2GILA

Structure of the extremely slow gtpase rab6a in the gtp bound form at 1.8 resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
161
structure length
161
Chain Sequence
FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the extremely slow GTPase Rab6A in the GTP bound form at 1.8 resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-6A
total genus 52
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gilA00
2VH5R 1R5BA 3VQTA 3KQKA 4QFMA 5JJKA 2WMNB 1NVUQ 2O8FA 1H8EA 1R2QA 1TU3A 4AIIA 4QGGA 3SHFA 2OHFA 2RHDA 2YC4C 4HZUA 1ESMA 4JT4A 2RKOA 2QE7D 4PHGA 2FSIA 4U00A 4F4IA 2YWEA 2PJZA 5F9FA 2CBZA 5IHPA 2A5FA 1H8ED 1DO0A 2FSHA 3LV8A 2XZOA 1I4LD 3LBIA 4JVLA 4MDEA 1JQJC 4PC2A 2IHYA 3IQXA 1AS2A 4JLDA 3G0HA 1OH7A 1A2KC 3MCAA 2ZR7A 1L4YA 1YR6A 2NGRA 2ZRLA 3GFPA 1NL3A 4ZPXA 5KYKA 2ASEA 4JVNA 2MMCA 1K8RA 1C9KA 121PA 2O0JA 4LC1A 3D6TB 4LHXA 4ZV4A 3AH8A 2WSSD 2W2TA 3HR7A 3B7GA 2DB3A 2VO1A 4Q9HA 1A7JA 4M2LA 3THWA 2QTVB 3Q9LA 3WMEA 3KUDA 3OEED 3SE0A 3CIOA 3QKSB 4MKGA 2OESA 2ZS7A 1TU4A 2ZUDA 1JALA 1GKYA 4M1YA 2VHQA 2CK3A 2JGNA 2OG2A 3FB4A 1Z47A 2ZPTX 2WV9A 1NLZA 5CITA 1GL7A 3HPRA 3PUXA 4GI7A 2AHOA 4A15A 2XZLA 1QDEA 3LBHA 2ZRJA 1SVLA 1U8ZA 1ZNXA 2CVHA 3GLHA 2NPIA 3Q3JB 2GEDA 2J3EA 4AI6A 4PC1A 4A0HA 4UNPA 4D82A 4MH0R 4NCJA 4DLSA 4KSBA 1H65A 5L3VA 1Q12A 4LYFA 1XP8A 3TMKA 1EWQA 1GG2A 4JS0A 2GJKA 2HLDA 3IEVA 3X1WA 1Z0DA 1DTSA 1F3OA 1UKYA 2O0HA 2P2LA 1JR3D 3F3YA 4OBEA 4UKDA 1XTQA 2NZJA 3ECCA 3QXXA 4L8GA 3RDPA 4Q48A 1QHSA 5KNDA 4TMZA 1RYHA 4TMVA 1UAAA 4B71A 4FI3C 5FBWB 5CB8A 2G0NA 2GVZC 3CZPA 5HE9A 1Q3TA 3CKLA 4DIDA 2GESA 1NP6A 4DKXA 4EIWA 2ECKA 4V0MA 4UNRA 1X8KA 4IDQA 4Q7MB 2H92A 5AK0A 3G82C 4URUR 4BGDA 2O8FB 2C98A 1ZAKA 2CVFA 3DM5A 2ZROA 721PA 2NO7A 4B3CA 4CEJA 3EC2A 1NVVR 2GETA 3CBQA 2V3CC 1WQ1R 2G9NA 3H4MA 1GNQA 2ZRHA 3KKNA 5JECA 1SULA 1Z07A 2NQ2C 3TUIC 4KLNA 1FMJA 1KY2A 3FVQA 2OO7A 1MV5A 3RS5A 1AN0A 2ZREA 3R8FA 2JDID 3TR5A 4NONA 3U7FB 1QHXA 2JLQA 3GJ4A 5C4MA 4GP6A 3EA5A 2ZRCA 1M8PA 3CRMA 1G8YA 1ZBDA 5J47A 3OE7D 3UMRA 1HQCA 3QXHA 2H1LA 3BRWD 1E0KA 5DLQC 2ZSAA 2R9VA 2YWFA 3CH4B 3MFYA 2CNWD 4HAUA 3ZZUA 1EFHA 1N6IA 4QRHA 5FL3A 3DKVA 4NZYA 2R6GA 3A4MA 3RSOA 2RAPA 3LD9A 3GEHA 2IS2A 5FPYA 4PC6A 1GNPA 2VIIA 5EE0A 3IGFA 3WRXC 2P6NA 1GIAA 1GITA 2OBLA 3WYGA 1E1QD 3BH7A 4B73A 3KXIA 4JLNA 1HV8A 1KKLA 2Q3HA 4DSUA 2DPXA 3AF4A 1FZQA 3AVQA 3LVRE 4KODA 1Z0IA 4P4UA 2CL7X 2DFTA 4IVPA 2XXAA 2ZRPA 1IY2A 3JZMA 5AJVB 2B6HA 2VP5A 1TF5A 1T0JB 2XB4A 2ZVQX 3LXRA 3PUWA 4KVAA 2JIZD 5FI1B 4NTZA 3W90A 2VHTA 2WBLC 3KFVA 4OHWA 1MOZA 3CX8A 4B2PA 1W46A 4PZYA 1QBKC 3L0SA 1FNMA 4I1UA 4KAXA 4DCNA 1JECA 3AVWA 4R71A 3R8CA 3R9IA 4F4CA 1GL6A 3NDPA 3IO5A 4M1MA 2FX3A 4PHHA 4AKGA 4C9BA 1JPNA 1VECA 1G4UR 2QAGA 4JLMA 1XJCA 4G5RA 2BMEA 3M6AA 1ZM3A 4HLUC 4LDJA 1WA5A 2HXSA 4QXAA 3MD0A 2FWRA 5DN6D 3OFND 2F1RA 2IS1A 1G64A 3VMFA 3FOZA 4O3MA 3PQCA 4ASUA 1NN3A 2NMVA 2C8VA 2J7PD 2CCJA 3DEFA 2O8EA 2C9OA 2QTFA 1IONA 4WXPA 3LX5A 4MDFA 1SHZA 1T0HB 1WDTA 3RAPR 4A8JB 3ZVMA 5EJEA 1OHHD 2P6RA 3IKJA 3LY5A 2G83A 3C5CA 4MRPA 4IEEA 1LTQA 3ZVNA 1R10A 3GD7A 1OKKD 4OQLA 1Q20A 4CEIB 1KMHB 3CPHA 5EE1A 3V4RA 1P61B 1U99A 5J5CA 3GLGB 1Z22A 1U98A 4QGHA 3QXSA 4ARZA 3UG6A 3K09A 1GDDA 3ZH9B 1BMFA 1U8YA 3REGA 2CLSA 3UANA 1E1RD 4AY2A 3FHOA 4Q18A 2QY9A 3ETLA 4C0BA 2E1RA 4I4LA 4JIMA 3B85A 1XRJA 5KO2A 1BKDR 1MRSA 3VKGA 1E4VA 4JBYA 1KIMA 1W4RA 3CPEA 3QVUA 4R7ZA 1YZGA 3SFZA 4EPVA 2BJVA 3QI2A 5FPTA 3VR1A 2CLCX 2P5TB 4AD8A 1OE0A 2ZETA 3KTAB 3BXZA 4WVFA 4IFBA 2BCGY 1NLYA 2Y8EA 4JJKA 1F6BA 1S0UA 2ZSFA 3I72A 4JBWA 5DISB 3TW4A 3RHFA 3W5IA 4M9SA 4HAXA 4HAYA 3PV0A 1G17A 3W9YA 4DBLC 4BQSA 2G6BA 3CF6R 4EDHA 4B34A 4Z54A 4AYWA 5AJXA 4K81B 2XNDD 4BEBA 3W6OA 3MJHA 4HAWA 4IDHA 2W6ID 3MWKA 1AQYA 1M7GA 2DYKA 2OEPA 1E99A 3JZAA 5DNYB 1W2GA 2A9KA 3R7WA 2V55B 1XF9A 4AG5A 2EVWX 3MWJA 4YMWA 1JXMA 3UWOA 1TQ4A 3EWAA 2BV3A 2ZYVX 3K0AB 1G6OA 3GQBA 5FUYA 3QXJA 2ODEA 2OAP1 3L82B 2UZIR 3WBJA 3DMDA 4HB4A 4POAA 3SHWA 2P65A 3BE4A 3EASA 1YZTA 2WJVA 1K5GA 3NC1C 2ZVPX 3RS4A 4XJXA 2CCGA 2R8RA 1MO5A 3UXMA 5EUMA 3N70A 4GNKA 1C1YA 4RVCA 4QBHA 3UIEA 1XB2A 4JLAA 5CLQA 4MUBA 3ZQ6A 2GCNA 4TL9A 1SXJB 1XTRA 2O0KA 2OFXA 4US0R 4ZCMA 2FN4A 4LYHA 1CJKC 2W2XA 4L15A 1QZXA 3KJIA 3TQFA 1EESA 4F93B 1KO8A 4CDGA 1Q22A 2ZR0A 1E3MA 3VKWA 2ODBA 4K8OA 4LBZA 3LQQA 4BLPA 5HKKA 4XWKA 1OW3B 1PV4A 1CR4A 3S1AB 4NYIR 2W6JD 4BRWA 4D4MA 4GPTA 2W00A 3QSYA 1S3SA 3EA0A 5E4FA 5JJLA 1J70A 2PZFA 2WZQA 2XSZA 4Z8YA 2DWOA 2GZHA 3U4QA 2ZRKA 3CRRA 2IF0A 4LJ8A 4XOIA 4ABYA 4JKIA 4CGZA 3DZDA 4M22A 2VP4A 1MO6A 1R8SA 5L3QB 2W6IA 4TSFD 2ZUBA 4HUQB 5F3WB 2VP9A 2YOGA 3BOSA 4KFTA 1JR6A 1E0AA 4F92B 2NTYC 4B32A 4C2UA 2R6CA 2AR7A 4B76A 4S2EA 3TE6A 3CR8A 2GNOA 1GKUB 2BJWA 4DLYA 3Q7PA 3NTUA 3OE7A 4IW3B 3RABA 2XTMA 4HUTA 1RRGA 2W2VA 1IQPA 1E2MA 2FFHA 5BYKA 1LB1B 2NG1A 4H1UA 1DBSA 1Z2CA 4NE2A 5GVRA 1ZMXA 2XNDA 3FFBA 3WMGA 1Q21A 4GMDA 2WWXA 4JYCA 2CCKA 3GPLA 4W9MC 1UM8A 3SYKA 4DEXA 5HE8A 4D4JA 4QNMA 3SNHA 4C4PA 2H5EA 4ESHA 1FNNA 2ODWA 2WWIA 5AJZA 4NCIA 1Z8FA 3CX7A 3EW9A 2FEMA 4NYMQ 1Z6YA 1DEKA 1N6RA 1TUEA 3B1VA 3WHLA 4OHXA 1EGAA 4NMMA 3VR3A 1L2TA 1UFQA 4LJAA 1DS6A 3EWSA 3ZGXA 3K1JA 421PA 1DAHA 3TRFA 3C7KA 1R0YA 2G1JA 1Z28A 1E98A 1YQTA 3UWKA 3I4LA 1KO1A 2J0UB 1KI9A 3EZ7A 3K0CC 3SI7A 1AA9A 4AC9A 1DAKA 2J7PA 2IC5A 4M1TA 4UXHA 5J4LA 3FHCB 1NMYA 4Q66C 2JLWA 2PT5A 4AYXA 1B0UA 4FMCB 4S35A 3I32A 4LBVA 4JL6A 4HEJA 2B8TA 4RY2A 4CEIA 4IEIA 2G77B 1W5TA 3TJZA 3MWLA 1OIVA 2MMGA 4PANA 3KQLA 2QI9C 4GT1A 1E2LA 5EXSA 3AM1A 1J8YF 2C96A 4HB0A 2ZYUX 3REFA 3T06B 1Q1EA 4D80A 3ND9A 5GADl 3FKSD 4BWYA 3N2EA 5A5GA 2FPKA 5C1BA 1AS3A 3MWYW 5EP1A 2VA8A 2JA1A 2DBYA 4D6PA 1UADA 1EWRA 1G8FA 2C9YA 5CYOA 2O8DA 2RB4A 2J41A 4JLBA 5BYJA 2R6AA 2EYQA 5K8UA 5ANRB 1MT0A 5EZ5A 3A37A 2PLFA 2FEOA 3TSOA 5GJCA 3IBGA 3U3RA 5JRJA 3RYTC 2FFBA 2GZDA 2WJJA 2F1JA 3D8BA 4GRAA 5P21A 5TARA 4P33A 3VFDA 1COWA 2Q6TA 5CM9C 2GF9A 2VHCA 2DFLA 1TQ6A 1JPJA 3PENA 2BKEA 1DAGA 3GLIB 2RGEA 4HZUB 1CJTC 4G5GA 2NOAA 1XEXB 3K8YA 4PZLA 1ETUA 4HZIA 1IN8A 3PITA 2RGBA 2OBNA 1ZD1A 2QP9X 1PLKA 2GCOA 4Q00A 1CR0A 4CYMA 5FPSA 2JIZA 4LHZA 1YZUA 5A0FA 4CF7A 1DE0A 2R62A 3ZJYA 1PUJA 1W1WA 4UQOA 1VG0B 2PCLA 1D8TA 3FDIA 3ADCA 3AF2A 1O87A 1N6LA 2JCSA 4ESVA 2QEQA 3NBZC 3W8RA 4DDUA 3ZVRA 4Q4HB 2I3BA 3N2IA 1EFTA 1EFRD 1ONBA 1UPTA 4M9QA 4PSAA 1KSGA 4V0KA 3TKLA 2D4HA 1NKSA 2HDNB 1RRPA 2VEDA 1Z5ZA 2A2ZA 4EFMA 5EE3A 2VSFA 1FFHA 3TVTA 1NBME 3RNLA 3GLIE 4PO8A 4Q9KA 4YMUA 4O0MA 2KSQA 3DOFA 2OFOA 4Q1AA 5D3QA 1E9EA 3KL4A 4PC7A 4GDFA 4M4SA 3K0EA 3VR6A 2E9SA 3SDZA 4PZZA 4QKQA 5BW8A 3SJAA 2KWIA 2ZS9A 3OESA 4LYAA 1JJVA 5FI0B 2WWYA 3QKRA 3A8TA 4Q4HA 4D26A 4QJ3A 2GCOB 5CK4A 3B6EA 3PFIA 1S4QA 3X1XA 1ODFA 5LB2A 3CX6A 5C4GB 4A6XA 1PVOA 1N6NA 2BHRA 4NCHA 4LJ9A 1QG4A 2IT1A 5JS8A 1N5LA 1W47A 1E9SA 1NBMA 1Z08A 2WWWA 2QG6A 5FOXA 5KHOC 3GLIA 1G5PA 1I2DA 5KPDA 2OZEA 4PSVA 4BRUA 1RIFA 2BIFA 2YHSA 3CM0A 1ZM2A 4X8MA 3AP1A 4IRUB 4OI2A 2JLSA 3B82A 5IK2A 1R8QA 4RD0A 1T3LA 2FGKA 2Q9AA 3BB1A 4US2R 4XWAA 5FTKA 2BOVA 2VP6A 2RGNA 4XVQA 4FN5A 3Q5EA 2ZSBA 4B6FA 4KLZA 5BN3A 5J4VA 2OSBA 3GLGE 1EG7A 3TAHA 1FP7A 2RGAA 4LHWA 2J0QA 5B2ZA 3I73A 3Q7QA 4KXFB 1IJEA 4XTCS 1NIPA 1F5NA 2IYUA 2NZ8A 2R44A 1CR1A 3J81k 2V7QA 3BJIC 3FMIA 4RD1A 2RGGA 2XJ4A 3C15C 1YJ5A 4NYIQ 4WAUA 1OFTA 5JEDA 3P20A 5HZKA 3FTQA 1VCMA 5FTLA 2YZ2A 1RE0A 4CT4B 1EXMA 3ZZTA 3OEEA 5JZVA 1QHHA 1W36C 3RRNA 1RFLA 4BZPA 5IF9A 3DKPA 4J0QA 3SQWA 3CW2A 1E79A 2FG5A 1U8AA 4QBGB 2HT6A 2PZEA 4WW0A 4PQYA 3FHTA 2X2EA 1KI6B 2ATVA 2IYQA 2QL6A 4CZ2A 2GXQA 5DYGA 3LW7A 4Y0VA 3SN6A 5FOWA 1WMSA 2D3WA 2GJ8A 4RFSA 1KZ7B 2D62A 2G88A 4WZAE 3WMFA 4GZLA 3AVYA 5LBIA 2ZANA 4E09A 2QBYB 4E03A 3DZ8A 1N2CE 1NMZA 4RCYA 2CHQA 4TZ0A 1Q1BA 1AS0A 2CDNA 5TY0A 4URVR 3PEVA 2KE5A 1CEEA 2B7CA 4YXWA 1G3RA 2A78A 3MJRA 4LV6A 1GKIA 4HAZA 2VQSA 1JJ7A 3LO5A 4IOMA 5AJWA 4TYWA 1G19A 5LPNA 1CJMA 4EPXA 2GAOA 4NCNA 1DELA 3B1ZA 4OK3A 4LY6A 3AP2A 4RJLA 1IN5A 3SYLA 1ZP6A 3QJYA 1TADA 1W48A 3AKYA 4TQ9A 4KITB 3OZXA 2X19A 2C2HA 3L0OA 2OILA 3DVLA 2BMFA 3B5JA 3UPUA 3OAAD 3T35A 2H7VA 2REBA 2GEVA 4X8OA 2H18A 1ZCAA 2X2FA 4UNSA 4PSKA 4O2RA 4PQFA 1K5DA 2GBLA 2WJHA 1D6JA 2P0EA 2PLRA 1G291 2QQ0A 3W3ZB 3VKHA 5L3QA 4Q9LA 2O8CB 2YC2C 1L7VC 4TWZA 2FJUA 1W2HA 2PT7A 4Q1EA 2BM0A 1KI4A 4RSGA 1KSFX 4LPSA 4MKIA 3VHLB 2XJ9A 3UG7A 3KXKA 4NYMR 2C95A 3UK6A 3CONA 3AGPA 4PQRA 1J8MF 3RLFA 4C0SA 4DSOA 1MABA 2DY1A 4LUCA 3CNNA 4M21A 4TLEA 4TYPA 2BBTA 5DI3B 5KSZA 1E9AA 1UKZA 4KCGA 5JLJA 2WSMA 5B30A 4B48A 3K0SA 2ZRAA 3O8CA 2PEYA 1HH4A 2FPMA 3DOEA 3TUZC 3LAWA 4M1SA 3KQNA 5FUXA 3S1AA 5KNBA 3AVXA 3Q85A 3NDBB 1XX6A 1DG3A 1YZLA 4ERNA 4FWTA 2ZRDA 3VU9B 3ZQJA 4JLPA 1VYTA 1Y63A 4RCZA 1ZUIA 1SVMA 4MA4A 2IYWA 1QHGA 5HZHA 2Z6VA 4LX0A 2ZRNA 3RSLA 1UF9A 3IHWA 2EFCB 5CJ2A 3CZQA 4FINA 1OXVA 1UKEA 1YR9A 1VCNA 2ZRMA 3EZ6A 1YRAA 2J9RA 3I92A 3QUSA 4TLDA 4C7OB 1JNYA 5EXXA 3WP1B 4AK9A 3LBNA 5EE5B 3VNUA 1R5NA 1SZPA 1DAFA 5L3RA 1Z63A 3MUFA 4PPFA 4XTRA 5EP3A 2J45A 4DT1A 2D74A 1X3SA 3BAFA 1GM5A 5B57C 4V0NA 1FUKA 1VIYA 1CRPA 3L8ZA 1OT3A 2J7KA 1HEIA 1Z6AA 3EZFA 4JL5A 5FH9A 4HYYA 3T5GA 1BO6A 4EPWA 1NSFA 3QG1A 4YQFA 2AXNA 4C0QC 3BS4A 1JBKA 1NLFA 1HQYE 4BFUA 4QGAA 2IXGA 4WZBE 1X86B 2J0UA 3KZ1E 4YXWD 4Q4JB 2WJIA 4XSGA 1QHNA 4V02A 1U9IA 2IXFA 2WWFA 4N1AA 4U7DA 4QC2A 2BEKA 4L9SA 1HE1C 4MRRA 3BC1A 1JEDA 2ZE6A 2NO1A 4RD3A 2Q9BA 3TQCA 3NG1A 3V4FA 5L3SB 2HYDA 3I8XA 2CL6X 4W5HA 1LNZA 3MGCA 5IT5A 2IEYA 5F9HA 3X2SA 1KI3A 2IW3A 4A0FA 3A36A 3OF5A 4Q4AA 5DGXA 2J0SA 5F2EA 5J40A 1P72A 1U0JA 1X8LA 1KY3A 4JMPA 4OQMA 4PAOA 3B9PA 4LBYA 1D5CA 1OYYA 1ZNWA 1E2HA 2IBMA 3B8HA 5KSYA 3L8YA 4IXNA 3WBKA 4RD4A 2Z43A 2AWOA 1EX6A 1VCOA 2BBSA 3U6BA 4DEYA 4P3YA 4E5UA 1A5TA 5G3ZA 1B23P 1D2MA 1QHHB 2FFQA 4TL8A 2EQBA 2WOJA 1N6HA 2H8KA 2OCYC 2V4ZA 1VDZA 3EIHA 4TLBA 4EFNA 4MRSA 1UDXA 3PUYA 4ZDKA 1KOFA 3LA6A 2BVNA 1NI3A 1ZRHA 3T34A 2ZSDA 3T5DA 1ZNZA 4FIDA 3VTKA 1PUIA 2CHGA 1KKMA 1GRRA 2V1UA 5CDFA 5BWMA 3CLVA 2QT0A 1XEWY 4LPKA 5UKDA 3TBKA 5DHAA 3QXCA 2B7BA 2D2FA 1NJFA 2J1LA 1Z0JA 3RVBA 2V1XA 2OFWA 2ZS8A 1ZU5A 2OLKA 2PL3A 2K5UA 4DXAA 2O8BA 2OBMA 3HR8A 1Z06A 2Q21A 4YLGA 4ZKDA 2IEZA 4HDQB 2LWIA 4KHZA 4IVQA 4YC7A 2BCJQ 3GMTA 1KK1A 3I61A 2YOFA 2RMKA 3I1FA 3AKDA 3HJNA 1KAOA 1FQKA 1CTQA 1E96A 3QF4A 1F2UB 1T3HA 3RRMA 3VX4A 3K70D 3D31A 4BZQA 4IOKA 4LJ4A 1E2KA 2WKRA 3OHMA 5C46F 2KB0A 3O47A 5CDFE 1MKYA 1HE8B 4L9WA 4GSYA 2FMXA 2ZI9A 2VYFA 1CXZA 4W5WA 1HURA 1V5WA 1E2EA 4KO8A 3WYAA 1NJGA 3QKRB 2VRWA 3NBFA 1U0LA 4E22A 2DCUA 5JS7A 2ZSEA 2IXEA 2ZIAA 1U90A 2AL7A 4O2LA 4DLTA 2ZITA 3CNOA 1XBTA 2WJGA 1WF3A 4M8NE 5FR2A 2HJVA 2AD1A 4EAQA 1NG9A 1KO7A 4DLUA 3TR0A 4QBFA 4DCSA 1E6CA 1XD8A 5DHFA 3NXSA 3B1WA 5FTNA 1TQ2A 2ZM5A 1IY1A 5DE3A 3KKPA 3RS7A 4BZXA 3IBYA 2XB2A 1S1CA 1E2IA 4IVRA 1S3GA 1AGRA 2FSGA 1JI0A 2QM7A 4QM7A 2CHVA 4XWOA 1NSTA 5AUPB 2EWVA 3IIKA 4WXRA 2R6FA 4B2LA 5CB6A 2AFHE 2ZRGA 4WOPA 2OM2A 4GOJA 5JFGA 2F3RA 4UXIA 2ZJ5A 2ZUCA 4Q5IA 2V6IA 2DR3A 2PMKA 2IWHA 4ZIRA 4BASA 4A0RA 4EJSA 2IUSA 2A30A 2RHMA 5DYIA 4EFLA 1XXHA 4MYHA 2Z5FA 5IDVA 1SQ5A 5IRCD 1E9DA 2QU8A 4F91B 1XD9A 3LVQE 2IYXA 2XSZD 1FW6A 2ZR9A 2AK2A 1KSHA 4PO1A 1X1RA 1AGPA 2IYVA 2A7QA 4P4TA 2BBOA 4I1SA 1RW4A 3LLUA 2J87A 4FCWA 4R2IA 1YKSA 5HPYB 3AF1A 3GJ7A 1IBRA 3SBDA 1RVDA 3VR4A 3I5XA 3KQHA 4IDNA 3SU8A 1S8FA 5KOYA 2ZI6A 1Z0FA 5DI3A 2FZ4A 1H8HD 4TLAA 2QE7A 1BIFA 1X1SA 4LOAA 1OFHA 3PEUA 1XEWX 4URZR 1CKEA 2QGZA 4PXAA 3TAUA 1RYFA 3QY0A 4C30A 4GOXA 1TX4B 2QENA 3TW8B 2EW1A 4QHTA 1S1MA 1E2PA 1G18A 4IJMA 3D7MA 3EZ9A 4JZKA 2QROA 4MUAA 1GVNB 1G41A 1XPRA 1X8JA 3CB4A 1M6NA 2FGJA 4US1R 4OJQA 1I4TD 2GTPA 3QKTA 1KJYA 5CYPA 3W6PA 2GDJA 2GJ9A 4PFSA 4EKDA 4G5QA 1P9NA 4OYHA 1F48A 2CE2X 2F55A 3H86A 3IIMA 3CRW1 4X8LA 5CLLA 3GJ8A 4B75A 2WOOA 4B43A 2VL7A 2IK8A 3NH9A 3CF2A 4H9GA 1YHNA 3CNLA 1VHTA 3PEWA 3K53A 4NKRA 1G6HA 2VHUA 4I1OA 5E7MA 1E32A 5JCZA 1L8QA 4GOKA 5FR1A 1TPZA 2QAJA 3DPUA 3FGNA 3H0KA 2REXB 2AX4A 1II8A 4LI0A 3QEJA 1AKEA 5KPJA 1F60A 2ZRIA 4KBGA 2FU5C 2C5LA 2CLDX 2ZYWX 4PO9A 1GILA 1HUQA 1T91A 2EWWA 1FP6A 1UBGA 2J46A 2QSZA 4PPGA 1ZM7A 1E2FA 4FW9A 3H2YA 1R0XA 2VP0A 1QVRA 3KKMA 4HLUA 1OH5A 1II8B 5KDDA 1K6MA 2RGNC 2V8OA 3GJ0A 2DFKB 3QNUA 4LBWA 4Q7LA 1XJ0A 4WZ6A 1XPUA 1IHUA 1N6PA 4ARZB 3QENA 4TMTA 2Z0MA 3NBYC 2BEJA 4MYUA 1XNJA 1Z6GA 3OIYA 3PXGA 1KI6A 4URYR 5GJBA 2XZPA 4M9ZA 4Q19A 2O8DB 5DO9A 5FFMA 3AKEA 1P60A 4YDSA 2GILA 3ZS9A 3A1TA 3GEIA 1G7TA 1E9RA 1J90A 2A5YB 1W36B 1IJFA 4PPQA 4AWXA 1LS1A 2PX0A 4DLXA 2MSCB 3NIBA 4Q1FA 1EK0A 4RZUA 2IX3A 2AD5A 4KYUA 4QJ4A 4HB3A 1J7KA 1KNXA 5TXGA 1OXXK 4M1WA 5EZ6B 1R4AA 4C2TA 3RS0A 3RWOA 1PJRA 2KJQA 1VCIA 3JVUA 4MYCA 4BLQA 3ADBA 2AN9A 2QQEA 3C16C 4XIGS 1W0KD 1XU4A 5FUWA 4JVSB 3PJRA 5DI9A 4L4UA 4RD2A 4Q02A 4FCVA 1KJWA 1ZD8A 3GLFE 1Q1QA 1ZCBA 2N1BA 2QMUA 3WY9A 4DLWA 4TYYA 1GZSA 1W44A 2HJGA 2YYZA 3NEJA 3QKUA 2FSFA 2C9CA 2Z83A 1H8HA 3KXLA 3LH5A 4NU0A 2O5VA 1TEVA 1UEIA 3KJEA 3NH6A 4ZI2A 1N5KA 2BMJA 4WIAA 4X8HA 1G3IA 4DVGA 1QG2A 4Q47A 3QPWA 5KDOA 1I4DD 3DHWC 1DG1G 3IEUA 4LJ5A 4DCTA 3CRQA 3K70B 3M1IA 1UKVY 2QPTA 4XD7A 4Q03A 4TYNA 1PZNA 1SGWA 4OI4A 4DCVA 1YVDA 2ZJZA 1CRQA 2B21A 3NC0C 4GBMA 4AKHA 4Z1MD 3KX2A 1LF0A 2ZU0C 4TQAA 5JHGB 1CULC 2IL1A 4RZ3A 3VHXA 1OLOA 1CJVC 2IWRA 4RKEA 2ZJ8A 2CE7A 4NDZA 4ILEA 3ADKA 3ZIAA 4CRWB 3EIEA 5H8WA 1AJEA 3AF3A 1VKJA 2Q0HA 5FBVB 1U9IC 4F38A 1CU1A 3R7WB 4DB2A 3B60A 3TNFA 2JLUA 1UJ2A 4Q1DA 2UKDA 3IDQA 4I99A 1CIPA 3KB1A 4I81A 5KDLA 4JLJA 1GP2A 2YV5A 4O25A 1UBEA 3VR2A 1R0ZA 2C78A 3PIRA 2CNWA 4XH9B 5TV2A 5K8LA 1NIJA 2ANCA 3HPQA 5M04A 2SHKA 4TT3D 2ZQ5A 1ZM9A 2WM9B 3KUCA 1TL7C 4PTLA 4ZO4A 1SVIA 3VU9A 3U4QB 2FH5B 1XXHE 4ACAA 1P2UA 4TMXA 2QP4A 3FFAA 3ONWA 3PVSA 2ZJBA 1F2TA 2PZGA 2WPDD 3PUZA 2ZI4A 3ZD6A 3OEHA 2ODNA 4MGZR 5SZKB 1VIAA 2F1HA 4OKSA 4F4JA 2CMKA 2FZLA 2XEXA 4DB4A 1WE2A 2QN6A 4OL0A 4DDTA 1XXHB 1G7CA 3T1OA 1FOEB 4MGIR 4G3XA 1OPXA 2GK7A 4B33A 1SXJA 4AKIA 1I2MA 1TQDA 5CM8B 5E7IA 3KB2A 1BOFA 3CF0A 3P4XA 4CIDA 4MRVA 2KI5A 2F1IA 1ZUHA 2H57A 3AKCA 3R9XA 1VG1A 1XMJA 1Q1ZA 1TUIA 1KTVA 3IO3A 2YVUA 4OQNA 4DUGA 1Z2AA 3U3KA 2P6UA 3SS8A 3NWJA 2ORVA 4EQ6B 4JLKA 1G3MA 3WYFA 3B1XA 4XVRA 5EXTA 1N25A 1NRJB 3O8RA 2KBFA 2WHXA 2YKGA 3DMNA 4M0LA 1SVSA 1Q57A 5FOTA 1QF9A 4XSHA 4A8JA 4TTQA 2QUZA 2W83A 1ZC4A 3M0EA 2O8EB 1ZIOA 4KBFA 3K0CA 1U94A 2A5JA 2ZXUA 1TTTA 4DJTA 3OAAA 1JQLB 2V9PA 4YMTA 4KVGA 1IY0A 4IOJA 2CK3D 2QAGC 3U3MA 1AZSC 2OT3B 5E95A 2BC9A 1RJ9A 1G20E 1XTSA 4P4SA 4B3DA 3E70C 1XD2B 2A5DA 4Y0AA 1KDPA 1DO2A 4PR0A 1DADA 1WXQA 4Q4AB 2YOHA 2I4IA 4EPYA 4AURA 1NN0A 4EPRA 3AQ4A 1COWD 621PA 2JJ1D 2QRNA 1AK2A 2FPLA 2GZAA 3QF4B 1ANKA 4EUNA 5TVKA 1Z83A 4KI0A 2YINC 5EP4A 1P75A 3H84A 3NKVA 1GFIA 5FTMA 3ZS8A 4C3ZA 5G40A 2F9MA 1NMXA 3QVVA 3R9WA 4Q21A 1E94E 1XZQA 4LSGA 1HYQA 3T1TA 3KKOA 2VLIA 3EPKA 2EFDB 5LB4A 3A4NA 2G3YA 2XITA 4CW7A 2GEUA 3GP8A 5H1YA 4OK6A 1VYUA 1WBDA 4OI0A 2IS6A 4QGFA 3TIFA 1T8TA 3CWZA 2D2EA 1W5SA 2ZE5A 1R0WA 4KSCA 4JBXA 3TUJC 4YONB 4BPBA 1HTWA 2QORA 2QNRA 3CRVA 1T8UA 1ZNYA 4HUQA 2IYLD 3IHLA 3ADDA 1NVXQ 4EQ6A 4QG7A 2LKCA 4NH0A 3ZYCA 3F5FA 4JLOA 2IHBA 3U7GA 1R6BX 3SJCA 2VF8A 3BFKA 4PAMA 3EC1A 5HCIA 4DHEA 4URWR 1XCPA 3X1DA 5EE9A 1HA3A 1A4RA 4U5XA 2D7CA 1KI7A 4ZDIA 3THOA 4PX9A 1IAQA 1ZINA 1DOAA 4EPTA 2BDTA 4HB2A 1R7RA 3E2IA 2OCPA 5H68A 4G5SA 1LFDB 1WB9A 4AKEA 5FBLB 5BN5A 1G1MA 1N5IA 2FNAA 3UKDA 4LK2A 3KDSE 2QMOA 4P31A 2QT1A 2IYYA 3FMFA 2DHRA 2GKSA 4DCUA 3LWNA 4BLOA 3VAAA 4D25A 2A3RA 2F6RA 4FMCF 5G53C 5C18A 2JEOA 3ASZA 2XX3A 4ZKEA 2V54A 4A4DA 1SXJE 3BH6A 1XMIA 2XXAB 1TEXA 4MGKR 3QPVA 1OB2A 1RPZA 2TMKA 4N0EA 4L16A 1KO5A 4Q4JA 3ZVLA 4V03A 3B2EA 1W0JA 2FDCA 1P73A 1Z0KA 1TNDA 3U3OA 1ZW6A 4ZCLA 2EYUA 1NN5A 2ZJAA 1VTKA 3T1VA 3WXMA 3BB4A 1VHLA 4QOSA 4R9UC 3P27A 1XCMA 2N42A 2JJ2D 3GLFA 1D2NA 1GTVA 4A1FA 1Q0UA 3F8TA 3U3JA 4A2QA 2ORIA 3BBPA 4PAQA 1T6NA 5BN4A 2OV2A 2PBRA 3CUEF 2MSEB 1ZUNB 1P6XA 3EAQA 3HWSA 3I8SA 1GNRA 1LW7A 4C0HA 4MITA 3X1YA 3AP3A 4R2HA 3I5YA 1ZYUA 1CF4A 1P3JA 4FMBB 1RKBA 3HU3A 3QPUA 2QPAA 3U6KA 4G1UC 1DVRA 4DIEA 2ZAOA 3E1SA 1Z0AA 3AV0B 5HKKD 1CS4C 3NHAA 4LWZA 4FXPA 2ATXA 1NG1A 5LD2B 1E2DA 4D0GA 3LNCA 1LF5A 4FMDB 4BFWA 2JATA 2CJWA 1ZVQA 5GJWC 1E2JA 4CEJB 3P32A 4FMDF 2XGJA 4K46A 2HYIC 2XOKA 4D81A 2OXCA 3A1VA 1G8GA 2VPPA 2LKDA 1FTNA 2ZE7A 4L5BA 3BD9A 1FUUA 1YE8A 2IF2A 1SKQA 3U5ZB 4MKFA 1DAEA 1NY6A 4LJYA 3RS3A 4HLCA 3Q5DA 3QIAA 4HAVA 1EFCA 2N46A 2QMHA 5FOSA 4IXMA 4OQFA 4B6EA 1OFUX 3GLGA 1RRCA 5L3SA 1NVWQ 3AGQA 3GLHE 4QJ5A 1Z6TA 2UZ3A 3EIQA 4B3XA 3WNCA 1WRBA 3U7EB 221PA 2D7DA 4BFYA 1E79D 1S2MA 1E0JA 1RC8A 4BFTA 1T5LA 2XTZA 4OK5A 1CBUA 2IA5A 3NBXX 4YDHB 5A4JA 1IM2A 2HCJB 2QM8A 1LVGA 2J5XA 3FKSA 3LRPA 5FBRB 2XAUA 4I1VA 1M1YE 3IILA 2BWJA 1G16A 5KNCA 1EFUA 3PEYA 1X6VA 3A1UA 1XWIA 3IPXA 3NHBA 5G41A 3GFOA 4DLVA 2O8CA 1WCV1 2I1VB 1J99A 2JJ2A 4TYQA 5CK5A 3VX3A 3SJZA 3BH0A 2WIAA 3THWB 1T4GA 5BXQC 1WBBA 2JAQA 5DH9A 3W8NA 3RRYA 3GLFB 2WKPA 3H1TA 1M2OB 1PLJA 3OEHD 3G5UA 4B47A 4IDPA 4B3BA 1ZC3A 1OXSC 5AWFC 4ACBA 2JLYA 5IK2D 2J59A 3RANA 4M53A 2IS4A 2PX3A 2QRZA 1XTIA 4AYTA 2ZU6A 3MRSA 3QBVA 1SXJD 4B44A 1OH6A 2ONKA 5KTYA 1US8A 3T12A 1BMFD 4C0LA 3U61B 3U44B 1LS6A 1D9XA 1P7CA 3KJGA 4RKFA 3UMFA 1D2EA 1C4OA 3E5HA 4CT5A 1F2TB 1MO3A 1SKYB 2GVDC 4PHTA 1FQJA 1OYWA 1XMVA 2W0MA 4ITRC 3AB3A 2RGCA 1OXUA 3CPJB 1TF2A 4MGYR 4IHQA 5HCNA 4OHZA 3B78A 3FYHA 3QEOA 1OJLA 3RC3A 2VBCA 3EZ2A 3RWMB 4KFRA 2ZJOA 2LCFA 1NBMD 1AZTA 4IKEA 2CXXA 4B2IA 1SKYE 3HDTA 2FV8A 2HF9A 1AKYA 2ZTSA 4LCBA 4ASUD 3B13B 1UBFA 3U60B 3A4LA 4BFSA 4R98A 3A1WA 1ZU4A 1XEFA 4QL3A 4BLSA 2ZI7A 1OB5A 4TQUS 5L8VA 2VP2A 1T9HA 3AVUA 5JCPA 3TGPA 3C14C 3QOFA 2RCNA 3GJ5A 1GRNA 4PHFA 5B64A 1NNEA 2IYTA 3MSXA 2EFEB 3OIVA 1UDWA 1JR3E 1G8HA 1MR3F 2OAQ1 4A6PA 4D4LA 1XZPA 1SHKA 2GF0A 3IPYA 3U2QA 1U81A 3ZIAD 2QP3A 5JRZA 5J4YA 2UVQA 2YWGA 4N0DA 1NKTA 2R65A 1XFAA 4WBSA 4ZDWA 1IN4A 3LLMA 5JI2E 4RZXA 1E9FA 2ZI3A 1XCGB 1AQUA 1P2SA 4LJ6A 4D0LB 1VMAA 4BFVA 1YZKA 2GXUA 1GSIA 2V6JA 3FPAA 1Z3IX 2QZ4A 5FOVA 1G7RA 5AR1A 5GVSA 2W6JA 2F3TA 3B1YA 4CEHA 1N0UA 2HUPA 3PG5A 2WAYA 1FMLA 4RZ2A 4W5JA 1OH8A 1XJQA 4DSNA 1XEXA 2FA9A 5KU1A 2JJ1A 2ANBA 5F98A 2RH5A 4MKHA 5FPHA 3EARA 4ON9A 3LFUA 1T5IA 4WA7A 4A8JC 5C2JB 4HLQB 2Q3MA 2L0XA 5EP2A 1US8B 3EPHA 1JB1A 1ZJ6A 5K8TA 5FTJA 5CIWA 1RRFA 4PC3A 3ZLJA 3HYRA 3AUYA 2WAXA 3EG5A 4YMSA 4DWJA 3ICQB 2GXAA 1HT2E 3W3AA 1OF1A 521PA 4A2PA 2JLXA 2NO6A 1DAMA 2E87A 2GXSA 4GZMA 1NF3A 2AWNA 1XMSA 4FCTA 2RGDA 1U2RA 2JASA 3GJ3A 3IQWA 4HDCA 4QHYA 4JYBA 3BFXA 5AUOB 1IN7A 2V7QD 4ZI3A 4DRZA 2ZAMA 4LHYA 2GRJA 3TLXA 1KI2A 1DPFA 1G3QA 5JWOA 1PLLA 1QVAA 3T61A 2C04A 3A6PC 1N3BA 3KJHA 2GK6A 3K9NA 1GWNA 1FTSA 2ZJYA 2ZEJA 5JWHA 4KYIB 3N5CA 4FD2A 1D9ZA 4HI0E 3THXA 1F2UA 5HTKA 2J0VA 3KKQA 4LC0A 3W5JA 4XVUA 2HCBA 2HV8A 3GEEA 2ZJ2A 2WMOB 3HU2A 4OI1A 4OJKA 3QBTA 1W0JD 3HU1A 1A82A 1LY1A 2QA5A 1MO4A 1KMQA 2O8BB 2OCAA 4Z51A 3L0IB 1IXZA 4RFVA 3GJXC 5LDDC 2GBLC 3BFVA 1KDOA 4Q7JB 4UJ5A 3ZD7A 1P9RA 2DFNA 2H17A 3LDAA 4AG6A 4ZIRB 4B3GA 3THXB 2MSDB 3X1ZA 5J4HA 1G7SA 4LYJA 4G01B 5FPKA 1ZIPA 2W0SA 3LX8A 5HR5A 4II7A 1KMHA 1VPLA 1Z29A 4V0OA 4JSYA 1NVVQ 1QHYA 4GMXA 2ONJA 4C0KA 3O8BA 4LHVA 1KI1A 3SQXA 1OV4A 2WJYA 4TLCA 4D2IA 3L0PA 3FMPB 4TL6A 3RS2A 5AUNB 1OIXA 5CIQA 3O8DA 3P26A 2FF7A 3HYTA 3WNBA 2IYRA 2QTHA 3CR7A 4OHYA 4JT2A 5AUQA 2HT1A 4JSTA 2NO0A 2IUTA 4F7WA 1YR8A 3I62A 1A1VA 1P9WA 3LXXA 4DC9A 3AF0A 4A0GA 3EPLA 3CWQA 5FL7A 3UMSA 5FBQB 3EX7C 1JXOA 1OSNA 3DDCA 2XTNA 5E3HA 3EXAA 1KK3A 1KZGB 2AFIE 4C0JA 4D4KA 2QAGB 2VHJA 4Q1CA 4E07A 1KK2A 4Z1MA 3BWDD 3GCGA 2Q9CA 3C4JA 1LV7A 3PR1A 1ELOA 4BUJA 4TMKA 3MLEA 1KGDA 4D0NA 4BLRA 1G3UA 3EPJA 2GWHA 2F43B 2WVJA 4LRWA 3C8UA 4TL7A 1NY5A 1N5JA 4GP7A 1IXSB 4QHSA 5B58C 2P5SA 4TSFA 1KI8A 5JEEA 1XDBA 1G8PA 2REOA 1G5TA 4B74A 2HXYA 4P0TA 4Q4LA 1FL9A 3CO5A 5D3MA 1XTKA 2XNSA 4TMWA 1EX7A 1W49A 1T3SA 2RGXA 3BB3A 2WICA 2GJSA 2WTUA 2AKAB 2ZRBA 3Q8XB 2WWHA 3L2OB 2JJ8A 4EJSB 4OHVA 4G5OA 5KSOA 1IN6A 3GFTA 2YNMA 2Q3FA 3WHKA 4A36A 5FL7D 4LV8B 3AEZA 5ELXA 4BFXA 1AIPA 3JVVA 1SVWA 2QPOA 2AKYA 2EFGA 4A92A 1OFIA 1E2NA 4CVNA 3W34A 1GRQA 1KYIA 3TH5A 2PJRA 5JSZA 4DT1B 2PEZA 2IYZA 2O52A 4Q7KA 2ZYTX 4TZ6A 3BORA 8OHMA 2W58A 1CLUA 1MH1A 4A9AA 1KO4A 1JAHA 3FKQA 4UNQA 4A2WA 4C7OA 4C0AC 5JSZB 2F9LA 1M34E 1YZQA 5AJYA 3SR0A 1P5ZB 3HP1A 4BE7B 4EJSC 2ERXA 3DL0A 5JBQA 1S9HA 4M1KA 4MQBA 2WWGA 4JJZA 4Q9JA 2C03A 3SEAA 3TSWA 3VR5A 2AXPA 2IUUA 1ZD9A 2F7SA 1N6KA 3SJBA 2HF8A 5SZIA 3C41J 2GCPA 3A1SA 1E9CA 3WNDA 1SVOA 1OXTA 1W4CA 2EU8A 3ND8A 4NPHA 5H70A 5K8IA 2C99A 1XPOA 3K9LA 2FOLA 3C5HA 4DUGD 2BKUA 2ERYA 1Q44A 3KFXA 3T1QA 3WRYC 3P1JA 1FX0B 3U44A 2IYSA 2Z4SA 3PUVA 1BYIA 3QF7A 4GFDA 5JHHB 5TMPA 3T15A 1MABB 1TF7A 2CEAA 2FFAA 4M1OA 1XD2A 3CH5A 2GHIA 2OXRA 1Q3HA 2WPDA 1E1RA 1CJUC 2B8WA 2BBWA 4P4SB 4IDOA 4NYJQ 1KHTA 1JR3A 1MRNA 2KBEA 3SYNA 3SZRA 1GAJA 3K9HA 3THYB 1IXRC 4QNRA 3MMPA 1UBCA 4KJZA 4NHOA 1W4BA 3MAAC 1Y3AA 1YRBA 1P2TA 4A82A 1J2JA 4DLRA 3Q72A 4JKYA 3K09C 2QMEA 3PCRB 3M4YA 5LD2C 1OHHA 4KV9A 3VNVA 1G21E 4MYTA 3OIWA 2DWPA 2AK3A 1E2GA 1HY3A 3QG5A 3QKSA 2WIBA 2X77A 1YZNA 4XD7D 4TT3A 4DDVA 5JJIA 4G0NA 1FPMA 5G3YA 1QRAA 4LGMA 4LJ7A 2BM1A 4YMVA 2YWHA 2YJTD 1UEJA 1KNQA 1P62B 3B9QA 2EFHB 1IOZA 1YR7A 2X1VA 5GJVC 1VG8A 1WP9A 2VSXA 1GL9B 2WSSA 1E9BA 1II9A 1KDRA 2NO9A 3SBEA 1KAGA 1AM4D 5EUQB 4ZCIA 3FE2A 2G0TA 1W36D 4N3NA 3P4YA 4JLVA 3MG9A 5EQTA 3D3QA 4GL2A 4H1VA 3DO6A 4Q01A 3NVAA 2R6DA 4Q9IA 3LQRA 1FX0A 1U0HC 1XTJA 3KTAA 4KU4A 1II0A 2I1QA 3THYA 4LV5B 2OCBA 2QBYA 4HSEA 1P2VA 1N0WA 1W0KA 5JI3E 2OE2A 4M9XA 2JLVA 5TDHA 1E69A 3BGWA 2JLZA 1P4SA 1KSJA 3V00A 1G4AE 4B35A 2P3SA 5BQ5A 5KUTA 1G9XA 1W4AA 3TSZA 1N0VC 1V43A 2CJWB 2CL0X 3SFVA 4BFZA 2OUKA 1W7AA 3FWYA 3BERA 3UATA 1Z6XA 4TTRA 2PMDA 1S9DA 4RD6A 2BMDA 2P67A 2B92A 2GA8A 2XOKD 3AVOA 4TTPA 1NN1A 1TAGA 1HT1E 5TB5A 821PA 3KQUA 1VG9B 4MRNA 5JMTA 2JLRA 1TMKA 2GAAA 2QSYA 3U7HB 5DIFA 4BECA 4NL4H 1G5RA 3AUXA 1QHIA 1KJZA 1E0SA 3QE0A 1E1QA 2NPFA 4B3FX 4HLDA 3AVTA 3WP0A 3K0AA 3K0FA 3ASYA 3ZDQA 2JDIA 5FUVA 4QM6A 2VSOA 1VYVA 3NEYA 1ESNA 3ZZ0A 4P32A 2H16A 1JAIA 2PH1A 1JEEA 1SXJC 1DARA 4U02A 2WKQA 3SC3A 4JL8A 3K70C 2DWQA 1M74A 3OIUA 3LW8A 3QQ5A 4KFSA 4DSTA 2G1KA 1CR2A 1DAIA 3AVVA 4NCKA 3F0TA 3IUYA 2Z4RA 3A58B 4HATA 1KDTA 4NBSA 2VTKA 1E2QA 2ZRFA 1YU9A 4BLTA 4TN1A 1CP2A 4V0LA 5SZHB 2F43A 2ORWA 1BS1A 4W7SA 1ZM4A 5D3MB 4V0ME 3RC8A 1A2BA 5E7JA 1OIWA 4PPNA 2C77A 2HLDD 4QBIA 4RFSB 1BH2A 4CEHB 4BEJA 1RZ3A 2ZI5A 6Q21A 2R2AA 1R5OA 3TK1A 5JWRA 1RJ9B 3V9PA 5FOUA 4JVMA 1GUAA 3SOPA 3TVDA 5J4KA 4NYJR 4Q1BA 2A5GA 4UJ3A 1KK0A 2D06A 3K0FB 4HDOB 2QGNA 5DSZA 5EXPA 4DZZA 1OKKA 3GLHB 1L4UA 2NIPA 4OQXA 5CJPA 4Z8XA 1S96A 1GOTA 4IFEA 4NP6A 3DM9B 3RRZA 2X8AA 2ZE8A 3R20A 2VF7A 1M7BA 3BIFA 2PCJA 3IIJA 1O3YA 4IOLA 1BYUA 3K9GA 3ICEA 1M7HA 3L43A 1SVKA 2GJAA 4ZDJA 4LZZA 3W6NA 1E4YA 2FE4A 3GJ6A 5KSPA 3FMOB 3OFNA 5DN6A 4KFUA 4UNNA 1EFRA 5SZJA 4DDWA 3BK7A 1N6OA 4URXR 4UXJA 3AVPA 2OLJA 4FWIB 3I3SR 4DLZA 2HEIA
chains in the Genus database with same CATH superfamily
2VH5R 1BXGA 1Y82A 1PJQA 4DEVA 5BUSA 4G23A 1IPEA 2VUHB 2YQ5A 4B7UA 1EUCA 2IHZA 2D5LA 1H8EA 3UBMA 4CFZA 1NNLA 2YC4C 4CFSA 1ZXLA 2N3ZA 1VRWA 1L6RA 1U5CA 2QE7D 2RKOA 3F90A 4JT4A 5E1BA 1LRLA 2YWEA 4KUHA 3ICCA 3U5TA 4EX7A 4H27A 1H8ED 4GS5A 3TLGA 1RXSA 4QREA 5JQWA 2FUEA 4MDEA 1E6UA 4PC2A 3FNRA 4JLDA 3G0HA 3KKLA 4G8BA 5EZYF 6REQA 2QZJA 4EGQA 1OH7A 2HWYA 2QG4A 3RFXA 1JTEA 3IOYA 5DK4A 2ZRLA 3B3AA 1EGMB 2X41A 1NL3A 4UEWA 3TI9A 3K8QA 5FWNA 3T7RA 2JL1A 4TSRA 2ASEA 4LYGA 4WBXC 2FK7A 9LDBA 2FUNB 2Y6UA 3H2GA 5TGZA 4BX8A 1WUJS 5TS2A 3GOQA 3EYWA 4BJHB 1S2DA 2AC7A 3K0SA 4MZDA 4WHMA 3HR7A 1Q2XA 2DB3A 2VO1A 4Q9HA 1HG0A 2ES4A 1RXVA 3Q9LA 3OF2A 5COBA 5IJ0B 3T9AA 4UTNA 3GUYA 1PQUA 2OESA 2K2WA 1TU4A 1F8GA 1SZCA 4M1YA 3VHRA 2CK3A 5KQSA 3FB4A 1Z47A 3DL2A 2WV9A 3QMMA 5F9MA 2QX8A 2HNAA 4GGOA 4Y2PA 3L4SO 2AHOA 1QDEA 5F1YA 4UM9B 5B3KA 1GYRA 1GPDG 2ZRJA 1SVLA 3Q3IA 2CVHA 2YIJA 3TD6A 4B31A 2ZWIA 2O05A 3Q3JB 2X42A 3TWOA 5C5CA 2PS3A 3ZDYB 4HGOA 1T9KA 2XWPA 4MJXA 4NCJA 3WNVA 1S5PA 4CN8A 4DLSA 1H65A 4M88A 3VPBA 5KINB 4LYFA 1XP8A 2PZJA 3JY6A 3WWZA 4QPCA 1P19A 4FONA 3PGVA 4D57A 1BEZA 2O0HA 3BGSA 2YUIA 4ML3A 1X9GA 3E23A 3KZCA 3QXXA 1Y4UA 3D7LA 5LUBA 3TMAA 2RONA 3HEAA 3VNQA 3OE1A 3RJ9A 2H1HA 3ETDA 1GZHB 3WLNA 2X9GA 3ONDA 4B71A 4FI3C 4HXGA 1U1FA 5BNZA 4K0RA 1L4EA 2GVZC 3W2TA 1M2JA 2PYDA 3CKLA 1NP6A 3T3NA 2ZKIA 5T3YA 3GAZA 4UNRA 1VLHA 4NBUA 5EJGA 1FRNA 3UYLA 2DMRA 5BPFA 4NNPA 2H92A 1PEYA 4URUR 3H5IA 3VUEA 3X2FA 3EIXA 2H1IA 5BN5B 2XRYA 2ZROA 3IMGA 3OCUA 4BNIA 5HF9A 721PA 2QS9A 4LJKA 4Q3CA 5I9SA 1IPFA 4PFQA 3CINA 4UULA 1Z2EA 5KTTA 3VZSA 1E1KA 4D74A 4UPEA 4KLNA 2YRWA 4XLLA 2VDMB 3W77A 1EIWA 2R1UA 1P3DA 5H9VA 2WU4A 3AHHA 4ZT2A 1CUYA 3NPAA 3QTLA 4LRSB 2AUMA 2AG5A 4KJXA 4UZFA 2BFEB 4GP6A 2ZRCA 2BFBB 4XA8A 2ZSKA 1G8YA 4H4DA 1D7AA 4INZA 5J47A 1VQ1A 4PSDA 1HQCA 1UDRA 2YL2A 4IBOA 1XAJA 2R9VA 2YWFA 4B40A 4N5IX 1U7XA 2FW7A 5IKMA 2JG3A 4IP0A 1AE1A 3ZZUA 1EFHA 2VPTA 1BE6A 1J39A 5FL3A 5JJBA 1EGVB 1E66A 3DKVA 4N3CA 4U3JB 2Q4TA 3E3OA 3ZIUA 3I12A 1VE6A 3A4MA 3MILA 3RSOA 3RVQA 1Y5RA 3OC6A 5DCYA 3GEHA 5FPYA 2QTWB 1JYEA 2OQRA 2P6NA 3B3JA 2CLEB 1GITA 2OBLA 3OZWA 2W8BB 3SWWA 3X1MA 4F4HA 4BMCA 2VDRB 1DZIA 2WIDA 4PCLA 2M1XA 3I2KA 4CT0A 2DPXA 3AR8A 4WUVA 3UJHA 4KODA 5E38A 3MTDA 1Z0IA 1ULHA 4P4UA 3O21A 3PNOA 1CRZA 1B0PA 4NS1A 2DFTA 2VQ6A 4IVPA 1M2WA 4UMFA 4EDFA 6YASA 3JZMA 3CT6A 2XXAA 3DV0A 7GPBA 5KYVA 1Y9DA 1RBYA 1S01A 4KVAA 1ZAYA 2JIZD 1R6TA 3CSSA 2WBLC 3KFVA 3I4CA 1W46A 1G55A 3WRYA 4DA4A 1JECA 1W88B 1BWQA 1LVHA 5K4AA 1M2NA 3NHJA 2CVQA 2BYTA 5HGXA 1GL6A 2C57A 3IO5A 1LKZA 4IGEA 2D0PB 4M1MA 3GT4A 4PHHA 4JUDX 5K01A 1MNQA 4Z2AA 4RTQA 1JPNA 2QAGA 3JTMA 4JLMA 1XJCA 2GFIA 3ODGA 1W85A 1VKOA 4GC5A 2ZB8A 3M6AA 4LDJA 2JBAB 2HXSA 5A3QA 3V8MA 6AT1A 1GGKA 2C20A 2PUWA 5LU9A 2P90A 4PIPA 4EEKA 3OFND 2F1RA 3TQQA 1PFVA 5MFPA 3CVUA 2H00A 2AMJA 3N2NA 3Q3HA 1X15A 1Y7HA 1HDYA 1NN3A 4RM2A 2C8VA 4I9GA 4LY3A 4BVAA 3ZU2A 3S1SA 4IHJF 3U0VA 3DEFA 2HR1A 1I1QB 2BSXA 2A9FA 3B3QA 2C9OA 2QTFA 1ZCFA 2OFPA 4FTWA 3ZUGA 2O8EA 5CEJA 3KT3A 4A8JB 1Y7LA 2P11A 4XUDA 1EUQA 4TXMA 4KK4A 5DJ5A 4DAEA 1M83A 2IY7A 1DXYA 1U80A 3D54D 2DFVA 4IEEA 1DQNA 4CEIB 4R3WA 3RTCA 4EA8A 2CF6A 1P61B 3B7WA 4HNSA 2RGUA 3GA0A 1AF4A 3LXUX 4G0OA 3GLGB 1Z22A 4D97A 1U98A 1A8IA 3SMQA 3ZCXA 4MWZA 4JUFA 4CR6A 4ARZA 2C7RA 2BF7A 4LWOA 4CCAA 2GBGA 3LKZA 4AZSA 1GDDA 2G08A 1G2OA 4D3YA 5H83A 3O7WA 3REGA 1E1RD 2ZIGA 2G1PA 1WZ2A 1GSHA 2D4AA 2QY9A 3IE2A 4MMZB 3GLQA 2E1RA 5H59A 4I4LA 4IIXA 1CNFA 4JIMA 4K87A 5CB4F 4QBKA 2WTAA 3B85A 2H4JA 1BKDR 3KSMA 5ALNA 4CI9A 4DARA 4OB8A 2DZDA 4U9IS 5LLSA 1GRVA 1E4VA 5EKTA 1KIMA 5JXGA 3VKGA 2D13A 4WCVA 1H4VB 4EPVA 1YR3A 3FTPA 3U48A 4GMGA 4RXUA 3ZDCA 4HMQA 1VJ0A 3DAGA 4H1TA 3DB1A 4N5HX 1H6BA 3DO5A 4X1IB 5A7FA 1GQYA 5BSGA 3EF0A 3DYIA 3TRJA 4BJ6A 4WVFA 1X7WA 3BRSA 4N48A 1AHNA 4DGSA 4IKPA 2A1UB 2D7JA 2EJBA 5DISB 4WXHA 4LZAA 1PI3A 3NDIA 2X3YA 3LQKA 3W5IA 3FRJA 4M9SA 5BOVA 4HAYA 3W9YA 4DBLC 5JD3A 3BRCA 5AM4A 1E62A 1CVLA 2VYQA 3CF6R 2BF4A 3KSBC 4G37A 2YWDA 4KQ1A 3HJFA 5EHQA 3O4GA 4DQVA 4M0KA 2B35A 2GPBA 1SK9A 4L6CA 5AVJA 2BPOA 2I71A 3OZBA 4DCOA 4B7ZA 5JROA 4HAWA 1A0OA 1H0KA 3AIKA 3PCXA 3OZIA 1E1CB 4EB8A 2DYKA 3V97A 5D1NA 4MARA 3UFBA 3JZAA 4YV7A 3C6XA 1L9KA 2OK8A 3SCZA 3CZMA 5DNYB 5EIAA 2AMYA 3CO0S 1QV7A 3RUIA 3SHTA 2EVWX 3L4BA 3MWJA 4YMWA 1CV2A 1WY5A 4M83A 4LF8B 1BH6A 3K0AB 5B30A 3QXJA 1NM5C 3DXYA 3L6CA 4QOHA 2OAEA 1UOOA 3JQ9C 3WBJA 2WQZA 5JBIA 2C59A 1CZLA 2O14A 2XVZA 5AHXA 4YRLA 2ZW9A 3EASA 1YZTA 4MVJA 5IPFA 2WKSA 1K5GA 3NC1C 2ZVPX 3IB3A 3RS4A 1DWUA 5LN1A 4MQ4A 3FDFA 4BVBA 4ND8A 4FDVA 3GRCA 3UXMA 3RFVA 3JQRA 4ZAGA 4RVCA 2TECE 4O4HB 3UIEA 1YU6A 3KSUA 4UM7A 5BQOA 5CLQA 4L4ZA 5E1MA 1AURA 4IY1A 5JZMA 4TL9A 1UOQA 4B3MB 1DQPA 4DOMA 2FN4A 4KKVA 4LYHA 4OUKX 5D7BA 1DRWA 5ERGB 1QZXA 2WJ4A 1N2IA 4FFOA 2CDAA 1YE3A 3VKWA 1T1SA 1XCBA 4K8OA 2IV7A 1JDJA 3K30A 3LQQA 5HKKA 4OLJA 4TV9A 2FR8A 2QN3A 3BXOA 1CR4A 4TKUB 3K1YA 5AHOA 4KH0A 5J5AA 5TMBA 2GD2A 1E5VA 4Y9TA 3M5CA 4BRWA 1FSSA 2WMDA 3QSYA 1G8KA 1WIWA 2WHPA 1XTPA 3EA0A 3DQPA 2WZQA 2R25B 4Z8YA 4B6JA 1FFYA 4H18A 5DLDA 3NXKA 4ENSA 4Z9YA 5KIAA 4Y7DA 3ANNA 3M1LA 1L4NA 2HLHA 3KBBA 3MS7A 4JKIA 4N6OA 5HBRA 5C1PA 5LP6F 4CETA 4U63A 3FPFA 2DPMA 3IXLA 5EINA 1R8SA 4RC9A 2O3QA 5E9QA 3NWBA 3QE3A 4DM7A 1YUMA 2C3MA 1E0AA 4W4TA 4PHCA 2R6CA 2AR7A 1RWMA 3T9FA 3N7UA 3UCEA 3ZV5A 4B76A 4EJFA 5HHTA 1OY1A 4TQGA 5ALKA 5EA2A 5F76A 5ALDA 3SNKA 3CR8A 2QGFA 2GNOA 2VG8A 4J76A 4P7BA 5L40A 4BATA 2V7VA 2BJWA 1ZFNA 3L8MA 3TZCA 4RXTA 4D7AA 1KKUA 1LPMA 3RABA 4HUTA 5I9BA 5EJFA 3CH7A 4O63O 1LB1B 1YCGA 3ZCSA 1Z2CA 4L5AA 2VNKA 4J4BA 5ALSA 2ICAA 2BKVA 2XNDA 3H2IA 3VHXB 4GMDA 1NXPA 1R0SA 3GWZA 1L7QA 1NPYA 2WWXA 1U4SA 5CA0F 3RK4A 3AR6A 4FYJA 3EXHB 1KC3A 4W9MC 1SIWA 3SYKA 3I09A 2Y1DA 3DVAB 4QNMA 4C4PA 3D7KA 2VDQB 2XYPA 1MB9A 2EBHX 3GDWA 3ILYA 4YP0A 4I50F 1S2NA 3DGFC 3O1JC 2FSVC 1MDBA 2FEMA 4XLZA 5JNUA 4ZVMA 1T2VA 1YC5A 1Z6YA 1AC5A 1WSAA 3FUXA 2HC9A 4OHXA 5A3JA 2PSHA 3PTZA 1UFQA 3VR3A 5HQ3B 1PW5A 1OYVA 1EVKA 3FYUB 4LJAA 4MUGA 4LXIA 1YQWA 1C29B 4LVCA 3AEQB 1IEVA 1B6GA 3B70A 2OZKA 3K6KA 4PLGA 5BMVF 2GD1O 1R0YA 1JR2A 1NBIA 1T1RA 4PZ9A 1E98A 1SC6A 3VA7A 1NOKA 3L0CA 2ZR8A 4GRDA 1R0CA 3I4LA 1HSZA 2GCEA 1M2OA 3AG5A 3B6IA 3EZ7A 3K0CC 1AA9A 1C30B 1CUDA 1JDUA 2R85A 5J4LA 5MGBA 4FNOA 1NMYA 3D59A 2PT5A 2Q1WA 4AYXA 3OTOB 5AVRA 4O4IA 4HEJA 2B8TA 1CHDA 2Y1FA 4MVJH 2HNKA 3WQRA 2KX7A 2VRCA 3PLRA 1M8GA 5GQSA 4UHJA 2NU9A 1P2GA 3DBLA 3B6ZA 4IPTA 3VSEA 5K6RA 1SQFA 2J9GA 1FS4A 4GT1A 3AM1A 2PMFA 2GDZA 3LQ1A 1QIJA 1V5GA 2WKWA 1SG0A 3L7LA 4KIJA 3ND9A 3RC9A 4EW2A 2OHIA 4J0CA 1ZL0A 1K4YA 1AS3A 1UR5A 5EOVA 2DBYA 3SZOA 4D6PA 5CP8A 1U2GC 2CFRA 1G8FA 2FKNA 1JQAA 1U0TA 5KHLB 2VNHA 4GBED 3IYLW 4NJEB 1EE1A 3P9ZA 1FFWA 2C00A 3A37A 5BQXA 2FEOA 1UBOS 5GJCA 1PG2A 1FX1A 4MPDA 1DRUA 2IBSA 1VBKA 1LK5A 3D8BA 3OFKA 4UMVA 4M0EA 5P21A 4P33A 1JSCA 1T8WA 2QRUA 3HWX1 3FTCA 1COWA 1M5UA 2Q6TA 3B2NA 3PB3A 4MS1B 5CM9C 4I4IA 4WZZA 3WL7A 5F64A 3RBZA 1JN0A 4D8VA 2BKEA 1PE0A 3O3MB 1NFQA 2RGEA 4NBLA 4BNLA 1ZXBA 5BRAA 3DE7X 3R3UA 3K8YA 1XEXB 3KPJA 3KYCA 3Q2IA 4P2GA 5G1PA 4TUYB 3CLSD 3OTGA 1XAHA 2OBNA 2RGBA 4JASB 5FO0A 5FNVF 5SY9A 1A27A 3U9SA 4LKOA 3BCRA 5FPSA 2JIZA 3WGOA 4CYMA 1J9GA 3ADOA 3AERA 4YWJA 2F8TA 1DE0A 3ZJYA 4QUKA 1W1WA 2VT7A 4UQOA 1KEKA 2PCLA 3EBOA 3BFJA 3ROXA 4HHEA 4ZEOA 2JCYA 2PS0A 4X7RA 1A5SB 3FDIA 3ZKWA 1CW2B 1N6LA 4LHEA 3COJA 1ES9A 2VYCA 3W8RA 4YJ3B 1OLXB 1X42A 1SC1A 4B85A 2I3BA 2YWXA 1ONBA 3AIMA 2NVWA 4TVSA 1KJNA 4HQOA 1KSGA 1YOVB 1QR6A 4PBTA 1RCUA 1LNSA 2C4VA 2O20A 1P0MA 3WXBA 5D8DA 1FFHA 1ZWLA 3PQ3A 3W5AA 2OV3A 1ACLA 4F71A 1H0HA 4Q9KA 4YMUA 1G2IA 2DCMA 4C6TA 3G88A 3GEDA 2AFIA 3QWBA 3W9SA 3SIWA 4UTOA 4N4AA 4M87A 4BBPA 3ZQUA 1GADO 3KL4A 5BPHA 1T8SA 2BGMA 3A6GA 1ULTA 1X1CA 3GXOA 2X58A 3H87A 3L5OA 5TIIA 1L7OA 3DDHA 2O50A 2W2QA 1N92A 3OURA 3BKWA 2GBFA 3ESBA 2F9FA 2PUHA 2Q5OA 5K3BA 1Y34E 4WZBB 5DIZA 3SJAA 4F11A 1VZ3A 4H35A 4FYXA 4PQGA 1JJVA 3A3PA 1IC6A 3MWEA 5FI0B 4YV1A 4MWBA 2O3TA 2WWYA 1B2LA 4ZVUA 3KS9A 3VV3A 3N7TA 3PD7A 1OLXA 3JVEA 3PHHA 3OLQA 5KVVA 3H1FA 1CPYA 3X1XA 4WNIA 2VNAA 1E7YA 4GLBA 2WSLA 4A6XA 1PVOA 4CMEC 1I36A 4BO7A 1P5FA 2D1TA 4BP9A 2E85A 2WWWA 3CTPA 3LQFA 1LX7A 3MRVA 4OYRA 4WBNF 1G5PA 5JBNA 2WD9A 2V0NA 3MTBA 3HKDA 2OZEA 1UPAA 3CVYA 1ENZA 1V0JA 2BFPA 3EG9B 1RDFA 2YHSA 1U1IA 2Z57A 3QVXA 4FS8A 3DHNA 1M1NB 4X8MA 3ZHBA 4B8YA 1SXGA 2FP3A 1M67A 4OI2A 3T7IA 5IK2A 3PYXA 4IKOA 5IYZF 4RD0A 3GGOA 1BE1A 1XZMA 3ILHA 4NV3A 2UV8A 2BOVA 2VP6A 4NZPA 3PQFA 4XVQA 3F97A 4FN5A 2G70A 4M7PA 3RYIB 4RETA 2QWXA 1VI2A 5BN3A 4FGWA 3GLGE 2OSBA 3TAHA 3TPCA 1E5LA 2RGAA 4UUMA 3ZN2A 2GGSA 4PGAA 5JH7B 5B2ZA 2FLKA 4KXFB 2PUGA 4GGMX 2ZZMA 1TO2E 2Q1SA 1NIPA 1F5NA 2IYUA 2R44A 2ZBEA 4WY5A 2AEFA 4TV8F 2CJYA 3T5MA 1GTMA 4UC0A 3PYMA 1D4ZA 3HFRA 3CZ9A 3PNMA 5JDCC 3CZAA 5CH8A 2NU9B 1XALA 4LI3X 3FBGA 4C6HA 1IZ8A 2RHCA 2YYYA 3H9UA 2Q4EA 3QTBA 3IAFA 4HP8A 3V8EA 5FTLA 2P9QA 3I2HA 1U3WA 3HP4A 4O4IB 1Y89A 3PC3A 4J1QA 4HPWA 2ZUSA 1J6UA 5FBZA 3ZZTA 2X6QA 1WDWB 1LPAB 5IEBA 5I7EA 4Z3DA 4L8LA 5IF9A 3DWEX 4WK4B 4KQEA 1YGPA 1E79A 3CW2A 1K8ZB 3BJZA 2PRIA 3C1TA 2HT6A 2JLAA 4WW0A 3S1LA 1YB1A 3CV3A 1Z75A 4E14A 1DX4A 2X2EA 3ORFA 4MQEA 2IHJA 1OTHA 2QL6A 3EUWA 4JOSA 3TZLA 2OC4A 3QMPA 5DYGA 4D9HA 4YLYA 1JDNA 5BQFA 1EFPA 4XQCA 5FOWA 1E64A 1WMSA 2GJ8A 2D3WA 4CLXA 1DUSA 2P40A 1PR2A 2PG3A 3WMFA 1G59A 5LBIA 3I30X 3JQCA 2QBYB 4E03A 1XVTA 5HUQA 5ISMA 3TLBA 3IQZA 2IE8A 4IJWA 4RA6B 4TZ0A 3LHKA 1AS0A 1MJ5A 3G1WA 2HLNA 3MJCA 2R96A 2VAMA 3MJRA 1QVVA 5I7VA 1ZVKA 4LV6A 3HZHA 1PJAA 4B09A 4OAQA 3LA8A 1O9GA 5LPNA 5KTOA 4EPXA 4ZOCA 4PLZA 1DELA 4UREA 2PKYX 3RVLA 4KUEA 3QX8A 1O6CA 4QDJA 3VH2A 3SYLA 4KWHA 1TADA 1W48A 3AKYA 3QK7A 4R54A 4TQ9A 4DA6A 1NFFA 1P7PA 1U7DA 1YASA 2QTCA 1XYVA 3DEIA 3OZXA 4X90A 5GOZA 1EJBA 4GI2A 4CHGA 2NVUB 4I2NA 4ROSA 4W1RA 3W05A 4W1SA 4WZAA 5EJ6A 3B5JA 4JDUA 3PPYA 2J5BA 1JHOA 5FTWA 3UPUA 2REBA 3OCCA 2GEVA 3AQIA 4X8OA 2X2FA 1VIVA 2ZZKA 2DHCA 1D09A 4G84A 4O2RA 1BEUB 2YJGA 3PEYA 2P77A 2WIGA 4P86A 1K5DA 2GBLA 2WJHA 3MINA 2P0EA 2VYNA 2QRKA 2PLRA 2J30A 5EZSA 2BRUA 2J07A 3AOEA 3I5AA 4UUAA 3W3ZB 2CLKB 1U7ZA 1XDWA 1ZH4A 5IAJA 1RWBA 1RKUA 1RM3A 3PNKA 2XWBF 2DP4E 4DQ0A 1WXFA 5E8JA 2UYQA 3ON5A 4LPSA 3VHLB 1U9YA 5LZ9A 3OHSX 1WMDA 4JOQA 3DGEC 5CNKA 1H2AS 4ZOAA 4NYMR 2C95A 2TS1A 2HX1A 1ZOPA 3IBTA 4DSOA 4X20B 1YJ8A 3PIDA 4LOIA 1V8BA 5AVOA 2O54A 3HVKA 5BWOA 5E2AA 4M21A 2E89A 2BMAA 1R4ZA 4ZT3A 3SY8A 5KSZA 3SIRA 5A62A 3EZGA 3K7EA 2C2KA 5KSWB 4KCGA 3K9WA 2WSMA 4BE9A 1KAEA 1EDOA 1PYDA 4FFWA 2RHBA 4O2BF 4RK6A 4I4TF 3E27A 2GI4A 3MUOA 4EGJA 3ZDDA 3H97A 1K6XA 1SH7A 4IUYA 3TUZC 1HYHA 2RARA 3Q9UA 2DSTA 4M1SA 5JD6A 3KQNA 1IMJA 2HSEA 1SPBS 3K4QA 3KZXA 1DG3A 3Q85A 4HNRA 3ZWNA 4ANFA 4ERNA 2ZRDA 3VU9B 4FWTA 1QVZA 1FTQA 2HZBA 1IQUA 4NDNE 4NU5A 3ZQJA 5HIKA 4RCZA 1Y63A 3W5UA 1ZUIA 5JAIA 3DMPA 1KP3A 2J3JA 3FBWA 4RY8A 3F98A 4L08A 1J0DA 4LX0A 1B41A 5JZ9A 2FZGA 3PGJA 2EFCB 4KDCA 5AP9A 2GN2A 4FINA 4Y6RA 1WX1A 3EBPA 3LT1A 3W90A 1PP4A 1VCNA 2ZRMA 3GFQA 3I92A 4MW7A 3K94A 5BV8A 4TLDA 1X14A 4NEQA 2I91A 4M3NA 4C7OB 3IURA 3TOCA 3WP1B 3LBNA 5JAMA 3VNUA 4DADA 2ZULA 4DJEC 3SE7A 6ABPA 3RTAA 1MX9A 4FFBA 4FW8A 5A06A 1X3SA 3VHQA 5D5HA 3D8NA 3GIDA 4PIVA 2FVXA 5C8VA 5J2UA 1TAUA 4P7GA 1U63A 2NXWA 5BT8A 5HUJA 5EGSA 3S70A 2FSVA 4O4JF 3C1UA 4J8PA 3G6KA 4Y3UA 1L5OA 3E7FA 2O8VA 4QOGA 1QRDA 3IERA 4YFVA 3NT5A 1JMVA 1UPFA 4REQB 4U7TB 1DGQA 5EHIA 2G71A 2WB4A 1YS9A 3GBPA 4BJ5A 1NLFA 2KHZA 4QGAA 3L1VA 3V9AA 3PE6A 4CLDA 3A10A 3J7TA 5A1TA 2WJIA 1XQYA 4FBMA 1JLKA 1QHNA 3KCQA 1XTZA 3PNYA 1PS0A 4N1AA 3UUFA 2BEKA 3VVMA 3ETCA 2F90A 2HRBA 4PO3X 3BC1A 4EHIA 4MX8A 2ZE6A 1UL1X 4CR7A 2PQ0A 3NG1A 2HYDA 1B74A 1WU7A 1WW3A 3K96A 5I7HA 1T5SA 1LNZA 3EVCA 4R1LA 2PXXA 1G8SA 3FPJA 2IEYA 4YO8A 4DQUA 1CEXA 4MW1A 4X1IA 2PD3A 3E4CA 2C4KA 2IW3A 3FLAA 2ZXFA 2E4YA 2J0SA 3HUDA 2DAPA 3JPYA 1XZNA 3UV7A 1FDRA 5FBKA 1KY3A 5FI5A 5A4FS 3MELA 2V6MA 5ED4A 5CYFA 4AP9A 1M0WA 1CZRA 2PJUA 3UN1A 5KSYA 3OOJA 5K0TA 1P1BA 3NT4A 3R7LA 3WFJA 1MGPA 2Z43A 1VCOA 2G7ZA 2YS7A 2J3LA 2I3AA 2TYSB 3A0UA 3NIGB 4DEYA 2OD2A 2P4HX 4EW6A 1ZPDA 3R5SA 5FOQA 2V7UA 3T9BA 4KRYA 1SCBA 1D2MA 3I34X 4U7JA 2L17A 3U31A 2QD2A 5IDWA 2WOJA 1DEAA 1N6HA 2CUTA 2H8KA 2V4ZA 3GEGA 2HGZA 3ITKA 1LXCA 3PVZA 4P3XA 4RMIA 1JIQA 3AZOA 3EIHA 4EGAA 1PWZA 2XADA 4A6DA 1UDXA 2YIVX 3QPAA 4JI1B 4Q9DA 4P80A 2D1SA 1Y4ZA 1KOFA 5ECGC 2BVNA 1ZRHA 5THXA 4Z5XA 1HO3A 3F8SA 2B5VA 2ZSDA 5FYQA 3VTKA 2CHGA 2PWBA 4WN9A 4EMBA 2V1UA 3ZU4A 5CDFA 3CLVA 5JMWA 2WG0A 1ODCA 5ED0A 1XEWY 2O2CA 2OSVA 2COKA 5IC5A 1N3LA 4GVXA 3IA7A 5EC8A 2BFWA 2OFWA 4TS9A 2WTBA 1LSSA 4CG1A 2PL3A 3WIBA 2H2FA 1A1SA 2YN0A 1AHHA 3EXEA 3G85A 3PGLA 1M75A 2JI7A 2RHOA 2Y05A 3MRTA 4HNGA 4ZKDA 4MWEA 1KAQA 4KHZA 5LWHA 3ZW9A 4NXNB 1KK1A 4NICA 3I61A 4DFDA 5LSAA 2RMKA 3PXDA 1WKBA 1WG8A 4L8FA 3AKDA 1J0CA 1E6EA 1KAOA 2XOEA 1FQKA 1DNPA 3QHAA 2EGGA 3HVHA 4H0CA 1T3HA 1VA5A 3RRMA 2RAFA 5IULC 3CLRD 3IAS6 3N0RA 1YL7A 4IOKA 1E2KA 3ZTWA 3VYSB 4NAUA 1XNHA 5C46F 1N4DA 2XCLA 3IAUA 3C3AA 5HW0A 5DEOA 1VE9A 4C05A 4GSYA 2PT9A 2FMXA 3J81A 2W8BA 5H82A 5ITSA 1MRZA 3HXQA 3N05A 3AIOA 2LXNA 1BD4A 1E2EA 1I30A 4AS1A 3C3XA 3ZDEA 2ZTUA 5TRTA 3MT9A 4ISBA 1XYGA 4ER3A 1DI0A 3KU4A 2DCUA 3I2JA 2CFSA 3PFHA 1U7PA 4GZ3A 2IXEA 3FVVA 4J94A 2ZIAA 4RJ2A 1AMUA 1K0UA 1O4WA 2AL7A 4HDKB 4B3TB 5LMCA 1CRLA 3H4IA 2WJGA 4MQFB 2HJVA 3ND5A 3WGUA 1DFIA 1K4MA 2GKOA 2SBTA 2WHQA 4EHJA 4DCSA 1C7QA 1XD8A 4JC0A 5DHFA 3INNA 3CMMA 3G3EA 5IUNC 4BLWA 2QD4A 3IAM1 3ME5A 1PT6A 4U3JA 5DE3A 5A9SB 3KKPA 2J9YB 1WVGA 2FI1A 4UM9D 4JI7B 3QFTA 4DILA 1WP4A 2WG2A 2XB2A 5BV0A 3R6WA 1S3GA 3QPCA 2J4CA 1M8JA 4QM7A 1JFFB 4D3XA 2CHVA 3P9RA 5CG2A 3W9BA 2C3YA 4LYEA 1NSTA 2G9ZA 4QUDA 3IIKA 5CB6A 3ZE1B 2ZRGA 4RABA 1R9GA 2H4FA 4XQ9A 1FLVA 2VWQA 4UXIA 5CBPB 4Q5IA 1E3SA 3PA6A 2PMKA 2IWHA 1SUDA 4BASA 5KYNA 4EJSA 2IUSA 5E1DA 1NMQA 1XXHA 3ILSA 1U0FA 5IDVA 1XA0A 1QYXA 1SBNE 4X1YA 2F8LA 1E9DA 5I51A 4EFKA 3GJYA 3LVQE 5ITWA 1TIBA 2ZIVB 2XSZD 1FW6A 1CJCA 3OQ6A 2CN1A 4AICA 1A9XB 3HA2A 1AGPA 4WFJA 5F7ZA 4MWCA 2VI5A 4P4TA 2Q0QA 2OZLA 4OQZA 4R2IA 4BTEA 3A0RB 2V3VA 5HPYB 3AF1A 3EMVA 3QKIA 5CXSA 2I6SA 3NETA 4G89A 1IBRA 1RVDA 3E0XA 4JIGA 1QYCA 4L50A 4Y7CA 3I5XA 1ULZA 2ZJ7A 3H9QA 3NR2A 4FJ1A 5KOYA 2VK4A 2XQVA 3ZHSA 3D6MA 4FYIA 1H8HD 4TLAA 2QE7A 4EQZA 3TZKA 2IDJA 4URZR 3RH0A 3W04A 1CKEA 4E6PA 2ZWAA 3IVRA 3I39X 2J09A 4J6FA 4V38A 1A5ZA 2PR2A 1ICIA 4GOXA 3U7QB 4QHTA 3L92A 3U80A 5CFMA 1E2UA 1HG1A 3ZJUA 2E49A 1G18A 2EL9A 1SUIA 1AMNA 4JZKA 2QROA 4QU0A 3DDOA 4QECA 2XUFA 4IUBS 3C6YA 5ALLA 3CB4A 2FGJA 4Y2UA 4OJQA 4JHXA 1LW6E 1I4TD 3DHEA 10MHA 1KJYA 1W29A 5JNVA 3W6PA 1GV0A 4MHTA 2D54A 4EKDA 4I0WB 2V6GA 1P9NA 2WFZA 1F48A 2CE2X 5F1KA 4DIUA 1MIHA 4G4JA 4PZPA 4MUEA 1FDUA 4RWEA 2ZSHA 4WTOA 3VXKA 1NJ1A 5JS2A 2WOOA 5LZ7A 4B43A 1YRLA 3GDHA 5TE9A 1LFAA 1NW7A 1TYAE 2JFGA 4M86A 3S40A 4AAYA 3IUJA 2SCUB 3K15A 1D07A 2QOEA 3R75A 1V35A 2DUNA 3F49S 4I1OA 1CFZA 1E32A 3CGGA 3KWJA 3ER8A 1VC2A 3QZUA 1TPZA 3KALA 3AM3A 3WFZA 3DVSX 2R5FA 2FZEA 3H0KA 7REQA 3O3OB 1II8A 3AUUA 4C06A 1TDJA 3BTVA 5GMOA 1F60A 4X1KB 4LCEA 2QZZA 4NSNA 1MAAA 4PO9A 6REQB 1FP6A 1FRQA 3ZE9A 5AI5A 1M6VA 5KTNA 2QX6A 2AUTA 3CRNA 3I05A 4RQUA 3RUAA 2IKQA 2I6XA 3C3YA 2HXGA 3KKMA 4ZZ2A 1II8B 1HE2A 3L0YA 3CUTA 4IFTA 5ICFA 3M3PA 4J29A 4LBWA 3HDHA 3RYFB 2B69A 2RBGA 1RXYA 2PK3A 1XJ0A 4Q7LA 4S2UA 3S7TA 3UVEA 5KQRA 1IHUA 1LLDA 2IYFA 2AOWA 4ZOEA 5IF3A 4ARZB 4TMTA 2WF7A 1FRVA 2Z0MA 2BEJA 1L7RA 5TF4A 2YHIA 3SF8A 3VU1A 4CM3A 4Z4EA 3DTVA 4NV1A 1M54A 2L18A 3NV9A 4M0DA 5FAXA 4EYGA 2MJLA 4YDSA 2DY0A 3ZS9A 2UYCA 1WDKA 3I9LA 4AQYB 1M0EA 4IX9A 1E9RA 2A5YB 1ZICA 2OV8A 3F9RA 4I5GA 4PPQA 4QNNA 4YAFA 3ZDXB 5A05A 4AF7A 3R2JA 1HNWB 2HQ1A 2PX0A 1Y1LA 5IEJA 4Y2SA 1C81A 1NT2A 4BAZA 4RVSA 3ANYB 1UJBA 3NIBA 3OPNA 3BTOA 5KWJA 2EQ5A 1JKFA 4KYUA 1N2OA 4QJ4A 5DM1A 4JXXA 4D99A 1RKQA 1KNXA 1JFRA 2OKCA 1OXMA 2IP1A 5EZ6B 1IIRA 1PU2A 4WOKA 5FNZA 4YAOA 3JVUA 1QB8A 5JDIC 3GUCA 5BSFA 3AHCA 1PVDA 5DCWA 3C16C 3JCZA 4ZVTA 2V5UA 1W0KD 4PRYA 4YGYA 4YRRA 3HYSA 2RJOA 3SKXA 4R41A 2BE9A 1NUQA 5FUWA 2BSQA 5DI9A 2JLBA 1Z5UA 1U6IA 2CXNA 2NSDA 4ID3A 4FCVA 4KNWA 3I9V6 1ZCBA 2N1BA 2O2YA 3HHEA 2QMUA 1DB3A 1R6UA 2QRJA 3CTMA 1KJQA 4DLWA 1DFGA 1DTEA 3DE6X 5LQMA 4P5DA 2HMYB 2C07A 5DULA 3BF7A 3BK2A 3FAZA 1MZPA 4DDTA 1DBIA 3IH5A 4F3TA 5TQ2B 4WK0B 4JMLA 4RH0A 3IDZA 1MJHA 3V6LA 4DZTA 1RZRD 2OGTA 2Q6OA 3NH6A 4IV0A 2PNJA 1AGYA 4WIAA 4BVEA 4N76A 4Q47A 5IXSA 3MS4A 2H29A 1E1YA 3IEUA 3K9CA 4ALNA 4DCTA 2D00A 2W2MA 4JEMA 1BW9A 3T95A 2I9KA 2FZ5A 2QJWA 1E8DA 2AEJA 3C6MA 4ZQFA 1NLMA 1AY0A 3R23A 3RFCA 3V8QA 4PBRA 2QPTA 2BI8A 3LDUA 3ANMA 2VLBA 5EJMA 1SGWA 1I5OA 3EA4A 5KU7A 1YVDA 2ZJZA 3O8QA 3HGTA 2B21A 4IWXA 2A94A 4HCJA 5SYMA 4AKHA 4Z1MD 3KX2A 2FPIA 2YX1A 5H0IA 5CNIA 4YI5A 2HSDA 3D3EA 3PICA 3N3AC 1CJVC 1SKUA 5AJHA 3L02A 4RKEA 5JPCA 2EKBA 2CE7A 1PK9A 3EMKA 4PSUA 3UA4A 2DUMA 3ZIAA 1TMOA 4CRWB 5H8WA 1AJEA 3O26A 2C5SA 2PV0A 1WSBA 3R9KA 2J3KA 4F8JA 4ZI7A 1VKJA 4MVJP 1C8LA 3D2BA 1GNLA 2XIQA 4YUWA 5HP4A 4RJJA 2B3TA 2XTJA 3FM9A 4MAMA 3QVOA 3D3NA 4DB2A 5JAPA 4L73A 2A4MA 3MGBA 2B25A 1CUJA 1KH3A 4I99A 2C7VA 3CUSA 1H2WA 2EEPA 4G0MA 4WCDA 4XSVA 5KDLA 4EHBA 2WYVA 1UBEA 1FDIA 4J9VA 4AIRA 1M0TA 3C3MA 2CFTA 4BFCA 5K8LA 1NIJA 4NARA 5M04A 1U2TA 2SHKA 2ZQ5A 5IVIA 1ZM9A 2WM9B 3NAQA 4LRXA 2PUFA 1QCYA 2VCHA 1HGXA 1F8FA 1EM8B 1SVIA 2UUPA 2VP3A 2WHYA 3HO8A 3OX3A 2FMIA 5EJAA 1GTJ1 4PNPA 2OV4A 2JGFA 2IU0A 1QK5A 1JIXA 3A9WA 3FFAA 4GMKA 4CKYA 3ONWA 4P7KA 3GFBA 1QZTA 3N2LA 4F9GA 2BEWB 2PZGA 2WPDD 4KXLA 5IMSA 1A5AB 3B6JA 1SEVA 1BVHA 1I3CA 1SHUX 3PUZA 5DYWA 3GK3A 4KRXA 5B1IA 3B6KA 3TIVA 3CLRC 5JECA 1ECLA 3RU9A 4YJHA 1UJ4A 2CLOB 1OT5A 2XEXA 3S5UA 3PFFA 3V7NA 3KTOA 2A9OA 1J2RA 4IL5A 3GFRA 2MOKA 4WOJA 3W7VA 1W52X 1FOEB 4G3XA 3BGDA 2Y6VA 2F1OA 5ALJA 1H2HA 1TQDA 4CR8A 3G2NA 3KYBA 4MRVA 3OD1A 2O7RA 2F1IA 3AKCA 3R9XA 4JQCA 4PLHA 5EIEA 2E4VA 5REQA 1Q1ZA 1TUIA 4ZYZA 1TFRA