1KYVA

Lumazine synthase from s.pombe bound to riboflavin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
147
structure length
147
Chain Sequence
DLKGPELRILIVHARWNLQAIEPLVKGAVETMIEKHDVKLENIDIESVPGSWELPQGIRASIARNTYDAVIGIGVLIKGSTMHFEYISEAVVHGLMRVGLDSGVPVILGLLTVLNEEQALYRAGLNGGHNHGNDWGSAAVEMGLKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6,7-Dimethyl-8-ribityllumazine Synthase
publication title The structural basis of riboflavin binding to Schizosaccharomyces pombe 6,7-dimethyl-8-ribityllumazine synthase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 51
structure length 147
sequence length 147
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 1kyvA00
1KYXA 2C9DA 1C2YA 2A58A 4KQ6A 1NQUA 2B98A 1W19A 1KZ1A 1W29A 5IM4A 1DI0A 1NQXA 2VI5A 2JFBA 1HQKA 1ZISA 1C41A 2I0FA 2O6HA 3NQ41 1RVV1 5IM5A 2B99A 2F59A 1T13A 1EJBA 4J07A 2A57A 1KZ4A 1XN1A 3MK31 2C97A 2C94A 1KYVA 2OBXA 1NQVA 2C9BA 1KYYA 2A59A 1KZ9A 1KZ6A 1NQWA 2C92A
chains in the Genus database with same CATH superfamily
1ZW1A 4WVFA 1WXFA 4WY5A 3T7CA 4MWBA 2PUDA 3AVYA 5CEJA 4XLLA 5TMBA 1G6HA 2QLNA 3KTAB 1J2YA 1YGYA 2W0MA 1P29A 5EESA 2XOEA 1V95A 4OA8A 3JQ7B 1RRMA 3JASB 4DCNA 3L3BA 1O4WA 5CFQA 1GQQA 3FB4A 2RKWA 1AD2A 1X8LA 2ATEA 2VYQA 3I09A 3JAKA 4TTJA 4WN9A 2Q2QA 4B2LA 3JQ8B 3TTTA 3F7OA 1X9HA 5JNVA 3DE1X 4F2PA 3G8BA 1KDVA 1E9RA 2QUHA 4C4XA 3R3VA 3Q7EA 4H7KA 4J1SA 2FSVA 2YWXA 3K3PA 5PGMA 2DQ4A 2DFKB 3I6QA 5EMKA 1A27A 4TYMA 2OP0A 1HYQA 5SV2A 3ILYA 3PIRA 4KNVA 2QYHA 3D5QA 1BEUB 4BMSA 2MIIA 4O4LB 1XXHA 2KW5A 4RQUA 4XB6B 3O1IC 5ELLA 4CKXA 3OZRA 3L4JA 1PS9A 1UQUA 4OQQA 1HH4A 2AMVA 1E9EA 1V45E 4LTMA 4NAHA 1WXHA 1TM5E 4UVEA 5L6MB 4MHSA 3SHFA 4HBZA 3JZFA 2XNCA 1X7DA 3M1LA 4INOA 2ORYA 1MPXA 2HHCA 5BV7A 1E61A 2ZSJA 3JQAD 4XPIB 4ENWA 3AV0B 3DDWA 3DKIA 1O1YA 2W6JA 4UMVA 4LJRA 5AKHA 1E6WA 1ULTA 1UEXC 1IOVA 3A9VA 3NHZA 4NABA 3C97A 4O63O 2VDWA 4LHSA 2MSCB 4U2EA 1MCZA 4CDMA 4WLEA 4Z4IA 2OV8A 1SQ0A 2CMHA 2P65A 3QVXA 4C0JA 3MTEA 2RBGA 5DI9A 4YLYA 1I8TA 5IANA 2GWHA 1DQNA 3U3OA 4G3XA 4PZ0A 4CN8A 3O2NA 1A4XA 4DV1B 2ID4A 2PUEA 1Y1SA 1U3CA 2BW0A 2WIJA 1R9MA 3W6OA 4EQ6A 3U6KA 4RHCA 1PDOA 4XD2A 4OQXA 4XQEA 4GOJA 4RDCA 4IKEA 2OCYC 2YIVX 4EYEA 2I9KA 4QFBA 3OU2A 2WU3A 2XTJA 5HK9A 1I01A 2ORIA 1QVWA 3GLHA 1I5OA 3N0RA 1RZVA 4YCJA 3UYKA 4HEQA 2HF9A 4BNTA 4J03A 1B3BA 3LQQA 4HP8A 5DXFA 5EIBC 4ASUA 1OLOA 1YHZA 3U1VA 3DMPA 1G2IA 2VH2A 1G5FA 5CU7A 2P68A 3FBWA 2HQ1A 2GVNA 2GJ9A 3MT7A 1OIXA 1U0TA 1E3LA 4EEXA 2APJA 3HKCA 4L6AA 3BXOA 3JQDA 3KQYA 4RZHA 2VTKA 3BGSA 5BWCA 3K5IA 4NDZA 2EKQA 1X9GA 3ROGA 4YT4A 1Z0IA 5IKEA 1N5KA 2ZAYA 3TM5A 1XEFA 2ZZKA 2BELA 3GRAA 3TMKA 1JG1A 2VH5R 2WF6A 4D8VA 4BFLA 4ZV4A 4AW9A 1LNQA 1H23A 3RFUA 2BMFA 2NU6B 4AG6A 1JEQA 4QHTA 4TS1A 1D6NA 3ETJA 4FGKA 4X44A 2R6CA 2BEVB 2BM0A 4Y7DA 4BLTA 1C1HA 4EEZA 1ZGHA 3D6UA 2H1HA 5CX1B 2J8ZA 1XDSA 2UUPA 4KO3S 1I3MA 4TVBA 3TZ6A 1WTCA 1SWWA 2OHJA 5CVDA 2CFRA 2QIPA 3P4YA 3KUDA 5DM60 4CV3A 2H2FA 2J5RA 3ZDQA 4JXZA 3BAZA 2BKVA 2W43A 1U3TA 2W37A 2LCIA 1SCJA 3L5OA 2IGTA 3OEHA 1TLLA 3MGGA 3N2KA 1QHHA 3QPDA 3VPSA 1YZHA 3HBFA 3W4KA 4OBXA 3EWSA 3K9GA 4TTVA 3UFXA 1Z2DA 5LA6A 3P2MA 3TJZA 1T0IA 4JJFA 1Z0UA 1AOXA 2XUGA 4G0XA 5DXAA 3L43A 1JG3A 2R11A 3ZK8A 4JENA 3VH1A 4C05A 2FW9A 1N0WA 3HKEA 3RWOA 3JR3A 4G4SO 1X1EA 2CVHA 2NZ8A 2DTXA 3EC1A 4LVUA 3BTVA 3ONNA 3ZWWA 2HK9A 4FX5A 2ARKA 1C2YA 2D00A 5L7WA 3TKYA 3WLJA 1NBOA 3I01A 4J6EA 4XJSA 1HKHA 2NO1A 4Y3UA 1E59A 4C3ZA 1P3JA 5F76A 2UV8A 1HTWA 3RJMA 3JD0A 4P34A 5GM1A 3SDSA 1L5FA 3E35A 4YJFA 4F56A 1MJGM 3LDUA 1P39A 1WZIA 1BH2A 4CLEA 4KIWA 1N7JA 2V3WA 4ZCMA 5IH7A 3K1ZA 1PFYA 4IILA 2XBLA 2FAXA 2JI8A 1HQYE 3WB1A 3AETA 3I8OA 3V4OA 2F2TA 2HOQA 2O8CB 2PTHA 4U7HA 1AT1A 1HNZB 4JITA 1N6PA 1YZVA 1SQFA 5TRTA 3AF6A 3L0BA 1KDZA 4HGQA 4X6YA 3KB2A 1AJEA 1N9KA 4UBNA 4BLOA 4MS4B 4LOAA 1K8RA 2VDKB 3N1UA 3NBFA 2G82A 3DHEA 1D5WA 4DY4A 3PC2A 5K8LA 4MTCA 4AD8A 2OMKA 2EJTA 3IUBA 2HNAA 2NU8B 3F98A 5D87A 3Q8XB 5K51A 1F2UB 1GG8A 1MRZA 2WT9A 4QGSA 1K3TA 5EJ9A 1K5HA 1RADA 3AW8A 4P4LA 4DBLE 2O4CA 4XIFA 3P9YA 1E64A 2J3QA 2ZJ0A 3QW4B 4WX2B 2R6JA 1UJ4A 1Y9JA 2H63A 2OAEA 1XRSB 2DR0A 3HCRA 3IAXA 4R3NA 2EARA 3G9XA 1K3UB 3C41J 1DO8A 1NIJA 1Z0SA 1U31A 1BA2A 1W4RA 3CLTC 4KQHA 4HNGA 1OAOA 4Y18A 4CIVA 1KMCA 3L7MA 1A9PA 2ZI3A 5BO5A 2DMRA 3FF4A 4YJ2B 3QX9A 1Z6PA 4GR9A 2J0SA 1ZBQA 2C0QA 4UAUA 1YZGA 1EBBA 4E5PA 1QZZA 2I2DA 2OCPA 2X8LA 2Z2IA 4OOFA 4UTXA 5L3SA 2KBEA 3BIFA 4D9BA 3DLPX 2X5JO 4YJ3A 1W73A 2XTZA 2GNAA 3RSHA 3D0KA 4RTOA 1SUBA 2RI6A 3C16C 5KVAA 1S8OA 5GQSA 2VHCA 3KL4A 2GX6A 3MLEA 3NIBA 3HH8A 4JQOA 4M1WA 4U2DA 3ZJVA 1FPMA 1U3UA 4RJKA 3UK7A 3TGWA 3IP6A 1KRHA 1GGVA 4DUGA 4DUZB 2C5LA 4PO1A 4QQRA 2OBYA 3EA4A 1S2NA 3VKUA 3DA8A 3GL9A 1QGUB 5EJIA 3ICWA 5F3WB 4I46A 2A2ZA 3CUVA 1UBNA 2QJWA 4NE7A 2Q4DA 5AMXA 4RHFA 5LBUA 3HXLA 3R6WA 1ZA1A 2PX3A 3B1KA 4MJLA 4B09A 1IBKB 1ZOPA 1BE0A 3QI2A 3KOXA 4YIKA 4GP9A 1DV1A 4G25A 1SURA 5GONB 3UAWA 1PWYE 1T5BA 3L8ZA 4RTNA 1L8AA 2BT4A 2WKSA 3H84A 2Z04A 1ESCA 1SG9A 3W8FA 2VNIA 2CKMA 2R00A 4KXNA 3LW8A 1QV9A 2C7VA 1PT6A 2CXUA 1E3EA 4KAXA 4FB4A 2EQ5A 2XYHA 2GOYA 3UMSA 3LUPA 3D8BA 1G5QA 3CRW1 2O8BB 2V1UA 4MW4A 2A1TR 3IQXA 3RU2A 1NBWB 4KR2A 2P4HX 1XZBA 4ZQFA 2NTYC 5CR9A 2XGSA 3DMYA 4BNJA 1VMEA 3T34A 1Y6GA 5B5SA 4LIPD 1P7CA 5HHTA 4DCCA 1J1ZA 5LP1A 3AVTA 1ZIPA 3FYSA 4D8WA 1FYWA 2F1OA 3U37A 4F46A 4AAYA 3SX2A 3E8MA 5F4BA 3MTDA 4PYKA 4PSAA 1QVAA 3I6IA 3PF9A 3RFVA 1WOMA 2X4GA 2ZAIA 1JYEA 5DNUA 3T1OA 5CT4A 3TNJA 5D8DA 3PE4A 3H65A 5FL7A 3GEEA 2ZSHA 3BRSA 4GF5A 1RIIA 1KI8A 4KXWA 4L5CA 5D01A 5B3AA 4Z1MA 4AG5A 2WWYA 3E03A 5EZQA 4C5AA 2PL3A 1QGAA 5KNBA 4M1MA 4F4IA 1POWA 2C8LA 2XPCA 4TYQA 4TL8A 4B48A 1RMQA 3A3OA 3GB9A 1PUIA 1E8MA 2FP4B 4CZ2A 1KYZA 2QROA 1WXIA 4CGZA 1LPSA 2DKFA 3WBJA 1EHCA 1EM6A 3NYQA 4BV9A 3TSOA 4LWQA 1MA3A 3GGCA 4FZJA 3RABA 2OPHA 2PFGA 4RGYA 3EVEA 3QLEA 4I4NA 1DTSA 1ZN9A 2UZIR 1WMDA 4UUBA 5T41A 1KFBB 3PC3A 1HDIA 4RMGA 3NPAA 2PVCA 1ZNWA 4JOBA 2G70A 4AP9A 5IW8A 3DF9A 3ROFA 5HZGA 3K2EA 2YKGA 2HQOA 2YW9A 4UULA 1JQKA 1C7FA 2CW5A 2ZWAA 2D4AA 1FLDA 4IIXA 2DF8A 1CR0A 3GBVA 4UHFA 3WLEA 5JH7B 2VSXA 2I71A 1BE8A 3OF3A 4A23A 1PT7A 4DANA 1J97A 4LA4A 3U61B 1BX0A 3FNRA 3ZOZA 2WG0A 4BTLA 1EVQA 1DARA 1K1EA 4L0QA 1U81A 4NOLA 1GEGA 3I4LA 1IZ0A 1O97C 2N0SA 4MQ4A 1QSGA 1IBMB 2I4RA 5HTKA 1K9VF 3AHCA 1SC6A 3VYTB 4UOEA 4CKZA 1CZLA 3OZWA 3AF2A 1NPYA 1KSFX 2BKAA 4J0JA 2BGIA 3RVQA 3H86A 4DYDA 1GZDA 2PX4A 4M8LA 2P2LA 3QVOA 4CL0A 1B8UA 1CP3A 4JA0A 2RAFA 1Y1QA 3LE8A 1PL0A 1S2DA 2BL4A 2ZRQA 1YO6A 3EVFA 4JSTA 1I94B 1VJCA 2C31A 1AB5A 5FJJA 1KMIY 4BO7A 1PEKE 3MCUA 1F14A 4Y6LA 1QLHA 3UGKA 3ROPA 4PEVA 1J2RA 4OFZA 4UHHA 1GZUA 4PHTA 3GJ4A 3IKJA 4C30A 1U6JA 4ZEOA 1NNSA 1PX0A 1U2RA 2IVFA 3FFWA 2WJWA 5EEGA 1ULHA 3EY9A 4JP5A 5KTMA 3O8QA 1UH5A 2AMYA 1GUFA 4D56A 2MWMA 1U3GA 1X1DA 2SCUB 4RIGA 1MQSA 3COSA 2XH8A 2FZKA 2OFPA 1TUBB 2HDHA 3C3CA 1B00A 3PQ4A 4HSGA 2EQBA 3KO8A 2G67A 2VF2A 1GTSA 2NTJA 1O9GA 2HF7A 2FQYA 1VG8A 2VJPA 1R0LA 1GFSA 1L9XA 2X86A 3ENZA 5I51A 1AKUA 1AF7A 1GJRA 1JLMA 1Z8HA 4EOGA 1C3EA 5JXJA 3EH1A 2VP3A 1QYIA 2CLSA 1U1DA 4MKGA 3CYFA 3IP7A 2GYYA 3VSBA 3K72B 3K9HA 1ENOA 1Z26A 1Z4PX 3T5PA 3CLRD 4O4JA 1QHGA 4W4TA 4C14A 2J46A 1JHPA 3LSTA 1JHDA 3R1IA 2JJ8A 1L7DA 4K03A 3K5PA 4JBLA 4MP6A 3T1YB 4LBWA 1PFWA 3A1TA 4GR5A 4H15A 3A1CA 2A0YA 4IWYA 4K7JA 5F5LA 4D7AA 2ZBPA 3NFRA 1NRXA 4ZVOA 3FCCA 5E4JA 3VU8A 4YRDA 3I2GA 3JWHA 2I6GA 1G63A 5T6BA 5DCYA 1JTFA 4E6EA 3WGNA 5ESDA 3PQ6A 1B1CA 5KYNA 1R64A 3HLTA 4DBVO 2X5NA 1CJUC 1UM9B 3A1UA 1JUDA 4EHLA 4EY6A 3NBQA 4EQ6B 1AA6A 2J32A 3FW1A 4KYVA 1T3ZA 4IY1A 4JWTA 4PGMA 5CGZA 4DMHA 1TNDA 3MQ4A 5EJ5A 4M7WA 2QLJA 3QK7A 4HLDA 4GOOD 3QITA 1RWOA 2Z5FA 1ZLYA 1DDGA 1PJCA 2VHVA 4WWHA 1ZCAA 4DWVA 1R8XA 5ALMA 4D57A 2P0EA 4WTOA 3LDFA 4C1BA 3TR5A 2AN1A 1XMQB 4RAOA 2X42A 2HA5A 3N76A 4UU1A 5KAMA 4CM4B 5CCEA 4J07A 3QLJA 3DR5A 2JLVA 1HNNA 3CR3C 2JDID 1VB5A 2K87A 2YVKA 4NENA 3O94A 3QPBA 4RUKA 4BQOA 2FETA 2VP9A 4XJVA 4FDVA 1GAJA 3K1YA 4UDOA 4YEDA 2A0FA 5TC4A 1T5OA 3KAQA 1T0BA 2OGUA 3O8OA 3NXKA 1F4VA 2MT9A 4W9MC 4GBMA 1TAGA 2BMDA 4Q1AA 1W46A 4MW2A 3NALA 1A1VA 4PU0A 1UDRA 3B53X 3BCRA 4CKEA 2HU2A 4LZLA 3TH5A 1SHLA 2DH6A 4BVKA 3T52A 3Q6IA 5JNRA 4O02B 4RVUA 3BTUA 4GX1A 1P1FA 1R18A 3QH4A 5INTA 3J81A 2ZIUB 3O03A 5FPYA 3IPYA 1SKYB 3GC6A 1DJPA 1QHHB 2VK1A 3D6AA 4RF3A 3S2EA 2XDYA 2JLYA 1B0ZA 4RTKA 3CJRA 4B8ZA 1XV5A 2QM3A 3UFXB 1N34B 2NU7A 2IXDA 5LA6B 4O2BF 4QTTB 4DF3A 5KOJB 1YFKA 2Y0CA 2O0MA 1U94A 1ZKMA 2D1FA 3FKSD 4I55A 2A5FA 5F12A 1X1BA 4BNYA 4BTVA 5IPFA 1ZN2A 3REQA 2O54A 1XUOA 1Z7WA 4HAWA 2WWTA 3DM5A 3TZEA 1I0LA 1G3QA 3L4EA 4POOA 3DMTC 4M98A 3U4MA 2F64A 2YMPA 5DIZA 1OGJA 2ZR0A 5CLHA 5E9JA 5J1TB 1PHRA 3L40A 1E1CA 5AKXA 3CH7A 1YNSA 2HMWA 4UM8B 5KNBH 4I50F 5JR3A 3TR6A 1PJTA 4A0HA 3LKDA 1A98A 1FU7A 2PSDA 2W4QA 2WKPA 3PGA1 2FN9A 3MCWA 3PGXA 3E5RA 2ZYUX 5E6RA 5CDFA 1GGFA 4I1OA 4AS1A 1TQ8A 2D1TA 1FZTA 2VN8A 2H0AA 3A05A 4Y9DA 5BSVA 1E9AA 3L7AA 4BMVA 5FX2A 3OE5A 3PEWA 1HORA 4JJKA 4JOSA 3P1JA 1XJCA 5AHWA 3D3WA 1SHZA 5ARDA 4DPMA 1Z4LA 5D5QA 3OOJA 5KREA 1BVRA 2OZEA 3LKZA 4BZWA 5JRJA 3WXBA 3A9RA 3T35A 4QO7A 5G41A 1PJZA 2Q8NA 3MC1A 5M2QA 3KB6A 4XVRA 5DYYA 3RJZA 2JHPA 3CLUC 2OGSA 2QENA 1SC4A 4ROSA 2FZCA 5CM8B 5FLKA 5JJBA 1T4BA 2R6HA 4MVJF 2J07A 2Q3LA 3GRZA 2W2VA 2Y66A 4HVAA 5E4TA 4AJLA 5EWLB 5KX5F 4YXFA 1ISPA 3CRQA 3CEJA 5AHKA 3KR0A 4UEJA 3VFDA 1EHYA 4TT8A 3NHJA 2OVFA 1GLVA 1M0SA 4BAUA 4C2BA 3JCZA 3CZ5A 3DV0A 5D3QA 2VBIA 3M33A 3SPXA 4BX9A 3NBZC 4P8RA 4KBYA 4LQLA 3VNSA 3T54A 1N1EA 3VDQA 5K3EA 1UC8A 3K96A 1TMYA 1X0VA 4V1CA 4F6LA 3Q1KA 3D3QA 5G2OA 3SCZA 3UAGA 2EZ9A 1S8NA 2Q6TA 3ZYZA 4FD3A 4D4HA 5CFRA 1ZSVA 3DTVA 1JDBB 1RACA 2N1MA 1NW7A 1OKKA 1QC5A 4INPA 1VE9A 2AEEA 2P9GA 2Z2XA 3GCGA 1JHYA 2FSGA 2JCXA 2NUPA 3BSSA 4FP9A 3ILVA 4TXHA 2ZIGA 1AS3A 4HEJA 5C80A 1MV5A 3VR2A 1KVQA 4I7EA 4JLWA 1RCTE 5B3JC 1GP2A 4D26A 1OBFO 2O8DA 1OTXA 2QRKA 1KBZA 4N03A 3OZGA 3JQFC 1N2IA 1QJ4A 3TTSA 1KWKA 1WXDA 3BH0A 3LKVA 1J9EA 4OQEA 3KKMA 1OD6A 3MG9A 4NYMR 3AI7A 3CGWA 3VDMA 5JLJA 3I62A 4UNNA 2DEUA 3B20A 3EG9A 1APBA 4KSCA 2HD4A 1OGIA 1I2MA 1N5IA 2UUOA 1OAKA 3IMGA 3T41A 3TL3A 4CIYA 2J85A 3WK6A 4J7AA 1HRKA 3E61A 3LP6A 3PUWA 1VECA 4XRRA 5AM1A 5WRFA 3DEZA 4O2AF 3OPVA 3RG8A 1XQ1A 3MD0A 3S2GA 2XV1A 3AOGA 2H8KA 2ZANA 2GXSA 2QX4A 4HXGA 3QVSA 4ENSA 2VA8A 2QLFA 3E8SA 4FE4A 1PJ3A 3GJTA 2ONJA 1N4DA 3D3NA 4B3XA 1I6MA 3IHTA 1VPEA 1Q3TA 2DPGA 1U8XX 1KZ6A 1T2DA 1NRWA 2IUTA 2P5TB 2PM8A 1OWPA 1NLFA 3BN3A 4XOIA 3I2KA 3EE6A 5FOTA 5C5EA 4MAFA 1Y3DE 3L6UA 4J7UA 2GDJA 4K86A 5C4MA 2J4DA 3WE7A 2FOIA 4CQJA 5C52B 1M7HA 4LHVA 1OXBB 3KPUA 4X24A 3PNOA 5IEBA 1UDAA 2GZRA 4QTXA 3SQLA 1S5PA 3AB8A 2CLMB 2PU7A 2XWSA 3HO8A 4R9SA 1UBFA 2ZVJA 4IDEA 4CCYB 1Q6YA 1XZNA 1ZD5A 2WC1A 1PWZA 1ZMOA 3D1JA 1TVMA 3Q9LA 3L7NA 4ZZ2A 1XKLA 5A5FA 3B82A 1XD8A 1BVUA 1Z7YA 5D7BA 4FDLA 3W34A 3BK1A 3FWHA 4KVZA 2Z43A 4BATA 2HH9A 2V7UA 1I1NA 5DYTA 3DYIA 4R9UC 2HU8A 2ZUUA 4Z3OA 4Q9JA 4R7GA 4RK5A 1KR2A 2C2BA 2CLLB 1RNLA 3LOPA 4J2OA 3MJTA 3T5CA 2JCGA 4XJTA 3KYIB 3LY7A 4MCAA 3IUSA 1OPRA 5BRJA 3H9EO 4UAVA 1L7OA 4LRUA 3NDIA 4LDZA 3W2IA 1KK0A 2QJRA 3KM0A 2IUFA 5DYWA 4E1AA 3ECSA 4KYUA 3LQ4A 4JH0A 5FPHA 4D8YA 3E6AA 1IBCA 1I32A 1TC2A 4CT4B 3TLCA 5DU2A 4TQUS 2EG5A 2WE8A 2Y1LA 3CT4A 1F0YA 4FQ7A 4R2IA 4TVOA 3WGQA 3IBTA 2OKGA 2F43A 2KLHA 3ZDEA 2ZR7A 4BFVA 2XZTA 5AJVB 5BR7A 3JWGA 5JQWA 1A9YA 4HXYA 4WCFA 2PVSA 1OI4A 5DHSA 2ANBA 1PVOA 3MJEA 4FLEA 4YJDA 1EQ2A 4D9NA 3NT2A 3IPCA 5KWVA 2V74B 1D04A 2GETA 2C2MA 2VG8A 3QEOA 4Y6PA 5F2NA 1B8PA 4FONA 2AN9A 3EFOA 4H18A 1TU0A 1CDEA 1B43A 1MXFA 1EH5A 3VC3A 1WHSA 1DKNA 1K7EB 2GMWA 1V43A 2VI5A 4P33A 3Q8LA 1OTYA 1PKEA 2UYHA 3V4SA 2H65A 1QP7A 1JG6A 3FMGA 3CEHA 5J5AA 3M3DA 4ACAA 1EWRA 1NG1A 5FDFA 4KWIA 5H9VA 2IRWA 1LDBA 3DL4A 2IV2X 3DXXA 4MUJA 4AY2A 5LQRA 3Q6MA 4MUFA 5AO9A 1ULSA 5B7PA 1TEXA 1HFEL 2PVPA 1SXHA 3JVVA 4M1KA 4BJHB 4ECAA 3BCSA 2W8ZA 2DBYA 2Z95A 1QG0A 3WAJA 2W6MA 3QA3E 1ZAYA 4BJ5A 4I9NA 3T4XA 2GPYA 4YMLA 3K6KA 5CTJA 5L8VA 2BSXA 4GBED 2H1IA 3TZHA 3W05A 4HWSA 2IYPA 4AY4A 1C7RA 5GY7A 4HWKA 5JARA 2I1LA 3AHIA 4FYMA 4J1TC 3TCXB 5TLSA 3AU9A 2WMYA 1L7BA 1DZIA 2QEQA 4OMCA 2GCOB 5DSXA 3CX4A 3V8MA 1N3YA 2VHXA 3ULKA 1U2TA 4UOQA 4EGSA 1ID8A 2GEFA 2JF0A 4P53A 3I42A 4LG1A 4CIWA 5TS2A 3NNNA 1FLVA 3WDSA 2YH2A 1DHTA 2R7AA 4KMRA 1CQZA 3WIEA 3D8TA 2GEUA 2VLBA 3OFSA 1V5EA 2PA0A 4RWEA 4ITVA 4JR0A 3D6HA 1GYRA 1PQYA 1V1JA 4EG1A 5KTYA 2QVCA 3ZHYA 1GSOA 4XR4A 3V3TA 5FOQA 2FK7A 5CVUA 1W0JD 1EZ1A 3O1LA 4O4JB 2QRNA 3TEFA 5C4IA 3QKWA 3FPLA 5EHNA 3ZUGA 1XKQA 4MKIA 1PSZA 4B6OA 3FUTA 2VEDA 3RTGA 2OY0A 4XEUA 4I9GA 3BS4A 1YKGA 3X1MA 4AVYA 5L40A 5JFGA 3KQMA 3BMNB 4TTRA 5JATA 2O2IA 2D8MA 1JR6A 3JRNA 3GLRA 3U3DA 4B4KA 1ZD2P 4ZYUA 4CQLB 1JA1A 3W5UA 1HSOA 1ZN7A 3DOEA 4EHBA 1FXSA 3AXTA 1NVFA 1IHYA 4ZVLA 3ANNA 1USUA 4G6ZA 4D4IA 3F1LA 1U4NA 1TA4A 1UPAA 1XNHA 3F6CA 3IP5A 3THXA 2ZUEA 2O8FA 4DJTA 4LQ4A 1H42A 4UE2A 5AT1A 1WW2A 2PSFA 3Q4GA 1US8A 1UAGA 2V3VA 2R8OA 3RC8A 4C0BA 4BEWA 1L6IA 3F0TA 2H4HA 4GYKA 3IKVA 4MS3B 3KHKA 2JH3A 3W5JA 3OWXA 3R0XA 3CVUA 3DQPA 4BRSA 5BWOA 1KJNA 4WAUA 4PHGA 4RNDB 4HNAA 3VKGA 1VZ3A 1Y8RB 4J75A 1EDOA 5K3BA 2B99A 4UUQA 4DCMA 4YXWD 3FPFA 5K05A 1EESA 3LT5A 1BMQA 1Z3CA 1J8FA 2F17A 1ACJA 4OJQA 3SHVA 4HDQB 1SQGA 4EYQA 3D6MA 1Y6ZA 5ALJA 1IMOA 2HU7A 4NENB 4YRFA 4MZXA 4LCJA 2Y92A 4Y2PA 4BU1A 4NMXB 1BDIA 2G71A 2BHLA 2D62A 5BVHA 5DNYB 2QT1A 4E30A 4GM4A 3V4PB 4WBXC 4YCNA 1HK7A 1RAAA 2CCGA 4OHXA 3TVTA 2R86A 5DWDA 2FEXA 1U2ZA 1R88A 1XBTA 2VT7A 4EYOA 1M2OB 3IHKA 4HZUB 4UU0A 4WBNA 2OO5A 3EZLA 1P3DA 1TD1A 2AV6A 2ATVA 1ZHOA 3EIQA 1G6OA 3IT3A 4AF7A 1DIGA 4CKEB 2VNAA 1BMDA 2R87A 5HE8A 2O5VA 4J9VA 4BVFA 4BQEA 8ABPA 1ABBA 5EIWA 3P97A 2WSSA 4D0RA 2FEPA 4XM2A 1IIRA 4DR5B 3W78A 2Z3VA 3KUCA 3X1XA 1SHTX 3CUYA 2OHHA 4BNGA 7AT1A 3FFTA 3ZC3A 3V32A 1R5JA 2F8TA 3C6KA 4JHXA 3REQB 2GCPA 5KEIA 5B58C 1RJWA 4C6RA 1GL6A 3RANA 3DPUA 2QIOA 3IDAA 1T3HA 3PUKA 2WHXA 3L7IA 3SLGA 1T4GA 2H4FA 2J9YB 2BISA 3RS2A 2H2WA 3TE7A 4B3HA 5JD6A 3CC8A 4G84A 1QDEA 2IDZA 4Q3NA 5GV8A 4US1R 3T61A 1YTUA 1EE9A 3NV7A 2ONYA 1WSAA 5KCMA 2ZSKA 4LBYA 4ZAGA 4TGLA 1FVXA 1XHFA 3F7NA 3IAHA 4WK0B 4QRHA 4WKCA 4PFSA 3TD6A 5EFZA 1HYEA 3L6RA 4PPFA 3TMYA 1NE7A 2EU8A 1TEHA 1VIDA 4MW9A 4ANFA 3SQNA 5BSGA 1XJQA 3V8RA 1P2GA 2WOJA 4GSYA 3W2TA 4D6XA 4XVHA 5DI3B 3MIIA 3QA9A 4MWCA 5B58T 1RE1A 4Y67A 3COYA 3MYRA 4ENVA 4TPKA 5IVIA 5BN4A 5JW6A 2YVLA 2WIBA 3HRKA 3HE3A 3M1YA 4E70A 4WVLA 1TYZA 4PCUA 1CJKC 4IJQA 3X2SA 3QY9A 1BHSA 1FZQA 2XUAA 3NOVA 1UWVA 5CVEA 3PLRA 4Y1EA 1XU7A 5DYIA 1RKVA 3VDXA 4ND4A 3CEAA 3W5HA 2VO1A 4WZAA 1JZQA 3MLBA 1OT5A 2ECFA 2EBHX 3S1AB 2DWCA 1COWD 5C5IA 2PCJA 1A2OA 1A8HA 3DV0B 1N9GA 4PX5A 4MB2A 4U0JA 2J3DA 1J00A 1UAAA 4BQQA 1YFLA 5HP4A 2CCJA 2YWBA 3O2QB 4CMHA 1JB9A 3HVJA 4B1FA 3SKVA 4ZDKA 2VJYA 2ZRLA 3FSRA 2BDEA 2RH5A 3HP7A 4I6EA 4NH4A 3RC7A 1NR1A 1RYZA 1UPBA 2O2ZA 4AXBA 8GPBA 4RU1A 1E20A 5AI0A 5K0GA 4LBVA 1HMPA 2E9SA 1L8XA 3TIVA 2OK7A 1WEKA 2NUPB 4NH0A 4F71A 5JFTA 5CYOA 2J5BA 2QW8A 3IEUA 1YDHA 1S01A 1WB5A 1IEVA 3UB3A 1ML3A 1U2EA 1PO7A 3O6VA 1R50A 1NIPA 2X22A 4E4TA 1E32A 4GOLD 3QKSA 3VUEA 3M4YA 4LTDA 2HA6A 3ANSA 2VJCA 2DY0A 1ZNXA 4L57A 5A6SB 2W48A 1UP4A 4QT0A 3WKEA 4CM6A 3H2IA 1FCJA 3P2EA 3WMWA 1KI1A 1V5GA 2ZJ3A 3H2BA 4D5EA 1B1AA 1OLUA 2H4ZA 3KPVA 4N5HX 5EE5B 2WJGA 3PI7A 3ZHCA 5U9CA 4KWEA 1YBFA 4LXGA 3B78A 2RC6A 3HVKA 2YMLA 3FPHA 3EN0A 3AM1A 4RPJA 2ZRKA 3PQ5A 2I67A 2YYZA 3PTZA 2BWJA 4L4ZA 3KWLA 4JT9A 1W5BA 1JAIA 3DONA 3ZDYB 5JBNA 3U4QA 4KQFA 3VM6A 3EQ7A 2W6JD 4IR7A 1A9XA 2M1XA 2Q4TA 4W82A 1SUFA 1SUSA 5DM4A 2WU1A 3L0OA 5AVUA 2GLXA 4IHKA 1MX9A 3E58A 4YRKA 1O94A 2BE9A 4ED9A 3ICCA 5A3QA 4O29A 2Y99A 1UMCB 4L4UA 3V7YA 4DXDA 3Q8MA 4MH0R 4AF6A 1H2YA 1Y63A 2QMOA 3EVAA 2P78A 4IHJB 1M76A 3ZIUA 1WU7A 2ZBEA 3LRPA 2WYWA 1UJ2A 4YAUA 5HYVA 3GOQA 3A9UA 3UTDA 1UBOS 2QRVB 2A9QA 1A2KC 4MARA 3PD1A 2ZIXB 3QMPA 3MINB 1DAPA 1KORA 3KYCA 4J1NA 4BY9E 2O8VA 4PVCA 1J20A 1WQ3A 1QQ5A 2NW6A 4BP8A 2WYUA 4AYTA 3GJ8A 3SBXA 5MFPA 1M1YB 3D5EA 1D7OA 1SIOA 1IZ7A 2AHRA 1ZAKA 1QB7A 3GW8A 3HJUA 5JYDA 2QP4A 3ZLTA 4A16A 1IOLA 1YUNA 1NVXQ 4F5WA 4HGOA 1DTEA 4KE9A 3KKEA 3K6SB 1CIVA 4E2ZA 3ER8A 2ABWA 1CVIA 2HLHA 1ODSA 1D6JA 1GCUA 1ZUD1 3BCHA 3BXZA 1GL9B 2R96A 3FR7A 3MUEA 4ASUD 2XMZA 4HCJA 1FUKA 2XF2A 3Q7QA 3L8DA 1A95A 4OFXA 4I36A 1IY2A 5JASA 1U8CB 1K5GA 3LFTA 3I5MA 1SIWA 3FAZA 1NU8A 3K2BA 3EX7C 3F97A 4XDYA 4X7BA 1MC4A 1W1IA 5GADl 4Z4FA 2EW8A 2ZBQA 2HY7A 4B82A 2V55B 2XJ9A 3KLNA 1F2TB 1NPTO 3KXKA 2BHTA 1QX4A 2M1ZA 2FSHA 1EZ4A 3DL7A 1EXDA 3EIUA 2BFAA 4DBZA 3K6JA 3OKCA 5CH3A 5AHRA 1DXHA 4WY8A 5EJ6A 3PFFA 1CUBA 3EFOB 5KPDA 3KQKA 4OAQA 4B0PA 4BLUA 1M72A 1MNQA 4MROA 1H9BA 3CMMA 4IDDA 3VZRA 1KEEA 1R6XA 4J8PA 2CHEA 4UFNA 5BSWA 4D44A 2QN8A 3AY3A 1NZFA 3KQSA 1BWSA 1ICIA 1NLYA 1XU9A 1CQJB 3OLVA 1U2GC 4YYZA 3H1BA 2B8WA 3ETEA 4A1FA 3IQIX 1XF9A 4FDUA 2I62A 3AKYA 2HQSA 3DT6A 4W5TA 3U6BA 4RC9A 5AK6A 1GZ7A 4GSLA 5G0VA 5TS3A 5LUAA 3WOHA 4Z9YA 4N39A 4J4BA 1E1KA 1TRKA 1Z4KA 2P3LA 4BNZA 3UJDA 5LOVF 5KYUA 3P9NA 1ODFA 2HSGA 3V8VA 4BZXA 1SA0A 4CLOA 4DSUA 5IZ4A 1CVRA 2FZVA 1A96A 1J21A 3CXUA 1W48A 4V3CA 2DWQA 2J1LA 2PGIA 3BL6A 3EFHA 3ZJ4A 3ISTA 3GMSA 3IP1A 4K9MA 3RGGA 3G1UA 4MKFA 3HXMA 1I3LA 2G0TA 2V03A 2GFHA 3HDVA 4G63A 4G0QA 3T7TA 4X00A 4TQGA 3EEQA 4K3VA 1LJLA 1MDBA 5J2UA 3GPCA 3HWX1 1O95A 2RDMA 4RJJA 5EXXA 4O1MA 3UMRA 3SQDA 4CF6A 3RS5A 3QKRA 1MOSA 5BQ5A 4EJSC 4JEUA 3QU2A 5JU6A 5ICGA 3ZNQA 3OTHA 3WDLA 1LWOA 3HVRA 1ZXLA 1T3GA 2AQHA 2IIPA 5FUQA 3B7WA 5JWOA 2RH4A 5BR4A 1XCJA 5AVOA 2R6FA 4LECA 1U5BB 1P7PA 2O07A 4OHVA 5EHGA 1ZJYA 4P31A 1IY1A 3ECCA 3QLUC 4PLZA 4LDAA 4W1RA 1RU3A 3K0EA 4R16A 4AWBA 2HGSA 2PRYA 2WAOA 4HEHA 2PQ2A 1RM3A 2J7PD 3TZBA 1F9AA 1G18A 5AW6A 1EPUA 4N8SA 1WKCA 3BZBA 1E6UA 1CZNA 2V4MA 2ZSIA 1YDEA 1CZKA 4FDMA 3WIOA 2Y1DA 4COOA 2VYCA 1V9CA 1KAHA 5KBYA 2OHIA 3CUKA 4LGYA 1J8DA 2IYYA 3U7RA 5LDHA 2H4YA 1HKUA 4YALA 4MKRA 2QTCA 3IXQA 1IYZA 3S3TA 3UCXA 1RM4A 4FFBA 3BWVA 2IUUA 2P30A 5FHQA 4X1IB 4S24A 5BP7A 5JZVA 1KQNA 3LLUA 3C0KA 4NQZA 2XEXA 5CTAA 4WZZA 4XFJA 1RKQA 4R8SA 2G06A 4AG3A 4R3WA 4KK3A 4PFJA 3NWJA 2Z83A 5BR8B 5ANRB 2AHOA 4NAVA 3PPIA 4PVDA 3A37A 2VAWA 3MTAA 2HCFA 1N9ZA 2RHOA 3FI0A 4DDMA 4ZI3A 1PZHA 3TAHA 4DIOA 3L41A 3MK31 2ROQA 1EFHA 3R3YA 3TLJA 1IY8A 1NF8A 3ROKA 4BNXA 4MUKA 2JAOA 3AEQA 2ORWA 4EVSA 1E2IA 3WL4A 3S70A 1KL7A 5B7GA 4ER3A 1JWBB 4JVLA 4DUGD 4ZHQF 5AM2A 2F1IA 4O1IA 2VQFB 3ITDA 3P26A 5F5XA 4X97A 2BBTA 3MTIA 2QTTA 2C95A 1Q7RA 3GT7A 4HDMB 4GKKB 4C4PA 3FSJX 4GMFA 2P67A 1UMKA 1VL8A 2QGNA 2R6GA 3P9XA 2R7LA 5DNWA 1BGXT 1ARZA 4QFMA 4YO8A 4ZV9A 3CRZA 1V96A 3AVWA 1TE2A 2Q4BA 4B32A 1E3JA 3AZQA 1XRLA 3COVA 4JVSB 1CK4A 3A14A 4PFKA 3LAWA 2ZKLA 1KZ4A 1AU9A 4L50A 3AJ9A 3BK7A 1KVRA 4NNPA 1J39A 3PUJA 1JBEA 2ID8A 2XUIA 2HJHA 1K5PA 3PE6A 1TEZA 3VJRA 3IEKA 4WN3A 3VO1A 4DLYA 4UTVA 1C3JA 1KU0A 1L3CA 1LI5A 4KOAA 4IX1A 3K53A 3O95A 3RRZA 4F6RA 1HZZC 1TVCA 3QYJA 4EHNA 3DPSA 2QY6A 4U00A 2QRJA 4D9EA 4S2UA 2I66A 3ZJ5A 2XQGA 5FRDA 1EUCB 5JYCA 2OD9A 1VMDA 1YCHA 1RWVA 4BMZA 3OZSA 1M67A 4ARSA 5CCBA 4PPNA 3A4MA 4GMDA 4PLCA 2IX9A 2JK0A 4II7A 1YS6A 4Q39A 5HSGA 1ZR4A 3EQ2A 4G4IA 5AKKA 1OFUA 2BCJQ 2XKJE 3MMNA 1Y33E 3D2BA 2OOSA 2WJZB 3CR8A 3MAJA 4QXRA 4DZTA 3WQSB 1AUVA 1QQBA 4HRYA 4Q4LA 4XJXA 4Z4QA 1A5BB 2DHCA 1QTQA 2HTFA 1D0IA 4PAMA 4QZVA 1QZUA 4RF5A 1EXMA 4MV3A 2IH2A 4NV1A 3R8FA 2XMCA 5L4LA 5HIMA 3A31A 5FL7D 4YN3A 3CG4A 5H70A 2ZCVA 4Z1MD 4R6XA 2Z56A 3P4UA 2VKTA 3VOSA 2DWPA 3IODA 5KNBD 5DSTA 5E0KB 2B6NA 2GPJA 5LQNA 3C2QA 1XLTC 3PIDA 1ZOIA 5JMPA 1H6AA 2D2XA 3ZGOA 5UKDA 5AVQA 4H3HB 3OBIA 1ISJA 1HT0A 2PXAA 3LYUA 1GZ6A 2JAUA 2OTCA 3DZCA 1U98A 2WUFA 3IVAA 4Q02A 4DWJA 4NBTA 4AF8A 1PZMA 2XBUA 2R7KA 1ZP6A 1KZHA 3EIFA 1TZJA 4JC5A 1KQPA 4K0RA 1T1JA 2XB6A 2DRIA 1RYHA 3CSSA 1C3OA 3VNUA 1MJGA 3VZSA 1EVKA 3PDWA 1L5WA 3NWBA 1WUKS 2DJ5A 4GZLA 2O19A 1JSCA 2WAXA 3K5WA 3ZZUA 4BC0A 1X77A 2PKQO 4NK5A 4IH1A 2NLOA 1N9GB 3UA3A 2ACKA 1VKNA 4GX0A 2G40A 2JNWA 3MMPA 4I9HA 1EIZA 2G5TA 1C9KA 2JJYA 1D1QA 3I0NA 4OQMA 5HMMA 5BUZA 3ICOA 1C41A 2XA2A 2Z1NA 4M1QA 4YLEA 5HQTA 2ZYRA 1NFFA 1L3IA 3TW6A 4LF4B 2JASA 3L82B 4OUDA 4PZZA 4DG9A 2OG1A 2JJ1A 3L4BA 4M37A 1KAOA 1JHOA 2LRHA 2NO5A 4G8BA 3MSCA 2A6PA 1DC5A 2FHPA 2YHIB 3L77A 5IFLA 3KSZO 1ENYA 2A84A 4K6FA 4OTZA 3RS9A 5HCNA 1THMA 1X1AA 1FB5A 2OAP1 3QOWA 2PH3A 2PUWA 1ZSNA 5IXYA 1L4NA 3AJEA 1USVA 5LPNA 3I73A 1EIWA 2BHNA 3T3DA 1DRVA 2NYUA 1TW3A 2W6ZA 2ZSBA 1W93A 1SAYA 3NORA 4YAJA 4M0UA 5ALRA 2GN6A 1BYUA 4OKIA 3TDKA 2MR6A 1MW9X 2XVYA 3VSCA 1R74A 4MKXA 3ZI0A 1KFKB 2CWWA 1G20A 4DZRA 1XDWA 2C8JA 2O8EB 1PJLA 1ND6A 1Q57A 1Q0ZA 1W0CA 4ZOEA 5KZMB 4LYGA 4QUIA 2JLSA 2VNJA 2Z30A 1LS1A 4QOIA 1GPJA 4UE3S 1N5LA 2CDNA 1BXZA 1FNMA 2PDAA 2YX1A 3AIKA 1BMFA 1Q16A 2PYIA 3PPXA 2CBZA 1KYVA 1YVUA 2HFJA 1Z2PX 2QUIA 3H1FA 1ISIA 4DSOA 3TBFA 1FFHA 4DCSA 3K4QA 3FUUA 2EP5A 1LPBB 4J0GA 5SZHB 3U4QB 1L4LA 2XQVA 1RQ2A 2A9RA 3CH6A 3DZHA 5A5GA 1X7WB 5A7FA 2HHHB 4MS1B 3A36A 1V16A 1RWNA 2HJVA 4OB7A 3EQ6A 5TQ2B 4BAZA 4PGHA 1JNYA 5E0OA 4D3YA 2WVAA 3EGOA 2OB2A 2NVUA 4G1CA 2BUBA 4B3SB 4QJ4A 4WH0A 5CFPA 5FYQA 1HFWA 3R4VA 4G2TA 3UWKA 4KH0A 1XPOA 2D5LA 3Q2KA 1YZYA 3D7KA 3DZKA 4BO5A 1P2DA 2CXXA 3QZUA 1BHQ1 1MVNA 4ER6A 5C1DA 4Q05A 5B30A 2FUKA 2XAAA 4HUJA 3BZUA 4CV2A 5EUMA 5AYVA 3W8NA 3NVKI 4ZXPA 1T91A 4P7GA 3DOUA 3U31A 4ZREA 5EXSA 1KO4A 4RNCA 1IVSA 3PX3A 5CDFE 1XD2A 3D1VA 5AVKA 4LI3X 1TA0A 1C7JA 1AZTA 1WDTA 2JI4A 3JV7A 4PGFA 5JCOA 4NXMB 1H69A 1AF4A 3FOZA 1HDGO 3MWYW 1GPWB 1J24A 1T2EA 4QNRA 1CDOA 2B8EA 2CF5A 2ZRNA 4EPWA 3BK2A 2YNMA 3LUFA 3OT1A 2NVBA 1OV6A 1QDLB 3VDRA 3N9IA 4Q4DA 5BWLA 4P08A 4KLRA 5B37A 1KFCB 1I7PA 2PX6A 5CPBA 3H1EA 4OXQA 1FS5A 2OP1A 4JJZA 1MB9A 5KQRA 5DTMA 1NFQA 3GJYA 3R3HA 2IYNA 2IXBA 4EGCB 2AUMA 2OC4A 2JAQA 3ORHA 3C7KA 5I7SA 1IZ9A 4NEGA 3DBLB 4HRXA 1JGTA 4Z9AA 1ZQ1A 4R1NA 2EFEB 5B1DA 4AJOA 1E7QA 1KU6A 3OJ0A 1QYCA 3UOWA 2RK6A 3C45A 2AF3C 4DB4A 1WCWA 4XXHA 5E8RA 4EG8A 1VP3A 2BBSA 2ZB7A 3E1SA 4YRQA 1WETA 1I4TD 2VPWA 2H51A 3DAHA 1W4ZA 2FPSA 3IVGA 4RESA 3V1KA 2PKYX 5EKDA 2AX4A 3C4QA 5LP6A 2I3AA 2O7QA 3FCAA 3H0KA 3B6IA 3QFHA 2Y4NA 1OX6A 2PAFA 3B3JA 4A6XA 1BVYF 2OBNA 3EXIA 2Y1GA 2YVQA 2W9XA 3KWFA 1EFCA 1M8FA 3ZDDA 4CHGA 1SOAA 1PS0A 2CHVA 2WM3A 1X8KA 4L76A 1Z08A 2VL7A 2IOFK 1S7CA 2WZDA 4HO1X 2PKWA 3KUXA 4Y1GA 4XX0A 1KSGA 4D3FA 1BWPA 2EEPA 2BZGA 4LJ7A 3V42A 4ZZIA 2V4ZA 3T4EA 4NLLA 1Q7EA 3QWHA 3UBMA 4JXXA 3DFUA 1YDFA 4IDFA 4KFSA 2A58A 1IQRA 1CYDA 1DKUA 2JFUA 1MVLA 4LWZA 4AJ1A 5KJ6A 1XMPA 4RW0A 3AJ8A 3FVRA 3A2MA 4OX9B 1U7HA 3CVJA 3NKFA 3ZLVA 3KLMX 3ZY6A 2GYWA 5FL3A 3K4HA 1CNMA 1EM8B 1OXUA 2FXIA 1XJ0A 2PNFA 2C4WA 3CKKA 2NSDA 3CCBA 3OJCA 4YPVA 3ZTWA 1CDZA 4HFMA 1G4AE 1BTOA 3B48A 1L4BA 2EXXA 3K0CA 1IY0A 2BGKA 4MQEB 4BE4A 4DMKA 2NV2B 2XOKD 2QDXA 4EUEA 3LVQE 2Q9UA 3RYIB 2CMDA 4Y6GB 1TAHA 1TK9A 2RHTA 2VHJA 1YJCA 1FMFA 1DCFA 1KR5A 2FSIA 4ZAWA 2A67A 1CIJA 1IDN1 3INRA 1QIDA 4LYYA 4MLPA 4Y2QA 4HYQA 1SMKA 1ZG3A 3HDQA 4G26A 2OA0A 2E1RA 1P8AA 3RS3A 2JLUA 1SXPA 3BXXA 1ZVQA 3GZTB 5LN1A 1J0AA 2AFIA 3AEUB 3G8CA 3E82A 1CR4A 3ET4A 4BZZA 3G7NA 1N5RA 2FMUA 4JLNA 4Y0NA 7REQB 5H3HA 1HR0B 2YXLA 2PZKA 3DT8A 1SD2A 3SYLA 3HGMA 3CE6A 3WGKA 4YUYA 4TYNA 1AV6A 1HTTA 2QLMA 2XGGA 3JQ9C 4R2LA 2K7FA 1LK5A 2OD7A 1NMYA 4TSFA 5AXAA 1GNSA 3KPJA 3UV7A 3TLBA 5JALA 2VJQA 1DQPA 4D6PA 3DO8A 1W85A 4MW7A 1IN1A 2F7SA 4FCCA 4G8JA 3JYOA 5G0SA 3VU9B 1IRIA 1Y98A 3OM0A 4HEA6 3UCFA 1Z6YA 1T6NA 4XGRA 1M1YE 3KAKA 2ZIWB 1O5TA 3JR7A 4M99A 4MV4A 3U5ZB 1HI9A 1R9GA 4G56A 3ZQ4A 4I1YA 2WPNA 4MYDA 5JI3E 5EXTA 2Q0QA 3E9NA 4HLNA 5JLAA 5I9NA 1TTPB 4RKWA 5AW8A 2HMUA 3N3AC 4LHXA 4NYJQ 4DSZA 5AUPB 2I3GA 3DTVD 4ZVPA 4K9DA 5FBVB 1ZK2A 1OKKD 4TUYF 2DQZA 4QOEA 3NV9A 4K8OA 2XMSA 2QMYA 1J07A 3IKTA 5CFMA 4LOKA 4WHMA 2DHDA 2G9QA 5KS2A 3HYTA 1PGPA 2HV9A 3VR2D 2OPBA 1KZ9A 2GD1O 3OKAA 5REQB 5A0VA 3VYSB 2WNSA 3OA0A 2BFDA 1T9HA 1R6BX 1W0KA 3BIJA 3U4IA 4GZ5A 4AP5A 1R4ZA 1EGQA 4M9ZA 3AEQB 4UAJA 1R9JA 5JSZA 2B3DA 2O3TA 4RAQA 3IV7A 5G1PA 1GUAA 3PICA 1K92A 4DWOA 2OB1A 3RS7A 4U2GA 1EINA 5IVHA 1QZXA 4WNAA 4N9QA 4R40A 5CB4F 3OQNA 4G5GA 5JAPA 4AKIA 1VLHA 1V7CA 1KPIA 2O3UA 1JWAB 3ZCTA 1E2EA 1Q2XA 3HR7A 3KR1A 3PZBA 1TGVA 4TRRA 5EQDA 4YR7A 2NWQA 3N7TA 3KYDA 5H80A 3O2SB 2H54A 3HFSA 3N5KA 3BD7A 1OBCA 4CKWB 5LR6A 1J5PA 3BILA 3LY9A 3I45A 4L5AA 4D82A 3R7DA 4BNWA 3QEBZ 3HXTA 1CBUA 3CH5A 3CVYA 1LDNA 4QQKA 1UUFA 4BFCA 1GTZA 1YBHA 1ZIXA 3U4GA 3GZNB 3RARA 4B44A 1STOA 2RFLA 4NFLA 1LQTA 4GP7A 3L8HA 2FW7A 4I5GA 3ZXSA 4UUNA 3VBEA 1SKBA 3H1PA 3HU2A 4TV9F 4X62B 2HDNB 3DMHA 1N2OA 1T1IA 2GBLA 3LIIA 5SY6A 1WE2A 3UWMA 5DCLA 3PWSA 1Q5PA 3PKZA 3C8UA 3W5CA 4EHJA 3U44A 4HFNA 5CLJA 1XL1A 4IDPA 3BQMB 3C8ZA 2HM7A 1EUQA 1KYXA 4HXFB 1UBUS 3KE9A 4JBWA 1G5IA 3NWEA 2HJWA 4KUEA 2QRPA 1B42A 3Q98A 1TM2A 1JDZA 1GO2A 3R24A 4PG5A 2ENWA 1BGWA 2BN4A 3HJHA 5IDVA 4HV4A 2BEUB 3IR7A 1E96A 1XDGA 3OTWA 3HB1A 2AFRA 4ZRMA 2XMQA 5ESXA 3PGLA 3SZRA 5IBQA 2XBMA 2B9VA 4Z86A 1JFVA 1B2RA 4HB3A 3CKMA 1H9CA 1LW6E 3QUCA 2Z98A 4MRMA 1XAJA 4AWAA 5F9FA 2QF7A 4K46A 2IT1A 1O96A 1GLGA 2VKQA 3OHSX 5DK4A 1WG8A 2WHYA 4L16A 1XVIA 2EV9A 1KEKA 4MA0A 3OSUA 5K4AA 2P40A 3GG2A 3SJBA 1ZXBA 1TVEA 4XTRA 4L8FA 3VRHA 3BWCA 4RK6A 3OPYB 4GYWA 3SM3A 4DG8A 3H5IA 2CMGA 3IJ5A 4A8TA 1LDEA 1XAGA 2P4QA 5DTQA 2ZSDA 4NJMB 4WOCA 1XMXA 3NAQA 3ED1A 4F4HA 2YRXA 2C3UA 2IZOA 4KBFA 3QUSA 1XVLA 3LHSA 1PZGA 1XP5A 2RONA 1NQAO 2P9JA 4FCVA 4D79A 1OH6A 3W9SA 1E2MA 3PSAA 2I1WA 1UDWA 3LC7O 1C30B 4OBEA 4JYPA 4N3GA 4JIGA 1JU9A 2XW6A 4J91A 4FUTA 5JS1A 3LPNA 1I51A 5E6UB 2H06A 2K6GA 4WXEA 4O4HF 1N0VC 5A05A 1E1DA 2QUKA 2PRIA 3HKBA 1KXJA 2VK4A 1X3LA 4L27A 4MR7A 1V8DA 2I99A 4IF6A 3FMPB 2H3HA 4ZEWA 5LNK6 1L1RA 1CSEE 1G8JA 3WJ2A 1DLJA 2VSFA 1OA0A 1ICEA 3PEFA 3Q11A 4QTZA 3NM4A 4QVGA 4WFJA 4YONB 2C0CA 2HRQA 4OJNA 3DE7X 3ZKWB 2R79A 1UODA 2FOXA 1P45A 1SUPA 3I05A 1I9CA 1GZ5A 4J7CA 3T9CA 5IJ0A 4JYCA 1EI9A 4HQFA 4PSDA 1J06A 4LMPA 3T1TA 3HM9A 5ALZA 4DKXA 2V0GA 3KZKA 1NLUA 1XPJA 2YOHA 3Q3VA 5KQSA 3IEVA 2ZU6A 1E62A 1VSUA 2WY2D 1QQAA 2W2MA 5EC8A 2DJIA 1YAHA 1MB3A 3PXAA 4WXMA 1RTKA 2IPNA 2ZIAA 1QHNA 1Y1LA 4TRMA 2GI4A 3PQDA 5H4GA 1I6KA 1FRVA 4X71A 1QV6A 5AW4A 4EY4A 3EQ8A 4DCVA 2DWUA 4O2BA 1UP7A 3UZUA 4BNUA 3SEFA 2HMSA 4RIFA 1Y9DA 4PTZA 5AVWA 4II2A 4W6ZA 2C1EA 3KTDA 2L69A 5EKXA 5DYGA 1UBSB 5HRUA 3GDWA 1N3BA 4DV3B 3BWYA 4PRZA 4EO7A 1H1LA 4BNIA 2IHJA 2W2KB 4Y6QA 4Y2YA 1F12A 1H2FA 3WISA 3FCEA 3LQKA 3E7WA 1VHDA 3GQVA 3W0LB 4DR3B 3ID6C 1XMOB 4Q7MB 2WILA 2CDCA 2IF0A 1BKSB 4P92A 2FMKA 4X1KB 3GLVA 1ZDMA 1MQ9A 3PU6A 5DB4A 1PYGA 2BR3A 2HRRA 5TGZA 1MNAA 1OHHA 1WZ2A 5JAZA 4DSNA 2A5DA 1Z4QA 3OSZA 2VCHA 2G9RA 4KO4S 4HRVA 3KKOA 4YHHB 3ZZTA 4FSHA 4XH9B 3IMCA 3BXHA 1P60A 2F8MA 2EFHB 4IDCA 3X44A 1FP1D 2AJDA 1D1TA 2G8LA 4AKGA 3UAOA 2H7YA 4PNEA 3MN1A 4MI6A 2VWGA 1VG1A 3FCXA 3HADA 5G0TA 3GNQA 4KIGA 4BC1A 3MB8A 3MHPA 3EPHA 1IN5A 2R84A 1GTL1 3FR8A 5KSWB 3GLQA 1JYSA 1E2FA 4EKEA 3ZE7A 1M1XB 3D7SA 3IXLA 4MVJA 2YVAA 3SICE 3PDCA 5FBWB 5JI2E 5KX5A 5BNIA 2W2OA 1XZCA 3V9AA 5A4KA 2JG3A 2NTVA 4MUHA 3ENKA 1IQPA 1MO6A 2ODNA 2ZIEA 3MYYA 4N54A 3U7GA 3BKWA 1Z5UA 3ZWMA 2YYSA 4FDTA 3INYA 4NVRA 3FGPA 1SUEA 4BO3A 3OWHA 2I4OA 3JZMA 4LSWA 1DC7A 1RJ9B 3SSOA 4D2IA 2B2XA 2X8AA 2WQZA 1O89A 1W4AA 3NWPA 5IVDA 4X45A 3DAYA 5CG1A 3UJ8A 1GZVA 3GBSA 4P4SA 1B0AA 4M6WA 5CXXA 1CERA 4D97A 5JJLA 3CTMA 4YRSA 5A3JA 4GGPA 2IHBA 4P7BA 2QBYA 1HT3A 1X1RA 4NX2A 4N5NA 4BBPA 1JILA 2PPLA 1ZD3A 1E9FA 2YRWA 4HDKB 4HKTA 4KXMA 1Y48E 3H5RA 1CUYA 3KKQA 3ZTTA 5B64A 2PS0A 4YJKA 2O2DA 4DLUA 1ORVA 3G2NA 4QJBA 4B5KA 2R60A 1LZLA 2QL5A 1ST3A 4PSVA 1TKAA 1RFLA 3LQ1A 2Y27A 4NK4A 1C14A 2WSSD 4GC5A 1VBFA 2UZ0A 4IH4A 1QKJA 1AQJA 2O1SA 2ODWA 3W5SA 4N5DA 3PKJA 5EP4A 2DHRA 3WG9A 2H11A 5M7EA 5FPSA 1LUAA 4YMVA 1ODIA 3X1JA 2ODBA 2FZLA 4QREA 3FHLA 4PQGA 5BOVA 3DKKA 4L3OA 1FTQA 2QL6A 1Z4OA 3UHAA 1FEZA 3E5MA 3E18A 4QYIA 3ZV3A 1MX3A 4DC0A 5U1PA 4W5RA 4O2AA 4PLHA 2Z9BA 5KNDA 2ZT5A 5GWXA 1DUIA 1HDYA 1V9SA 4YNBA 4ENRA 1CY2A 4MWDA 5DE3A 4C88A 1D4FA 2HWYA 3BXFA 1Q92A 3I3SR 1J1IA 2OFFA 3E7XA 4AJEA 1I1OA 4HRAA 3PPWA 1U3FA 4D0SA 5DNEA 4GVPA 4J4TA 4BASA 3OY2A 3WBFA 1U8FO 3CISA 1VPDA 4XKJA 3CM0A 3HDGA 3SIWA 1LC0A 5JXHA 1J0CA 3AGQA 3E7FA 4MQBA 2DPHA 4F72A 3NBYC 3R9WA 2RAPA 4Z5XA 3GI1A 4Q12A 3WHLA 2VS1A 4OI4A 4BWVA 1MC8A 3VKHA 3L93A 4PC6A 2XD9A 1D07A 3FOEC 4TKUB 1GIAA 1O77A 2NPOA 3GA0A 1ZMXA 4B3CA 2IYFA 4GFDA 5EQTA 2F55A 5CA0F 3VTZA 2QE6A 3PVCA 1CUIA 2W11A 2VLIA 2WUDA 3EB9A 1G8HA 5EXDA 4AX4A 3RVJA 4NXNB 1KAEA 5T3YA 1E7YA 2CE7A 1MN6A 1YASA 3TQFA 2D6FA 3DXYA 4U6SA 2FG6C 4F12A 1NNEA 5K09A 2XQJA 2ONZA 3NAGA 2W6OA 4YPOA 2H4WA 2OBMA 1QX3A 2G77B 3B3FA 2QYSA 3GD7A 4FGLA 2YJGA 5FV7A 4BFXA 2QW1A 4FE3A 2J09A 1LSSA 3OX1A 3GN1A 4D0NA 1ZIOA 3FDJA 2IS6A 4KR7A 3JQEA 2OILA 1LD3A 1H4VB 2N47A 2NQ8A 3PFGA 4RXTA 4F3YA 5B2FA 1AQ6A 5E4FA 4ZK2A 3PVZA 1X1CA 1SOWA 1CTQA 2C9BA 3KKKA 3R5FA 4UZEA 5HKLA 3RE1A 1P80A 5FNVF 3BSWA 3UAVA 2XRFA 1Z56C 3QF7A 4Q4AA 4IOLA 3H1GA 4BTEA 4N82A 4ZHSA 2CD7A 4FC7A 5KKAA 4PR0A 1USIA 3AI2A 4OB8A 3F8TA 3W1VA 4A8JB 2OKCA 1I7SB 1Z38A 1YS9A 4ALMA 1NUTA 4E03A 1V1RB 3OO0A 3LO5A 4IEIA 4DV2B 3FTEA 2F1JA 1RWXA 5ER9A 1U2QA 5L3RA 1RWKA 3STUA 1QVVA 3Q5DA 3M7IA 3PP8A 4AUNA 2P9QA 3KYJB 3D54D 4ZO9A 3H1TA 5BUSA 1NXWA 3L1HA 1TZMA 4WSOA 4E1VA 2DUNA 4NBLA 5CCXA 2IPXA 2C59A 5F3DA 3UV6A 4FSXA 4CKYA 4CLDA 5I4CA 1DEOA 1FSZA 1GRCA 1Z15A 3WADA 4WOJA 1RBYA 1G16A 2ZUCA 2NXJA 1D2RA 1DBPA 4UBIA 2PGJA 5JWRA 1MJ5A 1XDZA 2IBMA 3IHLA 3EF0A 1KQGA 4OO3A 5I7HA 4JB8A 2Q5EA 2REXB 2WIAA 3M8KA 3MW8A 4LHWA 4RCYA 4JBHA 1U8AA 3ZDZB 1ZIYA 4BMXA 1A9RA 1LF5A 1FSPA 4YRMA 4ZYWA 4R8KA 2XKBA 3M1IA 4Y2SA 2VHYA 1CUAA 3B9BA 4L5BA 5LMZA 2GEVA 2I87A 5EE3A 1K8YB 5I7WA 1KYIA 5CH8A 3HP1A 4H1UA 4F4DA 2Z2KA 4YRCA 4BNVA 1FNDA 2HBRA 3MJRA 4TVSA 4KE7A 4ZTZB 5KNCH 1JU4A 2ZFUA 4QSMA 1CNFA 5KMGB 3OICA 4ZO7A 1M1ZA 1Z7GA 2FWPA 3O2JA 2FR1A 3AIMA 2RG1A 4V3BA 1HV8A 3BB1A 2GILA 4IIJA 1K4MA 3KDSE 3RYFA 3VR4A 1SQ5A 4LJ5A 1IEXA 2FFJA 3KL2A 3NDPA 2P75A 4B3GA 4COKA 3MJFA 3OEEA 1OXVA 3MWLA 1OVGA 2EBUA 1V4BA 1XMSA 3R0QA 2Q9BA 3P8ZA 2A1TS 3RASA 3WRXC 4CT5A 4IKOA 3PGVA 1TRHA 2FLWA 1O03A 2M9MA 4Q3OA 4R1TA 4BBZA 2JFFA 3C87A 1KOGA 1GT91 4R6WA 3RTBA 1BZYA 4NS1A 1PSDA 3R41A 1F20A 3NAZA 1ILEA 1PR4A 3H4IA 1FPQA 2JA1A 3FJYA 4FYHA 4V0NA 4ERXA 4RD1A 4F2WA 1G2QA 3M4JA 1C3LA 4OPMA 1OYOA 4MRAA 4KN9S 1A7AA 5LBIA 1WWKA 2FRDA 3G1WA 5LWQA 1G7RA 1M8KA 1U6KA 4AJ2A 5EFOA 5ADVA 1RI3A 2O2XA 4QOGA 1R6VA 2EX4A 3DYBA 2DQYA 2W7TA 4F21A 4F5DA 3WL7A 4DLSA 3HABA 4KAJA 4ZO8A 1DOHA 3HXPA 4GZ3A 3ZQJA 2PX0A 1JHQA 3P9KA 1QH1A 5EZYF 3W6ZA 2XA1A 3ZDXB 3HACA 1LFAA 1YS2X 3ITNA 2QM7A 3HXQA 1FX0A 2P62A 2VPTA 2YWDA 3NG1A 3LQFA 4C3VA 1VL6A 3A2LA 2VJLA 1N6OA 4URZR 4DG5A 2TMDA 5HJEA 3QI7A 4IUCS 4EF5A 5G3ZA 1FTNA 3QE2A 5C3UA 5CA1F 2IE8A 3I39X 5SY9A 5KKNB 3JPWA 1B76A 3HKBB 4EHHA 5A1JA 3A0RB 5DK6A 4ZAYA 5KNDH 2X19A 3UJNA 1OH5A 1JXAA 2XXAB 1W36C 4IBOA 2F3UA 3R23A 1UJCA 2PX5A 4ZYZA 1Z16A 2B21A 2IYEA 1WUHS 2RH8A 2OO7A 2OFWA 2YXDA 2ZRHA 3G2IA 3UEOA 3VOAA 3NTRA 2AZDA 4LKRA 3Q6NA 3VHXB 1ULUA 4NSNA 2YDYA 3OOSA 4F38A 2VHQA 5AKZA 1YQUA 1M7BA 4EFMA 3NGXA 2O5CA 4FOTA 1KMHA 4Y9UA 1RVDA 2V7WA 4EF4A 4Z2AA 1VSVA 3RCBA 1JYFA 2G36A 2PBRA 1X38A 3K20A 4J1QA 3JX9A 4QDJA 4Q9LA 5EHQA 3HC7A 3HCPA 2H9YA 3KZMA 3RGWS 4UFPA 3GLIB 3V1UA 1DJMA 5HG0A 3OZCA 1SBTA 1BE6A 3MZ0A 2QNBA 1RR6A 1L5SA 2IOHA 4YP5A 4P7FA 5EJ7A 2Z08A 4O2BB 4O4IB 3RSZA 5FTKA 5BN5B 1O95D 1RWPA 1XCOA 4BKQA 2OUKA 1M2EA 1L7RA 1AKEA 4KV9A 1JEJA 3TQOA 5AM3A 5CBPA 2XF8A 3EW7A 2FYTA 1X80A 3L1UA 2I34A 4AZVA 3FHTA 1H1LB 4EGAA 5L3ZA 4MUIA 2QVZX 3P9ZA 1TKCA 2HU5A 2ANCA 4ZI2A 3WMEA 4CFYA 5COQA 3NBXX 2GD0A 2HK7A 2AWNA 3LOUA 4GMGA 4Z6KA 2PE5A 1NP3A 4X41A 1RP7A 1RQ7A 3PZRA 4I50B 1H66A 3MUFA 1D09A 4BVBA 2V96A 2GQ0A 4Q1FA 4H6PA 1TO6A 5FWXB 1QUFA 3FCSB 3GZJA 3ZDCA 1L4KA 3ZE6A 3J80A 3PV0A 4ARAA 3MGCA 2PT5A 1DPGA 1PT8A 3R4CA 4UM5A 4B34A 1O6BA 3ZWYA 2IY7A 2OQ2A 2J0VA 4Y1RA 2Z3ZA 4ZDIA 4KITB 3JQFA 3JZIA 5F1YA 3TEMA 3VKVA 1WEHA 2KX7A 1N2HA 3KBOA 1T2CA 3WS7A 3OFJA 1JG7A 1MRNA 2YOGA 5HNKA 3TRKA 4IIHA 4M76B 3GNSA 1P61B 4N9WA 3TCNA 4K0KB 3O4RA 4X64B 1OWOA 1V0JA 1JDVA 1YR6A 4A2QA 1ISRA 2IITA 5DW3A 1KI6B 4Q7EA 2OBBA 2IEDA 3H5VA 1I7NA 1WXGA 2IEZA 3L7DA 3RHTA 3AJRA 1SO8A 1OC4A 3GUUA 4E2YA 4TXLA 2ZI5A 3ZXUB 2EZ8A 1ZINA 4H6VA 3S0JA 2P9HA 4BFWA 1HG1A 3G2QA 1EK1A 1PS8A 4KXQA 4MUXA 3KKLA 1V8ZA 1P31A 1JG4A 3P32A 4OQNA 4HNSA 4TM7A 2OXCA 2B6HA 3L6BA 2QN2A 2J5QA 4J4HA 4Q93A 4XLZA 2CMKA 3KEQA 4R8VA 1XYVA 5D3MA 3U3ZA 2I7CA 2GXUA 3N7UA 2Y0EA 3FPKA 1V25A 2C5SA 1UK7A 4B35A 2QUZA 3O8NA 5CM2Z 1FOEB 3TBHA 3CKYA 5K99A 2BPOA 3FTFA 2V7QA 4Y2HA 3D59A 1EX1A 4HT3B 3RFTA 3CE9A 4M6WB 3IMFA 4ZICA 2PRSA 521PA 4RETA 4ZI7F 1J42A 5TB5A 2BGNA 4BB6A 1YK0A 1TLTA 3FWKA 1I4LD 4RKYA 3I9FA 2QBYB 2JFPA 6YASA 3RT1A 1TM3E 1WNTA 1E8DA 4GNRA 4S1VA 1L7AA 1Q50A 1U8TA 3D6TB 2ADMA 3IVCA 4GPIB 1P5ZB 4L85A 4U7FA 4NBUA 5LB4A 3RI3A 3E23A 1JJIA 8LDHA 1TOAA 5CM9C 4OJYA 3S2ZA 1EGMB 2YBDA 2Z2YA 3C14C 5AVXA 2WTXA 4JMPA 1Q3KA 3EZ6A 4IFIA 2F90A 2R5NA 4BPBA 3K9WA 2OM6A 2NP6A 3UMJA 4GDFA 3RSGA 2R65A 4K9OA 4UC0A 3IVMA 1KKUA 3E5NA 1GCIA 2GSWA 1X7XB 4MB6A 4NHEA 4LMAA 2HJ9A 6LDHA 3RD5A 1SUCA 3NHYA 1X42A 4WA7A 1CX9B 4M0PA 4LJKA 3VR4H 1RLMA 4IXWA 3G8YA 4HDNB 4EBBA 5CFNA 3OTOB 1URPA 2GK4A 1XAIA 1HTBA 2JHCA 1DQSA 4XFKA 2NSLA 2RJNA 3IEIA 1E3QA 1Z28A 5BQ3A 4P82A 5E3JA 4D9MA 1X8JA 4G23A 4RDHA 5DBGA 1E1QA 4XYEA 3SDBA 1IM5A 2NN3C 4G89A 3K8QA 4ZIRA 1Z75A 5TNXA 1KJYA 4LZWA 2QZZA 5FV4A 5KB3A 5K6RA 3DVRX 5CNIA 5HQ3A 4O8ZA 4ENQA 2XJ4A 4B2IA 3H11B 3CT6A 1P1JA 1EGAA 3R5SA 2EFGA 5F7JA 3UGJA 1YJAA 2XQKA 3OMXA 1U3VA 4H0FA 1DX6A 2NGRA 1LJUA 2FGKA 2H6EA 2WUGA 4N0MA 5ENDA 1R5OA 3CLHA 4UDXX 1MH1A 2OAGA 2IHTA 2X3FA 5DBFA 5K20A 4F3NA 4AL4A 1QQTA 2L0XA 1H2BA 2IOFA 3LX8A 2JFOA 3PNPA 2C54A 1M2JA 2Y4OA 3PNKA 1P19A 3S8EA 1BFDA 2QVLA 2W0SA 4J90A 2WJYA 2ZGVA 4FWIB 1AQIA 1F2VA 5DOZA 4CM5A 3Q40A 2W2QA 1T9ZA 4YP1A 3WSTA 2JB9A 2PV7A 1M8GA 4G4GA 4IMRA 1DXQA 2B83A 3OCZA 4GSKA 3UJ9A 2JGFA 2OFXA 1MO2A 4QTYA 2QRUA 3QVWA 1AMOA 1P6QA 2QD5A 4PR3A 4PC3A 2R25B 4WZBB 3G59A 3UWDA 4O25A 4LF7B 5E1OA 4P1ZA 4JKOA 1H2HA 1LSUA 4BWFB 5ITZA 5DBIA 3UG7A 4HATA 1L1QA 4C89A 4PCAA 4RK4A 4D8UA 1XVVA 4LCBA 2IZ6A 1F4LA 3M6LA 2EZUA 1SU7A 3P9SA 3PUVA 5KJEA 1IVNA 4ER0A 2XR1A 5DM70 1L7MA 4WJKB 4J1TA 2ZYWX 1ZPDA 2JFYA 1DCTA 4WV3A 2C97A 3S5JA 1U4OA 4HFRA 1JQLB 3CR7A 4XA8A 4GPBA 3SZUA 5A0TA 3AXSA 3KSBC 4J0EA 4EENA 1MT0A 2AI3A 1KEVA 1ZHHA 2O1EA 1AKVA 4V02A 3DZDA 3OVMA 1XXLA 3QU9A 4DR2B 3AG6A 2OCLA 2CL6X 3PYMA 1CCWA 1U7UA 2BI8A 2D2IA 2NVWA 3EUWA 4RFLA 5AESA 1VGQA 1HYGA 4KZPA 4TLLB 4RM2A 2CNLA 2FN4A 2JRLA 2ZITA 1SHUX 3NASA 4QAQA 4ZCTA 1SD1A 3DDNA 3QMWA 4OYYA 1MOZA 2WQ6A 5D6NA 1BXKA 4G5XA 4N8DA 1ZRHA 1DFIA 1FP4B 1Q19A 5EMLA 5A03A 3H7IA 4XE5A 1P2FA 4IDQA 4Z8YA 2RHGB 5FBKA 1UFVA 5K3FB 4U3JA 3B5EA 1ZM7A 1NVTA 3LGSA 1QK5A 2FWBA 3NMUF 1FSFA 4RPCA 1YZQA 3S1LA 1KZYC 2R7MA 3FYCA 1XK6A 3PYLA 2D7JA 2PMKA 4IS2A 2AW5A 2X58A 4QYMA 5JZ9A 4M1EA 3E22B 1Y82A 4MYRA 2AJLI 2BFCA 5HS6A 1N2CA 4X7PA 4RPLA 3RTAA 2VJAA 3CPSA 1AZWA 5LOVA 1F3LA 2BFPA 2E5WA 2E3JA 1JQJC 1QO0A 1OQAA 4GE3A 5THXA 1OUMA 2WJ4A 1RQNA 1RCFA 1NMXA 2IYUA 2JAWA 4JR2A 2M6KA 2I3DA 1AKNA 2ZZMA 3VJMA 1JAHA 3AI1A 4Q47A 5CJJA 3DHWC 5CPFA 1FF9A 3ZZ1A 5K3CA 4V1CI 1JPJA 3IAM1 3KKPA 3KWJA 4KJZA 3C6ZA 3ZHTA 3IBCA 1SB9A 3M70A 4FKZA 5A5DA 4UEQA 4XYGA 4PQFA 1USGA 2J3HA 5KI6A 2WWRA 4RK0A 3RHFA 1TF2A 2PO5A 2JGJA 2W2PA 1TAUA 5IXSA 4G0UA 4PRLA 2O3JA 3NM5A 4UUMA 2ZZNA 2H1FA 1CEYA 2CVZA 3H8WA 3HB9A 5JEEA 2LP4Y 1ECGA 3EIOA 2CV1A 4X8HA 3JRXA 3P7MA 4HOYA 4K6GA 4FFNA 2FPPB 2O7SA 1BCRA 1HDXA 1P91A 3AWDA 4OHOA 4XIIA 2GZ3A 3NVAA 4ZQHA 3H4VA 3LL7A 4FVTA 2MHCA 2FEMA 2WD8A 3PFBA 4OBWA 5F73A 1Z12A 1PGNA 3EEIA 3RUPA 2AG1A 5FTNA 1J22A 4BMOB 4GPAA 3EPJA 3RRJA 4B7AA 1A04A 4F1KA 5EJEA 3L6OO 2BEWB 2B4KA 1AIPA 5DX1A 4L5IA 4FSDA 1UL1X 2D59A 3RJ9A 3BMOB 4RVFA 1LW7A 2W6IA 3VHQA 4CF3A 5HS4A 5JHGB 2UXBB 3HNRA 1WPGA 1R6AA 3QYPA 3OF5A 2GHQA 1V6SA 1T8UA 1I4WA 5JOQA 4PLFA 3AERB 2ZRPA 3HGQA 3PWZA 1PGJA 2DUUA 1JE1A 1AXGA 1DUSA 1RPAA 4ZVMA 5I4KA 5KYWA 1TVKB 1MABB 3ONWA 1IEQA 1IHXA 1ZVKA 2FSUA 4N3AA 5HF5A 3KU4A 4FILA 4I2NA 1DQZA 2NACA 3ZNPA 2P41A 1P2TA 2VSOA 3S7ZA 5L9AA 2GAIA 3RIMA 1ODCA 1ZVJA 2NTEA 3KR2A 1JR2A 2IFTA 2YY6A 3PGKA 3CLKA 1CJVC 3FTCA 4P58A 3LBAA 1LK7A 1ZUHA 2GN9A 2JAHA 1NJ2A 2J7KA 4BDSA 3NBMA 1IWBB 4CDGA 3ER6A 3P9CA 3NYRA 4RPKA 4V03A 3SF0A 3QX3A 4W5NA 3PHCA 2CNWA 3CF4G 3N2LA 4LUCA 2C7OA 1C8BA 1C0LA 4KREA 2ZSAA 3KZOA 1ZC4A 4OY3A 1NZDA 4B7CA 1K4YA 2W71A 3FI9A 4ZAXA 1DB3A 2K5UA 2YJZA 3CZCA 4CR7A 1JKMA 3HEMA 4NCIA 2DKOA 1UQRA 5JNTA 1JFFB 2HDWA 3WMXA 3ZW8A 5JD4A 5CD9A 5CD1A 3G2LA 5LQKA 4OHZA 3LX5A 2EL7A 3MA0A 2XDAA 2Q1SA 2O3RA 1NW6A 3R09A 4GPD1 1UBCA 2CJYA 4CMGA 3IIEA 3B6JA 2CHGA 4M54A 4PC1A 1IM2A 1GL3A 4PYOA 2QL7A 3GFGA 2GESA 4IXTA 3WL5A 4KC0A 3WRVA 3DDOA 4X61A 2C4UA 4FS3A 1MG0A 4MULA 4CKCA 5AW1A 1P1IA 1SXJD 3KS9A 4ZQEA 5JUWA 2IX3A 3PDHA 4PV7A 1VMIA 4XR9A 3MSXA 3PNLA 4TV8A 4FMPA 1T5DX 2WW8A 4DN6A 2ZBGA 5T4FA 2AC2A 3ACDA 2IEAA 2J3KA 3FMVA 4R84A 3FZYA 5EQJB 1W6RA 4K28A 5DTJA 3WNCA 1X80B 3IT1A 2P0YA 3I28A 5EIEA 2HCRA 3MJVA 3L9XA 3TX6A 3OUUA 5JSQA 1EFAA 2E2WA 3HSYA 2X1LA 4XCVA 3FCYA 1HPLA 2FPUA 2WJVA 4J0HA 4MI3A 4EG0A 4OYRA 3FPBA 2B94A 3IEPA 3OWOA 2QL9A 1CUUA 4QPCA 3HDHA 2ENUA 2DPYA 4WINA 3I58A 3V97A 4MVCA 4TSFD 2Q1XA 4JLJA 3CZAA 5L3QA 1CETA 1WSDA 4ARVA 3MJCA 2MSKA 2YWFA 4TLAA 1RC8A 2KE5A 3AF4A 3ECAA 4BLVA 5JROA 1NUAA 3I12A 3WNVA 3AEZA 1XCLA 2GN2A 3H42B 5TF4A 1PZEA 2B1RA 3NTOA 4EPRA 5K3AA 3IE2A 4CL3A 1GU0A 1OASA 2QWXA 2FPGA 4UHEA 4MI1A 2HSDA 4ZRDA 1XTQA 5KSZA 2L18A 4HEA1 4N18A 3WWYA 3VSAA 6ABPA 1PZFA 1YC5A 5IT0A 3SF8A 2XUZA 1GG2A 2Q9CA 3COWA 3LHKA 3LC1O 2IHVA 4MPJA 4EL0A 3MJSA 4KMOA 3QXHA 5FFMA 4YAGA 5K8JB 1IG3A 2W2XA 4MQ5A 3ZY5A 3BZWA 2H48A 3AGPA 3VU0A 4I1PA 3W1EA 2DZDA 3RDPA 3B1WA 4ARZB 1HMYA 1EFVB 2W5UA 3C1TA 2JGAA 3PHBE 4LWPA 2C9CA 1Q0TA 1TXGA 4R1LA 1V6AA 5EWJB 421PA 3H9CA 2Y3IA 2Y76A 1W0KD 2W93A 3SR4A 1ZYUA 4GPEA 3CN9A 3AILA 3CGGA 2PRZA 1JAZA 3T06B 2JH9A 4OGLA 1JAYA 3WL8A 3AYZB 3GRCA 1WB4A 3EXFB 4NULA 4IVQA 1DKMA 3ZKAA 1NV8A 1ECBA 3EMKA 4R1MA 4J3FA 2Y05A 2PZGA 1M10A 4D25A 1F0NA 1NJ6A 4A2WA 1Y9ZA 4Q3AA 3LPAA 4RIEA 3DT9A 1G64A 4EB6A 4X8MA 2AOXA 1WXEA 3RLIA 3NEYA 1B26A 4ER5A 1G0NA 1ZJJA 4GGMX 5BW8A 4N12A 1N8TA 5DKFA 3THWA 3IPLA 3CNNA 5K8VA 1I5RA 4BO6A 1SB8A 3FVWA 1ZQ9A 2HI0A 5B6JA 1NL3A 3Q3CA 1FE8A 2A0UA 1E1RA 2H2IA 2FY8A 1ULZA 1AB6A 5DHFA 2O23A 3N2YA 3DMNA 2IUSA 3I2FA 3RT7A 5ES3A 3C1AA 3GEPA 3JALB 4BNNA 4DEYA 1H4TA 3PSHA 4FGWA 3K8OE 3F1KA 4B7XA 2C3PA 2VF8A 3OCVA 4OD0A 4EY7A 3GN2A 2F9LA 4FR0A 1PW7A 2PUJA 3SEQA 1ZM9A 1UFKA 4MIOA 4PCVA 1KY3A 1VIMA 1TZ2A 5EIBD 1NBAA 3EYAA 3RFFA 1Q0QA 3U16A 1QXSA 2QSYA 1QWSA 5HKBA 5A3VA 4RMHA 2G7ZA 3C1OA 1Y7TA 4DIBA 4DLNA 4B4OA 2HCBA 4ZQGA 1PNTA 2RK3A 4BGDA 2D7CA 2LPMA 1YIDA 2IYAA 4JP2A 5EGSA 1M1UA 5EINA 1P2VA 1W87A 3HDYA 1IN7A 1IRXA 1YV9A 3L1IA 3L5KA 4PAQA 1L5KA 4MICA 5LLDA 4MWSA 5BOSB 3IE0A 4BX0A 5FUBA 5MN4A 5A4IS 3CZ9A 1R8QA 2HGZA 2PK3A 1TO2E 2WDPA 3QIVA 3Q2IA 3QMVA 2ZIZA 4MCHA 1FNCA 5EJ2A 4XQGA 3RC1A 4MW0A 2JZCA 4HTFA 1YZNA 1GQFA 2R6ZA 2HPHA 1KMQA 1WAMA 4K8RB 5JD5A 4DB2A 3KOZA 2ZW9A 1VPVA 4MUMA 1DV2A 2F62A 3AC0A 2YR0A 1PNQA 2KMLA 2KPOA 2R2AA 3ZV4A 2DULA 3V2GA 2ERYA 1EX9A 4ND5A 4F2GA 1U2GA 2IE0A 1OVMA 2ON6A 4AZSA 4F84A 4IMIB 4DYHA 5GZ1A 4ZKDA 2RCNA 3PNBA 1FBTA 1HOTA 2D0OB 2OBLA 2Q3MA 2O9JA 1SBQA 2ZVPX 3OQHA 3ADDA 4M1YA 2YV3A 4QU5A 5L7TA 2BHSA 3LMKA 1IHDA 3A6EA 4JXKA 1P0FA 3K0FB 4LJ4A 3B6MA 5LJIA 4DLBA 3TIXB 1Z2EA 4LJ8A 5HBGA 2ZS8A 3TW0A 4KR9A 1Q6ZA 4R7TA 3PRYA 4NBKA 2QLBA 5ITZB 4DCJA 1RXVA 2BGGA 2DM6A 3KQTA 2X0JA 3HZRA 2ZBRA 4JGBA 2FQWA 3K1AB 3ZCQA 5AIBA 1CQIA 4XUCA 3FTPA 5JAOA 2CNDA 1OSNA 3AU8A 3E3NA 5A4MS 4MVJE 4N47A 2QQFA 3IELA 1NJSA 2ZPAA 4QARA 1S3SA 4NDAA 2VP6A 2QAIA 2YFHA 4I4TA 2J6CA 1TM1E 3RADC 1KJIA 3R3XA 4FQ8A 1JIJA 1CUDA 1RLTA 4C0WA 1Y1RA 4K9KA 4MB0A 2EW2A 2ISQA 4EJSA 2I22A 3D43A 2VIIA 221PA 1MENA 3NZEA 3DW3X 3IP8A 3OECA 1FFAA 2XE4A 4JAVC 5CRIA 2E6KA 5LNK1 2BTQA 1P74A 4QUEA 2WF5A 1BIFA 1Y3IA 3TXYA 4CM8B 4Z51A 2JLWA 4DLLA 2AOTA 2BJHA 2H17A 2Z09A 2JJMA 3IALA 3QLUA 4EKDA 1XG5A 4URFA 3MWEB 1R4NB 1ONPA 4ZTUB 3BRWA 1F6WA 3QVMA 2CHQA 2KM1A 3F5DA 1G5TA 1Z07A 5IWCA 4IV8A 2P3SA 3UICA 3THSA 1VYVA 1WCYA 3NC0C 5ERGB 1Z5PA 4FBGA 3HI6A 3ND8A 2PLAA 5EJGA 4BOYA 1NHGA 4II3A 3D3JA 4G1FA 1SH7A 5K6AA 5U4QA 3LGXA 2C5AA 2QSUA 2OL4A 2V5AA 1OBHA 1WVMA 4PANA 3W5VA 3JZDA 5AVYA 5C53B 2VTBA 2G1JA 3LF2A 4IKPA 2NU9B 2Y77A 1PEAA 4G5HA 5ICEA 4GOXA 5EMHA 2IOQA 3T4UA 3CLTD 1IPEA 5FLXA 4R3UC 1Y1KE 3JPYA 4EUHA 1QR6A 4AY6A 1TM4E 3PK0A 2NSHA 2OHGA 4NICA 3N8IA 3G8DA 3OJWA 4UM9B 5IJ9B 3JAMA 1HEIA 2KS6A 5TVKA 3K9QO 1CRZA 2Q6VA 3RAPR 4S05A 1OHHD 1PI3A 1E8NA 4IJKA 5P8WA 3AR6A 3U40A 2GKGA 1Z4IA 3B89A 3LVBA 4HDCA 4DY6A 5JNWA 1I3NA 2EJVA 2QPTA 2ZDHA 4TMFA 1P8JA 1X39A 3RRXA 3HB0A 3OQJA 1C8LA 1BEEA 1QG6A 1SVOA 1U90A 2IYQA 3HJTA 4DBLC 2X0IA 1PYDA 1DAFA 2VPPA 3GWGA 3NYWA 3PVSA 3Q0EA 2PN1A 3IULA 4NMHA 1W8IA 2AMLA 2OV4A 2WMOB 1Y1TA 1N4AA 4CG0A 1CF4A 3HY6A 1ZOLA 3SX0A 1BDJA 3HS3A 2Z1DA 4FX2A 1C1XB 1F51E 2Q5OA 3ZLBA 3LU1A 1OFUX 2C3OA 1MQ8B