2GILA

Structure of the extremely slow gtpase rab6a in the gtp bound form at 1.8 resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
161
structure length
161
Chain Sequence
FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Ras-related protein Rab-6A
publication title Structure of the extremely slow GTPase Rab6A in the GTP bound form at 1.8 resolution
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gilA00
2IUUA 3K0CA 1WMSA 4V0OA 4DCTA 1W36B 5JSZB 5F98A 1PUJA 2A2ZA 4DUGA 3KJEA 4GMDA 2VP4A 2N46A 2F43A 1J90A 2IS1A 3AVVA 3KUDA 4Z8XA 3SJCA 5J4KA 1HE8B 4BLOA 2PJRA 1EWQA 5CK4A 1OKKD 1ZD8A 2FPKA 2W83A 5CJPA 3PEWA 3NIBA 3RRNA 5P21A 4JKYA 3K0CC 4TWZA 2NPIA 5LD2B 3CRW1 2QAGB 3GFPA 4LC0A 4PZLA 4HUTA 4C3ZA 1IJFA 2R65A 3B1ZA 2F1HA 4I1VA 4MKHA 2X1VA 2ZJAA 4LI0A 3U44B 1N5LA 1T5LA 1DS6A 1JR3D 2C04A 5H68A 1H8HA 2A78A 5IF9A 3FMPB 4URWR 1W0KA 2QN6A 1T91A 2ZETA 3EIEA 5C4MA 2A5JA 1EFCA 1GL7A 2OZEA 3P26A 5FPSA 4AY2A 1N6HA 2D74A 2H16A 2O8FB 2NZ8A 3FOZA 3KXIA 2K5UA 1UBEA 1Q1QA 1G1MA 2ZJYA 3PUXA 3BB1A 1U99A 2HLDD 3LWNA 3QEJA 2X19A 1X1RA 1N5IA 2GAAA 1E6CA 4P4SB 5EP3A 1XXHA 3NBZC 2ORVA 3Q5EA 1K8RA 4E07A 1V5WA 3PUZA 2QSYA 1E1RA 2B21A 2PT5A 2BCGY 4PC7A 2VEDA 1EESA 2ERXA 2KB0A 4MRVA 3IEVA 3UG7A 1UPTA 3VR2A 1P5ZB 1ANKA 2OLJA 3B85A 1TQDA 5FBWB 4KSCA 3W5IA 5HPYB 4QL3A 1ZC3A 3FHOA 3OZXA 4L16A 1XF9A 4V0NA 1BKDR 3TKLA 1N6PA 3AUYA 5EXPA 2IYRA 3BFVA 2V1UA 4FMDF 4R2IA 1MABB 1XWIA 2RGGA 4F93B 3BD9A 4PAQA 3FHCB 1KIMA 3KTAA 1OFIA 2HJGA 4LYFA 2GXUA 2YWFA 4I99A 5FOSA 3GLFE 1ZMXA 1QHYA 2WVJA 3B1WA 4BE7B 1OIVA 4NE2A 1D8TA 1KI2A 3TRFA 4CW7A 3WYAA 2G83A 5JRZA 1FMLA 1C4OA 3QKSB 3TSOA 2CLCX 4LOAA 2PZFA 2Q9CA 3ZGXA 2JDIA 3EG5A 2RHDA 2AX4A 1NVVQ 2GXSA 4AURA 1PV4A 2ZS9A 1XMVA 4UXJA 3LXRA 2CXXA 4CYMA 3KXKA 4TZ6A 1A2KC 3IGFA 4KI0A 4AIIA 3LQQA 4IOJA 1FPMA 2JJ1D 4JVSB 1T3HA 1NP6A 4DLVA 3LBNA 2HT6A 3LNCA 1S9DA 1DAHA 3DKPA 1OXTA 3X1XA 3TGPA 2JCSA 3QENA 4QG7A 4RD2A 3RHFA 4BEJA 3HDTA 2BWJA 1M2OB 2CK3D 5EP4A 4LHWA 3NHBA 4DLSA 3W6OA 3JZAA 3MJRA 1ZD1A 3D6TB 3EPKA 2D7CA 4JJKA 4R2HA 3RSLA 4DUGD 3B5JA 4OI2A 2AHOA 1YZQA 2ZRLA 2O8CA 1GIAA 2QMUA 3W3ZB 3CZQA 5E7JA 5JI2E 2ORWA 4ZKDA 1ZU5A 5C1BA 4LC1A 4K8OA 3CLVA 4I1UA 2UZ3A 5FBVB 2Z43A 2ZSAA 2EFEB 2ZRPA 2ZJZA 2QG6A 1E2IA 5D3QA 3AB3A 1E2EA 2IC5A 1YRBA 5LBIA 1UAAA 2H1LA 1N6NA 5EZ5A 3I8SA 4RFVA 2ZRDA 4UXHA 1XPUA 2I3BA 2QTFA 2RGDA 4D4MA 2BKUA 4L8GA 1HYQA 2CCKA 2BM1A 5AK0A 2DCUA 2VHQA 1GM5A 1YQTA 1H8HD 1HY3A 2FZ4A 2IT1A 2PMKA 3FFBA 1KHTA 4U7DA 2QBYA 1AK2A 1W0KD 1BIFA 4LHZA 3DHWC 4NTZA 4ZCIA 1BO6A 1E9FA 5HCIA 1S1CA 4IXNA 1TEVA 2QEQA 4XD7A 5FTMA 4B44A 4ASUA 3NBFA 4OQMA 4TMWA 2GJSA 4JLAA 4CT5A 1DG3A 1HT2E 2OG2A 4B48A 3EXAA 4EPTA 1SVOA 3LVQE 2FGKA 5L3SA 4F4CA 3I8XA 1E1RD 2FOLA 3B9QA 1KKMA 3THYA 1GRQA 1TPZA 2MSCB 4RY2A 5DHAA 4FMCB 4MDEA 1G64A 3HPRA 1XTJA 2BJWA 521PA 4IRUB 1F2UB 1KK1A 2ZE7A 4MGIR 1Z6AA 2BMEA 1GL6A 3EZ6A 3QBTA 4TMKA 1OT3A 5A5GA 1G8FA 4S35A 4GRAA 1G7RA 1F48A 5B58C 1W4CA 1CR4A 3U2QA 1U2RA 2AKYA 3ND8A 4DVGA 1SKYE 2AWNA 4ZIRA 3U3JA 2BIFA 5BXQC 1XEWY 2HXSA 5DI3B 4C30A 4DSOA 3SE0A 5M04A 5CM8B 3N5CA 2DYKA 4LHVA 4JYBA 3LH5A 3IILA 1S96A 1E1QA 2ZRIA 2CL7X 1ODFA 3P32A 4AG6A 2XNDA 4K46A 4MYCA 1A1VA 4LJ5A 1NY5A 1NJFA 4C0KA 1DAKA 4GPTA 2FMXA 1WCV1 5DSZA 4URVR 4AC9A 1TUEA 3GMTA 4Q1EA 1P3JA 4KFUA 1E99A 1AKEA 1M7GA 5KNCA 3KQNA 1W4AA 2IHBA 4JT4A 3RRYA 1E0SA 3MMPA 4H1VA 3VR4A 1G3RA 1RRGA 4RFSB 5KPJA 2BM0A 1N6IA 2CLDX 3QUSA 5HR5A 5EP1A 4M9SA 3MAAC 2ZYTX 4DSNA 1CRPA 4JL8A 3AP1A 1CR1A 4BFZA 1CJTC 2YZ2A 1HQYE 3H1TA 1MO4A 2EFDB 2GJAA 4BLRA 5JLJA 4CEJA 1C1YA 1XBTA 4ZV4A 3VAAA 1YZTA 2ZI4A 5CYOA 2J7PD 2CCGA 2QP3A 4B76A 3TH5A 4R98A 5SZKB 3WHLA 4WVFA 4EJSB 4L5BA 4GL2A 2WIAA 2FNAA 2GJ8A 1GNPA 2QL6A 4C0LA 2R6FA 3AVUA 2KJQA 2C9OA 1AGRA 3CPJB 3K0AB 1G5RA 4LJ8A 4A0FA 1NVXQ 3GEEA 4RZ2A 1QHXA 4B3GA 2Q9AA 4LV6A 1XD2A 2F7SA 4E5UA 5BN3A 1J7KA 5TXGA 2X2FA 1E2KA 3A36A 4HDCA 4NCIA 3RS5A 2JLVA 4IEEA 3CRRA 2O8EA 1RC8A 1NVUQ 1Q20A 3REGA 2L0XA 4OQFA 1SVLA 2JIZA 4L15A 1W5TA 4RVCA 1CU1A 3U61B 4PC6A 3AF4A 2Z4RA 2BKEA 1E79A 5E95A 3WHKA 1E2FA 5CDFE 1S2MA 1W46A 3MFYA 2QA5A 4MH0R 3BFKA 1W44A 4JVLA 4ASUD 4BRUA 3W3AA 2CHQA 2YWGA 5J4HA 4HB4A 5CK5A 1LVGA 4W9MC 3IPYA 2BHRA 3NBXX 2ZRGA 1AIPA 1IN6A 1W0JA 2ONKA 3GLIA 1IBRA 5GJVC 5JS7A 4OK3A 4NP6A 4LX0A 5EZ6B 3UMFA 3WP0A 2WJGA 1VCNA 5A0FA 4TZ0A 3PENA 1RIFA 2RCNA 3FYHA 2HF8A 4O25A 4FIDA 4G5GA 4ZI2A 4TLAA 1NMZA 1XB2A 2YYZA 5HZHA 3RLFA 3KFXA 1YU9A 3WMFA 1Z3IX 1D2EA 2RGBA 2YOGA 4DCVA 4EPYA 1Q1EA 1UDXA 2OBNA 3L8ZA 4BLTA 1ZIOA 1NJGA 3OIVA 4KFSA 4QRHA 4IKEA 1YZLA 1KAGA 1EG7A 1KSHA 1NN1A 4DRZA 4LYHA 4MA4A 3BE4A 3FMIA 4NCNA 4DT1B 1E1QD 4HAZA 1N6KA 3EW9A 4RD6A 3ZS9A 2WPDA 2XNDD 4LY6A 3ASZA 1XJQA 2CL0X 3GLHB 2E1RA 5SZHB 4HAYA 3WRYC 2QU8A 1EGAA 3QJYA 1G8PA 3LX5A 4QGFA 4HLDA 2CBZA 4DC9A 1SXJA 1Z8FA 5SZIA 4B3DA 1GKUB 2A9KA 3AVWA 5EJEA 1KJWA 4UNPA 2ZUCA 5KUTA 4BFSA 1DPFA 2W2XA 4PTLA 3TR5A 3OEHA 3GFOA 1E2PA 3ADBA 2GXQA 1KMHB 3Q8XB 5CLQA 4B74A 1S1MA 1D2MA 4G5OA 5FFMA 4IVQA 5C2JB 4LCBA 2VLIA 2WKRA 2ZM5A 3TNFA 4WA7A 1KI6A 4HB0A 3SYKA 1SXJC 3H86A 3VHLB 3GP8A 1E2HA 1ZUNB 4X8LA 2EFGA 4C7OA 2OEPA 1WRBA 5D3MA 3QE0A 4NL4H 4DCUA 5KOYA 1OFUX 2C9YA 1KO5A 2R6DA 2ZROA 2ZI5A 1Z6TA 4PZYA 1E0JA 4FXPA 2R6AA 2WBLC 1IN7A 1M74A 2KSQA 2GCOA 2HUPA 1VDZA 4MRPA 5HZKA 3I3SR 4QBIA 2RAPA 4ILEA 2W0MA 2FX3A 1E98A 4A9AA 1OSNA 4DWJA 3B2EA 3C5CA 4O0MA 3GD7A 5J47A 3KQHA 2IA5A 2V4ZA 5FPYA 3KKPA 2MSDB 1OHHA 4LUCA 3T5GA 3EX7C 1NNEA 3P4XA 3NC0C 3CR7A 1QBKC 1CS4C 3DM9B 4E09A 2MSEB 1ZRHA 4BFXA 3M6AA 5KNDA 3SHWA 4JSTA 5AJYA 3AM1A 1Z0DA 4OJKA 2J3EA 3LXXA 3GJ0A 3U3RA 2AXPA 1YZUA 4KVGA 4M1WA 4CZ2A 1QHGA 4P4TA 4B6EA 2JIZD 3S1AB 4D4KA 2GVZC 3GJ4A 4G1UC 2NG1A 3CX7A 1Y3AA 2ATXA 3T1VA 3LO5A 1OB2A 1E79D 1DAFA 1VG8A 1GKYA 3OE7A 2PEZA 1ZCBA 3LV8A 4TYWA 4LSGA 2B8TA 4AYWA 1A7JA 3QF7A 3WY9A 3HU3A 3U6BA 3LVRE 4TL9A 4A0GA 2YKGA 4HEJA 1OYYA 1W0JD 4IDNA 3V4RA 4WXPA 3LY5A 2LCFA 1U8ZA 1VIAA 3NH6A 2OFXA 3A58B 2ZUBA 1D6JA 2F43B 2D7DA 2FGJA 1JPNA 1FOEB 2H5EA 3LLMA 4RZ3A 1N6RA 4OKSA 2ODBA 4HDQB 4QOSA 4BZXA 2CVFA 2Z4SA 2NMVA 4M4SA 1ZUHA 3AGQA 2QSZA 4ZO4A 1XTRA 1YR9A 3QVVA 3DPUA 4XH9B 3DKVA 4GOXA 3EZ7A 3KUCA 1R5NA 1II8A 4OHWA 3F8TA 4XVRA 4DIDA 3FMFA 4EDHA 4KAXA 3FHTA 1YHNA 3FVQA 4KLNA 3TVDA 1HTWA 4HLCA 3ZIAA 2VL7A 3AUXA 4OQLA 4QNRA 3T35A 4BASA 1WA5A 4DJTA 3OFNA 3THWA 1G6HA 1BYUA 1XTKA 1TTTA 4QJ5A 1A4RA 4H9GA 2KBEA 1A2BA 5IDVA 1K5DA 1NL3A 3KJIA 1L2TA 1UF9A 1NBMA 3X1YA 1FW6A 2DHRA 4LYJA 1II0A 1T3LA 3UWOA 2PX3A 2WPDD 5KU1A 3A1WA 1E9AA 1MR3F 4B75A 4BLPA 1W1WA 2ZSFA 2YINC 2QY9A 4P32A 2ONJA 4UXIA 4U02A 2RGEA 5E7IA 5FI1B 4HUQA 1ONBA 5FOUA 2PEYA 3B8HA 1SXJD 3GJ7A 3QEOA 3QPVA 3VX3A 2JLYA 2FPLA 1G8HA 1XXHB 4M21A 1TF5A 3L0IB 2JJ8A 1Z2CA 4FW9A 3L2OB 2OCPA 3OEHD 5C46F 4BRWA 721PA 4C0JA 1G7TA 3ZLJA 1P72A 1NY6A 4KV9A 2WJIA 4F4IA 2REBA 4RZXA 3EPLA 1U94A 1G8GA 1XD8A 2WJJA 3K0SA 2BBSA 1P73A 1G9XA 2DPXA 4V0ME 3U7FB 2TMKA 3CONA 1Y63A 2OXRA 3K9GA 2VBCA 2NPFA 5AUNB 1FNMA 3C41J 4WZ6A 4YMSA 4D81A 3CX6A 3PFIA 1Q3TA 1ELOA 2GESA 2XZPA 2LKDA 3EIQA 4US0R 4Q48A 1EX6A 1XCGB 2BDTA 3LBIA 3KTAB 3UANA 4PPQA 3V9PA 4HLQB 3TW4A 3HYRA 3I61A 1D9XA 4PSAA 3KQKA 4IEIA 1NVVR 3TQCA 1JNYA 1XFAA 4QBFA 2PZGA 1I2MA 2YOHA 8OHMA 1TQ2A 2VYFA 2FN4A 2QROA 4FCTA 4QHSA 5B2ZA 3WBKA 4F7WA 1GRNA 3NKVA 1M34E 4PPNA 3AKCA 3AGPA 1WF3A 1R4AA 3BERA 1OHHD 3C7KA 3SBEA 1EX7A 3OIYA 1RRFA 4NKRA 4M1SA 2WICA 2ZU0C 2OFWA 2FSGA 4LV5B 2YJTD 2BMJA 2OE2A 1R8QA 5ELXA 4BPBA 3L0OA 2AWOA 3NDPA 2CK3A 2EU8A 2XX3A 3OIWA 5L8VA 5JZVA 3ZQ6A 2F6RA 1X8LA 1OXSC 2CJWA 3ZYCA 2WMNB 3TVTA 4JLKA 4B2PA 2J46A 5FBRB 4Q4AB 3IQWA 4A0HA 3FDIA 3OE7D 1MV5A 3B60A 1R0XA 3PV0A 2NQ2C 3NEYA 5HE8A 1CXZA 2QQEA 2XJ9A 4PX9A 4M1OA 1VCMA 4RD4A 3DDCA 4V02A 4B3FX 3IEUA 1GKIA 1TF2A 1W2GA 1OJLA 1QHNA 2NGRA 4EFNA 2O8CB 1HV8A 1JJVA 3LW7A 3BS4A 1HA3A 4R71A 2VRWA 1FFHA 3W8NA 2MMGA 1PUIA 5EE3A 1KDOA 5KO2A 1R0WA 2WOOA 1COWA 1XEXA 4B35A 4US2R 1E2MA 4B6FA 1QRAA 2RKOA 4PHFA 1EFRA 3P1JA 2BV3A 3HP1A 3QF4B 1VG9B 4IDHA 4Z51A 3P27A 5EQTA 3ZIAD 2IYVA 1GG2A 2DB3A 3OFND 4LRWA 3QSYA 4C2TA 3MRSA 4C0SA 3VTKA 3RABA 4QNMA 2XZOA 1G3MA 3BH7A 5FH9A 1NBMD 2AK2A 1NSFA 4QC2A 3SNHA 2QBYB 1X6VA 3ADDA 1JR3E 4Q7JB 2J5XA 1KI7A 4UNQA 4CF7A 2IS6A 1OF1A 2OFOA 2V9PA 2ZE5A 4O2RA 1DAMA 4Q01A 4JIMA 4Q7LA 421PA 4HSEA 2W00A 1TU3A 2C96A 4PQFA 1SVIA 3P4YA 2PCJA 1E96A 4M9XA 3GLHE 4JLOA 1FTSA 4CDGA 1S3SA 1AM4D 2W58A 2A5DA 2XAUA 4KYIB 1GL9B 4MRSA 2QZ4A 5H1YA 4NHOA 1GOTA 5L3SB 3SDZA 1QF9A 2AFHE 2ZJ8A 4QGGA 1UBGA 1ZM2A 3C16C 2OM2A 5AUOB 3GQBA 2PT7A 3MJHA 3SJAA 3THYB 1OFHA 2ODNA 3E70C 1FMJA 4URYR 4JL6A 2H92A 4ZDIA 1KY3A 4JZKA 4N1AA 3LDAA 3KL4A 4PC1A 2CCJA 2GEDA 4EPWA 5JI3E 2P0EA 4P31A 5FL7A 2G88A 2IBMA 3UG6A 4C4PA 5KHOC 2GJKA 4C0QC 4ZI3A 3ZS8A 2GWHA 2X77A 3K1JA 1KI8A 4YC7A 2HDNB 4ZIRB 1SULA 3MLEA 2VIIA 1BYIA 3NC1C 4TT3D 4B33A 1N25A 3KKQA 3F3YA 4YMVA 1NLZA 1WP9A 1EFHA 3I4LA 2ZS8A 1AZTA 1ZC4A 2O8BA 4TLBA 1G3QA 3PUYA 4DEYA 4UNRA 3IO3A 3W5JA 2ORIA 1QVRA 1TX4B 1KAOA 3AKEA 3FKQA 4Q1BA 4RKFA 1NLYA 3FB4A 1DO2A 3IIJA 3D3QA 1J8MF 1MH1A 2RGNA 3I5YA 4EUNA 3VQTA 5K8TA 2O5VA 3OHMA 4S2EA 1EK0A 1VG1A 4OI0A 1B0UA 1XJ0A 2CHVA 4N0EA 3CB4A 4RKEA 2ZYWX 3C8UA 3U60B 3U7HB 2IS4A 2BCJQ 5GVSA 4QM7A 1XEFA 1JXMA 3AH8A 3AKDA 2J7PA 4TL6A 1VMAA 2CL6X 1IJEA 3RSOA 3AF3A 3SBDA 3W9YA 3QQ5A 4EIWA 1JQLB 1T3SA 2Q6TA 2VHUA 2VTKA 4KITB 2RGNC 3G5UA 5CITA 821PA 2HV8A 4BLSA 1KSFX 4EFLA 4CEJB 3PEVA 4A92A 3SYLA 3HJNA 4DB4A 4US1R 4Q4JA 5DGXA 5EP2A 4MRNA 4RZUA 3CW2A 3MCAA 1P4SA 3A1UA 3Q5DA 5F9HA 1RKBA 4GP6A 3THXB 2V6JA 1CP2A 2VF8A 3THOA 5HKKA 2P6UA 2AK3A 3UATA 4EQ6A 1W4RA 1GTVA 5FPHA 4PO8A 4TLEA 4TYYA 4M8NE 4Q7KA 1TMKA 4DDUA 4D4JA 1Z6YA 1Q12A 4NYJQ 3JVUA 4K81B 2R62A 1ZP6A 3HR8A 1K5GA 1COWD 1CKEA 1KSGA 3WMEA 1XD2B 1RRPA 3MWKA 1EFRD 2Z5FA 3PG5A 5J4LA 2NO6A 4TLCA 4QXAA 1AKYA 3ZDQA 2N1BA 3QKRA 1GP2A 4D0LB 4M53A 2RGCA 4WZAE 1P9RA 5TY0A 2O8EB 2EVWX 2FA9A 4GFDA 5JHHB 1HURA 1DOAA 5DYGA 2QI9C 1Z07A 3W6PA 2DFKB 3CR8A 3OEEA 3QVUA 3F5FA 5LD2C 2VF7A 3WRXC 1Z0AA 1NF3A 2ZJOA 1KYIA 4Q1FA 1YJ5A 4TQUS 3ND9A 1E9SA 1EFUA 4KFRA 1Q44A 1QG4A 2V1XA 5FUYA 4A8JB 1AS3A 1Z6GA 1MRNA 4AWXA 4DLYA 1GITA 5E3HA 1OFTA 1YR6A 3CRVA 1KTVA 3AVTA 3GLIB 1LW7A 3NH9A 2Q3MA 1G18A 2ZI9A 3AKYA 4M2LA 1OH5A 1XMJA 3KXLA 1XEWX 3QXHA 1VYVA 1AS0A 3SYNA 2R8RA 1XXHE 2ZVQX 1ZAKA 1P9NA 1AQUA 1CRQA 1E9CA 3A1TA 4O2LA 4CEHA 3T1TA 2IYWA 1UKEA 1OV4A 1ZVQA 3I73A 1Z22A 2J87A 4KYUA 4Q9HA 3K8YA 3RS3A 3T34A 3QXSA 2FH5B 5KSZA 5FL7D 1M7HA 2WWHA 3ADCA 1E94E 2VPPA 4GZMA 1CEEA 1UADA 4GZLA 1P62B 5DI9A 3EZ2A 4YMUA 3DEFA 5GVRA 1IN4A 3G82C 4HB2A 4DKXA 1XTIA 1XCPA 4YMTA 4MKFA 1U0JA 5J4YA 3EASA 2WTUA 1TNDA 2XSZA 3I62A 5JHGB 2ZAMA 2YOFA 3QI2A 4JS0A 3E5HA 4OYHA 1RVDA 3B9PA 2QMEA 3SFVA 3MSXA 4P3YA 3OAAA 4Y0AA 1J70A 4OI1A 4D82A 3QG5A 4MYHA 3BK7A 2ZSDA 2KBFA 3BH0A 1K6MA 2GBLA 4P0TA 2HYDA 3U6KA 5IT5A 2ZU6A 1Z6XA 1Q1ZA 1SXJB 1KNXA 4BECA 4KVAA 3KB2A 4DHEA 2WAXA 4A2PA 2JATA 1G20E 2EWWA 1R6BX 5KSYA 4D0NA 2VP2A 4L9WA 2OT3B 4XSGA 2ATVA 3EZ9A 4H1UA 4LJ7A 2NIPA 2EW1A 4C0HA 2DFTA 2QRNA 5KYKA 2GEVA 1Z0KA 2WWWA 4PHTA 1OB5A 1FL9A 2C77A 3LX8A 4LJAA 1E9DA 1NN3A 5L3RA 2A5YB 2ZRKA 4DLUA 2GBLC 4D6PA 5A4JA 1KI6B 2D62A 2FZLA 2NO9A 2OBLA 4F92B 4C7OB 4BFVA 1OIXA 2BEJA 2VP0A 1F2TA 3EAQA 4IW3B 4DLZA 1JAHA 5AJVB 3GEIA 1LTQA 3N70A 2EYUA 1GNRA 4Q66C 1P2UA 4BGDA 3DOEA 2F9MA 2JEOA 3H84A 5GJBA 5HKKD 4GOKA 1R5OA 3A37A 1XTSA 1DAEA 2G0NA 2IEYA 2GCOB 4YQFA 2B7CA 2QPAA 1YKSA 2ODEA 4AYTA 1E3MA 1JAIA 1KO1A 1PLKA 2QMOA 2QP9X 4LJ4A 1FX0A 4PR0A 1NKTA 1N3BA 2ZI7A 3FTQA 2XTZA 2ANBA 3ONWA 3OIUA 4TTRA 4ERNA 4BUJA 4G5QA 4WW0A 1XD9A 4LBZA 4UKDA 1KDRA 4KHZA 1KKLA 4XWKA 2OAP1 4TYPA 2XTMA 5FTKA 1Z63A 1E69A 2GRJA 4OK5A 3MUFA 3EA5A 5DE3A 2ZI3A 3OEED 2QPTA 3CBQA 3KDSE 4X8OA 3IIMA 2YHSA 4Q9KA 4M1YA 3BWDD 2B7BA 1JQJC 1UJ2A 2PZEA 1XNJA 3R20A 3W34A 2WSSA 1ZCAA 1VPLA 2BBOA 2W0SA 1KY2A 4M1TA 1G5PA 1RW4A 3L43A 5G3YA 1GILA 1ZM4A 1KMQA 2JLQA 3AQ4A 1SVMA 3BB4A 1NI3A 2LWIA 2ZITA 4Q00A 3O8CA 1FNNA 4URXR 3KZ1E 2WJYA 4OHZA 4RD3A 5CYPA 1Z29A 3PJRA 3JVVA 3PR1A 1G41A 4ARZB 1NG9A 1Z5ZA 1E2GA 2WMOB 4CVNA 3U3KA 1XX6A 4ZDJA 4IOLA 4A36A 3RVBA 1XMIA 1CLUA 1O3YA 1II8B 1LS6A 3D8BA 1XZQA 1CR2A 1TQ6A 3L8YA 2A3RA 1ZM7A 1E9RA 4AKIA 1P75A 3DMNA 3VR6A 3BFXA 2D4HA 4BZQA 3TQFA 4Q1DA 3THWB 4POAA 5B30A 4EFMA 5UKDA 4MKGA 3PIRA 4JVNA 4GNKA 5DNYB 2XSZD 1YZNA 3RRZA 4LJYA 3BGWA 4Y0VA 2O0JA 4IDPA 3FE2A 1KO8A 4I4LA 2ZTSA 1JI0A 2J0UA 5EE0A 2XB2A 1WDTA 1VTKA 3EC1A 3OAAD 4NYMQ 4YMWA 5FR1A 5GADl 1P7CA 3VNVA 3CUEF 4HZIA 4M9ZA 5G41A 3AEZA 4Q02A 1QHHB 3EPHA 4KXFB 3GLGA 2LKCA 2BBWA 4HUQB 4URZR 1HT1E 3CM0A 1IHUA 4QM6A 3BXZA 1CBUA 4B34A 1Z06A 3WYFA 4DZZA 4V0MA 3O47A 1J8YF 2IYXA 2FJUA 2QE7A 3DZDA 1XU4A 3ETLA 5ANRB 1Z0JA 4AKGA 5AJWA 2GCNA 4HAVA 4TLDA 1JBKA 3ZZUA 4W5WA 3CH4B 2BJVA 2I1VB 2ZANA 3N2IA 2G9NA 3OF5A 3SU8A 4PFSA 4A2WA 5EE1A 3B1YA 4IDQA 1GRRA 4FMDB 4OQXA 1VECA 4KODA 3RC3A 2H18A 3GJXC 1XP8A 1DELA 2ERYA 2C98A 2FSIA 2NTYC 4UNNA 4Q9IA 1BS1A 1QDEA 2QNRA 2P65A 2HYIC 2OILA 4DDVA 1P2VA 4OJQA 5KSOA 2XOKA 4OHVA 4NCKA 3RAPR 2OHFA 3TJZA 2QT0A 3NG1A 3V00A 2IX3A 3EA0A 1IY1A 2ZI6A 4Q4HA 1R7RA 4HLUA 4DDWA 1FUKA 2QQ0A 1NG1A 4JVMA 3DM5A 1U8YA 4MITA 4D4LA 3LAWA 3EPJA 1Q21A 5G40A 3QPUA 1LFDB 2GEUA 1U0HC 2QRZA 5DISB 1TQ4A 2YC2C 2ZRHA 3CNLA 1SHZA 4QKQA 2A5GA 2GHIA 2A7QA 1S0UA 4NYIQ 2PCLA 1Z2AA 3T61A 1E9EA 5H70A 4OHXA 4GI7A 2IUTA 1MRSA 3TE6A 2CJWB 3FKSA 2IF2A 5FTNA 4FWTA 5HE9A 1KNQA 3A8TA 1PLJA 3A4MA 4HLUC 3ZJYA 4HZUA 3QG1A 3KQUA 2B6HA 2ZJ5A 1RJ9A 2WSSD 4LHXA 3FWYA 4A15A 1W2HA 1UDWA 4BFUA 1U9IA 2NO7A 4FMCF 4OK6A 4DDTA 3K9NA 1AA9A 2ASEA 3SFZA 3GJ3A 3VMFA 5B57C 4TTPA 4MGYR 2IXGA 1SVKA 2IYZA 2V6IA 3Q7PA 1SZPA 2WWFA 1ZNWA 2F55A 4KBGA 3GLIE 3CZPA 2ZSEA 4M9QA 3VR1A 1JPJA 2OSBA 3C15C 2CE7A 2OO7A 2RMKA 5FR2A 1X3SA 4PZZA 4Q4LA 2WM9B 1W7AA 1U9IC 2D2EA 3ICEA 2ZE6A 3I1FA 5GJWC 1XEXB 5EXXA 3ZVMA 2NO0A 4GDFA 1SHKA 3W90A 4JLNA 4D80A 1G5TA 4OHYA 2GZDA 2ANCA 3E1SA 3R7WA 4Z1MA 1GNQA 1ZINA 1US8A 3PEUA 5KDDA 2EQBA 3B6EA 2OESA 4QBGB 1GFIA 2C5LA 2VSFA 1V43A 3AVXA 3WBJA 3CNNA 1G19A 1GWNA 1IN8A 1OE0A 2VHTA 5DLQC 4A6PA 3H0KA 1IY0A 3AVQA 4B43A 4V0KA 1BMFA 1U8AA 2ZR7A 1IY2A 2FFHA 5L3VA 2JLXA 2IUSA 4DSUA 4B71A 1SVSA 2DWPA 1T6NA 3NDBB 1QVAA 5FTJA 4PHGA 1MO6A 1P61B 4YXWA 1PVOA 3C5HA 3PXGA 1Z47A 2XB4A 2IYUA 2DFLA 1SXJE 4NMMA 3U5ZB 4PHHA 1VYUA 5TDHA 3EARA 1JEDA 2BEKA 3VFDA 1NKSA 4EPVA 3GLFA 4DCSA 1R0YA 4R7ZA 2QE7D 5F3WB 1OLOA 1GDDA 3UKDA 3K70C 3U4QA 3A1SA 1SKYB 4TT3A 2ZRFA 2XZLA 2N42A 4M0LA 1HE1C 3IHLA 4GBMA 4ZCMA 1TL7C 1LV7A 4XWAA 2ZAOA 4XSHA 3TIFA 3VU9A 2GTPA 1NSTA 2WWXA 3PQCA 4OI4A 2FE4A 2AD5A 1W4BA 1N5KA 2FFAA 2DFNA 1YVDA 3MGCA 1ETUA 1KDPA 1T4GA 2QT1A 3LD9A 3PUVA 5AR1A 3ZH9B 2VO1A 1RRCA 1UKZA 1KI1A 1XPRA 1MKYA 3I32A 2IYQA 3IBGA 4LJ9A 4TQ9A 3K09A 4HDOB 2J0QA 2O8BB 2XOKD 1ESMA 4BFWA 1U98A 1XTQA 2B92A 4Q1AA 2GKSA 2FDCA 4PANA 1JEEA 4BWYA 3X1WA 3I5XA 2Q9BA 3BOSA 1HH4A 4JKIA 4PQYA 4DCNA 3AVPA 2PL3A 1ZM9A 1G3UA 3KKMA 2XEXA 2ZQ5A 3Q7QA 4EPXA 3GJ8A 6Q21A 2YV5A 2J0SA 3KFVA 4AI6A 1MOZA 4L4UA 3K09C 1G4AE 3P20A 4IDOA 4JLPA 3K0FA 1UBFA 4DLTA 4QJ4A 3RWOA 1FUUA 1T0JB 3A4LA 5AWFC 5JWRA 2WWYA 1SGWA 4LK2A 1FZQA 4PSVA 3FKSD 3REFA 3AF0A 4AG5A 2I1QA 1HEIA 2H57A 3MWJA 4QBHA 2NO1A 1AZSC 5KDLA 1E4YA 1Z0FA 5FUVA 4CIDA 3LLUA 3U3OA 2IS2A 3I72A 4Q4JB 4FINA 2QAJA 4GT1A 3K53A 1KK2A 3RDPA 4NYJR 3CWQA 3JZMA 4CEIA 4JBYA 1IXZA 4FN5A 1U0LA 3GPLA 3FMOB 5FPTA 1LF5A 5LB4A 4DIEA 3G0HA 4EQ6B 4BQSA 4AKHA 1S4QA 2JLWA 2XXAA 1N2CE 1R5BA 2Z0MA 3CNOA 3X2SA 2PJZA 4RCZA 4TL7A 3L82B 5FPKA 5CIWA 2JGNA 1Q1BA 5JWHA 4A1FA 1NRJB 4WZBE 3VR3A 3TSZA 4D2IA 2BOVA 3SR0A 3IUYA 5CLLA 4QHTA 5C4GB 2DWQA 3HR7A 1R10A 1G8YA 2GF0A 2O8DA 2WJHA 5EE5B 4LPKA 2A30A 4DBLC 3J81k 4KJZA 4Z1MD 4TMZA 1OYWA 5FOXA 3PITA 3KJHA 3QKRB 2F3TA 4E03A 3AVYA 4X8HA 1X8KA 2J7KA 2VP9A 1D9ZA 1N5JA 4XVQA 3CF2A 3NVAA 1QZXA 2RB4A 1DAGA 2GZHA 1T5IA 3GFTA 3H2YA 3IQXA 3ZVRA 1UKYA 4QJ3A 2ZRJA 1TU4A 1BOFA 4R9UC 5F2EA 3SJZA 2YVUA 2R44A 1NBME 1BMFD 2IEZA 5F9FA 5EXTA 2GA8A 5TV2A 121PA 2KWIA 3K70D 1I4DD 4L9SA 2YWEA 3UWKA 1E32A 4IJMA 2GXAA 4PAMA 1ZBDA 3RS2A 4IOMA 4JT2A 3W6NA 1G16A 4ABYA 4B32A 3GEHA 4Q1CA 1H65A 2OCBA 3R8CA 3HYTA 3MG9A 3AP3A 2E9SA 1LB1B 4YXWD 3T06B 5GJCA 2SHKA 3BORA 4URUR 3EIHA 1KI3A 4FCVA 3SZRA 4FWIB 3W8RA 2ZE8A 2D3WA 4NDZA 5L3QA 2JAQA 1O87A 3Q72A 4HAXA 3IHWA 4B3CA 3HPQA 1S9HA 4FCWA 4CEHB 1D5CA 4G5SA 5EE9A 5EUMA 5FOWA 2REXB 5JJIA 3BB3A 5E7MA 1MT0A 1NN5A 4XVUA 5BW8A 1AN0A 2YC4C 4JBXA 3M4YA 2CLSA 1NIPA 2PMDA 3TUIC 5TVKA 4BZPA 1CJKC 4Q9JA 4G01B 1WE2A 4KSBA 2J45A 621PA 2H7VA 1P2SA 1XJCA 1AQYA 3KB1A 5FBQB 3IKJA 3D7MA 5BYKA 1YR7A 3NHAA 1OH6A 3X1ZA 1WXQA 2ZR0A 1CR0A 1G4UR 5JRJA 4DLRA 1NMYA 1XDBA 1UM8A 2ZR9A 4GP7A 4RD1A 4CRWB 1KZ7B 4D25A 5CB8A 2QTVB 2CDNA 2VSOA 4WXRA 1PZNA 1F60A 3LBHA 3GCGA 4GMXA 5FUWA 1W49A 3T1OA 2HF9A 2UZIR 3B1XA 3WNBA 1RZ3A 1JJ7A 3O8DA 1KI4A 4PPGA 2I4IA 3TK1A 1II9A 1TUIA 4DB2A 5J5CA 4OBEA 1J99A 2JLRA 1LNZA 2O0HA 3X1DA 5DIFA 5JCPA 2VH5R 5JSZA 1LF0A 3F0TA 4Q9LA 3D31A 2ZVPX 2QTHA 4Q4AA 2IXFA 3PCRB 2F1JA 1DAIA 2ZRBA 4JLMA 5HCNA 2WIBA 3E2IA 1I4LD 5BQ5A 1XMSA 4KCGA 5KPDA 1W48A 2QMHA 3AVOA 2QGNA 2NZJA 4A82A 5B64A 3WMGA 2QM7A 2X2EA 3DVLA 4M1MA 3CPEA 2WSMA 1IXSB 1KK3A 3CRQA 4HAUA 1F2TB 2CEAA 1OPXA 3BBPA 3L0SA 4PC3A 1W36C 5JJKA 1Q22A 2QAGA 4GOJA 3T1QA 2FEMA 1CTQA 5LPNA 2DBYA 4AK9A 1DARA 2J1LA 2GNOA 4F38A 3U44A 4II7A 1OXUA 2IYSA 2FG5A 4PAOA 3CO5A 5TMPA 2QENA 2QP4A 1ZU4A 2X8AA 2A5FA 4NZYA 4QFMA 2KI5A 3TR0A 3ZZTA 5CDFA 1FX0B 2FWRA 1L8QA 3QF4A 2GETA 1KO4A 4JL5A 2AKAB 2ECKA 2O8FA 4C9BA 2B8WA 3ZVLA 4F4JA 2OAQ1 3RS4A 1ZM3A 2ZJBA 2QAGC 1LY1A 4DLXA 1F5NA 3UMRA 2ZXUA 4NCJA 3QKUA 2Q3FA 3NBYC 2ZRNA 1WB9A 4JLVA 2VA8A 3ASYA 5DH9A 1IONA 4P4SA 2HT1A 2V7QA 4IVPA 5DYIA 4B3BA 1NIJA 1UEIA 1XZPA 2IXEA 4YONB 2CVHA 2CHGA 5KNBA 5IRCD 2IK8A 4B73A 3IIKA 3O8RA 1W47A 4PSKA 4NCHA 3BH6A 1HUQA 1T8TA 4MGKR 4AKEA 3NXSA 1FP6A 2FEOA 1DO0A 1TEXA 1QHSA 2QUZA 4DXAA 3T5DA 3A4NA 4X8MA 1OH7A 2Z83A 3CF6R 3QNUA 2NOAA 2P2LA 1DEKA 3B7GA 1MABA 3FGNA 1E2QA 4FD2A 1I2DA 4Q18A 2FFQA 2ZRCA 2XTNA 1Z08A 5FTLA 4B47A 2W6IA 1KOFA 2IWHA 4ACBA 1SVWA 3U7GA 3SQWA 1J2JA 3H4MA 3RS0A 2PX0A 2ZJ2A 1KJZA 2Q21A 4B3XA 1OH8A 1ZD9A 5JFGA 3SJBA 2BMDA 2BVNA 2EYQA 2WKPA 5JCZA 3RRMA 3UMSA 2C95A 5FL3A 1E4VA 4I81A 1IXRC 3QKSA 5DN6A 2FSHA 3GJ5A 4ZDKA 4F91B 1NVWQ 1GUAA 4U5XA 4W7SA 1XPOA 1F6BA 1Z83A 4NYMR 4ITRC 3TLXA 1TF7A 5JS8A 4ESHA 4ON9A 2R6GA 1DBSA 4BFYA 1KZGB 2QORA 1SQ5A 1E2DA 2WAYA 3UIEA 1UEJA 1T8UA 1G291 1X1SA 2ZS7A 4LYAA 1WBDA 2UVQA 3CH5A 4IOKA 2O0KA 2HJVA 2HCJB 2J0UB 3FFAA 2C2HA 2OCYC 2ZYVX 3CWZA 2JDID 1SKQA 2PBRA 2AXNA 2R9VA 3BC1A 4TYQA 1B23P 3GLGB 1RE0A 3KX2A 1E0AA 4WAUA 4MYUA 4QHYA 2D2FA 5JMTA 1X8JA 4XIGS 4TYNA 1VCOA 1D2NA 2G1JA 2IW3A 4MRRA 2OXCA 1W36D 1G7CA 1YE8A 3WNCA 1KO7A 4CGZA 3U7EB 5G53C 4XWOA 5D3MB 2V54A 3BAFA 3QY0A 4NPHA 1Z0IA 2ZREA 4HYYA 1ZNYA 3L0PA 3QBVA 2C03A 2PH1A 5FOTA 4A4DA 4OL0A 2VHJA 4G5RA 3THXA 4XTRA 1R8SA 1CJUC 2JJ2A 2G6BA 3VKHA 4KO8A 4KBFA 5JEDA 3RC8A 2GF9A 4J0QA 4PXAA 5IK2A 4Z54A 2H17A 4UJ3A 4UNSA 1F3OA 4JLBA 2JA1A 2AN9A 3RYTC 2OLKA 1IAQA 4TMXA 3T15A 3BIFA 2G77B 4NBSA 3TMKA 3QXJA 1A5TA 2IYLD 1U90A 2ZRAA 2C8VA 2HCBA 2FU5C 3B1VA 1DE0A 1AGPA 4Q4HB 4NONA 5JEEA 1EFTA 1Z28A 1RPZA 2P67A 4NYIR 4BLQA 5J4VA 4E22A 1MO5A 3QPWA 2GZAA 1N0WA 3LRPA 1S3GA 2AFIE 1OXXK 4U00A 3SEAA 2RGAA 3CRMA 1WQ1R 1FP7A 5KDOA 2JLZA 5AUPB 4MUAA 1AJEA 2V7QD 4ESVA 3B82A 1G21E 2EWVA 3Q9LA 3LQRA 4Q5IA 4XD7D 1GZSA 5AJXA 2P3SA 3QOFA 1XRJA 5AJZA 4LDJA 5E4FA 5J40A 4DLWA 2JLSA 4G3XA 2ZRMA 4A8JA 1I4TD 1DTSA 4HZUB 3LA6A 5JWOA 4TN1A 3C14C 3U3MA 1RJ9B 2GILA 1W5SA 2BBTA 4KU4A 1IQPA 1F2UA 2VSXA 2Y8EA 4MUBA 1ZNZA 4HATA 1MO3A 4KLZA 1M8PA 1TAGA 2IWRA 4NU0A 5HTKA 2GK7A 1NMXA 3DMDA 1ZNXA 4XOIA 4WBSA 2AL7A 4MGZR 2R6CA 4BEBA 1KK0A 2XJ4A 1VKJA 3IDQA 4LWZA 1GSIA 3N2EA 3EC2A 4HI0E 1JB1A 1OXVA 2BMFA 4ZPXA 3VKGA 5DI3A 2Q3HA 2VP5A 2W6ID 4A8JC 2QGZA 4HAWA 4ZCLA 2D06A 1M7BA 2W2VA 3UPUA 2PLRA 3MWYW 3A1VA 1LS1A 2ODWA 1DVRA 5FOVA 3DOFA 3R7WB 5DN6D 3WXMA 4D26A 3CKLA 2Q0HA 1US8B 1JECA 4JMPA 3TAHA 1N6OA 2MMCA 4ACAA 3NEJA 3ZQJA 1JR6A 3VHXA 1ESNA 4MQBA 3PVSA 3DZ8A 3K9HA 2EFCB 2VHCA 4GSYA 2GCPA 4RCYA 5BWMA 1QG2A 3TW8B 3NWJA 1E9BA 1ZIPA 5CM9C 3B78A 4RFSA 3C4JA 2GK6A 1H8EA 2ZUDA 3AV0B 4G0NA 3AP2A 2OBMA 3K70B 2GVDC 2F1IA 5DO9A 2IYYA 4IXMA 2DR3A 1M6NA 3R8FA 1PLLA 2QM8A 1VG0B 4JJZA 3PUWA 4IHQA 2V3CC 1Q0UA 2J9RA 4A2QA 3V4FA 1CULC 5BN4A 1L7VC 4V03A 4OQNA 1R0ZA 4LJ6A 1OIWA 3UXMA 4PPFA 1IOZA 1P9WA 2W6JA 4EJSA 3WNDA 3GLFB 2XGJA 1CJMA 2YWHA 4DSTA 1G3IA 4P33A 3BJIC 4RJLA 3U4QB 2QPOA 5C18A 4PQRA 1P60A 1BH2A 3K0AA 5TARA 3TUJC 2BC9A 2G0TA 3KQLA 3Q85A 1A82A 3ADKA 3VU9B 3ZD6A 2WKQA 3SQXA 4HB3A 3T12A 1RFLA 1Q3HA 4Q03A 1C9KA 2J0VA 2JJ2D 3UK6A 2ZIAA 2WJVA 3RWMB 4TSFA 4AYXA 4TQAA 2CNWA 5IK2D 4EJSC 2REOA 4PC2A 1AS2A 4YDHB 4XJXA 2ZYUX 4ZKEA 1DADA 1UBCA 3CIOA 5FUXA 2AD1A 4LBWA 4O3MA 1Q57A 3Q3JB 4Q19A 5DHFA 2C9CA 4W5JA 3M1IA 5FI0B 4W5HA 4PO1A 1VYTA 3ICQB 3TUZC 2FF7A 4WOPA 5BN5A 4IFBA 2UKDA 2F9LA 1G7SA 4EKDA 1XCMA 5H8WA 3R9XA 4D0GA 5K8IA 4XTCS 2G3YA 5LB2A 5CIQA 5EXSA 2IF0A 4QGHA 4BFTA 5LDDC 1JALA 3EWSA 4I1SA 1N0VC 4NH0A 2HEIA 3VX4A 2YNMA 3HWSA 2OV2A 3K0FB 4RD0A 5EUQB 4I1OA 5CJ2A 3HU1A 3SN6A 1KGDA 2Z6VA 4LV8B 1FTNA 3SHFA 3R9IA 4FMBB 2KE5A 2IYTA 3DL0A 1OKKA 4AD8A 3R9WA 1NLFA 2AR7A 2DWOA 4TMVA 2G1KA 4IFEA 3WYGA 1HQCA 2O52A 4UQOA 1VHTA 4DEXA 2P5TB 2FPMA 2ZPTX 1T0HB 2GAOA 4ARZA 3BRWD 2ZEJA 4PO9A 1RYHA 3QIAA 1YR8A 5K8LA 3ZVNA 4CEIB 4LPSA 1N0UA 1NN0A 2WOJA 3DO6A 4LZZA 1CF4A 5KSPA 3MD0A 1T9HA 1CJVC 4Q21A 2W2TA 3CX8A 1JR3A 1L4UA 3B13B 3SOPA 2XXAB 3CPHA 1KJYA 4DT1A 4EPRA 1VHLA 3I92A 1CIPA 5SZJA 2FSFA 3TBKA 2JLUA 2C99A 2CMKA 3EWAA 3GLHA 4M22A 3PEYA 2O8DB 3RNLA 2DY1A 1N6LA 2R2AA 2PLFA 2OCAA 4EAQA 4V0LA 2J41A 2HLDA 2RH5A 2FFBA 5IHPA 1E2LA 1OW3B 3ZD7A 4M1KA 1DG1G 1YRAA 3M0EA 1P2TA 3OESA 4MYTA 4LBYA 4RSGA 3HU2A 4MKIA 2P6RA 1FQKA 3KKNA 4JLJA 1GAJA 5G3ZA 5K8UA 4IVRA 1IN5A 1QHHA 3CF0A 1KMHA 3SI7A 3IPXA 2VP6A 3FPAA 4JBWA 3A6PC 1H8ED 4Z8YA 4C0BA 3O8BA 1P6XA 4A6XA 5AUQA 1YZKA 2F1RA 4C0AC 2WV9A 2RHMA 1ZJ6A 2WZQA 4Q47A 1M1YE 2OUKA 2XITA 4KFTA 3KJGA 4YLGA 2HXYA 2XNSA 1QHIA 3GLGE 1R2QA 4JYCA 4YDSA 4N3NA 1VCIA 2WHXA 1YZGA 4JSYA 1ZYUA 3AF1A 2GJ9A 3TSWA 2W6JD 4N0DA 4TL8A 4ZDWA 2FV8A 4MDFA 5L3QB 1KI9A 1EXMA 1FQJA 4P4UA 4CT4B 1GVNB 2IHYA 4LHYA 1ZUIA 3RS7A 1ZW6A 2WWIA 3AF2A 4JLDA 1KSJA 2F3RA 1G17A 2P6NA 3IO5A 3K9LA 1E2JA 3EZFA 3ECCA 1G6OA 4B2LA 3VR5A 4C2UA 3SS8A 3KKOA 1PJRA 2CE2X 4A0RA 1UKVY 1VIYA 5FBLB 5KTYA 3QKTA 3GJ6A 3ZZ0A 1E0KA 3K0EA 3VNUA 2V8OA 3SC3A 1U81A 2IL1A 1UFQA 3MWLA 3WP1B 3RANA 4TMTA 4TSFD 4WIAA 2CNWD 3IBYA 2J59A 5JECA 5JJLA 4FI3C 4LGMA 2H8KA 4Q7MB 5BYJA 4B2IA 1E2NA 1WBBA 1X86B 221PA 1KDTA 2GDJA 5TB5A 2EFHB 4QGAA 4TTQA 1JXOA 2WWGA 1TADA 2JASA 1L4YA 1RYFA 2JJ1A 2P5SA 3S1AA 4LBVA 2VQSA 2V55B 3LFUA 3QXXA 2E87A 3TAUA 3LW8A 1IM2A 2ZSBA 2RGXA 3NTUA 4UJ5A 1S8FA 3VKWA 1EWRA 2C78A 5CB6A 5JBQA 3QXCA
chains in the Genus database with same CATH superfamily
1Z5UA 4H7HA 1R8YA 3G7SA 4D4IA 3DXZA 3N6RA 3DPIA 3CLTD 3ES9A 4XJVA 3TYXA 2R48A 3KJEA 3WGQA 4DUGA 1YWGO 3HZZA 5A3VA 1EBBA 3KE9A 4QE3A 4RY9A 3X2EA 4B3JA 2WY2D 2B0JA 4PG5A 4QYWA 2QVZX 3HXQA 1WM1A 4YROA 4Z8XA 1XQWA 3H3FA 3RK0A 5J4KA 4JJGA 4FGSA 3UK0A 1EWQA 5H83A 2XOXA 2EL9A 1OKKD 1BXZA 4XD2A 3GYGA 2EF0A 1L3CA 2QD3A 4Z6KA 1X13A 4DCJA 1JVNA 1HLFA 1URPA 4JX8A 5SICE 1DJPA 5FI3A 2V6MA 3L5KA 4C05A 4HBZA 3PYMA 1YZYA 2XE7A 2NPIA 1TT5A 4YR7A 5F12A 5LD2B 4EVIA 2W5UA 3AHFA 4Y6OA 1JHZA 4M36A 4TXMA 3CUSA 5TS2A 2DY0A 3B1ZA 3E9MA 3WZ2A 1OA1A 3AY3A 3ODPA 4MKHA 1IHPA 4K2HA 2ODQA 4MSUA 3UOAB 3C4VA 1C9YA 4CTKA 1OV6A 2FQYA 2A78A 3LDGA 4URWR 3OECA 1D4OA 5AYVA 2WABA 2XE4A 4MA0A 4GICA 5C4MA 5IAKA 3HO8A 3SPXA 2A5JA 1GYQA 4ENRA 2NSJA 3R3WA 2O8FB 2H16A 2F3PA 2NZ8A 3FOZA 3KXIA 2XGOA 1SBIA 4GEGA 3RFVA 3DUFB 3R0ZA 4GYYA 4B83A 3L4KA 1P29A 2ZJYA 3HB9A 3DE4X 1GQSA 1S8OA 4OXXA 1GZUA 3BB1A 5DBOA 1ZK3A 2AE1A 1U99A 2NUTA 4DWWA 2C07A 4F5DA 2X19A 4YHHB 4LF8B 1X1RA 1N5IA 2BP7A 3NATA 3O95A 4KN8A 5EPEA 2RAFA 3HWRA 3VUEA 2HXGA 5KVSA 3IKVA 1XXHA 1Y1LA 3NBZC 5HIIA 2ORVA 4D3ZA 3Q5EA 2UZ1B 1T2CA 5EMHA 4ZZ1A 4JODA 1E1RA 3K6KA 2B21A 2BCGY 5DT2A 2VEDA 5A6SB 3N8HA 4LSZA 4D9EA 4MRVA 5AI4A 3MELA 4CIWA 1YVUA 1GQFA 4ZYLA 2GAJA 6CHYA 3AI1A 3P2OA 3ZWNA 1K7XB 3DXXA 1TQDA 3AEXA 3EW7A 4ZVVA 5FBWB 5BV7A 4HNTA 5DGTA 2GB4A 2IIPA 3FHOA 2KHZA 4GR4A 4V0NA 3VTFA 1KJNA 1YS7A 3QPDA 4TKVA 3IVMA 1VE6A 4P98A 1X7XA 1JG4A 4X0EA 4FMDF 3C5WP 4IDBA 3GA7A 2RGGA 3FW1A 1Z6PA 1KQ3A 4P34A 4E1AA 4ZU6X 1PX2A 1MJNA 3FHCB 3L6RA 4CQMD 3PD7A 4EHNA 1CFJA 3GGCA 1SUIA 4I99A 3UJHA 4CLDA 1QAOA 1Z6ZA 3GLFE 4LRQA 5ICCA 5BNTA 1U3VA 3EPHA 1OIVA 4NE2A 1KI2A 2I7TA 2FWJA 4KRGA 4DJDC 1TIKA 3VR5D 2G83A 1X3LA 2HAEA 4YJ3F 1WUJS 3EWNA 5IULC 3MWGA 2PZFA 2A1UB 4L5JA 5TRTA 2DQZA 1KH2A 3RKSA 2DBQA 2LXNA 3GNQA 4CFSA 3HTXA 3S40A 4CN8A 1NVVQ 1OFUA 3H8WA 3ZGVA 4C6RA 4DABA 1XMVA 3EBOA 3QEMB 3T3OA 4YAFA 1TYCA 3CR3C 3LXRA 2ZIEA 4KUEA 2IPXA 4UXJA 4TZ6A 4U2CA 2C3PA 1T2AA 3QEAZ 1GCGA 3KALA 3UMJA 1V5FA 4JVSB 4WSOA 4F0JA 3U62A 5LQCA 3H5LA 1RKQA 1YR2A 3WDSA 5HG0A 2HT6A 4KH0A 3RVSA 3T3EA 4BAUA 4XUGB 3M2TA 4JXKA 1PZXA 3T4UA 3X1XA 3J81A 1EJ2A 5A3SA 4AJIA 2NM0A 3CSSA 3EYAA 1IUNA 5F23A 5IJZA 1ZGZA 2GK3A 3NV9A 4K40A 2CK3D 3NHBA 1RYNA 2QJFA 3M4NA 2ZCUA 2H1SA 4FZRA 4CI0B 2RAUA 1IH8A 3BXFA 2UZ0A 3D6TB 4FEAA 4M46A 1PUXA 2D7CA 4X94A 3EPKA 1N7HA 4JYAB 3B5JA 3PKJA 4FOOA 4JQSA 3FHLA 1T9BA 4BL5A 4CKEB 2CLLB 4EYSA 2AHOA 4S1OA 1SRQA 2ZRLA 1N4DA 1WHSB 3K2IA 5IJ0A 3A6ZA 3F7MA 3FRJA 2QMUA 1C0IA 1TQHA 2QTTA 3CZQA 4RY8A 4UU0A 2PANA 5E7JA 1T10A 4IDAA 1GADO 3P9QA 4GAEA 4BAZA 5I47A 4K8OA 1JLLA 2J3KA 2Z58A 1UMCB 2BGIA 4R5MA 3KD2A 5IX8A 2EFEB 5KS2A 3WTCA 3EGDA 3RYIA 3GRVA 1E2EA 2BFAA 2E18A 3VYUB 3ZKWA 4OHPA 1KZ1A 4X65B 4CKBB 1JH8A 1MJGA 3H99A 4RFVA 1XPUA 4CV2A 2RGDA 2W2PA 1VZ2A 2DPLA 2BKUA 4HXFB 4HX9A 5EMLA 4IUYA 1HYQA 1SIWA 1T6BY 4BJ5A 4OYLA 4WTOA 4AN0A 2SCUB 2Y27A 1NQUA 4O1HA 2P1DA 4WEOA 3T5MA 5K7SA 3NP7A 4G1CA 2IT1A 3FFBA 1KHTA 1AK2A 1DEHA 1G1AA 1BIFA 1W0KD 3FVRA 4M0DA 1LBEA 2I54A 1Q7EA 4OB6A 3DHWC 5DK4A 4CG2A 2D1SA 4NTZA 1Y1RA 4YCAA 1FYXA 4EEZA 1BO6A 5AJHA 2E1PA 1E9FA 1QIEA 4IXNA 1ATZA 1X9IA 2RJNA 4H7PA 1XDDA 3WVNA 4D9NA 4GU5A 4UHHA 4MS1B 3VSDA 1MLDA 1M6VA 1WD5A 1HK7A 3NOQA 3SHOA 5AM2A 3RAFC 3EFOA 4X24A 4OKNA 2YH2A 4ZRNA 3SJ7A 1KYXA 4CT5A 3CVXA 1C2YA 1Y9ZA 3ORQA 3ANMA 1L7BA 1MXFA 1LBIA 4NABA 3T94A 2ONZA 1VMDA 3EXAA 4GSKA 1KJ8A 5TJ9A 1USKA 2FGKA 3RFCA 2Q5FA 3QPCA 4G23A 2FUG6 4XYGA 4E5SA 5C52B 4BB6A 4N5IX 1HE2A 1MEOA 4PLWA 1Z33A 1GRQA 2R87A 1TPZA 5FEMA 4W5OA 3KDPA 3THYA 4Q34A 3UWSA 4IRUB 1F2UB 1SOUA 4KK4A 1XYVA 3UO8B 3FTNA 2ZE7A 4ER5A 2PRYA 3KETA 3LY8A 4AU1A 1WKCA 2G8NA 2JFXA 4KN5A 4BJ1A 1J25A 1OT3A 1XSEA 5ARCA 1G8FA 2WFLB 2GBGA 3Q2KA 5F2KA 2HA0A 2O6LA 5B58C 1W4CA 2FE1A 1BCRB 5EUCA 5EI5A 3U4DA 2AWNA 3WK6A 2G40A 4ZIRA 4WBXC 5AM5A 1SD2A 4HQOA 4KE8A 1XEWY 2B6NA 2JFVA 4TS3A 4YV2A 3TO5A 3D7LA 4BVAA 5CIYA 3RUPA 3FPLA 1KBQA 4IDCA 4JN6B 2OKGA 1IHDA 1XLUA 3LH5A 4JYBA 1QIMA 1E1QA 3GC6A 1T0PA 4L2IB 3H8JA 4LISA 1ODFA 4DQKA 4AG6A 2NXEA 4FDMA 4U63A 2XNDA 2C2YA 1DEAA 5CDYA 3VMMA 4ZAXA 4L3OA 1B76A 1NJFA 1XFDA 1P4HA 3SC4A 4C0KA 2C2WA 2IVZA 2AOTA 3KWLA 1H66A 2CWWA 5DSZA 1U2SA 3NMUF 5K0CA 2VOEA 1HFKA 5K51A 3GMTA 4WY2A 1FE8A 3GL9A 3C5EA 3I9OA 2WWRA 5K3DA 1LLFA 3VHXB 1DO8A 1IATA 1SA0B 4C87A 2OBFA 4RSRA 2ISSD 1AKEA 2QRKA 3KQNA 1NVKA 2CXPA 2OCIA 4Y9RA 5ABPA 3MMPA 3ZDXB 4QU5A 1JI3A 1G3RA 2VCHA 1RRGA 3Q3EA 3EGXB 1CUFA 1L7PA 3CO0S 1N6IA 3MQ4A 2WT9A 4BO1A 5HR5A 5EJMA 1JHRA 2Y1DA 3QXGA 3MAAC 4JDUA 4LHSA 4M9SA 4R05A 4DSNA 2D0DA 4EABA 1GPWB 1CJTC 1TCBA 4YUXA 2ZUVA 2B69A 5E4YA 3AG5A 3MMSA 3Q9NA 1BD3A 3V42A 4ZV4A 2ZI4A 2OQ2A 2PH5A 1D7OA 1BDHA 2HEGA 1NBEA 2XQGA 1ZI6A 2HCTA 4L4ZA 1USVA 4UREA 4B76A 1QGZA 3TH5A 1OWPA 3FI0A 5SZKB 4CLOB 5IZ4A 1V4BA 1ESCA 1ZOIA 3CW8X 2VRNA 1IWPB 1MRZA 4EJSB 4GL2A 1V1JA 2X9VA 4DZRA 3KCNA 3LVFO 4AP6A 3NGMA 2LCIA 1DRWA 3OJLA 1GNPA 4HVAA 4LGVA 4U0JA 4LYDA 2V7VA 1V25A 5JJCA 3OX3A 3I5UA 1V7ZA 3K0AB 4RKQA 1QZTA 4DV6B 1G5RA 1WU7A 2DC1A 4O59O 4TTAA 4EMBA 1AMNA 1NVXQ 2QI9F 3PD0A 4RMJA 4RZ2A 1M34B 4RTSA 1A9TA 2PFKA 3F78A 2XUDA 3H9UA 1T3GA 3GGGA 1HLPA 3JWIA 2C4HA 5L6MB 1XD2A 4DEVA 5DWQA 3QU4A 4E5UA 2HC9A 4JD5A 1J7KA 1C9JA 5IJWA 2X2FA 3A28A 4NCIA 1WHTA 4R7TA 1F0KA 4TROA 2JLVA 2FW9A 1KORA 1RC8A 3C74A 1DLIA 4MVJD 3I1YA 2ZBFA 3RTGA 3VVLA 3WGKA 5BW5A 1SCKA 2FSVA 4RQUA 4Z4EA 2JIZA 5M34A 4RVCA 3VDRA 1N7IA 4CDNA 7REQB 3B3FA 5I7UA 5JC1A 2A88A 1CZHA 4FKZA 3X2FA 3AF4A 5BN5B 1E2FA 1PNRA 1W46A 3DAPA 4RK1A 3PC2A 3BMCB 1PG0A 1CDZA 1PR4A 4Q4DA 1UK6A 1W44A 3E7FA 4GKVA 4KH1A 3RRBA 2ID4A 2CHQA 2GA9A 1LVGA 1PQYA 1RNLA 1R27A 3MJTA 4MUFA 4ROSA 2ZRGA 4QUHA 4WGFA 4BNMA 3ZJUA 2ONKA 2UU9B 3NJ8A 3L1UA 4DRXB 2ZB2A 2G7ZA 4QXQA 4FK8A 5GJVC 2WAMA 5GTDA 3GLIA 1DCTA 3I9LA 3IQFA 3LIIA 2XQFA 2R1TA 3NZEA 3S5UA 2OZPA 2W9XA 4NP6A 3C8MA 4ZWNA 2G4CA 4U4AA 5EZ6B 5EJ8A 1ECFA 1V3TA 3KBBA 3O2QB 2EJVA 5A0FA 3DONA 1PL8A 2RCNA 3R6GA 5K0FA 4O25A 3KP1A 1NMZA 1XB2A 5HZHA 3OQOA 2ZBUA 3O31A 1QWOA 4WLNA 1ACLA 1GTRA 4TN5A 2YOGA 2M6SA 5HF8A 4EPYA 4ARCA 3NEPX 4MVYA 3R5SA 3L8ZA 3WWPA 1FFCA 1ZIOA 3BD8A 4JR0A 4QA9A 4FFOA 4WZBB 3Q7EA 4RGYA 5DXJA 5LQNA 3GBPA 4CG0A 2FDRA 2PSSA 4QRHA 4R69A 1GSOA 5E7QA 4UM9D 1EG7A 5AW1A 4X1IB 1KSHA 1ODKA 1A8HA 3HCOA 4LYHA 3ZJ5A 2VTEA 3BE4A 3FMIA 2R6JA 3RSQA 4HAZA 4RD6A 4XFDA 4DV7B 1AF7A 3KBOA 4FZVA 4M55A 3N07A 4BX9A 2WINI 3OI7A 4GSLA 1AD2A 4IO1A 3D4LA 1H9AA 3JTEA 3KNZA 4UHCA 3BPSA 2QU8A 4LOIA 5DX8A 1U5BB 1TA4A 1GUFA 2VSQA 2OM6A 4UU1A 3RB8A 4HLDA 2CBZA 2XD9A 3MYYA 1J1UA 4Z5XA 3DE7X 4P35A 2AFHB 2RBEA 5TGTA 1E5VA 3AVWA 3IBSA 5KNCD 4D5EA 4C5CA 1SVUA 4WWHA 1C1DA 3LG2A 4BNDA 2FR8A 5AW4A 1ZXBA 3ONDA 3RSCA 4UCWA 3OEHA 1ZEJA 1XPJA 4IO0A 3VR4D 2GS9A 2HK7A 1IZ7A 3FPHA 3ADBA 2VDRB 3Q8XB 1RXWA 2OY0A 3DBIA 3DOHA 1T1EA 3LY7A 4YRIA 1S1MA 1PJ4A 2BN4A 1E3TA 3QW2A 4G5OA 2VXYA 4IVQA 2NU9B 4PTZA 1UXKA 3MPUA 4FE3A 2YHBA 2JVIA 3ZDFA 4XJSA 2WKRA 4BKUA 1U28C 5A7HA 3TNFA 5FV4A 4L08A 4MP3A 2CLOB 4WKCA 2PKCA 1SXJC 2EERA 3K31A 4L8FA 5LLSA 2H7XA 3FNBA 3UPDA 3VDXA 1U0RA 3AK4A 3IP8A 4ALJA 3DBLA 3HQ4O 2ZI5A 4LJLA 3SS7X 1PBNA 2DVMA 2XB6A 3MTDA 5FQNA 4JV5B 3A6LA 3AEQB 3DMYA 4ZCSA 4DG9A 1GPYA 1M74A 1DGQA 1X1AA 1VDZA 3R3JA 3F4BA 4QBIA 5LKRA 5AK5A 4J1TA 4LGYA 3C5CA 2PWAA 4LDAA 3R8XA 3OWOA 3AHHA 4BB9A 2II6A 4F2HA 4JP3A 4JI6B 3WAKA 5CCBA 1K6IA 3WOVA 5IVDA 1OHHA 4CLRB 5FUBA 3EX7C 1NNEA 2C1XA 2OD9A 4GVXA 1Y3IA 5F7ZA 4DR7B 4MUGA 2EBUA 3A2NA 4KX3A 1F4VA 1DFIA 4E11A 4EENA 1G38A 1EUYA 4YRRA 2GMWA 1L7NA 5CVUA 4DMMA 4PG8A 2J3EA 2EGGA 4YJFB 3GJ0A 4M89A 4PZDA 3U3RA 1OWNA 4WMLA 5EWJA 2JGKA 4S0ZA 3MQ2A 1LTHR 2IXDA 2XT0A 3C6XA 1XDGA 3LCRA 4M7PA 3CRZA 4ZAYA 4NESA 1L8XA 4BQRA 2GVZC 5IYZB 3PFCA 2ATXA 5EINA 5CFOA 4II3A 4D98A 1N1EA 1Q1GA 5BUCA 1CB0A 3RJ5A 3AEYA 4KX5A 3HY4A 3CVVA 1DBPA 3I0NA 1QO9A 4G36A 4GBGA 1V8ZA 3IRUA 2IDMA 1ZN2A 1A7JA 3JYQA 3SXPA 4LGCA 1C8BA 2XUPA 5FJIA 2YN2A 1KWKA 3G8AA 1Z7BA 1VL6A 2H1CA 1OYYA 1W0JD 1DBWA 3O75A 3NP9A 1IPHA 1UBOS 2RC5A 2LCFA 2WK1A 3HN7A 5CGQB 1VIAA 1CF9A 3JWJA 3A58B 4UVEA 4LSWA 1JYSA 2ZUBA 1U3TA 1N2CA 4RNDB 3AUAA 3L4EA 3RRJA 4RZ3A 1FOEB 3F9RA 1QAMA 3V2HA 5JH7F 1ZCZA 3HMKA 4OKSA 1RLIA 1BVUA 3MBKA 1RRMA 4MCAA 4NEGA 4M4SA 8GPBA 2GN4A 2M1XA 3AGQA 3DDOA 4ZO4A 1XTRA 1YR9A 3T41A 3NCTA 4IIFA 3OC6A 3V4PB 3L40A 4GOXA 3W5UA 3KVVA 3DE1X 1VOTA 4KB5A 5JJBA 4DR5B 3EIUA 5EHIA 3FHTA 3PA8A 1YHNA 1TT5B 1Y8ZA 1HTWA 4RF2A 4YJGA 4L0CA 3ZIAA 2VL7A 1V0JA 4QOIA 5IVPA 1YRWA 3OFNA 1YNOA 3THWA 2C88A 4WCFC 1TTTA 4HRVA 5IDVA 1K5DA 3KJIA 2C4WA 3Q7IA 3U3ZA 3L8EA 2XNKA 1GCOA 3MIZA 3MRTA 3PPYA 2X1LA 1U1GA 1FW6A 5LZ5A 3V34A 4YAJA 2B2NA 3FUXA 3RBVA 1QCZA 2PX3A 4QVIA 3UAVA 3A1WA 4W63A 3JQPA 1E9AA 2A0WA 1BAPA 4H2DA 3UGJA 3DXYA 1M8GA 4JOBA 4P32A 5JD4A 3EGVA 4R84A 1NXWA 5FI1B 1UBSB 4J3NA 4HUQA 4KQ1A 2NUTB 3KJXA 3B8HA 1E20A 1SXJD 2FG6C 4PLCA 2BP7B 3GJ7A 4JC4A 3ONVA 2A0KA 3CQ9A 3NRBA 4LRUA 3N76A 2HPVA 1M33A 5ALPA 1XXHB 3CVWA 4CUZA 3IOYA 3SM3A 3UT0A 5E9JA 4KMSA 3JAWA 2J48A 4RMHA 2GAFA 5EMNA 5HBGA 4BRWA 1W75A 1VJ0A 3N8DA 1P0CA 4GPIB 1D6SA 3IQDB 4U1RA 4X97A 1ZR4A 3ZLJA 3IYLW 1F1JA 2I2CA 3H3JA 4KV9A 5KCMA 1GYPA 2GKOA 4FYKA 2A84A 4MV6A 1U94A 1JFFA 1U9JA 2MT9A 2WVHA 4LE0A 4TLMB 1TK3A 3HCCA 1YA8A 4KWIA 3KSDO 1JIJA 1FRNA 3HL4A 4Z0TA 1PYOA 3P9YA 5LZ8A 4CCAA 6REQA 1MB0A 3CONA 3LUFA 1Y63A 4TKVB 1I2BA 13PKA 5E1MA 2NPFA 4F2GA 1I5RA 4L3VA 3C41J 4WZ6A 2XY4A 4KO2S 1Q3TA 1A9SA 2XZPA 4PIPA 4US0R 5ALTA 2BDTA 3V9PA 3PIIA 4PWYA 4BQPA 3RAJA 3TSYA 3BF8A 2FUG1 2WF5A 3HYRA 4QULA 4EG5A 3ZX4A 3BHMA 2CV2A 2Q2VA 4HGNA 4BCDA 1WCWA 1NVVR 2GBFA 2H4ZA 2PJDA 1JHDA 2YOHA 3PUJA 4XWTA 3BK2A 3WYCA 8MHTA 3TNYA 4QHSA 3NTLA 4I4IA 2PTHA 2VVTA 1INLA 2WU8A 3HCRA 2E4VA 3SQOA 2B0CA 2XODA 3PHBE 4RE6A 3V4RA 1E6KA 4E4YA 3T5AA 1RRFA 3C0KA 3NW9A 1B8VA 3VOSA 5IAEA 5ICMA 1OC4A 2H6EA 3MS4A 3ECAA 1C7FA 1KPGA 1R8QA 2QVCA 3E3LA 4YK7A 3ROGA 4DBZA 3NDPA 3P2KA 4J49A 2CK3A 3DD5A 4WKNA 5JVDF 3DOUA 2XX3A 2IW1A 4HY3A 3O1IC 1QRDA 2EHJA 2YUIA 4Q1VA 4EB6A 4YASA 1OXSC 1Y0BA 4ME6A 1EP3B 5KJ6A 4OP1A 2BEVA 5KAPA 5FBRB 3PPWA 3DTNA 3I9V6 4JU9A 3I5AA 4KGDA 3BWEA 3B9RA 4F56A 3ZOZA 1BH6A 1OVMA 4LVCA 1N2GA 2CC2A 1ISHA 4FYHA 4KKXB 3DNFA 3P0HA 4XARA 3JQ9A 3RAGA 4I50F 4KW7A 4YRLA 5H3CA 2ZSUA 4EFDA 3PSHA 4DLAA 2XCIA 4V02A 1UOOA 2COEA 2WG0A 3DULA 3IEUA 5K4HA 3AOEA 2Q4DA 1SOAA 5EJ6A 1D6NA 1QHNA 3WYNA 1UDCA 1Y89A 4EFNA 5IJ0B 3ZD7A 1RWVA 1GD1O 3LW7A 1P0QA 4M0KA 1VPWA 5CB0A 1JLLB 4ZT7A 1IXKA 2MMGA 3DZIA 5CURA 5F7JA 3GVPA 1I2AA 1P5FA 5KO2A 3R3XA 1PJ3A 4LF5B 2WOOA 4B35A 3RYIB 3HACA 4B6FA 4PCVA 3NLLA 3ZKWB 3P1JA 4QICA 3QF4B 4G5XA 3P27A 2B5VA 5EQTA 4WKPA 4KIGA 3PFGA 5IABA 3NTQA 2E3JA 4Z1OA 3STYA 4LRWA 4E5KA 1WWKA 4G2TA 4AY6A 1HDCA 4RVGA 1Q15A 1UBRS 3CBGA 3EMKA 4NMWA 5KBYA 1F0PA 3BH7A 4XEHA 4GLLA 3SNHA 4CM6A 4ZK2A 1CV2A 1X6VA 4Q7JB 3C3AA 2ARKA 2J5XA 5LQDA 5FAKA 4CV0A 5JWRA 1JLRA 1GZ4A 1VP3A 4JIMA 4KQCA 4Q7LA 4EW6A 1LVUA 3ZQUA 3H5OA 4UASA 2X2PA 3SOZA 3H19A 4PQFA 2BGLA 1ODLA 1M6VB 2D59A 3QLUC 5JDIC 2B1JA 1S3IA 3EFOB 4CN9A 1FTSA 2B78A 5CB6A 3TGLA 2I7CA 3E0QA 1AM4D 1AE1A 3ABRB 3D81A 4KYIB 4YUYA 3C1OA 4FM9A 1CUVA 2A8YA 4MRSA 3SP1A 1Q1NA 1Y6RA 4NHOA 4BBJA 2P35A 4FSHA 3JY6A 4IJQA 4W7IA 4BTLA 4E33A 1D4AA 1D1TA 1QF9A 2IY9A 2VF4X 2Y1LA 2ZJ8A 4S0XA 3C16C 3JQGA 4UPEA 1UQTA 3GOHA 4EYQA 4COKA 3I04M 3WLPA 4HVCA 4DJEC 3THYB 2X8JA 1OFHA 4WFIA 1O0CA 2V0GA 1LH0A 2FK7A 4JL6A 4URYR 5J5AA 5FBHA 3QEBZ 3GROA 1P1IA 5KNDH 1XMQB 3QFFA 4B79A 2G70A 1BN7A 3LDAA 5HJ5A 3TVYA 3KL4A 2CCJA 5CFMA 4CR8A 1FJXA 5FL7A 5IM4F 2IBMA 4G8CA 4E32A 5LU9A 3TGWA 5I9BA 1ACMA 4K2AA 3C3CA 3IUMA 4L4RA 1KJIA 1RAIA 2GWHA 2AMLA 5AVSA 4CKYA 3WQBA 3MAGA 4ZIRB 4E6EA 2IGBA 3MLEA 1F7VA 1BYIA 1WPQA 3GEBA 4B33A 3E22A 2BZSA 3F6CA 3IP9A 3S28A 4YMVA 3ROZA 4IINA 5BT8A 4AAYA 3GT7A 4ODIA 2O8BA 1PJSA 2IXBA 4K03A 1G3QA 1ZOSA 3L01A 4J03A 4UNRA 3IO3A 8AT1A 2ORIA 1V5GA 1QVRA 4FIZA 4G65A 1RXEA 3FKQA 1YBFA 4Q1BA 2QRMA 2VYVA 3IIJA 1P7ZA 3QA3E 4NE9A 1XRPA 1MH1A 2RGNA 3WWCA 5AESA 2AOTB 3GLSA 4OMUA 3ZE9A 4BB0A 1TU0A 4N3AA 3VQTA 5C37A 2JARA 2O5VA 2SKEA 4DMFA 1EK0A 1NOKA 1B0UA 3FMVA 4OI0A 2OGWA 4CIBA 4RKEA 3UAGA 4JR1A 2CUNA 2JZCA 4I46A 2XWBF 3U60B 2C7GA 3U7HB 2X5XA 3DUWA 3V33A 4C1BA 2WYHA 4LOLA 3E23A 1X9GA 1IBCA 2HWUA 2VJQA 4G4GA 5GVSA 5TIIA 3BYZA 1ZD4A 1JXMA 2CNBA 3AH8A 3AKDA 1LZLA 2WJ3A 4OFZA 4TL6A 1IJEA 1SC3A 3H2HA 1DDIA 4WESA 4LRTB 3LPLA 5CLGA 4XIYA 3X3HA 3QQ5A 1K8ZB 1WXXA 2B34A 4HBGA 1JT2A 2Q6TA 1OXKB 3LLCA 4TRMA 4PF1A 1S5PA 4KWEA 4R81A 1J20A 3QYPA 3V7WA 4BLSA 2YMPA 4O0LA 2OECA 3IVRA 2OVBA 4A92A 3SYLA 2QPLA 3F7OA 2GYWA 5BSFA 5MN6A 4BGVA 4Q4JA 5DGXA 1PL0A 5JYCA 4U7WA 1I0IA 2PR7A 3CW2A 1VBMA 3KVNA 3C98A 1B42A 3NYQA 4UATA 1XZEA 3MYRA 1U8FO 1JPVA 2V6JA 1E2UA 2VF8A 3OCXA 1X77A 3ZXUB 3CINA 5HA5A 1B93A 2PMFA 3S2ZA 3PIDA 4DQUA 2AK3A 3UATA 2R8PA 2JGIA 1GTVA 4PSCA 5ARDA 2I4TA 4PO8A 3KU4A 5DGIA 4TYYA 1MNQA 2D13A 2DCMA 4XYEA 4ZA2A 3S70A 2YHUA 3VU3A 4NMLA 1Z6YA 3WB2A 3E5RA 2F8SA 4DBLE 3RTBA 1Q12A 3C6YA 1NXOA 2JF0A 5JNVA 1KQNA 2AEMA 2F3SA 2GTHA 3D6FA 1CKEA 3NU1A 4QOJA 1NZJA 1XD2B 1Y37A 1Y5LA 5T8KA 1AH2A 5IXJA 2NADA 2H1WA 2G07A 2HNAA 5J4LA 2CL5A 3OCUA 1AKYA 2ZUEA 1JFVA 4Q7QA 2RBKA 4QGBA 1WHTB 4WASA 3ERCA 4RV4A 1K92A 4ZMSA 2EVWX 4GFDA 3WLSA 5AKJA 5GGXA 3D6AA 3JD0A 2BM8A 3VZRA 1HE4A 1X14A 3G5AA 3QVUA 1B73A 2PUBA 5CCDA 4JT9A 1W0CA 5ES4B 3RYCA 1L6IA 5CM2Z 3WRXC 1Z0AA 3PZBA 4DM4A 3RU9A 3UAOA 4ZYYA 1DG9A 1KVUA 1W88A 3ZG6A 4TQUS 1QU3A 1XNGA 1SVNA 3CEMA 3COPA 4KFRA 4K9MA 1E8DA 4KZKA 1Q44A 5IZCA 3VGPA 3HE3A 3DFIA 3I42A 1OAKA 2CNOA 4NJOA 3U7IA 1GSHA 3EQ2A 4XGNA 5KJCA 3PE6A 4HRYA 4DLYA 1ZFNA 1GITA 1HORA 2ZQZA 3T7IA 1YR6A 4MR8B 1XCBA 2BTOA 2NU8A 1HETA 3OPMA 3GLIB 2WFAA 1K6XA 1G18A 2ZI9A 2GZ3A 3C1AA 3CJRA 4KE9A 1JN0A 2CVZA 2RFLA 2JNWA 3M4ZA 2R8RA 1ND6A 3KUXA 2P11A 4LOJA 3OLVA 4UCFA 1Z12A 3PNMA 2ADMA 3A1TA 4O2LA 3T54A 3T1TA 5KX5A 1T1GA 2IYWA 2XNCA 1QOZA 2A9FA 2H2WA 2QRUA 4KAAA 3IT0A 4RIHA 3RS3A 1YUNA 3F6SA 3TQHA 2I0FA 3IPRA 1FDWA 3QFSA 2WWHA 1E94E 3OOJA 5JG7A 1LC0A 1UADA 2RGYA 2H1IA 1P62B 2UUBB 4JI0B 4I5DA 4YMUA 3DEFA 4P80A 3G82C 4OA5A 4BATA 1L5MA 2Z30A 3VBEA 3EASA 3QVTA 1JQ3A 1JDVA 1YQWA 2P0YA 2WIDA 2Y9PB 2YOFA 2ZAMA 3HI6A 3SYRA 4E2ZA 1QPZA 1GUBA 4GW3A 4HL6A 4LWQA 2EZ8A 4X7MA 3FOCA 4S1WA 1K9SA 4N5MA 2WJ4A 1FFBA 4FFNA 3CLRC 4P3YA 3OAAA 4JXJA 1LJLA 1VPDA 4IJ6A 4RGBA 4X6LA 3QPAA 3DE0X 1GYRA 3LHKA 4KPYA 4JZYA 1C29B 1I36A 2DPGA 2WIGA 3OD5A 4OP3A 1XVIA 4RORA 1Z6XA 1ETHA 4XQ9A 4LJKA 3NIGB 5CNMA 4DIMA 3OICA 4A2PA 2ZTMA 3UTDA 1DV2A 2X76A 2R86A 1R6BX 3DWIA 2PVSA 3HLKA 2VP2A 4GECA 4OHCA 5CB4A 4BNDB 4MVWA 5ES3A 2OT3B 3UUWA 1FZTA 4F4FA 4AUMA 2EW1A 2NT4A 1QGED 1KH1A 1XKQA 2GF2A 2OV4A 2WWWA 1TOAA 2F17A 3QLEA 1STOA 3KSRA 1OB5A 4L07A 4L6CA 2C54A 4DGQA 4DG5A 1CRZA 4AP9A 3LX8A 1ADCA 2DM6A 2A5YB 2ZRKA 3HJCA 5DMXA 4HQ6A 4OO3A 1JH9A 3P2MA 2D62A 3ROPA 1M1UA 2FZLA 1UT6A 2X1MA 4F92B 2AZDA 3RYFA 4DS3A 4F21A 3QTBA 4MO2A 3B51X 3O73A 4AJ1A 2WTXA 5GOTA 3CG4A 4Q66C 3N70A 4PV7A 5LMUB 3DBLB 5DHSA 2F9MA 2JEOA 2IZZA 4KLRA 4ND7A 3H84A 5JTTA 4YALA 3N7UA 1Z88A 5H3LA 3R41A 1K75A 1DAOA 4DMLA 2OCLA 2Z1NA 1CY7A 1DAEA 2IEYA 2IJGX 4YQFA 3PI7A 1JAIA 1SC1A 4IXTA 4QT4A 2AOUA 1T29A 2JIBA 4ZICA 4PR0A 1NKTA 1U9YA 4R8KA 4NARA 4Y9UA 2OWEA 1RSZA 4W6QA 2ZI7A 4ZO6A 3T4XA 3W7VA 1IZ9A 2XTZA 2D1FA 4HMQA 4HDNA 1OLXA 2YWBA 2WAOA 4B09A 1R4MA 3OIUA 4LF9B 3IERA 1I7PA 3E61A 1NMSA 1JIQA 2JJMA 3EVFA 5J3JA 1N2OA 4UDXX 1B41A 1L5FA 1OASA 2WA2A 1S02A 1RXIA 2HDOA 2R68A 3DDWA 2W8ZA 4M8KA 4KHZA 4R3WA 3ORFA 3WRWA 3ZZMA 1W94A 5IS2A 4TYPA 5FTKA 1U8XX 1E69A 1WBBA 4IYJA 3T0IA 1COZA 2CMGA 3EA5A 3L4BC 5EWJB 5BR7A 2JRCA 5DE3A 4BY9E 2M2IA 3OEED 2RSLA 3F96A 1ZZGA 3EEYA 4X8OA 4Q9KA 1X7DA 3BWDD 1JQJC 1UJ2A 3PGJA 4DXDA 1VL1A 1IBMB 2WSSA 4R6XA 4M88A 1HZJA 3CKMA 1MHTA 4HRAA 3WGGA 3L43A 2I9PA 2BKAA 4PSUA 4CBVA 3JVEA 1N32B 1UIRA 3BB4A 2A9QA 2GPYA 4Q00A 3P9PA 1PFVA 3S4YA 2DHEA 4U7PB 2YZMA 3C6KA 1N2CB 3JVVA 3QNUA 3PJRA 4PPYA 1JB9A 1NDQA 1GGVA 3WQQA 3G2NA 4ARZB 3KQQA 4Q9AA 1MNAA 1Z5ZA 5BN1A 2C4UA 2FEPA 4ZDJA 3BMQA 1O5OA 1WMEA 3RVBA 2HLPA 1Q2XA 3R6TA 3ZUPA 3BJMA 3D8BA 4MICA 2HRCA 2FN8A 3CLRD 3QWHA 3I9V1 1THZA 2A3RA 3FCAA 3NV7A 2Q99A 3LKBA 1SRRA 1PZEA 1P75A 4GMGA 3TOVA 2HHHB 1QQ7A 3H7IA 1GN8A 4YJGB 4BDSA 3CE6A 2R47A 3E05A 1EEHA 3TQFA 1SPBS 2QMZA 3QWFA 1G42A 1RPJA 4RO0A 3ZHUA 3THWB 1KFCB 2HU7A 1EZ4A 5UKDA 3LOPA 4MKGA 4EFMA 2VZ9A 4TRRA 2XSZD 2XGSA 2OXFA 1IVYA 1LBQA 3RRZA 1J2TA 4HNGA 4I4NA 2Y0BA 2E4WA 4I4LA 3FSRA 5F3DA 1T1RA 3TE6A 2NUPB 1U1CA 3EVDA 5DYWA 2WZCA 1FS4A 1N9ZA 1AKTA 5H02A 5B2EA 1P7CA 1XDSA 4HZIA 1HMPA 4NCBA 2HWYA 4KXFB 4IHJA 3K7EA 3TTUA 4ND8A 3WE7A 3H6KA 1ZH8A 2W2KB 4HUQB 1PP4A 2VBIA 1XLTC 3CM0A 4URZR 2I5PO 3OWHA 1MEJA 3RUFA 1IHUA 4QM6A 3S2GA 1Y6FA 3M1YA 5DCUA 1EE2A 1ZGCA 3HB4X 3OPNA 1TCCA 3WYFA 1JKMA 4D0SA 3JAWB 5B1SA 3AR2A 2V0NA 1XU4A 3ETLA 2GCNA 2X0EA 4MB6A 2PV7A 4GC9A 2O3UA 2HSJA 2YJ4A 4G1MB 5EJ2A 4A26A 2XRZA 1JFFB 2DWUA 5EJ4A 4TV8F 4XKJA 1PU2A 3RPEA 3SU8A 3ZY2A 5ED0A 3TEFA 2QRVA 4A2WA 2I7DA 6REQB 4V1CI 1FVXA 1ZRNA 2VP3A 3A6DA 3BEOA 4P4NA 1Q17A 5K45A 2D5LA 1T5DX 5FNVA 4OMDA 1TZ2A 2H18A 1YBAA 3AF5A 3MLBA 1OTXA 2XECA 3TLGA 2C98A 2D5AA 4OY3A 2FSIA 2NTYC 4PLPA 4RYDA 1FTGA 3OKPA 1ICEA 3R44A 4XOUA 1RLMA 3IAM6 3RT7A 4DDVA 1P2VA 1WXGA 4NFLA 1UBHS 4Y9SA 3UYKA 2YIDA 3VYSB 1PNQA 3LT0A 4Y2PA 4NCKA 5DTMA 1IBSA 4D56A 1G2PA 3EVEA 1M54A 1LK5A 1BC5A 2QT0A 2W6NA 3PQ6A 2IOHA 2QOEA 3V00A 3VGJA 2GI4A 1NC1A 4W5QA 4HLUA 2VT7A 4Q24A 2QQ0A 4AO8A 3LAWA 3EPJA 3QVOA 4BU1A 4CETA 1L1FA 2WVGA 2AIRA 1QYDA 2ZG6A 2XCRB 1TQ4A 3IUNA 2ID9A 2YC2C 3LBYA 3WMRA 2Y67A 1A0OA 5EEGA 4RVOA 5AKYA 1FSZA 4ND5A 3BMNB 1XQ6A 3LFTA 4E15A 1MAHA 1S0UA 4FUQA 1Z2AA 3QZUA 4WJZA 1NKVA 1OGJA 4OHXA 3QU9A 4GI7A 1MRSA 4OAPA 4WZZA 3VPAA 4EB6B 3ZHRA 4R1LA 3C70A 4X6UA 5HE9A 1KNQA 2BEVB 1EZ1A 2I6SA 3A4MA 3K30A 1TUBA 5DHUA 4ZYUA 2B6HA 4HQ0A 1DXYA 3DEJA 5CFRA 1FW8A 1BHJA 1VKZA 1H2HA 2RHLA 2OENG 3KQSA 1L4BA 4MINA 3SXUA 4ZGGA 1JEYB 4FMCF 1G2QA