2GILA

Structure of the extremely slow gtpase rab6a in the gtp bound form at 1.8 resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
161
structure length
161
Chain Sequence
b'FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-6A
publication title Structure of the extremely slow GTPase Rab6A in the GTP bound form at 1.8 resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 52
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gilA00
4GFDA 5B58C 5FPTA 1MT0A 1TQDA 1EFTA 2O8CB 1FMLA 1Z8FA 4HAWA 4LYAA 2C2HA 2V7QD 5TV2A 3TUIC 1DG1G 4EUNA 5UKDA 4DZZA 2HCBA 5GJCA 1UEIA 2RGCA 2GWHA 3ZLJA 3A1VA 2WAYA 1MV5A 3GLGA 4QGFA 3ZYCA 4OJQA 4BRWA 1GNQA 4E09A 1KK0A 1P6XA 2CK3A 2EFGA 4I1UA 1OFHA 3NWJA 1W4CA 1R5OA 3FMOB 1P2VA 4DDVA 3IBGA 3SE0A 2IYQA 5DI3B 2C95A 2GESA 1KI7A 4CEHB 3U6BA 1KMHB 3RRZA 4BQSA 4HDQB 5FL7A 4E07A 3L2OB 1R8SA 3VX4A 1M7HA 1D9XA 3K0CC 3LVQE 3KXKA 1SVMA 3AM1A 1E2DA 2YNMA 2ZE5A 1Q1BA 2RB4A 3KJIA 5C2JB 4OQXA 4QBFA 4M1MA 1MABB 2KBFA 2PCLA 4ZDJA 2OCBA 2QA5A 3ZIAA 4BZQA 621PA 1KZ7B 4XSHA 4TT3A 4CGZA 721PA 5DN6D 4ESVA 1W0JD 2VSXA 3GEIA 5F3WB 2ZS7A 1N0UA 3CF0A 4HUQA 4GL2A 4Q02A 3AVYA 1ZC3A 3K9LA 3ZZTA 4QBIA 3TAHA 1N6HA 3TAUA 2QAJA 2PX3A 3V4FA 4YXWD 1E2KA 4Q00A 3NBZC 4EFNA 4V0KA 4UXHA 4HLCA 4EPWA 2GCPA 2W00A 2JJ8A 4JLMA 1VYUA 1TF2A 2ZITA 4AKIA 3IPYA 2BJVA 4TQ9A 2WWYA 3SC3A 4DT1A 2C99A 4A8JC 3IO5A 3MUFA 1AKEA 5AJWA 3BXZA 1I4TD 4M8NE 2XTZA 1R0YA 2V7QA 3B6EA 3PJRA 4FMDF 4M1OA 1HEIA 2J0VA 4ZDKA 2IXEA 1SZPA 4BWYA 1Q0UA 1P60A 1YR9A 5DYGA 2IT1A 4TQUS 1PVOA 1C4OA 2B8WA 2QPOA 5DHFA 1D2MA 1PLJA 5GJBA 4M1KA 2NMVA 4DCNA 4PSKA 3TSWA 3SQXA 1K6MA 3Q72A 2ZSBA 1TUIA 3DOEA 2CHGA 1BMFD 5P21A 4KITB 1XNJA 3Q7QA 1Z6TA 1H65A 1D2EA 2YWGA 1E98A 4AYWA 2GJ8A 1Q22A 2QTHA 2ZJ2A 3WYGA 4XD7A 3UWKA 1P62B 4IRUB 4UKDA 2FA9A 4RVCA 5KSPA 4EFLA 5JCZA 4MGYR 3THXA 3CRVA 1UKYA 1U2RA 4HB0A 2BKUA 3CX6A 4BLQA 4MH0R 1Z07A 5DN6A 1W0JA 4NCJA 4O0MA 3SJAA 1S8FA 3UWOA 2GETA 3W3ZB 4NYIR 4GRAA 4OBEA 5SZJA 1YZKA 1R2QA 1OW3B 2OBNA 2ZS8A 1AS2A 2VP9A 4HZUA 1UKEA 4ARZA 6Q21A 5JJIA 1CF4A 4YXWA 5BYKA 3FYHA 4RFSA 2F55A 5JBQA 3L0SA 4MRPA 3E2IA 2GXSA 2BMJA 1EXMA 2OFXA 1WBBA 5EZ6B 4D4JA 3ZD7A 4IHQA 2ATXA 5D3QA 1N6PA 2O8CA 4P31A 3BD9A 3B8HA 4CZ2A 2D3WA 1W5TA 2OV2A 1FP6A 1OLOA 3LX8A 4IFBA 1F2TB 5D3MA 3K70C 1E2GA 1WP9A 4RD2A 4Q21A 2EW1A 4UNPA 4JSYA 4IEEA 3ZGXA 3ZH9B 3K09A 1ESNA 1TU4A 4NDZA 1MOZA 2GK7A 2ZVQX 4GP7A 1X1RA 1DPFA 3KXLA 3BH7A 4MKIA 1G4AE 3X1YA 2BDTA 5G3YA 4OKSA 3CRQA 1YZGA 3WMGA 4AG5A 2ORVA 3GEEA 5DI3A 4A0FA 2F43B 4CEHA 1KMHA 4X8LA 1R6BX 1RE0A 3EZ6A 1GUAA 3LVRE 3LO5A 1N6IA 4DEXA 1RYHA 4KODA 1BMFA 3RS0A 2IXFA 4KYIB 4CYMA 4BUJA 4P4SA 3CX8A 4N0EA 1IM2A 1D2NA 2D7CA 1MABA 1R10A 1QHGA 3F8TA 4DJTA 1ODFA 4Q4JA 3KTAB 3KUCA 4H1VA 5FH9A 3GD7A 2V1UA 1G8YA 1QHHB 1GDDA 2CCKA 1XJ0A 2F9LA 2QP3A 4TL7A 4LUCA 2C9CA 3UKDA 1L2TA 1KDTA 3G82C 1MR3F 2OM2A 4JVLA 4WZBE 1GIAA 5TY0A 4CW7A 1J7KA 3QF4B 3WP0A 4C0QC 4HDCA 4WXRA 2P65A 5E95A 3QEJA 4R98A 5K8TA 1JXOA 4KFTA 1E2HA 1KZGB 1IN6A 2JAQA 4WVFA 1SHKA 4EQ6B 1NVXQ 1XBTA 1CS4C 2C78A 2EFEB 4PZZA 3TVTA 3ICQB 2O8BB 4RZ2A 2BHRA 2ZU6A 4U7DA 3PENA 5FUYA 2KI5A 4KVAA 2ZRLA 1HT1E 3WBJA 4OYHA 2H57A 2J7KA 1KI9A 1Z63A 3NEYA 1VDZA 3T1OA 3NBYC 2OBMA 1SVKA 3T12A 4I1SA 2V4ZA 5LD2C 2V3CC 2NO9A 3BE4A 1KI4A 4Q48A 1COWD 1G5TA 1Z0KA 4B3GA 4G0NA 1XTJA 2Q9CA 2ZRKA 3ECCA 1KI6B 2ZYTX 3FKSA 5FTJA 4C0SA 1E2EA 1E2LA 5JRJA 4FMCB 3PEVA 4JMPA 3AB3A 1EX7A 1BO6A 4ASUD 2QTFA 4QRHA 2FPLA 4AKHA 3SDZA 4DB4A 3SEAA 1V5WA 4KSBA 1XD9A 4IKEA 2PT7A 2QRNA 5L3RA 4F4IA 5L3QB 3CZQA 1TMKA 2O0JA 2QMUA 1ZNZA 1WF3A 1Z47A 2J46A 2V55B 1OIXA 5L8VA 4DUGA 4NP6A 5CLQA 1M7GA 2FE4A 3HDTA 2Z4RA 3HU3A 1R0ZA 5LDDC 2ZRFA 1HQYE 1OH5A 3W8NA 4A1FA 1CJMA 2HEIA 1CP2A 4QM7A 4IDHA 5CB6A 4A6PA 4BFXA 1XTSA 2AD1A 4BRUA 1BOFA 2ZTSA 4DLZA 4EIWA 3WNBA 2KSQA 1G16A 4HATA 2IHBA 4M21A 1FPMA 5KNCA 2GRJA 4M9XA 4W5JA 1QHYA 2XB4A 1DADA 4A0HA 3U6KA 4N1AA 1OFIA 1S9DA 5HCNA 3FFAA 2PZGA 2FJUA 2FN4A 3OEED 2C98A 2HV8A 3GJ4A 4OQLA 2ZI5A 3JVVA 4YDSA 5EE9A 5DGXA 2ZM5A 3Q9LA 1U94A 1RZ3A 1NI3A 2J0UB 3U7HB 2WV9A 2XTMA 3FMFA 4NU0A 4DLSA 2GF9A 4TMTA 1TNDA 3EZ9A 3HYRA 1XJQA 5EP4A 2FV8A 1N25A 4ABYA 3OEHD 2P6RA 1MO6A 1L7VC 2X2FA 3RVBA 3AVTA 2JGNA 5JRZA 2Z5FA 2WAXA 1KJYA 1SKQA 3H2YA 3GLFE 1F2TA 2RHDA 2XNSA 2PLRA 1OB5A 2QMOA 1OYWA 4LJ7A 2A7QA 3R9XA 3OF5A 4AI6A 1XF9A 2CHQA 3AVOA 4KLNA 3SJCA 1D8TA 2QMHA 1COWA 5CDFE 1G5RA 3W6OA 4JSTA 4LOAA 4XWKA 2IYYA 1ZU5A 3AVPA 5DYIA 4XWAA 1DAGA 1GITA 2VP4A 3SJBA 1XX6A 2F43A 2FFBA 4ASUA 1KDRA 2PJRA 5DIFA 2V54A 2OG2A 1YE8A 2BEJA 2JLQA 2PEZA 3MD0A 1LY1A 4IFEA 3FVQA 1UADA 3GP8A 4JLKA 2H1LA 4EAQA 4BZPA 1C9KA 5AJZA 5E7IA 2A5DA 3GJ3A 5FOWA 5KDOA 1CTQA 1XEWX 3QPWA 4TMVA 4KVGA 3T15A 1SXJC 2ZI6A 3KTAA 3P1JA 4LYJA 1Y63A 4D82A 2Z4SA 1QHHA 3KZ1E 2FSIA 2QGZA 2DWQA 2NZJA 3MMPA 1VCMA 4KI0A 5JS8A 1ZIOA 2HF8A 3U3RA 2ZREA 1U81A 2H17A 3B9QA 4Q7LA 1ZM7A 4BGDA 3KJHA 3KQUA 3CR8A 3QF4A 4LJYA 1B23P 1KY3A 4R71A 3VR1A 4IW3B 3DEFA 2P0EA 5F98A 2NO6A 4EQ6A 4WA7A 3UMRA 2AXNA 4UJ5A 1L4UA 1S0UA 1OJLA 2O8BA 2QORA 3TBKA 2NO0A 4MRSA 4NE2A 4D0NA 3LD9A 1VG9B 1G8PA 1S2MA 4A0GA 5JMTA 2G3YA 1DE0A 2GEVA 3CRMA 4PO1A 4V02A 4B44A 4FN5A 2VF8A 3OEHA 1AZTA 2MSDB 3AKYA 1II8B 3UIEA 1TF7A 1Z28A 4Q1AA 3UG6A 2P2LA 3CM0A 3NDPA 2GXQA 3V9PA 4B43A 4GP6A 1GNPA 4JLDA 4A36A 1W2HA 4RFVA 2AHOA 1UBEA 2XB2A 1HTWA 3THOA 3X2SA 4QBGB 3T1VA 1IJEA 2P67A 3CBQA 3OE7D 1RFLA 1W47A 2BBWA 4HAXA 5EQTA 2PT5A 5LB4A 3LLMA 4M0LA 1UEJA 5FTKA 2WWIA 5FR2A 4DSOA 3BAFA 5EXSA 4G5SA 4DVGA 3JZAA 1FX0B 1VECA 4PSAA 4MYCA 1X1SA 3N2EA 3W8RA 4QNMA 4BE7B 2QSYA 1XTRA 5L3QA 2J5XA 4FCTA 1U90A 1WXQA 2GZHA 3U7EB 3EPLA 4D2IA 3RS2A 1RRPA 5KDLA 2FSFA 4D4LA 1T3HA 1MH1A 1BYIA 2GK6A 1QHNA 2QGNA 2ZANA 5TXGA 4QBHA 3U3KA 3ADBA 3QXHA 1T4GA 1Z0IA 3GJ7A 3L8ZA 4MGZR 2IYVA 5K8UA 1FL9A 1IONA 2E1RA 4LCBA 2FZ4A 5KPDA 3BRWD 3LQRA 5BN5A 4UNRA 4IDNA 2ZI7A 1N3BA 5E4FA 2REBA 5JEEA 2QE7D 5JI3E 4V0ME 3IKJA 3T1QA 1NG1A 4XJXA 4WZAE 3RDPA 3K09C 1E9SA 1ZM2A 4KO8A 1Z29A 4GSYA 4Q7JB 2HJVA 5CM8B 1TQ6A 3ZJYA 1JAHA 1T0HB 4XIGS 1NKSA 4JL5A 2RHMA 3LDAA 4DDWA 2ORIA 4AIIA 4PZYA 3M0EA 3AP2A 2QG6A 2OFOA 2W0MA 2FZLA 4LYFA 3IIMA 3B2EA 4B2LA 8OHMA 1S3SA 3C14C 3DPUA 1UDXA 4ZIRB 1KYIA 2ZRCA 2ZQ5A 3C5HA 1WA5A 4B73A 2D4HA 4IOKA 4L8GA 1KSGA 2QUZA 3NVAA 3EA0A 3D3QA 1TPZA 2ATVA 2IUSA 4GNKA 1DAIA 3OE7A 4LC1A 4NYJQ 4RZUA 1AA9A 4NCKA 1E0JA 1SULA 3GLGB 2BVNA 4TTRA 3ZVRA 4KAXA 2YC2C 3TR0A 3SS8A 2QBYB 3H0KA 2DWOA 2F3RA 4Q47A 2P5TB 4UQOA 4M4SA 1YR6A 2IWRA 3I5XA 2RMKA 2EFCB 3U5ZB 3T5DA 4OHWA 2O52A 1KAOA 2VL7A 421PA 2HUPA 4Y0AA 1IN5A 1JAIA 1LFDB 2CJWA 2ZRAA 3RRMA 4DBLC 1OFUX 5CK5A 1XTKA 1GTVA 2BMFA 4HAUA 3X1WA 2XZLA 2WKQA 2REXB 2EQBA 3U4QB 2ZXUA 5DE3A 4HDOB 3EA5A 2JATA 1KIMA 2OLJA 2WTUA 3LH5A 1CRQA 4URVR 2OZEA 2AK2A 1SGWA 4M9SA 3C15C 1E4YA 1ETUA 5G53C 1KJWA 5EUQB 1KO8A 2R6FA 3TQCA 2W58A 3V00A 1AGRA 1DAEA 2GKSA 2IA5A 2QE7A 5FI0B 1XPRA 4HUQB 4AKGA 2IEZA 1XZPA 2CHVA 1HV8A 3CWZA 4HLQB 3CB4A 4TLEA 2GILA 1X8JA 4H1UA 1SVLA 3HU1A 3P20A 4PAMA 3RS3A 2RGNA 5FR1A 2Q6TA 4B3FX 3CRRA 2NG1A 2NO7A 4G5QA 2CE7A 3L82B 2ZRJA 1II8A 3MJHA 1NMZA 1AQYA 4LJ6A 2ZJYA 1HUQA 2EYUA 5HE9A 2ZR7A 3B1ZA 3I73A 2JLZA 4LHWA 4RD3A 3LXRA 4F92B 3U7GA 2FWRA 1NLYA 1ZYUA 2VF7A 3DZ8A 3P4YA 4G3XA 5FTLA 3OAAD 1R7RA 5BQ5A 2JEOA 2UVQA 4PHTA 1U9IA 1UKVY 3B13B 1F5NA 2NOAA 1K5DA 4R7ZA 4AWXA 3E70C 4LJ8A 1BH2A 4NONA 3QBVA 2WOJA 1PLKA 1J99A 1FX0A 5HCIA 1KNQA 2Q0HA 1Z2AA 1GWNA 2EFDB 3K9HA 5TDHA 2J0SA 4DLUA 1XPUA 3WMFA 3VHXA 3O47A 4DWJA 5KO2A 4HZIA 2CL7X 4A6XA 4OHXA 1DOAA 3BWDD 1JQLB 1KHTA 2VSFA 3QOFA 1Z06A 4Q4LA 4TTPA 5FOXA 5AK0A 1XP8A 4XSGA 1JB1A 3SQWA 2JCSA 4PAQA 3EAQA 1UDWA 2IYSA 4YONB 1A82A 1OXVA 4MYUA 1KNXA 3NXSA 4MA4A 1KO5A 2WJIA 2P6NA 5GJVC 3U3OA 3F5FA 3LFUA 4C0JA 1NLFA 1U0HC 4B48A 4AY2A 2GF0A 3I61A 2O5VA 4MQBA 3IHWA 3GLFA 1GZSA 1Z0DA 1ZCBA 4TZ6A 4I1VA 4MUAA 4OJKA 4PSVA 4DCTA 3VNVA 1ZCAA 4LPKA 3A1WA 2QT1A 4Y0VA 3RSLA 1G7SA 4RCZA 4XH9B 3I1FA 1WRBA 3ZVNA 4RFSB 3U3MA 2QQ0A 5CDFA 1P7CA 5E7JA 4ZIRA 5KTYA 2YWHA 3RANA 3SFVA 2C03A 2XOKD 2GVDC 4B3XA 1G6OA 1XTIA 3T61A 1ZD1A 3BH0A 3ASYA 1LVGA 1ZNXA 4O2RA 3RYTC 3O8RA 5D3MB 3TIFA 1XMIA 5HPYB 1CJVC 1JPJA 3PUVA 4L9SA 1G21E 3K0FB 5J40A 3K53A 4II7A 3VFDA 5HZHA 4DC9A 5BXQC 3OAAA 4B33A 2VHUA 3IGFA 1JJVA 1ZJ6A 3Q7PA 1VKJA 1T3LA 3BFXA 2QBYA 2FU5C 4PC1A 1YZUA 1HH4A 4BLPA 2VYFA 4B6FA 4JS0A 3W90A 2FH5B 4JKYA 5EE0A 3CKLA 4LI0A 5FPYA 1JR3E 3KKNA 1TQ2A 1N5LA 2YINC 1A4RA 5GADl 3HR8A 1CRPA 1P61B 2ZRMA 3U4QA 4G01B 2PH1A 4Q5IA 2OLKA 2WJGA 4B75A 4P4SB 5F9HA 1EGAA 2XGJA 2I1QA 1FQKA 4EPYA 4ZPXA 4Q4JB 2FMXA 1G8GA 4G1UC 3IIKA 4Q01A 2LKCA 3BK7A 1LW7A 4Q1FA 2ZSDA 2X8AA 4NH0A 5EP2A 1D9ZA 1G3MA 4RD4A 2CCJA 1NVWQ 2UZIR 1GRNA 4IXMA 1CR2A 2E87A 5CK4A 1AQUA 2QTVB 4PQYA 3FTQA 4Q1EA 1CU1A 4J0QA 1CR0A 1T5LA 3AV0B 2HT1A 1PZNA 2GJSA 1EFUA 1Q20A 1W48A 4OI0A 1IOZA 4JLAA 2J9RA 3C41J 4NCNA 1N6KA 2F6RA 2R62A 1G41A 1U8AA 1MRSA 1UBFA 2ZI4A 3RC3A 2OCAA 2BBSA 2RGXA 4URYR 3SZRA 2FG5A 3OIWA 1D5CA 4HB2A 4RCYA 4DEYA 4AD8A 5LB2A 1KKLA 4LY6A 4OQMA 3T1TA 1Y3AA 1ZMXA 4A15A 4C9BA 4CVNA 2A78A 4U00A 5L3VA 2KJQA 1H8ED 2YOGA 3QE0A 5J4YA 4G5OA 5J47A 1XPOA 1EWQA 3LXXA 5FOVA 2IS1A 1G7CA 1NY6A 2ZI9A 4TLCA 5EUMA 1KDOA 2UZ3A 3SHWA 2OUKA 4W5HA 4FINA 2LKDA 4U5XA 4BEJA 4TLDA 2ZI3A 4BFSA 5CJPA 1BS1A 4PQFA 4P4TA 1W2GA 2LWIA 2F1HA 3QIAA 1O87A 1XTQA 4RY2A 1ZRHA 1N5IA 1A7JA 1KI1A 4AG6A 4IEIA 2QU8A 4V0MA 2YKGA 3DL0A 4L5BA 1AZSC 3IQWA 5JHHB 1P72A 2G1KA 3BORA 1YZNA 2YZ2A 1NG9A 4IVRA 2OAP1 3ZD6A 4YMUA 2N1BA 5JEDA 1UF9A 1XCMA 4C3ZA 1XD8A 2BMEA 4PC6A 2VBCA 1ZUHA 3NBXX 2ERYA 1VCIA 1TEXA 3AKEA 1Z6GA 1R4AA 2DFKB 2FEMA 5IRCD 1N0WA 2BM1A 2IUUA 1G291 3TGPA 3W3AA 3VR3A 2AFIE 1JPNA 1JQJC 3I72A 3PIRA 5L3SB 1M74A 4DXAA 4TL9A 2A3RA 4DB2A 1VHTA 3WNCA 3A37A 3KXIA 5KYKA 1N2CE 2A30A 1NJGA 2CL0X 3NKVA 5FPSA 4B35A 3X1XA 2IK8A 3B60A 4G5GA 4KYUA 1YZQA 2IUTA 4PR0A 5DSZA 5G3ZA 1E9AA 3AVWA 2ODNA 1KI8A 1N5JA 1CJKC 4JBWA 2BMDA 1MO4A 4D4KA 3K0FA 4DDTA 3WYFA 1WMSA 3VX3A 4B6EA 4AK9A 4C7OB 2C9YA 1EX6A 4FMDB 1KAGA 1S1MA 4R2IA 2NGRA 1H8EA 1ZUIA 2CVFA 3AP3A 4D0LB 2NPFA 2Q3HA 3PG5A 4MDFA 2DCUA 3SBDA 1XZQA 1FNMA 2QM8A 4OHYA 2HYDA 1VMAA 4FWTA 1YR7A 2VA8A 1G8FA 1K8RA 1NNEA 1OIWA 4TQAA 2K5UA 1HYQA 2X19A 2VO1A 3TVDA 1QHXA 4KSCA 4EPVA 4IOJA 1N6LA 2IHYA 2ZAOA 4PPFA 2FOLA 2RGNC 3VNUA 1DBSA 1IXRC 5FPKA 3NC1C 2WIBA 5FTMA 4HAYA 3NDBB 4MRRA 2QAGB 3X1ZA 4BASA 5TMPA 1KKMA 4URXR 4HAVA 4JKIA 4R9UC 3SNHA 1II9A 1GRQA 1QDEA 4XVRA 3CLVA 1QVRA 3SYNA 4F4JA 2DFNA 2B7CA 2HXYA 1KTVA 3MJRA 2ZRDA 2OESA 2IYUA 4A2WA 2ZYVX 1U9IC 3AF4A 2NO1A 1YZLA 3QBTA 1RRCA 1F6BA 3L0OA 3QPUA 4Z1MD 3LA6A 2WWHA 3TK1A 2EWVA 2PEYA 1UBGA 3GMTA 4MYTA 4F7WA 5BWMA 2FEOA 4AC9A 2HYIC 5FUVA 4ZI3A 4K8OA 4LWZA 4I81A 3UXMA 4KV9A 2HF9A 4OL0A 1CEEA 1FUUA 1OXUA 4PHGA 2XAUA 2BOVA 4RD1A 1DTSA 4MKGA 4PX9A 3TUZC 3UMSA 2X2EA 2FFHA 4TZ0A 1JALA 3BFVA 1J2JA 1MKYA 1IXSB 1XXHE 2IL1A 2VP5A 1NRJB 4PZLA 3SR0A 1JJ7A 1NVUQ 1JR3D 3CPEA 1AS3A 4TYQA 4QJ3A 1YJ5A 2WKPA 3KKPA 3N70A 4A2QA 4DSNA 1A1VA 3VAAA 1T3SA 5JI2E 3VR6A 4UNQA 3TSOA 4ZKEA 2J59A 1T91A 4EKDA 1E79D 3LV8A 2IW3A 1IJFA 3B1YA 2QZ4A 2MSEB 1F3OA 2JLUA 3HYTA 4DIDA 1E9FA 3WXMA 5EE1A 2ANBA 3GQBA 4LYHA 1MRNA 3ZZ0A 2Z0MA 1M8PA 3K0SA 4OK3A 1E99A 2V8OA 4X8HA 3DM9B 4DHEA 4GOJA 2P6UA 3I92A 2DHRA 5EZ5A 1A5TA 2IYTA 4PC7A 3R8CA 4FCVA 3W6PA 1VYTA 1W1WA 4LJ5A 5J4LA 5KPJA 3AF3A 4A9AA 1E9CA 4MKFA 2R8RA 1T6NA 2VHQA 3R20A 1W36B 3MWJA 3EIEA 2G88A 1T9HA 3CWQA 3DHWC 4LRWA 2QT0A 1E0KA 1NMYA 1JI0A 2JA1A 3B1XA 3MG9A 5L3SA 4Z1MA 521PA 1W49A 1KO4A 4B71A 3BFKA 2R65A 1KK2A 1D6JA 3EIQA 2OXRA 3OIUA 4BLOA 4EFMA 1S96A 2IF0A 2Q3FA 4KCGA 5FL3A 1OH7A 2O8EA 1WQ1R 4HLUA 4BPBA 3QKSA 4QOSA 3ZQJA 4F93B 1E1RD 4URWR 1HE1C 3EZ2A 5J4HA 3PVSA 1RYFA 4Q66C 3GFPA 4YQFA 1NY5A 5HZKA 2V6JA 4TTQA 2IYWA 3SI7A 4AKEA 4C7OA 3FFBA 5J5CA 1JR3A 1SVWA 3W9YA 1G20E 3B82A 1XJCA 3AUYA 4M9ZA 3ONWA 3Q3JB 5B30A 4KXFB 4C2UA 2QM7A 1P9NA 1QG4A 4M1SA 1YQTA 4TMWA 3BC1A 3TLXA 1XWIA 3MRSA 5EXTA 2QMEA 1E79A 2XZOA 4GMXA 3SJZA 3CNLA 821PA 1ZW6A 3ADCA 2NQ2C 3LW7A 4MYHA 3G0HA 5KNDA 1F60A 4JVMA 1QRAA 2CJWB 3OFND 1E96A 3JVUA 2BKEA 4HLDA 2ZRIA 2QNRA 4TSFD 4NZYA 4BFWA 2JLYA 3QNUA 2QAGA 3MCAA 1NP6A 1P2SA 1SVIA 1RVDA 2JJ1D 4CEIB 2AKYA 2BBTA 2WJJA 4TLBA 2OHFA 3I3SR 2WJHA 1UAAA 2D7DA 4NPHA 2PLFA 3PEUA 3WHLA 3A4NA 3RC8A 3LW8A 1W36D 2ZSFA 4U02A 4KFSA 3TJZA 3FHCB 1EESA 2J1LA 3U44B 5KOYA 1YR8A 4E22A 4K81B 4RZ3A 3OEEA 4DCVA 3ZZUA 5TARA 3X1DA 5JS7A 1DEKA 1DAMA 3A1SA 1LF5A 1XXHB 2WHXA 2I4IA 1G9XA 2ZE6A 3WBKA 4HAZA 2FPMA 4P4UA 2ZYUX 4LDJA 4R2HA 3KB2A 4BZXA 1E1RA 4MRNA 1CR1A 3L43A 4QHSA 3THWB 1OYYA 1EWRA 2BBOA 4ILEA 4WZ6A 3K9NA 3ZVLA 1GKIA 2Y8EA 3REFA 3AVXA 2JASA 2G9NA 1JECA 1XEXA 2JLSA 1W0KD 4LV8B 3CUEF 4L15A 2KB0A 3BBPA 4MRVA 4AYTA 3BERA 2OXCA 3ETLA 2ANCA 5C18A 2WMOB 5EE3A 4BLSA 1YVDA 2UKDA 2VPPA 1ZD9A 3NEJA 2GZDA 2F1IA 1KSFX 3MSXA 5FBWB 2HJGA 2QSZA 2EYQA 3MFYA 1N5KA 3NC0C 3DO6A 1W5SA 4Q9HA 1SXJE 3AGPA 4JZKA 4ZKDA 3OFNA 5DH9A 1Z3IX 4B3DA 2J45A 2CVHA 1LF0A 2I1VB 2VQSA 3LY5A 4TSFA 1X6VA 2RH5A 4JJZA 4LV6A 1OPXA 3WHKA 3KB1A 1ZIPA 4LBZA 5EP3A 5BYJA 4JT4A 4Q7KA 1PJRA 2WWGA 1PUIA 3M4YA 4MGKR 3CNNA 5B2ZA 2BEKA 4QHTA 5EXPA 1UPTA 2IYLD 4IDPA 3NTUA 5JCPA 2GDJA 5E7MA 3BJIC 2WJVA 2F7SA 3U7FB 2X1VA 4JLOA 3A36A 3RS5A 3CW2A 2Z83A 4W7SA 5KU1A 2Q21A 3B9PA 4M53A 3EW9A 5HE8A 4GOKA 4ITRC 1VHLA 1Z0FA 3DZDA 2IX3A 3GLFB 1QBKC 1SHZA 5FFMA 1Z0AA 3EXAA 4NYMQ 1XD2B 5DLQC 3S1AB 4JLVA 3WRXC 4A0RA 2OAQ1 1FTSA 1II0A 5B64A 2GJKA 5FOSA 3SBEA 4DDUA 2XXAA 3AUXA 3AVUA 3R7WB 4PANA 1I2DA 2FX3A 2OILA 4BFTA 3AKDA 1TF5A 4Q1BA 1DARA 3AEZA 3CNOA 1NN3A 2BC9A 1P75A 3EG5A 3EPHA 1VIYA 1W0KA 2WM9B 3AP1A 1KK1A 1QVAA 1T8TA 4PPNA 2GVZC 3W5IA 3KQNA 2C8VA 2GAOA 1WBDA 4Z8XA 1G5PA 4QXAA 1VCOA 2QI9C 3H1TA 1ZM3A 3SU8A 1ZINA 1J90A 1NN1A 1NJFA 1CIPA 1RRGA 2QEQA 1IN4A 3KL4A 4QJ5A 4F91B 2J0QA 1IBRA 4QNRA 4D26A 5AJVB 1GKYA 1ANKA 2O0HA 5H70A 2OO7A 1GRRA 5JWOA 2RGGA 4TMXA 2FF7A 2R2AA 1ZVQA 4H9GA 5FI1B 3VR4A 3FMIA 4BECA 1VG0B 3BB1A 2ZRBA 4ZCMA 4Q9JA 2FNAA 3PXGA 4CEIA 2DPXA 2R6GA 2ZS9A 4EJSB 5AR1A 4Z8YA 1W7AA 4GZMA 2RKOA 3U2QA 3WYAA 4IOLA 5FBRB 1E2FA 4NYJR 4KBFA 4PFSA 1Q1ZA 3GCGA 1XRJA 3SHFA 4PXAA 1XU4A 3REGA 4UXJA 4D4MA 2Z43A 1QHIA 5CJ2A 3U44A 2YV5A 1OB2A 2HT6A 3U61B 4D6PA 1ZP6A 2DY1A 3QKRB 5EJEA 5JJKA 2G77B 2AK3A 1E2PA 1GL6A 4DIEA 2H16A 2OEPA 3IUYA 3QG5A 1WB9A 2B6HA 3AF0A 1AS0A 5KDDA 1XXHA 2OE2A 4DLXA 2WPDD 3EWAA 5JHGB 1IY2A 2XJ4A 1TADA 3IILA 3H84A 4LPSA 2ZAMA 5ANRB 5ELXA 1GSIA 1DG3A 4RD6A 3UMFA 2VHJA 3A58B 2C77A 2FFAA 2WOOA 5IHPA 3THWA 2C5LA 2W6JD 3P4XA 3PV0A 4C30A 2CEAA 2ZU0C 4JLPA 4DLRA 2GBLA 1US8B 4GOXA 2AFHE 2VRWA 3EX7C 4JBXA 4GT1A 1HE8B 4JVNA 1G7TA 3IEUA 5A4JA 5C1BA 3K0AB 1NVVQ 5JECA 1C1YA 1UBCA 4DLTA 4NL4H 3LRPA 1OV4A 1DELA 1W4AA 2OFWA 3AF1A 4HB3A 1KSHA 5IK2D 1KI3A 2GZAA 5A5GA 2IS2A 2ASEA 3GPLA 3LBNA 1N0VC 3DKVA 4NMMA 3BIFA 4TYWA 1AN0A 1G8HA 4RJLA 4B74A 5IF9A 1JEEA 2WWFA 1TTTA 2Q9AA 1E2JA 4RSGA 2MMGA 1N6OA 2VP2A 4LHYA 1DAHA 3VKGA 4CRWB 4YMWA 1P2UA 3KQKA 1AIPA 4OI4A 5KHOC 3B7GA 1NLZA 4HLUC 2C9OA 4O25A 3A4LA 4D81A 4Z54A 3HPRA 1S1CA 4AURA 3ZS9A 2AD5A 1CLUA 4M1YA 2A5FA 2ZSEA 1U0JA 3BS4A 3NBFA 3MWKA 3PR1A 4CDGA 2JJ2D 4LSGA 2VHTA 5CYOA 4IDQA 4ZDIA 2OT3B 5H68A 2F9MA 5DHAA 3HP1A 2ZVPX 1ZM4A 2DB3A 2P3SA 5J4VA 2V1XA 4P33A 1IN7A 1XMSA 1XD2A 2IYZA 2ZJZA 3S1AA 2LCFA 3ZIAD 2QQEA 1HURA 1XEFA 4QC2A 1ZM9A 1Z0JA 4JYBA 2RGAA 5BN3A 3R7WA 5FOTA 3BB4A 3CH5A 3SYLA 1GNRA 1R8QA 3QXXA 3FOZA 4KFUA 2W6JA 4XTRA 1W4RA 2ZETA 3RS4A 1G3QA 1E9DA 1JEDA 1DS6A 3N2IA 4EPTA 3DDCA 2XITA 2QAGC 4P0TA 3ICEA 1CR4A 1X8KA 1DVRA 4GI7A 2MSCB 4TL6A 1EG7A 4PHHA 4HI0E 1BYUA 3U3JA 1SXJD 5LPNA 1OKKD 5CITA 2PCJA 3J81k 3C4JA 1DAFA 1B0UA 2WSMA 2GTPA 2SHKA 1XDBA 5FTNA 4EDHA 2ORWA 4Q9LA 5IK2A 5CB8A 1RPZA 3FGNA 5JWRA 3SFZA 2JDID 4F4CA 4YDHB 2O8FB 3EC1A 2ZPTX 3T5GA 1ZU4A 5GJWC 2ECKA 3V4RA 2Q3MA 1I4LD 4B34A 1OHHD 3NG1A 2GHIA 3N5CA 2ZUBA 2ZJBA 1LNZA 2FSHA 4LX0A 3GJ0A 5FUXA 3RSOA 3EPKA 1TAGA 4EJSA 3RWOA 2YJTD 3D31A 4TYYA 1JNYA 4WW0A 3QJYA 5JSZA 2JIZD 4TMZA 1E2MA 2EU8A 3RAPR 4QM6A 3L8YA 3KQLA 4NBSA 3I62A 3TKLA 2QRZA 1LS1A 3C8UA 3CONA 5F2EA 1ONBA 2WVJA 1ZAKA 2GXUA 4POAA 5SZKB 4OHZA 4PC2A 3QKRA 3D7MA 2I3BA 3QPVA 3AF2A 2HLDD 3CPJB 4V0NA 2R9VA 2JJ2A 1KI2A 3AVQA 1M1YE 5H8WA 4IXNA 4Q03A 1IXZA 3RRYA 1KK3A 4XD7D 1L8QA 3KUDA 4ACAA 3R9WA 3GFOA 1JR6A 3QG1A 1XEWY 4D80A 1PUJA 2IEYA 4Q9KA 1S9HA 4O3MA 4DKXA 5DISB 4B76A 3T06B 1VTKA 3QEOA 5A0FA 3A4MA 1EFHA 4UNSA 2XOKA 4W9MC 3IEVA 2ONKA 1P73A 3KX2A 1US8A 3VR2A 2PBRA 1P2TA 2H5EA 4B2IA 4CEJB 1M6NA 2FGKA 1Q3TA 3K0AA 2ZJAA 2QPTA 3ZQ6A 4IVQA 4M1TA 2PMDA 1NN5A 1SXJA 1KMQA 4FXPA 1OKKA 2GNOA 1ZC4A 2CDNA 1W36C 4LHVA 4ESHA 3WMEA 1X8LA 2B21A 1YHNA 1N6RA 2JDIA 3QKTA 1X3SA 5GVSA 3TW8B 3ASZA 3BGWA 2AX4A 3C5CA 2XZPA 3FB4A 1NIPA 1O3YA 3AKCA 2FDCA 1EFRD 4LJAA 1X86B 3KJEA 1OHHA 2QROA 3QENA 1YZTA 3QY0A 1VG1A 2NPIA 5FBQB 2W0SA 1ZBDA 2ZYWX 2ZR0A 1NL3A 2ZRPA 2YHSA 4RKFA 2JIZA 2XTNA 4NYIQ 4S2EA 1Q1QA 4FCWA 3GEHA 2HDNB 5JJLA 1F2UB 3AVVA 3M1IA 3QXJA 1OIVA 4CIDA 1TX4B 2C04A 3WNDA 5E3HA 2QN6A 4C0HA 1Z6XA 2ZRHA 2BCJQ 4OQFA 2HLDA 2A2ZA 1E4VA 1ZUNB 3FHOA 4PHFA 4DSTA 4WAUA 2ZRGA 1XMJA 3TQFA 2IBMA 2CLSA 3D6TB 3E1SA 4LHZA 4Q4HB 5SZIA 3VMFA 3RHFA 2CLCX 1FNNA 2JLXA 3IDQA 4US0R 1S4QA 3TH5A 1G17A 4B2PA 4PTLA 4FMBB 2AWOA 4OHVA 3Q8XB 2ZIAA 3CZPA 1CKEA 2A5YB 3B78A 2O8EB 1AJEA 3QKSB 4N0DA 1P9WA 1U0LA 2BM0A 3CF2A 3TR5A 2GEUA 4JIMA 5KSOA 1FUKA 2IYRA 1MO5A 2FFQA 2CBZA 4FD2A 4GPTA 3TRFA 1NIJA 2AKAB 1P4SA 5CIWA 3QXSA 4XVQA 1J8YF 2CLDX 3L0PA 3MGCA 3EWSA 4Q9IA 2RGBA 1Q21A 2CNWD 3LLUA 3PFIA 3IQXA 4MKHA 3M6AA 3QVUA 4GDFA 2O8FA 3KFVA 2OCYC 2GEDA 2O8DB 3TNFA 4IJMA 3A6PC 4W5WA 1VCNA 3GJ6A 3JZMA 4L4UA 3F0TA 3P27A 3RWMB 4A2PA 1V43A 2YOHA 1EFRA 3GJ8A 2ODBA 3P32A 1XFAA 2VHCA 4JLJA 1Z22A 5AWFC 3IHLA 3THYB 1QG2A 4FMCF 3ZVMA 1FZQA 3CF6R 3FKSD 1KO7A 1HT2E 4V0OA 5C46F 1G64A 1NBME 4YMTA 4PC3A 5KNBA 2XX3A 4I99A 3HPQA 3PUZA 4PPGA 2PL3A 2ZUDA 2Q9BA 3AQ4A 2GBLC 1E69A 1GILA 2WMNB 2AWNA 1GP2A 2YC4C 1CBUA 1SVSA 4LBVA 2KWIA 4LZZA 2JLRA 4C0AC 4DUGD 1VG8A 3C16C 2KBEA 1TUEA 4A92A 4ACBA 1IAQA 1YRAA 4OI2A 3WRYC 2J87A 1OXSC 3H86A 3R8FA 1UKZA 2R6AA 4M1WA 5K8IA 1KY2A 2B7BA 2WZQA 4TYNA 3EPJA 2BWJA 1TQ4A 1R0WA 4RKEA 4L9WA 2FGJA 3F3YA 4WOPA 2VSOA 3G5UA 4DCSA 4CEJA 3VU9B 1JXMA 2D74A 3GFTA 4JJKA 1ZD8A 2J7PD 3BB3A 2N46A 2VP0A 2IXGA 2DFTA 1XEXB 4KJZA 2CCGA 4LBYA 4PO8A 1Q3HA 1DO0A 3GLIE 4URUR 2PJZA 4LHXA 1E9RA 1J8MF 2CNWA 2R44A 3NIBA 4D25A 1Z6AA 2GCOB 3U60B 3QI2A 4C0BA 2NZ8A 5JFGA 2H92A 4XVUA 5G40A 4FW9A 5EE5B 3IO3A 1XCPA 2QP9X 4JT2A 3UK6A 2B92A 4RZXA 5JWHA 1E2QA 2YYZA 4QGGA 2D2FA 1F2UA 3B5JA 3PITA 2TMKA 4TWZA 4DLWA 1PV4A 1GM5A 3LQQA 2JLVA 5CYPA 4JVSB 2NTYC 4YMVA 2L0XA 3CR7A 3A1TA 3CIOA 1VYVA 5G41A 2R6DA 4XWOA 1SVOA 2C96A 3R9IA 3DMNA 4X8MA 1GKUB 4A8JB 4E03A 3KKQA 1RW4A 1G19A 1UJ2A 3LWNA 4CT4B 3TW4A 1ZNWA 4A82A 4US1R 4Q4HA 3TMKA 2WWXA 4LGMA 5FBLB 4PQRA 121PA 2RCNA 1GOTA 3KFXA 2V6IA 1ZNYA 2GJAA 2GXAA 1NSTA 3CX7A 3Q5DA 2OSBA 2QPAA 2DBYA 5EXXA 3L0IB 2XEXA 2IYXA 1MO3A 1RIFA 1LS6A 1S3GA 221PA 3T35A 2RGEA 2YWEA 2XXAB 2AR7A 1FTNA 3CH4B 4JLBA 2W83A 1KJZA 5H1YA 2D62A 1EK0A 1U8YA 1YRBA 3HJNA 3SYKA 1LB1B 2V9PA 3WY9A 4EJSC 1NN0A 1TU3A 2J7PA 4O2LA 1KSJA 1G3RA 2ZE8A 1ELOA 2H7VA 2R6CA 1KOFA 4NKRA 2GJ9A 1RJ9B 3IPXA 4NHOA 4P32A 3O8BA 5AUNB 4MDEA 1HQCA 3GLHE 3GJXC 1LTQA 1UFQA 1TEVA 2O8DA 2VTKA 3W6NA 3FHTA 4I1OA 1E9BA 2HXSA 2H18A 2EFHB 3VQTA 2W6ID 4F38A 1Z83A 3THYA 4B47A 1A2BA 4YLGA 4XOIA 1W44A 3LX5A 4M2LA 3VR5A 5K8LA 3K0EA 3ZDQA 4ERNA 2EVWX 1Z2CA 2VP6A 4QJ4A 5AJXA 3QKUA 3MLEA 3RABA 1OXXK 1I4DD 3EC2A 2JLWA 1CXZA 1U98A 3OIVA 3OESA 1E9EA 4AYXA 1U8ZA 1E3MA 4HSEA 4B3CA 1XMVA 1E2IA 3KDSE 4NCHA 4LC0A 5DO9A 1AM4D 3ADDA 3RNLA 3GLGE 1AKYA 4MUBA 1Q57A 3UATA 3QXCA 4TYPA 2A5GA 3E5HA 4P3YA 5B57C 4NCIA 2O0KA 4KFRA 3LBIA 4UXIA 3K70B 3I8XA 1BKDR 5DNYB 4BFVA 4US2R 2W2VA 3ADKA 5SZHB 3LAWA 4YC7A 3PCRB 2ZR9A 4LJ9A 2ZEJA 4KLZA 3A8TA 1AGPA 1WCV1 4HYYA 2YVUA 4OK6A 3UG7A 1OH6A 2G6BA 3LBHA 2BCGY 1E6CA 1IY0A 2YOFA 2QP4A 4BFUA 3GLIB 1HA3A 3VU9A 5FUWA 2F1RA 3FKQA 4B3BA 2AXPA 2G0TA 4GMDA 5TB5A 5M04A 1GL7A 3K0CA 1OFTA 3Q5EA 3I5YA 1CULC 2G1JA 3K9GA 3KKMA 1YU9A 4DLYA 3P26A 3B1WA 3KKOA 4HEJA 4D0GA 1QZXA 5AUPB 4Q1DA 4A4DA 5FBVB 1R5BA 4XTCS 1E0SA 1H8HD 2PZFA 1OE0A 1AK2A 4Q4AB 2H8KA 1T8UA 2MMCA 2GCOA 2AL7A 2CMKA 2N42A 1NBMD 1T5IA 3AGQA 3FWYA 3I4LA 2QENA 5J4KA 2QY9A 3W5JA 1GAJA 4BFZA 4PPQA 4V03A 1TL7C 3VHLB 1IY1A 4I4LA 1IHUA 2CE2X 2W6IA 2REOA 3QSYA 2DYKA 1KGDA 4QKQA 4Q1CA 1Q1EA 3IBYA 3DVLA 1U99A 4LBWA 1A2KC 4FIDA 1KI6A 5CIQA 2XNDD 3K1JA 4TN1A 2JJ1A 5FOUA 5CLLA 3LNCA 1QF9A 2IF2A 3AH8A 1Q12A 2WICA 3WP1B 4EPXA 3DM5A 2PMKA 3HR7A 3RS7A 2XSZD 4DLVA 2RAPA 2ZJ8A 3QVVA 2J3EA 4LK2A 2EWWA 4KU4A 4PO9A 3RLFA 4Q18A 4A8JA 3QUSA 1FOEB 5HKKD 4LV5B 1E1QD 1SQ5A 1XCGB 3EZ7A 2A9KA 4TMKA 3K70D 4V0LA 3NHAA 4C4PA 5LD2B 4N3NA 1SKYE 2IWHA 3B1VA 4JBYA 4LJ4A 1F48A 3FE2A 2D2EA 3DKPA 1G3UA 4ON9A 4HB4A 1KO1A 3ND8A 5TVKA 3DOFA 2IS4A 3B85A 3Q85A 2HCJB 3KJGA 1G1MA 3GLHB 4UNNA 4NTZA 4URZR 4QG7A 4TL8A 4TLAA 4DCUA 1E94E 3SN6A 4JYCA 4OQNA 3KQHA 1WE2A 4MGIR 1RJ9A 4KBGA 2J0UA 2BJWA 1L4YA 5GVRA 4DSUA 5KUTA 3NH9A 2DFLA 1CJTC 3UANA 1IN8A 1P3JA 3I8SA 1GVNB 4B32A 2F3TA 1H8HA 2DR3A 4OI1A 4WXPA 1BIFA 1I2MA 5F9FA 3O8CA 1WDTA 4C2TA 4ZCIA 5HR5A 1NBMA 2VH5R 1E0AA 3QQ5A 4NYMR 3ZS8A 5JZVA 1EFCA 1GL9B 3TE6A 3FPAA 4S35A 3EIHA 3VKWA 4CF7A 4HUTA 4YMSA 5FPHA 2ODEA 2DWPA 2Z6VA 5DI9A 2VLIA 2GA8A 1VPLA 2XNDA 4X8OA 3A1UA 4IDOA 1DAKA 4QGHA 5JSZB 3CPHA 5IT5A 1G4UR 1M7BA 3QF7A 4RD0A 1GG2A 3D8BA 4BLRA 2ONJA 2D06A 3CRW1 4ZDWA 2P5SA 1Q44A 2XSZA 1OXTA 2X77A 3NH6A 4QFMA 2A5JA 3CO5A 4ZV4A 4QL3A 2WJYA 5HKKA 5KSZA 1K5GA 1E1QA 5CM9C 2ZJOA 4IVPA 1RKBA 5C4MA 2WWWA 2ODWA 1NF3A 2OCPA 2WSSD 4JLNA 2F1JA 2BIFA 1G3IA 2VIIA 3PQCA 3PEWA 4GZLA 4E5UA 4IOMA 1N6NA 4M22A 1ESMA 4MITA 4Q7MB 3O8DA 4PAOA 1DO2A 4QGAA 3PEYA 5JLJA 3GLIA 2KE5A 2OBLA 3PUWA 1FW6A 3K8YA 1W4BA 3FDIA 2PX0A 4WIAA 1R5NA 2ZRNA 2IS6A 5AJYA 4OK5A 2W2XA 5HTKA 3OZXA 5IDVA 2ZJ5A 1G18A 1XB2A 2ZUCA 3TSZA 3EARA 3W34A 3T34A 2IC5A 3NHBA 1SXJB 4ZO4A 2RGDA 4Q4AA 1Z5ZA 3OIYA 3PUYA 4G5RA 2CXXA 2ZE7A 1FQJA 4DT1B 5BW8A 3MWYW 1M34E 3C7KA 3UPUA 2NIPA 3HU2A 4K46A 1Z08A 2CL6X 4WBSA 1P5ZB 3H4MA 4C0KA 4QHYA 1NSFA 3MAAC 5LBIA 2ZROA 3PUXA 1VIAA 1NMXA 3VTKA 4BLTA 4ZI2A 4EPRA 4BFYA 4DRZA 1J70A 2CK3D 2G0NA 2E9SA 2FPKA 1E32A 4C0LA 2ZSAA 4FWIB 3TUJC 4L16A 1G6HA 1R0XA 1SKYB 4UJ3A 3I32A 4KHZA 5BN4A 5AUOB 1RRFA 4Q19A 5FL7D 1NVVR 1YKSA 1RC8A 1P9RA 3BOSA 1CJUC 3BH6A 5AUQA 2VEDA 3RRNA 5C4GB 2B8TA 4Z51A 5EP1A 2G83A 1OT3A 4JL8A 1Z6YA 1OSNA 2WSSA 1M2OB 1OH8A 2WBLC 4M9QA 3VKHA 3EASA 2WPDA 1FFHA 3MWLA 2ERXA 2GCNA 1IQPA 2PZEA 3SOPA 4TT3D 2W2TA 1JBKA 3FMPB 1KDPA 3GLHA 2WKRA 3IIJA 3THXB 1FP7A 1GFIA 2BV3A 2J41A 5KSYA 1OF1A 2AN9A 2XJ9A 2WIAA 3HWSA 1NKTA 4JL6A 1UM8A 1E2NA 1W46A 3DMDA 4GBMA 2QL6A 4HZUB 4ARZB 1HY3A 1PLLA 1QHSA 2YWFA 4BEBA 1LV7A 1T0JB 2FSGA 4FI3C 1FMJA 3EZFA 3ND9A 3OHMA 4ZCLA 2GAAA 1G7RA 4CT5A 3GJ5A
chains in the Genus database with same CATH superfamily
2FUKA 5FPTA 5FULA 3IALA 2P78A 3WLSA 1TQDA 2GZ3A 1EFTA 4DUGA 3VR6H 3ZUGA 3A14A 1FMLA 2O8CB 1FDSA 2Z8YA 5JBIA 3Q9NA 2C2HA 1QO9A 5KC9A 1JU9A 1LVUA 2I6UA 3OZUA 4M76B 5JSFA 3WIUA 3KQSA 1X7GA 2HCBA 3FTPA 3PU6A 5GJCA 3UUWA 4F86A 2FF5A 3K5PA 2GPYA 1K0UA 1N8TA 2GWHA 4RVNA 4MV0A 1MV5A 3NOOA 4OMFG 1DQNA 3GFGA 4MUNA 4QGFA 4N0PA 4OJQA 4BRWA 1NJSA 2EFGA 3IQIX 4HCJA 2J85A 4CF3A 4ENVA 1W4CA 5AESA 4XRRA 4F56A 1WSWA 1GNVA 4E15A 4NBRA 1GKKA 3IBGA 4RU1A 1DSSG 2WK1A 2IYQA 1QP7A 2XVMA 4JWKA 1ZUWA 3PFWO 3OURA 1KMHB 4XM1A 2OYSA 5FL7A 3AETA 3EISA 4R31A 2UZ0A 4JZYA 4TXMA 4E07A 1ZNQO 2DHEA 2H52A 8ABPA 4PQEA 3LVQE 3SZLA 1VDMA 3R24A 4PONA 3UHPA 1Y8CA 1Y3FE 3BDAA 2PZAA 5T67A 2CWDA 2PYZA 4RK6A 2XVXA 5ICMA 4B7ZA 1P4RA 3KJIA 2VYQA 1KQPA 2A86A 3A1DA 4BWGA 4OQXA 5A7FA 4CBVA 4YRFA 2BFFB 1URPA 3DBLB 2IUFA 3V46A 2OCBA 2Z9CA 4GICA 1Z88A 3C85A 2GF2A 4J3FA 5DX0A 4EUEA 2YVAA 3O3OB 1LD3A 3SEQA 1UZMA 4BZQA 4YH1A 1GYRA 1FXWF 3K9QO 3L7CA 1A2OA 2TRSB 5A7GA 1K5PA 2AG0A 3VAZA 4KUGA 4TT3A 2B3DA 721PA 4C7JA 4PZAA 1SUBA 2ZS7A 1N0UA 1XAIA 4INAA 1AK1A 4MW2A 5A9SA 2D1RA 4DIOA 2VYNA 1UP6A 5T8KC 1V3UA 4I50A 1Z18A 4REMA 4QBIA 2JVIA 3TAHA 1N9GB 1S7CA 2WUVA 4FILA 4KUHA 3U7JA 4W7HA 1QG6A 5AK4A 3QPCA 4IM7A 3WGUA 1Q5PA 3GGDA 1E4OA 5LP1A 4HLCA 1JN0A 4O2BA 2BI4A 2FB9A 4RIFA 4AKIA 4DV3B 1VYUA 2ZITA 2NAPA 3PP8A 3RUFA 1B8PA 3N0VA 1QB7A 4N5MA 1NA5A 2WT8A 3LC0A 3G2JA 4A8JC 3IO5A 2QRVA 1P0FA 3KPJA 4GPBA 2OB1A 1B41A 5DM1A 3GF4A 2VA9A 4Z0NA 3HA7A 4JUFA 4ZDKA 3EDYA 3Q1LA 4NECA 4P22A 1Q0UA 4RGQA 4F9EA 5CFLA 2WG0A 2YQZA 1LEHA 2P4EA 3AONB 2Q4EA 3CZ5A 3HCPA 2A6PA 4NENB 2FOXA 4TQUS 4N47A 3DZHA 4U4AA 4CLHA 4JI5B 1JHXA 1WXGA 1U3GA 5IWCA 2DG2A 5DHFA 5J2UF 7MHTA 1PLJA 4NBNA 5H9VA 4M1KA 4BDSA 2XUZA 3VZCA 3GT0A 3M6XA 4LECA 4PSKA 3IAS6 3AI7A 3VR5H 1DT5A 1GA6A 1XN1A 2XQGA 3OZBA 3L0DA 1XHLA 3SQXA 5DX1A 5HRUA 3Q72A 5CM2Z 3KPWA 3JARA 3HBFA 2WNHA 3HWRA 2BH2A 3N6VA 5E9QA 5P21A 2P11A 4N9QA 4X93A 3Q7QA 5BUSA 2CLKB 2JK1A 3D6VA 1D2EA 1Z7YA 2YWGA 4F4UA 3HV0A 2ZJ2A 5TT0A 4LNUA 3VH1A 4XD7A 2QYSA 1QYWA 4QUDA 3NHZA 4NPAA 4P0PB 3O90A 5FUBA 1XYGA 3R7BA 5C8XA 3NUQA 3C7DB 4ZOQI 4MGYR 2OFFA 3CRVA 2A8YA 4ZVMA 1UKYA 1U2RA 3PKIA 1N7GA 1Z07A 3F5QA 5DN6A 3LLCA 3WBBA 4DY6A 1Q14A 1Q7TA 1Z5OA 1KQGA 1TZJA 3SJAA 3UWOA 4QLAA 2XUIA 3PUJA 3U39A 2HNBA 1KH3A 4KR7A 3KLPX 3QNWA 4OBEA 5SZJA 4EKIA 1HLGA 4FQ8A 3VMMA 1I2AA 1BGVA 2VP9A 3MLAA 1J8DA 3SC4A 1X77A 2TMYA 2BFPA 2WW8A 3T9DA 3WL8A 2DU8A 3A28A 2NM0A 4N3CA 3I76A 2F55A 1GQYA 1N2OA 1DWPA 2GXSA 3IKLA 3DDUA 2FQQA 3EGDA 1WKCA 2R6JA 1M6VA 2OFXA 2XTAA 2WYVA 5EZ6B 4D4JA 4MWSA 5DNWA 2OHHA 1JFFA 1V7PC 3DR5A 3ORSA 2WUFA 3G8DA 4YT5A 2AMYA 3PGJA 3QLJA 3C6YA 2NXNA 3B8HA 1LQUA 4CZ2A 4YCLA 3IXLA 1Z45A 1HX7A 1F2TB 4L8WB 5D3MA 3WADA 4RD2A 1P1JA 5G0SA 4F45A 5DVZA 3GZNB 4IEEA 4ZOLA 4MR9B 1CQXA 3R75A 2HSZA 2G63A 1IK6A 2I4TA 3F5MA 3N9IA 4FDMA 4NDZA 2ZVQX 2F8LA 2VF5X 2Y0BA 3KYBA 4GP7A 2XZDA 4ZWNA 5DNEA 5JZOA 4YP7A 1YZGA 1UBHS 2J9FA 2LDXA 2V0NA 3ZDCA 1M10A 1GO2A 3D6HA 3PC8A 4A0FA 1XZAA 5LYJF 3KSUA 1SK9A 2F43B 4CL0A 2O2HA 4DPKA 1A8HA 1N6IA 4KODA 3CNHA 2ID9A 2W6QA 1BMFA 4YRNA 3E22B 3TW6A 1HZZC 5BY2A 1AGYA 2CXHA 3W9UA 3IR5A 3PGA1 5IEBA 2QTAA 3LIPA 2FEWB 2D7CA 2FW6A 1OI7A 2MU1A 2WJ3A 3X1KA 4JGIA 4K28A 1ISPA 1KZ9A 2NYRA 4Y8VA 1ODFA 4Q4JA 3CVOA 3KUCA 1KR5A 4RAOA 3GD7A 1G8YA 3BICA 1H6AA 4W1QA 3MTGA 3WWCA 4NCBA 2IKQA 3GFVA 4LQLA 3ML1A 2GO1A 3G82C 4MPRA 3U62A 4CW7A 2ECPA 1BRTA 2HJWA 3AI1A 1UL1X 3I01M 1ZEJA 1J7KA 3AL2A 5IG2A 2Y71A 4WXRA 4PG6A 1DKQA 2O4UX 2P65A 1RHJA 2VJDA 4R98A 5EYPA 1KYZA 2QTVA 3BE5A 3DCJA 3LA8A 1KTIA 5A9TA 1EK2A 1M34A 3WO0A 1UT8A 4V38A 5HJ2A 1T9AA 3PSHA 1AQNA 1XBTA 4YBZA 5JZBA 2XGSA 4JXZA 4PZZA 3ICQB 3L05A 2W2LA 1GFWA 2XODA 1X13A 2X1LA 3T7JA 1NE7A 2DXIA 2QWXA 1UK8A 2KI5A 2ZRLA 1NVKA 1F4LA 1HT1E 2B8NA 4OYHA 2FUG1 2R8PA 2H57A 2XMRA 3KHSA 4I4TA 1KI9A 4OFZA 1OLUB 4R9VA 4WXHA 4D44A 4QRIA 5B58C 4PAWA 1A5AB 1Z6PA 5I9LA 4FEEA 3T12A 1YBVA 1F1JA 3AX6A 4L5CA 1JSZA 1CQPA 3BE4A 1B8UA 1BE1A 1PQUA 1PT7A 2A9VA 3CE6A 4IO1A 1K98A 5K3CA 3AXTA 2M32A 4L8YA 4FYJA 4TS1A 1ZGBA 4XASA 5LMUB 2Q9CA 1UMKA 4TVSA 3ECCA 3LBAA 3JZIA 3G17A 1LPNA 1GVHA 5LM3A 5JRJA 3H5AA 3IYLW 2I6SA 4ZAWA 1EX7A 4GMHA 1AKNA 1L7OA 2QN3A 3OC0A 4JBGA 4EFDA 5IJWA 1E8NA 4BC0A 5AXBA 1OA1A 2VF2A 3KVNA 1R9NA 4Y6GB 4BQOA 1DWQA 3DMGA 2V96A 3O1LA 1XD9A 2XMCA 3LGXA 4HEA6 3GYGA 5HBGA 3S55A 2D7JA 4HS4A 4RVOA 5FHRA 4P7KA 1UK6A 1JAZA 3VC1A 1ZNZA 1CDEA 1WNFA 1Z47A 1ISHA 5E1BA 1BA2A 2PZ8A 3C3MA 1X2BA 1EXWA 3HDTA 5I48A 5CCEA 1SZDA 4EUKA 1R0ZA 2JS7A 3WIVA 3VTZA 3TIIA 2XZTA 1QKKA 1UBLS 5BSEA 2HEIA 4BO4A 4FE3A 1Z33A 4YGYA 1CP2A 1RAGA 2BFWA 3O3MB 3EQ6A 1JB9A 3ZD8A 1KYVA 3NORA 5COBA 2O48X 5D2CA 3UYLA 1FTYA 1BH6A 2A0XA 3JTMA 4LZOA 4WK4B 4X6UA 1MJGA 5GM2A 1FPMA 1ZK3A 2ZATA 2E4XA 1QH9A 1Y1SA 4BLWA 4R5HA 2XB4A 1KAHA 1FZTA 5GZ3A 6ADHA 5DP2A 4P80A 1O8BA 2F8MA 2C98A 2HV8A 2YH2A 1PDOA 2ZI5A 3FSGD 5EE9A 2ZM5A 5DGXA 1OI2A 2RAFA 3TPCA 1V26A 5IZCA 4B46A 3ZV6A 4Z9FA 1NI3A 2J0UB 4JSRA 2WV9A 2XTMA 2W98A 3CIFA 1IZYA 1F8XA 4JBNA 4X3PA 5KJ6A 1TNDA 3EZ9A 4AW9A 1JEAA 2X3UA 5KQPA 1BD3A 3OEHD 4RF4A 3FPJA 4MS1B 3IE2A 4F9GA 3RVBA 3AVTA 3D4IA 4PIVA 1RJEA 5KTTA 1JSRA 1EQUA 1LDGA 4PS0A 4BUZA 1Q11A 1NX9A 2DTDA 4RHUA 4L51A 3ZHTA 4CI0B 2PIDA 2BEUB 2QMOA 2VT6A 3RTBA 3TIGA 1CQJA 2VI5A 3O8OA 4AUEA 1QRTA 4NCAA 1IFXA 4YCMA 3GG9A 4AI6A 1Z74A 2CHQA 2X76A 4KLNA 3SJCA 4NAHA 4UPDA 3BF7A 3FY4A 1COWA 3I5MA 4LYDA 3QELA 4YLYA 4LOAA 3KLMX 2IYYA 1W88B 8MHTA 2L82A 1ZU5A 4AXXA 4GXNA 1DRUA 1XX6A 3ZHSA 2FFBA 5CXQA 3DZCA 1KDRA 1E59A 1K4MA 1E1KA 1BD4A 2JBHA 3ELBA 4RKQA 4GR5A 5JFOA 1SA0B 2Y1GA 5ENZA 5HZMA 1CY8A 2ES4A 2O20A 3SP1A 4IFEA 1UADA 2JZOA 3H7AA 4QT0A 2CUNA 1M8JA 3GJ3A 4RNCA 5GINE 1TD1A 2X5JO 3NXKA 4TMVA 2JJYA 4NULA 1KFBB 4LYJA 3D81A 4D82A 1AKUA 2Z4SA 4GMFA 2RBKA 2IV2X 2FSIA 4L75A 2DWQA 3KBBA 3MMPA 1VCMA 5JCJD 5F1KA 1DDGA 4UREA 2X1MA 1Y7HA 2VPQA 3PF9A 4DIFA 2H17A 3GAAA 2NACA 4EHNA 4UEKA 3CR8A 3QF4A 3QWAA 1PJ4A 1SCKA 1Z39A 3SIPA 1FJHA 3BRCA 1KY3A 2OLEA 5EJ2A 4R71A 2NZ2A 1YL7A 2W93A 3T5AA 3WWDA 4I46A 2CWWA 4AECA 4PW0A 3CLKA 3BIXA 2NO6A 3R6DA 1PK9A 4WA7A 5DM0A 3F7TA 1VPDA 3W2GA 1L4UA 4OQEA 4KGVA 4AJ4A 4GOND 2VEOA 4EJ0A 1G60A 4AZ0B 4DCGA 1V25A 2NO0A 2IEBA 4NE2A 2QLFA 5BV0A 4DYDA 3KIPA 5CFPA 5JMTA 1E2BA 2G3YA 2P8SA 3CRMA 2BHSA 4FN5A 3SX0A 1ORIA 4TWRA 1TF7A 3C4QA 3UG6A 2XQVA 2P2LA 4P3XA 4PZUA 4KLCA 2IYOA 3A25A 3GCZA 2VSNA 4UUPA 3TFWA 2I3AA 2IXDA 2H48A 1FS5A 4E5PA 4TLLB 2WPNA 4UEOA 2Z2XA 3T5CA 3VPDA 2E4ZA 3ABSB 3V55A 1TQ8A 4GZ6A 4C87A 1RFLA 1W47A 1JIXA 3AR8A 4FFDA 5EQTA 2QX4A 4RE5A 3TW0A 3MGKA 4WN3A 3IEMA 4LHSA 3NKFA 1H6DA 3D8UA 3H04A 1Y98A 1JEYA 4XM2A 1SHLA 5FTKA 4ZGWA 2ILVA 1NT4A 3MD9A 4BMZA 3UMCA 4DSOA 5FJIA 3RSCA 3WVNA 1MG5A 1NM5A 1DIAA 2IOYA 3I9MA 4OXRA 5EXSA 3AU8A 4MLCA 3DV0B 2GLTA 3ONFA 4BE7B 1XTRA 5L3QA 1VPTA 4TN5A 2H3HA 2J5XA 2VPYA 3IUEA 4FCTA 5ITSA 2OCLA 1V8PA 2PH5A 1NJ8A 1E1LA 2I2WA 3HA5A 2PUWA 5HIJA 3E9MA 2EZUA 1RYEA 4YAFA 1D1TA 4D4LA 1L7QA 2YMMA 3NM5A 3AR4A 1EDDA 2GARA 3KJFA 1TZCA 2ZANA 3MJCA 1L4NA 2NWQA 4UUBA 1H3FA 3G2IA 3I6QA 4QBHA 4N8EA 3U3KA 3UB2A 4QUIA 1QIFA 1T4GA 5DM2A 3GJ7A 5EHQA 3UAZA 2BM8A 2IYVA 4D8VA 3FOZA 3FCOA 4F5DA 3KXPA 1K27A 4FK8A 1J8FA 5BN5A 4JYZA 5DW0A 1JKJA 2R1VA 2ZI7A 5E4FA 1ILEA 2REBA 5JEEA 1NMQA 1UANA 2QE7D 3D6MA 3NFYA 5EMMA 3T1QA 4CKBB 1YOBA 3I6IA 4RIEA 4CG3A 4GW3A 3BF8A 3K6JA 4ZQGA 3KCNA 2ROQA 3HLYA 4I5GA 2HJRA 4Q7JB 3JSAA 4NEHB 1ZH0A 2CFCA 2BSQA 1O95D 1ULSA 1FYFA 2ETXA 2GHRA 4JL5A 2RHMA 3PC8C 4PZYA 3HU5A 3MS2A 2P6PA 5KOHB 1XA0A 4JJ6A 1QFJA 1G1AA 2G76A 3QLVA 3ZE1B 2PA0A 3IIMA 4CKXA 1QP0A 2IIPA 3P96A 5IBRA 4B2LA 4WKGA 5ER6A 4PEVA 3A9TA 2P9JA 1NXWA 4B73A 1OBVA 1KSGA 3NVKI 2YRFA 3EA0A 8GPBA 2DPHA 2PD3A 2VCEA 3A4IA 1K9SA 3HJTA 5LA6F 1PEKE 1XRQA 2H7YA 2HCRA 1DAIA 4KE8A 4BUCA 5AW5A 3HB1A 1Y6GA 5ELMA 4CE6A 4XWWA 5FWXA 1TCCA 2BJHA 3GLGB 4FDTA 1ADBA 1T8YA 4LRQA 4CQLA 2YC2C 3TR0A 1JDNA 4G8BA 2C7OA 3DLAA 4Q47A 4UQOA 1F14A 2WUDA 1YR6A 4M4SA 1IPEA 4EF5A 2I9KA 2OCDA 3I5XA 3HKEA 5HQ3B 2GD0A 3W5HA 3U5ZB 4R8LA 4KN9S 2O52A 2VNHA 3ICCA 4Y0AA 1SCAA 1P0MA 1IN5A 3EMKA 3GU3A 4I3FA 3EGVA 4DCMA 1OFUX 3C3WA 5CK5A 4KPYA 1XA4A 2FWPA 3H0CA 2WKQA 2REXB 2EQBA 3FVVA 4Q9AA 5DHQA 5DE3A 1K6JA 9GPBA 2B35A 1PGOA 2IZ7A 2JATA 3FAKA 2OLJA 3NHLA 2ONCA 4UASA 5IYZB 2BHTA 2OZEA 3EIWA 2B34A 1QH1A 1PL6A 2EX4A 2OYCA 2NUPA 1ETUA 1A1SA 4C5BA 5A3JA 1XZ8A 1PG2A 4S1WA 2IEDA 2XI4A 1C29B 5ALMA 1L3CA 1PNQA 2X4DA 2D54A 4RWEA 1O9GA 5TS2A 1RPJA 5KYYA 5EINA 4V1CI 1E62A 3CLRC 4JI4B 5IN5A 1XZPA 2CHVA 1LX6A 2JFFA 3CWZA 3OJCA 4TLEA 4N5HX 5TQJA 5C5IA 5FEMA 3BXHA 2Q07A 3LP5A 1SNYA 3OJWA 2R7AA 4H1UA 3HU1A 2CFOA 4G37A 2Q7XA 3DDOA 3KT6A 3GVHA 3K15A 1U0RA 3ETEA 3EQ8A 4RTPA 3K1YA 1UDRA 4B3FX 5AM2A 1TAQA 4IUDS 2NO7A 1D3AA 2C94A 3I37X 2ICAA 5B12A 1LJUA 2ZJYA 1HUQA 3F78A 3HWX1 5HE9A 4AUKA 5CA1B 3GHHA 2JLZA 1GGFA 4OSEA 4WKCA 1TCVA 2DFDA 5I9BA 4E6EA 2QQGA 3KJNA 4AJOA 1EUYA 1SQFA 1YJ8A 3S7TA 5F1YA 1EWVA 2FWRA 2O3JA 1NLYA 4JBHA 3OFKA 3WLHA 1IY9A 4RM2A 1ZYUA 1BQ3A 4KWHA 5T6BA 3A9VA 3UJAA 1TLFA 3OAAD 1WVMA 3I3OA 3M83A 3ZH2A 3L18A 3B13B 4BN4A 1F5NA 3PWKA 4PM4A 2NOAA 4R7ZA 5F2OA 2Y99A 3PRKE 2JHGA 1A4XA 2Q27A 2I0FA 1U0TA 1PLKA 2C9ZA 1J99A 1RKQA 2PRSA 3QY9A 1A69A 5AKJA 2PUGA 3ZV3A 3MS4A 1L7AA 4GOOD 2YTZA 3O21A 2HSJA 2P1DA 1Z2AA 4CLOA 1CY0A 4CFSA 1IHYA 3CJQA 3FLMA 4MI3A 4PZ9A 2ZT6A 3E9DA 2Y77A 3EVTA 3ILHA 1YB6A 1U8UA 3WMFA 4U2KA 1N9KA 1ABBA 2OV8A 4QYWA 5IZCC 1RLMA 4ZO7A 3Q40A 4A6XA 1MNAA 3QOFA 3HA2A 1JH8A 1Z06A 3P8ZA 4GBJA 2NU9B 5LQJA 3MIIA 4M3NA 1XP8A 4HZGA 1JB1A 2C97A 4PAQA 5K0EA 4HVAA 4NE7A 4N8DA 2CUKA 2OBFA 4MYUA 4RWZA 1ADJA 4EYOA 1SFRA 2QI9F 1KO5A 1Y6RA 5TGDA 1USUA 2P6NA 1EHIA 4YV1A 1LJ8A 2Z2KA 3FB1A 4N3BA 3HM2A 3WOVA 4QVGA 2J5QA 4UTZA 4UUMA 1N4AA 3F5FA 3U3OA 4CF5A 6ABPA 4OATA 1USWA 1Y6QA 2H0RA 1QGUB 2IOFK 1I51A 1C9NA 1NX6A 2GF0A 2ZTMA 4LYGA 2A5LA 1JVBA 1JDUA 1N5OX 2HWUA 3CLTC 3H16A 1XRNA 3IHWA 1C7EA 1Y5IA 3IMFA 4HS9A 4MQBA 1V6CA 1GZ6A 1YL6A 3LXUX 1POWA 4I1VA 4PSVA 4QTTB 5ALKA 1JV2B 3KWJA 2OHJA 4LPKA 3NBKA 3TN7A 1EP1B 4R9NA 3I1FA 3PQ8A 4RFSB 3UUGA 1JTVA 3BK2A 1YDGA 1SCQA 1N0HA 3ESZA 1Q84A 3FIUA 4JDUA 2DBRA 1J22A 2HDHA 3OP1A 5LCXA 3RANA 3SFVA 3UAYA 3LUJA 5D7BA 2GVDC 3GCDA 1YQXA 3H1FA 3T9BA 1ZL0A 1RZUA 4YGXB 2Q3CA 1RNLA 4FBGA 1ZNXA 3E3AA 3T94A 1XMIA 4FFBB 1O5TA 3K0FB 4II7A 4MW5A 4PGAA 3DGEC 4DC9A 1NBEA 5EFZA 4CODB 3FTNA 3NC4A 4RH0A 2CGEA 5J59A 1T3LA 3BFXA 5CEFA 3QE9Y 1RKVA 1Z34A 5L3VA 2YICA 1KMMA 2VJCA 4JIGA 3U4GA 1OC4A 3PS9A 5C5DA 4OJYA 5JYBA 3NW9A 1ULTA 1WXDA 1U04A 2QIPA 4IQ8A 2GI4A 1R5JA 1NV9A 3W90A 1JAXA 4JKYA 4K0RA 2VRBA 5CVVA 5EE0A 1IHXA 3V4LA 5DM60 5CB4A 5FPYA 3JWJA 4OFXA 2BKAA 2BUCA 1QYRA 4DJAA 1B26A 1AMNA 1BS2A 2WJWA 4N6NA 3TQQA 4EB3A 1CRPA 2H2DA 2R8OA 3T95A 4IIUA 3EVZA 1NVAA 4Q5IA 2OLKA 1VKZA 2RCYA 1YO6A 3RSQA 2GZ1A 4YROA 2QR2A 4WNYA 1Y8QA 3G1WA 3A7DA 2LRHA 4XX0A 1EVYA 4Q01A 3U9SA 2J3KA 1LW7A 4Q1FA 2JANA 3N0RA 3I0MA 3K32A 1HDCA 5JAUA 2AA3A 2X8AA 1XZCA 3GMSA 3W5BA 2O8NA 2VPIA 2PUFA 1QE0A 4ZN6A 1CYEA 1G4HA 3MTIA 4MR8B 4S24A 4AFNA 1D9ZA 1DX9A 4MUEA 4MYSA 1NJ5A 3WZ2A 1NVWQ 2WMDA 2UZIR 1Y3BE 2YS6A 2ZUWA 3IQZA 5F2KA 3W5UA 3HS3A 3TWOA 1AQUA 3JQAB 3PYMA 1DC5A 3LSTA 3E84A 3MCWA 1CR0A 1ND5A 3OTIA 3AV0B 4B4KA 2HT1A 1PZNA 2Y0CA 1TAHA 2GJSA 5AMXA 1IRXA 2GPTA 1IEQA 3CX4A 4PPYA 4UBNA 1MVLA 3NBQA 1Z4IA 4B6JA 2XECA 4B2YA 1NM5C 4BB9A 2C1EA 2X9GA 5FQNA 1T34A 4G4JA 4Q3NA 1E9VA 5BSGA 2ZI4A 4M98A 3ZW8A 2OFPA 1S2NA 2BBSA 1O9BA 1X7WB 3P9KA 1D5CA 3TTXA 4RCYA 1DBRA 3K31A 1KKLA 1NBOA 1ZGJA 1VP9A 3EDRA 5TQVA 3KYIB 3KS9A 4A15A 3DFZA 1NPDA 3F2VA 2QTNA 4MPJA 6REQA 5J4YA 2YWDA 4G5OA 5ECWA 1XNGA 1FMTA 1HM5A 1XPOA 5HS6A 4IX1A 1MB0A 4Y1FA 5B7GA 1JW9B 2IYFA 1K5HA 1JA0A 2OUKA 4MCIA 2LKDA 4R84A 1GG9A 3FXAA 3OZTA 4U5XA 4YDQA 4MQEB 3LYLA 3SWWA 1ZCFA 1WMEA 4JUDX 1O97D 1ATZA 4FEGA 5TRTA 4FGLA 5AVTA 4G4SP 3P2KA 2QMZA 5I9MA 5TJHA 4B3RB 1N5IA 2X5KO 3RKUA 4IEIA 1FE8A 2QU8A 1WLYA 3EEIA 4WZAA 5KYXB 3BORA 3VSAA 1R3DA 5BR1A 1YB4A 2C8LA 1FC0A 2VPWA 16PKA 3QLVC 5JV5A 4AF6A 4HWRA 4EG6A 2N1BA 4NLLA 3V1LA 1BCSB 1XCMA 4C3ZA 2BMEA 3CVXA 3S8YA 4TV9B 1YFLA 3I9FA 2ERYA 3PC2A 4YN3A 1TEXA 3AKEA 2EC5A 4Q15A 5JARA 4JP2A 2FEMA 4D0SA 3E4DA 5IRCD 3O4IA 1N0WA 1ECBA 3KZMA 4P6VF 3W7AA 3JQAD 5CFNA 5HRCA 4ZC1A 1PK8A 1SXPA 3DR3A 5BSKA 5M5BA 3LLVA 1L8XA 3VR3A 2AFIE 3PC4A 3G9XA 2CHUA 5L3SB 4PZCA 1CRZA 4U7JA 4DUPA 2NU6B 3I9JA 1AT1A 2A3RA 4DB2A 2QVZX 2XWSA 3X2FA 2FRVA 4DV5B 3P9IA 4E3ZA 3ZV4A 1FX1A 3B60A 3TFQA 1GGKA 3UVEA 5DSZA 3VYTB 3NHWA 1RRMA 5G3ZA 2OQVA 1E9AA 4HJXA 4Q7EA 2ZYRA 5LDHA 1CJKC 4G0UA 2PWPA 3TCXB 1PYGA 2ADFA 4PICA 5AP9A 4B6EA 4WE3A 2ZIZA 1CUYA 5K3FB 3OPVA 5FX2A 4NFSA 4DRXB 1DQRA 2XYGA 4H18A 3FOWA 2OHOA 3GLFA 3I5AA 1ZUIA 1Z75A 1QRDA 2W2QA 2K2QB 4JCOA 2AMJA 2BFMA 2NPFA 2Q3HA 3TLGA 4MDFA 4MJ3A 2DCUA 2VR1A 5A04A 4OHYA 4FVTA 4FWTA 1G8FA 3EFOA 4KR0A 1M2GA 4TKUB 2G8LA 3FLAA 4TQAA 2H5LA 2K5UA 2ZKLA 3TVDA 3S8EA 1QE5A 2FW0A 4LXYA 3RJ9A 1CFJA 1DAPA 4EG7A 4KSCA 2NU7A 1N2IA 1N6LA 1XR3A 2IHYA 4IEFB 4IOJA 1YAJA 1Z4JA 2ZAOA 1T4BA 3CS3A 1CZUA 4F46A 3AY7A 1MNQA 1E2UA 1RFGE 2WIBA 3ORRA 2QAGB 2VUTA 3P0JA 4RA9A 4KO1S 1CUBA 2JJMA 1IWOA 1AN9A 3F3KA 1R8JA 1KKMA 1RLJA 3WQHA 4G26A 3ROMA 1Y1PA 3DBRB 1FK8A 3FZYA 4JKIA 1UPUA 2AT1A 3L0ZA 1D8AA 4GS5A 2AJ8A 2WD9A 3IQEA 3O8QB 3QBEA 4LMRA 3CLVA 2L17A 3BAZA 3CLUC 5COAA 5JW6A 2PSHA 4N6OA 4FT2A 1M2VB 1Z2DA 3S27A 2DZDA 2QRPA 1KZ1A 1YC5A 4B85A 2ZRDA 1QRSA 1DX6A 4B80A 2OESA 2ZYVX 4TM7A 5BXYA 8ATCA 5J2TA 1RRCA 2K7ZA 1NBIA 1F6BA 3QPUA 4WEQA 3L4SO 1OWPA 2BTQA 3M3DA 3RVOA 4B3MB 1MB3A 4D3XA 3CH6A 2YMPA 3R4CA 4AC9A 2HYIC 1C0KA 3HKBB 3NVMB 4QEDA 4K8OA 1VIMA 3D43A 1YVRA 4LWZA 3QUBA 2C5GA 2M2IA 2NZYA 3D3NA 4HVCA 3INNA 1FUUA 3CUVA 1OXUA 4RD1A 5C32A 2IE0A 4XAQA 1GT6A 3ROFA 1F3LA 1ORHA 1YR3A 3SIRA 3ZBQA 3MT8A 5DLYA 1FFSA 1H2FA 3K9BA 3UMSA 4TZ0A 2YWRA 4MW7A 1KXZA 2Q6LA 3OBIA 3GNTA 2IL1A 1QAOA 2VP5A 2Y67A 2Y1EA 3B51X 4K05A 1MW8X 1JJ7A 2Z2YA 4GU5A 1AZWA 4U6NA 1AS3A 4I19A 1GPH1 1GUZA 1SVNA 4EB6A 3QU2A 3L1JA 3BWYA 2C5FA 4P92A 4A2QA 3QX3A 2QJOA 3IUBA 4NFYA 4C4SA 1T3SA 2F1KA 3N8KA 1KVQA 5DU2A 4ZU1X 3VR6A 5JI2E 4QJBA 2FEXA 4PZ0A 4A7PA 4BV8A 1XNQB 1T91A 4Z0HO 1EUCB 4EKDA 4G4SO 5EIOA 2D1QA 1X9IA 4FUQA 4BNDB 1EEXB 3LV8A 4A0QA 1SXQA 2IW3A 1X1DA 1IJFA 3BBLA 3B1YA 3IOYA 4KN5A 4WA8A 4ZVRA 4R7TA 4YEDA 4JP1A 4G1VA 4Z9YA 3RVDA 1Z8NA 5C81A 3ZWXA 2JLUA 3HYTA 4BGIA 1XTVA 3UJ8A 2ZBQA 4IH9A 4RMGA 3WXMA 1FUEA 2C3PA 1YF3A 1YIDA 4WDQA 2NVBA 4MZDA 2VG8A 4C6TB 1M8PA 2FQ1A 4OK3A 3DM9B 3DZBA 3NIWA 4IXWA 2PVPA 5FO0A 3ZWVA 1A5TA 5TGTA 2I55A 2AFIB 2OCGA 3EVEA 4JC0A 5ESRA 3TLEA 4DGSA 3B3JA 5J4LA 3KAJA 3ZI0A 5U4QA 1XCOA 3I04A 3R41A 1JEJA 2XADA 3D8NA 3EVDA 3JXEA 5TPWB 1ZZEA 1MX9A 1LSSA 3MWJA 3L1UA 1BMQA 2G88A 4NZNA 3UCEA 3O4JA 1O0CA 4ZICA 3ZWBA 2GEJA 1E0KA 3BTVA 2GPNA 1NMYA 4YP0A 5JOQA 4K03A 1C0EA 3PPIA 4CJXA 1W49A 3QEMA 4UNIA 4E13A 4G5FA 4W8GA 2JD1A 2VAVA 3VYSB 2R65A 5KHAA 3RVQA 3WL6A 3WGMA 1JHMA 3K73O 3HH8A 1X87A 1VSVA 2I6TA 3OPMA 3DTVA 2Q3FA 3JZFA 5FL3A 3NRBA 3RH0A 3T5MA 3U7QA 4CIVA 1EUQA 4RY8A 4X44A 5CVUA 1HT0A 3DZFA 1RQNA 4MWDA 4QTZA 2XLBA 4URWR 5AVJA 2O54A 2X0RA 1YHYA 4RS3A 4HDNA 2CKDA 1L7BA 2PV7A 1L0BA 2V6JA 2WF6A 3C6MA 1BSVA 2YNMC 3FRHA 2VQFB 4O4HB 1HKUA 2IYWA 1QQ7A 4PTZA 3OOEA 4FS8A 3E0XA 5CDTA 1SVWA 2XUAA 3JQ9A 1P5FA 1N2SA 2I4OA 4CDMA 4M9ZA 4Z6KA 1L4MA 5ALUA 4AY3A 2QK4A 5B30A 2QM7A 2VS1A 4U7HA 2O3TA 1QG4A 2HK6A 1NQ5A 5KC8A 1UKBA 1YQTA 4F04A 4PNZA 3DWEX 3H1PA 1TYCA 5KX5A 3Q2KA 3E53A 4B6SA 3EXHA 1CUZA 2XZOA 821PA 4M83A 1H05A 1KAEA 4GRIA 3NP9A 1PO7A 4K3VA 3GEPA 2DLNA 3LOPA 5FPQA 3G0HA 2IPMA 5ERYA 4AICA 1RPNA 1F60A 3IQFA 4JVMA 4ZTZB 1QRAA 1IBKB 2CJWB 3ONVA 3OFND 1E96A 2C07A 4RL4A 4FNOA 1U2PA 1SXIA 2ZRIA 3GN1A 4L4SA 2WJAA 4DIUA 3KKKA 1DINA 3I05A 1P2SA 4Y9SA 2NX2A 4ENUA 2OHFA 3PNOA 4XIIA 5JISA 3WLOA 1JIJA 1O96A 4FS3A 2QZ9A 1XWFA 1UAAA 2DQSA 4A27A 5B3KA 2F67A 3PI7A 3PEUA 3PDCA 3A4NA 5ER9A 4ZVPA 1H1TA 3LW8A 3QMPA 4J29A 2QJTA 3DB2A 4RFLA 4U02A 2WY2D 3ZHUA 4E5YA 4JQYA 5HHTA 2D7DA 1T0BA 3RBAA 3U44B 2I4NA 5TX7A 4KQ2A 2PLNA 5E3IA 3W79A 2E2WA 1EKXA 1QWOA 3HHPA 3OEEA 4RZ3A 4H59A 4CMKA 4DCVA 1DAMA 3EJWA 4B4OA 4EJ2A 1EP3B 1MEEA 1B7GO 2O07A 4E6PA 3WBKA 4Z1OA 3OUZA 4LDJA 4R2HA 3CLHA 4R0VA 3K05A 5REQA 1E1RA 2YY7A 3NHSA 2P9HA 3L43A 1OYYA 2BBOA 2QY6A 4ILEA 3ANLA 3K9NA 2GSWA 2SCUA 1QFXA 2XYVA 2LPMA 5KYUA 1KQNA 3AVXA 1PEDA 2G9NA 5C35A 3WYNA 3OKCA 1KZ4A 2F3UA 3CUEF 3DBOB 4L15A 5K0SA 2BGNA 5AK3A 1JLLA 4ZCRA 3BBPA 2G4CA 5BNTA 3BERA 1WR8A 3FYCA 1FJ2A 4I7EA 1R4ZA 2ANCA 4QEKA 1M33A 2DH5A 3FUVA 2Q62A 1CE8B 4BWYA 4FB5A 1YVDA 3QJGA 3HGTA 4N7BA 4G8DA 1Q0TA 3DL7A 5B36A 2F1IA 2IVFA 1DCMA 1XELA 2XTJA 3HG7A 3NTQA 3UBMA 4QODA 5I7EA 3HO1A 3OLWA 1GZVA 1L5NA 2WM2A 3OEWA 3MFYA 4KAFA 4BDTA 4YWHA 2XKBA 1GZDA 4CLRA 4PVDA 5I6DA 5K7SA 5C1OA 3AGPA 3OQPA 6LDHA 1C8KA 1YS4A 3IBCA 1Z3IX 3IUNA 5DH9A 4B3DA 2ZXFA 4IWYA 1OGYA 4TSFA 2BAGA 1XFDA 2G72A 1T1GA 3AXSA 4JJZA 4YI5A 4F72A 3ZIUA 1Y1KE 3KB1A 1ZIPA 5ARDA 5EP3A 2M6KA 2FSUA 1WULS 3WSVA 1CUVA 3F3SA 1MQ8B 2VNSA 3MW8A 1CUSA 5C1PA 4Q7KA 1AKTA 1WHTB 3KQOA 1XKLA 1N4DA 4MGKR 1AD2A 5B2ZA 4ZI5A 3RYHB 4Y9RA 3UKOA 1VM6A 2IYLD 1N2CA 5JCPA 3BJIC 3C7TA 1WAMA 4HXEB 4J75A 1EUZA 4BGVA 1E1NA 1BHO1 2HRZA 3A36A 4WNCA 3RS5A 3V48A 5JD5A 1UWVA 4W7SA 1GU1A 3EW9A 3HFGA 1Z0FA 3DZDA 3K5WA 3MXOA 1QBKC 4NICA 5K99A 5FFMA 5AW1A 3GRKA 3OIGA 4NYMQ 2IGTA 1T2VA 2CV2A 2O7NA 4F1KA 3HSKA 1IUPA 2ZWPA 2XMGA 5U4XA 5FOSA 3MT9A 1Q95A 3SBEA 3WLAA 4QQNA 2XXAA 4S04A 2PA3A 4AQYB 3H1BA 3RTCA 2E4VA 2OILA 5FDFA 4MKZA 2P2ZA 4EO4A 3AKDA 2M9MA 2VCHA 1DARA 2YMQA 4Q1BA 5F35A 3JAMA 5IUKC 1FB5A 4D5EA 2BFEA 3OOHA 1K6IA 3MJ4A 4KXYA 3EPHA 1VIYA 2ENWA 4E30A 1D6MA 5YASA 4C5AA 1Q0RA 2VK2A 1T8TA 3W5IA 1RJDA 1N92A 4LKOA 3E7DA 2C8VA 4AY4A 2BISA 2GAOA 3NTOA 1LTKA 3T7KA 2PAAA 2C82A 1G5PA 1CNFA 2FR8A 3PGXA 4QXAA 4J1SA 1FP1D 1THGA 2FX5A 3HCAA 2CFIA 3AUUA 4IUYA 1NJFA 2QN9A 3G0CA 1RR6A 5DK6A 3HJBA 5LZ7A 3WK4A 2J0QA 4I1YA 3UM9A 3ILVA 1OVGA 1Q74A 1VLHA 1GKYA