2WA1A

Structure of the methyltransferase domain from modoc virus, a flavivirus with no known vector (nkv)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
248
structure length
226
Chain Sequence
GICSSAPTLGEIWKRKLNQLDAKEFMAYRRRFVVSRGTAKLAWIDERGGVELKGTVVDLGCGRGSWSYYAASQPNVREVKAYTLGTSGHEKPRLVETFGWNLITFKSKVDVTKMEPFQADTVLCDIGESNPTAAVEASRTLTVLNVISRWLEYNQGCGFCVKVLNPYSCDVLEALMKMQARFGGGLIRVPLSRNSTHEMYFVSGIKNNIMGNVTAVSRQLLKRMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NON-STRUCTURAL PROTEIN 5
publication title Structure of the Methyltransferase Domain from the Modoc Virus, a Flavivirus with No Known Vector.
pubmed doi rcsb
source organism Modoc virus
molecule tags Transferase
total genus 80
structure length 226
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2wa1A00
3P2KA 5DM4A 3NTVA 2UYHA 1HMYA 3GJYA 3HCDA 2OO3A 4QDJA 4RTMA 2PGXA 3GO4A 4RTQA 4IKPA 4BLVA 5JR3A 4DA4A 3EVZA 3HCBA 3FTFA 5DRYA 1SUSA 2XVAA 1XXLA 1YB2A 5DX8A 1R00A 3PLAE 4R6XA 2XYVA 1N7JA 1O9GA 3FYDA 3KR2A 3NDIA 3OPNA 5HFJA 3VSEA 4C04A 3QV2A 5GWXA 1JSXA 1BOOA 3Q7EA 2Q41A 1RI3A 4E2YA 1P1CA 5DXAA 1X1BA 1RI1A 3UJCA 1D2GA 5DM2A 1IM8A 3G2MA 2Z6AA 2Y1WA 2AN5A 3BKXA 3I9FA 3L8DA 3HP7A 1P91A 3HCAA 2NXEA 4Y2HA 3X0DA 4HRAA 5EKUA 3GRYA 3LDUA 3B5IA 3LBYA 2WA2A 5E8JA 4AZTA 3MCZA 3PX2A 1Z3CA 3HCFA 4BLUA 3E8SA 2N47A 2IBSA 5EVJA 3TM5A 2VP3A 5K0JA 4HG2A 3PB3A 4YUWA 2NYUA 5EMMA 2UYQA 5EZQA 4RV9A 3KKZA 4YMHA 3UA3A 3LKDA 3TKAA 5ERGB 3U81A 5HIKA 3NWEA 2XVMA 2B3TA 3DTNA 4QTTB 4LWPA 4Z2YA 1DUSA 1R8YA 3EVBA 1AF7A 4CKCA 4EKGA 3KR1A 2CWWA 3ERCA 3ELDA 1RJGA 3SXJA 3UJ9A 1VL5A 3BGDA 2OB2A 4CWAA 2QM3A 2BM8A 3GU3A 1KHHA 3G89A 1WZNA 1NBHA 2UYCA 3G2PA 1XDZA 1WS6A 2NP7A 1XCJA 2IDKA 3B3FA 1ORIA 3DXZA 3KR0A 4IWNA 3DP7A 5BXYA 2Z6UA 4PONA 5E1DA 2HV9A 1EJ6A 3E23A 3JWGA 5CIYA 4OBXA 5T64A 4KDCA 2YVLA 3LDFA 1WY7A 3MTEA 5EEGA 3THSA 2OZVA 5LR6A 1F38A 4A6DA 2NXJA 3MHTA 4PYIA 1ORHA 3NJRA 2G72A 3BUSA 4F85A 4GC5A 3TQSA 1ZGJA 3M6XA 2GH1A 5E2BA 3PT9A 3AWIA 1JQEA 5CD1A 4KIGA 5C1IA 3TOSA 5K05A 3KQTA 2QYOA 1RJDA 3CJTA 2ZZKA 3G5LA 3G2QA 4RTJA 5FHRA 5EMLA 3EVAA 5HILA 1VLMA 3T7SA 5D1NA 2UYOA 1JR4A 4GOOD 4PGGA 4PYJA 5LQCA 1EJ0A 3M70A 3PFGA 4BY9E 3SMQA 1G6Q1 1XCLA 2P3QA 3ELUA 2ZBPA 2FK8A 4C03A 4FSXA 3FPGA 2YX1A 2PSSA 4BP1A 3LPMA 3FTEA 3TPZA 3HCCA 2I6GA 1V39A 1KIAA 2JG3A 2BZGA 3EVCA 4DKJA 2Y1XA 4DQ0A 1RI2A 3UZUA 3FUXA 3ER9A 2AOUB 1MJFA 5K0EA 4QQKA 2GA9A 4PCLA 4QVGA 3UBTA 2R6ZA 3GRUA 2PWYA 4FR0A 4WVLA 4C06A 3EEOA 2NNWB 3MB5A 1QAMA 2E5WA 3EGVA 3C3PA 3LX6A 5K0NA 4E2ZA 1YFLA 5CM2Z 10MHA 5FA8A 3G2OA 1JSZA 3CJQA 3FTCA 3HTXA 4G56A 4B17A 3PX3A 3K0BA 5FQOA 4CKEA 3DMFA 3HVIA 4RSRA 2H1RA 5BP7A 3GWZA 1XVAA 2ZTHA 3GRVA 4DMGA 2JH9A 4ER3A 3DR5A 2JH8A 3FPFA 3RODA 2DPMA 2FYTA 1X19A 2ZWAA 2IP2A 2B9EA 2G8NA 5E9WA 1X1DA 3GCZA 3P9NA 3QOWA 2BM9A 3KQSA 2I62A 3MAGA 4ZTBA 4PNEA 2YTZA 4LECA 5GM1A 3OCJA 5H02A 3ORHA 1SG9A 5T6BA 4ER6A 5GIOE 1VP9A 4KW7A 5GOZA 5HIJA 5LQJA 2ERCA 2YR0A 2YXEA 1WXWA 1U2ZA 3EVFA 5K01A 3G8BA 4R8SA 3LCVB 2ZCJA 2O57A 3DLIA 3BWYA 3TKYA 3QOXA 2NXNA 2G70A 1KR5A 1YF3A 3NWBA 3O31A 4FS8A 4PYLA 3SSNA 5K8VA 3ELWA 1VP3A 3OU7A 3KPUA 1O54A 3FPJA 3IEIA 4YUZA 2R3SA 3GXOA 1F3LA 1IY9A 2HNKA 5K09A 4MIKA 2JHAA 3A27A 3RW9A 3IHTA 2FPOA 2ZULA 4QDKA 5KQRA 3NVKI 2K4MA 4HSGA 1FJXA 2P41A 3EMDA 5EIFA 2P7HA 3FUVA 3UJBA 5LQNA 4ISCA 1RJEA 3CBGA 2BR3A 3BWMA 1YZHA 2JHPA 2CMGA 3FRIA 4X63A 4AZWA 4H0NA 3CGGA 4HGYA 4C4AA 1NV9A 1AQIA 2IPXA 2WK1A 5EHIA 2NP6A 1UIRA 1PJZA 1VQ1A 4RTOA 2ZBRA 3IV6A 2ZFUA 3LECA 5EHGA 3SSOA 5ICCA 2PVCA 3HVKA 5K0GA 5EG5A 3H2BA 3DXXA 5M5BA 2FK7A 4RTPA 4M37A 2C7RA 5D1HA 3EGIA 1WG8A 2BH2A 3TRKA 3AXTA 2LD4A 1UFKA 3LGAA 3G8AA 2EFJA 4PYKA 3PTAA 2IH5A 3P9KA 3O7WA 1KPGA 4KWCA 5T67A 1G60A 2P40A 3EVDA 2H11A 3KU1A 1NV8A 1Q0SA 2CKDA 3P8ZA 1OR8A 2QRVA 2ONYA 4RTKA 2Z6QA 3EVEA 1QZZA 1L1EA 2PLWA 2VDUE 4O29A 3BT7A 7MHTA 5CVEA 3OU2A 1MHTA 3EPPA 3KR9A 1SQFA 4P7KA 4RVHA 5DM1A 5EOVA 2O07A 1NBIA 5DTQA 4U7PB 5DX0A 1SUIA 4HH4A 4PCAA 4U7TB 4YUYA 5HOQA 3B3JA 3P97A 1R74A 5E1BA 2JHCA 2UZ4A 3IYLW 1X1AA 4RVFA 1DCTA 2G71A 1NW7A 4RVDA 2HMYB 2A14A 5IKMA 2FHPA 2PJDA 5KVAA 3I58A 3OZTA 3R6TA 3HCEA 2IBTA 4PIPA 3G5TA 3ANXA 1P1BA 3EMBA 2ONZA 3F4KA 1JG2A 3SR4A 3R0QA 4QTUB 4GEKA 1N7IA 3DUWA 1NW3A 4YMGA 5FWDA 3UWPA 3ME5A 2AOVA 4K6MA 4MWZA 3MTIA 5HZMA 4FP9A 5ICEA 4LG1A 1Q0TA 2NXCA 2PWPA 2AR0A 3UJ6A 1AQJA 4E70A 2AOTA 3PS9A 2IDJA 3O4FA 1B42A 1KXZA 3TM4A 4XUDA 2VZ9A 2XYQA 4JXJA 5HEKA 5G02A 4KIFA 4EK9A 2PXCA 2WA1A 1ZG3A 3PFHA 4QPNA 2ZW9A 2AZTA 2VDWA 3CCFA 5CVDA 5DXJA 3S68A 4BP3A 4C07A 4EMSA 3KPYA 5BW4A 2C7QA 1QYRA 3C3YA 3R24A 2PX2A 5BW5A 3I5UA 5CVJA 3MCTA 4FT2A 4GC9A 1JG3A 2KW5A 3GRZA 4MTLA 3EGEA 1XDSA 1EAMA 4PINA 2AOXA 5FADA 4HTFB 1X1CA 3GDHA 3B3GA 3JWIA 4M36A 3FYCA 2IIPA 3KPJA 5DM0A 2B78A 2IGTA 5K0FA 2F8LA 3A7DA 1FP1D 4IV8A 5F2OA 4RTSA 4MHTA 2AN4A 3T7RA 2AS0A 2BR5A 5CVVA 3KQYA 5EIWA 5FHQA 5GINE 4OBWA 2ORED 2OY0A 4GUAA 5CUQA 2YXDA 3HA5A 3BZBA 1NW5A 1R6AA 3JWHA 2PT9A 4ER0A 5F2KA 3AJDA 3TMAA 2IH2A 3ER8A 2FCAA 1NKVA 5HIMA 5E1OA 4F84A 3OZSA 3CJRA 3SGLA 4POOA 1FP2A 2EJTA 1L3BA 2EX4A 3FUUA 3KPWA 3E7PA 2ZSUA 5K0BA 4PYMA 1SVUA 4OA5A 1G38A 1I9GA 1IXKA 2PBFA 5IH3A 3OFJA 1ZQ9A 1T43A 1BKYA 3TR6A 2ZIGA 3LCCA 3LCUA 5DPMA 3P2IA 5DT2A 5GM2A 4YUVA 3V8VA 5LQAA 2O06A 3D2LA 1G8AA 3FPHA 3AY0A 4GOND 2HTEA 4HGZA 1TW3A 2B25A 3G7UA 5DSTA 3SX0A 3R9XB 1VPTA 2ADMA 3LBFA 5HIIA 4NECA 2DULA 5FUBA 3TFWA 4HC4A 5LQRA 2YXLA 4DZRA 3HM2A 3BXOA 5DRTA 2ZIEA 2ZZMA 4P58A 3UFBA 5EMKA 1KPHA 3VC1A 3K6RA 3B89A 4RTRA 4MQ4A 5P8WA 1Y8CA 2YQZA 4C08A 2ESRA 1KPIA 1JQDA 5LQUA 4EKIA 2OBFA 1EG2A 2V7EA 4OX9Y 1I1NA 3MGGA 5CCBA 4P7GA 4E31A 4EVIA 3UJ8A 1FBNA 4YUXA 4PIMA 4WXHA 1R18A 4E33A 2PX8A 4GOMD 2P35A 3OU6A 4PWYA 1INLA 4OQDA 5E1MA 1L3CA 1XTPA 4OQEA 5KYGA 1FPQA 5FA5A 2PXXA 2GAFA 2ZLBA 2AN3A 1RI4A 5E2AA 1SKMA 4XUEA 5DLYA 3FZGA 2P3OA 5FQNA 1L9KA 3M6WA 5EPEA 2ZIFA 3NMUF 3V97A 2IH4A 1AV6A 1ZKDA 4QPPA 3JWJA 3ELYA 1BHJA 2EJUA 2AVDA 1NW6A 4RYLA 2O05A 4XCXA 2P7IA 2P3LA 1JQ3A 3DOUA 3EVGA 4R8RA 2ZVJA 3A7EA 4X60A 2C7PA 1G8SA 3I64A 3HVHA 4QVKA 5FCDA 2QE6A 5EC8A 5ICFA 3MERA 1O9HA 4E32A 3LL7A 1H1DA 3BGVA 1JG1A 2P8JA 3KQVA 5DX1A 4E2WA 4IV0A 5EGSA 1NE2A 4X1OA 4L7VA 1WXXA 2HWKA 3HA3A 3Q87B 4V0QA 1XJ5A 3FRHA 5GIPE 4RX1A 3R3HA 4E2XA 3GGDA 4RTLA 4PYNA 3SM3A 9MHTA 4ER5A 2I7CA 1QAOA 2PY6A 4YV0A 2QY6A 3M33A 4P7FA 2OPBA 3BGIA 3KQMA 5E9JA 3NVMB 2P1DA 2QRVB 1JTEA 4M38A 5EZSA 3HVJA 3ID6C 4GOLD 3WSTA 1I4WA 3P2EA 3G88A 2JJQA 4C05A 3A26A 3BWCA 2VDVE 5DSXA 8MHTA 3LDGA 2GLUA 4V0RA 4CTKA 4YV1A 1NW8A 1KYWA 1ZGAA 3I53A 3KQWA 2GS9A 5FTWA 3SVZA 3HA7A 3BWBA 5LSAA 1M6YA 3UJDA 1D2CA 4DCGA 4KDRA 3MQ2A 2OB1A 1EIZA 4OA8A 3P9CA 3FTDA 3BKWA 2AVNA 3GRRA 2OXTA 3UJAA 4A6EA 2AOUA 5DWQA 3UA4A 4DCMA 4UOEA 1VIDA 4F86A 4QQNA 4FT4A 5DTRA 4PYQA 4RVGA 1SQGA 3CVOA 4ER7A 1BC5A 4GF5A 5MHTA 2CL5A 2GB4A 2ZWVA 1G55A 2PX4A 4LWOA 3A25A 3GIWA 5K03A 4HTFA 4CTJA 5E9QA 4RTNA 1ZHFA 3EEYA 3NW9A 5B1SA 3VC2A 3T0IA 3KQOA 3P9IA 2C7OA 2ZBQA 2BR4A 3FUWA 4CKBA 4AZVA 2IFTA 4BLWA 2G1PA 3OZRA 5K0CA 1RI5A 5C9ZA 2YUIA 1YUBA 3M6UA 3DMHA 4ATNA 3DH0A 3DULA 5GP1A 4DM3A 4RWZA 5EKXA 2AOTB 1XDUA 3OE4A 2XYRA 3B7PA 4PYOA 3LKZA 2B2CA 2O0LA 4X61A 5FWAA 2XBMA 1VE3A 3P71T 3C6MA 3C6KA 4FGZA 3OFKA 4GQBA 5DTMA 4Y30A 3TLJA 2H00A 4R6WA 2PT6A 4R05A 4P7JA 1QANA 2GPYA 3DMGA 4GBED 4AZSA 3M4XA 2PX5A 3DLCA 2V74B 3HEMA 1JTFA 1N2XA 2EG5A 1D2HA 1R8XA 4XUCA 1QAQA 5EMJA 1KP9A 1P39A 2PXAA 1PRYA 3OE5A 3RIEA 2CMHA 3KQPA 1UWVA 1HNNA 5E8RA 1JG4A 2AOWA 5U4XA 1TPYA 3VYWA 4CXMA 1NT2A 2VS1A 3E05A 3THRA 1DL5A 5EEHA 1EQAA 5FULA 4FSDA 3KPVA 2PKWA 3CC8A 3LSTA 3M6VA 4AUKA 3KHKA 4FZVA 5K0LA 2OYRA 1RJFA 3REOA 3SSMA 1L3IA 5CVUA 4E30A 4YV2A 1KYZA 4EQZA 3GNLA 2PV0A 1M6EX 3FUTA 5C0OE 1VBFA 2FRXA 4AX8A 5F2NA 4X41A 4KVZA 5ICGA 5LQKA 5CCXA 4KRGA 1TW2A 3LHDA 3A4TA 3HNRA 5KS2A 2ZZNA 3NDJA 5KQSA 3FPEA 3AXSA 2I9KA 3PVCA 5EQJB 3C0KA 4DF3A 3UJ7A 1YFJA 3T7TA 4PGHA 1M0EA 3KQQA 2HR1A 5JUWA 1YZ3A 2OKCA 3CKKA 4M7RA 3DXYA
chains in the Genus database with same CATH superfamily
4UHBA 2PUDA 2QU7A 3GJYA 1LS1A 1RRVA 3WZLA 1JHVA 1Z4LA 2HPAA 4RTQA 621PA 2AKAB 1R0WA 2GHTA 2XH8A 4WCVA 3SIRA 5JR3A 1GRRA 1RP1A 3JQ9C 1KWKA 1JJIA 2VA8A 5TARA 1O5TA 4LY6A 2VBIA 1SU7A 4R6XA 3O2SB 3ZY5A 4A91A 5B4TA 3P0RA 1D1PA 1NDUA 3X1WA 4KWHA 4K9OA 1PJTA 3CCCA 4NH0A 5JD4A 2IU3A 2VDOB 1Q19A 1XFAA 3MWDA 2JLBA 1X70A 4M1MA 4Q15A 3RE1A 2CN1A 2VJMA 2AN5A 2GTIA 3FUCA 4MWTA 2P27A 2ZUVA 4Y2HA 3L06A 1H2AS 3L7MA 1OU0A 3OESA 1VL2A 1WCWA 4LPKA 4O1HA 3ROFA 3SC2B 5I01A 3WOVA 3ZCXA 3BILA 2MYUA 4R5MA 1PVVA 3PX2A 4YQZA 4W7HA 5IN5A 4RVUA 2R8ZA 4WNAA 2PANA 5EVJA 2VP3A 2BRUC 3ODPA 3TM5A 1AQLA 3LUBA 2IOQA 2WAXA 1Y3FE 1GKLA 5JNTA 2D3WA 3KKZA 3KXKA 4P0TA 3AEUA 5JMOA 2B1IA 5BSHA 3QFRA 1YQGA 2BOVA 2JKZA 1I6WA 1RM5A 3GQBB 4J1TC 4QLOA 4PNPA 4KHZA 3BIFA 1WZCA 2DFDA 4OTZA 3W1WA 4QOEA 4RXMA 4R2KA 4B76A 5FUYA 2R7NA 4MWOA 4Z9YA 5FWNA 1TVKA 2MSWA 3ZVNA 2I2BA 3KM0A 4HDKA 1Q83A 1WVIA 1FK8A 4B6JA 1GPUA 3EZ9A 4JGIA 3SQOA 1P7CA 1UXJA 1OFIA 3PNYA 4GNRA 4YMSA 2A9QA 3G5MA 3MWEA 1EIWA 3DE0X 2P2SA 5BXYA 4WK2B 3DQPA 3EDMA 3NRCA 1V11A 4IUYA 2BFCB 1YQ9A 1J2RA 3AR2A 2ZYDA 3DF7A 1SBQA 1PW7A 5CPBA 4KDCA 5T64A 2OO5C 4CL0A 4DE5A 1FP4A 2H29A 2Q2QA 3TFOA 1ZIDA 1SC1A 1SG6A 4ZI7B 2OBLA 4MQEA 5DCUA 1QDLB 4ANFA 2VP6A 2IYTA 3D5TA 3OEEA 2VZEA 4GC5A 3WWEA 1H66A 1SB9A 4YK7A 4OPMA 1YL5A 4WFQA 3ZTTA 3I73A 4F4IA 5EWMB 4KXNA 4NCJA 1PKEA 2BELA 5C1IA 4B4OA 3BK1A 1RJDA 5KWEA 5JJCA 4TM8A 1N2HA 4PG7A 5KJCA 4BY9E 5DMHA 5FL7D 1E1RD 2IELA 2ZSKA 4Q9IA 5EQFA 3CPHA 1JNYA 2VNSA 2YX1A 3SJUA 3T1TA 1PF7E 1QH8A 2VHTA 4TXLA 5HCUA 3L1HA 1BEUB 1NBOA 4BBPA 2CXSA 3ORFA 4KR2A 3RYCB 5CYGA 1OBHA 1JHQA 1J0EA 1FYWA 4KN9S 1PP4A 3I1FA 1YAJA 1MPTA 3MJEA 4WQMA 3JPWA 1AMNA 3NHUA 1T24A 4WT7A 3WB1A 4Q4LA 3IILA 1DARA 4HZUB 4LTMA 4F9TA 1TIPA 4FDUA 3PFWO 4JKYA 3SK0A 1PE0A 5BYAA 4EWLA 5EWLA 3FHOA 2OC4A 4LUCA 4MZXA 2ENWA 1N2CB 2BI7A 4M0PA 1FRZA 1NE7A 1QP8A 1SY7A 2YWGA 3I0MA 3CRVA 3O91A 3UB3A 3LX6A 4RMJA 4NAUA 4F9FA 3D3NA 3FNFA 3ZXXA 4AK9A 4ZYWA 2X6TA 2IYLD 1YT5A 1N5IA 2DKNA 5ANRB 1E3MA 2FEXA 4J9UE 4WMLA 3ZE2B 1J2YA 4DV0B 2BFWA 3D3WB 2BBOA 4DLVA 4NBNA 4TWBA 2JI8A 5FV4A 3S6JA 4C43A 3O1IC 3RJ5A 4D0NA 3RAPR 3FPFA 2AHRA 1E7SA 1QDUA 4XCVA 4D9KA 1YJ5A 1XZDA 2UZ3A 3RS0A 4N48A 3QX8A 1XD8A 3BIWA 2E6UX 1KI4A 5HCNA 1GTSA 1YBAA 4WCFA 1HDXA 1OPRA 2DCUA 4ZARA 4C7XA 2G77B 2OHVA 1KFEB 4MKGA 2ZAIA 4WL0A 4CM9D 1YCFA 1QORA 1Z4OA 2GPTA 2ORIA 1LLFA 2N46A 3CX6A 1M1NB 2JCBA 3KWJA 3LLVA 4WCFC 4WKCA 2O57A 4K28A 3TSZA 5DVZA 1FX0A 2IOYA 2EHDA 2G70A 1RLJA 4EFNA 3TSCA 3B78A 1MTOA 3CINA 4NV1A 2CFRA 5D5QA 3ELWA 4URUR 3PXUA 1F4VA 4ENUA 1APBA 4NCIA 2H1CA 2O7NA 2C4WA 4J07A 1SOVA 1WVGA 1PK7A 1R0KA 3K35A 1JFSA 1O94D 2X7HA 2JHAA 5E9AA 3HSSA 2E1RA 1CZHA 3HU1A 4TOIA 5KQRA 4FFBB 1NLYA 1YVEI 2H48A 3A4MA 1OXBB 2LKDA 1Z15A 4PBSA 4ZOEA 4K26A 1Z6ZA 4KJZA 2GASA 1WPGA 3M4ZA 2ZWIA 3WLTA 3WYDA 1NV9A 5EHIA 2RG1A 4WFJA 2NQ2C 4EEKA 5KX5B 1JJBA 5EUMA 2J5RA 3OM1A 1DTWA 1MA0A 2Z6VA 4IG4A 4CU5A 4JSYA 3SSOA 4DA0A 2QSYA 1MAWA 3TXYA 3BWVA 1EVZA 4ONEA 3ZW7A 4QNRA 1YFKA 5GMOA 5C81A 2F3UA 4RTPA 1YKFA 1MO3A 5D1HA 1TQ4A 1GZ7A 1GVNB 1VI2A 3FCYA 1MOZA 2LD4A 2K2WA 2C1ZA 3L46A 4Q9LA 3RFTA 3ZD7A 3FZEA 3TRFA 1X74A 3WYBA 2Q3LA 4WTOA 3SDZA 1UKEA 2P40A 5LXTB 3UG7A 2VSFA 1M33A 2QRVA 2FWIA 4QO7A 1Z4QA 1L7PA 2NVOA 4ZN6A 2VT3A 1HZZA 3EVEA 3TLCA 3JVVA 2KB0A 4M0MA 4JI3B 1B7GO 3S2GA 4YAWA 3F97A 1T8RA 4BJ5A 3EQZA 4BO5A 1HZZC 2PEZA 2WV7A 3PV0A 1CZNA 2WZQA 3MNFA 3UT5B 3C5VA 4DARA 1LK7A 2QUKA 4FYMA 1Y37A 3I28A 2GA8A 1SUIA 5CXSA 4FDAA 3OAAA 4HWTA 4D3FA 3UFXB 1NP7A 3TG8A 2WKSA 4NQRA 3LHKA 1G5HA 4R8MA 3THXB 4DHEA 1GFWA 1JSLA 2WJWA 3OG9A 5JS7A 4CEJA 1ZFNA 2RBGA 4OHZA 4YPVA 2Z43A 4Q7QA 1C9NA 2CCJA 4Z99A 3WQHA 1Q50A 1C4WA 3L6CA 2CLMB 3QEMB 3VI4B 3ZLJA 3USZA 2UVQA 3TZLA 2ADFA 4I9GA 2QVGA 2VOEA 4FW8A 1NULA 1WV1A 3TI7A 1CIPA 5JI2E 1ZXLA 1UM9B 3R9IA 3VJLA 1QG4A 5AHOA 1NQ5A 2R9VA 4GE3A 1AD2A 3VSAA 2AKEA 1KAEA 1RJ9B 3ME5A 4Q1EA 5JYDA 1O97D 1KVUA 2QLBA 4HUQB 4LOAA 5A7GA 1E7RA 1U9IA 1N5MA 2FF5A 3EZFA 4TZ6A 2AG0A 1X7GA 2VKQA 3OZIA 3PQCA 4RF4A 3TM4A 1KXZA 2PU7A 4LXTA 4ZEWA 1NY6A 1GD1O 3F49S 3NTUA 4EK9A 5LNK1 2HA4A 2O8DB 1FQWA 5AM1A 1Y8QB 3DMTA 2RGEA 3SBOA 3LPNA 3PIIA 1P0QA 3C3YA 2X86A 1W0KA 3DMTC 4EY5A 4FT2A 3SYRA 2Z2ZA 1HNZB 4RJJA 3ZWQA 1T5DX 1DWUA 3D0OA 1W44A 2G25A 2HX1A 5H83A 4B40A 4MPPA 1T9ZA 2EZTA 4FPXA 1W0CA 2XDYA 5EHNA 4M1KA 5A5VA 3ZU5A 1HOXA 5CYOA 3CRQA 5JE8A 4EPXA 2F8LA 5CP8A 2P2ZA 4Q24A 1EHYA 3WDMA 4EO7A 4EABA 2J1LA 1G9TA 1N5RA 2FE4A 2GAOA 3UXYA 2Z2IA 3U31A 3RC1A 4OI1A 5ENVA 5CUQA 3W05A 2CUZA 5KTPA 3PJDA 1RW4A 2R84A 3OVMA 1ZONA 4X94A 2CGEA 2GK7A 1JWBB 3QLUA 3ZS8A 2HHLA 1MB4A 1DX9A 1ZH2A 3H1GA 1EBUA 3WX0A 3K94A 1IWBB 3QLUC 2JEYA 3B70A 1GR1A 4C5AA 1K6MA 2CLOB 2H3HA 1QCYA 2ZSUA 3CEHA 3EUFA 1V2GA 4O63O 4TTTS 5TGZA 4KN6A 3WLIA 2AQKA 9LDTA 3MYYA 4GYYA 2R1UA 4RULA 1H2HA 5DHTA 1DRWA 3K5IA 3QMVA 4KGXA 3S4YA 3F2VA 3FPKA 1TF2A 4L5JA 5E3IA 4C08A 5LDHA 3H4VA 3IEXA 4E5YA 3OA2A 2ZT5A 3WGMA 2WAOA 5KYKA 3P9RA 3TUZC 4FFRA 3PNQA 4HPWA 4P93A 2Q5FA 3AM3A 3V4RA 4BN0A 4G0YA 4MKZA 2G0AA 5U1PA 3R5KA 5DW0A 1A2QA 1U1CA 3K0CA 3KOOA 5D6NA 2RDMA 1EDBA 3UYKA 3IEUA 1LY1A 2W58A 2ZYAA 4PVDA 2QN2A 4GR4A 3SR3A 3LQRA 3K0CC 4DJFC 4O4JB 4FJ0A 3KEQA 1ONBA 1PX0A 3OKFA 1U28A 5CCBA 3JVIA 2ATEA 2HLPA 1CEXA 3HBFA 1U98A 3QI2A 2ZB3A 1EVIA 3UJ8A 1X7DA 5K0ZA 4DV7B 3VJRA 5ILQA 1THZA 4X6YA 1QQTA 3NJ4A 2XQGA 3CVXA 1VE9A 1JXMA 5I8PA 2MYPA 1XAGA 1DV1A 1RWXA 1YQDA 4OQEA 4R3UC 4OJQA 2AQHA 3IQXA 3VYVA 3E81A 4YJHB 2AN3A 1RI4A 1SKMA 4BNZA 4DSNA 3ACCA 3GQBA 1TCCA 1DHTA 1WXIA 3OTHA 5LOVF 5C52B 1PNQA 2C5LA 4WOBA 4KPGA 1IUNA 3ELYA 4JB8A 2H9YA 3UW1A 3F1LA 1QVZA 3FE2A 5F5XA 1CY0A 1PJ4A 3EVGA 1XCGB 2A4MA 2H7VA 1QO7A 2OORA 3A7EA 5AXBA 4ZVVA 1HFJA 4B6RA 4V0SA 4MQFB 3GMSA 5KCZA 3MERA 3OETA 4MI3A 2HQSA 1I4OA 1I4DD 2NZWA 4Y3UA 2WLSA 1BKDR 4HI0E 4HB4A 5JTTA 3KOUA 2BFCA 5C34B 4UBKA 1R3UA 5AXCA 4L0MA 2Z83A 1KS2A 1GOTA 1K5PA 2A35A 4J6EA 4JFAA 2QBYB 1SIOA 4ZI7A 1HI9A 2RJOA 1EPUA 3OFNA 1XTRA 3WBBA 3BCRA 2ODWA 2ZJ0A 1WMFA 2N9UA 4P86A 3Q7SA 2B4QA 5EWMA 5AI9A 5A5EA 4R2XA 1BG6A 1H8EA 3LPAA 1KOLA 2VP9A 2PUBA 4PHHA 3RK0A 3EWNA 3U3JA 2I0FA 1KH3A 3AHIA 2W98A 3BWCA 2ZQZA 3I4FA 5MFPA 3MOIA 1BZYA 2JA1A 3RYCA 3HA7A 2VR1A 4A0RA 5J2UF 2ZUBA 5F23A 1GGVA 1Q91A 4HNHA 4HZUA 1QH0A 2EZ8A 4LZPA 4AJNA 5H4GA 3K0SA 3QX9A 3OCWA 4OGLA 1N75A 4L8FA 2E7ZA 3UA4A 4ZXFA 3VKUA 3MT9A 1ZGBA 3S2UA 4D8UA 2J9XB 4EFMA 3QPUA 1W36B 1I3NA 4RJ2A 4CTMA 1N2CA 3LG2A 2JZOA 4OV6B 2C2WA 2YHSA 4P5EA 3EGWA 1E5QA 2PKEA 1J8VA 2WOOA 3NIFB 5HK9A 3OTIA 3AL0C 4ZTUB 4FD3A 4XASA 2FVYA 3L7LA 2M6RA 4WV3A 2FEOA 1N4AA 2EW8A 4C3VA 5FEMA 4LHYA 1DI0A 4XB2A 4L75A 3IT0A 2PMKA 3LP8A 4O8ZA 4EUSA 2PH3A 4KDFA 3R5TA 3SKYA 1T26A 3D3WA 5DLPA 1H42A 3CPSA 2YUIA 4PHGA 4HQLA 3DMHA 1S96A 1QKIA 2DTEA 1EK2A 3CR3C 3JQCA 4UDNA 3TZHA 4ATNA 4CMHA 3BCSA 4KREA 1V43A 2FVXA 4KK3A 1FDSA 1QU2A 2ZJZA 4YS6A 3DE7X 4CT5A 3OUTA 2CHVA 5IDXA 3VNBA 2FW0A 1CQPA 3C6KA 4HH1A 4XVQA 1E3IA 3VM6A 3ENVA 4DQUA 4ON9A 5LMZA 2H1FA 3ZR4B 1A27A 1QO0A 3CX3A 4G9EA 3PYXA 4GBED 1M1NA 4D4GA 1P3DA 1D0IA 4LC9A 3M9XA 4JJ7A 1D2RA 4MS4B 4QIHA 3CNLA 5KTNA 1SMKA 2JI4A 3EXG2 1U3WA 3OTOB 3EGCA 1DX6A 1T0PA 3I76A 3TSYA 2JD1A 4D0RA 4HAIA 4DIBA 4ETIA 1YR2A 3LY5A 1A50B 2IV3A 1PZGA 2PZEA 3HKBB 1RYZA 2FSHA 7REQB 2YOHA 3C3DA 1BFUA 5GVSA 5HKOA 2WC1A 1OT3A 4M46A 3SD7A 3VKHA 2XTAA 1MX9A 1O8CA 4KO8A 4XWAA 1FDRA 2RAUA 4KBFA 5DN9A 3B85A 1HT2E 1MG5A 4FFBA 2FEKA 5EXXA 1G7TA 1L5QA 2O4CA 1A1SA 4Z8XA 3CF6R 5TY0A 4XOUA 4J2OA 1W8IA 2QTCA 4X93A 1V1RB 1JB1A 4QGFA 4C88A 3FHJA 4JR1A 5I9MA 2L18A 3NV7A 3LC7O 3VC3A 2WKQA 1TJ3A 5KX5A 1CUHA 3LAWA 3F7NA 2FMXA 1PS8A 4G36A 3T7TA 2AC2A 3PQFA 3SZLA 2BGGA 5JUWA 1JYEA 1SBYA 1YZ3A 2GCGA 2GN8A 3QVJA 4BQNA 4EPTA 2LR0A 2WYIA 4DAEA 2HMVA 2EKPA 2O0HA 1XNQB 2XGGA 3H5AA 4RDXA 1OH8A 2OO3A 3HO1A 2JFYA 1HT1E 4WXEA 2NWQA 1W76A 3EIUA 3ZHVA 1NBEA 3ZDQA 3PHHA 2Q46A 1B23P 5KPJA 1YB2A 3A2KA 1G9SA 4H1UA 5LXTA 3PLAE 3SLRA 3U7RA 3FTQA 1TM2A 1FTYA 2JIZD 3KKNA 4NTZA 4HH3C 3UHJA 2C8KA 3VSEA 3E2PA 3E35A 4NMLA 1THGA 3AWDA 5DXAA 5AW2A 3S8MA 3H5NA 1M1YB 3DGFC 3F8TA 4E51A 1ANKA 1Q7BA 1VDMA 1VPDA 2FY8A 1ZRHA 1HE2A 4F71A 3UT5A 2HA3A 5LLDA 2I4MA 3C7TA 1JHUA 1P75A 3DTVD 5E6RB 4YIHA 3EDOA 1F20A 5IKOA 1BS1A 2HXYA 3UFXA 3KB2A 2Z5LA 3HCFA 3THXA 3E8SA 4RGYA 2H4XA 1TU4A 3CF4G 3ASVA 4UNQA 4BGDA 1XKTA 5DM70 3H3XA 4AJLA 3AFHA 1A4UA 3TBKA 3QEMA 1PYDA 4YEDA 3CISA 3ETJA 3BGWA 1TU0A 2YZMA 2PLRA 1EVKA 1L5FA 3SMVA 2C58A 4TVBA 1NUHA 2ROQA 3SDSA 2RBEA 2CWWA 4TMVA 4CM6A 3T94A 1UM9A 1JYSA 5AVOA 3TMKA 3WWPA 1NASA 1IWPB 2EARA 1Z8HA 1RJ9A 1DOZA 3HR8A 3NYWA 2OCDA 3UG6A 1R1DA 2PBZA 1KKMA 2D8MA 4HUQA 4X97A 3VOBA 1MMFB 3VYUB 3UBMA 1NXOA 2WFLB 4LQCA 4A1OA 4CTNA 3SNHA 1C1DB 1EVYA 2HV9A 3E23A 2IYUA 2VSOA 1O5IA 1V8DA 4NZOA 2WIGA 2GD6A 3A10A 4F9EA 2O8DA 4DR2B 4ZO7A 3IA7A 4LV5B 2Q1SA 3UXMA 3VU9B 1Y8QA 3P0JA 1TZKA 4MK4A 1MC4A 2P9ZA 3BQNB 1DUIA 1XCBA 3WE7A 3MGCA 1G98A 2D8AA 2GD2A 3FKJA 4YTEA 1Z33A 4QXRA 1LPAB 3HC7A 1GUDA 1AXEA 1V47A 5JCJA 3KQTA 3TOSA 1VJTA 1VKZA 2YL2A 1CE8B 5K6AA 5C53B 2AB0A 3DM5A 3I5YA 3WWYA 3BRWD 4PYJA 5EXDA 2YHIB 1R37A 3T3PB 5IC6A 3PFGA 3PC2A 4ZVUA 1G6Q1 1XTBA 2GSWA 1U8TA 3HG7A 3LT1A 3DFKA 3K9NA 4N5HX 1DAHA 4BVBA 3VO2A 1G2IA 1N5DA 5AJHA 1OYYA 1A2KC 3JQAB 2WG2A 2QRKA 3L0ZA 1GARA 4DJ5X 3FAZA 1G7RA 3O9VA 1G5TA 4S2EA 4DPMA 3L82B 1UP6A 2FB9A 5K20A 5EP2A 2DTXA 2P9QA 3FUXA 4BDTA 2R6AA 3VZBA 2B8NA 2E6KA 3AP2A 1G4AE 1FYVA 4JHLA 5DNAA 5ESRA 2ZIXB 4I4TF 1SCNE 4L4SA 4RFSB 4JCCA 3WVNA 1PWEA 2P2GA 3AU8A 4YPOA 2OAGA 1JUDA 4Z4FA 4FR0A 4JV5B 5FFFA 1YHZA 1E2IA 5JPCA 2HRQA 1J2TA 5IFKA 3ZGLA 4CKXA 2HLDA 3MF4A 4L07A 5I3ZA 2ATXA 3NI2A 4U6QA 3TLAA 4WZ6A 1YOBA 3ZHYA 3AV3A 1H6CA 1Z5PA 3NS7A 5J4HA 2BGWA 1XU4A 3CKLA 3OWOA 2GCNA 2OLKA 4BC1A 5ETJA 5JD3A 3PXCX 1I01A 3K1JA 3L2OB 3QNMA 3CZAA 2EKDA 2H4ZA 1VXRA 3DXFA 1QQ6A 1NVGA 4X6LA 4BMDA 1SQ6A 3RODA 2ZWAA 3LCRA 3EOAI 5EVCA 3ZJTA 5AUPB 2N1MA 3SZUA 1X1DA 4CFYA 4K2HA 1YA8A 3BJMA 3KZMA 5B53A 3E58A 4EB6B 4CIVA 4WBXC 6CHYA 5H02A 1DDGA 1PL6A 2C5GA 2GKOA 2J4CA 3UHOA 1HEIA 1U5AA 4KW7A 4ZAXA 4Z1MD 3H9GA 1RPTA 2QR2A 4O4JA 4CIYA 2I4LA 3PJEA 2IUYA 4OCZA 4GX0A 4Q34A 7YASA 1RM3A 2XNJA 1K4MA 1YQWA 3P9QA 3ZHRA 4HNVA 3CSDA 3NAGA 3OTGA 4GI2A 4DILA 5K8VA 4E7PA 4EF6A 1ZO8A 4QFCA 1O54A 4F45A 2R3SA 3TJMA 3IOEA 2G83A 4YJHA 2IS4A 3RS9A 2QR3A 1DT3A 5K09A 1C0PA 1G8HA 3EK2A 5E0OA 1X9HA 3L7IA 1ZUHA 2IGBA 3VHQA 3AB8A 4ZZ3A 2JAHA 3G1TA 3TNYA 2ZAOA 4G1MB 3A1NA 1AS0A 4CFSA 5GOTA 4UTRA 1RIFA 3RSSA 1F51E 1M5RA 3C4VA 4CM8B 1FUEA 4B82A 3ZQJA 1ISMA 1FJ2A 2JHPA 4L74A 4AZWA 1Q92A 2FZGA 4HGYA 4MQFA 3WZMA 5TC4A 4NFLA 2WU8A 5IU6A 1M6VB 3UNXA 3P5SA 1VQ1A 1ADJA 3BSYA 3LBIA 4R83A 3ZIAA 5EHGA 5M29A 3VAZA 4ADSG 4KSBA 4AI6A 3UC5A 2QBYA 4L3OA 2O2YA 2ATVA 5L9AA 3ORRA 1FBTA 4HS9A 1A7AA 4ER5A 1U6KA 2QGZA 2ODNA 5H3LA 4C4SA 1Y3BE 3PTAA 1YDHA 2G4LA 2JGJA 3AR3A 1D2NA 3FVTA 4IEEA 3KU1A 1Q0SA 3S1LA 3GEMA 3N2NA 4RKQA 4LYAA 3RK4A 3IC5A 3WGIA 3RC8A 4H0CA 4NCKA 5H8WA 1MHTA 3KR9A 2ENUA 5AXDA 3OZUA 3I9MA 1W34A 5DM1A 5ITWA 1XHLA 2P78A 5IBCA 1J5XA 1K7FB 2VRCD 4QGAA 1XK7A 1P6UA 4AKSA 4DC1A 3C43A 4ZIRB 3BB3A 3DT9A 3R41A 4OY3A 4X95A 1LBHA 5AD1A 5JO9A 2INGX 2Z5GA 5E1BA 4A3SA 2C77A 4EF4A 1Z0KA 2AK3A 2I71A 2YHUA 1AA6A 4DUYB 3RT1A 1SVWA 1T4MA 2WNHA 3VPDA 2H4HA 4L15A 1W36C 5K3SA 3LMKA 4FMBB 1U8EA 3GNSA 5ECYA 4DM4A 4JY7A 1JHRA 1J7KA 2RG7A 3N74A 2BKVA 1NVAA 1P80A 1OH7A 2ONZA 3EB9A 5A4KA 1W87A 4RSMA 3W3AA 1D09A 4K03A 2Z9DA 3E7WA 2I55A 4Q47A 2ZB7A 4M7PA 1J42A 4TWIA 1U31A 4G5OA 1RBQA 4K6MA 1G59A 1E2FA 1WTAA 2NXCA 3J81k 1CY1A 1L4UA 1WKVA 2AR0A 721PA 2YRWA 1C7IA 5IYZF 2PS1A 1HT3A 2CVQA 4MKFA 3QA3E 3HY6A 4DSUA 1W48A 1DU4A 3FIJA 1A1VA 1V16B 2Q0XA 2WA1A 3MBOA 4JVMA 4RK4A 2VG8A 3BA1A 4OQQA 3CCFA 3VDRA 1DBSA 2PZMA 4M0FA 4G0UA 1I5RA 1GJRA 1OZGA 1PR3A 1NT4A 5A4DA 1W4BA 2QL7A 3FOWA 2PX2A 2NADA 2I2WA 3EQ9A 4MS4A 4P54A 1N1GA 4RLHA 3WLFA 2CFCA 3HCOA 3PJGA 3PLRA 4MS3B 1QYDA 4TQAA 4X3PA 4BUCA 4JASB 1KY4A 2CJPA 3OKAA 3OZEA 4PQRA 3ZDYB 5KHAA 5A3JA 5CVCA 3CKMA 3U3MA 3O2JA 2VUTA 4H17A 2IIPA 1AKYA 3FNGA 3HKBA 3JRWA 4U2BA 7REQA 2HYIC 2BGKA 5DV9A 2NZXA 4IIFA 1WUTA 3CNNA 3DYVA 1PJLA 3CT6A 5I9SA 3BYZA 3WV5A 1H3EA 5EIWA 3OJWA 1NYRA 3MWGA 4O02B 3PNSA 1EFKA 4GUAA 4QRDA 5HKBA 3HA5A 5EIOA 4JL5A 2FZCA 5ALEA 1RBMA 3TH5A 3AKEA 1TTTA 4RPJA 4RLQA 1V1RA 3AJDA 3T3MB 5LMNB 1Q0LA 4GGPA 2H1OA 2BHTA 1AMOA 3GEGA 4AS2A 1EESA 3UAXA 2J41A 3TVTA 1FP2A 1KO8A 3E9QA 3JR3A 4MULA 3QY9A 2IW3A 4EYKA 4RXUA 3CNQS 5B2ZA 2XUDA 5EE9A 1SUEA 2FEPA 3D6TB 2EKBA 2BJHA 1F14A 5AW5A 3R7SA 3IUEA 5TRTA 4ZAZA 4G1UC 4O1MA 4CF4A 1Y1LA 3OZBA 3UHFA 3D2LA 1QGDA 1XCOA 3WLMA 2CNBA 1PZNA 1N4DA 2HTEA 5B58T 1TW3A 3U2QA 2O3SA 2Q3MA 1YGYA 2W4QA 3NRJA 1HC7A 4KXYA 1JEQA 2W4IA 2PH7A 1YU9A 2QJTA 3SSAA 4CMGA 2YXLA 2CJXA 2YHBA 3ZK9A 3BXOA 3VNRA 2QX9A 3M5DA 5GONF 3MTGA 4QAQA 4F1WA 1Z5WA 3BFVA 3EA0A 5AK0A 3E15A 1FP6A 1F06A 2K7ZA 3TTWA 1TE2A 2WYOA 1M1YA 4UNNA 1DEKA 1JWAB 1L5MA 1S4MA 1LDGA 3C3AA 4OXQA 3H0KA 4ND8B 2ZJAA 3RSLA 4EKIA 1N9KA 4NENB 4WLNA 3RVOA 2YHAA 1O9BA 5CLQA 4E2FA 1RCTE 1KK3A 4HFJA 4L8GA 5E6RA 1A9SA 2XDAA 4EVIA 1FBNA 5HKAA 2D3TA 3L7YA 4G23A 4N8SA 2JI7A 1UKAA 1DS6A 3BSSA 2HJHA 1YZGA 3FDIA 4HB3A 4LHXA 4XD7D 3ZV5A 4DCSA 5JBQA 1IN1A 4IUCS 5B36A 4TWAA 1WB4A 1JSRA 3CX4A 2J08A 4JSTA 4RKFA 3W5HA 1I7DA 1K8RA 1GKIA 2IKSA 5ICMA 2P4EA 4ZVMA 1KI9A 4IQGA 5EPEA 4MVYA 3FD8A 1R3DA 2Z0MA 4I50A 2EEZA 2WVAA 5L6LB 1RVDA 4HDCA 1N77A 4LZLA 4MA4A 2GZ1A 2VNAA 3TE6A 1R6XA 2MR5A 3ZNQA 5IS2A 3L4JA 4LX8A 2O05A 4DR4B 2TSYB 3HKCA 2QX6A 5CDFE 1UDBA 2XA2A 2ISQA 4ZMBA 4DR1B 2FX2A 2WFLA 3K73O 4CV0A 5L7WA 1UBOS 4IV0A 4E6EA 4AJPA 1C1DA 3IQEA 3AVQA 1FYXA 3BE4A 3HA3A 1QF9A 3Q87B 3RABA 4CKYA 2R1TB 3VU9A 2AEJA 3DOOA 4MVJA 4AJIA 4XM2A 1WKBA 4NMWA 1JPNA 4NIMA 5A62A 4US1R 1NW4A 2CSUA 2ZAYA 2CXRA 3CF0A 3QENA 2G6TA 3EWSA 4FWIB 3WKAA 4FMCB 2HB6A 4AF8A 5IXJA 4RABA 3SZ3A 4XB6B 1DV2A 2SHKA 4YH1A 2H4JA 2P69A 4OXNA 5IJ9B 1CE8A 1RR6A 1GV0A 4MX8A 3VTKA 3KQMA 4C7BA 1SXIA 2YHIA 4IDBA 1ZMRA 1WCV1 2H7YA 4NZNA 4Q1DA 2HGSA 1MX1A 4HDNB 2RC6A 3Q0IA 5EJMA 3PT5A 3W6OA 3P9ZA 3PHIA 3V1KA 1U04A 3L18A 2XWQA 3DWIA 3LP5A 1AB6A 1MRSA 3JQAA 5GADl 3MXTA 1J49A 3P2JA 4WXPA 3FSGA 1M6YA 3DAFA 4WEOA 3E5NA 4FFSA 4GECA 4P4UA 1BD4A 1T2CA 3FSJX 3D1LA 4WA8A 5T5QA 5CBKA 4M0CA 1EIZA 3LTEA 2FFAA 2YICA 1UQTA 4CIDA 2HKIA 2EP7A 1ZBQA 3GZNB 4A6XA 2ZIXA 4KQXA 3N76A 3RANA 1NVXQ 4YQEA 3VPHA 2NO0A 2G17A 4UE6A 4W99A 4DMLA 5B6JA 4LQLA 5LN1A 5KBYA 1ZHFA 3SAJA 3FB1A 3DLHA 2P5SA 2JFOA 2WT9A 3MUOA 1CF2O 4G5XA 4CG1A 4US2R 4KMSA 3W5SA 3NRBA 4YX9A 2Z1MA 2IQ5A 2W7TA 2IFTA 1CK4A 2JIOA 3M5CA 4FR5A 1FDOA 4TV8B 1DRKA 2FW7A 2EDAA 3C4JA 4R4JA 4B3FX 2GJ9A 3RU9A 3KQLA 1Y81A 3ZU2A 1XYVA 4X7MA 4LBYA 4JODA 2HT6A 2HU2A 3DULA 4GSLA 5B6PA 1H8HA 1GTJ1 4IJVA 4QAJA 4WN3A 4ZKEA 4BV8A 1GAJA 3NGMA 4OQLA 3TBHA 3OQIA 4P3NA 2HBQA 3G6KA 4EB6A 1E9BA 1QZUA 3P71T 2J9YB 4DR3B 2AA3A 3CR7A 4FGZA 4IRMA 3OZGA 4FKZA 1F4LA 2ZIZA 3QHPA 1IJKA 1EUDB 1KKLA 4KO3S 3TLJA 4EVQA 1F17A 1IONA 1W73A 5A2GA 3VR4A 5ES3A 1CUFA 3GN1A 5CR9A 2BFBB 4JLOA 4BX9A 1M8PA 1PI3A 4YECA 2P91A 4U8GA 4UFNA 3VXKA 4BNMA 1GFIA 4XUCA 1X7YA 2O2IA 2VT7A 3KZVA 5IDYA 3NCTA 1E60A 3RIEA 4BQPA 1VHTA 1CJUC 3PLNA 1P1IA 4OEHA 4NX2A 1E4OA 3FWHA 1KEEB 2AOWA 4GPTA 1U3GA 4N5MA 1L4LA 1WSWA 1UQRA 2HEGA 1OJLA 3AERB 1DL5A 3K9WA 4HO1X 3THRA 1PHRA 2ZJ4A 3LX8A 4BLTA 4CDGA 4IIXA 3VR6H 4U2KA 2GCEA 2ZWPA 1OWPA 2KLBA 5IUKC 4E30A 5AOBA 2FZEA 4CM8A 4WBNB 5HHTA 3U09A 3HVRA 3K05A 2J6BA 2H07A 2XE4A 3O4IA 4FONA 4BBZA 5F3WB 1UDXA 3LQKA 2CLCX 1Q5PA 1XTQA 4PZ0A 2Z8XA 1M6VA 2X5OA 3A6KA 2CYBA 3CNHA 3NHPA 1C3OB 3H8JA 3OIWA 4K05A 4C2TA 2X3YA 1TJPB 4JBNA 4P3OA 4B46A 1TYEB 4I8IA 4QSMA 5KYWB 3D4PA 2AGVA 5FOSA 3VU0A 5C35A 1YJXA 5EP4A 2YCBA 1NTRA 3M8KA 4MYHA 3X1KA 2OMEA 3OCZA 3LK6A 2XOEA 3W3AH 1EUYA 4K9KA 3ZOKA 1DZIA 1S8AA 4TLLB 4XTRA 4IIJB 4D74A 5CRIA 1TMYA 1XZQA 4BO4A 5DRYA 1YQXA 1SUSA 2H54A 3A1TA 2NZUG 1IBMB 2IQIA 4B9AA 1H2RS 1JEDA 1UJMA 3HJUA 5TJ9A 1JSXA 2JBAA 1B3BA 4DKXA 3NUQA 3NHKA 2PGIA 3D7LA 2IPOA 4CMEC 1A71A 5I9BA 1C3VA 1UDCA 3AHCA 4G01B 4KXFB 5LQSA 5JECA 4BFWA 4BEVA 5LZ2A 821PA 3LUGA 5TT0A 3I6BA 3GHYA 4D4MA 5C7OO 4QDOA 3HJFA 5JS8A 1MVLA 4ZIRA 1Y48E 3CUEF 2VHXA 3NBUA 3TL3A 3ZWMA 4FE4A 4QQRA 5ALSA 3W9UA 2A9FA 3ZGVA 3IPLA 3A9SA 5K0JA 4HG2A 3Q1KA 4Y9TA 4BB6A 2H65A 1ODLA 2ZR8A 5EZQA 4D4KA 3I34X 4RV9A 3UQZA 5I8WA 4U9IS 2PYDA 1V8PA 3GELA 3WBJA 2OHIA 4KODA 3RO7A 5AK6A 5JAMA 3ELBA 4Z4GA 2VKTA 3E03A 1ORWA 1W49A 4QUGA 3ZE0B 3IXLA 2QTAA 3R3YA 3KR1A 4AN0A 3V9PA 4S0XA 5AJZA 1BA3A 1NVDA 1CDZA 3M3PA 3K4PA 3BGDA 3H16A 4N7MA 3E18A 1XMXA 4PHTA 4QBHA 4TXHA 4DA7A 5LIPA 5GV7A 5BRNA 5CXUA 5BSMA 4UJ3A 2UDPA 1RRKA 2X1LA 5IBPA 4EPRA 3RTCA 2QMZA 1NATA 4OUKX 4LZNA 1EJ6A 2XTMA 4HR7A 4Y1EA 1MNQA 4B2PA 3V46A 5CIYA 4OF4A 1BHO1 4CL2A 4MWSA 1K8QA 2XZOA 4DLRA 1P45A 1USUA 3WLOA 4HUTA 4F85A 1KK0A 5TV2A 3DWFA 4I55B 5HUQA 1VGQA 3G0IA 1EXMA 4OU4A 3A9UA 3KEMA 2B61A 4BS9A 3D6FA 4MS3A 1SULA 3GYGA 4HXGA 1J8DA 3FAKA 5B1YA 2FN8A 1PYGA 3G5LA 2RE8A 1SUDA 4FWTA 1IL0A 1FUUA 3NALA 3HB4X 3KG2A 3E9EA 3KALA 1OOEA 1CRLA 1SXJB 3D6NB 4LY3A 1XHFA 3KS9A 5D1NA 4UD2A 3UCEA 4N12A 4QLAA 4BN4A 3BQ9A 5A02A 2J0QA 4LRQA 4BZQA 4KTVE 4BP1A 1KQNA 2HHHB 3IRVA 4WE3A 4BGEA 1MZVA 4G65A 3TWOA 5M34A 1RZRD 1VMEA 2Z30A 3GP3A 3ROGA 1XZFA 4LEIA 5CB6A 5BW8A 1T9GS 2G6BA 2WWYA 3V1UA 3ICQB 3FM9A 5H3HA 3TBFA 4NE9A 3AG6A 1VPVA 3GBPA 2GDZA 3M81A 2FEAA 2HHJA 4QVGA 2JAPA 3SYNA 4R9VA 4YRAA 1A97A 1Q11A 3B1KA 3NHAA 4JJZA 4M9RA 4NAVA 5BMVF 4GP6A 3U3KA 2KBFA 4XDGA 3MB5A 1QAMA 3PR3A 4MAMA 2Q7OE 4KQFA 1EA5A 3FDXA 5K3OA 5H16A 2BCJQ 3E9RA 2TMKA 2KHZA 1UKCA 2ZSJA 2FMIA 3HYNA 2QN7A 3EC1A 4EJMA 1K6EA 1RAFA 2EG9A 1OPXA 3QVKA 4GFDA 1GPYA 1FYFA 2VHWA 3LZDA 4F38A 2ZE7A 3MZ0A 4XAQA 2FPSA 5GJBA 2YKGA 2WF9A 2Y9PB 4BBJA 1P0PA 1D6MA 1Y1TA 2QN9A 4QOGA 4X91A 1Y7LA 4DA8A 4D9NA 5IM4A 1KGDA 3LPDA 4PLWA 4I4IA 1RBZA 5HCIA 5BSTA 4CTOA 4PNEA 4CF5A 1UBNA 3EUAA 1J90A 4MVJH 3RM3A 4ND8A 4NENA 2HNBA 2PSEA 2POQX 1Z36A 3BXFA 2B4YA 4W7IA 4X24A 5DHFA 5ALDA 1KC3A 3C6ZA 3EVFA 4ND2A 1A76A 2DBVO 3LCVB 1JGTA 4PLVA 4TSKA 5FD8A 1HUQA 5TXGA 3JQQA 4PZCA 2ZCJA 2DFNA 4N5IX 3RS8A 3TD2A 1KVSA 3EDCA 3TIIA 2NVWA 2CLFB 2W6NA 2ZJYA 1I7NA 4MRVA 2WTMA 3CW2A 3AQ4A 3KPUA 4KITB 4UQLA 3CLVA 3IE2A 4AF7A 1JHMA 1TMKA 2HNKA 4B2IA 4ZYTA 5JJIA 2AJDA 2WG1A 4C0LA 5FLKA 4WUTA 3VAYA 4NATA 2F17A 2V7TA 2ZRJA 4NV0A 4A1FA 4YT2A 1ECCA 1ISIA 1DAFA 1MJHA 2BGUA 2HJGA 3C41J 4R9RA 2RGYA 2XUFA 2IHJA 4UEWA 1ACLA 3LLSA 5EIFA 3E1SA 3U19A 1FMTA 1EWQA 2UXDB 3DFUA 3C6BA 1U3UA 3V5NA 3GDOA 3M34A 3TW6A 2W2LA 3IBYA 1MLDA 1RQXA 4JMLA 5LMCA 4RTOA 4NYJQ 2ZBRA 1BWQA 2DR2A 4J4TA 4OHYA 4O3FA 3FFAA 4TTJA 2OV6A 3KEOA 2R1TA 2LP4Y 3WAKA 2V5VA 2HOQA 5FRDA 4O4IF 5DF1A 3TNLA 4YLEA 3TDKA 4EY3A 1G5FA 1JEYB 4MWGA 3TAHA 4PM4A 2XTNA 2FQXA 1IY8A 3RGGA 2PUAA 1TM7E 1M1UA 2GPJA 2HK6A 4MDEA 2GVZC 4IGKA 1A2BA 4PYKA 4LCBA 3UMRA 2BFOA 4CM7A 5IJ9A 3H1EA 1L5RA 3HJHA 2R47A 1G66A 5FDFA 1I1QB 3E3LA 4DJAA 4W8GA 1F1BA 4CG0A 5BURA 5CIQA 2R00A 4JYCA 3Q7QA 4HDNA 4DLKA 5LNK6 4JI4B 3VNVA 4ZICA 5AVKA 4AIRA 4K6KA 1MOPA 4ZVPA 1LBTA 1ZN2A 3FJOA 4GPIB 1SCQA 5CMLA 5IAGA 2EFGA 1S4QA 3EA5A 3H87A 3IHKA 4N0DA 4CYMA 4ERNA 3N8KA 4TUYF 4CPDA 1NVVQ 2PM8A 5AXAA 1QZXA 1BVUA 2ODQA 2C95A 3H65A 3PE3A 3U3ZA 4BIIA 2F67A 6REQA 2RGDA 4XX1A 5FB3A 2Y76A 2XJ4A 3PXGA 4XGQA 2MYNA 2BUBA 4U00A 3GZNA 3H4IA 3C3JA 2C3PA 5D86A 5HF6A 5CDTA 5K4GA 2VQFB 1EK1A 3IUQA 2QTRA 4AWBA 4P92A 1RQPA 2WU0A 1GGNA 3OQNA 3H2YA 3D7KA 3KLNA 4EQ6B 3RBAA 4B3IA 1TC1A 5EQTA 3QPCA 3UXEA 5B55A 2BP7B 3SJ7A 2DFLA 4HMQA 3ZY2A 4WZAB 1GZ6A 5FOQA 3CLUC 1PSZA 1N6IA 3VUEA 1NX6A 1E2MA 5KCMA 2WHYA 1N7IA 1XF1A 1EB9A 4TV8A 4N7BA 3UMYA 2A88A 1BDBA 1WOMA 3MAAC 4IJWA 4Y6SA 3TSOA 4U0KA 1E9VA 2YYAA 3RU2A 1FUKA 4F3CA 2P67A 5KJ6A 1NUTA 3PS9A 5JDCA 1C9KA 2AFHE 4L4ZA 4KR9A 3I0ZA 1GU7A 4COOA 3M5PA 4MV4A 4HWKA 3Q3GE 2E89A 5G0UA 5JDCC 1GILA 3F7TA 1EUDA 1OFHA 2F1OA 3A3NA 5LA6F 2I1QA 4C07A 3DV0B 3KPYA 1QCDA 3R6LA 2XTJA 2I8LA 2BFBA 1DC7A 2Q1YA 4WNIA 5EI5A 5FUWA 5HFNA 5LP6F 1HY3A 4D9HA 4ENRA 3PKIA 1HE3A 3KWFA 3Q3VA 1Z2DA 4KSCA 2IITA 1J1IA 2VTVA 3B5EA 4JJ4A 1V48A 4UBNA 5J2TB 3KVRA 5DM0A 1KEEA 1GZSA 1RNLA 2VF7A 1Z56C 3C1OA 3K92A 1SR8A 3PGKA 4KXUA 1N8KA 3ZU3A 4EDHA 2A7QA 2G7ZA 5ERXA 1NVUQ 4WBNA 3T3NA 3OSUA 3QQ5A 1QHEA 1UK8A 5EJ6A 3MTJA 3PD1A 1G2OA 4PXSA 2VHJA 4AZ3B 4M83A 1W1WA 2D74A 2WIFA 3NHWA 4QDXA 3IODA 3NTXA 4R5HA 3HWX1 4FVTA 3IMEA 4R3NA 4C6TB 4C0XA 3QF7A 1C3OA 2JJ2D 1WUKS 2X4LA 4XYMA 1YRQA 5JNVA 2GZMA 5FAXA 5DHAA 2C2XA 4FM9A 2YWXA 3GFPA 3L0BA 5FTJA 4D9BA 2C61A 4L8VA 1JLHA 3KJQA 1PJBA 5FXMA 1O0CA 1BJTA 3JD3A 5I4CA 4J1NA 4GOND 4UPVA 4ZOBA 4A0GA 1BVYF 2R8XA 5IZCC 4IIJA 3PWZA 4YP0A 2A1UB 4AYXA 4AW9A 4BKPA 2BHRA 1CUVA 3OZXA 4PZAA 4LE0A 2ZJ8A 3BPSA 5F7ZA 3BDVA 3V1YA 3HM2A 5TQVA 1JI0A 5EINA 1YQEA 4P4LA 3UFBA 1K66A 2GBFA 4PHCA 2AFIB 4MQ4A 1TK9A 3KCNA 1JXAA 1G2QA 1GFZA 1G3UA 1SIWA 4UAGA 1GL7A 1OROA 1R4ZA 2WSBA 4HDRA 4GQIA 4U3JB 2FMHA 3C1UA 4MO9A 4MYTA 1P72A 3AEQB 2JKYA 3I1YA 4FGWA 2WG0A 3PUWA 1XZAA 5MGNA 1U11A 1GKYA 2FOIA 4GZ6A 4TVOA 4XD2A 2B8JA 4R1NA 1ENOA 2VPPA 1QFJA 2P35A 4TWZA 4BTEA 4E33A 2DT5A 1G21B 4ZMRA 1WX1A 3ADKA 1OGIA 2VTEA 4DIOA 4MICA 1VKNA 2I7DA 3SFVA 1PQWA 2FWAA 3RBVA 1NQVA 3CV3A 2ZTUA 4A23A 1PUIA 3SHTA 5HE9A 1R0ZA 4YDHB 2EJCA 2WMDA 4HAVA 5I48A 1CJMA 3G2LA 3EXHB 4JBXA 3U0BA 2BFEB 2XVXA 3D02A 2HK9A 4H77A 3JWJA 2E0IA 2O2CA 4JJKA 3IUNA 2HL6A 2Q28A 2YFKA 2P3LA 3CEAA 1DIOB 1P74A 1WKCA 3GEEA 3GT0A 3H05A 4N49A 1HH4A 5CB4A 5SZHB 2NUTB 2WINI 2COEA 4K9RA 3VGPA 3OZFA 3GVCA 3O1HB 2ZITA 4V2IA 3AY3A 3FRHA 3R3HA 4PSDA 3D7MA 3QKRB 1P4JA 2ZRBA 3FCXA 3DAYA 3ER6A 4F11A 3NAQA 1YCGA 5TE9A 1JB9A 2XQJA 1KMIY 1KFCB 3B1JA 4I55A 3OA0A 1DBPA 2BV3A 4WKBA 4CHTA 2XXBA 3F6CA 4JYPA 4D9IA 1JFFA 4P7FA 5KQMA 1D4OA 1BJKA 2OGUA 4CUJA 3BGIA 3H5LA 4BDSA 3QMPA 1SXJA 2P1DA 4IZIA 3KOWA 1JTEA 2ETVA 5HE8A 3HV2A 1KTVA 2ZJBA 4GOLD 1Y3IA 4S1VA 5HBRA 3AJAA 3R3SA 4EG4A 3ZV3A 4B45A 1M8JA 4BO1A 1K63A 1PLLA 3O3CA 1HTTA 3IEKA 4POAA 3RU7A 4EHBA 3LQ4A 3KJNA 4P9NA 4Y6QA 4HB0A 3VU1A 1EP1B 4ZYZA 4NH4A 5KJEA 2ZI5A 3FMFA 3ADBA 1D2CA 3MQ2A 1JWLA 4GQAA 4L02A 3R7WB 2HN9A 2JGNA 3TEMA 3GDGA 4A16A 4A82A 4Q1BA 1EGVB 1EM6A 5HZKA 1FQJA 1J2JA 2MTBA 3GJQA 3FDFA 4YT8A 4D2IA 5KNBA 1SKUA 4QU9A 5BWLA 4JKIA 2OM2A 1HTWA 1QZTA 5MHTA 2P65A 4AY4A 2ZETA 3BS4A 3SZMA 1YZTA 1I1OA 1T4CB 1C7RA 3EAFA 4LDQA 1I6LA 5TVKA 4EW6A 2GPBA 3SVTA 1JJVA 3AF2A 3AUTA 4BQFA 4F21A 1XIVA 4OI0A 3D6VA 3G02A 4CKBA 3WA7A 2X14A 4HB2A 2FX3A 2H2GA 2A4KA 3C1AA 2GHQA 3DEYX 3OZRA 3ZK7A 3ZIAD 4P4NA 1GCOA 5ABPA 4ACBA 3EZNA 4MGEA 3ND7A 2W22A 5JD6A 2I7VA 3OFVA 3E3MA 3IVGA 4M6WB 4RWZA 2GTHA 5D5PA 2QRPA 5TPZA 4DBVO 3DZKA 3LKZA 5LQNA 4CM5A 2Q3FA 2HIMA 4NABA 4QODA 1UPAA 2B0CA 4F5YA 5K8JB 3FVQA 4GQBA 4TL6A 2JAUA 4J8PA 3RSZA 3W4KA 3OTWA 5KOJB 3WDLA 1GRVA 4BMNA 1WR8A 5AESA 2DM6A 5I4BA 4EJ6A 1W5FA 1J8QA 2GBLA 4FUTA 5CHEA 3TDNA 1QHNA 3O82A 2D2FA 4G0ZA 5AHXA 1ULHA 2GWHA 4X54A 4BN5A 3E9YA 2O8EB 1OQAA 2GBLC 3NNSA 1OWLA 1EGAA 1I2ZA 3KQPA 2R8PA 3RSGA 1RABA 3OI7A 3V6MA 3DOJA 1VE5A 1ZM9A 3L1UA 1ADYA 1MQ8B 3KPVA 4MKXA 2W90A 4XJTA 2ZBGA 4TLCA 4WD3A 5DI3B 2O7VA 1BQ4A 4OP1A 4PTLA 2F2TA 1SELA 3KUCA 1XMOB 1MC8A 1PWHA 1IB6A 3F0TA 3SC4A 1CB0A 1EH5A 1WNTA 2PZJA 5HQ3B 5IJ0B 4URZR 5BVHB 2Q4EA 2C4HA 4Z4CA 4K3UA 2C4TA 3G1WA 1GYPA 3PYLA 3SS9X 4EHHA 5JAOA 5KEIA 2ZXUA 3GFFA 3MCVA 5EAIA 4YP9A 2DLNA 4B8ZA 4PZEA 2O4UX 1CZOA 1KAQA 1A9QA 2YASA 1JG7A 3R7DA 1N0UA 2ZJ2A 3IOMA 4LIPD 2OKCA 3ML1A 1SUPA 1E5TA 3N6RA 1Q0UA 1BROA 1JEYA 3KIPA 3V4PB 1ZNWA 1N92A 5MDHA 3THYB 1B0PA 1YR6A 2WWTA 4M7OA 4ZCSA 2YINC 2XUKA 3E0QA 2A94A 3FVWA 2ZE5A 3IVCA 3LYAA 3PFIA 3EVZA 5CNIA 1GL6A 1VLQA 4B2YA 1U1DA 4G86A 1VL1A 1VBNA 5FLYA 4LRWA 3SYMA 3N59A 5FTLA 2GCPA 3QV2A 4OOEA 1JZSA 3AHDA 1FB5A 3DNMA 2AF3C 3ETLA 2YVAA 3HXPA 3MAJA 1ZK2A 4GOXA 3TTTA 2VCEA 4NNJA 3WYAA 3I2JA 3R9KA 1RI1A 4ESVA 4RBNA 3G2MA 3LVBA 1KU0A 3S8YA 3RTDA 3OQMA 4Z0NA 2Z6AA 4XVHA 1GFSA 1UFQA 1P4AA 3COPA 4UVHA 3UUWA 3UVEA 1A8SA 1AK1A 4HWRA 3KXPA 2RONA 4XB1A 1P2VA 1RYMA 3M89A 1WIWA 3LBHA 4XPIB 1ST2A 1UZMA 2WF7A 3GJ5A 5CU7A 4N47A 5DWVA 2IU0A 4AKEA 2DPYA 5C5DA 4NMMA 4XJXA 4QRHA 2BMDA 3AIIA 1FA9A 2KQUA 3KWLA 4FLFA 4MIEA 3OOJA 4TKVB 4YLGA 2YNMC 5JRJA 3KSAC 2GYUA 5TJHA 3WP1B 1RCUA 4EQ6A 4ICIA 3EC7A 1G2PA 3LKDA 3LV8A 3EFOB 4Q3KA 1O7JA 4H18A 3U81A 1K0UA 2BP7A 3WRXA 1M5UA 4AMYA 2NVBA 4HGQA 1Q16A 2X77A 4WZAA 1GSIA 2CB9A 3WRXC 1NQOA 3PDWA 2V6BA 4B3RB 1DJMA 4OIMA 1UF9A 2NTNA 3OJXA 4ZDIA 2VJYA 3ERCA 5INTA 3LQFA 2OB2A 5CLIA 3NAMA 1G1MA 1ZNYA 1T6BY 3DB1A 1KORA 4QXAA 1U94A 4TTPA 4AS1A 2B20A 2WM8A 4KIJA 5GJVC 1I10A 1F0YA 3AR4A 4L3WA 1FRVA 3EEQA 3JWGA 1ORDA 2DCMA 3DCJA 2WU3A 3II6X 3NTQA 3PNMA 3LDFA 2OQRA 2G06A 4IXNA 4LSZA 1ZOOA 1Q21A 2W93A 3Q5DA 2MCFA 4B48A 1U8FO 1ZWLA 5MN5A 3A1UA 3W9BA 4AJ4A 1T6YA 3JSXA 4KMMA 2VDKB 4Q7LA 4RJIA 4WFIA 5K05A 1TO6A 1ZSYA 1C9YA 3QELB 5G53C 1H2FA 3T7SA 1XN1A 1N34B 4WK4B 1E6UA 5J2TA 1HEUA 2IHYA 1OXMA 2JVIA 4I8DA 5JISA 3U48A 4MEJA 4RNDB 3PQ3A 3HDYA 1SB8A 1GLVA 2CZQA 1I13A 2PA3A 4KE6A 2HSZA 4RK6A 1Y7IA 3VDXA 2G28A 2HA5A 2LXNA 2P5YA 2PCJA 3DOHA 3WIEA 2I6GA 1KZ4A 1P5FA 3HZRA 4JR2A 2VUHB 2Y1EA 1T1RA 1FTSA 2PKCA 2D5AA 3AIMA 1FCJA 3IVXA 3C6XA 1KZGB 3PI6A 1ADBA 2OFFA 5BRJA 1E2BA 1DAPA 4BO2A 4HQNA 5EESA 4TSFD 4C6TA 1A4RA 3DMYA 4JJEA 4L5YA 3IXQA 3F5DA 1VSTA 1L5YA 4G4SO 3RU3A 3ZV4A 2PD3A 1GDHA 1Q15A 2C2YA 4L51A 4OQNA 2W6ZA 4Q7EA 5GJWC 4UHJA 1DMSA 3D0RA 3L49A 4JEMA 1JSZA 5F33A 1WOYA 3I01A 4YRDA 2QN1A 1G1AA 1VPLA 4WY5A 5E2IA 1RP7A 2GLXA 3C8DA 4NLLA 1KK1A 2FQYA 5BY2A 2ZB2A 4W9NA 4HS4A 1WLSA 2NZJA 2A1UA 1TECE 5DKFA 1E1DA 2QN8A 3WNQA 4OSEA 1KZ1A 2JH9A 4ZGBA 3N8DA 4ZDKA 5E7IA 2Y0EA 3FFWA 1X19A 5DJ5A 3JZDA 2NUAB 2XQVA 2J8ZA 3P45A 2GJAA 1RPNA 2AFIA 5GM1A 3WQRA 1JR6A 3RG2A 2SKEA 1T8YA 2YDYA 3GLHB 1E4VA 2G9VA 3OZVA 4U3JA 2CHQA 5I7UA 1E1YA 1AF4A 1FLAA 3AEQA 4JELA 1QO9A 3ZE1B 2NXNA 1I33A 1SZPA 1XYYA 2GEKA 1KR5A 3GLUA 3O83A 3THYA 4RF3A 1ID8A 3O31A 4FS8A 4X64B 4PYLA 1G21A 3ZCRA 4NZYA 2AMJA 3FNHA 4PFSA 3JQAD 1OGYA 2RC5A 1K68A 3FSGD 2WKPA 4L7QA 4JUDX 1BXGB 5FT9A 1SUCA 1VHDA 2OGSA 3NHBA 4BGUA 3AV0B 3EXHA 3RW9A 2BFEA 4CR7A 3NTLA 5B7PA 5A3QA 4M0KA 2JFGA 3O38A 3NXSA 2YZ7A 4IKOA 5F64A 5A4JA 1QE0A 3IAS1 3BDAA 1PEDA 2V65A 4KIUA 3TZKA 2H08A 3FRIA 4LYFA 3U44B 1D1SA 2CXNA 4IOJA 4KLRA 4QUIA 4RAOA 1S3GA 4G8DA 1Z25A 2Q4DA 2PN1A 5BN5B 3DOFA 4AG6A 2WILA 2DFTA 4CCYB 5JSFA 1FW8A 1TCBA 5JZSA 1IZZA 2PCLA 3OWHA 4M53A 1T2EA 4D6XA 3FLBA 1YBFA 1AGNA 2ACVA 4MW1A 3AL3A 5M5BA 3DO6A 3KC2A 1U90A 3L7AA 3WAJA 5K1ZA 3QVLA 3REGA 1RYYA 5KB3A 3EQ6A 1GPLA 2DFPA 3RCBA 1X3LA 2IZZA 4YCCA 1H8HD 2WTXA 4RPGA 3LGAA 4B8WA 1UC5B 4EJ2A 1T8TA 1FU8A 5PGMA 1U0HC 1HQCA 3QYAA 3QPAA 3E22B 2D62A 4DIDA 1EXNA 2EGUA 2ZYVX 3FSRA 5JSKA 5FLXA 2NPOA 1EK0A 4ITVA 3HUUA 3AKDA 3FLEA 1LF0A 3VR4D 3FWKA 4O29A 3OT1B 3UXHA 1HKUA 2H85A 1SCDA 3NT4A 4IDGA 1CY6A 4QICA 3WGUA 5DYYA 3CQ9A 2QRZA 3L6BA 3DDNA 1ICIA 2WLTA 3M3DA 1GSOA 1E3QA 3LUHA 4U2CA 5B58C 1H23A 3H1FA 5K7SA 3GJ6A 2ZE8A 3R7WA 1EFTA 4Q9JA 5HOQA 2CVZA 2JJ8A 1IDN1 4TN1A 4ZV4A 2Y93A 3U6BA 2XOKA 3F6PA 3KYCB 4R8LA 1HE8B 1O89A 1Z2PX 2P4QA 2RGXA 3CO0S 1NW7A 4X5OA 5IRCD 3PXDA 2GN2A 1MAUA 4EI8A 2BONA 4YRMA 3FTNA 3VV3A 4LSMA 1OYVA 4BE7B 1DKUA 1T4CA 1VMDA 3HCEA 3RS3A 3BZWA 4DSTA 3FOBA 3INRA 3NM4A 4NG4A 3UW3A 3I5MA 5F2EA 3DFFA 1ZGCA 1PJAA 3OJEA 5DT9A 5THXA 4YMGA 2XXJA 4S05A 3T5BA 1GRQA 2RHRA 1GAEO 3UICA 5ICEA 3ZDXB 4J0DA 3QM1A 2XZTA 4QEDA 4YLYA 2BAGA 4M6WA 1IEQA 2P90A 3RRMA 3ZE8A 3B48A 2HMUA 3HDTA 4KIFA 1E9CA 5AKGA 2WI8A 3IJEB 3DP9A 1FZTA 1CDOA 4S1TA 3SFTA 2DY0A 3GD5A 4HL6A 1U2PA 4BE4A 4D9FA 5KOJA 2FXIA 2OFPA 3HNOA 1PLJA 3F8WA 1GN8A 2H4YA 3MMPA 1FX1A 1VGRA 2WAYA 1Z4NA 4MW0A 1QMPA 5IYZB 2C4VA 4CEHB 3F1KA 3JAMA 2DBZA 4CBVA 2O8EA 2VJOA 3DCNA 1KDPA 4QPDA 2XCTB 1XQWA 1KMHB 3IKTA 4MPTA 2RHMA 1BJRE 1H0RA 4HMPA 2WWGA 4RELA 1NN0A 4F3KA 1IWOA 1E6MA 1KFJB 2CEKA 4J0JA 4PRZA 5E95A 1SVNA 3V8PA 3WRYA 4MSUA 3RASA 5CVVA 1J0BA 1QRAA 1C2YA 5DI3A 3L92A 5K3AA 3WRYC 3B36A 2C4MA 1JIUA 1KBOA 3GAAA 1HL3A 2JFBA 3FWPA 1BFKA 1KDTA 2JVKA 2YXBA 1VIAA 4FHGA 4JLKA 5BVHA 5HQ3A 5IJ0A 3PWTA 5HIMA 4IW3B 3BMOB 3JQDA 4HNUA 3FIUA 5BR4A 4M22A 2EX4A 1XXHE 2FX5A 1GPMA 3U4GA 2OO7A 5F7JA 2DBQA 4QASA 5JDIC 4BMCA 4FOTA 2FWBA 3H9CA 4B3BA 2WSSD 1NSFA 2ZJ1A 2RK6A 2EYQA 3MLEA 2ZIGA 3WYGA 5CW2A 3U7FB 2QORA 3I1JA 4JJFA 1G8AA 4CV3A 5ALIA 3WFZA 3PRHA 3C98A 3IBGA 3DYBA 3IPRA 4LRYA 1KI3A 3Q3JB 5I9LA 1ICEA 3R1IA 1Z22A 3AK4A 4RGBA 4UUNA 2V3CC 4FYYA 4DM7A 4FXPA 3RUCA 5DNWA 3T9BA 3O94A 2G9NA 5I4IA 3MSXA 2FV8A 2B36A 4J4BA 4BKRA 1J6UA 1HETA 1KI8A 2J3JA 1UT6A 3I39X 3EG5A 4UUPA 2GAAA 1ZZGA 3GUVA 1I1NA 1UM8A 4XPIA 4DLWA 1YKSA 3TK1A 3HLKA 2GR9A 3T4EA 1HQKA 1RRFA 1JKJB 1NWHA 2ZIVB 4W1SA 3K9QO 3QE0A 4N7RA 1CZRA 1E3WB 1ENPA 4GOMD 4C7JA 3OU6A 4Z54A 4LOJA 9ATCA 4DUZB 1L3CA 3KEFA 1ZN8A 2LW7A 1TB4A 4TKVA 2UYYA 4TS9A 5DNCA 1VJ5A 3HA2A 3ONDA 2H6EA 5EL0A 1FFAA 3B51X 3EFOA 4X8LA 3ENNA 3G6WA 5ALGA 3E4DA 4ZJYA 1VB5A 3QWFA 4OB7A 1R9MA 4QBFA 3NMUF 4MQLA 1C9MA 1Y5NA 4LNAA 2NAPA 3GUYA 2V1UA 5SY6A 4IJKA 2VP2A 3GEHA 2XUGA 3GJ7A 1C8LA 1ABBA 3W7AA 1HYBA 2ZUCA 1CP3A 1K89A 3E1GA 3I8OA 1BXKA 1NQUA 5LDGA 2Y0DA 4J75A 3KXIA 5JWRA 4G1CA 2IEGA 3OIYA 1H1DA 5IUJC 3DMPA 1KTIA 1QF6A 4EUHA 5EGSA 5B4UA 2XT0A 4W5OA 1U4NA 2ZVPX 5HSGA 5GIPE 4RE6A 3O9MA 2V0GA 4JI2B 2JGLA 1ZI9A 4LCJA 2BKEA 3CRNA 1YV9A 1SWWA 4XR4A 3OPVA 4YAIA 2BZSA 4B3CA 3ZHSA 3GVPA 2OTCA 4YNBA 4LZZA 4JDUA 3W4IA 2DWQA 3T4XA 4LJ4A 3RVPA 5CCEA 3BBLA 2JLAA 4B7ZA 2XB2A 4BRUA 1MAHA 3A6FA 3K6JA 4NULA 4EKNB 1J22A 1W6UA 2E82A 3WISA 1MV5A 1RAHA 3AF4A 4CLRB 2QDXA 3HB7A 3ZGXA 2PGDA 4MQMA 4GX5A 1IUOA 2IYEA 1MHPA 4DV6B 2CV1A 3AF1A 5CA0F 1MA3A 3EC2A 3F7MA 5ADWA 1QXSA 3S40A 4M8IA 1PEAA 3CZPA 4A6EA 4MR8B 5DWQA 3CUYA 3AT1A 2WTUA 1DXQA 3BMNB 3FDZA 1W7AA 4F86A 3WK5A 2CDNA 4FFPA 1RHMA 1I1HA 2FQ1A 4GO1A 4GF5A 3HABA 2VH2A 4GU5A 2PX4A 4K6FA 1GG2A 1P2SA 3ZH2A 1ADFA 1VYHA 5JWOA 4UPDA 4GH5A 4X7PA 1BRTA 1Z4IA 4CFZA 3NW9A 3OZ7A 3WL3A 4JBYA 8LDHA 3VR3A 1M6NA 3OEHD 1Y1PA 2ZBQA 1JT9A 3LFUA 3MTQA 1ZW6A 1GGMA 2Q3DA 4G07A 3S55A 3SJCA 5C80A 4M8KA 5IVPA 2PGAA 4IDEA 3GLFB 4AQDA 1R12A 2G1PA 1C0EA 3L5OA 2GAJA 3V8MA 2HHCA 3CB2A 4KVAA 4UHKA 2AQIA 3A9RA 4QYIA 4YACA 1AZTA 2A9RA 1YZFA 4IEFB 4PLTA 4E5NA 3NYRA 5BO5A 2AOTB 1NUAA 3KOXA 2NUAA 3GAMA 4OVKA 5JCXA 2BPOA 4OHBA 2H1IA 1PJRA 2PTHA 2WBLC 3ZY3A 4ZCRA 3ZZUA 1EFDN 1Z8FA 3GLHA 3ND6A 3KVNA 3DWGA 5KQGA 2P6PA 3PEFA 4TRNA 2GJKA 4YJGB 4EDFA 1J07A 1USVA 1KL7A 1SHZA 1EVJA 3GCXA 5EHZA 4DNPA 2QYTA 2O8CB 1JFTA 1XVLA 2JEZA 2XCIA 3F5QA 3SIWA 4UXIA 1IG0A 5HDBB 1BGWA 2GK6A 2PXAA 1Q74A 4K3VA 4NOKA 1PJ3A 1LTHR 1D04A 4XQ0A 1U0JA 4XWKA 3E2MA 3ZE6A 2CDRA 1BX0A 5AVRA 2PNFA 2O0KA 2O5EA 1RLOA 1S2OA 3ADDA 1S2GA 2VS1A 4NICA 1UKYA 1LBSA 5LZ7A 2GO7A 1QOQB 2PKWA 2YWDA 2CLSA 1YJQA 4UMEA 1OAOC 2RGWA 1TMOA 3GXBA 1GCAA 3IAM1 1N8TA 3UWDA 3HZHA 1DQRA 1TZBA 2LVBA 3EIWA 5JRZA 3HWSA 4RDHA 4QDZA 4EGAA 1L2TA 3IIMA 1N6RA 2CUNA 3CLUD 3PQDA 2V6FA 5ALRA 1LSUA 4FJ1A 5BN5A 2PR7A 2QRNA 4OP3A 4CCYA 4H6WA 3QTBA 1T6XA 5HPYB 2ZZNA 2AFIE 4DL9A 5DOVA 3ULKA 2FSSA 4D26A 4DF3A 4BEWA 3R6WA 3RTGA 5FUQA 5F73A 3FHCB 2W2OA 3IB6A 3IE1A 4E03A 3FCCA 1ZWKA 1DOHA 1RZVA 5SYNA 4ZT3A 4H4DA 4MUKA 4F1KA 2XMCA 5KO2A 5B1HA 1NMZA 1VI5A 2MOKA 1YZUA 1ZC4A 3EBOA 4CV1A 2G5GX 5KVCA 4DA4A 2BFPA 3WADA 1X3SA 4AP5A 3O1JC 5J4YA 5FI3A 5AOCA 3E22A 5FBVB 1KJJA 1AQYA 3H5TA 2QNIA 1SXGA 3RC9A 3EAGA 1XWIA 1ZBDA 3F74A 2WJ4A 3HXTA 2VOJA 3IV9A 1RI3A 5GWXA 3F3KA 4LYJA 2HQBA 1U3DA 3ON5A 3I3SR 5L53A 1D2GA 2M9MA 1Z6XA 3ZK8A 2OSBA 3PR1A 1QZ3A 1I7PA 4X7BA 3N6XA 1NJ8A 4Y9UA 3X0DA 3DAGA 4DBLC 3L6DA 1CQZA 5BQFA 2D2IA 2GEJA 4FIDA 3T1HB 2JJYA 4BAGA 3IDSA 3P20A 2AG6A 5B1EA 3B5IA 3GLGE 3BWDD 1XDWA 4UU8A 3ETCA 4PZ9A 1Z3CA 5CAEB 2JASA 5EWJA 4BQSA 3KYCA 2HJVA 2MWMA 1VC2A 5AO9A 1IK4A 2LIPA 1FP7A 3PB3A 3PZRA 5SZJA 3PIRA 4UBOA 2PL9A 5EMMA 4PLGA 3CUWA 3K8OE 1Z7YA 4GIBA 1BN7A 5F7OA 1EFPB 3HJRA 2C2ZA 4QTTB 2VF5X 4WACA 1X0VA 2VUSA 4KQIA 4EKGA 1T8PA 1Y8ZA 2D4AA 2Q99A 3M4YA 3QF4B 4LYEA 5CX1B 1UBJS 3SR0A 3HGMA 3WB9A 1U9ZA 4UUAA 3IL2A 1U65A 4QL3A 5JMPA 5AKKA 4R31A 1HBJA 1VL5A 1Y89A 4DLLA 2H8GA 3D5EA 3EAQA 3MRVA 1N0HA 4QA9A 1JDZA 3CH7A 3GU3A 1OFTA 3AZOA 3VAAA 1KHHA 1VL8A 3JZIA 1CEEA 4JFRA 2NP7A 2MSKA 3B3FA 3DXZA 1TEVA 5TF4A 3ZXUB 3DPSA 4FHDA 1R15A 2XKJE 4ZI3A 3WLNA 3P0IA 2NACA 3WLAA 1YJBA 2DE0X 2WKRA 2C2KA 2OV2A 3THSA 3E7XA 4DIKA 4ZMSA 1HLPA 2WYUA 2P2YA 4A6DA 4F4FA 1E1MA 1T6ZA 1ODKA 5T3YA 1P6QA 3TQSA 4DV4B 4IL5A 5DFAA 4BFTA 1ZMOA 3JR7A 1M2KA 4LQDA 4M9SA 3PC6A 1X2EA 3VMMA 3ZN2A 4AB1A 4DUPA 5IYZA 4CEHA 1WB6A 2ZRDA 2QYOA 2Y9MB 3AFMA 2A7XA 3OURA 4JEHA 2QQEA 1EDDA 1VLMA 2O1XA 3MEQA 4C7OB 1KMHA 4IGFA 2R4QA 3LD9A 3MHPA 4FI3C 4MEAA 3U80A 1P1JA 2BCEA 3ZEAA 4WK6A 1XPRA 2B6HA 4Z3KA 5JLAA 3F6RA 4JWKA 5BUQA 4EI7A 2Y1XA 3UAZA 3V2UA 1U0BB 3PUJA 1TF5A 3NONA 4W4TA 3GFQA 3CUUA 3ZHCA 5IWAB 4P81A 1KRXA 3BMOA 1I3LA 1OWOA 2DECA 5DCYA 1H9BA 3PEEA 3ZDCA 1AGRA 1W29A 4IM7A 3UOWA 1Z7EA 4S1WA 4KUEA 2ZSAA 5DTJA 2PWYA 1Y6QA 4KQEA 3W04A 3Q3EA 3WB2A 4C06A 5K8TA 5KNLA 2OXEA 2EEPA 2YQ5A 4XX0B 5I7SA 4BBAA 5LDDC 3LRXA 1SVKA 1AKMA 1QC5B 1X86B 1Z13A 4LTNA 4E3WA 3ZHOA 2V58A 4GM1A 3ZZ1A 2NNLD 3FX2A 2WMNB 2OK8A 4ABYA 3MG9A 5I51A 4N0EA 3S44A 1QHYA 2H1RA 2VBGA 3BA6A 2JJMA 4G89A 3Q4GA 1HNWB 1W47A 2CE2X 1EUCB 1RWPA