1KYVA

Lumazine synthase from s.pombe bound to riboflavin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
147
structure length
147
Chain Sequence
DLKGPELRILIVHARWNLQAIEPLVKGAVETMIEKHDVKLENIDIESVPGSWELPQGIRASIARNTYDAVIGIGVLIKGSTMHFEYISEAVVHGLMRVGLDSGVPVILGLLTVLNEEQALYRAGLNGGHNHGNDWGSAAVEMGLKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 6,7-Dimethyl-8-ribityllumazine Synthase
publication title The structural basis of riboflavin binding to Schizosaccharomyces pombe 6,7-dimethyl-8-ribityllumazine synthase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 51
structure length 147
sequence length 147
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 1kyvA00
1KZ1A 2JFBA 4KQ6A 1NQVA 2A57A 2B99A 1W19A 2A58A 3NQ41 1NQUA 1NQWA 2I0FA 1C41A 1DI0A 5IM4A 2C94A 1NQXA 2C9DA 1T13A 1HQKA 1RVV1 2VI5A 1XN1A 1KZ9A 5IM5A 2O6HA 2B98A 1KYVA 1KYXA 1ZISA 2A59A 1EJBA 4J07A 2F59A 1KZ4A 1C2YA 2C97A 1KYYA 2C92A 1W29A 2OBXA 1KZ6A 2C9BA 3MK31
chains in the Genus database with same CATH superfamily
4EGSA 3QI2A 4JOBA 2NO0A 2ZB4A 3DFMA 4OATA 1DQZA 3RT9A 4HJXA 5ICSA 1SU8A 4UE6A 3NFYA 4NDNE 1B3BA 2IYTA 3OICA 3RTCA 4EVRA 1M2HA 5BWLA 2KYRA 2D5IA 4HUQB 1QAOA 3HJCA 5EE5B 2PZEA 4Z7OB 3IJPA 5AOCA 1BTOA 2EIXA 5A0VA 1PNOA 2ONYA 4I2VA 4OAQA 4F8JA 1G8YA 1I3CA 1UZUA 1YXMA 4CU5A 3R7FA 4D9GA 5FLXA 3I12A 2C4KA 4NCJA 4B0OA 3IAXA 2O3SA 2A9PA 2Q0SA 4GI1A 4MUNA 4UNSA 3MYYA 4ALJA 5CBPB 3QEKA 3RANA 4BO6A 5AW9A 2OGZA 2HSEA 5DFAA 3C8HA 4U2EA 1DDOA 1T5SA 1ZCJA 1RU3A 3FI9A 3N53A 3LGSA 4YPOA 4NIMA 3JQ7B 4AYXA 1OC4A 1POWA 1TJ3A 5I8WA 3U7QA 2BMFA 3IPAA 5FUXA 1ZU5A 4FSDA 3AP3A 4BQIA 5DHPA 2WJ3A 1YOBA 1XT6A 4L4UA 2DSTA 4Y1GA 1JQDA 3AOEA 4I3HA 3T7KA 3ZGXA 3GVPA 1D0VA 1XKTA 4ESVA 2ZB7A 1O95C 3EIUA 1OX6A 2QYOA 2GUGA 2FSSA 2IF2A 2WT4A 3SHQA 3BFKA 2ZYHA 1KSHA 3V9AA 3FRIA 2XCRB 2X0NA 2GEJA 1FVHA 3L92A 1HURA 2X41A 4QM6A 3YASA 4XFJA 2PUVA 3M6LA 1SG6A 1YGYA 1ZU4A 2HGZA 1H2FA 3HYNA 1X6VA 1OWMA 3OHSX 5J1TB 4BMSA 3NO4A 5EJGA 5JCJD 5KYYB 1O97D 1CUXA 4KQGA 4MUGA 1BVHA 4IR7A 4PPGA 2HXSA 4QUBA 1RRPA 4Y2HA 5CCDA 5A7FA 4U0KA 5HRAA 1CXZA 3L6UA 3EC2A 4AP6A 4JKOA 3K1AA 4WKCA 1RTKA 4AICA 1AY0A 4F2PA 2EYQA 3JQGB 1X7DA 3NONA 1SVKA 2QX9A 4KQMA 3KJFA 3GT3A 3H2ZA 4QWMA 2ZT8A 3N6VA 1I3MA 3K6SA 4FCTA 4WW0A 2FFJA 2HQ1A 5HPYB 5IJAA 5E4YA 1Q1BA 1XZIA 2HMSA 1P8AA 2YRXA 3IIJA 4E46A 3ZCQA 3ZE9A 3RIXA 2VSOA 1TZ2A 3U09A 2Z2JA 3BGDA 3UYLA 2XGMA 1XN4A 2ISSD 5DNVA 1ZIXA 3LLCA 3OZ7A 1PJLA 2FPUA 1O03A 3MCAA 4HDRB 3R9IA 1A5SB 4ZCTA 4J0KA 4U5QA 1U0HC 2EKLA 4R5MA 5ER6A 1HE2A 1HDIA 2FJ0A 2G7ZA 2HJVA 2J7PD 3CRNA 4EVIA 5LZ2A 2QI9C 3WLAA 4JUAA 1KFCB 3FF4A 3KLNA 1VHJA 3T52A 3F8TA 3JW8A 3DMTC 3OZGA 4UUOA 4OB7A 2N46A 3CEJA 3PT9A 5KTSA 3KYDA 2QUZA 3L4EA 2W2TA 4TTIA 2AVNA 2HFJA 4Q66C 3BD6A 3D8HA 2D6FA 2VUSA 1WHSA 2VYND 4PO3X 1R37A 2CXOA 6CHYA 4HGRA 3R7SA 2HXYA 1DRWA 3U26A 4MRSA 1XCJA 5A7HA 4UE2A 3HJFA 2JLCA 3BZUA 3HNPA 4RA9A 3RGGA 3C4VA 1ZNQO 2JRLA 4LTMA 1OLSB 2LKDA 3KOYA 4R8LA 4I66A 1VG8A 2F1OA 3D0KA 2UV8A 3NIFB 4FDTA 3WLOA 1SUEA 1W49A 1Z0IA 3EUAA 4CKXA 5LD2C 4B6GA 3AH8A 3EWIA 2W6QA 2P9JA 5CHEA 1HYEA 5EJ9A 2ACWA 4IDGA 5HQ3A 2O2SA 3MT9A 4LYJA 4Q4LA 5AK6A 4OQ4A 3STXA 4OB8A 2CY0A 3W1WA 2GNAA 1XZAA 2POCA 1Q2XA 4U7HA 1A2KC 2YIJA 4JMLA 1M0SA 4BGIA 4DGSA 3FMPB 3T35A 1WPXA 4A5SA 4I1UA 1G19A 1QG0A 2LWIA 3S3TA 3SPXA 3UC9A 3WWPA 2DHEA 2Q1YA 3H11B 3DSRA 5K45A 3UAZA 1NUUA 3UV6A 3VZRA 1NSFA 2A8YA 2OZKA 3GHYA 4OEHA 3WS7A 2QW0X 2XQFA 3KR1A 4G6ZA 1DZ3A 4N6NA 4LJSA 2A59A 5AW8A 3AHFA 2O7NA 1N4AA 1TQ2A 1T9DA 4WA7A 3VA7A 3MK31 3V1UA 2B34A 1SOMA 2MSDB 4C0AC 5LXTB 2WVHA 3FAKA 2EBUA 1MEOA 1I2MA 3A3KA 3B8EA 3E7XA 2C20A 3GCXA 3CIOA 2DXIA 3HCDA 1KAOA 3ZJVA 1Y1KE 2O06A 1UM9A 3PG5A 4CMIA 3ND9A 3R1IA 4DWOA 1D8TA 3JWEA 4FD3A 5LPNA 2JI8A 2VZ9A 5GGYA 4QPPA 2Z8YM 1AB6A 1YJBA 2AXQA 2Z98A 4ZRMA 4F3RA 3W5BA 2C9OA 2NSLA 2YZKA 4G09A 4I8IA 4KPFC 3WDMA 4EUEA 2QS9A 1CJSA 2RBKA 2O1XA 2NTNA 2VVTA 3P9KA 1JZSA 4DQ0A 4QFBA 1LBSA 3T0IA 1O3YA 1SXJA 5G02A 1AD2A 1D2AA 2V7EA 3QW4B 5HKLA 3RVSA 3K5HA 4EI9A 4F85A 5JJIA 5D87A 2RGRA 4AZVA 4RKYA 2WE7A 3AJRA 2XMCA 3FVTA 4MR8B 3C7TA 5K4AA 3QWHA 2J0SA 5HS6A 4QG3A 2IPAB 2ZROA 3T7RA 1EGQA 1YR2A 3WB1A 2GDJA 1OXMA 3LKVA 2P2CA 3A9WA 2CHEA 3SBEA 2WKRA 4QUKA 4ZO7A 2DTDA 2VNJA 3CT4A 1P0MA 3GU3A 3LCRA 5JS7A 4GPEA 1RYZA 1EFAA 3PFWO 4FQ7A 1DZIA 2WAOA 3H5TA 4QOFA 3SBXA 1ZW6A 4BJ1A 1KFEB 4RIIA 2XD4A 3FNRA 5KTPA 3W04A 5ED4A 1G6Q1 2CLOB 1N9GB 1U8UA 3D4OA 1PQWA 3IJRA 3JYHA 4S0ZA 1BKYA 2C2BA 3TXYA 1KDRA 2VYFA 2J0UB 3GP5A 3LUDA 3NVKI 1ZGBA 4ASUD 4BMCA 2V0NA 3CH6A 3RYHA 2OBNA 4YUWA 3ZXXA 1O0SA 2WKSA 3KQKA 3I72A 1CR0A 1A8PA 2IWRA 1LA2A 4YUZA 3L40A 4U00A 5FWXA 4RTSA 1L4LA 1I7PA 1N5KA 2RHHA 1K86A 3RC9A 3GC6A 5JARA 2Z5LA 4UVHA 3ZH9B 1YRAA 3HP4A 2F3RA 3NPAA 5K3CA 5BW5A 5BUZA 1V2HE 5H81A 3LOQA 2NT4A 1IHUA 1AA9A 1GAQA 4XX0B 4A8JC 1A96A 2JFOA 1ZM3A 1NDUA 4E4RA 1TLLA 3Q7SA 1ZGJA 4QM7A 3OJLA 5L3RA 5TQ0B 3GRPA 1HETA 4O33A 4QQKA 2WZDA 2PUBA 5D8DA 2ZPUA 1KU6A 3BMOB 3D7RA 1Z4QA 1LS6A 1IPHA 4DLBA 3BK2A 3HJGA 3N8NA 3O21A 5P21A 5KC9A 4FMBB 4DKJA 1PHRA 3K6JA 5E9WA 2PMKA 3D7SA 4WGGA 3V8EA 3WJ2A 1ZOIA 5C5EA 2V74B 4Q47A 5I7UA 2ZWIA 3VR5D 2WIKA 3D2BA 4Y6LA 2UXBB 1KI9A 3E5HA 4IDBA 2W90A 3ROTA 2PX0A 4ALLA 1ONPA 1WE2A 5KOJB 1Y8AA 3X2FA 1F9EA 4I50F 1Q0SA 1E92A 4JZKA 4O4IA 1MA3A 3RO7A 3CNLA 4INAA 1QANA 2EX1A 1AV6A 2CJPA 3K0EA 4JBWA 1S9DA 4I50A 4ZQIA 1UPTA 4MB2A 2BJHA 4NMHA 4BMDA 4PCVA 1IN4A 1ZI6A 3VAZA 2GAFA 1XQWA 4LQDA 4GSKA 2WC1A 1PSWA 1M7GA 1GT6A 2ZTMA 1WRBA 2WR8A 1QGAA 1YR6A 3ZE8A 1N57A 1JR3A 3N9IA 1FJHA 1XNJA 5I4BA 1DT3A 2QZ9A 3A58B 4HGZA 4O1HA 4FOTA 4OXYA 3SJAA 1BEZA 1KI7A 1HFWA 1KK2A 4RESA 1CRWG 3RV4A 4F4IA 1UXIA 3FLMA 1G9XA 3KKEA 4G9EA 4HNHA 4DYDA 2VT3A 2VK1A 2LP4Y 4K3VA 3UH0A 3WNDA 2QVZX 4H7IA 3RSZA 5KQSA 2VHXA 1KYTA 3GBVA 3AEUB 2OAEA 1K2WA 4GYKA 2HQRA 5DP2A 3H4MA 3GUYA 3DEKA 1L9KA 1QG6A 4LBYA 4AS1A 4DANA 1GNQA 4X85A 1RADA 3CW2A 3HZZA 2QD2A 2KB0A 4L6IA 3U7EB 4WBNB 3LKDA 2BFFA 4R9VA 3VKFA 1UC9A 3CF2A 1VIDA 1G3MA 1RAAA 3WLKX 2RGXA 3I9LA 1D1SA 1GQ2A 2NMVA 1NKSA 4JX9A 2IV7A 4Z99A 4EHJA 2XA2A 5L9AA 4BX9A 1M67A 2QN8A 3WKBA 4V03A 1T0JB 2YMMA 5CLGA 3EXHB 3E9QA 1S96A 4CIBA 4RLQA 2R7AA 5I9LA 1SCBA 4LBWA 2NX2A 4PG6A 1MX3A 4NJMB 4PPQA 4URZR 5CNIA 5FFMA 3TDMA 3ZI4A 5ARBA 1IY9A 1FSFA 4R2JA 2ZS9A 1Q15A 1FFGA 3R3VA 1LSUA 1MU0A 3D64A 1KMMA 3NHUA 3P0RA 1NUHA 3Q98A 5D5HA 4DLUA 1Z0JA 4Q9KA 4ID9A 4D8WA 2CNWD 3A1WA 2I6TA 3JQQA 4G8BA 5D3KA 3UXEA 3BFVA 3PFGA 3ZWXA 2GI4A 3PEYA 1B0ZA 4OK3A 2BEWA 3GOQA 5KVVA 2K2WA 2BGIA 3K0CA 2C1ZA 2GKSA 5C52B 2VTVA 4PU0A 4OH7A 4BJHB 5DX8A 1LNQA 3BWXA 3WGMA 3II6X 5ER9A 2JGEA 5FUYA 5EA2A 4C22A 1CR1A 4J07A 4BB9A 5K05A 1RBYA 3FLAA 2B20A 2P78A 4KR9A 5C9ZA 3GZNA 1R4MA 1XP8A 2P2ZA 4LG1A 3ZJ4A 1EX9A 4B80A 2Q21A 1FS6A 5ABPA 3CO0S 3SJBA 1VDZA 1W8IA 3MWDB 1P74A 1RHKA 2A86A 3N0XA 4H4CA 5ALFA 2C2WA 4BEJA 1JTFA 3OFND 4DA0A 3A4LA 1AC5A 2CNNA 1X7ZB 2FHSA 3CN9A 2OHOA 2XUQA 4JEMA 5IBQA 1TA4A 2ET6A 2WIFA 4I9GA 4ZU3A 2Z6QA 3AFNA 1I7SB 2G1PA 4JZYA 2HV9A 3THRA 1XUOA 4MRVA 2NU9A 4INJA 2X6TA 3RHSA 2Y93A 2GAJA 1E3IA 4Z8XA 5I7AA 4DPLA 1XTPA 2XMDA 1KARA 4ER7A 1C2YA 1TD1A 1J49A 1QYIA 1SUIA 4R7TA 1NATA 3PQDA 4HN4B 5HZGA 1P7CA 3DEYX 3IT1A 1XHLA 4A15A 2E37A 4UHFA 1QSGA 4URYR 2WWIA 3VSEA 3LL4A 4A4DA 2DG2A 4QTXA 2NVOA 4PQYA 4G0WA 3MNFA 3U4QA 3HJTA 5BT8A 2B82A 1ZRMA 3UGJA 2MTBA 3D5TA 4AQ7A 4UMDA 4F8YA 1CVRA 4L3VA 4BMYA 1X13A 4LI3X 3QPBA 4CMJA 1CS4C 3SYTA 5LQUA 2QTHA 3T6KA 3W2EA 4MINA 4YBZA 1OYYA 2NGRA 2PKCA 3QE4A 3OZUA 4KQEA 3C39A 3UCXA 2UYOA 4G23A 5HRCA 1B41A 3R5FA 4IH9A 3H2BA 2VF2A 5AXCA 3ISJA 1M75A 1BA2A 2DHCA 2HRQA 3HWRA 3PF8A 3DCIA 4QRHA 4ALIA 1BWRA 5F1PA 4CKEB 2EOAA 4MR7B 4QYWA 2IYYA 5A04A 1JKMA 1DC6A 2NPOA 4BMVA 1ORVA 1PT9A 1YK1A 2GDZA 2IP1A 2QM3A 3PXDA 4WSOA 2PWZA 1Q7RA 2Q49A 3G5MA 1MC8A 1AT1A 5FT9A 1XNQB 4Y67A 5J2UB 1TYZA 2X2EA 1G63A 4J8PA 1Y3HA 5KX5B 3B70A 3N1UA 4KB5A 3H0EA 1ZM4A 3ZKWB 4AJLA 5GOZA 2F8LA 4R51A 2EZ8A 1VIYA 2OQ2A 3E22A 3ZV4A 1JA9A 1FLAA 3AM1A 1EJ6A 1W35A 3SG0A 2GXSA 1MNAA 4IIXA 1RXUA 5TMEA 1RWVA 2YIVX 4QXQA 1XK7A 4Z0PA 4DMLA 4UD2A 1T9AA 3KDSE 5LOVF 2O3JA 2UUBB 1CVLA 2P3QA 1JLKA 4GMXA 3H6KA 3LUCA 1G5HA 5J2TA 1WULS 3N2LA 3A1TA 3ZX5A 2C9BA 3K0BA 4EECA 6Q21A 3PJGA 1CSEE 1RYEA 2QOEA 1QP0A 2Q2QA 2Z1NA 1NG9A 2J67A 3TJZA 4PGAA 5FI0B 1UR5A 4X6LA 1J4AA 1Q50A 5I7SA 2LIVA 3G2IA 4V0MA 1Q7BA 3ZC3A 5EE0A 2D1YA 4MGZR 4H3KB 1M2KA 4D4LA 3LC7O 1KSGA 3JQCA 1JKIA 1UBHS 1NLFA 2Q1SA 5DTRA 4FPXA 1T9KA 2OD7A 1CLUA 3UYKA 1NR7A 3AVXA 5BT9A 4FC7A 1KI6B 1W1IA 1XRLA 2FRXA 2XECA 2BF7A 2BBTA 3DZBA 4IVQA 4U39A 3T1NA 2VZ8A 3IIIA 1UBRS 4G5RA 1ZHFA 3O8CA 5ADHA 3QOFA 1RPTA 3ROMA 5HM8A 1C0KA 3NB0A 4GE0A 4OSEA 3RK0A 4CQMD 4E32A 4LS3A 5K6RA 2GM9A 5IWAB 1CCWA 3FLBA 4C3OB 4DJTA 4IOKA 4AKEA 4CIWA 1KXJA 2H4YA 3L01A 1H69A 3RVOA 3C1TA 2O8VA 2ZYRA 3CCFA 1T8RA 4I3FA 4JB3A 1GL3A 2B21A 4R69A 2GAIA 1K7CA 1CP2A 1Y6JA 4RSHA 2JIZA 4C3UA 1GNSA 1Z75A 1V47A 2W2LD 3FYTA 3A4VA 4HNGA 4MVWA 2IEAA 4NAHA 4Y2RA 4DC0A 4C6TB 4RKWA 1YNSA 2VP4A 1SVIA 3NHSA 2BMDA 2Z2KA 2W2KB 2JLRA 1FP1D 2EZ4A 2OK8A 5AO9A 5AQ1A 1W4CA 4C6HA 1V8OA 1G20E 2QY9A 1ZOSA 4ZCMA 2UUCB 2F64A 2FFRA 2QKYA 1SKMA 3RCBA 2A5JA 2PFSA 3SYMA 2UYCA 2GNOA 3JAWB 1GN8A 2D1FA 4FDMA 1GU1A 1EYZA 2GZ3A 3P9ZA 2OYSA 1RWXA 3K09C 4FMCF 3DXFA 3IQZA 1W8DA 1FY2A 1EPUA 2OUIA 2ZSUA 5K03A 3B1FA 1HI9A 1M5TA 3L4BC 3VJLA 1Z28A 3RVMA 2BHNA 1N0UA 2CBGA 2H4JA 4PQRA 1WW2A 5IJXA 5MDHA 1N2GA 1NTRA 4BCBA 4G37A 3EPRA 2KI5A 5E9AA 1I7DA 3F4LA 4AUKA 1ZUNA 3E53A 4XZ3A 4ZPJA 3FDZA 3IQXA 1SA0A 4ZDJA 3PR1A 5LXTF 5A62A 5JTUA 1DBSA 1SOAA 4NNPA 4LWPA 4Z9YA 1CQJA 1YTLA 2OHXA 4HAXA 3Q8MA 1M8JA 2N75A 4H0FA 1Y48E 4TYQA 4FHFA 5CIWA 4KYIB 5IVDA 3OM8A 1MOSA 4MAFA 1YSCA 3GJ0A 3M4NA 4K5QA 4HB2A 3D4BA 3OKAA 4UQOA 3ZD9A 3ZLBA 2Z83A 2Y05A 1YB5A 4CLOB 2FSFA 5DJ5A 1F9AA 1JVNA 1VCMA 3V7NA 4DXAA 2DJIA 1NNSA 2DWCA 2JVJA 2Q7XA 2XYHA 3DB1A 5KSPA 1IH8A 2XNDD 5DNWA 5G4LA 1CWUA 4NG5A 4F5WA 4NBTA 3GGCA 5IHXA 1P72A 1YACA 3CH5A 3I23A 1SVMA 5I9NA 1R4NB 3PC7A 1DLJA 3FGPA 4PGFA 5ECYA 5U4QA 4PYKA 1ZD3A 1G8KA 4FQ5A 3R7BA 4TRRA 4LF4B 5HF5A 1JLRA 5LJIA 2BSXA 5JXHA 1YJ8A 1E9FA 3HU2A 3WSTA 2A3RA 1XZ8A 4GYJA 4B6QA 1IUNA 1YAHA 2FRDC 4OJMX 4B2YA 3ESDA 4OOFA 1BH2A 5IKMA 1XHFA 1Z6QA 2OXEA 2XCUA 3STWA 5TV2A 3HDTA 1HYHA 1D9ZA 3BM5A 3DAGA 5L8VA 1JR2A 5BWCA 3LCCA 4XM1A 4PFJA 5JNWA 4CQNA 3VZBA 4DEVA 3KZKA 1KETA 4YDHB 3FPLA 3O4HA 5I7OA 2RHOA 1JEYB 4G5XA 3BL6A 3UWMA 3G1TA 2ODAA 1KPHA 4Y0NA 1E8NA 2XQJA 4ONEA 4Y2SA 3IKLA 2ZYSA 3C3JA 3TW6A 1PW7A 5HK9A 5K8TA 2B83A 1SVLA 1IK6A 3KD3A 3H5LA 5JRDS 4MS3B 2YC4C 4IDNA 3OTQA 2I54A 1F2DA 3QUAA 3EPHA 4E2ZA 1W4RA 1XEXA 3JQFC 2DWQA 2NVBA 2H7YA 2QUAA 4PTZA 1KBQA 1KRXA 2QPLA 2I9KA 4N4AA 1TQ6A 1JDUA 1UIMA 4M9RA 3LBFA 3OX2A 4K6OA 4WN9A 4B4WA 3FHJA 5JQGB 4ARBA 3IUNA 1M1UA 5LZ9A 1N9KA 2AJCA 2QTFA 2W6ID 3N05A 2C9YA 4KGVA 2YYZA 4OFXA 4B3SB 1J6UA 5A3QA 2UYYA 4L7QA 1Z37A 4M0PA 1DTWA 4IFEA 10MHA 1NUQA 2VOJA 1ORHA 4H4DA 1N3LA 2DH5A 4L07A 5D85A 5KTTA 5T4EA 3GUVA 1MXFA 2ZSKA 4QC2A 3PENA 1AMNA 3WO0A 3S1AB 4B2PA 1E79D 1YZFA 1YR7A 3JR3A 2FW1A 3L7NA 1W85A 3N8GA 3BN3A 5L3QB 2V8OA 2VN8A 5K0EA 2AVDA 1PG2A 2W6JA 2G0TA 3AV0B 4HZGA 5G40A 1J22A 1V45E 2WMNB 3HE3A 5T6MA 3A4TA 1KO1A 4OL9A 4REMA 3WYDA 4IS3A 4AO8A 5JZOA 3S81A 2P75A 3UQYS 1PS8A 5HJ2A 5C4MA 4GOOD 3W2HA 2R1ZA 1HDXA 4HLNA 1GOTA 1QRSA 3T94A 1A5AB 3CUUA 3GAZA 2XHZA 3KB8A 5JRZA 2Q4OA 2XF2A 3FCSB 3CM0A 1TQ4A 2EKQA 1U1CA 3G49A 5C3MA 3QHQA 4TS4A 4AJ4A 4B3FX 2EFJA 1P7PA 4JDUA 1V35A 5DLPA 16PKA 3ZDCA 1P9NA 1GFZA 4FGUA 2V59A 1SOWA 1EWKA 2VCEA 2YTZA 3LLSA 4K9QA 3RDPA 3SYKA 3KSDO 3RLFA 4TZ6A 2E5WA 3A9VA 2BGGA 2KPOA 4PRYA 1YZGA 2QYHA 2GXUA 3AM5A 3DULA 5AM5A 3K30A 4W9NC 3IVAA 3V2HA 1N9ZA 2NO9A 1E5XA 5EL0A 4LW8A 3FOAA 4PXSA 2J5KA 4FFOA 4XYLA 4DIDA 3QW2A 5I8ZA 2EC5A 3T7DA 2W2XA 1MB4A 3FNGA 3SC2A 3JQ9A 1BOOA 2AE1A 1NM5C 2OD2A 1UM8A 2B5VA 2CNWA 1T8WA 2J85A 2XVAA 3LXRA 4YVFA 4GOJA 1KVQA 5I3ZA 3JALA 4LJ7A 1IWBB 2AZDA 1R9GA 2NO6A 4ARZB 1YR8A 4M1EA 4RD1A 3EDQA 3RRZA 3RASA 1Z6XA 1XRNA 3HBMA 4DMRA 1ENYA 3JVUA 5SZKB 4GR4A 2XMGA 3AEXA 4IIJA 4NZYA 4WUTA 3IKVA 2OC4A 4LK3A 4OXXA 4WXRA 4YRCA 3T5CA 4BKOA 3ZE2B 1UBEA 4B33A 5L4LA 4CKWA 1N5JA 2B8TA 4QQFA 1K7XB 2FPGA 4QJBA 1S1MA 4TVBA 4URVR 1Y9ZA 5IS2A 4JLDA 2H4ZA 4A0FA 3F7MA 5IVIA 3NLLA 3JQBA 3O1JC 5AI6A 3KU1A 3U7IA 3IMEA 1D6NA 4DA8A 1A9OA 3C1OA 1IG0A 4UUAA 1G8SA 1SVUA 1IHDA 2CJXA 3WLHA 3A10A 5KMGA 3ZS9A 4DZRA 1HEIA 1U7PA 4ER0A 1LPBB 4RIGA 4KX5A 5K0ZA 4DMMA 2V0CA 4P4UA 5IAJA 4RTPA 2VWHA 3MJCA 4Z0TA 5AW3A 3G0BA 4HDKA 5E95A 2IU0A 1JEJA 5BY2A 1XDWA 3ACDA 1QOQB 2HD4A 2IOFA 5AMXA 1XCPA 3KSAC 1X8XA 3H1TA 3PVCA 2P69A 2OBYA 1GZSA 1NOIA 3TGLA 2O2YA 2C5HA 1SZCA 3ZCPA 1YU6A 2GXQA 2BGTA 4RS3A 2V45A 3AJAA 1NZFA 4X90A 4DC1A 5B1YA 3G7NA 1KHTA 4M8KA 4ITUA 3GH3A 1JNYA 3GQVA 3KOMA 2M6LA 4FCWA 3GOHA 3NM4A 2NLOA 1DINA 1KDPA 3TW8B 3K4QA 2XNKA 2DY1A 4M8SA 5FORA 3SQLA 1XEAA 3MINA 4FDVA 1SQ6A 4GKBA 3UENA 1XVTA 1QJ4A 1U7WA 1J7JA 2Q27A 3OY2A 4JC0A 8OHMA 3I3SR 3ZLUA 2VJCA 2PL3A 2WVJA 3Q5GA 3I92A 4K2HA 1JRLA 1LS1A 1TO2E 1USKA 1SC9A 5PGMA 3SDBA 1CUIA 2UAGA 4BQQA 1XEWY 1NXOA 3EJWA 4B3BA 1DAGA 3RTBA 2XAUA 1L4BA 2GCIA 5C1BA 5CB6A 4OSOA 1YR1A 2GK3A 5ARCA 5BR1A 4XLLA 1J7KA 1N0WA 2RMKA 5EWLA 4E5DA 1Z13A 3TNDA 1WCIA 2J48A 3E9YA 1YKGA 2GBIA 4F1JA 4BPBA 1Z5PA 4N5HX 5IZCA 1Z34A 5EZSA 5ADVA 1GNTA 2OXFA 4EARA 1R9NA 4H7HA 5KREA 4OIMA 2FSVA 5EPOA 3RSSA 5ICGA 3TECE 3U3KA 2YQ4A 2FPWA 1JIXA 1YOVB 4ZD6A 3EXAA 4X1YB 1U3DA 3M6XA 4JL8A 2VXCA 1GXSB 1UPBA 5L6MB 5EHGA 2VJMA 3WQRA 5C31A 1E2QA 1XAGA 4XI9A 2PBFA 3ZY3A 1LPNA 1P2FA 4HDSB 4GXQA 5AHXA 4IJVA 5ALMA 1XYYA 5EWJB 5BMVA 1MO3A 5AVWA 5CDFE 4ZVQA 5KO2A 1W2WB 3EOAI 4UASA 1N7HA 1XDGA 3O4JA 1V7CA 3R0ZA 1W0CA 1QK5A 4OQMA 1VRCA 5DNCA 4KITB 2VF5X 5B3JC 5ILQA 2IKSA 4M0UA 2KX7A 2Q5CA 3C16C 4LAFA 5AHWA 3IAHA 3WLEA 4AG5A 1L7RA 3Q12A 3OOYA 4YH1A 1JDPA 1ZUD1 3X1ZA 2HDWA 4YCLA 1ZC3A 3EGOA 1HE1C 4YECA 2YWHA 2GPYA 1VPVA 1P1KA 5F78A 1V5FA 2FP4A 4TTVA 4P80A 3CPSA 4IILA 1C9JA 5IC6A 5CLQA 3N0TA 1R15A 2J41A 1F17A 4HXEB 3WNZA 5KYKA 2CZQA 5DCWA 2V7QA 3D8SA 5B3JA 3RVBA 3PJDA 3ZWOA 2XUFA 4TXMA 3U7HB 4IWNA 3VSDA 1G2PA 3U4MA 3AYXB 4QYIB 3TRFA 3R5JA 1R0KA 2YXDA 4OAPA 2ZRNA 1DU4A 1U1DA 3WB0A 3R09A 1RP1A 2D0DA 1KDOA 4OA8A 1Q3KA 3JAKB 4Q00A 2QZSA 1QCDA 1RRVA 2P5YA 3C8MA 4Q9LA 1SY7A 2AJTA 5DVZA 1GLGA 4O4HA 4YDSA 4B35A 5CDSA 1GIAA 2IOYA 3OY7A 2AI2A 1A9SA 1MCZA 2Z2ZA 3N3BC 1BQEA 4KLZA 4QFCA 8ABPA 1EA7A 3AB7A 4BZZA 2L42A 2JLBA 5DM4A 1OB2A 1DO2A 1VYTA 1XBTA 4ZVNA 4ETWA 2A14A 1E69A 1NBWB 5CEEA 1OJ7A 2AQKA 2Q9CA 1P0CA 3KUKA 3TDKA 2YNMC 4P08A 1TOAA 5FL3A 1NE2A 2BBOA 1U2SA 2CNOA 2JC3A 1Z08A 1JHMA 1ZI9A 4J94A 4X1KB 3ZHBA 4OGGA 3F71A 1IB0A 3BL8A 4RX1A 5ALIA 3NHFA 3O9VA 3C41J 1EG2A 1GQFA 4AMBA 1QVZA 4AXXA 1J0AA 4HBZA 4CKYA 4LHZA 5AW5A 2R00A 2YHBA 1NJGA 3I8XA 4C05A 2G4CA 2X4IA 3ZDZB 1O9HA 3MWFA 3EX7C 1EXWA 4P92A 2G07A 5AI8A 4QYTA 5H16A 1BXGB 4OXIA 3TYXA 2ICAA 4DAEA 4B4OA 1W75A 4EUSA 2CMHA 3H42B 5KB3A 3EEOA 1PS9A 3HN6A 2A1UA 2BRUA 2Z9DA 3HXQA 1C4XA 3MOSA 2XAAA 2ZK7A 3PNQA 5CT8A 2CBZA 2O1WA 2PXAA 3G3EA 4NRDA 2Y8EA 2I4RA 4IHKA 4RKQA 3Q7IA 4BS9A 5BVGB 1ULZA 4CEJB 4Z4IA 4O63O 5CFLA 1O4WA 5EHZA 5TMPA 1DWPA 1KRWA 1K97A 3QVUA 5T8KC 4A1OA 1AURA 3DQPA 4OGLA 1MAHA 3MQ2A 4JY7A 5DLEA 1Z29A 1K1EA 3C3WA 2BOVA 2DF8A 1T2CA 2ODBA 2WOJA 2ZXEA 2PUDA 5AD1A 1PLLA 3DBVO 4HYQA 3U7GA 2NACA 4TVKA 5JE8A 5B53A 1KYZA 4W5QA 1QH1A 5ADWA 2F48A 1PAUA 3CR8A 4PO8A 5F7JA 1KAEA 2N1MA 4TV9F 1JLLA 1L6IA 3SEQA 3R5HA 3TOSA 5L7YA 3AU9A 4O29A 2DB3A 1FTNA 3QWIA 4FC6A 4WY5A 1CK4A 1FFXA 1ZK0A 4RAOA 1EXVA 2BUBA 4FYMA 4QGBA 2PBLA 4JLPA 2CXUA 2I87A 3Q7PA 4TV9A 5JPIA 3WYCA 3D6TB 1FNDA 4JP3A 2Z9CA 4RC9A 2XUIA 2C9ZA 5EMHA 3LVBA 1II8A 3LXXA 4HDNA 4HNVA 3Q7TA 1MOPA 1GTJ1 3KL4A 4MO2A 3QJ5A 5DBFA 4MARA 4P0PB 1Q84A 2LCFA 2EX0A 4PCLA 1ESEA 3OUTA 3UJ3X 2ZOSA 5AK4A 4P0TA 1QMGA 1WW3A 2LDBA 3QH4A 2ZJYA 3AUSA 4YCDA 3BL5A 4WLOA 3Q8XB 1TF7A 1ID1A 4KQIA 4DDWA 2YC2C 1VM6A 1DE0A 3SF8B 4BWYA 3M5WA 3ZHXA 3B78A 3KCNA 1JX6A 5G41A 3K6KA 4F6LA 3BBPA 4OYYA 4B9AA 4EGCB 1GQQA 4ER3A 2W6IA 2OYRA 2DHDA 2ADOA 2YZ7A 5CVVA 4YJKA 1PYDA 4FFVA 4E70A 1D07A 1VRVA 2VUIB 1I2DA 1Q44A 3CONA 4OUKX 5DNEA 5E0KB 3RYCB 3VH3A 3W6PA 3ZQ4A 5E6UB 1ZM2A 2WLSA 3V55A 1X19A 4FFPA 5F5NA 2IZ6A 1X1QA 1JA1A 4PG8A 1JIUA 4O1IA 4PQFA 3NBQA 4TVOA 3M1AA 3WOHA 4L28A 3WYAA 3GPIA 1UKZA 4FNAA 4HAIA 4OMCA 1LTHR 4RSGA 5A5FA 1M6WA 2QJWA 3ZY2A 5KWSA 3OUUA 3Q3JB 3H17A 4GWLA 1N32B 1QFXA 4EY7A 1B15A 4PF1A 2QQGA 2WTEA 3LPDA 5KYUB 1MKYA 4JN6B 1ZD2P 2Z1DA 2WG0A 1DADA 1TAHA 3Q6IA 1HOXA 4A2PA 4EY5A 3I83A 3PL5A 4DJJA 1E8DA 5F64A 2AW3A 4QT0A 2G63A 1TU0A 1E9AA 3ZLTA 2PTHA 3NG1A 1L8LA 4MGYR 4CIXA 1Z2CA 3VC3A 2NWQA 4YJ3B 3P9YA 3F6YA 5JQGF 1OGYA 3LCVB 4GMFA 5C51B 3BB3A 2QM7A 4KO3S 5GZ1A 4GMKA 5BN1A 1KY2A 2JI4A 2PX4A 4NQRA 2J5QA 2X1HA 3BPSA 3IT0A 2IH2A 4N6OA 1FQWA 1U65A 1X8JA 2FSUA 3HADA 2C1EA 4J0HA 1IHPA 1KDVA 1EHYA 3WRXC 4GDMA 4QYXA 1W0JA 3B2NA 4XA8A 1HNZB 2PKWA 2ZWVA 1HM5A 2VQ6A 1QE5A 2PXHA 3VV3A 5KYVA 5G0TA 1ECFA 2KM1A 3SU8A 1QTNA 1VG1A 3F90A 4BP8A 1DBWA 2B78A 2D3WA 2CT8A 1ADBA 2B99A 3M9XA 1A71A 3BJEA 1T4DA 4YROA 4LZNA 4IOMA 2AK2A 2CDNA 1RAIA 3WK7A 4B3CA 3KXKA 2FF7A 1T15A 1WMFA 2ZR8A 3LH5A 4II3A 4R83A 1XNGA 2QD3A 2RGAA 3PXUA 4B75A 3W9YA 1MO6A 2ZTLA 3C8UA 1MB9A 1PLJA 3EEFA 4J7XA 2ALJA 4NHOA 2NP6A 1DGQA 4CMIB 1OB5A 3HJBA 2ZCJA 2ZE5A 4GWGA 4IQFA 2C8LA 4GRAA 4UZEA 3KLBA 4XVUA 5HGJA 3QZUA 1DC7A 3H5VA 3DJYA 1E4VA 4ILEA 4QOSA 5KI6A 1XMQB 2B37A 4BNZA 3UMYA 1J56A 2ZIVB 2X1VA 1OWLA 3BSWA 3TPFA 4UNIA 5A4FS 3G9QA 1E7MA 3HLKA 3E0QA 3H18A 4RNDB 1UT6A 3KAQA 3AKEA 4O2BA 1L1FA 4NS4A 5IT0A 3RADC 1SXJB 1AXRA 1MV5A 1N2IA 2MIIA 1JE0A 4BX3A 2VXBA 1NW8A 3I2YX 5LMUB 3HG7A 5EJMA 1WF6A 1FIUA 3LYUA 5EE1A 1IATA 2Z5FA 3CLSD 1HKUA 1UAGA 3FPJA 821PA 3I5MA 3AZOA 1R64A 4HSEA 1Y3AA 1H42A 2ACKA 3W7AA 2FFHA 1JSCA 4AX8A 1IVNA 2JIOA 1PZNA 3HQ4O 1PJ2A 4UM7A 2NVUA 1JT9A 2I6XA 3K7EA 4LTNA 2G1UA 4B7ZA 4DJ5X 3JZDA 1SHZA 2HF7A 1F0KA 2OV2A 1RAHA 2QIOA 2AFVA 3A11A 4FZRA 5D3QA 3NEPX 2QM0A 3WWEA 1L3IA 4X84A 4O2LA 5BRAA 4Q9HA 3HDVA 3MMNA 1GNLA 4LE0A 1BYUA 3Q8LA 1S5PA 2FVYA 2GPTA 3A2MA 3FPCA 4FOPA 1P2SA 4AKHA 4RV4A 4EAQA 2WJAA 1VMEA 1BG6A 1B74A 4HO1X 4MKHA 5B1IA 2XCSB 3K8YA 2GOYA 4B8ZA 2WTUA 3RYHB 3LBNA 1N77A 5CLFA 1WKVA 4YP5A 1EE1A 2G8LA 2ZYGA 1XZKA 3BTSA 1YZQA 3C2QA 3DZCA 3KOZA 3IDQA 3OD1A 4EB3A 3GEIA 4MKXA 2I4MA 5FWXB 1K3UB 2BHLA 3JQEA 1OVGA 4ZV4A 1PIWA 5GZ6A 2ZSHA 3IAAA 4RJLA 3E3MA 1IBSA 1A1VA 2FAXA 2WYIA 1FP4A 1KNXA 5LLSA 1L5HA 5M04A 2IBMA 3VISA 5EG5A 3BWMA 5F7XA 4FS8A 3V8QA 4XCQA 1PP4A 4PVDA 4LF8B 2IK8A 5TQ2A 2A1TS 1FXWA 3BB1A 3OMWA 4K28A 1M74A 4AD8A 1AZLA 2WV7A 4R71A 1A4RA 3ANXA 1T8SA 2VTEA 3S44A 1KMNA 4CV2A 3OM0A 4MPRA 2EYUA 5B2FA 3WQHA 3L6BA 4MB0A 2HJ9A 2JA2A 5IMBA 4XWGA 4DXDA 3V33A 3LX4A 4S1NA 4H35A 1Q77A 5GINE 5FKJA 4E4YA 2EKZA 3ONDA 4WK0B 2ZBEA 3B82A 4KIWA 3ZTTA 3CX6A 3BKXA 4LYYA 3ZGLA 2E2WA 1REQA 2R6DA 4FILA 4YCSA 1SKBA 1P6QA 3MWLA 5BW4A 3HGQA 1Y9EA 3BJMA 3GARA 1BDJA 1YQWA 2YOFA 3OE4A 4Q1AA 4DW8A 1ZYUA 1JAYA 1W25A 2GRUA 1R4AA 2CJWA 4JUBA 2XMZA 4RDCA 5FUVA 1NRJB 4CR7A 3T1HB 4EKGA 1JUDA 4FGLA 1L5YA 2PSJA 4LIPD 4B4VA 5I7RA 1MJNA 2BCEA 5ERXA 1D2RA 3WAJA 3FSEA 1NRIA 1ULHA 1INLA 1ZH8A 2AEEA 3EOZA 3HBJA 4L5JA 1YFKA 1WS6A 4BAGA 1TIKA 1UPFA 3OTWA 2J3KA 1GQRA 2GPJA 2PZFA 3L8EA 4MW6A 4RZUA 4DRXB 4L4ZA 3MSXA 3TUZC 1BMQA 4UM9D 4EJFA 4C2TA 1HV8A 1R5BA 4MRMA 1FRQA 3RJTA 2GVDC 1K5PA 2WSSD 5EE9A 5E8RA 2ZWPA 2Y76A 1Y3IA 1U4OA 4G4IA 4MYHA 2JFBA 2IHYA 2ZVDA 1RVDA 3IEVA 2VBGA 4JXJA 4GPAA 2CMFA 1II0A 3WYGA 1BEEA 2JI9A 2E6UX 1HL3A 3TM4A 1RRCA 2QNRA 4NE7A 1FP2A 2B69A 1Z45A 2EARA 3GUZA 3KQYA 1KKLA 1IY2A 1UJ6A 4TS3A 4DMFA 1JYFA 3UB2A 3L5OA 1Y6FA 2R1TB 3EW9A 5ENVA 2RE8A 1R0BA 2JRCA 1Y5RA 1NMXA 2AFIB 1RLJA 3VZDA 4CM1A 3IUQA 1DDGA 5AM4A 2GWRA 1VL0A 4KK3A 4XWKA 2OQIA 3CUWA 4N5DA 2O0MA 4QFDA 1GL9B 4JAVC 5BSMA 4JBIA 4RPKA 4B6OA 4UNRA 2HOQA 5DBOA 5TLSA 3G0DA 2XDQA 5CDFA 4KR3A 1SU7A 3ILYA 3LBHA 3PC2A 5I9SA 2BGMA 5CLIA 1EKXA 3NBZC 4M8LA 3I9MA 3IA7A 3E8XA 3WLLA 2IGBA 4D3XA 1X1CA 4EO9A 2GTIA 3VO1A 1ZEMA 3AERB 4LWQA 1FQKA 1B8OA 3BD7A 1AB5A 4L78A 3ZHRA 2GZ2A 1N2CE 1YUNA 3WGNA 5BNIA 3ETGA 2PX8A 2MJLA 2F1RA 4RQTA 1VIAA 1V8FA 3F7OA 3U3OA 3OWXA 2WWRA 3VNQA 2I91A 4PX9A 2BEWB 3RARA 4ME6A 3NEJA 5CD9A 4YJ2A 1R88A 4UM8B 2YV5A 5BN3A 2TECE 4B32A 1G8JA 2ZRBA 2YVUA 1SCNE 2CLSA 3KJZA 3OJXA 1BROA 3HCPA 2XJ9A 1H1DA 4YONB 1NYTA 3L4KA 2RI6A 4BNDB 3SR4A 1RBMA 2YJTD 4Q12A 4V24A 2H2WA 4GFDA 1G21E 3TZCA 4DE5A 4MWZA 5LDGA 2W6NA 4EY4A 2BFWA 4LVOA 4ZOCA 1QHHA 3JRXA 3NEAA 4WLUA 1YULA 1ZH6A 3PC3A 4J0GA 4JLAA 4LJYA 1IXKA 2BI7A 2XZTA 1TGYA 4ZYTA 4LDNA 2ZLBA 2CMDA 1V6AA 1BE1A 3EUFA 3M83A 2Q6TA 3HV2A 3HXTA 4JP1A 3QTTA 4M36A 1T6ZA 4MKIA 4Y2QA 3N7UA 4MV1A 4BFVA 3GLIE 1HPLA 1DIBA 1J8MF 3SZLA 3TNLA 1BCRB 2PA0A 1LNZA 2Z9BA 5TPZD 1A8QA 2EZ9A 3QVOA 1C8LA 4ZYYA 1BYIA 2QB5A 3E70C 3V34A 2ZRJA 3OEWA 2RGDA 2DFNA 5I9MA 1A4IA 3UJDA 1TCAA 2ZR7A 3CX8A 4JQSA 4FHZA 4ZOLF 5U4XA 1XROA 4KP7A 2GZDA 3CLKA 3FB1A 2OCLA 1FTWA 1Q1QA 5EFOA 5K0NA 2P67A 5J23A 3PFIA 3AUJB 4UEQA 3PWTA 2XUHA 3LQ4A 4KNWA 1LBIA 1P1CA 5IBRA 3UJCA 1PG5A 1K0FA 3NH6A 4TTTS 5DN9A 2WYVA 1WUIS 3EVTA 4DLPA 1PKXA 4O25A 4PC2A 1OXTA 4BQSA 2N47A 2X13A 4JVLA 2H1WA 4JYCA 1CJBA 5F7ZA 1CUZA 2UYHA 2YY5A 1WMSA 1W5BA 1DWOA 1N6OA 1EB9A 1NX9A 4RTOA 4AM8A 1YRQA 3QU9A 4EO7A 3ZIDA 4HYTA 5A71A 4BQNA 3VSCA 2OT3B 2YS7A 4FOOA 4AMYA 4ZDKA 5DYIA 3MS7A 3GX1A 4JYPA 2W0MA 1D03A 2NSDA 3IAS1 4FM9A 4JLKA 4FFBB 3GLHE 3I04M 3DEIA 3DP7A 5JH7A 4XPZA 4GLOA 1XMJA 1EBFA 2I99A 3C8DA 3TSZA 1F2UA 2WD8A 4DR6B 1XE3A 4Y2XA 3U7JA 4OBEA 1VMKA 2UZIR 3BTVA 4NH0A 5AKHA 3ZZMA 4IGFA 1OLXA 2CK3A 4GD3Q 5JFOA 1Z5UA 4DQKA 2C9CA 1QHGA 2OWEA 3SSMA 2JLZA 1QO9A 2BEUB 3B9RA 4A92A 4F86A 4WERA 3FCUB 1VE9A 4O1MA 1SUPA 3TI7A 5JIBA 3GFVA 5DBHX 1WMDA 2MINA 4HXYA 1I1OA 3HCCA 1ZMRA 2O2IA 1A82A 5HFJA 5JOQA 5FP0A 2XT6A 4UUMA 1LVGA 2NW6A 1G5PA 4GOLD 4A8TA 2IPNA 2NUTB 1GPJA 3UZUA 1HYQA 4X7PA 2REXB 4G81A 3TO5A 4DUPA 3VR4H 1ISMA 2QR2A 1KP3A 2YXBA 1CUFA 3H2JA 2QLJA 1Z2NX 1ZS9A 2OC9A 4TOIA 1H65A 4NCNA 4V1CI 3FZGA 1AX9A 1E8MA 4D0GA 1R4ZA 2AR9A 2DQKA 1KJ9A 2IYEA 4DV7B 1Y4AE 3DPUA 1L3BA 2X22A 3TEFA 1OYVA 2GJAA 3OKPA 2B8EA 4N18A 4MULA 3JXEA 1MD9A 1GUDA 1WJGA 3LD9A 2BKUA 4IICA 2GCPA 4QOIA 1LI7A 1U98A 3LLMA 3R5SA 4HAWA 3STYA 1Y4ZA 2I1WA 4JP5A 3OUZA 3QEOA 1U8FO 4D3FA 1T0BA 1YVUA 3PDUA 3E2PA 3WLNA 4Y98A 1ZH4A 2HBQA 4MROA 4X00A 4EG6A 5ADUS 4U6SA 3VTAA 4QE3A 1SU6A 4FFRA 2UYQA 4HGQA 2ZVPX 1G5RA 2FE4A 3MTAA 5DHRA 2EERA 1TK9A 4FSHA 4M0DA 4KN8A 5LYJF 1QLHA 4E5SA 1VBNA 2RKWA 3P45A 1DI0A 5BQOA 4TRMA 4UU1A 4BZWA 2ID4A 1FC0A 2XQGA 2PX2A 2XE6A 5JHHB 5TXGA 4R9SA 2DMRA 2EV9A 2ERXA 1WD5A 3HP7A 3ASUA 3NTVA 5FBWB 2I1LA 2J46A 1O94C 5JC1A 1GAXA 3MOIA 3URMA 2HWYA 4MKRA 2JI7A 3WGHA 5C1OA 3OQNA 4R1LA 2PMCA 3LLVA 4AECA 5GIPE 1JW9B 2TMKA 2V97A 3KKKA 4N7RA 5E1OA 2FA9A 3UJ6A 1APBA 3NETA 3LNTA 2XCTB 1T0UA 1FW8A 1SRRA 1KZ6A 1MVOA 2QRLA 5FBHA 5G0WA 1XZNA 3G8BA 3T61A 3ZGYA 4LYAA 1SG0A 4YJ3F 4BJ5A 3G2HA 3ESQA 1CUEA 2QTNA 3Q3HA 1PZEA 4WKGA 3ZBPA 4GG1A 2PLRA 5K3DA 1ZVKA 4WESB 5HYVA 5J4VA 1P7VA 3O03A 4DREA 4IKOA 1ONNA 1RLOA 1SCJA 3K16A 3QVJA 1D4ZA 5JC8A 1E2NA 1QOPB 4MKZA 1ZL0A 3R6DA 4ZARA 1N5LA 5C4GB 1CZNA 2A9JA 3U9LA 4V0RA 4FXPA 1YBFA 2V4ZA 4WFIA 1MW9X 3EAQA 3DTVA 3HH8A 3LKBA 4MUMA 5I4KA 1I6KA 1RP7A 5EMNA 2A7QA 4MUKA 1V16A 4FR2A 1NY5A 1ZUNB 4HLDA 2CLHB 3UWKA 3CF6R 3IP3A 1ZR2A 1U7TA 3NVDA 3FOFC 1E6LA 3HBNA 4IO0A 3DE6X 3QOWA 2NZJA 1CQJB 4PBRA 2D2EA 3ORQA 3CR7A 3SZOA 3VGJA 1SBHA 4C5CA 1QQ5A 2BMAA 3LUFA 1UBLS 3DAYA 4MUJA 4O59O 2WINI 4EEKA 6NULA 5E3JA 1RXEA 5BNFA 1TF2A 4M9UA 1F4VA 1Z6GA 1ZGCA 3ID6C 4ZOEA 3GYBA 1EJ0A 2O3RA 5IM5A 1ZAYA 2COUA 1E3JA 1IJFA 2PQMA 2X2OA 3FUVA 3KELA 3OCUA 2IUTA 3D3KA 1W36D 1KIFA 1I10A 2ZZMA 1U90A 3OF3A 4BN0A 4OP3A 5F7OA 1UMBB 2YASA 4MWDA 3KJEA 2QN1A 2FSHA 1EGAA 2V6IA 5ERYA 1C7RA 3G2MA 4KLAA 2P40A 4R01A 3TL3A 4D02A 5HKAA 4LZPA 1UMCB 3AF3A 2YZGA 3PRKE 1OTXA 4JBYA 4NBUA 5HSGA 2B7BA 1SH7A 2C31A 3USZA 3DL4A 3UXYA 1KL7A 3L7BA 3LCJA 1CX9B 2BGKA 3RK4A 4UHKA 1ULBA 2J9RA 3GPBA 3HL4A 3WL4A 9LDTA 2PMEA 1GFWA 5EJIA 4PX5A 1PR0A 3B3GA 3BS4A 3H04A 2IHJA 3RS7A 2BEVB 3LW8A 4RY8A 1KKMA 1IVYA 5AJXA 5BP7A 4JI7B 2CHQA 4HT3B 1SVWA 1WXFA 4HSGA 4ZVVA 2QV7A 1PSDA 2FXVA 4ZVSA 2D0OB 2VDWB 4RK1A 1BMFD 4JYBA 4ZVLA 2XCIA 2IW3A 1AUXA 2IXTA 4D4JA 5B7QA 2VHTA 1W88B 1CJTC 3CZ9A 2NPFA 1PNTA 5KAPA 2BE7A 1NQVA 4TMFA 5EI5A 5K0FA 2EF1A 2KBEA 1P18A 2RGNC 2GMWA 3MT0A 4LZLA 3VC7A 1C9EA 1WOMA 3OKCA 4IO1A 4YAKA 4GX2A 2V8BA 3PXAA 4IMJB 3UCEA 4NOMA 1QTIA 3HKBA 2AMFA 4E30A 1QTRA 1EZ1A 2GVZC 3BWEA 4WN3A 1ZCAA 3T4EA 5K8CA 3E7PA 1L4UA 2DLNA 4ZAYA 1X86B 3NNSA 4ML3A 5DCYA 5JCXA 1VE3A 4RK7A 3ADBA 3JARB 4HV4A 3IKMB 5K0SA 3T06B 2PO5A 2PS9A 2QRVA 1DTWB 2Y1WA 5G0UA 4BZPA 1EFPA 2QR3A 1PEKE 4MIYA 1EP1B 4OUDA 5CGQB 5JS6A 2GJKA 3UBMA 3I45A 4H08A 5JVDF 1Y8CA 2WSSA 4MWBA 2C88A 5ESDA 3W3AD 2F1IA 4GT1A 3PBKA 1CNMA 4M1WA 3VU9B 1E1CA 2DERA 4CDRA 2TRSB 5ALPA 5EKTA 1PX0A 1D4AA 3TBKA 3ZNPA 1VHDA 5T3YA 1RI1A 1YCDA 1O87A 1DFIA 5JBNA 2XSZD 1IPFA 5LA6B 3WGQA 5JEEA 4C7OA 3L0DA 5G3YA 1RPAA 3VO9A 1P60A 2G80A 3BDAA 1V5WA 2OGWA 3DAPA 3JWGA 5YASA 3IBFA 4AKTA 4DWWA 3SE7A 3ON5A 2Q62A 4Q7QA 4TKMA 3KHKA 2J1LA 4R8VA 1S8AA 4P32A 5J59A 4EG4A 4HN9A 4IIGA 5F2EA 1GP2A 2Q46A 3JD2A 1X7WA 1X9IA 1IBRA 3HSKA 1JMYA 5THQA 5JADA 4RS4A 1R6DA 3EK2A 3BQ9A 3MG9A 4ACAA 2XXAA 3MPOA 3QKSA 4ENSA 3R3YA 3D8RA 3SS7X 1ZXBA 3N2ZB 2QR5A 5KYWB 5A6SA 1FSPA 3ZJ5A 1SWVA 1D4OA 1FQOA 4DV0B 2X0IA 4H7JA 5JO0A 2ZBFA 5K0JA 4TLEA 3N74A 2BDUA 4C7XA 3JALB 2JFPA 5K6TA 1DTEA 1S6YA 3DXYA 3TNFA 3J7AC 1SZDA 1TO1E 4K9MA 4TTPA 3NIDB 4UULA 5AVQA 1Z7GA 3OCYA 3GJZA 3VR1A 1FU8A 4IIJB 2BSQA 4TMTA 3H1GA 5G3ZA 1IIBA 1GRRA 4PAOA 4ZQCB 4PLWA 4CKWB 2BMEA 4GC5A 1GEEA 2FPGB 1NQWA 2AMLA 4TQAA 3K05A 2HI0A 4ZI3A 1UBKS 3ZWYA 3VH2A 2DQYA 1N2XA 4TMXA 4DWVA 4REQA 2C5LA 3EVEA 3NDRA 1FFDA 2IYAA 3HA2A 1BE8A 3IPCA 2C2GA 4X3CA 5KMGB 2ZDGA 4OU5A 4ZC1A 4UQLA 1UDWA 3AI2A 4QICA 3UA3A 2XBMA 4F3KA 5KKNB 3JQAB 1Q2UA 5BNWA 4BFLA 3AVWA 2RAUA 1H85A 3EDOA 3K4HA 3TI9A 4OJYA 1Q7EA 3W34A 4HDKB 4AJ9A 1O0CA 1WXQA 1ZMBA 3CKYA 1SXGA 9ABPA 5FUQA 3U6BA 2H07A 4GHWA 3SICE 5GY7A 4QHSA 4UCWA 3NQ41 2BKLA 4NZPA 1NRXA 3NKVA 1UT8A 4V0LA 2QJTA 2AR0A 3A6EA 3AP1A 1JSLA 5E3HA 2LNDA 3CZAA 1C7QA 2A92A 3EA4A 4F5DA 4EI8A 1J0XO 3OJWA 3PXBA 2OQVA 5JY6A 2HCFA 3AIKA 4C3ZA 1GPMA 1JQ5A 4HNAA 1X15A 2I6UA 2CZGA 3S5JA 4EUKA 1KS2A 5KQGA 5KYXA 2J8ZA 3PC4A 5TB5A 4Y6QA 3FGOA 3AETB 3GBPA 3IQGX 3VXKA 2WU1A 4KTVE 4RTQA 4TUYB 4HGPA 3HXOA 1Z0AA 4R2KA 4D96A 3X1MA 1WW8A 1N2CA 4FZJA 4PCAA 5CA0B 2XUAA 4E5MA 3CVJA 4WX2B 3KALA 4MYSA 5CVTA 5JDIA 5HKKA 2WM2A 3NTOA 4C76A 5BSVA 1WHTA 1P4HA 4N8DA 3Q7EA 3I61A 2R8YA 1UBTS 2GN6A 4UE3S 1L8XA 4RFLA 2H54A 1ZGZA 2ATXA 2JLYA 2XKJE 3GRVA 3KQSA 4OXKA 3LP8A 1GZ3A 1JFSA 2BTQB 2XB9A 3JQAD 1GGEA 1PFYA 2ROQA 4DABA 1A4UA 1HC7A 1M34B 2H9YA 5JHGB 4OLBA 2IPXA 1KERA 2NUPA 5KSOA 1XEFA 4Y1EA 4XUDA 1G21A 3FRHA 4Q37A 1P33A 2WFLA 1NW9B 3HBLA 4CF5A 4S12A 4WY8A 3O1HB 2ZRDA 2ZJ5A 3HCRA 3V48A 2FZKA 5DSXA 2OM2A 1IZ7A 3F7TA 1U7ZA 2WG1A 1HT1E 3G2NA 4V0SA 4R68A 1A9YA 2HRZA 1H2HA 1EDEA 3GLIA 2EWVA 1X2EA 3N2IA 5AXDA 5BORA 1JKXA 3ZD8A 2AF4C 2VJMB 1A9ZA 4BJ6A 3LA8A 4R05A 3B6ZA 4WV3A 3TZ6A 3O8RA 1PL7A 3SQXA 2H0RA 1Q16A 4XVCA 3JTEA 3SC2B 2C5SA 3LMKA 3BMCA 3Q15C 4HDMA 3PUXA 1YCHA 5FULA 4HHEA 1S8NA 3DT9A 4A6EA 4M9XA 1N2BA 4MP8A 5BN5A 3IMCA 3SF8A 1KQOA 1CZKA 2D2FA 4XYMA 1IN6A 4BUZA 5IHPA 4Z1MD 2CD9A 5AKYA 3EIQA 3VU0A 1YB7A 4LE2A 1DAPA 2FW8A 3P27A 2I9PA 4KQ2A 3KTOA 4ZPXA 3V00A 3WNQA 5CA1B 2P8SA 4ICIA 2FP4B 4UTZA 1S2OA 3HFRA 4KI0A 4WOJA 3ZV3A 2G5TA 4UQPA 2EAUA 3OQMA 1DFHA 4CR6A 1L5NA 1CEYA 3C3BA 1YQQA 1GR1A 1PFQA 3OCZA 2CL0X 3O8OB 4O5OA 3R9XA 5HG0A 3JVDA 4QGGA 3UJNA 4EG3A 1WXDA 1T8TA 4LCJA 2ZATA 3KEGA 4EB0A 3NASA 4J0IA 4UHHA 1KQ3A 4FFSA 3U62A 4RQBA 3WIDA 5KWIA 1KP9A 5E2BA 2V4MA 4HEQA 3FJOA 1H0SA 3OOEA 4X91A 3WO1A 3LYAA 1Z63A 1MAUA 2ZU0C 4GECA 2HREA 3QHPA 3UMVA 3BVPA 2C83A 1X1TA 2R44A 2WNSA 1CS0A 1QNFA 4ENRA 2O4CA 1VE7A 1QFJA 2YS6A 4KQJA 4QODA 4EPWA 4XQ9A 2OWDA 1R8SA 1V8ZA 4QECA 1F5NA 4ATNA 1MGPA 1EFVA 2JGKA 3BXZA 2L0XA 3ICOA 1OFVA 4XAQA 4QSHA 4BASA 5EWMA 1MJGM 1U11A 5CVDA 5AXBA 1BFDA 1TXGA 1T1SA 3RIHA 2V3VA 3IULA 5FBZA 5T67A 1A2BA 2W0SA 3I01M 5TX7A 1RVV1 1U0RA 4MAMA 2IYVA 4PAWA 1Y7IA 2FK7A 4HVTA 4U7TB 2QLLA 3BE6A 2Q4BA 3SM3A 3VR3D 3O8DA 2OK7A 2ZBVA 2WJIA 3WTCA 4MP6A 5F1YA 2C3PA 3QVTA 3EB9A 3B1YA 4GS5A 2O8CA 1NXQA 4S2EA 1XZBA 1A50B 1EX1A 4RELA 3WGLA 4L8YA 1Z5WA 4OK6A 4ZQEA 2NO7A 4GPZA 5K3FB 5BRNA 2JLQA 2Q07A 5L4SA 3KOXA 1P8JA 3GRZA 4E31A 5EXSA 1EFRA 1R27A 4HRAA 2B8JA 3HB0A 2BGLA 2PLFA 2BR5A 3UATA 2RHTA 2ZJZA 2JDID 4YHHB 5CUQA 5G1PA 2VH5R 1PLKA 1ZBQA 3AB8A 4M60A 1JDSA 1FSGA 2QZZA 5TF4A 2AQIA 3MHPA 4GXNA 3E5NA 4EG8A 5KQRA 2F9LA 1FDVA 2BMWA 3PF9A 1E2JA 1AQLA 4H18A 4G1VA 1AS3A 3SE0A 1YTUA 1O58A 2E3JA 4G5OA 2UVPA 4BGUA 4CG2A 1YDEA 3GJ7A 3S6JA 4F3TA 4XGKA 4ZZ0A 2Y1KA 4E94A 1U8YA 2NAFA 3F5DA 5FB3A 4B87A 4EPTA 1AN0A 3ZQKA 3E81A 1U3VA 3FZNA 3QXHA 1E3MA 3DLIA 1KVUA 1L7VC 1QHFA 2O0HA 2RHCA 2RH9B 3G0GA 5LP1A 1NC3A 1DBVO 1Z5VA 4FYVA 1PJSA 2Y71A 4KWHA 3LF2A 6LDHA 4NARA 4DR1B 4NCBA 3KFLA 1NHGA 4EF6A 1AZWA 1MO4A 3Q1KA 4EJ2A 1NJ5A 2PX6A 1VB3A 4EENA 4WZAA 3VVBA 1ZCZA 1NP7A 2F2TA 1SKYE 2HY7A 3OEED 4Z9FA 1KFJB 2R8PA 4N54A 4HWSA 4NBRA 3SZMA 2VNAA 2HMYB 1G0NA 1T9BA 3H9EO 1ML4A 2H1VA 3PC6A 5AI9A 5EUBA 4CFYA 3VU1A 9MHTA 3S2FA 4E15A 3SKVA 4Z53A 1X74A 3AVPA 3ACBA 2EQ5A 2ZEJA 4BGVA 1BMFA 2IY7A 3MJTA 4B1FA 2XJ4A 3GGJA 4NLLA 1PR2A 2EP7A 5HF6A 1Z25A 2XUJA 4UMVA 3QHAA 5KNCH 5GONB 1U9IA 5LLTA 1PQUA 3LT5A 4JGBA 3I62A 3EWNA 3RRBA 2DBZA 1F60A 3IEPA 1UJ4A 4GI5A 1YR9A 4MX8A 5KEIA 3SSAA 4Y2VA 3ZS8A 2YXEA 1Q0QA 2X4LA 1J25A 3NZEA 4KVFA 4UOEA 1E2MA 2BGNA 4M0FA 1T9ZA 2QMZA 4HZUB 3AFOA 4X8MA 3RE1A 4YUXA 3DBHA 1SIOA 4QNRA 1KBZA 4WCFA 5KDLA 1FNMA 3B7WA 3H1EA 2RHBA 3AF0A 4LVNA 3ZVLA 4X24A 5DMHA 2DM6A 3IB3A 1GAJA 3NWBA 3JVEA 3KAJA 1FYDA 3SYRA 4YMTA 4R98A 4TXHA 3VR4A 5IPFA 1BNCA 1RZRA 1P2GA 2ZI6A 4QFMA 5HRUA 4Z51A 1UWVA 1P0IA 1JG3A 2ZCUA 5E2IA 1ID8A 2RGUA 3UPDA 4FEYA 1UC5B 3RRFA 3W8EA 3SWWA 1N5MA 4LYDA 2J5RA 2OECA 4KFRA 1GADO 4P98A 3K0AB 1QKIA 2YWXA 1KE1A 2XIJA 3VR2D 3H9JA 3EIFA 3ZQJA 4P4SB 2IHZA 1E5DA 4XRGA 1CDOA 3LT1A 2OB2A 4GEGA 1Z7WA 1QBGA 1S2DA 5BQXA 1YL6A 4EFNA 5K8IA 2NTYC 3AHJA 3F78A 4LRWA 4NK4A 3O95A 4K9DA 1U0JA 4OHMA 4EATA 2GXAA 5LP6F 3MAGA 1DWUA 2FXIA 2TMDA 2Y77A 2IYXA 2AR7A 2X2PA 3MB8A 3ODGA 4MVYA 5JLAA 3AG6A 3ZBQA 2C82A 5H9VA 2WYHA 3SMVA 1UJMA 1FDUA 3IQIX 3QGMA 2QRNA 4ZOAA 5K0TA 2HWWA 1UQUA 1N1GA 4FR0A 2Q28A 3Q7QA 4AU1A 2PT7A 5AT1A 1PFVA 3DHYA 3H5NA 3TIFA 3AONB 3LQQA 2XGJA 3MZ0A 5TC4A 3RUFA 4WWHA 1Q0PA 1ZNZA 2WOOA 2XYVA 3C7AA 3G0IA 2W48A 3KOOA 4M98A 2GB4A 4JU9A 1A5BB 1N6PA 4MW4A 2QXYA 2R8RA 2B61A 4I19A 2N9UA 1FFSA 2YDXA 4GPD1 3AVTA 1H5UA 2CF6A 2GAOA 1O4VA 2WU4A 1KGDA 3BE8A 3PGA1 4HH1A 3Q2OA 4HTFA 4I1YA 1NYLA 5FPTA 1O8CA 1MT0A 2ZDHA 3PPVA 4AYWA 1YVPA 3DZKA 4BQOA 4C7BA 3K9BA 2FK8A 4N5MA 4XR4A 4KQFA 4X7BA 2CFCA 5KVQA 2DFKB 4E08A 3AXSA 4N65A 4OHRA 4P7FA 2X5XA 3IEIA 4E09A 1T4MA 3GHHA 5ICFA 5BQ3A 4OQXA 3IOEA 3R4VA 2JKZA 4OB6A 3EHDA 4PYMA 1RQXA 1E7SA 2PH7A 4J16A 5K8VA 2JGLA 2Y6UA 4QDZA 4QHTA 3O7WA 3PEUA 4JYMA 3VKUA 1QYDA 2JCGA 5TGZA 1LCIA 4BNKA 4DDVA 2VCHA 1J07A 2X9LA 3G8DA 4NH4A 3WAGA 3UTCA 2DR3A 1UP7A 3N58A 3PGVA 1AKNA 2JLVA 1UFRA 2FRVA 4EG1A 3DO6A 2WWVD 4N6GA 1G2IA 2IZ5A 2ZKIA 2Y1OA 3V4FA 1V9SA 3WIUA 4HYYA 3ZJUA 5F5LA 4DCJA 5CIYA 1WEKA 1RCFA 4O2BB 2OCDA 4F3NA 4Q4HB 1Z7BA 2QSJA 2Z95A 5ALYA 3OOHA 1GNPA 1E9BA 4KUGA 5DP1A 1F1JA 5BOVA 3ILVA 2CVOA 1X80A 2HAEA 3RSCA 4NCKA 1C9KA 1GZ4A 1WZUA 2DUMA 2ZG6A 1GZUA 3ABQB 4I55B 4EI2A 1OASA 1D2EA 1BFKA 4C89A 1P0PA 2IOFK 3H75A 4ZHQF 1U2GA 4G07A 1GYRA 2GFIA 1MQ8B 1WR8A 3OPNA 4MKGA 4XIFA 2NVUB 3EG9B 1FJGB 3AVVA 3N0WA 2JJ2A 1GITA 1PJRA 1XLUA 4EBBA 1MENA 1NKVA 2JIMA 1NE7A 2GCOB 1JXAA 1NUPA 1THMA 4UBOA 4G97A 3A1DA 4F9TA 1NG1A 2V9ZA 2CJYA 1CF4A 2X7JA 5C53B 1HMYA 2PIAA 4V3CA 5D3MA 5FV7A 3NC1C 1N8TA 2GPNA 3I9V1 5HFNA 4YRPA 1BVUA 4FW8A 3PHGA 5AYVA 3MA0A 3M3DA 3TXXA 4F92B 4LY9A 1GAWA 1XL1A 3HCEA 4R81A 3IJEB 1FU7A 2LUOA 3KRTA 4PGGA 2OFFA 3VYWA 2WUVA 2H1FA 4XJXA 2CDBA 3S1SA 3ZJYA 4EG5A 4EJSA 3FYUA 1U31A 4C7KA 2H5IA 3LWNA 3I6IA 2B1RA 1UC4B 1FP4B 2BE9A 3RUCA 2I78A 2OCYC 1XVLA 3AILA 3BB4A 3KE9A 3A6PC 4NYIR 5EVCA 3PUYA 2RKOA 2F3SA 4MHSA 2FMKA 2XWSA 3TW0A 3VU8A 2B9VA 4I4TA 3B6JA 1B8VA 3GELA 4FBLA 3R3SA 3OX1A 4G5QA 3PWZA 3PVSA 4DDTA 3GRKA 4ZYXA 3EXEA 2IHVA 2OHHA 1T8YA 5J9FA 4D9IA 4DUGD 5I6DA 2FG7C 1H0HA 1CDEA 3TZQA 2GCEA 4TUYF 3M34A 3RAJA 3K5IA 4IIEA 5GIOE 3E2IA 3IHWA 3LL7A 4NE2A 3GFGA 3UV7A 5FWYA 5AK5A 5BOSB 3EPJA 1AS2A 4LF9B 2J9XB 4KXLA 2GKOA 2YWJA 4NZOA 2WF5A 2GAAA 1LBQA 4Q19A 4RWZA 3QI7A 2YHIA 3NWJA 5JSYA 3RD5A 3PXCX 2XMRA 3LA6A 3ZK9A 2NUAA 2QZ4A 3ENNA 3EQ9A 3GFBA 3P4YA 2D1RA 4BX0A 2F67A 4NCAA 3KZNA 4FJ0A 1YHNA 5KHOC 2HDNB 3L07A 3R7WB 2Z57A 4G65A 3H83A 4RGVA 3EFHA 421PA 1LW7A 4RD6A 5DT9A 1I0IA 4FEGA 3VQTA 2CJWB 3FVRA 1PZFA 1V7QA 3OEYA 1FFEA 1M2GA 1B43A 1E2KA 1GPAA 2J3HA 3COWA 3G82C 3O2SB 3PICA 2AZ4A 3QNUA 4QU9A 2G28A 4OKSA 1KAMA 1DQSA 1NN5A 1PDOA 3NUZA 3VUEA 4I9FA 2V7BA 1J06A 4DM3A 2C5BA 4F2DA 1NNI1 3O74A 3JQ8B 1C81A 1CVIA 4NBVA 7GPBA 2GEDA 2QTTA 4HDOB 1DCFA 4TMVA 2RK3A 3FSGA 4MRMB 5HE9A 4II7A 4MVJI 3TLGA 4N41A 1L8AA 2D59A 2JEZA 1LDBA 1RW4A 1W9MA 4JASB 4M7OA 2C4VA 1Z0UA 2B1JA 4Z0NA 2MYNA 3PEEA 2XEDA 2P3LA 1VIMA 2VSXA 3PUIA 2VF8A 5COQA 4B4UA 5B58C 1ZIDA 1KOFA 5E0OA 3AOEC 1NLUA 3BWYA 1EFDN 1Z7EA 2LE0A 2WUFA 3OE7A 4PLFA 5CG2A 2VDJA 1CBUA 4UBIA 3UT6A 3TB6A 3LHKA 2HNKA 3CSDA 1HLFA 3UUFA 3VH4A 1I1QB 1O57A 1LRLA 4BFUA 4LZOA 2VEOA 1GY8A 2ISQA 4HWRA 4UATA 3PR2B 1E9RA 3IDSA 2HCRA 3DR5A 1PL8A 2WJYA 4BL5A 1S7CA 1NUTA 3IHKA 4DSTA 1KRHA 1J99A 1N2EA 4QUJA 4DLZA 5JBIA 4FGSA 4X5OA 1VGVA 2VYVD 1HZZA 2AN1A 4AMUA 4DYHA 5IVPA 4GWKA 1K2VN 1T2DA 1X92A 4G4GA 1N1MA 3W5VA 4D9NA 4BO0A 2LVBA 4KDCA 4C1BA 2HMAA 4J3JA 2FY8A 4U5XA 1DRJA 2ESRA 2ZAGA 3GLUA 3D02A 5DI3A 2AN3A 1OD6A 2X1LA 2Z43A 3UPTA 1C1XA 2BD0A 2JDIA 1QK3A 1TJNA 2XKAA 3MBOA 2J3JA 1YAJA 3O31A 1P4GA 1U2DA 3OECA 5ITZB 2IOQA 3N70A 3EHEA 5AUNB 1T2AA 3EAFA 2WNIA 4WFJA 1PQ4A 2FJUA 5KOIA 1PT6A 3TTVA 4F6RA 4BRUA 4JLJA 4G0OA 4EHAA 3KHUA 5C1DA 1L4EA 4LF7B 1DC8A 2AGVA 2R66A 2W6OA 4BNYA 2QXUA 2OLKA 3AR6A 1X77A 3REQB 3R23A 1J1ZA 1OZAA 1T1RA 1XAIA 2VQEB 2BFNA 2OV4A 2W8BB 3E9EA 1A9TA 1G9SA 4R0NA 1A88A 3E6AA 1N36B 2HK8A 3PZRA 5ALRA 3IUBA 6AT1A 1XD2A 1IY1A 4RZIA 1O95D 2WE8A 2C96A 4IS2A 3UEOA 1XCGB 1BWQA 3DL7A 3RIEA 3O8NA 1GGHA 2WDZA 3ROFA 2R0QC 3M7IA 5ETJA 3OIWA 1U0NA 2B6NA 1SWWA 3LM8A 1RRFA 3CMCO 2W98A 2W2PA 3GD7A 2MR6A 4Q1EA 5JWRA 3N2KB 4NMLA 4DCOA 5LQDA 3KOWA 4KLRA 4PC1A 4XE5A 2BISA 4MJLA 2M1ZA 1ZLYA 1EM6A 2Y1XA 1R8JA 4ZQBA 5BURA 3B52X 4YBRA 3MUFA 5C18A 2F4NA 3QNMA 3G1UA 5CX1A 3DOIA 1J5XA 2O2ZA 3WL5A 1G8HA 1JQ3A 2RDMA 4N01A 4G4SO 5HZHA 2NP7A 2A0WA 3RFUA 2E82A 2PGDA 3FFXA 3G2OA 3TCKA 4QYMA 3V80A 3O4IA 2BEJA 3PHJA 1KDZA 4ZJUA 1WV0A 3IA2A 1QCYA 3DBRB 1AKWA 1NVTA 2RKBA 4IZOA 4ZVPA 3LX6A 1OX4B 4RW0A 1KOLA 4EB6B 5I45A 1GSHA 1QGUB 1E1YA 2FZLA 5MN4A 2YJ5A 4B5LA 4B48A 5K8LA 2IV2X 5DNUA 1ZA2A 4MTCA 3VM6A 3BXPA 3Q88A 2BPOA 1T10A 1TEVA 2NU7A 1T5DX 2QVXX 3RQIA 3HKCA 4XFKA 2AN4A 5FR1A 3V7WA 1GDHA 3C85A 3QELB 3WWOA 1C0IA 4H15A 3UGQA 2C4NA 5C37A 1ODTC 4LV8B 2C2ZA 3A4NA 1SGWA 3H5IA 4OYLA 4DGQA 3OLQA 2E49A 2FP3A 1M1XB 3HJNA 1RTTA 4ODIA 3PHIA 4ZKEA 3WJ7A 3AJ8A 4PHHA 5BR8B 4PLZA 1UFKA 2Y0EA 5TT0A 3W4IA 1V6CA 2JBAA 3HGMA 1D5WA 1UUFA 3UOWA 2HU2A 3I5UA 4DDHA 2AMYA 1XVIA 1YS2X 5LMNB 1OLXB 2IYNA 1U9JA 3EY4A 4MR9B 1VLZA 1L7QA 3QXGA 2ORED 5K0GA 5F98A 1LEHA 1PF7E 1Q92A 3E9ZA 4PBTA 4PE5B 4ZI7B 1EFHA 4AY2A 2OLJA 2I2CA 1T9GS 4L4YA 5GONF 3IRUA 4LDQA 4I46A 4KOAA 2MINB 1FFYA 3HZRA 3CRW1 2XV1A 3RT7A 5GZ3A 1NOKA 1I94B 1YZKA 4DLYA 3M49A 3GLTA 4HB4A 2VJKA 1RKQA 4CIYA 2EKPA 1ZK4A 5LQSA 1FDTA 1WSAA 3DOFA 1C29B 1D2NA 1EWTA 1OPXA 1CY2A 1ONOA 5KTOA 2AC2A 4J0EA 1W1WA 3F3SA 2ZRMA 3QX7A 1XKXA 4A5OA 3X1DA 1UMKA 5BUQA 2WD7B 2XWJI 5K9ZA 2IEZA 2PA3A 1SCUA 3SXUB 2PMWB 3FTFA 4RPLA 1UOOA 3SEZA 1F06A 2XQKA 2X0DA 3RS4A 1VCNA 3TZEA 3NM5A 3D0RA 1I4LD 4GKKB 5ALOA 3Q85A 3UHAA 2FLKA 3HKDB 3T9AA 2O8NA 4AL4A 1Z3CA 2QT1A 3E84A 2DTXA 4US2R 1N34B 1C1DB 1SXJC 3GAFA 4LZJA 4OFWA 5K8JB 3OJOA 3GLVA 1SVNA 2PHZA 3ONWA 5EIAA 2VWQA 1VBFA 3OT1A 3SEFA 1MQ9A 1W2GA 1RYMA 3Q5EA 4HDQB 4PR0A 3R3JA 4MLCA 4KSCA 4RMIA 3SY8A 4M0MA 2WIDA 4RSRA 4UJ3A 3OQVA 3ZNOA 3QMPA 3UUWA 4C7VA 2YV3A 3A6GA 4MRAA 4DY4A 4YJDA 4BXOB 2B2XA 3S2ZA 1GQOA 4LMBA 5G53C 3DZHA 1RLMA 2YQZA 4B6JA 5JNRA 3KQNA 1YZLA 4LNAA 5BPFA 3OZSA 4RLHA 3UMMA 2FYTA 2GJSA 4NPHA 2D00A 3ZW7A 4YT2A 4M0CA 1YKFA 2ARKA 3JD1A 3T9CA 4EEZA 3BRCA 3ZJTA 5FO1A 1E98A 2J3EA 5LWQA 5KWJA 2POQX 3GUUA 2PKEA 4NXMB 3WGYA 2CLEB 2VPZA 3EODA 4NCHA 1Z38A 5L7WA 3RJ9A 3EXIB 3A1UA 4FK8A 4MPJA 1S9HA 2OAP1 4XRRA 4F4CA 4J0JA 4BNFA 2CSXA 1VZ2A 4KO8A 2FR8A 3AP2A 3UY4A 5LQKA 5NULA 5FBLB 3RAGA 2NUBA 3WXMA 2PUAA 2G7MC 1FYWA 5A3SA 4BC1A 1SN7A 1SB8A 3ZNNA 1JEOA 1ZLXA 4P2BA 2WPDD 4RFVA 5H3LA 3ZIAD 1TJYA 5FNZA 1CLEA 3AO0B 1ZK3A 2H6EA 2HPHA 4PSKA 3A6JA 4C7MA 3A26A 3F6SA 3PQ8A 4QTZA 2EGGA 1IE3A 4MVJE 1XF1A 4A8JB 2YFQA 3NHMA 1ICIA 2ZBRA 1WP4A 4AUEA 2FUEA 4UCQA 2QGZA 4KU4A 3RSLA 1BU5A 1NW4A 1XTQA 5CD1A 2ZRQA 1OFUA 2C5EA 2HTEA 4B84A 1IB6A 5F33A 1N3YA 3ORSA 3L7CA 3OOWA 2YMPA 4CNBA 1HQKA 2BELA 1V2GA 3I09A 3NRBA 1CG6A 5KTRA 4AZSA 1L1QA 2V03A 2J5XA 2IU4A 1X3SA 2HQBA 2EZTA 4X95A 3DBOB 3HL0A 3LWDA 3PIRA 4W82A 1T8PA 4K1LA 3ZW8A 3AESA 3TS1A 1EEXB 1ESNA 3R5XA 3OPYA 5KNCA 3OPXA 1WSWA 4YXWA 4A8PA 1PO7A 3J81k 4PLCA 3U81A 3QVGB 1UAYA 4IEIA 1G64A 2P0AA 3H8WA 5LU8A 4TYPA 2OKGA 2VPQA 4UTRA 1EGHA 4QXAA 1CQWA 1TVMA 2BFPA 2DU8A 4PIMA 1IN5A 2GF2A 4XQGA 3ZUGA 1TGVA 4I55F 2I6SA 3LFUA 4ESOA 3MBIA 1LPMA 4NBLA 1S8OA 3FOEC 1E2FA 2RGEA 1TYDE 2O23A 1XZHA 1MQSA 1GSAA 2VJDA 2VA8A 3LHSA 4ZTBA 4Z2YA 3ZDFA 1G2OA 2HR1A 1NC1A 5AIAA 1WXXA 5F9FA 2GN2A 1SUBA 5K3OA 4GOXA 4UVEA 5FTNA 1W0KA 2KSQA 5DYGA 1VI5A 1XZJA 1LUAA 4AURA 4AY4A 4H1WA 4UHEA 5CH3A 4WI1A 3GLFA 2R1UA 5IKEA 1CZOA 1ZNXA 2ZUCA 1IZ0A 2EBWA 3UG6A 5JLJA 4OYRA 4ZICA 1Y1RA 4TWJA 2VRNA 4ETIA 1JG4A 2OQRA 4BBJA 3C3KA 3KNZA 2CV2A 5D86A 2E89A 3Q0IA 1P1IA 1E0DA 3PUZA 4X6XA 4KACA 5FHRA 1FUUA 2E0IA 3A1CA 4MVJD 1C14A 1O77A 4BQRA 4PINA 3HDJA 3S28A 3PGLA 2PSHA 4CTMA 1EUCB 1V7ZA 3P52A 3SXJA 4C07A 1L1EA 4V0QA 2VHVA 3FPEA 5ERGB 3EULA 2EW2A 2O2DA 2ZQYA 3NT5A 1C9MA 5HE8A 3UB4A 4Z49A 1TVKA 4O5AA 2W8ZA 4IDCA 1WL8A 1C4KA 4TX1A 1CUBA 3HJRA 3EC1A 3KUUA 5JCOA 4BTVA 5JT1A 1RXYA 3UC5A 3UUGA 4E1AA 4Y7CA 1FDRA 2NAPA 4I8DA 4OUDB 5DLQC 4PHTA 4IHAA 1SXPA 4Q4DA 1QX4A 4RPJA 1XSEA 2HB6A 2ZW9A 4EUNA 5K09A 4ITRC 4XGIA 5I9TA 3LZDA 3SDZA 4C2UA 5L7TA 1HDGO 3T5GA 1E1CB 4JBNA 5AVXA 2Z6UA 3WGTA 4F93B 1OFHA 5TDHA 2BFCB 3K0CC 4DXHA 1HR0B 2XE8A 4LUCA 3HDHA 3KTAA 2EQBA 1UANA 3AUKA 4C7OB 3AEYA 2RH4A 3HU1A 2JHFA 3FSRA 2PAAA 4P36A 5FAKA 1X1EA 4H7DA 4EAAA 3VC1A 2QXTA 3FX2A 2PX5A 3FUUA 4NDAA 1Q19A 5HX7A 5LBIA 4KXXA 3IT2A 4MWOA 2VK2A 1KPGA 3RKUA 3TSYA 3VNAA 2D4AA 3F97A 1E59A 2ZB2A 2GNPA 3RU3A 4FIZA 1HSZA 3RF7A 1LX7A 2PJUA 3D6AA 3TB4A 1UADA 2QTBA 1OXBB 1EUDA 1GA4A 3HUFA 4F06A 4G67A 1XTUA 3X1YA 4DLXA 5M2QA 1A8HA 1LGYA 3QKSB 3GLGE 4R84A 4L75A 4D5GA 1L7NA 1GPH1 1GD1O 3TSWA 5LB2A 1JAZA 1XJ0A 1GYPA 1AUVA 2I33A 2IT1A 3BZBA 3KU4A 4OFZA 3ZYCA 1A5TA 1YQEA 2W83A 1KYYA 1OZ0A 2HX1A 5F1KA 2VQDA 5C7OO 1GU0A 2G36A 3AIOA 3D6NB 4YRJA 3SJCA 3T4XA 3THSA 2JD2A 1F5SA 2Z6VA 3I64A 3GLGB 1CV2A 2VKQA 1TMYA 1VXRA 4QJ3A 1TMOA 2G8NA 2V96A 3FPAA 2F9MA 2W4MA 4ZJYA 3K8ZA 3BHIA 2VDQB 4CTOA 4I08A 5IT4A 5B3KA 4ZCLA 1YE8A 1NSTA 1XKQA 1LXCA 1Z4LA 3EBPA 3PUHA 2VDPB 2QENA 4OV6B 2I2WA 2RHMA 3G6WA 5F76A 3W5UA 3BFXA 2CFIA 2YZMA 1O95A 4C4TA 4CKCB 3NRJA 4NZ9A 4Q82A 4QO7A 4A2CA 3U60B 1TCVA 2QX8A 3QYAA 2F43B 2IITA 3EOBI 2WSMA 2RJOA 3STVA 4EYKA 1J2YA 5DXAA 4A2QA 3TKLA 4E5KA 1O8BA 3INYA 5HF8A 3RNOA 2ZSJA 3COZA 4R16A 4ZCPA 5M3BA 5MFPA 3GEBA 4EBFA 4HR7A 1J0EA 1NIPA 2GEUA 5KSWB 4OOEA 3GVCA 1X0VA 2BN4A 4J1SA 4KC0A 3SKYA 2LD4A 3RF6A 3GYGA 3LAWA 2ZPTX 4F97A 1OFIA 1A2OA 5TIIA 5CT4A 4MVCA 1VLHA 3HU3A 4D0SA 4M1TA 2EFYA 2ZAOA 2AFRA 4O2AA 4LDRA 3LP6A 3ZVNA 2NT3A 3EZLA 1DAEA 3RHTA 3JQ6A 3MFYA 3GCGA 4B3DA 3GN1A 2QL6A 2V4UA 1MABA 2FOLA 1I24A 1VLMA 2IIBA 2JJMA 3WDLA 1GLVA 5KYXB 2YUIA 3CW8X 4Q1DA 1A8SA 3I52A 4KXUA 3EVGA 2JK0A 3F98A 3GWZA 2ZYIA 2N42A 3NXSA 4Y1FA 1DFGA 4ENWA 1EP9A 2IE0A 3D3JA 4IDHA 4YAJA 5JI3E 1HG1A 1GTSA 3RHFA 1B14A 1EU1A 1ZN2A 3IIKA 4EO4A 3NDBB 5IDVA 1IHOA 4XOIA 2B8NA 2P6NA 2VIIA 5ELXA 2SECE 4ROSA 3ZGVA 4ZQGA 3B1KA 4TRJA 3WMWA 3IUEA 4RE5A 1SMKA 3O75A 1ZGHA 3TLAA 1U3GA 4JXZA 1VSUA 3SHFA 1MH9A 1I51A 3FWPA 3ZVMA 1XTJA 3KUCA 2QI9F 4FT4A 5DM60 4WBXC 3SHOA 3LNCA 5CLHA 4B46A 4LJ4A 4D97A 2QD1A 3P9RA 3OA2A 1E2PA 2Q3FA 2XBLA 3ESAA 4GR9A 3K0FA 4JT2A 1VLQA 2NUPB 4UDOA 2DCUA 4YRKA 4ENTA 3TVYA 5JWHA 2ZYVX 4GPIB 3DMTA 2XCOA 3OT5A 3TTYA 1UK7A 1DQPA 2PGOA 4X1IB 5TR9A 4IY1A 1QGDA 5GJVC 4DLWA 3NX4A 3LF1A 3RIGA 3FMGA 1NBME 2WJ6A 4UXIA 4WMLA 3M70A 1NI3A 3SFZA 3ZKAA 3OLZA 2M98A 2X3FA 3DFKA 2DTEA 1FXSA 4PR3A 5EZ6B 5JMOA 2VDLB 1VHWA 3ZWCA 4RJIA 5DK4A 2FW7A 2ODQA 5FPHA 4ND2A 4C4PA