA 2Z6QA 1R8XA 3P8ZA 1SQGA 1KHHA 3KQTA 3NVKI 2LD4A 3F4KA 5ICGA 2EJTA 2OB1A 2JHPA 2AOTA 3B3JA 3B7PA 4PWYA 1YFLA 2AS0A 2PT6A 3TOSA 2AVDA 3SSOA 2I62A 4C08A 1L3CA 2BZGA 4QVGA 5C0OE 2G71A 1H1DA 5DRTA 5M5BA 1AV6A 2WA1A 2G8NA 2Z6AA 4DA4A 3HCFA 4PYKA 3TM4A 3KPWA 3CC8A 1V39A 3DTNA 3FPFA 3BKXA 3JWHA 5ICCA 1G55A 1JSXA 1YZHA 1EG2A 3FPHA 3P2IA 4KDCA 4ER3A 2BH2A 4HSGA 1NW3A 10MHA 4OQDA 1PRYA 4RTSA 3KPJA 4XUEA 3GRZA 4E2WA 3Q7EA 2EX4A 2PV0A 1VQ1A 1D2CA 2PX2A 3ELDA 4CKCA 1YF3A 5FA5A 2YXEA 1ZG3A 4X41A 1JG4A 5CUQA 3FRIA 3LKDA 1QAMA 4DF3A 3BWMA 2GH1A 5DX1A 3UJDA 4BLVA 3ERCA 3EPPA 5DWQA 4IV8A 4P7JA 3C3YA 4EKIA 1TW2A 1ZHFA 4IWNA 3UJ8A 5K05A 5K0BA 1R8YA 1NBIA 2B25A 3GCZA 2HMYB 3BT7A 1NV8A 2PVCA 5DT2A 1O54A 3SX0A 2I9KA 1KPHA 1ZGJA 3VC1A 3DMFA 2ORED 5JR3A 2G1PA 4R6WA 2P7HA 1NBHA 3AXTA 3M4XA 3WSTA 4YUXA 5LSAA 2IBTA 4M7RA 2B9EA 2IDJA 5CIYA 2I7CA 4ER0A 2CMGA 3P9IA 4PYIA 3HTXA 3KQWA 5G02A 1F3LA 4PYOA 1G6Q1 3BGIA 5DM1A 1WZNA 3M6UA 4RSRA 4RTLA 3FUUA 4C07A 3R9XB 2YR0A 1IM8A 4RV9A 1HNNA 5F2NA 3LPMA 2XVMA 3TLJA 1RI4A 3TQSA 4E30A 1KIAA 3KPYA 2ZFUA 1FP2A 4GEKA 5HFJA 3UFBA 2XYVA 5FULA 2NXJA 2OBFA 2ZZMA 3AY0A 3EMBA 5FQNA 4RVFA 3G2OA 1P1BA 5EIWA 5E9QA 3RW9A 2PBFA 2P3OA 2QRVA 1JQEA 4EQZA 3HVJA 2AVNA 3MCTA 3MCZA 4XCXA 1QZZA 4V0RA 4P7GA 5DTRA 3DLCA 3DLIA 3C6MA 4GF5A 2FPOA 3GXOA 4WVLA 3S68A 3DMGA 2C7QA 3M33A 4PYQA 2ZVJA 5K0GA 2P3LA 2Y1WA 3TMAA 3AJDA 2NNWB 3EVDA 2QY6A 3ME5A 2ZLBA 3AWIA 3I9FA 4R8RA 4DKJA 4PYJA 4EKGA 2WK1A 5K01A 3KQSA 2E5WA 5DX8A 1VL5A 3GJYA 4MHTA 3TPZA 1SUIA 2GPYA 1I4WA 4PIPA 1XCJA 4HTFA 3CJTA 2ZIFA 4C4AA 5E1OA 3REOA 1YFJA 3G89A 3T7RA 2P3QA 1R00A 3FUVA 1INLA 1SUSA 4U7PB 4GC5A 2PWPA 1R6AA 5E1DA 4PCLA 5FADA 2KW5A 3FYCA 4RTNA 1UFKA 5F2KA 1RJGA 2P35A 5K09A 4R6XA 1KPIA 2PY6A 5T6BA 5BP7A 4YUVA 4BLWA 1RI1A 3KR0A 5GIOE 5K0CA 2ZBPA 3FTDA 1EAMA 1O9HA 2HNKA 3GIWA 3MAGA 3HEMA 3K6RA 2UZ4A 3MTEA 3PTAA 4G56A 5FHQA 2VDWA 1Y8CA 2JJQA 3IV6A 4ISCA 5DX0A 4DCMA 1RJFA 2OO3A 2P40A 2ZWAA 3A7DA 4Z2YA 1NW8A 4X61A 1JQ3A 4CWAA 3LHDA 3T0IA 2B2CA 2PXXA 3OZSA 1I1NA 2PXCA 4F86A 4XUDA 4EMSA 2ZZNA 4POOA 4IKPA 5CVVA 2ESRA 3E7PA 9MHTA 4K6MA 5ICFA 3BWYA 3PVCA 5E1MA 5DXJA 4ER7A 4OQEA 3TM5A 5EMLA 2FRXA 4L7VA 2QYOA 1UWVA 2O0LA 3SM3A 4RTJA 2YUIA 1ZQ9A 5HILA 4RTKA 3KR2A 1JTEA 4C05A 3KR9A 4PYNA 1BC5A 2I6GA 2WA2A 3R3HA 3EVAA 2HTEA 2IH4A 2CL5A 5HIIA 4AZWA 5K0LA 5BW5A 2C7PA 2QE6A 1NT2A 5LQKA 2O05A 4OA5A 5E9JA 3OFJA 4LG1A 5EGSA 3TFWA 3TKYA 5ICEA 4BLUA 4QTUB 4ER5A 3FUWA 3Q87B 4GC9A 4BY9E 1VP3A 1X1DA 3FPEA 3O4FA 3GRVA 4PGGA 2GLUA 1UIRA 4X60A 5DLYA 4IV0A 3CVOA 3UJAA 3SSMA 2YX1A 5EC8A 2GS9A 5FWAA 1XVAA 3DXYA 2JH9A 3HCDA 1IXKA 2VZ9A 1KP9A 2YXLA 3BUSA 3CKKA 3I64A 1L9KA 4GOMD 3THSA 3FRHA 4M36A 2VDVE 5IH3A 3FPJA 3B89A 3OU2A 1D2HA 3SXJA 4QDKA 5FTWA 3M6VA 5HIMA 4PIMA 3FTCA 3UBTA 1XXLA 2P1DA 5LQJA 2AN4A 5C1IA 4CXMA 3I58A 3BGDA 2G70A 3M70A 5E1BA 5DSXA 4QPPA 4FSDA 3E8SA 3KU1A 3THRA 1RJEA 3VC2A 3PB3A 3MB5A 1FP1D 3LCCA 5FA8A 2P41A 1G8AA 4FGZA 2ZTHA 2O57A 4DM3A 5GM1A 3GO4A 3R6TA 4MIKA 3UWPA 4AUKA 2QRVB 3TKAA 1N2XA 4P7FA 1DUSA 2IIPA 4PINA 5MHTA 3R24A 2XVAA 2ZBQA 3MQ2A 4YUYA 3OFKA 1FPQA 2IBSA 2IDKA 3QV2A 1M6EX 5EZSA 1JSZA 4KVZA 4E2ZA 3G2PA 3C3PA 3JWJA 4ER6A 2PSSA 1G60A 3A7EA 1G8SA 2N47A 5EG5A 2A14A 4QVKA 5CVEA 3BZBA 1ORIA 3IEIA 4LECA 4PCAA 5FCDA 3T7SA 1D2GA 1RI5A 4RX1A 3GDHA 5D1HA 2EJUA 2PWYA 3BXOA 5DTQA 5FQOA 3UA3A 1WXWA 4PYLA 3E05A 1P91A 2V74B 3OPNA 3KKZA 1QAQA 2PX5A 1X1BA 5EMKA 3P9NA 1VP9A 3KHKA 3LECA 1NKVA 3HVKA 1B42A 1JG2A 2PJDA 3V8VA 4YUWA 5C9ZA 5DTMA 3CGGA 3NDIA 4HGYA 4RTQA 1KYZA 5DM4A 3X0DA 5EEHA 4F84A 2JH8A 2PGXA 5KS2A 3OE5A 1VE3A 2ADMA 3MGGA 2YXDA 5ERGB 1EIZA 5EPEA 5DXAA 3V97A 5BW4A 3OCJA 3PLAE 3EGIA 3LBFA 3G88A 2FK8A 3QOWA 4HG2A 4RWZA 3M6XA 5CVJA 2FYTA 4QPNA 3EEOA 1JQDA 4PYMA 2CMHA 5E9WA 5K03A 1XDUA 3DP7A 2BR3A 3FPGA 3MERA 3G7UA 4Y30A 5CM2Z 1QANA 2QM3A 4E2YA 1Q0SA 2R3SA 3DXZA 3EEYA 4UOEA 5LQUA 4QTTB 5KQSA 5LQCA 2NXNA 2C7OA 3H2BA 1WS6A 3UJ6A 1KR5A 2OZVA 1XDSA 3ELYA 5EHIA 4FR0A 3I53A 5DRYA 2PKWA 4MTLA 3DH0A 4R05A 2NXEA 1R18A 5DSTA 5EKXA 1WXXA 3O7WA 3KPUA 3SMQA 1IY9A 1BKYA 2H11A 1P1CA 3A4TA 3M6WA 4QQKA 4DCGA 1EJ6A 2H00A 4CTKA 5K8VA 4RTPA 1RI2A 2NXCA 3EVBA 5FHRA 3UJCA 2C7RA 5HIKA 1JG1A 1JR4A 4R8SA 2GAFA 3A26A 4AZVA 3EGVA 3GGDA 3UJBA 5DM0A 1VLMA 5HOQA 2CWWA 3OU7A 2ZZKA 4HTFB 2HR1A 4EVIA 1N7IA 2OKCA 3EMDA 3EVCA 4P7KA 3SSNA 2PLWA 3HCAA 4WXHA 2PX4A 3LCUA 3HVIA 2ONZA 1NE2A 3P97A 2JG3A 4KRGA 3LKZA 1RI3A 3CCFA 4RVDA 1Q0TA 1XTPA 2OYRA 3ORHA 3UJ7A 4PONA 4DZRA 2Q41A 3DOUA 2AOUA 4HGZA 3CBGA 5GM2A 4FT2A 4FSXA 4H0NA 2ZIGA 3EGEA 4KIFA 3UZUA 1MHTA 3LSTA 3HM2A 2AOVA 2AOTB 3HA7A 3EVEA 5CVDA 1DL5A 2B78A 3PFHA 3NW9A 3GRUA 3B5IA 1JTFA 4C06A 3MTIA 4RTMA 3C0KA 3KR1A 1FJXA 5K0EA 4RYLA 5GIPE 3JWGA 3LDGA 3NWEA 4GQBA 3OZRA 5EHGA 5CCXA 4HC4A 2NYUA 1U2ZA 3IHTA 1M6YA 3LBYA 2O06A 3TR6A 1SKMA 2NP7A 5CVUA 1KYWA 2PX8A 3DUWA 4X63A 5T64A 1I9GA 5P8WA 4C04A 2PXAA 3SVZA 5CCBA 4YV0A 4E70A 1XDZA 2ZWVA 2DULA 3SR4A 1O9GA 3EVFA 1L1EA 2BM9A 3BWBA 5B1SA 1NV9A 1F38A 1KPGA 3HNRA 3U81A 3GWZA 5DPMA 4HH4A 2EG5A
chains in the Genus database with same CATH superfamily
3HL4A 5EI5A 1HC7A 5K6TA 5C51B 4XD2A 1GGEA 4FQ5A 2MINA 2NO5A 5BQFA 3CFYA 3MEQA 5EIBD 2PRKA 5KBYA 5E4JA 3ZQ6A 4RJTA 1JKFA 1CUFA 5ICEA 4DMGA 2AOWA 2BFWA 2VRNA 3GUCA 3GZ4A 1LY1A 2WAXA 4QUDA 4UEWA 5FLEX 3RH0A 3ZE2B 4E09A 5CX4A 3GPCA 1XP5A 1ZH4A 4Y6GB 1NJGA 1LBQA 2VCYA 2VHVA 3KTAA 3LPNA 3PRHA 2OZLB 4LPKA 3WLOA 3MHTA 3UC5A 3H7AA 3MLBA 3GA0A 3AXSA 2JI9A 2XRMA 4C08A 2OZLA 4G8JA 4BCCA 1NF2A 2F9MA 4LSGA 5C81A 3QBTA 1G0NA 2BFFA 5A4AA 5IAAA 1W87A 1YZYA 4Q3EA 1JL3A 5CDHA 3NTVA 3NKFA 1WPGA 1EWTA 4B46A 2YTZA 4Z6KA 4JLNA 2VEOA 4RFSA 1Z13A 5CVTA 4AJ4A 1GA4A 3CPSA 3FF1A 1YBVA 3IP6A 4ZVPA 3FKSD 4CN8A 2ZSJA 4BATA 1XZNA 2ECQA 1NURA 2NT3A 3AFNA 1T9HA 3LC0A 1RHJA 3N76A 3QLUA 1PGNA 4BE7B 2KX7A 2P11A 3IJEB 2J5RA 1NRJB 4B4KA 2ZR0A 5LMNB 5K51A 5K45A 4JYAB 4M86A 3KQPA 3THXB 2AMLA 2PT9A 1E96A 1ISHA 3PKJA 1KBZA 4KE8A 4UNQA 4Q9IA 3SOPA 4FB4A 3TZHA 2WTEA 1NWHA 2MSEB 1DKOA 3S70A 2R62A 3ZY4A 3F8TA 2XB4A 2UZ1B 4C3ZA 2O6HA 3I04A 2XSZA 4TSFA 1W25A 3DT8A 2A9VA 3MFYA 3QVSA 4UTRA 3EOBI 4ATNA 1XDBA 4G3XA 1S7GA 1NZFA 4LNUA 1RRKA 2B1RA 2JA1A 2FFAA 1MVOA 3MRVA 4DA6A 1BCRA 1C3OB 2WJPA 1BDMA 2A1UB 2YJ5A 3OD5A 4KWTA 1U6IA 1BMDA 2AJDA 2EGHA 2JD2A 5AK5A 3T38A 3V1NA 1ZLYA 1ZC3A 1GFWA 2X3UA 4M6WA 4X3PA 2NU9B 4CN9A 1CRQA 2A84A 3H11B 1DKRA 2XUJA 5JAUA 3KLBA 3RKUA 2GHRA 1R16A 1U7XA 3HXTA 1ODKA 1LV7A 1D4ZA 4UVIA 1WW2A 3RJZA 1M7BA 4RCYA 2X1LA 5CNMA 3MOSA 2QX9A 4HOYA 3ZV5A 1T36B 4TZTA 2H6EA 5TY0A 3VR5H 4Q4CA 4E51A 2PT7A 2J4CA 1A9XA 5G40A 3PNVA 4IDEA 4C3UA 3O82A 3V7UA 3Q72A 8ADHA 3QFTA 2AN5A 2CHVA 4BLOA 2HSGA 3HZRA 3P2KA 1U81A 4QTZA 4B84A 2BRUC 1O6FA 2VT3A 3I2YX 4GX1A 4ZDKA 4D96A 3N7UA 5A06A 1LD3A 1CWUA 3KQQA 4NECA 3FIUA 3A9UA 3OLYA 5A5VA 2PZAA 3AHGA 4HFJA 2JCYA 4CLOA 3TYXA 1JAHA 1JDBC 2DPXA 2R25B 4ARAA 1CETA 4KQMA 5A4IS 1MUUA 3SF8B 1U0RA 3BWVA 5U1PA 1HTBA 1U2DA 4LWOA 1LLDA 1TF5A 1GCAA 3VFDA 3NB0A 3TRKA 1B16A 3W79A 3UV6A 2IYQA 5DNAA 1JR2A 2HZBA 1Z4MA 3HU5A 2OENG 4X91A 1VBFA 3K7EA 3P2EA 4QHSA 1ZH2A 2ERXA 2EBWA 3KPVA 5IARA 5LR6A 3E5RA 3TO5A 4I5EA 5CB4F 2WKQA 1GKKA 2IU3A 3CT4A 4FN4A 4KLZA 1E2QA 1PKEA 2REBA 4KAJA 3OZWA 2C7GA 1W5AA 2H1LA 2FH5B 2RHMA 5J2TF 5BW8A 4JEHA 5JVDB 3VC7A 2G1KA 4I14A 4OQNA 2W2MA 2CSUA 4D41A 4R0MA 4DPKA 4K0KB 3VDNB 2ZRIA 3H9CA 6REQB 3T1TA 1SXJD 4AD8A 2IZ6A 5JSZA 1HL7A 5KYVA 3QITA 4ZTZB 2PT6A 1Q50A 3EZYA 2AVDA 1PTKA 4AU1A 5B37A 2HU5A 4JC5A 5DFAA 4A6PA 3IMKA 4AUNA 1UFRA 2VP6A 2WUFA 3IOMA 5JW6A 2Z8YM 1K6MA 1CY0A 1L4UA 3NIGB 4GYWA 1TTTA 1GG8A 4AI6A 3IOYA 2QAJA 1XJWA 2ZYDA 2JDID 2VRCA 3MJFA 1GTZA 4INPA 1FX1A 3GPDG 1F6BA 3IAXA 2ZQ5A 1YZHA 5SY6A 4RD1A 4ER3A 2XZPA 1EE2A 1MABB 4UHJA 3VU3A 4JR0A 1CBUA 4QLBA 4WT7A 1F06A 2KMLA 3DMDA 1G5QA 3Q7EA 2YQ5A 4B81A 4CKCA 5BT8A 6NULA 1D4FA 1FTWA 2D1TA 3AU8A 2CXPA 2X1VA 4EZIA 2IHUA 1CCWA 2CLHB 3ZBUA 1KO4A 2Q3BA 3K4HA 4JC4A 3PKIA 4HVLA 4IXTA 5AVYA 2WBLC 1PJCA 1Y9DA 3B1KA 4XCVA 4P7JA 3B6JA 2FDCA 5AI8A 3I8OA 5ALSA 1R6XA 4HYYA 2X0EA 5K0BA 1PYGA 3EIEA 1T5LA 4RHTA 3V1LA 1T6NA 2C8VA 3L04A 1TUGA 4QGFA 1HBJA 3D4NA 3KYCB 1NX6A 2VO1A 3JATA 3N74A 1G5PA 1XRMA 2ZUCA 4UATA 1U80A 1CR4A 2WT8A 1E69A 1LTHR 3HR4A 1ORRA 3IBGA 3LD9A 5CA1B 1E2IA 5KWSA 5L51A 4CR8A 2ZJ6A 1WTCA 3ZE6A 2WSIA 3KHTA 3SLGA 1DV1A 4DDKA 1XWFA 1DLIA 4G1BA 1HT0A 1VBMA 3LFUA 4ZREA 5G4LA 4BMPB 1CVRA 5FX2A 2HIAA 1D2RA 1G6OA 1U3GA 1OX5A 2ZE7A 1M6HA 1JQLB 3V2HA 1T6BY 1P6XA 1I3NA 1M0WA 1CB7A 4I1PA 4IDDA 3MCUA 3PF8A 1AGYA 4H1VA 4KQGA 4JA0A 2B7CA 3WNZA 1XZGA 4DZTA 5KSZA 1KOFA 2EL9A 3F47A 4AJNA 1CQJA 2MOKA 4UEQA 4CTKA 5DM70 1NULA 2NZUG 2EEPA 1G0OA 1IB0A 5FQNA 3RK4A 3RW9A 1JBQA 3ZWCA 2GHQA 2RKOA 4Y18A 1I1QB 2JFZA 4AJHA 4ECEA 2BDUA 1H5UA 3DCIA 3LWBA 1YU9A 4KAFA 4GNRA 4NE7A 3RB8A 2UUCB 1DXHA 5SYAA 2GM3A 2HEGA 2QMYA 4RNDB 4XDZA 5EJ4A 1AF4A 2XB2A 1MVNA 2JJYA 2PGJA 3G0GA 3NHAA 3CF4A 2EKPA 1CK4A 2Q3FA 4J03A 4Y8VA 3VU8A 2ACKA 5JMPA 5BOSB 2HO5A 5IZCA 4UMEA 1NVTA 4QXQA 3L1KA 1E2GA 2DSNA 3E22A 4YXWA 4Y67A 3TDKA 4UM9D 4JP1A 2FQ1A 3YASA 2G80A 4IHJF 1KMQA 1ZD5A 3EIXA 4FPXA 5ER9A 3WR5A 4E4RA 3NT4A 5KJ1A 1U6JA 1V1RB 1XCJA 4W5JA 5DEIA 3TRIA 3VR4H 1ODSA 1SKUA 2FJUA 4N7BA 4C9BA 1EI9A 1KI8A 2VYVA 4D4IA 1PR1A 1SBHA 3WZLA 5WRFA 1INLA 1SUSA 3WLKX 1XCBA 1K6EA 1U28C 4EUHA 3OZUA 7GPBA 2H29A 2QDKA 2NUPB 1YB5A 2QZ9A 3DLAA 3FCYA 5M04A 1JR3D 1JZTA 1M8FA 2FWIA 2FXVA 2J33A 2JFGA 3SFZA 4D42A 5LJLA 4IHJA 3WQRA 4RLSA 1NN0A 4C6HA 3RV4A 1XKTA 2AIRA 2WSYB 1U04A 1IY2A 5C52B 1F3OA 1Y4ZA 4O4IA 4FDVA 3A6FA 1NN5A 4N5LA 4RZIA 2ZBPA 3FTDA 2ZT8A 4H1UA 4MQ6A 3E7WA 4TQAA 4IHKA 1EA7A 1QB7A 2P6PA 5HXAA 1AQ6A 4QGBA 4TLLB 1EZZA 4WEOA 4DSNA 5HM6A 1YQXA 4JNKA 3AI7A 3QVGA 1LBTA 3G5MA 1O89A 3TQQA 3EY9A 2IPNA 2M1XA 4JKIA 4YYEA 1V5GA 4RY8A 1JQJC 3SF0A 5K8UA 2EFYA 1FFEA 3T4XA 4CIDA 1U3TA 9MHTA 1U4SA 1IVYA 1ZC4A 4UREA 5E1MA 2D0OB 1EESA 4QFMA 621PA 2AF3C 5DGCA 3BOSA 3HSKA 4D26A 2IS1A 3R6GA 5CMLA 3RWMB 3U4CA 2GM4A 1JTEA 5CXSA 1NXXA 3OAAA 4AG6A 5FUQA 1YJQA 2AC7A 4I1UA 2LDBA 4EBFA 2OOKA 1Z5NA 1SOVA 2VNHA 4OA5A 4KXYA 2Y4OA 4PLWA 1FRFS 4EFMA 1Z4QA 3H13A 3R9XA 3AVVA 1HYBA 2VC2B 1HT3A 1J9ZA 2B94A 4DSTA 1VP3A 1Z33A 2G9UA 3Q3JB 3RS8A 1G8FA 3NM4A 4A0HA 4EP1A 1KRXA 1AKQA 4EHAA 3LE8A 5AJXA 3SSMA 2WQZA 3DPIA 2F1OA 2R86A 3CZ5A 4FXOA 3RPEA 2GK4A 1N6RA 3TLEA 3DZIA 1U8ZA 1ZISA 4A8TA 4MUMA 1XI2A 4O02B 3ZJ4A 1NVXQ 3H3XA 5AUPB 2JCBA 1E7MA 1JR3A 1QQTA 1SELA 2COEA 3OM1A 3H4MA 4M54A 4UTZA 4LDQA 3WOVA 3KB8A 1CFJA 4G01B 4YY3B 1QG2A 1Q17A 4TVBA 4KE7A 4JL6A 1OAOA 1NG9A 2PO7A 2CK3D 3CN9A 5KSYA 1ODCA 2QRKA 3V33A 4AUEA 4JT9A 3BIWA 4UCQA 4WCFC 4CF3A 1REQB 3BGDA 3AOEA 2PRIA 4TMKA 1BHQ1 3AB7A 5J4KA 5I7AA 4BKQA 1P60A 3DBOB 4J0IA 2XCRB 2EDAA 1THZA 3E8SA 3N1UA 4AWAA 3HVUA 3UHFA 3S0JA 1EDBA 3LCCA 4Q48A 3OTWA 3BFKA 3GJXC 3QVVA 3T52A 3VZCA 3F6EX 1J2EA 4DLXA 4F9GA 1FYXA 3LZCA 1N1EA 4H4CA 2JFQA 2RBKA 4MR9B 5MDHA 4MOWA 2QRVB 1KYXA 1F8XA 4HDRA 3SZGA 4QFBA 3A6JA 1VIVA 4M55A 4M0LA 3AZPA 3QK7A 2V7VA 5G4KA 5IAEA 2X4GA 1NMEA 2EP5A 2R5NA 2H1FA 1P3JA 1K86A 3BX1A 1F48A 3LQYA 4JYBA 4UBMA 4KVZA 4BU1A 1QZTA 3L4EA 2YXNA 4JFAA 4OAOA 1LPSA 5IDVA 1MGOA 1QP4A 2E6KA 3HB9A 3NZEA 1GGHA 3T1QA 1G8SA 5EG5A 3TLBA 1PI3A 1SIUA 3BEOA 3IUYA 2DBRA 3P0EA 4R2HA 4ZIRB 2DFVA 3WI7A 2Z8YA 2GM5A 2KJQA 3UA3A 5DN9A 1E7YA 1WXWA 2WV9A 4EOGA 1P91A 1PYDA 3VKVA 1TADA 1US8A 5AUQA 1Q19A 4MVJI 3WYCA 4I50F 2GILA 3ZCXA 3H2KA 4V2IA 1F6DA 1ETUA 4KX3A 5DTMA 4L3VA 1VI5A 4JV5B 2JZNA 5DM4A 3DZ8A 3AYXB 1R64A 3IT1A 4IUBS 4N0DA 2E21A 5ECYA 5EEHA 4BNUA 4F84A 2E7ZA 3GLFA 5CD9A 1QLWA 3LU1A 2WR8A 1FNCA 3FVTA 3L1JA 3QXGA 2O2XA 4F4IA 1XG5A 2PBLA 3LPLA 4ZVTA 5HJEA 5ITSA 4RXMA 3FH0A 3WYEA 1HDGO 4O4HA 4N0EA 5L3VA 1PUJA 2R3SA 3O8DA 4UOEA 5BQ5A 4FYJA 2PUTA 1FDIA 1VHLA 3WAGA 2WYIA 3ZUGA 2DX7A 2OZVA 5E6SA 1E6KA 3LPCA 2RARA 4GFDA 1J0EA 1PTJC 1MTZA 1PNRA 2PVSA 5CFQA 3AHDA 4LPSA 1P1CA 1PJ4A 1SQ5A 2XZDA 3MS4A 4EYSA 4NAVA 1TT5A 3IPCA 1I7LA 5M34A 3KKNA 3TTTA 4EMUA 1JA0A 5K3BA 3UXYA 2WVHA 5CW1A 4OXKA 2GAFA 5HSGA 3VKWA 4HDNB 4DR4B 4KRYA 1U9CA 4O63O 2CWWA 2IEBA 4K9MA 2I1VB 4QT0A 1QUFA 2IKSA 1EXWA 1RRMA 2Z0MA 1SBCA 3B70A 4MV3A 4ZRMA 1JEDA 1LJLA 3VXKA 3OTOB 4QWMA 2RH9B 1GTVA 3DVQX 3SDBA 1TA4A 1T9CA 2WP0A 4DE5A 3QFFA 1PO7A 1L5WA 4Q1BA 4K9DA 4Y6SA 3WL3A 1WW3A 2Q27A 2PUJA 1NJFA 3O2NA 1BWRA 2A4MA 3DDUA 4LDRA 4PNZA 1TO1E 3MWKA 4CM4B 821PA 3B6ZA 1A95A 3G9QA 4QGGA 2G04A 3U6KA 1GRQA 4FSXA 3EGEA 3UZUA 3W8DA 5KNDH 1F7UA 1KETA 4E08A 4GGOA 1G2QA 3VSDA 4IUDS 1E2MA 4NYJR 4BNVA 2QQEA 4YAIA 1Z4PX 4XRGA 1UDWA 1ZK1A 3DLPX 1M5UA 3HR7A 1GIAA 1S02A 2ZE5A 4JXKA 4D25A 2XY4A 4BMYA 4PHTA 1JBEA 3GLIA 2FAXA 3VPFA 1Y1KE 4ZJZA 3QUBA 1N9ZA 4GQBA 2DCUA 3RS5A 5CCXA 1U2ZA 1PS0A 3LBYA 4ILEA 1RYEA 4DUGD 4IX9A 2ZSAA 4X63A 1U0OC 2IDZA 5JBNA 5L8VA 4KC0A 5JH7A 1C8VB 2J4DA 3PUWA 1QX4A 2X5OA 2C04A 2XITA 3VM6A 3UYLA 1H69A 1CDEA 3NS7A 5M3BA 5AI4A 4KL8S 3ZHTA 1HYEA 3QYPA 3C6XA 1MENA 4EJSB 3D6NB 4LYDA 2QY9A 2ZSHA 3VRHA 4DLYA 2WUWE 1ZAYA 4IFEA 1UXIA 4IJMA 5CT9A 4C2TA 5IYZF 4CKWB 1JXQA 1Y82A 2Q2NA 2I6TA 3AHFA 4IRMA 1LTKA 3BKWA 4WMLA 1Q84A 3H42B 1D2MA 1N6LA 2NV6A 4Q4HB 2H9IA 2HA2A 4B1FA 3SI7A 1SUAA 3V1MA 1JA9A 1TA9A 4AN4A 4OHPA 2WSLA 4GE0A 4X20A 4D3YA 4YRKA 1UL1X 1BS2A 2R8PA 2QVLA 5JWRA 3OJWA 3JYHA 4N12A 1V11A 1DDIA 2JKYA 1E7SA 3TPCA 1M2KA 2CD7A 5DB4A 3UHOA 3ZLJA 3HCBA 1E2BA 1JNXX 3LIIA 3OMWA 1AE1A 3WWEA 4G8BA 3O8OA 4A8HA 3IXMA 3RD5A 4BP1A 3EG5A 4DWJA 3G2MA 1WQ4A 2LP4Y 4H6VA 1V71A 1XZQA 1COWA 2WIBA 2YZ7A 4IWXA 4L2IB 4ZWNA 3S1SA 1RAAA 2FFBA 4C1NA 4X62B 2IX9A 5H3LA 4ZT6A 4E3WA 4H4EA 3R5SA 4P9NA 1NG1A 5DNDA 4HQKA 3VPCA 4F85A 1JFLA 3HABA 1Q20A 1KVRA 4JB2A 1T4MA 2R00C 1Q83A 1N8KA 2P2DA 2WIFA 1LBHA 1CR1A 3K16A 3N2ZB 4H18A 1UBNA 5AHKA 4DMCA 3LGAA 5CTJA 1X15A 2ADOA 5A04A 5A5EA 1ES9A 5C34B 1H94A 2HPHA 3QELB 2BJHA 1BVUA 3HS3A 3OOJA 4M9SA 4EYEA 5KQLA 1ZRNA 4GR5A 3EVGA 4RA9B 3PXBA 2JRLA 2VZ8A 4KLRA 1UK9A 4M0DA 2POCA 4LDAA 2ZXEA 4X90A 1G20B 2HADA 3VI3B 2OB2A 3T5DA 3PGXA 3W7VA 1C3OA 2RGBA 1ECFA 4KMRA 3WJ7A 3P19A 4V0MA 1VJRA 1ZW1A 3C6QA 3HPQA 2ICAA 1UFQA 3HO1A 2LZ0A 4QOIA 2F7SA 5EVJA 1N9KA 2WV7A 2G83A 3HA3A 3H9BA 1EFVB 4HBGA 2VDMB 3LHFA 3T0FA 4IFBA 5CDUA 4CKZA 2MSKA 4MWCA 1JNYA 2AZDA 1IEXA 4MVWA 2P0EA 1S96A 5IBPA 2A0XA 5FI0B 1XZKA 3UCXA 5AVZA 1SXQA 4BPBA 4Z86A 4QGHA 4B7CA 2IKQA 3WRXA 4ENRA 4HAUA 5TMBA 3E5NA 3EZNA 1D09A 3WNCA 1GPLA 4Y6PA 3K8OE 3KZKA 4D80A 1EDOA 3AHJA 3OE4A 1FBNA 1IG0A 1WLYA 4K9QA 5I3ZA 1BDHA 1RQLA 2BEUB 2P1ZA 3UH0A 3EIUA 4GOLD 2G5PA 4OFBA 2KYRA 2G9RA 3KTAB 1Q7RA 1Z4IA 3I45A 1VZ2A 1ZJJA 2I6QA 2IYWA 4GRAA 1G19A 1MVLA 4ZXFA 1UBUS 2W5UA 2GJ8A 3QU5A 3EEBA 3GC6A 1B0AA 4NZYA 3IQGX 1LZLA 1W5BA 2R60A 1L5MA 3CUSA 4TN5A 4GM4A 2HTFA 3K92A 3OE7A 5I7UA 4QTYA 2RHTA 3MWYW 1C9NA 3EY4A 2DQKA 2VNSA 3FPSA 3I01M 4NICA 1HOXA 3TIGA 4D82A 1KZ6A 1YZ3A 4ZEWA 1QYCA 4GVLA 3U80A 3KQKA 3KFLA 4ABYA 1D6JA 4BRWA 3E3LA 5GOZA 1JW9B 1HM5A 2LIVA 3ZD9A 3ZE0B 3HVRA 4X20B 4ZI7F 2DHQA 4MVCA 2JVKA 3W6UA 2RJ3A 3U16A 2X7HA 1Z07A 3WNQA 3UT5B 2VK1A 3DBRB 4QU8A 5ALGA 1O1YA 5FV7A 3UUFA 3DMTA 4TM8A 3IUPA 3A4YA 4Q3AA 3RVPA 4D0NA 2V98A 2D2VA 2FN9A 2ZJZA 5FBQB 5GAJA 4UQOA 2HWXA 2CDBA 4YUAA 2XGJA 2D2XA 2C5LA 5LDDC 1RACA 2SECE 5DYYA 1V95A 3N2GB 2D4HA 5DHAA 2C2GA 3SC3A 3E84A 3TXYA 1YS9A 1L8AA 1YIDA 3R0JA 2QUZA 5GADl 1F2DA 1GNLA 2BFBA 1VL8A 3E48A 1ND6A 1NOIA 3EDMA 1TZJA 3KQTA 4HNQA 5IG2A 1ZH6A 4ACBA 1CQJB 3AI3A 3GP8A 2SICE 4LXUA 2GVNA 2IW1A 4I4CA 1L3CA 4B40A 2C5SA 2YHIA 4X6LA 4E0BA 1BFDA 4DJDC 1GT6A 4M0MA 4C0XA 2L42A 4ZPJA 2W6PA 4RUKA 1E1RD 5AVUA 3DTNA 4I2VA 3C87A 2XA2A 2A5YB 4M6WB 5ICCA 2NV2B 1JSXA 4HPXB 3LA8A 2FG5A 3ZV4A 3KVNA 3TD2A 1NWCA 3OKAA 3PNYA 4XR9A 4CIWA 1C14A 2AJTA 4INAA 3A4NA 3ND9A 4OLBA 1D6NA 5I48A 3D4OA 2HBRA 1E61A 1A50B 2QPOA 2CL0X 1H9BA 1QKIA 3H7IA 1MA3A 1N4DA 4TTSA 4QDXA 2WU0A 3HN7A 2QNBA 4CM9A 3BEDA 1WDWB 1DADA 2DTEA 1S0UA 2ZT6A 1Q1EA 2IYVA 3F6PA 1H65A 2F67A 3PHIA 5CLLA 5DT2A 1DCKA 2C59A 1GUFA 1U5BA 3JWEA 4L0MA 4KPUB 4YCNA 4TUYA 2I2BA 4I81A 2EWWA 1ZS9A 1KA9H 2OO5C 3KEOA 3AFMA 1H8ED 2R48A 1TEVA 3QXSA 4FE7A 4M7RA 5FAXA 5CIYA 1TRKA 5CPBA 5KVVA 4V38A 3U6BA 3Q9UA 1V1JA 2FP4A 2YY5A 3AIKA 4RM2A 5BURA 4PYIA 4WACA 3C4JA 3LF2A 3S5JA 3NT5A 4D7AA 9ABPA 1HYGA 1XO1A 3MM4A 1EQUA 3OQPA 3R44A 4MUFA 3BHNA 1IATA 1KGDA 1AKNA 5D3MB 2H4XA 4PRKA 5HMLA 5F9MA 3VJRA 3L82B 4CEIB 1IN8A 2GSDA 2C3PA 4IYJA 1RLMA 1S2OA 3LZ6A 3R09A 1M1YA 2ZJYA 4BMZA 4A15A 5EJAA 2XHEA 3N07A 2EFHB 2PBFA 3ZY5A 1ZPDA 2ZSDA 3JQEA 5GGYA 1J8YF 1Z29A 5JJIA 4FMCB 1TKBA 3LOQA 3SHQA 5B2EA 1G21B 2X0RA 2O3RA 4R3WA 4B3MB 2IF2A 2K6GA 4EUKA 2VUSA 4IXNA 4B3XA 1IUPA 4HMOA 3VVCA 5K4HA 3LFTA 5IN4A 1CZOA 1DMSA 1E89A 2PWAA 4FOSA 5J47A 5JAMA 1JHVA 3H9JA 4YPOA 3GEIA 2EFDB 4AJJA 4MHTA 4NWIA 1K0FA 2ZXUA 3DSRA 3HFRA 3FOBA 3H5RA 5CAEB 2G40A 5BV2P 4TMWA 1KP2A 4J16A 3KX2A 4F4DA 3F9IA 3RVOA 3E3NA 3DFUA 2XKJE 1C7JA 1R10A 1GUDA 5IUJC 2ZSIA 4B32A 2R1ZA 1UFKA 2HJSA 5KKAA 5CXQA 1RCUA 2VT6A 1MAUA 1IZ9A 4RF5A 3K71B 1WKCA 4RU1A 3GDOA 2CZQA 1KI1A 1DTWA 2JBWA 4BO1A 2AJ8A 5GIOE 2QXUA 4OMDA 1ST2A 5JJKA 2IV3A 2EQ5A 2FZ5A 3AW9A 4LNHA 3K6RA 3BIJA 2FG7C 2JGMA 1P7CA 4EGCB 1OIXA 5BVHA 5ED4A 4MS4B 1E7RA 3R8CA 1YB7A 3AW8A 1G41A 4ZAYA 2VYCA 3ZJTA 4KOAA 2XR1A 1DXQA 1KI7A 3VOTA 4DG8A 1FQJA 3OZSA 3E53A 2X0FA 1SO8A 3H65A 1VPWA 1NVKA 2ESRA 1VMKA 2EGGA 1FFXA 1R5JA 2HNAA 4GMDA 3UK6A 1OTHA 3FWKA 3K2IA 4NATA 5FNVB 4KFTA 2PL9A 3SIXA 3GPIA 3TN7A 3ISVA 4J16C 1Q74A 1SU8A 1Y8QB 2HA3A 4HYQA 4TXHA 4YRGA 2HJWA 3UMYA 1I6LA 4TXNA 1VSQA 4ED9A 3K8YA 1NXWA 4PYNA 4OQZA 2PGNA 4KMOA 4WEQA 5ALUA 1CQZA 1ITZA 2DKNA 3NBXX 2QWXA 4Z8XA 4AZWA 2RAVA 1RC0A 5LQKA 5FPPA 2A1IA 2XXJA 1PGQA 1RZVA 1ZVJA 2QORA 3AY3A 3L4BC 3QU4A 1K5PA 3V3TA 4TZ0A 2DBYA 4HEJA 4PSDA 5TB5A 5K2OA 4R1NA 4KRFA 4W8GA 2XCOA 3O4FA 3O1IC 3UJAA 5C1PA 1LQTA 2FX5A 2EP7A 1OAOC 3MC1A 5JJBA 5J2UA 3IIEA 2PKXA 4XXHA 4TS3A 4WI1A 4JROA 4BP8A 3KNZA 3LMKA 3LNCA 2WJ4A 2XA9A 3LLVA 1DBSA 4W63A 2AXQA 4HGOA 3BUSA 4XYGA 3THSA 1K7SN 3FRHA 1M83A 1U8YA 4WVFA 1K0UA 5DBGA 4BNNA 1GL3A 4MA0A 3HRKA 1T4DA 3AIOA 1D2HA 1YVEI 3IQZA 3TLXA 4MUAA 4O2LA 3JQ9C 1RXWA 4W5OA 1OF1A 1U2GC 1X7ZA 2B1QA 2ZB7A 3CLRC 3RO7A 4A2QA 4MGYR 3EVTA 4B75A 2Q9AA 4E3ZA 4NR0A 4Z0PA 1X1EA 3IOCA 5JAPA 2XXAB 3M6IA 1UZLA 4XJSA 4DRZA 5IKXA 3EHEA 4RMNA 3E6AA 3ED5A 4ANFA 1CEXA 2IXDA 3DVSX 4ZVUA 2BGIA 1D07A 3NTLA 1Q7GA 2ZAIA 5AIBA 1NVWQ 4RE6A 3CV3A 5L4SA 5H9WA 3PC6A 1Z2PX 2F3PA 2PYZA 2PZJA 3LXUX 3OZCA 5D3MA 4LZAA 2Q5JA 3WLNA 3I2FA 4P2BA 1XDDA 4MIKA 2GXAA 1N2XA 2JKVA 2IIPA 1TOAA 4PINA 3THYB 2Z8ZA 2R87A 2XQGA 4X1KB 2Q46A 2QP9X 5E4YA 4K86A 5ITZB 1QMGA 3UBMA 3DHNA 5EZSA 1F8YA 4P4TA 4UW9A 1IEWA 5DBIA 4E2ZA 3IL2A 4JJGA 4G0YA 1AVTA 3QVXA 3WGTA 1CP2A 1GNQA 2PMWB 4UPVA 4UMFA 3LJKA 3IURA 3NGLA 3UMBA 3LQ2A 4RKRA 1B3BA 3IEIA 3UT5A 2ECPA 2YNMD 4AQDA 4MVJA 3KJNA 4F4CA 3ZKWA 1X1RA 1Y7TA 1QAQA 2CLSA 3QFSA 3AEQB 4ZEVA 1JHOA 2QW1A 4CL2A 1XRSB 2R8BA 1B42A 2BMWA 3VH4A 1E79D 3VU0A 2NSDA 4MP3A 3WTBA 3F3YA 3T3OA 3HU2A 3KV1A 4UOQA 3I5AA 2R11A 2GCEA 3HJAA 1U3FA 4RIEA 1GT91 3ICWA 1N8NA 3D3QA 4KO1S 5FL3A 5F9HA 3KYDA 4BASA 2ZUEA 2CJWB 1QP7A 3QOWA 3VR6D 1PSZA 5A0FA 1KI9A 3IIIA 1CVLA 1JQDA 1I2DA 4OLFA 5E9WA 3EFEA 1NAHA 1MJGM 4MP6A 1PJRA 3KXIA 2CW5A 1TUBA 3BRWA 3WB0A 4WY8A 1QO0D 4XDYA 5A4FS 3B1WA 4LGYA 3TNYA 5K8JB 2XNJA 3ORRA 4JI4B 2XODA 3O3OB 2O5RA 2W37A 2WHPB 3JQ7B 4DDMA 5JLJA 4O4LF 2FW0A 4OY3A 4Z3KA 3IPAA 1XVTA 2YC2C 3WIUA 2R7MA 4C76A 5DSTA 1Y3DE 2C92A 2RGWA 3DO5A 3HUEA 1M8KA 3OEWA 1JB1A 2ZTMA 2X0JA 2X42A 3C24A 4GI2A 4M7PA 4MITA 1OZAA 1WB5A 3C16C 2NPIA 1X7GA 2P27A 5AVRA 3INTA 3EUWA 1M0SA 3DBLA 4WIAA 5JTTA 5HOQA 2O5EA 1EM8A 2ZAYA 4PAMA 4ZEOA 3D0KA 2HF2A 1JUDA 4LF4B 4P92A 2P1RA 3IRVA 1FSGA 4WXHA 1VKZA 1XKLA 3L8MA 1DIOB 1ORVA 2XF2A 3OLQA 4FJ1A 4TTQA 3FCAA 5TMEA 3HLYA 2Q4DA 5HDBB 1OBCA 2NO4A 2O6LA 3GEGA 2Q41A 2GR9A 3AERA 3JAKB 3P9XA 4LMBA 4TSKA 4BKPA 4CQMB 1DC6A 1J0BA 4E5YA 2XGOA 1YRHA 4QXPA 3GX1A 4H0NA 4KIFA 4RD2A 1Y5IA 4H7HA 4LZNA 4YFYA 2FPGA 5DHSA 3R74A 4LJAA 5EA2A 4BX9A 5EIXA 3H8SA 1CUCA 1WB9A 4OATA 2MSLA 1I0IA 3EEFA 4AYXA 1X9GA 1OXBB 2I4NA 2P4QA 4S1VA 3KO8A 4I55A 3PRJA 1L1RA 4G0WA 4CQNA 2W6ZA 5K0EA 1U3UA 5GIPE 3HDYA 1DOZA 4R2KA 2IE8A 5C2JB 5ETJA 3WLPA 1LRLA 2E18A 2PVPA 3H04A 1TYDE 2CCJA 4M1QA 1Z35A 2GAAA 2Q5LA 3DTVD 1NBMA 3G0DA 3OUZA 4K28A 1SVKA 3H1AA 4E12A 1BNCA 4F5EA 1H66A 2ATEA 2OCLA 3C6BA 4KQ1A 2P9TA 2GBLA 2C3MA 3R3WA 3GUVA 3TQHA 4AS1A 3KVVA 1L4GA 4GOXA 3WB1A 2C5EA 1RMYA 1XC7A 2XW6A 3NDBB 2DYKA 3N9IA 5IBRA 2RJOA 3P9KA 2FSSA 1S7CA 3TZ6A 5EKTA 4BO7A 4DCPA 4OXYA 5CG2A 4COOA 1RCFA 1ORWA 1SPXA 3IJRA 3GCGA 4UHEA 1P9WA 1IIRA 2P9CA 1T3GA 3ZWQA 4EI9A 1TGYA 2CDNA 4WGGA 2HWKA 3CRMA 2B83A 2DHEA 1GTRA 2P5SA 1W581 4Y2JA 1G2PA 1ESDA 1IXYA 5L3RA 4CKBB 3H99A 2WB4A 3FJYA 3IVRA 3IUQA 4ASUD 3U31A 3EQ9A 1YH3A 3AGPA 4MKIA 4O1IA 2JJ2D 2BTOA 1UBTS 3CISA 1VJDA 1HG1A 3CONA 2A58A 1ENZA 2QBYA 3K35A 2NYAA 1PEAA 2RBGA 2FWAA 1SHTX 3WQSB 5M2QA 2GOYA 2J5XA 2H31A 3ADPA 3PXCX 3OTHA 4KQFA 5IWAB 1EGHA 4ZO6A 4BL5A 4ZTBA 2Z58A 5JYCA 1W47A 3VVLA 4A82A 1IK4A 2UYOA 3QVJA 2GTPA 2FPIA 2RKWA 3HYLA 2VOJA 1ZM2A 4Q0MA 1SN7A 4QLAA 4BV3A 5KOHA 2Z83A 1RC1A 3NRCA 4M99A 3GQBA 1YUMA 2XQJA 3O9VA 3D1LA 3RJMA 2WLTA 1E64A 1Y8RB 1MB3A 2FWMX 4CRWB 5EUCA 3O95A 2KQUA 2EBFX 2RGNA 5HX7A 2A9KA 3BD6A 3NANA 4NPCA 3O8BA 4X5OA 2EZ4A 5FOSA 4LDNA 1RCTE 1N1MA 1R66A 3GJ3A 2YFYA 2GZ3A 4HZGA 4FYIA 1YZVA 4FDLA 3DT6A 1PFYA 1UC4B 3E82A 1W5TA 5EHNA 5FD8A 3EQ2A 1PW7A 1XA0A 3LFHA 3MIZA 1Z62A 1TUIA 1VKHA 5IKMA 4U8HA 4F56A 1BCSB 1GPKA 1ND5A 1FBTA 3P0RA 4JCOA 4LX8A 4O5AA 4Q39A 4ZC8A 3HYSA 2YKGA 2BBTA 2J9YB 4IEEA 1PWHA 2I66A 4W5TA 2A6PA 3M4YA 4DC0A 5K4GA 3IODA 3WG9A 1E2EA 2IGTA 4RKQA 1CFZA 3ZCPA 4LC9A 2NZJA 5EGNA 4IJQA 1XTUA 2MT9A 5IKEA 1RWVA 2DECA 1ZIDA 5FWDA 4N41A 3TOXA 1N33B 1SJ9A 1W4BA 3W05A 2QZZA 3NJ8A 4HEA1 3S8YA 4MV8A 2XRZA 1U99A 2J6HA 5GINE 4IICA 4DJJA 1I30A 2ZEJA 4ZI5A 3UANA 1TI7A 2IITA 3KSZO 4S2EA 4UNIA 1GZHB 3QMMA 1FDTA 3UV7A 4CTMA 4ZZ1A 4MPJA 4Y1RB 1P0MA 1JFFB 3JAWA 3DUFB 1EQAA 1OLXA 2O8EA 2HFKA 2JFVA 2D8AA 4L5BA 1OIVA 4XIJA 1NY6A 4HGQA 4CQJA 3FVVA 4XWOA 3TTSA 5IASA 1WWKA 1UPAA 4EPTA 1ONPA 2FUG1 4IH1A 5ALOA 4Z0HO 1ZVKA 3QPBA 1H0RA 1AQYA 3GJ7A 4KAAA 1PLJA 4EG1A 1Y9EA 3WKCA 1C8KA 1RJ9B 5KNBA 1U0BB 1K88A 1NR7A 3WWYA 1JQ5A 2WTMA 3HFGA 1GYPA 4N8EA 3NC1C 4F2GA 4F96A 4X45A 4MLCA 1Z2OX 3KQYA 3FNBA 3QPUA 3DEIA 1FUKA 2CUNA 1UQUA 4WZAA 4H9GA 4WNAA 4DV0B 2FVXA 1YUNA 3R0QA 4L07A 1SEVA 4QDOA 4LFCB 4ND3A 5T6MA 5AW8A 4MKHA 2CFRA 4FU0A 5TGZA 1GADO 4OJYA 1B00A 2G06A 2FHPA 1PR3A 1U0EA 3SPXA 3VR3A 4OHXA 3VKFA 5K8TA 4ROSA 1YQ9A 1NDHA 3MOIA 4BQIA 2AOTA 3VSCA 3IEMA 3WYNA 3TLYA 1JXMA 5FF9A 3PFWO 1C0EA 3RG8A 3U26A 4CGYA 1G7CA 2YBEA 1FP4B 2UYYA 5DTIA 5M5BA 1KOGA 3OHPA 1FU4A 3PQFA 5C7LO 2R6JA 4P98A 3NIWA 4FYWA 4X54A 2XE8A 3VNQA 1PVOA 1ZH8A 1QZXA 4GPZA 3DCJA 2HRRA 5KOJB 4BKOA 1ZGHA 3JQGA 4PV7A 4MROA 2O50A 4EYOA 4KK4A 5CBKA 2WKRA 2XWJI 10MHA 1ZWLA 3MTQA 2Q7DA 5LWQA 1UT8A 3FWHA 3FIJA 5FBRB 1JZSA 4NZZA 4NJEA 2FUNB 1NAIA 4RMHA 4F91B 2B6HA 3D3JA 4PICA 4FQ7A 2WPDA 2C9OA 4XM2A 4RADA 4MTCA 3OP4A 4RENA 1X13A 2CB9A 4ZJPA 5FOVA 3AVTA 1CJCA 2ZATA 4O2AB 3RT1A 2K7ZA 1SHUX 2A5DA 2G08A 4Q05A 4DLWA 4EECA 4Z5XA 1ZINA 4FD2A 3GQBB 2JBAA 4Y2GA 3SQWA 1B76A 4ARZB 1A27A 1IOLA 3M4XA 1AZLA 4CG2A 4HH3C 4MIYA 4O6VA 5K2MA 4IIYA 1L5NA 1MAWA 2X5NA 4PQFA 1TEHA 2AC4A 1Z0SA 2H4HA 2YICA 2QX4A 4NYMR 5HGXA 2B8JA 1WHSB 3GIDA 3GEBA 5DM1A 3HTXA 3S2SA 4C07A 4KWHA 1JI3A 1DCFA 4CG1A 3QY9A 4OHFA 3ROPA 3Q10A 4DC9A 3O3MB 1ZIYA 3BTVA 2Q0HA 1JU3A 2IY7A 2PMKA 3KPYA 2VJMB 4BFYA 4NYIQ 5DGHA 5ISMA 5HFJA 3AKEA 2NO1A 3NU1A 2XYVA 4R98A 4ETWA 2NXJA 4AJLA 4JEIA 1C7FA 1GVHA 2Z2IA 5E3HA 4C7OA 1Z8DA 4E21A 2AFIB 2V1XA 1VPDA 1ZOOA 1JWLA 1FFSA 2KLBA 2G9VA 4YASA 1FVOA 1Q7TA 1UBKS 1H2HA 1LGYA 1ZVQA 2PH7A 1Y1LA 2YNMC 3GNTA 3P9QA 4KXUA 4LJSA 4M2LA 3CLTC 5B1YA 2WPNA 4RGQA 4OLAA 5K0GA 9GPBA 3OVMA 1FOEB 2XZOA 3VKGA 1D0SA 1KZGB 1W85A 3AJDA 3I9V6 4QOSA 3EVDA 4OB6A 3WIOA 3WYAA 4CMHA 5KNBH 1LNZA 3I9FA 2R2AA 3FMIA 2JLCA 4Q7LA 3EEIA 3DE0X 3R0IA 4R1PA 4GECA 1LRJA 1NSFA 3HN2A 4OHWA 2FW7A 5IRCD 3KUCA 1P2VA 1QVVA 2O14A 1WSDA 5IF3A 5J4YA 1JA1A 1I4WA 1Q0UA 1WD5A 2R84A 3L6CA 1DWUA 1NVUQ 2VPIA 2VF4X 3WFJA 5FAKA 1RR6A 2P2LA 2YV4A 3QA9A 2P3QA 3EJWA 1MG5A 4IFIA 4U7PB 5ESXA 1Q0ZA 3K5IA 5K0TA 1Z4LA 1WZCA 1SCUB 1C9EA 3B60A 4JI3B 1E6LA 5KYYA 3MT7A 3G8YA 4TV8A 3TUJC 4RTNA 4YJ2F 1U31A 3U1BA 3O3NB 3FG9A 3ESRA 5CLIA 5KI6A 3ZX5A 4ZYLA 1T2CA 1RE0A 4BEVA 2CUKA 2YOHA 4MS4A 4A1FA 2HGSA 4BVLA 4BBJA 1T91A 4O4IF 4YUVA 1YULA 5AK3A 3ZS8A 4BBAA 3IUJA 4RW0A 1G3UA 1U7TA 3H5AA 3MAGA 3GIWA 4ON9A 4BO2A 3GA7A 3U09A 4HMQA 3QYJA 1ZIOA 1J23A 3EYAA 3IP8A 4RD3A 2IZZA 2FR8A 1S9DA 1NU8A 1UDCA 2ZB8A 3GZJA 1XROA 2J46A 1I7NA 2P40A 3RG2A 3LP6A 3RR2A 4ECAA 4F6RB 5B7NA 5CLFA 1H05A 2ZRLA 3BK2A 2DFKB 4LVUA 1Z0UA 1BG6A 3QVOA 2B98A 3GH1A 4B71A 3PYLA 1LJ8A 3W90A 4QYTA 3MMPA 4B3CA 5F12A 1PW5A 3PFIA 2QD3A 2XKBA 4C20A 2M9MA 3WJ2A 3W4JA 1G3MA 4L4ZA 2Q1YA 3S28A 3TB6A 1AKMA 2O8BA 4JSRA 4OM8A 5HILA 2R8YA 1K63A 4HB4A 3I23A 3BF8A 3PGVA 2VPQA 2CVQA 3A8TA 1YCDA 3H9EO 3SD7A 4RPIA 5KUTA 3R9KA 3IMEA 4CCAA 1YK1A 3Q0TA 3PVSA 3FNEA 4LY9A 1T5DX 2O05A 1QJCA 5CYFA 4G24A 3KBBA 4LG1A 4B44A 1SWVA 1PFVA 3HWX1 3OT4A 5H0IA 1NNUA 1U3DA 1WW8A 1R0RE 2XCQA 1YR3A 5H9VA 1KZ7B 4I8DA 3ECCA 2G3YA 3OECA 3ZQUA 2GS9A 4U5XA 3DA8A 3GBSA 3V4SA 3DZDA 1E3LA 1RTKA 3D7LA 2GF0A 5FNVF 1W0CA 1KHTA 1HEUA 4FFPA 4I1VA 4BFXA 1H9AA 2P5YA 3HDTA 4GWGA 2CT8A 3CKKA 4IGEA 3U9TA 4NYIR 3ZHYA 1V7CA 3EXFA 3QU9A 1T10A 3TIVA 4DDUA 5JXHA 5ALKA 2BMDA 4LCBA 3SC2A 1PK7A 4ZAGA 4EHIA 3SXJA 4EA6A 4N8SA 5FWXA 3WHLA 2GO1A 1QZUA 4IOMA 4B9AA 5B7QA 3QKSA 1O03A 2OOSA 4BB9A 2OQVA 4D9KA 2J0VA 4MKXA 3SG0A 1A5TA 3NG1A 1XEXA 4Y6RA 4WKNA 5EE9A 3JQ8A 1RZ3A 1EUQA 3F8SA 3GCDA 3MYYA 4B6QA 1U11A 4ETNA 4Q7EA 3E1GA 3INYA 3UJPA 3ZWOA 4NNPA 2ID8A 1P4GA 1ADCA 2VSYA 1O8BA 5JI3E 2VJNA 4IOJA 1QHXA 2EX1A 4V02A 4Z8YA 2O1XA 1R3UA 4DYVA 4FGLA 3DB1A 3ET4A 3A1SA 4JASB 1QOQB 5FR2A 5T4FA 1XVVA 2CZCA 2W4MA 1SXJE 2VUTA 4C0KA 4LRYA 4OK6A 4ZJYA 5L3QA 4PY2A 2G36A 2C07A 1G7SA 4XEHA 2F48A 4AIRA 1Q3HA 4FM9A 1LV8A 2C2WA 5F1OA 3RADC 4ZVLA 1S2DA 1V3UA 5DGDA 3CZMA 3FGZA 4E2FA 1CDDA 1XZMA 1H85A 2BSAA 3B51X 2CE2X 4N5NA 3ADOA 4OI4A 4S2UA 4F46A 2J30A 2R7NA 2HJHA 3AONB 3D4PA 5JCOC 3G02A 3B6EA 1MDFA 4BQQA 4ZKEA 3LWZA 4I4TA 3OCWA 3QI2A 1YC5A 3MD0A 4HAVA 4ODIA 1CRPA 5AJHA 5B58T 1KO1A 4L85A 2H48A 2OAGA 4KR7A 5J58A 3BULA 3BGSA 1E5XA 3VZBA 4M9XA 1SA0A 2PMFA 3BL8A 3WNBA 4YJGB 5C9ZA 1EHIA 1XOIA 2HA5A 2FPWA 1L7XA 1YZKA 4NS4A 2XUDA 3L01A 3MCVA 1MP0A 1ONOA 2PG3A 3EGWA 1XELA 3TUIC 3FMOB 4MQMA 3EDOA 3EGIA 3EK2A 3SSNA 4B8YA 5BXQC 5AVWA 1XZCA 2IUTA 2JI6A 2GK3A 4G8CA 4JC0A 4WBXC 4AROA 1PR5A 2WVJA 2CMHA 3GJ6A 3E8XA 4PYMA 4R3NA 1AMOA 2BR3A 3B1FA 5JS1A 2QM3A 1HDOA 3IESA 5EQTA 2X8AA 4LDJA 4NX2A 2A9OA 2ZRJA 3X2EA 3Q7QA 2XUQA 2PZGA 5BYJA 1RXYA 4F1WA 5BNTA 1O5TA 4FR0A 3I53A 4X95A 5LZ8A 3AETA 4BYGA 4IH9A 4QGSA 1ZGBA 2BD0A 4JLOA 4NE2A 1CJVC 3UWSA 3BERA 2IPMA 2J5KA 1CV2A 3H2SA 4RA6B 1HDRA 2P65A 2VEDA 3X1YA 1WE2A 2Z8XA 4OXXA 1X1SA 5KZMB 2A0UA 2BBSA 2COUA 4UVHA 3D02A 4UNNA 4Z1OA 5JALA 5HIKA 5LP6A 4B3RB 2Z9BA 5EWLB 2Q2VA 4EITA 3THWB 1UBFA 1Y8RA 2OD2A 1E9DA 1W9HA 5IK2A 1Y8QA 4HLUA 2FRDA 3PCTA 1MXFA 3ZWMA 4NAUA 2WHEA 2ZSBA 2OKCA 4WN3A 4AL4A 1BXRB 1SIOA 3KJIA 5FLXA 3AF1A 1KOLA 4EBBA 3ONWA 5DYGA 4JDUA 1BE8A 3LKZA 1EX7A 2QRMA 5I8ZA 4RESA 1Z6PA 1LK5A 4LYEA 1N2HA 1YR2A 1E5VA 2EKLA 2QPAA 3CRZA 3A11A 3KVOA 4IGFA 4ZYYA 5KTTA 3QE9Y 5GPBA 3T3MB 2GSWA 3O4VA 2JLYA 4YXWD 2IEDA 3DOEA 4H7EA 5JFTA 4Z3OA 1PS9A 3U7HB 4PU0A 3TLKA 3IUMA 4F4FA 2O19A 3O4GA 4NFSA 3EVEA 4JX8A 1VKOA 1RRVA 4N65A 4HZUB 1OFGA 4JJEA 3C5EA 3ZXXA 1N1DA 2PGOA 5B6JA 1PAUA 2EFEB 4PC3A 4HV4A 4WNIA 1FJXA 5KSOA 3AF4A 4QWWA 4DILA 5BWMA 5BNWA 4IXDA 4EF5A 3SQNA 3TLGB 4Y98A 1KH2A 3M1YA 2X3FA 1LS1A 3W5HA 1KYWA 1RKVA 2BUAA 3BFJA 2A5JA 1F4LA 3PRYA 4FFBA 4NJMB 4EB6A 1T0JB 4FWBA 3CNOA 1VJ1A 3FLMA 1NUHA 5A7GA 1XDZA 4C30A 4E70A 4BVGA 1IBKB 1QR2A 2QDXA 1IN5A 5B1SA 2XAUA 3BL6A 1Z28A 1N2IA 1YB4A 1F38A 1XTBA 1C1DA 1MIOB 2NGRA 1K7XB 2VHYA 1PR9A 1TVKA 3PXAA 5EMJA 5L4LA 3H2GA 1QQ5A 1T43A 1USIA 1XU7A 3P9CA 2XA1A 1BIFA 4WRRA 4CG3A 2OD7A 3RS0A 1TYBE 3VNUA 2G6BA 4LQDA 4HI0E 4A6XA 4CMBA 1P29A 1I0LA 2HQSA 1C3VA 2B1GA 2V8BA 2XDQA 1Z8FA 3MWEA 3OPQA 4MRMA 3P9ZA 3CVUA 1H1TA 1ST3A 5IK2D 1S4QA 3EWNA 4WESB 1PSWA 3DE2X 2R1TB 1AY0A 1CUVA 1DP4A 1HE3A 3LCJA 1FMCA 3PQ7A 5REQA 1DTWB 3NDPA 2BBWA 4II7A 4BNFA 2Y1FA 4WNAB 5EESA 1QPGA 1QYRA 5F5LA 4NOMA 2YHSA 1JZQA 1MX9A 1YDGA 3ISTA 1NGSA 4UUBA 3C3EA 3QF4A 1KKLA 3NHPA 2NTYC 1V4NA 3AH8A 1AG9A 1FDRA 2B5VA 3LIPA 4IRXA 3U1VA 3U39A 1XKXA 4YCLA 4H1WA 1XCLA 3HDHA 3K9NA 3AJAA 2Q5HA 2A86A 1M54A 1MO2A 1MHPA 3T3GA 5T4BA 1YBHA 4R0NA 1I3MA 4EG4A 3SXUB 2IYYA 2QQ0A 4P83A 1JX6A 3FUXA 5H5JA 5A03A 5DHQA 5BORA 1ESCA 3T99A 3TGPA 1NUUA 2Z2XA 4JYMA 3FTPA 3SJCA 2QTAA 1FUIA 3WAKA 4P3NA 2BGGA 3L8DA 4J1SA 1T25A 2VZLA 1TLFA 1SG9A 2XPCA 2PFGA 1ZMXA 3I73A 4OO3A 1RFGE 4U8GA 3KJFA 2V7PA 3OX1A 1KYVA 1SBQA 4OA8A 3OZDA 1BX0A 4MRSA 2DLNA 4KVFA 1A2KC 2WHQA 2XTMA 3DBVO 4YT2A 3QPVA 3PFGA 5EJ6A 3ICOA 1EFTA 1E1MA 1JJAA 2XAAA 1ZM7A 2UU9B 3CX4A 1RLJA 1JAXA 3E7DA 3VJMA 5CU7A 4CF6A 3IRUA 2I8CA 3TI9A 2PD6A 5HW0A 2GJKA 4UULA 1SU4A 2CE7A 2HM7A 2QM0A 5K8LA 1T5HX 2AX3A 1DBQA 2RG7A 4HSEA 3RM3A 3OTIA 1M2FA 1KU0A 3C3BA 4FZ3A 4M87A 5DHPA 4GI3A 4HEHA 4YP7A 1ISPA 4MHOA 4K6KA 4I9UA 2ZBRA 1LBSA 3A27A 1CUEA 4M1KA 1A9QA 5CK4A 4D9BA 4EK9A 3CIOA 2XE6A 3L92A 1PEYA 2V96A 3SJBA 2PGIA 3OA0A 4M76B 1WEKA 3PUYA 1U1DA 2MSCB 2QGZA 3H5OA 3QWIA 4KO2S 5JROA 3THXA 1RPNA 4B79A 4B33A 1F4PA 1VHJA 2WT4A 1V35A 3KB6A 2W2KA 3N58A 4JYCA 1I2AA 1V6AA 2ERCA 4QHYA 5C8ZA 3K1JA 5CNJA 5GVSA 3FDZB 1QB8A 4JLAA 2QBYB 3K0BA 5HF9A 2FW6A 1TJPB 3VPSA 2HC9A 4FDTA 3ASVA 3D8HA 5BSWA 1YOBA 3R7NA 1GDHA 1SCJA 1JHUA 1LBEA 2V6IA 2QIOA 2XWBF 4I0WB 5EIFA 1KU6A 3OC6A 5GP1A 5I9MA 5C37A 1JKIA 3DULA 3TFOA 1CJBA 2R79A 4RVHA 3V4OA 4PCUA 2XMSA 3HWSA 1DBWA 4KDRA 1YZQA 2VUHB 4NPHA 3R7LA 2CFTA 1X9IA 3L6DA 1DAGA 2PL3A 1PT7A 3MGCA 4QJ4A 2J3LA 4D9JA 3GHHA 3HBJA 2Q21A 3E70C 4KTTE 1DMRA 3FYDA 3ZS9A 4CLXA 2D7CA 5DF1A 3TRFA 1D5WA 1DOHA 2CXRA 2J85A 1ENOA 2W6NA 2WJWA 3MRTA 1D1TA 2YZ2A 3V55A 4BJ1A 1FNDA 3F90A 4E4YA 4WXYB 1IULA 5F2OA 3CX8A 4G0NA 1R0WA 3VVMA 3WDKA 1SQGA 1N0IA 3HCPA 4XGNA 4DMFA 4J43A 1S3SA 1L8OA 3F4KA 5E95A 4BFUA 2FZVA 3DW1X 3B7PA 4JJ8A 4CVNA 2AS0A 1R9MA 4ZA2A 4IIJF 4JD5A 4P3OA 4Y2SA 4FDUA 2OM2A 5JJCA 5EJEA 1L5ZA 5LIRA 1SURA 5K5EA 1H4TA 5D1HA 3GVIA 1KDVA 2AC2A 5DHRA 4DC1A 3TNDA 4PYKA 2OA0A 5JD3A 2ZIXA 1KAMA 3KPWA 4RXUA 1LDBA 3PI6A 1Y3FE 4BO5A 2FKNA 4FCTA 2QZJA 3F1LA 1Z7GA 3KZOA 4M0EA 4F71A 2L18A 4Q00A 1WXHA 2FP4B 3K6JA 3MA0A 1F2UA 4L5IA 4RTSA 2GBLC 2HNBA 3GG9A 4NH4A 3K0FB 1IL0A 3GFFA 2YXEA 4GPD1 1RABA 1REQA 2GEVA 2ZJ2A 1JEYB 3ETHA 1GRRA 1JDTA 3IP3A 3FRIA 2IV2X 3RRJA 3CNNA 4BVFA 5A2QA 2VDPB 4Q47A 2VF5X 1A1VA 3D4IA 3OETA 1QH9A 4D8VA 1HMPA 2NX2A 4AX4A 2RGRA 3BL5A 3ICEA 2FP3A 3TVTA 3UNXA 5JO9A 4RJIA 3KKPA 2I3BA 1NV8A 2O0HA 1T2EA 4B2LA 4CZ2A 2XZLA 1RFLA 3QLEA 4UAGA 4C0BA 1AN9A 3RAFC 4NOLA 2WAAA 3AR4A 3OIDA 4ARIA 4MS3B 5IABA 5JWHA 5ERYA 4YUXA 2IDJA 1C30B 1MCZA 2Q5OA 2FSPA 4RBNA 5JS8A 3O9MA 3J81k 4RLFA 1M1YE 3UFXA 3P9IA 1WDMA 2CUTA 1YWGO 1F3LA 3IAEA 1SKBA 1ZMBA 4LRXA 3AR5A 5EUMA 1JIVA 1U2SA 3Q5GA 4DIKA 4O2BA 3E35A 3NHFA 1IM8A 3D64A 1PLLA 4ZVSA 1L4NA 1TM7E 2JL1A 2XHZA 1C3XA 1SIWA 3KEFA 3TQSA 2WB2A 3VISA 1Z5UA 4MW9A 1SXGA 3VBEA 5HUHA 3I0ZA 1PR2A 4MW1A 4GO1A 1OV6A 4YACA 1Q1BA 2CFCA 1E6CA 3G2HA 4G1EB 4CTOA 4Z4FA 3C8DA 3M5DA 1P73A 2XNKA 1MRZA 4FLEA 4G8DA 4GZ5A 2P6MA 4RVFA 4AJPA 7ABPA 1PZEA 1AA9A 1QCCA 4K3VA 2ILTA 4P7GA 1T15A 1Y63A 5C4IA 5FP0A 3C6MA 4GF5A 2FPOA 2N46A 4JLJA 4TQ9A 2A3NA 4C6SA 2FE1A 2WD7B 4FMBB 3ZCVA 4BO4A 4CHTA 4OUKX 1Q44A 3A36A 3LWDA 4B6FA 5KWEA 1O6BA 4Q1EA 1BH6A 2AD1A 4O4JA 3VNBA 4GH5A 1TUEA 4GX0A 3GVPA 1PQYA 1M6NA 2JHFA 3E8MA 5DGTA 5KIAA 2B7BA 2QRUA 4JT8A 3MXTA 1DPGA 5DX8A 1QLHA 3P26A 4RSGA 4BFSA 1V8FA 1JEJA 4Q7MB 4B3DA 4PIPA 3D1JA 4B47A 2GCIA 4FC7A 4H31A 4YROA 4W5NA 1EU1A 4FOPA 4U63A 4DIDA 8OHMA 4FJ2A 3S81A 1AUVA 4W8OA 3H6GA 3KZMA 1M6VA 5HF6A 1LCIA 1YS7A 9LDBA 4PG5A 2OC4A 2RD2A 4MUXA 3C8MA 1NATA 1N5RA 4PZYA 5BQOA 4WCFA 4X92A 4YHBA 4ZFNA 2PPVA 1IBCA 2FR8C 1JH9A 2Q1TA 5FFNA 5K0CA 4NFHA 2PM8A 4RFVA 1UFVA 3REGA 3W2GA 2E55A 2R5WA 3TMKA 5AK0A 3O93A 2OLEA 2C2OA 5KYNA 4GPEA 4F0JA 1A96A 1ZIPA 1CJTC 1V3VA 2OO3A 1H23A 3KDAA 1FU8A 4OHOA 5DM60 1N6KA 1VHDA 4Q4DA 3NUGA 2B2CA 2H2IA 2RMKA 1VLQA 1RYHA 3CZAA 4YJ3A 4A2WA 4FYYA 5DBFA 1O96B 4DA9A 5BYBA 4YPVA 5ARCA 4BBZA 4IMPA 3LYLA 3QXXA 4Q1VA 1EFHA 4U39A 4XYBA 4C5BA 3A9VA 4L5YA 2VJMA 3TM5A 4Q4AA 1W0KA 5LB4A 1P1FA 1UOEA 3D5EA 1Z7WA 4ZV7A 3CZ4A 4EF6A 4E1BA 4LRUA 3Q98A 1PWEA 3IELA 3K0KA 4P1ZA 3BTUA 4CQLA 1Y3IA 1ZN2A 4OI2A 2D1RA 4G4IA 4TWJA 3DOJA 5E9JA 1B15A 4Q3DA 2W9XA 3EC2A 3D8NA 4Q9NA 1XZAA 1B6GA 1GZ6A 2GETA 1Y42X 2OQIA 2ZBDA 3DYVA 3I76A 3K0CA 3OH8A 2D1QA 4KMSA 3SE0A 4U2KA 4X60A 3HZZA 1A4IA 1UIRA 3P2YA 1QE0A 4H7DA 2QZSA 5ESWA 2WVAA 2XXAA 1Q0RA 3MUNA 4MGHA 2QW8A 2P0YA 2PUCA 3DAPA 1SRRA 4TKUA 4DRYA 4J0HA 2JPDA 1ICIA 2JH9A 2AFIE 4JLWA 5C53B 3HB4X 2DUMA 4DV7B 3H9UA 4P54A 3UB4A 1Q5PA 5CFZA 3VPXA 1GTMA 4S0XA 4K0RA 2JIBA 3CNBA 3QHQA 4J0EA 3MTGA 4M36A 1GTL1 3BB4A 3FPJA 4PS0A 3OU2A 4WUTA 1P9LA 1Z6AA 1SU7A 4M1OA 3SS8A 5I3CA 1GAXA 1J97A 3C98A 3DDSA 2XCSB 2PL1A 2YHIB 2YMQA 3ZBPA 2W6JD 4H3HB 2ZBFA 3ZX4A 1AO3A 3JVEA 4RF2A 4RZ3A 1C30A 3AMVA 1RDFA 1W19A 3IUSA 5F1KA 1MOZA 3DD5A 1W36B 5AW5A 4PGMA 4NC9A 3MWFA 4BV9A 3M70A 1A97A 3PUKA 1SULA 4MRRA 3SEZA 4CV0A 3ABSB 4FOLA 5GY7A 1POWA 3THRA 1QYVA 2XIQA 4B7XA 2PJUA 2FFRA 1JDBB 1C29B 2P78A 2R9VA 3F2IA 4KQEA 4J0GA 4EFLA 2IEYA 1UBJS 1WOMA 1MW8X 5F78A 5J4LA 2YZKA 4Q19A 2YJ3A 4FGZA 2I7TA 5H7XA 3VR4A 1YC2A 1Y5RA 4ID3A 4YA6A 5IU6A 1UJBA 4AUKA 2JVIA 3PNMA 5C80A 1LDEA 3QI7A 2G28A 5B4UA 3BSSA 1FUEA 3FLEA 2IBSA 4GZ6A 1XNQB 1Z8HA 3L49A 3CLSC 4H7JA 5AK6A 6CHYA 3E18A 3FWNA 4E03A 1C0PA 1NXQA 2DPLA 4M0CA 1Z2CA 3U3JA 4XB6B 1FRQA 2D5CA 4N49A 2B4YA 5CB4A 1OWNA 4ZOEA 1W85B 1DJNA 3RTAA 2OORC 3VR5D 1F0PA 3BZBA 2V9PA 3A3YA 4HLNA 4YMTA 2V6BA 2V6MA 1K6XA 1RRPA 4G63A 4JC8A 2FLVA 4G25A 3OPNA 5K6AC 3R5HA 3H4IA 2AXEA 3M6LA 5ILOA 1ZSYA 1E3EA 2H07A 1CQIA 3GZNA 3L1HA 4BGVA 1XALA 5C8YB 3C5WP 1Y1QA 4N3NA 3W2HA 2JFHA 4WLNA 5FOTA 3ESCA 4LOLA 3BICA 3D81A 3PGKA 4PO1A 3ZD6A 2PGXA 4OXQA 3GUZA 2WE8A 3L7KA 3QW4B 4Q21A 5DKFA 1Y0BA 1ZOPA 3EGDB 2FVYA 3NAMA 3G88A 5CVJA 1QGAA 3OQBA 4DQVA 1JWBB 4N82A 1SKYB 1Y5NA 2EJWA 2O23A 2HLDA 2VSQA 4EKDA 4ND2A 4S05A 2OE2A 2OFPA 4JP5A 5EY5B 3RRYA 2HRDA 4A8PA 4OHKA 2C8JA 3OG9A 5FA6A 1DJMA 3B12A 1TX4B 1VB3A 3BE4A 2FEKA 3ADCA 4YRSA 3ELYA 3LHIA 2PT5A 4P86A 3MG9A 4U2EA 4OYHA 4F9EA 1AXRA 2G5CA 5AKJA 3U62A 2Q3HA 5HZGA 2H5EA 4MS1A 3I2IA 1R18A 5K8CA 3O7WA 4KXLA 1IZZA 1HZZC 3WQHA 3M6WA 3H5WA 2TECE 5AW6A 4M8LA 3WA7A 2X3YA 3AEKB 1YR6A 1O6GA 1XCGB 4X71A 2PV7A 3GJQA 2ZRHA 3ROFA 5B58C 3JVDA 4LJ8A 4DMHA 2IEZA 2ES4A 2WF6A 1HL3A 2ZYTX 3FPCA 3UJBA 4AP9A 2A7XA 4DABA 4J29A 1WPRA 3FR8A 4WJLA 1MT3A 1W52X 3EVCA 4MVXA 4LBVA 4LXXA 3PT5A 4N0MA 4EATA 3P97A 1H1LA 3RFFA 4BMNA 1FJ2A 4I5FA 2B36A 1GUAA 3MF4A 3ORHA 5T41A 3TQIA 3Q7TA 2F3SA 3PI7A 4MPPA 4DCCA 1ZNZA 2X5XA 1N34B 3AJ8A 1K3UB 2WSBA 4YRDA 1HQKA 2AFHB 1IWBB 4J2HA 3PE4A 1ULUA 4PQYA 2IUSA 2WKPA 4BFVA 5AT1A 4KFRA 2HSEA 2RI6A 3RRNA 1AKTA 1DNPA 4ZVMA 1JTFA 4C06A 3RLFA 5BWOA 2FSGA 3QXJA 5E9AA 1PV4A 1YQDA 5JRJA 4N8DA 4D3DA 3C3DA 2I1LA 3AEQA 4GKAA 3OZRA 3N2GA 4L0QA 3TR6A 1DJQA 2FUG6 4REOA 3K4PA 2JARA 5EZ5A 1AO0A 4PQRA 4BQPA 1SCAA 3T4EA 4OB7A 2HRCA 2P5UA 1JPVA 1TK2A 5JS6A 2H57A 3DF9A 3EPLA 1X39A 4ZOLB 2G09A 2JLWA 1YDMA 4ZHQA 3ECSA 1UMBA 2ETVA 3FHLA 3ICCA 3BXEA 3N2IA 2I4OA 3PIIA 5E7QA 1P74A 3RYFB 4UTNA 3AV0B 3RHSA 1Z0KA 4Q7JB 1H3EA 2C94A 3M5PA 1QBKC 2Q3LA 4PTZA 2ZUWA 4PGHA 4XB1A 5JANA 3EGXB 5ENDA 2NWQA 4KLAA 2PUBA 1BDIA 5THQA 4DLZA 1X1TA 3CUEF 4LFBB 5COAA 4ZV9A 5KKCA 4IDNA 2XX3A 3PDWA 3KKLA 2NO0A 3ANTA 2EKQA 2YV5A 4J90A 1TAHA 3WRYC 3AJRA 3AB3A 5TSDA 4BMDA 2XQIA 1TC1A 4X24A 2R1VA 2HCTA 3F5DA 3FMVA 3VHXA 4A6EA 3FNGA 4KG7A 2SCUA 3HU1A 2XYPA 1ZX1A 1CIJA 1HDEA 2PMCA 2CLDX 1I51A 3EDQA 4OK3A 3GJRA 2UYGA 3AEKA 1VCIA 1HE2A 2JEOA 3IQFA 1L3IA 1OXXK 4RDHA 3ZCTA 4D81A 5I47A 2Q99A 5L3SA 2N42A 4TL8A 3RYIA 4QXOA 5NULA 1JG3A 2IP2A 3AR9A 2X6RA 3CWZA 3OCCA 4RS4A 2JHAA 2WUEA 4IFTA 3ZDEA 5KQRA 1NXTA 3ZWBA 4HWOA 1J1UA 3ABQB 3A2NA 3HP7A 3OO0A 4N0PA 1WLSA 3OJXA 5BQ3A 2ZUSA 4N1AA 3QOXA 5JOQA 2YV1A 1ZRMA 3FDZA 2CJXA 3LOPA 5IJXA 3VR6H 3DVAA 4BVAA 2VYND 4UUOA 3L7JA 4V24A 3PC7A 1PJSA 1NQOA 1R4NA 2BR5A 1T8TA 2WEKA 2ZJ8A 1UFOA 4MUEA 5BV8A 4QATA 3GUHA 3IUBA 1RQPA 5AHXA 4HAIA 1I0ZA 3CVYA 5JC1A 3KQLA 4NBRA 1U8XX 3R3YA 5KHLB 5LYJF 2HSZA 2CYCA 3GLQA 3AUAA 4ZK2A 5GGXA 1JHMA 1QNLA 3OTGA 3CJRA 2NN3C 4KQHA 1L3BA 4GOOD 4MQFB 3MZ0A 1ZDMA 2XGMA 3QWBA 4CF7A 1W88B 4GOJA 2FW9A 3GU3A 3CR3C 3TRDA 2OCAA 3P71T 1QUEA 4PLHA 5DIZA 3ADDA 1HT2E 1KEWA 1U1FA 4PX9A 2B30A 2PQ0A 3C1UA 1LI4A 3QKRB 5E6UB 3KSRA 3TDMA 2MTBA 1YGPA 4XJVA 5BV7A 3MJCA 2JCVA 3RVJA 2YV3A 2VKTA 3B2NA 2C83A 1FJGB 3T3PB 2FPSA 1EXNA 2WZQA 3F3KA 4GSLA 2VQSA 3AF2A 3SYMA 5H4GA 1N3YA 4YEDA 1QRTA 2IXGA 1OBFO 1R6DA 1EFLA 1OYOA 1UDBA 5I8WA 1RWPA 5TR9A 1AQJA 3T3EA 2PZMA 3PCRB 1E7WA 1IFXA 1CU1A 4Q4JA 4Y9DA 4D6YA 5HM8A 4JELA 3ROXA 5KX5B 4Q3CA 2O2ZA 1WNFA 3RIEA 2J3HA 3AIMA 3DAOA 4RL4A 2A88A 3B2EA 4CKBA 3PQDA 2Q1XA 4BQOA 3KWFA 3PSAA 4CCWA 2CBGA 3W8EA 5JSQA 4JDPA 1QC5B 5LN1A 1RRGA 3HO6A 1VIAA 5HZMA 4R9VA 1I5RA 1UBRS 3CNEA 2FK7A 4QUGA 2AMJA 3HBNA 4NFLA 4RHCA 3WZMA 2HFJA 4DYHA 5HQJA 4YHHB 1RWNA 2Q5FA 4PLPA 4J76A 4TTPA 2V7BA 2QN1A 1XIVA 3M6MD 2A9RA 3E9RA 3LXRA 3N8GA 2YIMA 3MTJA 4ZVOA 1O0CA 1GDTA 5CTAA 4RFLA 1XJ5A 1XVLA 2VATA 3A1TA 5KSWB 1CX9B 2ZULA 5SYMA 3ZDBA 1TPYA 2Q62A 2QXYA 1A3CA 1NNI1 3F3MA 4PFSA 4YP0A 1ADGA 2ECFA 3UMFA 4E15A 1QP8A 2PUWA 3GNLA 3F98A 4KODA 3R7AA 4EKNB 3E23A 2ONKA 3EB9A 4GKBA 3MMXA 4FEEA 4EVRA 1S1CA 1AV7A 2FSVA 2H1RA 2JEYA 2IYLD 5E6SB 5JNTA 4PLYA 1MQ8B 5A3JA 4HNRA 5AVVA 3IBYA 4TLBA 3MSXA 3R1IA 3SCZA 3K8QA 3N6RA 4F7DA 3CF0A 1NNEA 2IXBA 4KW7A 1M0EA 2DPMA 2UZAA 2Z5VA 4JEMA 5CLGA 3ZCSA 4P0PB 3KQNA 3LQFA 2CSXA 4WFJA 1ZNWA 2R8XA 5JPCA 3G1TA 4R2JA 3KELA 3FSGD 4JI0B 2LD4A 2WMYA 2CNWD 5EUQB 3LYHA 5LYYA 3I5XA 4IMIB 1YFLA 3QE4A 3BMOB 2FMTA 4EPYA 4R5MA 2UKDA 3IEXA 4XB2A 1ISSA 1JLLA 3LUHA 3SSOA 1RMQA 3QVUA 2H2FA 4DBZA 2X8WA 3LY5A 2G8NA 1RZUA 2B82A 2CLCX 4DA4A