2GILA

Structure of the extremely slow gtpase rab6a in the gtp bound form at 1.8 resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
161
structure length
161
Chain Sequence
FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-6A
publication title Structure of the extremely slow GTPase Rab6A in the GTP bound form at 1.8 resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 52
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gilA00
5J4KA 3ADDA 1CBUA 2NO1A 5AJWA 1EFRD 4A9AA 4Q47A 1T9HA 4DJTA 1Z07A 3WMEA 4KVAA 4GL2A 5SZJA 5F2EA 3AKCA 3TR0A 1UKVY 4Q7MB 1VIYA 1ZD9A 1E9CA 1TUEA 3T5DA 3CONA 1XJCA 5FTLA 1PUIA 4EPVA 1KI1A 3U4QB 1EXMA 3RC3A 3WNDA 5IDVA 5H8WA 3LWNA 5IF9A 4M8NE 1W2HA 1R0ZA 5EP1A 3K8YA 1AM4D 5IHPA 3DMDA 1MV5A 1FNNA 2GF9A 3TUIC 2G6BA 2IYLD 4FI3C 2QP3A 4AYWA 2VO1A 1WDTA 5F3WB 4TL7A 3HU2A 3AGPA 4RD4A 1EFRA 2QY9A 1JPJA 3IBYA 2GDJA 1M2OB 1N0WA 1E0JA 1MRSA 3L82B 3GFTA 3DHWC 1N5IA 1GP2A 2GJKA 1LTQA 3N2EA 3P20A 1FW6A 4OHWA 5FPKA 4R7ZA 2ASEA 1SQ5A 4KXFB 5B57C 3WNBA 4DLWA 2C77A 2XB2A 3RDPA 3SC3A 3UG7A 4E03A 4CEHB 3VR3A 3QY0A 4ZI2A 3G82C 4Q4HA 1OFUX 1KIMA 3AVTA 5F9FA 4GI7A 4B44A 3EIQA 5TB5A 3BFKA 2O8DB 4PAMA 3A37A 1NBMD 3QVUA 3TKLA 1G7SA 3KQKA 3RWMB 2ZI5A 3EPJA 1FOEB 2FF7A 3L0IB 1D2MA 1G291 4EQ6B 4Q9IA 4YXWD 3CW2A 1SVSA 4JLKA 4N0DA 2CVFA 1XTIA 1KZ7B 1J99A 4Q7JB 2O5VA 5BWMA 1MO3A 3K0FB 4LBZA 3GLGA 4B3XA 1O3YA 3OHMA 2RGCA 1P7CA 3A1VA 4TSFD 1Z63A 1G8PA 4I4LA 2ZJAA 4DLVA 2HXYA 1XNJA 2ZRHA 3EXAA 2EWVA 1T4GA 1W4AA 2HEIA 2HXSA 4Z51A 2P3SA 5EE1A 3LLMA 4B6FA 2VF7A 3EPKA 2QP9X 5DNYB 4HZUB 4KAXA 2B8TA 3EZ7A 4B3BA 4BEBA 3FFAA 2IYSA 1QHHB 5E3HA 1WBBA 1NBMA 4LJ6A 1NVVQ 3A4NA 4LJAA 3RSLA 3QIAA 2ZI4A 1P60A 2J0VA 5C46F 3ECCA 1GOTA 2PCJA 4YXWA 1VTKA 2RCNA 3TAHA 2FFAA 3M1IA 1E0AA 1EG7A 1GKYA 1KI7A 2ZETA 4JLVA 1RRCA 1DAKA 4XIGS 1J2JA 1YRBA 3HR7A 2X77A 3B2EA 4G5GA 1Q20A 1ZUHA 4RD3A 2X8AA 4QC2A 5E7IA 4AKIA 4G5RA 2ORIA 4TSFA 3TQCA 3I32A 3AUXA 3VFDA 5EQTA 1Q44A 1HE8B 3VR5A 2G88A 3B82A 4B3CA 1Z6GA 3TR5A 1DOAA 1P3JA 3QF7A 2QT1A 1G8YA 3GFPA 4TWZA 4TLDA 1KI4A 1P61B 1DG3A 1U98A 2YVUA 3AKEA 2OT3B 4LC1A 4GP7A 2GF0A 1KSJA 3FTQA 1ESMA 5FPTA 2NO0A 3RVBA 4AYXA 4KSBA 1I2MA 2IYYA 1OLOA 4PX9A 2AK3A 3LRPA 3TSOA 3K0AA 5KSOA 3U3OA 1W44A 2GETA 5LB4A 2VHTA 4LHZA 4KITB 3R9XA 3LBIA 4R71A 1JJ7A 1Z3IX 1W36B 1QG4A 1FL9A 2FA9A 3CH5A 4M22A 4ZCMA 2CCKA 3U5ZB 3TIFA 1CJKC 5KNBA 2AFHE 4EPTA 5KTYA 1FP6A 2V1XA 3D6TB 4HB3A 2GESA 1DTSA 1S9DA 1ZNWA 3B9QA 3GLFB 3N5CA 4G3XA 2PBRA 4YC7A 1UDWA 3U61B 3L0OA 5JJIA 2ZJOA 4LSGA 1D9XA 2CE2X 1LS6A 2WWIA 3MUFA 2ONJA 1N6OA 3MFYA 4BLPA 4ESHA 2WKQA 3GCGA 4GRAA 4L15A 3F5FA 2DB3A 1Q3TA 1E79D 3FHOA 1GRRA 2W0SA 1FTNA 4LBYA 4U5XA 5L3QA 1Q21A 4Q1AA 2H5EA 1NVWQ 5JWOA 4ZI3A 4NU0A 721PA 2BVNA 3THXA 2GAOA 2WKRA 4LPKA 4IOMA 1XX6A 1KO8A 1YZUA 2GBLC 3KJGA 1TPZA 5G53C 3WYAA 3BWDD 4M1SA 3X1XA 1X8KA 4NCKA 3UWKA 5HZHA 421PA 3F8TA 3A1WA 1NF3A 1SGWA 2GK6A 1RRFA 4M2LA 1YZNA 1OJLA 3ICQB 5FTNA 3T15A 2REXB 4Q19A 4AY2A 2O8CB 1AGPA 4BZPA 4JBWA 1HQCA 1IN6A 1YHNA 2G9NA 1VECA 2PZFA 3B1WA 4BGDA 3V4FA 4CYMA 1UPTA 4I1VA 4JVSB 1NKTA 3FPAA 1XCPA 4Q7LA 3KQUA 1ZM3A 1OIXA 3FFBA 1RZ3A 3QUSA 2OILA 1S2MA 4GP6A 5HR5A 1E79A 1BYIA 2ZPTX 2D2EA 4U00A 2NIPA 3HP1A 3NH6A 4A2WA 3BIFA 3T61A 4EUNA 2OUKA 5L3RA 1VG1A 3QE0A 1CJVC 1NN3A 3K70B 1M7GA 1N6HA 4BFUA 2IC5A 1T5LA 1KAOA 1XD9A 3RS2A 1Z83A 2AFIE 2QEQA 4ZDKA 5EJEA 3GJ0A 4OHYA 3JZMA 4JKIA 4NYIQ 4YONB 2GEUA 1ZVQA 5AJZA 1U9IC 1R0WA 4P32A 2KBEA 4KBGA 1XEXB 2QGNA 4CT4B 5K8UA 1F2TB 1D8TA 1R0XA 2PT7A 3VHLB 4WZ6A 5G41A 2WWGA 1HTWA 4PZZA 4DDVA 1KAGA 4YMWA 2YJTD 5DE3A 4HDQB 3H86A 4PTLA 3IO5A 3BAFA 5CLLA 2MSCB 3K09C 5P21A 1JJVA 1P5ZB 2F6RA 3NWJA 3PG5A 2VBCA 2AWNA 4TQUS 3NIBA 3GMTA 2BBOA 3L43A 1SXJD 3IPYA 5KDLA 3V00A 1XDBA 2QQ0A 4C0SA 3I8SA 1TADA 1C1YA 5TV2A 4JYCA 4KSCA 3FHCB 4I1SA 1GSIA 1IXSB 3LXRA 2GVDC 4B2PA 1E99A 3TVDA 4FMDF 1KY3A 2GBLA 4PZYA 1V43A 4ASUD 5JSZA 1NN0A 4A0RA 2J0QA 3LBHA 1JR3D 1YR7A 2XNDD 1HYQA 4XSHA 2WM9B 1H65A 1KI2A 2FJUA 4M9SA 1XXHE 3T1QA 2EFDB 4JLJA 2FSFA 4A92A 4DSOA 1KDPA 2WTUA 1SXJA 3LW8A 3K53A 3DM9B 4DCSA 3UXMA 3AF2A 2ZI7A 1YZKA 2H16A 5D3QA 4I1OA 1GL6A 2A5YB 4EDHA 1QDEA 1S1CA 5FOVA 3SE0A 3AM1A 4P4SA 5C2JB 4NHOA 5HCNA 4DLRA 4C0BA 3PUZA 3MWKA 1N6IA 1E0KA 1ZAKA 3N2IA 4IEEA 5EZ5A 4DT1A 2WSSD 4ARZA 2VLIA 3RANA 1QHSA 1Z28A 2R6AA 4NCJA 4EAQA 3KKMA 4BFYA 2FZLA 3QXCA 4A82A 2R62A 3R8CA 3U3MA 1G3RA 2HF8A 4JSYA 3GLIA 2OBNA 4O2LA 3P32A 4TMTA 4Q1CA 4ASUA 3TW8B 3PUWA 4RKEA 4QL3A 1YZTA 4Y0AA 1DVRA 1JR3A 4BFWA 3AVUA 4WZBE 3W9YA 2XNDA 4C0KA 4GNKA 2BV3A 4UNNA 4V0LA 3HPQA 3NHBA 1U9IA 3GJ8A 2CL0X 1ZUNB 3IQXA 2CL6X 2CCJA 4L8GA 5LPNA 3BFXA 2A5DA 2C95A 1XMSA 1SVKA 2GCOA 3E70C 1IXZA 4Q1EA 4BZQA 4EFNA 3CNOA 1H8HD 1LS1A 1G64A 4DCTA 4C4PA 1FX0A 1Z8FA 3QXXA 5HKKA 1X8JA 5FPYA 2CE7A 4B3GA 4F7WA 5KSYA 1N5KA 2B21A 4XVRA 4KODA 3K9LA 121PA 2V55B 4D81A 4AWXA 2WSSA 1XFAA 4XWAA 1RJ9B 4LYJA 2VPPA 3AVQA 1KK1A 3K09A 3IPXA 3THYA 1XZPA 4BLTA 2FMXA 3MCAA 2WAXA 1SVOA 3HU1A 2XX3A 2JLSA 4DLYA 2IUUA 3GJ3A 4I81A 1EFCA 2ZYWX 4UJ5A 1NVUQ 4M1TA 5EE3A 3ETLA 1UKZA 4H1VA 4HLQB 2EYQA 1HT1E 1FMLA 1U2RA 2XXAB 1GNRA 1BYUA 1E9SA 2IHYA 3LW7A 5DISB 4QGFA 3FMPB 1OFTA 3V9PA 1OH5A 4TLCA 2OCPA 1H8HA 3A8TA 1X6VA 2ZRCA 4BFZA 1KK3A 4A0GA 2ZAOA 1K8RA 2VSFA 2W83A 1XPRA 4NYIR 4TT3D 2IF2A 1SKQA 3KKPA 4TMKA 1YJ5A 4RJLA 1D9ZA 1NLYA 5CDFA 3VR6A 3I62A 2GCPA 2FNAA 4POAA 5FUYA 3PVSA 1IAQA 2DFKB 1KJZA 5LB2A 4FMDB 4E22A 1IBRA 2ECKA 2D06A 3OAAD 5J4YA 3BGWA 1KY2A 3RRNA 2D3WA 4CIDA 1BIFA 2YHSA 1P6XA 1NSTA 1TU3A 4ZCIA 4LYHA 4EPRA 1U8ZA 1DG1G 2EWWA 4L5BA 2RGEA 2ZS8A 1CF4A 4JS0A 3CM0A 2OZEA 3ASZA 3QG1A 3I4LA 4KYIB 2KB0A 4R2HA 3VKWA 4D2IA 4TT3A 1W48A 3MAAC 1U8YA 1XCMA 2V6JA 1KGDA 2WPDD 3WXMA 2QROA 4NKRA 5J4LA 2PLFA 621PA 1W4CA 1TTTA 2I4IA 1Q1EA 2Z4SA 4GT1A 3RWOA 2H92A 5FOTA 3IIKA 5EE5B 1XMJA 2PL3A 2ZRMA 4XOIA 3GPLA 1ZIOA 1NJGA 2GILA 3OAAA 4PPQA 1HEIA 4XWOA 4P3YA 3NHAA 2BDTA 1ZNXA 4NTZA 1T8TA 5FUWA 2XTMA 5G3YA 3SI7A 1W4BA 1S9HA 2OG2A 1G4UR 2BEJA 2FV8A 3REFA 2F3TA 2WKPA 3DM5A 1OYYA 3ZZ0A 4A36A 3T1OA 1PLJA 1DEKA 2WWFA 1JB1A 3ADBA 1XTSA 2AR7A 3I72A 1BS1A 3CR7A 3BB4A 3RYTC 4MGKR 3VU9B 1W36C 4CEHA 1FTSA 1DAHA 2WPDA 2QRZA 3A1UA 2IS2A 3U2QA 2A30A 4LY6A 1TF2A 2W58A 2WHXA 4MGIR 1US8B 4TTPA 1RE0A 2WIAA 2O8DA 4Q02A 1T3SA 4ON9A 5JCPA 4FWIB 4B3FX 4QG7A 3X1ZA 3VHXA 1VMAA 2OO7A 2L0XA 4P0TA 5TARA 3WBKA 3SQWA 4EQ6A 2IS1A 3PJRA 4URUR 4IOJA 1P4SA 2J9RA 3NTUA 3RABA 3BERA 2G77B 1MO6A 2J5XA 1KOFA 3K0FA 4K8OA 3WRXC 4FMCF 4JBYA 4CVNA 3GJXC 1NSFA 3AF4A 4Q18A 4B71A 8OHMA 2RGAA 1F5NA 1G7RA 4YLGA 1ONBA 1PVOA 2GCNA 4E5UA 4KFRA 4OL0A 2XTNA 4ZCLA 2W00A 3VR2A 3CF0A 2ZVPX 4WOPA 2G0NA 4KI0A 4Y0VA 5J4HA 5CM9C 2VH5R 5HTKA 1KMHB 2C9YA 4QBFA 3OE7D 4HZUA 2XGJA 1EWQA 3LV8A 5FTMA 1QHHA 4LCBA 1AK2A 3AB3A 3FHTA 4F4JA 4W5HA 5EE9A 3RLFA 2MMGA 4LYAA 5BN4A 4GMDA 3H1TA 3Q7QA 5DH9A 1RPZA 3QPUA 4OK5A 1PLKA 1WE2A 4EJSC 3IEUA 2IS4A 1GNPA 1RKBA 4V0OA 1Q3HA 2OV2A 1W36D 5JS7A 2PCLA 2JATA 3NBFA 4TN1A 3SYNA 3K70C 3ICEA 4HDCA 1P2UA 4LZZA 1F48A 3AKDA 3LQQA 4HAZA 4CEIB 3FYHA 3AP2A 1E94E 1Z08A 1RYFA 2JLUA 4G5OA 1HE1C 2QSZA 2OLKA 4AKGA 4FN5A 3UANA 1TQ2A 2R6FA 2PLRA 4PO1A 4N1AA 4ACBA 3OE7A 5K8IA 1XRJA 4UJ3A 1KK2A 1O87A 1QBKC 3CLVA 1R8SA 1EFUA 2EFEB 3DKPA 2F43B 4I1UA 4JLOA 4JVNA 2E87A 1ZMXA 1AKEA 4Q01A 5CM8B 4Q00A 2DWPA 4ESVA 2BJVA 3UK6A 4LV8B 1L8QA 1OFIA 1G5TA 2DBYA 2V6IA 5DLQC 1HA3A 2IYZA 5E7JA 1W46A 1GNQA 4NONA 4DSUA 4X8MA 1YZQA 1G9XA 2Q21A 3ZD7A 1IONA 2P6UA 1SVIA 4PQRA 3QSYA 1SZPA 4N3NA 2ZI9A 1Z6YA 2PMDA 1N0UA 4G0NA 2ZJ2A 3SHWA 3BH0A 4RD6A 1N6LA 2Q3MA 3V4RA 3QEJA 2E9SA 3E2IA 2R6DA 3L2OB 5KU1A 2ZVQX 3FMOB 1A7JA 2R6CA 3E1SA 3RS3A 5B64A 2R44A 3GLFA 4DSTA 1NN5A 1UEJA 1G7TA 2IXFA 3SJZA 2Y8EA 4IHQA 3J81k 4QFMA 1Z29A 1K6MA 1ZC4A 2QP4A 3Q5DA 1WBDA 4GFDA 1TU4A 2QAGC 2H1LA 2ZQ5A 4B33A 4BFSA 1VKJA 2QENA 4RZUA 5JCZA 1VCMA 3CRQA 3L8YA 2A7QA 3MLEA 3AGQA 4P4UA 5AUPB 4CDGA 3QKSB 1Q1QA 2B7BA 3CZQA 4DBLC 3K0CC 4LRWA 2O8CA 5EXSA 3KXIA 4HB4A 4LPSA 3W34A 2ZRBA 4V03A 2IYXA 5GADl 3KKNA 2IYQA 2ZJ5A 2ZUCA 2FEOA 4FMCB 4ILEA 5GJBA 4L9WA 3PEWA 2QTFA 4Z1MD 4KVGA 4PSVA 4LGMA 5FOUA 2B92A 1KDOA 2VIIA 5GJCA 1UFQA 1R8QA 4MUBA 4TMZA 3ZQ6A 4IFEA 3I3SR 4MYHA 4V0ME 2ZROA 3W8NA 2O8EB 1KDTA 1JI0A 1U81A 1YKSA 4B75A 4GMXA 5EZ6B 3Q3JB 2RHMA 3NEYA 2N46A 3C15C 1PLLA 2P6NA 1R2QA 4PC7A 2X2FA 2F55A 3AEZA 3CB4A 4MRSA 2FEMA 2Q6TA 3ZH9B 6Q21A 1FP7A 1YR6A 1T0HB 4M9XA 4QGGA 4QKQA 1R0YA 2TMKA 2P65A 1OH6A 3ND8A 4NL4H 3QF4B 4IKEA 3BFVA 1AN0A 1IY2A 3KUCA 1VG8A 4IDNA 2BKUA 2ZSBA 3I5XA 3LNCA 4LV6A 1XEXA 2J0UB 3Q9LA 2HJGA 1F2TA 4IEIA 1W5SA 4G5SA 2ZR7A 4Z1MA 1LW7A 4YMSA 4DB4A 3FGNA 4L9SA 5H68A 2ODWA 2I1VB 4MA4A 4EIWA 2REOA 4F4CA 5EXXA 5SZIA 5FR2A 3BE4A 5C4GB 4BQSA 1ZM4A 4IFBA 4LHXA 1XWIA 2OEPA 4IW3B 2XITA 3C16C 3IGFA 1E2LA 4BZXA 3W3AA 1E1RD 3K9HA 2CLSA 4MITA 3ASYA 1U0HC 3OIYA 1QHNA 5TMPA 1UEIA 4NDZA 4QHTA 3HYRA 4O25A 4OKSA 4IVQA 1DAFA 2XJ4A 4WXRA 2D74A 5A4JA 2YWFA 4Q4AB 3PEVA 4BFXA 3SN6A 1Z0AA 1QVRA 3WNCA 3BD9A 2PH1A 1VPLA 4NH0A 2NMVA 3IIMA 3UMFA 1RYHA 1ETUA 2QT0A 2WICA 2EW1A 4KFTA 1ZINA 5KO2A 1GRQA 3DO6A 1A1VA 3PIRA 4FXPA 2JLVA 1ODFA 4GPTA 3THWB 3ZDQA 1KNQA 1KSHA 2YNMA 1UDXA 3BXZA 2VA8A 3K0CA 1XTQA 2OESA 3EZFA 3Q85A 2OM2A 4C7OA 1JXOA 3TVTA 2KJQA 3EWAA 3TAUA 3SNHA 1NLFA 1E1RA 3IBGA 3DZ8A 4P4TA 4UQOA 3CF2A 1AIPA 2ZITA 1M8PA 4QRHA 5AJYA 4LJ4A 4KBFA 3OEHD 4PFSA 1N6PA 2FG5A 4DLUA 2CDNA 4TL6A 3AKYA 1E4YA 4LC0A 4MYTA 4D0NA 2HT1A 3VQTA 3LH5A 4KFSA 1JNYA 4B3DA 1BH2A 5FBVB 1D2NA 1ZW6A 1A4RA 1E2JA 3DVLA 4JLPA 1Q57A 4RD2A 3VX4A 1XXHB 4M53A 4LUCA 3ZYCA 3E5HA 1GUAA 1T6NA 2PJZA 4CZ2A 4OK6A 1Y63A 3WRYC 1BKDR 2IYTA 3O47A 2ODBA 5B58C 5JHGB 1OB5A 3A6PC 3L0PA 4RCYA 2NZ8A 4LBVA 2C03A 4AURA 5KDDA 3OEHA 1OHHD 4GOJA 3FE2A 2BOVA 5FBRB 1Q1BA 3QG5A 2ZJYA 4IOKA 2X1VA 3A36A 2BBWA 1S3GA 3A58B 3WMGA 4R2IA 1RJ9A 2PT5A 2QU8A 3RS5A 1NY6A 4V02A 2P6RA 1N3BA 1PUJA 2JGNA 4HSEA 3BRWD 3QNUA 3VR1A 1JQLB 1P9RA 2OBMA 1E9RA 3EPLA 4KCGA 3LO5A 1S0UA 1E0SA 1SVLA 4XJXA 2ZXUA 3KQLA 2ZE7A 2KBFA 4QJ3A 3KJIA 4PPFA 3QQ5A 2XXAA 1G41A 1UBEA 1NP6A 2D62A 3CRVA 4DEYA 5DYGA 2GEVA 5C1BA 5DI3A 4G1UC 5AR1A 2W0MA 1G20E 2YC4C 4RY2A 3SBDA 4JZKA 3QKUA 2XSZD 1OHHA 2JJ2D 4Q48A 5EUQB 4AKHA 1OXXK 3C4JA 3M4YA 4LX0A 3NEJA 4BASA 1KI6B 2FE4A 3CNNA 4FIDA 2IL1A 2RB4A 5K8TA 3CPHA 1ANKA 3JVVA 3UATA 3BBPA 4II7A 4EJSB 1GDDA 3EIHA 5F9HA 3QBTA 1F2UB 3TJZA 4OYHA 5BN3A 5JECA 2ZRJA 1FPMA 5JBQA 2MSDB 2V9PA 1L7VC 4XH9B 1NIJA 1XTRA 1AS2A 1TNDA 1XZQA 2EYUA 1E3MA 1E9FA 1GKUB 2F3RA 1MR3F 4JT2A 1E9EA 1GAJA 1VCIA 1DBSA 3U3RA 1ZCBA 3SR0A 3AVVA 2NO7A 2OLJA 1JAHA 2QMHA 1NMYA 3ZLJA 1E2GA 4HUQA 1SKYE 4NCIA 2YYZA 2ZRNA 4MGZR 3REGA 2WSMA 2F1HA 1IJFA 2JJ2A 1TQ6A 1OYWA 2XSZA 3B1YA 4PR0A 1P73A 4WBSA 1I4TD 1L4UA 4OHVA 4C0AC 3OIVA 5FI1B 1CR4A 4IDOA 2PX0A 3K0EA 2QN6A 3DPUA 4GOXA 4B32A 4DXAA 4Q1FA 4WAUA 2QMEA 4F91B 4FW9A 2W6ID 5DHFA 3RRZA 5L3SB 2D7CA 2FOLA 3RC8A 2ORVA 1YZGA 3NXSA 1CTQA 3FWYA 1CS4C 4PO8A 4XWKA 4C0LA 3CH4B 4HAXA 3NDBB 4L16A 1ZM9A 3ZVRA 4UNRA 3U3KA 2XJ9A 2D4HA 2DWOA 2W2XA 1E9DA 4TQAA 1F60A 2JEOA 3IHWA 2ZE8A 4H1UA 2IW3A 4OHXA 2OHFA 3P27A 1GM5A 1CR1A 1N25A 5DI9A 2VP6A 3KJHA 1KSGA 4TTRA 1KJWA 2RH5A 3I5YA 4CEJB 3QEOA 1YE8A 2CCGA 1X1RA 1LF0A 3MWJA 3SFZA 2OFWA 1N6NA 2QAGB 3VU9A 4BECA 3BH7A 2YKGA 1UADA 1I2DA 3EX7C 4Q9LA 1A2KC 1N5JA 2CNWD 4QBIA 4TMWA 5DO9A 3U60B 3A1TA 4JT4A 4V0MA 1ZD1A 1QG2A 3NBZC 2PJRA 1US8A 2WOOA 3FB4A 2W6IA 1VYTA 5LD2C 3EARA 2FPMA 2XEXA 1NJFA 3CRMA 4RFVA 1NL3A 4PO9A 5G3ZA 1CRPA 3MJRA 1V5WA 1IN4A 5JMTA 1G8FA 2QM8A 2B8WA 2RMKA 4ITRC 3IKJA 4LV5B 5E7MA 5C18A 2IHBA 4KO8A 4EPWA 4AD8A 1G7CA 3PENA 1XEWY 4KU4A 4M21A 1WA5A 2W2TA 2JLYA 4AYTA 1C4OA 2GA8A 2Z43A 3EZ2A 5FBWB 5ANRB 4C9BA 2AXNA 3VNUA 1NVXQ 4M4SA 2C98A 2HT6A 4HB2A 5CYOA 1NMZA 1DARA 5HKKD 2Q9BA 4HLDA 3T35A 4WZAE 4BUJA 1HT2E 2EU8A 2F1JA 1FNMA 2VHQA 1HUQA 2CNWA 1LVGA 4BEJA 4YMTA 1KMHA 2A5FA 3CZPA 3UIEA 4DDTA 3ND9A 1OPXA 1UKYA 4WXPA 1EFHA 2WJHA 4ZDWA 3B1XA 1E1QD 2WJIA 1M34E 4KLZA 2D2FA 4PAQA 3GFOA 2RGNC 3LVQE 1YR9A 4IDPA 3TE6A 4C3ZA 1Z0KA 4CRWB 1VCNA 4TQ9A 1YU9A 2JA1A 3ZZTA 3DOFA 3QXHA 1S1MA 1IOZA 5DIFA 2VHUA 2WJVA 2OBLA 3U6KA 5J4VA 5B30A 4HYYA 4RZ3A 4CEIA 1E2HA 1ZP6A 2IT1A 2EFGA 3QXSA 2JLRA 2YWHA 3SJAA 3ZD6A 4PHGA 2DWQA 3TW4A 3FOZA 4W5WA 3GP8A 1N0VC 1XMVA 3IHLA 4QOSA 3I92A 3GLHB 1P62B 1TUIA 1XEFA 4C0JA 5M04A 2QZ4A 2H57A 3T12A 2F43A 1EFTA 3HR8A 4J0QA 4JLBA 4PAOA 4QNRA 1TX4B 3BC1A 4KV9A 2ZM5A 5HE9A 1E1QA 4D4LA 1LY1A 2C9OA 4W5JA 1XPOA 1KI3A 1OH7A 3MJHA 4A4DA 1QF9A 4MRRA 3TBKA 5GVSA 4NZYA 1TQ4A 2BBTA 2PEYA 1R10A 4H9GA 4FINA 2IA5A 2YOHA 1KKLA 2RGBA 3TSWA 3R9WA 3P4XA 1W0KD 2YWGA 5FBQB 4RFSB 1RC8A 3T1VA 1NI3A 1Z6AA 2KWIA 3LA6A 4KFUA 5KSPA 3T5GA 4PQFA 4BLSA 4URVR 3RAPR 1YR8A 2HCBA 3EW9A 1W0JD 2GJAA 3CBQA 3B78A 4A6XA 3O8RA 2JASA 2BM0A 1SHKA 2IWHA 1OF1A 5SZKB 1E2DA 4EPYA 2ZRAA 2GJ8A 2DHRA 1HY3A 4JIMA 3FKSD 1AS3A 4FCTA 2WV9A 2ZI6A 4MRPA 3SHFA 4D4MA 2ZUDA 2R9VA 1CJUC 3KKOA 1XJ0A 1ZCAA 3RRMA 4HI0E 3MMPA 3WP0A 1HV8A 1OIVA 4A2QA 5BN5A 5CITA 1ZM2A 3GJ4A 5FL3A 3QKSA 2NPIA 3CPJB 4DEXA 1W0KA 1GILA 3U4QA 2QPTA 2UZ3A 2GZHA 3HYTA 4M0LA 1OFHA 5BYJA 1T8UA 4DSNA 1XTJA 5FFMA 4BPBA 2ZSAA 2YINC 2R65A 2QG6A 4PHHA 5JRZA 2VP9A 1W0JA 1EX6A 1GVNB 1QZXA 4QBHA 5K8LA 2QL6A 3EC2A 1KTVA 4V0NA 3JVUA 1ZBDA 3IDQA 1KO1A 3PR1A 2QGZA 2WMNB 3AH8A 4W9MC 4B6EA 4EFMA 2QM7A 3FKSA 2HF9A 2VHCA 1FUUA 5AJXA 2E1RA 3X1DA 5KPJA 2RGNA 5IT5A 2O8EA 1JALA 4F4IA 3EASA 4R98A 3SEAA 2O8FB 4FWTA 3DMNA 3GLGE 1NNEA 1JEDA 2OFOA 4Q1BA 1P2TA 5SZHB 4E09A 1E2KA 3Q72A 3JZAA 2JJ8A 3WHLA 1IM2A 4RD0A 4TMXA 5F98A 4ABYA 4ZIRB 1AA9A 2P5TB 1XTKA 2V54A 2A9KA 2FX3A 3EA5A 3ZGXA 1NKSA 2B7CA 3LY5A 4ZV4A 3NH9A 4IDQA 3K9NA 1NBME 4AC9A 4EKDA 2J0UA 5KDOA 5A5GA 5BW8A 1OB2A 1SVMA 1Z0IA 2JJ1D 5JHHB 4QNMA 4D6PA 5EP4A 2QBYB 1DAEA 3BS4A 3DL0A 2FDCA 1AJEA 1E2QA 4CGZA 1CIPA 2UZIR 5AWFC 4Q9JA 2CEAA 1L4YA 1G3UA 3PEUA 1F3OA 3WP1B 4DKXA 2QNRA 4FD2A 1KO5A 1LFDB 4MGYR 2WJJA 2CLCX 1PJRA 3C8UA 1E96A 3BB3A 3IUYA 4Q7KA 4B73A 4C2TA 4QXAA 3L0SA 1E2EA 3OIWA 4E07A 4B2LA 1MT0A 521PA 1JPNA 4PC2A 4G01B 2FSIA 3IO3A 2V4ZA 5BQ5A 3WHKA 2VP2A 2NQ2C 4DLTA 1EGAA 1OT3A 1M6NA 1UM8A 1XU4A 2HLDD 2W6JD 4MRVA 1EWRA 4DLSA 1RW4A 2GXSA 1XD8A 1IQPA 2IXEA 2JJ1A 3L8ZA 4JL8A 4RD1A 3I61A 4Q4AA 2WWYA 1XB2A 1WB9A 4B35A 1NG1A 2GAAA 2GJ9A 2ZR0A 3TSZA 1U90A 3U7FB 3ADCA 4RSGA 1TL7C 3CPEA 5JWRA 3GLHE 1G5PA 1CR2A 4MKGA 2VP0A 2ATXA 3C41J 3A4MA 1WRBA 3THWA 1UKEA 1OXTA 3NDPA 5HCIA 1RFLA 4OI4A 3VKGA 3ZIAD 1GWNA 4HB0A 3W6PA 2WMOB 2FU5C 4HEJA 4Q4LA 5AUQA 1G1MA 5FL7D 3S1AB 2OAQ1 2QTVB 2HCJB 4KJZA 4RCZA 2VHJA 2HLDA 3EZ6A 2W6JA 3GLIB 1ZUIA 1I4DD 2BMDA 4NE2A 1TF5A 1E2PA 1E2MA 1U99A 2Q3HA 2RKOA 3LBNA 5D3MB 3ZS9A 4BWYA 4LDJA 2QE7A 1DPFA 2ERYA 3QI2A 1G5RA 1P72A 5EXTA 2C78A 2GK7A 4Q03A 2V3CC 1CR0A 1IN5A 4O0MA 3QBVA 3PFIA 4HZIA 4US0R 1CJMA 1FX0B 2HYDA 4L4UA 1M7HA 2GHIA 1J7KA 1XXHA 1CKEA 2FFQA 2QSYA 3F0TA 3K1JA 3H84A 3KXLA 1L2TA 1DELA 2BEKA 3NC1C 4DZZA 1MH1A 5J47A 3ZIAA 3DKVA 2Q9AA 1W5TA 1ZJ6A 2QPOA 5FL7A 2KI5A 2QMOA 2VL7A 1XPUA 1GZSA 2PMKA 1TEXA 5IK2D 4C0HA 1GFIA 2ZE5A 1VG0B 2FFHA 2QRNA 2BIFA 5LD2B 4Q4JB 1KNXA 4Z54A 4D25A 1W47A 1P9WA 4I99A 4UXIA 5TDHA 1GTVA 1G18A 1ELOA 4C30A 4YMUA 1DAIA 4OI2A 4ZKEA 1HH4A 3TH5A 2XZPA 4PC6A 1ZNZA 3WY9A 2XB4A 3O8DA 1NMXA 1E2NA 3WMFA 4DLZA 4LJYA 2PZGA 3DEFA 1J8YF 4G5QA 5BYKA 4QHYA 1G3IA 3KB1A 1AQYA 1ZM7A 3K70D 4LBWA 3MSXA 4BLOA 3LX8A 4HUTA 1WMSA 1SHZA 2A3RA 2XNSA 5ELXA 5FI0B 2D7DA 4LOAA 2CL7X 2HUPA 1NN1A 3QVVA 1X8LA 4OI0A 2OE2A 4RZXA 5IK2A 1T0JB 2H8KA 4TZ6A 4IVPA 3R8FA 4CT5A 3U7GA 2CK3D 2IYUA 3CRW1 2XZOA 3FMIA 1D5CA 1F6BA 1N6RA 4F38A 2FGJA 3I1FA 3CX8A 4US1R 3W6NA 1NLZA 4MYUA 1UBFA 3WYGA 1KI6A 2DFLA 4YQFA 1JXMA 1XBTA 3NBYC 4DDWA 1E4VA 5AK0A 1DO2A 1JR6A 1OSNA 3KFVA 2F9MA 4EJSA 3HWSA 1F2UA 5GJWC 1IHUA 4QM6A 1Z2CA 2QMUA 3LD9A 1ZU4A 3KL4A 3R7WB 3SOPA 1XD2B 2DR3A 3CWQA 1E9BA 3B5JA 5CJPA 4ZO4A 2IX3A 2CHGA 4IDHA 3UG6A 3PEYA 2P5SA 1W2GA 2QORA 1II8B 4NCHA 5KHOC 1VG9B 2GKSA 4KHZA 1IJEA 1P2VA 2IEYA 1P2SA 3BB1A 2ZRIA 1AS0A 5KOYA 4LK2A 5DYIA 5JRJA 1X86B 1Z0DA 4R9UC 2CK3A 1T3LA 2Q3FA 1IY1A 1N5LA 2JDID 3CKLA 1OE0A 1GG2A 1KYIA 3OFND 3QPWA 3F3YA 3NG1A 4XTRA 3TLXA 3CO5A 4XD7D 4F92B 4LJ7A 1G16A 3KUDA 3A4LA 3AVYA 4PANA 3MGCA 2W2VA 1KSFX 1XCGB 2R2AA 4GZLA 3HPRA 5L3SA 2DYKA 2G83A 2BM1A 4KLNA 4HLUC 5CIWA 5TY0A 1IY0A 1SXJE 4UKDA 5UKDA 2N1BA 3NVAA 5L8VA 1S3SA 1J8MF 1UJ2A 3D8BA 5J40A 3SDZA 2ZEJA 1SKYB 2ZYUX 3U44B 1S96A 1B23P 5FBLB 4C2UA 2EVWX 4Q21A 3B6EA 4U02A 3X1WA 2BMEA 3IIJA 4B34A 4B48A 1VYUA 3QJYA 4BRUA 1LV7A 2JDIA 4NYMQ 1AQUA 1P9NA 2BMFA 2ONKA 4BRWA 4CEJA 1EESA 1WXQA 1MRNA 3GLIE 1XMIA 2CXXA 2AKAB 2QAGA 3OFNA 2H18A 3QKRB 4HAYA 4URZR 2JCSA 4JLAA 4XD7A 3VNVA 2GRJA 1JR3E 2YOGA 3UMRA 1Z6TA 2GEDA 3RS4A 4ZDJA 2IS6A 5FR1A 2AD1A 2H7VA 4Q5IA 2XAUA 5CYPA 3W6OA 4TYNA 4M1KA 2V7QD 1UF9A 1LNZA 3QKTA 5AUNB 1MO4A 2KE5A 4M9ZA 1VDZA 3LVRE 5HZKA 2QI9C 4GOKA 1GKIA 2Z0MA 4O2RA 3EIEA 3P1JA 4B74A 3H2YA 1E9AA 3LFUA 4X8HA 2CBZA 2H17A 2VQSA 3C5CA 5JJLA 3UPUA 4FCWA 1RRPA 2AX4A 4OQNA 1CJTC 3GEHA 1W49A 3OESA 3GJ7A 1BMFD 1YRAA 2IBMA 2VEDA 2ZRDA 3DDCA 3IQWA 1NIPA 1RIFA 4JVLA 2C9CA 1I4LD 3O8BA 1GL7A 4WIAA 4QGHA 5JEDA 2ZRFA 3FMFA 2Q9CA 2C99A 3NKVA 2ZS9A 5KSZA 1G17A 5FPSA 2AXPA 2I1QA 2ZS7A 4URYR 4DIDA 1ZRHA 4X8LA 3AVPA 2HYIC 2JLWA 2V7QA 4QJ5A 1KI8A 4YDHB 5DN6D 3KQNA 1R5OA 3AP1A 4ZPXA 3MG9A 3ZJYA 3P26A 3TMKA 1TQDA 1XP8A 5JWHA 3U7EB 5CB6A 3ZQJA 2ODEA 3CR8A 2AKYA 1CLUA 4A1FA 1Q1ZA 2CJWB 2VP4A 2RGGA 1VHLA 3AQ4A 5DGXA 3DZDA 4A15A 2ZSDA 1T91A 4D80A 2WZQA 3PXGA 5CB8A 5CDFE 1LB1B 2FSHA 2GNOA 4OQLA 1BMFA 2FSGA 2J59A 3M6AA 4OI1A 3OEED 4OQXA 1DS6A 5TVKA 1W7AA 4DC9A 2AK2A 2VSOA 3PV0A 4M1WA 4BE7B 4A8JB 4JLNA 2V8OA 2FPLA 4HLUA 4MDFA 2AD5A 2ZAMA 3B60A 3C5HA 1G3QA 1MABB 4TYPA 2GXAA 1JQJC 1W4RA 3D3QA 4IJMA 4JMPA 2O8BB 3T06B 3CUEF 3GLHA 2FGKA 1Y3AA 3KTAB 1II9A 3QPVA 1CEEA 5AUOB 1S8FA 4TZ0A 1SVWA 3T34A 3OZXA 5DN6A 5G40A 3P4YA 4MKIA 2X2EA 2IYWA 5HE8A 3RNLA 3M0EA 5JFGA 1FQJA 1U94A 4DHEA 1ESNA 1OXUA 1R5BA 3RHFA 5FOWA 1VHTA 3R9IA 5GJVC 2ZRLA 2DFNA 1DAGA 2J7KA 2P67A 4P31A 4HLCA 4BLQA 5C4MA 2N42A 3PUXA 1COWD 4XTCS 4RFSA 2OCYC 3CRRA 1Z0JA 1Z5ZA 2O0HA 3LQRA 1G4AE 4TL9A 5FPHA 2ZUBA 3TNFA 821PA 4IRUB 4KYUA 3OEEA 3OIUA 1GL9B 2RHDA 2BWJA 3Q7PA 2AN9A 4OK3A 3KDSE 1LF5A 1VYVA 1P75A 4GBMA 2F9LA 1DE0A 2G0TA 4WW0A 5KYKA 3G0HA 3PQCA 1AZSC 4LYFA 3EAQA 1OV4A 4RKFA 4F93B 4UNSA 2BMJA 3AF3A 4CW7A 1HQYE 1BO6A 1ZIPA 4LHWA 4UXHA 4YDSA 1E69A 4JLMA 3RRYA 1YVDA 3K0SA 3MRSA 1K5GA 2ZYVX 1TAGA 1KI9A 1MKYA 4AG6A 2RAPA 2FZ4A 3VTKA 1CRQA 1SXJC 2AL7A 2A5GA 2NG1A 2LCFA 2PX3A 5CLQA 4M1OA 4P33A 3TK1A 1COWA 2P0EA 2FFBA 2ZRPA 1KZGB 3VR4A 2J3EA 3EWSA 5DHAA 4HAVA 3U7HB 4JJKA 2C8VA 4LWZA 5FUVA 3MWYW 1WP9A 1D2EA 5E4FA 4NYJQ 3PCRB 4NYMR 5JLJA 1B0UA 2OAP1 2REBA 2BCJQ 1WCV1 1BOFA 4O3MA 5FUXA 5TXGA 3IEVA 2QTHA 3GJ5A 2GXUA 3MWLA 2SHKA 2WWHA 1QHIA 2AHOA 3OF5A 4PQYA 1QRAA 4PPGA 3GEEA 4OHZA 4IVRA 4A0HA 4DUGD 3C14C 2VF8A 2Z5FA 4PHFA 3ZZUA 2O8FA 1GIAA 2ANBA 2WJGA 1X1SA 2J0SA 3Q5EA 3B8HA 2K5UA 4DIEA 4LI0A 4S2EA 4Q4HB 3X1YA 3TGPA 4JL5A 1U0LA 5FH9A 1WF3A 4ZIRA 1M74A 4D0GA 1YZLA 4K81B 2PZEA 2UVQA 4OJKA 1NVVR 3H4MA 3TUJC 2GZAA 1J90A 3SBEA 2CVHA 2UKDA 3ZVMA 2QBYA 2LKDA 5E95A 3GLGB 2C96A 2IUTA 1ZYUA 4W7SA 2ZYTX 4DUGA 1YQTA 1N2CE 2GJSA 5DSZA 3T1TA 2ERXA 1XF9A 3BK7A 1XJQA 2O52A 2ODNA 2QPAA 4PSKA 3SU8A 2WVJA 2YV5A 1TF7A 2QAJA 4MUAA 3D7MA 4Q9KA 3RSOA 4DWJA 4FCVA 2ZJ8A 2Z4RA 2EQBA 4BLRA 1II0A 3RS0A 4M1MA 4DRZA 3PUYA 2CHQA 3HDTA 2HV8A 1MO5A 5FTKA 2CHVA 4Z8XA 2HDNB 2BHRA 4U7DA 5JS8A 5J5CA 2Z6VA 1FZQA 4CF7A 4MKFA 3LLUA 2GTPA 4C7OB 2Q0HA 3KZ1E 3TUZC 4PSAA 1GITA 2AWOA 3D31A 4PZLA 2LKCA 5LBIA 2J1LA 1EX7A 2NOAA 1QHXA 2VYFA 1Q12A 4D4KA 1SULA 1OXVA 4US2R 1HURA 2DCUA 4JL6A 3CIOA 1E6CA 2WIBA 2NPFA 3S1AA 1GRNA 2LWIA 5KNCA 1ZC3A 3KB2A 1WQ1R 4JYBA 3GLFE 1PZNA 2OXCA 4HAWA 1AKYA 3Q8XB 3I73A 2ZTSA 1OW3B 3DOEA 1NY5A 4QHSA 3K0AB 4JLDA 5D3MA 2PEZA 2IUSA 3C7KA 1AGRA 2F1IA 2ZR9A 3ZVLA 1KK0A 1M7BA 1EK0A 5KUTA 2X19A 3KX2A 1A82A 2BC9A 4PC1A 3GD7A 2GXQA 5JEEA 1U8AA 2C2HA 4NPHA 2WOJA 4A0FA 1OKKD 1N6KA 5A0FA 2ZJBA 2DY1A 1OIWA 3G5UA 2O0JA 3W5IA 1E2IA 4N0EA 2OSBA 3CNLA 2NZJA 1K5DA 4RVCA 5JI2E 4PXAA 2OFXA 2IK8A 2MMCA 4D4JA 1S4QA 2EFHB 2J7PD 1Q0UA 3HJNA 2A78A 1UBCA 2A5JA 4WVFA 1G8GA 3PUVA 4XVQA 2FWRA 2ZJZA 3MD0A 2ZIAA 4JKYA 4DCNA 4AI6A 4MDEA 5L3QB 2F7SA 5JZVA 3BOSA 1D6JA 4Q4JA 3IILA 2GWHA 3THXB 4D0LB 4PHTA 2VTKA 1KKMA 3B9PA 3BH6A 4NYJR 1UAAA 3AUYA 3QXJA 4JVMA 4LJ5A 4URWR 4OQFA 4DB2A 1VIAA 5DI3B 2CMKA 1Q22A 2J41A 2NO9A 5AJVB 5FOSA 1QVAA 4AG5A 1A5TA 3FKQA 1KO4A 1OKKA 4LHYA 4M9QA 2EFCB 3AF1A 4TLBA 1FUKA 4FMBB 2BKEA 1OH8A 4MKHA 1CULC 4MH0R 1IN8A 5KPDA 1R4AA 4QM7A 2XZLA 221PA 2J7PA 4D26A 4IOLA 1VCOA 1G19A 1KDRA 2NGRA 2O0KA 2Z83A 3NC0C 1Z22A 4LHVA 3FDIA 2A2ZA 2ANCA 2ZI3A 4NMMA 3KKQA 3RS7A 2ZSEA 1TEVA 2GZDA 3KFXA 2OCBA 2IEZA 2VSXA 3BJIC 5CJ2A 3W8RA 1KJYA 2NO6A 2RGXA 4PPNA 4Q66C 4A6PA 3B85A 4QGAA 2KSQA 5H1YA 4EFLA 5LDDC 3GQBA 2ZE6A 1KMQA 2I3BA 4QJ4A 2JLQA 1A2BA 5FOXA 4BFVA 4V0KA 3THOA 2ZU6A 1T5IA 3AF0A 4UNPA 2BJWA 3LX5A 1W1WA 4TLEA 3R7WA 4HUQB 1Z47A 4B2IA 4YMVA 1IXRC 1XD2A 4LJ8A 2OCAA 2GVZC 4URXR 2B6HA 2DFTA 1CU1A 4XVUA 4JBXA 2C5LA 3WYFA 2HJVA 1DAMA 1II8A 2XOKD 1Z06A 5EP3A 3GJ6A 3AP3A 4HAUA 3AV0B 2FH5B 3QF4A 3CWZA 2J45A 4OBEA 3EC1A 3WBJA 1RVDA 3EA0A 1FMJA 1MOZA 1R7RA 4TYWA 2IWRA 1JAIA 1CP2A 3VMFA 1Z6XA 1AZTA 4MYCA 1C9KA 2YZ2A 3QOFA 3QENA 2DPXA 2JLZA 4ZKDA 2ZRGA 2WBLC 2R8RA 3AVOA 3UKDA 4A8JC 2R6GA 5L3VA 2XTZA 4B43A 1UBGA 3ADKA 1U0JA 2WWWA 1OXSC 3B1VA 5JJKA 3KXKA 5EXPA 1RRGA 1NG9A 1DO0A 1ZU5A 4AK9A 3I8XA 4ACAA 4S35A 4B76A 5CIQA 2XOKA 3X2SA 3U44A 3SYKA 3SJCA 3LAWA 4K46A 4OQMA 4TLAA 1TMKA 3AVWA 4TYYA 2V1UA 4DCUA 2WWXA 4UXJA 4XSGA 1KHTA 2BCGY 5JSZB 1E32A 5H70A 2IF0A 2G1JA 4NP6A 4DLXA 2QE7D 3U3JA 3CF6R 4Q1DA 4ZDIA 3QKRA 3SYLA 4IXMA 3VKHA 4RZ2A 1XEWX 4IXNA 4C0QC 1SXJB 4JJZA 2YC2C 4X8OA 4DDUA 1E2FA 4TTQA 2IYRA 3SJBA 2ZANA 5HPYB 2WJYA 1NRJB 3W90A 1G6HA 4P4SB 3ONWA 1G8HA 4EPXA 2J87A 1CXZA 3VX3A 5BXQC 3KQHA 2VRWA 3AVXA 4DT1B 1H8ED 5KNDA 4ARZB 4DVGA 1KO7A 3R20A 1ZD8A 1G6OA 3H0KA 2ZSFA 3LDAA 2NTYC 1DADA 3B1ZA 4HATA 3ZS8A 4A2PA 2ORWA 4GDFA 2RGDA 5JI3E 4B47A 1X3SA 4AKEA 3SQXA 3HU3A 2WAYA 4BFTA 5EUMA 4MQBA 2C04A 3VAAA 1G21E 2BBSA 2QA5A 3A1SA 3NBXX 4PC3A 5EP2A 1J70A 5CK4A 5B2ZA 4HDOB 3EPHA 2GCOB 1QHYA 1R6BX 4NBSA 3CX7A 3CX6A 2G1KA 3O8CA 1Z0FA 4M1YA 3B7GA 1T3HA 1ZNYA 2CLDX 1H8EA 2ATVA 4DCVA 3B13B 1E98A 4TYQA 2JIZD 4OJQA 2CJWA 3UMSA 3THYB 5GVRA 2J46A 3UWOA 2FPKA 3GEIA 2JAQA 1PV4A 2G3YA 1R5NA 2YOFA 4ERNA 3U6BA 2IXGA 2MSEB 1JBKA 3LXXA 5IRCD 2JLXA 3W5JA 4TL8A 2IYVA 5CK5A 2VP5A 5FTJA 4A8JA 2P2LA 1FFHA 4AIIA 5EE0A 4QBGB 1MABA 3EG5A 3FVQA 4MRNA 2O8BA 3TQFA 4GZMA 4Q9HA 1Z2AA 3BORA 4NCNA 3KTAA 1JECA 2QUZA 2ZREA 3ZVNA 2FN4A 2ZU0C 3N70A 3SZRA 4Z8YA 1IN7A 2OXRA 2ZRKA 4TMVA 3EZ9A 1JEEA 4D82A 3KJEA 1G3MA 3SFVA 3K9GA 1M1YE 1QHGA 4UNQA 3SS8A 2QQEA 2JIZA 4JSTA 1FQKA 2YWEA 3TRFA 2F1RA 3PITA 4WA7A 4GSYA 3W3ZB 4LJ9A
chains in the Genus database with same CATH superfamily
1MX9A 5J4KA 3C97A 3WFJA 1EFRD 4JBHA 3KM0A 4Q47A 3ZU3A 3L77A 2VJQA 3PFNA 4MVJA 1C7IA 3ETDA 3GJQA 4OHKA 1GXSB 4WACA 4H7HA 5EOVA 4QUHA 3WYEA 4ZMBA 1O96B 3GBPA 2E49A 1BQ3A 1UKVY 2SICE 2X40A 3NFYA 1VIYA 4YVFA 3H11A 3TSYA 3UQYS 5C7LO 2BFEB 1NW5A 1ZSVA 2B61A 3QVWA 4FFLA 4H0CA 3D1LA 3O1JC 3BSSA 4LC9A 4O2BB 4OQEA 3P94A 4EPVA 4M1ZA 1S3IA 4J0DA 3WNDA 2D6FA 4X64B 1OXMA 2QYSA 3KJZA 5IC5A 5L51A 4M8NE 2PJDA 1R0ZA 1L5WA 1OV6A 2QX7A 5JNSA 4ZVSA 5D01A 1XKQA 1AM4D 3UB3A 4TXHA 3TO5A 3M3DA 2O2XA 2HB6A 3EQZA 3TUIC 2K87A 4BIIA 5JNLA 3PIDA 5A62A 2I99A 4G9BA 2H9YA 2PIAA 4B4DA 4KQXA 2HOQA 4EZIA 2VJLA 5KOIA 5JALA 4UDOA 1GU0A 2VO1A 3LI2A 3I2JA 2VJMA 5GZ1A 4O5AA 1NF9A 3HU2A 3VZBA 3NT4A 5H83A 1RIIA 4J4HA 5IXJA 2XCTB 1U3WA 3R23A 4Q3CA 3IBYA 5FO0A 4DPLA 4LN1A 1PHRA 5BR7A 1M2OB 2NU7B 5H80A 5IVPA 13PKA 4G0YA 1E0JA 1MRSA 3U3DA 3L82B 4ZVUA 5DW0A 1G38A 2VJKA 1N5IA 3C3CA 1GP2A 2BTQB 1VCHA 3I28A 2KPOA 3QVGB 4ZPJA 4OHWA 3UJPA 2PMCA 5I3ZA 5DM0A 1EXWA 2ASEA 4NQZA 4YCNA 4RTKA 4B8YA 1WB6A 3WNBA 1NX9A 5EA2A 1D7AA 2FFJA 4J3NA 3A04A 3UKOA 3SC3A 1F38A 2Q3CA 3UJ8A 4JB2A 5AW0A 4DIBA 2WABA 1E1MA 3EHDA 2FW8A 3LDFA 2B4AA 4IGFA 5I8ZA 5HJ7A 3AVTA 5GTDA 1LI4A 1X0XA 1WCIA 5MDHA 1NBMD 2XRYA 2PRJA 3K20A 3QVUA 4IEFB 1O77A 1G7SA 4EMSA 1VE3A 3AUAA 3K72B 4BNMA 3EG9B 2ADMA 4QDKA 1YIDA 3L0IB 1G291 4YXWD 4Q9IA 2QT9A 2AMJA 3T7CA 3KYIB 5BSTA 2Y0CA 1LPOA 1OX6A 1WUJS 4NBKA 4QQKA 4R1OA 4YY3B 1OR8A 3O4HA 4GYWA 4BBPA 1N0IA 3E8SA 1YVRA 3PGLA 5BWMA 2VQEB 4NENA 5JY1A 2JFFA 5AXAA 5EKUA 1O94A 2H2GA 3K7EA 3A1VA 1S7CA 1G8PA 1EDBA 4F2PA 1G5IA 4N5DA 1XNJA 2EWVA 1W4AA 2HEIA 4Z51A 3LLMA 1RQXA 4AZWA 3CUVA 1W9HA 3FJYA 3KKZA 3KK0A 5DNYB 1AXRA 4ZYZA 1VMEA 1RZRA 2PT6A 2IZOA 5DX8A 1LBSA 3FFAA 4BEBA 2P9BA 5E3HA 4NC9A 1KEZA 4MUGA 4K0KB 1SQ6A 1NVVQ 3IBTA 5J2UA 1F1BA 3BJMA 5CCDA 3VPSA 1NUPA 2P5YA 2QX4A 5F1YA 5BN4B 3QIAA 1EUYA 5F1KA 3GD5A 5HDQA 3Q7SA 4XEUA 4ROSA 2PCJA 4HDMA 1RQGA 2JFYA 2FX2A 3OOYA 4KR2A 1XTZA 1PRYA 3KPYA 4WESA 4UOQA 4XRRA 3UWPA 1E0AA 1GKYA 3TJRA 4AKTA 1TU0A 4H08A 3KQYA 3TL2A 2BL4A 1QM5A 1D2HA 4GBGA 4BRZA 4ZI7F 5LVAA 4XDGA 4DQLA 1D2RA 3GPCA 3NUGA 1OQAA 1Q20A 2NP7A 4QC2A 1ZL2A 2X8WA 4P5PA 4G5RA 5AW9A 4MHSA 1QMGA 3QHPA 5EXDA 5AVXA 1ZJWA 3RUDA 1PWYE 2FPPA 4WXHA 2X15A 3ZC3A 2JAOA 1DOAA 4GLJA 4UZEA 4CXMA 1AHNA 3QF7A 1KJ9A 2V6GA 5HF6A 4TWZA 4RIHA 1P61B 4EG8A 1VXRA 4IJUA 2YVUA 4E11A 3QFRA 1WVGA 2HRRA 1WZ2A 4AYXA 4LZPA 3CVUA 1PFKA 1MC8A 4D4HA 4HR7A 5A05A 2B5VA 4KSBA 1DIHA 1SC3A 2OYCA 3TSOA 3WLTA 2AK3A 3ACDA 3K0AA 4OFZA 3SHOA 1M2FA 5AW6A 5DCUA 4BGUA 3VYVA 3R9XA 3P9SA 2ABWA 3LBIA 4V0SA 1Y1TA 4LVUA 4NZPA 3RUEA 4B79A 1DC8A 4OG2A 2CDRA 1TM3E 1NUHA 1O6FA 1XVAA 3QBJA 3CH5A 4M22A 4U3JB 4D3FA 2I80A 1YNOA 4D99A 2G82A 3PFFA 2B83A 2AFHE 1L7PA 3KOWA 1DRWA 5KTYA 1GYPA 2O2ZA 2TRSB 2WU4A 2BFCA 3RK4A 1HZZC 3IVGA 1WXEA 1W93A 1NOIA 2WU3A 2QRPA 5GIOE 1ZNWA 1QGUA 4N0PA 1RXUA 4YROA 4O4LF 5DGDA 3N5CA 4G3XA 4MICA 3HHPA 4YC7A 2B3TA 4BVFA 4KI7A 3BDAA 2WWIA 4YAKA 1XJWA 1ULBA 3JZIA 3VKFA 2UZ0A 3VJLA 3GCGA 5A5FA 1QRSA 3WL6A 1IZYA 3GA7A 3TX2A 2IOYA 5BRNA 4OHPA 5DRTA 2W0SA 5FWYA 4NPCA 1SXGA 4K26A 3LYLA 5LSAA 5JAIA 4RVSA 2GAOA 4LPKA 1GZDA 2OK7A 4PQGA 4RNCA 4EEKA 2X5XA 4TUYA 4M1SA 3X1XA 1X8KA 4LQ4A 3H13A 2C7PA 3DFFA 3F8TA 1ZUWA 3EIOA 3QP9A 1SGWA 5JH7A 1Q0TA 4I3GA 1TA0A 2GK6A 4S1TA 1PR9A 2EIHA 3IAM6 3VVBA 1S7GA 5CFQA 1OJLA 1EI9A 5J9FA 4YQEA 3T15A 2REXB 4BNLA 3QVTA 4HFRA 4CBVA 3H0EA 2G9NA 2PZFA 3B1WA 3ROZA 3D3WB 3A3YA 4JYZA 4D3DA 2OCGA 1XPOA 4I1VA 3W4JA 4JVSB 4DUPA 1E8NA 3LWBA 5FP0A 2OILA 5B3JA 2JRCA 4YCDA 3VR5H 1WW8A 1QAOA 1R6XA 4P53A 5CEJA 2NUAA 1E79A 1YQWA 2JJYA 3LUJA 1PT5A 3A14A 3N0WA 3OO1A 3SC2A 3RF7A 2JGJA 1UT6A 3NH6A 1XZKA 4GE0A 1A98A 3SOZA 5L3RA 1A3CA 1XTUA 1CJVC 3Q7IA 3C6MA 3QRWA 1N6HA 1I7DA 3K9BA 1CX9B 2GBCA 1F2VA 3AFNA 3CEHA 3RVOA 1AKRA 1QYDA 3ZLUA 4BFUA 5K0GA 1JU3A 3RHZA 5BR8B 2PYDA 2PUVA 1PYDA 3RS2A 1QYCA 3IJPA 4L4ZA 1QZUA 4C4SA 4DV2B 2LPMA 1U7OA 4OXIA 2QEQA 3DDUA 4OHYA 3JZMA 3JYOA 4NYIQ 2FP4A 2CJXA 3JQFC 4OCZA 3CG4A 4CETA 1GCIA 1M1YA 4P32A 2NSDA 2OXTA 2HMTA 1DRKA 4OKIA 1K8QA 4EO4A 5TIIA 3AJEA 1PQYA 1MG5A 3VHLB 5KNBH 1OWMA 5G41A 2WWGA 2IHNA 1GYQA 1IWPB 1YCDA 4P7GA 1GGHA 1YI1A 1G5HA 1HG1A 4YJHB 5EIEA 3DDZX 5DE3A 1GUFA 3A1CA 1D1SA 4PTLA 1XV5A 4EA9A 2YHIB 4KDCA 4EUEA 1ISIA 1FS6A 4FFMA 4ZVLA 3BAFA 1LSSA 3CGWA 1TIPA 4OBBA 3K09C 3SF8B 1NXSA 3SVTA 3EISA 2BHNA 4DTIA 2X5OA 5CJJA 2EV9A 2VBCA 4FFWA 4Z4IA 3NIBA 1DQZA 2I71A 4ZAZA 2MR6A 5CVDA 4GQBA 2BT4A 3MMNA 4DA6A 2CV1A 3IPYA 4WLNA 3KAJA 4NG5A 4NBRA 1AMOA 4UPEA 3DDWA 5AHRA 2R4UA 3B51X 4LGCA 1UXIA 2CFSA 4B0OA 1M0WA 4F97A 2QOEA 1TADA 3ILXA 2J07A 4E88A 1I30A 2FSSA 3G49A 3LVFO 1H2XA 4FOTA 3O73A 2I3ZA 3LXRA 4BP3A 1KVUA 2GVDC 3BDIA 4U2EA 2GB4A 1XMXA 3CZMA 1XYGA 2O9JA 2VKQA 4FMDF 3NAGA 4RFLA 2GBLA 2R5WA 3MGAA 1J24A 4BEVA 3HP4A 2QUAA 4DR1B 2JI4A 3I58A 1JHVA 1YASA 1J06A 3BX1A 3D8SA 4ASUD 4A0RA 2O07A 2QN2A 2EG5A 5BV2P 1U2PA 3ILYA 4WCFB 4G5HA 3FVWA 3OI7A 3P9ZA 2UXBB 4EHAA 2FJUA 5ESXA 4LGYA 3IOCA 5FLKA 4M9SA 1XXHE 3SHTA 2FSFA 1ZBQA 2H52A 1QZTA 1PAUA 2O3JA 2Z9CA 3QWHA 3LW8A 4Q82A 4CUKA 1WOMA 1NVFA 4HADA 4KJXA 1V4VA 4AU1A 1K4KA 3L40A 4FEEA 4K6FA 3AF2A 1YZKA 2H16A 3ENQA 3OPQA 5D3QA 2A5YB 3WGNA 4WE3A 3R0XA 4I1RA 3SE0A 1WCWA 4FOOA 1FFYA 3ZGYA 4GKAA 2Q1YA 3PUZA 16PKA 1JAXA 2OORA 4BC1A 3RW9A 1DCMA 2G8NA 3A11A 2VLIA 4V2UA 3D6HA 1QHSA 2ZWMA 1T13A 4EAQA 1IOWA 5C9ZA 2I65A 3CZAA 3QXCA 3KYCB 4NG4A 2I78A 3OY7A 5C0OE 4BGEA 3GGPA 3G0OA 4JSYA 5IAAA 3H8WA 5KHLB 3O8NA 3LC2O 2MINB 4Z4FA 1O6CA 1GPWB 2XKJE 1SZDA 3TQTA 3ZW9A 4C0KA 1WXFA 4LDQA 4S1PA 5IEBA 1Q6ZA 3OECA 3NHBA 1N2IA 5BVGB 3IQXA 4ZU3A 3L79A 4HEHA 2DTXA 1Z12A 4UULA 1K0UA 3B38A 1CS0B 3EAGA 4ZVKA 2C95A 1UP6A 3M2TA 1SVUA 1QGED 2B1GA 4D97A 1N5MA 3CNOA 1H8HD 4UEWA 4WH0A 3UWSA 1G64A 2IBSA 4RU1A 3VH1A 1JYSA 1VIDA 2H1IA 3TBFA 5FPYA 1N78A 2CE7A 4IFIA 1QC5A 1N5KA 4XVRA 3LS2A 4KODA 4XDZA 2I91A 1MUUA 2P11A 1NX6A 1QS0B 1W2WB 3NHPA 2WSSA 4P9NA 1XFAA 2H5JA 2OM6A 2PPLA 4LYJA 1TYCA 4H3HB 4XWAA 3N2GA 3T9BA 3VR6D 1GLNA 3IPXA 5CURA 3VU1A 1DIAA 1MQ9A 1D09A 2FWJA 1XZPA 2EZ9A 1D2CA 3BMNA 4JI2B 5FV4A 3KPJA 2XUJA 3R4VA 2I4NA 3MCVA 4XUCA 4NK4A 5I9SA 4A8HA 1RJWA 1EFCA 3PFGA 4YJGA 3WSVA 5EE3A 3LP8A 3WL8A 1SWWA 4BL5A 3GNSA 1KXZA 3CTMA 3G0GA 2FAXA 1PS8A 3NV9A 1BYUA 3PE6A 4UVIA 5LYJA 4KTVE 3B3FA 1TJ3A 3JQAA 1X7GA 5IJXA 1UC9A 2DX7A 3KQTA 3LTNC 1OFTA 1VPDA 1EK6A 3THRA 4O2AA 3LKZA 1HORA 3VSDA 1X6VA 3IP5A 4ZFNA 3EF0A 4A0GA 3O3NB 2P4QA 2VSFA 2JZNA 2QDKA 2W83A 3CVOA 1QF6A 4JYPA 1SKQA 3RYCA 4KPEC 2BMWA 4U8HA 4RJLA 1GN9A 1Z4NA 4Q15A 4HRYA 3VZSA 2JIBA 3QWIA 1QRDA 1C7RA 3GZTB 4CTOA 2GCPA 5AKYA 1AQIA 3I62A 1CZNA 3MOIA 2V7PA 4UFPA 3MTJA 5FUYA 3AG6A 5BN3B 5LOVA 2OBBA 1MJGA 3M33A 5DNUA 5ARBA 3RJMA 2EJTA 1PJ2A 3WV4A 4MZXA 4YMGA 2CGEA 1NVAA 5I7RA 4OQYA 1KJZA 4V38A 4E22A 5KJFA 2DRIA 2D06A 3ZGZA 3AM5A 1Z5WA 5CDGA 1JKMA 4PZDA 1DJNA 4E0BA 1HLFA 1NUAA 2FR0A 3RRNA 2D3WA 5FXMA 2WA1A 1ACMA 2P2DA 2YHSA 3EYWA 1U5CA 3GNLA 1P6XA 1NSTA 2BSQA 1TKBA 1YFLA 1XQ6A 3PDJA 1U8ZA 1Q0QA 1Y3FE 4JMLA 4LOLA 4LYHA 2EWWA 4GYKA 4O02B 2RGEA 2F00A 1IPHA 2IZ0A 3GDHA 4JS0A 1UPXA 4GWGA 2BR3A 1VRVA 2O2IA 4JC4A 4DJEC 2ATIA 4WPGA 2M2IA 2YIDA 1ZLXA 3B89A 4HN2A 4FFNA 4KYIB 2KB0A 3B48A 3ITEA 1XWFA 4FHGA 1UWLA 2FR1A 4D8XA 4NKRA 5J4LA 621PA 1W4CA 5I01A 2WAMA 4EO7A 1NRIA 3AIIA 3ACCA 2IEBA 5BMVA 2Z4SA 2QLLA 2H3EA 3H04A 3OMWA 1IHOA 2PL3A 4XOIA 2HJWA 1U9YA 4RA9B 5JD3A 1ML3A 1NJGA 1NGSA 2GILA 2NPOA 4Q3LA 3QELA 4S2UA 2GX6A 3IR5A 5F9MA 3SJUA 3ZWMA 4RABA 3I5AA 3I3OA 4H7FA 1E8MA 3DBRB 3TCXB 4ZV9A 1CQXA 3V4VB 2XE4A 1WCXA 2GSWA 4AY6A 2N75A 1W4BA 3H2KA 3JPWA 3V1NA 5I7EA 2UYHA 2M1XA 1G4UR 4U8GA 2WKPA 3VTZA 2IHTA 4C88A 4A36A 2WWFA 5JJ5A 5JO0A 4YXFA 3W7AA 3WAJA 1U2EA 1XLWA 3HL0A 3ADBA 2QUHA 1BS1A 1NQOA 3MBOA 1GFZA 3VR2D 4CEHA 3A1UA 4XRGA 4RH3A 2IS2A 3U2QA 4IIJF 3N8DA 3IEXA 1SA0A 4RS4A 3NBKA 1JTEA 2BW0A 3UK1A 1RE0A 2ZZNA 2R6HA 5ALEA 3CINA 2O8DA 1T3SA 4ON9A 4OSEA 1ENPA 4EO9A 5HRUA 1R6UA 2RARA 4K9OA 2ZBDA 4QG7A 3X1ZA 2GHTA 2YS7A 5EKDA 1FSZA 1OZGA 5K45A 3KALA 1SCQA 3WBKA 1FXWA 4LF4B 1PFYA 1UXGA 1OBOA 1R64A 3EZXA 3INGA 4LGVA 1I7QB 3BERA 1BJRE 4Q9AA 3EE6A 1X87A 1RXVA 2OGTA 1MDFA 3SD7A 5C5EA 4A0QA 1ZR2A 4K8OA 5ARCA 3WRXC 1UBOS 1ONPA 4JBYA 3B1JA 1NSFA 3AF4A 5BRAA 4M9RA 3B3QA 1DIBA 1FFEA 2IDKA 2RGAA 3H9BA 3JARA 4OP3A 1ONBA 1P29A 2GCNA 4KFRA 4E5UA 3KTOA 1JIUA 4R8VA 2DLCX 1DB3A 2O48X 3TR6A 5J4HA 5CM9C 1JSLA 2XMPA 4L73A 1LV8A 4GIBA 4OQPA 3X1KA 1UZLA 3DV0A 3EVAA 4GMGA 4HZUA 5HTKA 2XGJA 1EWQA 1CY1A 3LV8A 1XN4A 3D6VA 5EJIA 5FTMA 3KZKA 1RADA 4LCBA 1ZW1A 5FWXA 3UMMA 3RTBA 3II6X 1RTTA 1K6IA 1M5TA 1ZL0A 4LYAA 4GMDA 3EVDA 5ICEA 3TDKA 2Y1WA 4EUKA 1WE2A 1C9JA 1KGSA 5CBPA 4OHMA 3TB4A 2RD2A 1HKUA 3GWGA 2O2CA 1GNPA 2GSDA 5DNVA 3ZDEA 5J58A 1SCJA 3DCJA 2OV2A 4M99A 5ERXA 5TNXA 3ICCA 3H18A 1ABBA 1GG9A 2JATA 2IEGA 3FMVA 3K70C 1U1GA 1JIXA 4UPVA 4YYEA 5HQ3B 3HI4A 4W9NA 4A03A 1Z26A 1FYEA 5HKOA 2BF7A 4HAZA 2C29D 1Z08A 4MNTA 4S0ZA 4LTDA 4G5OA 5K8CA 3NC4A 2VS1A 4AKGA 5EEGA 1T5HX 4FN5A 5BVHA 2JIDA 3T3DA 2OBYA 5KQGA 2QN1A 2WD9A 3QX9A 3F8SA 1U8CB 1S8OA 2PXCA 4FDMA 4HO1X 1KK2A 4WK6A 1R8SA 4IIVA 3L0BA 4OHUA 1FDSA 4YA6A 4IRXA 2XVAA 5DTMA 2BJVA 3FOWA 1IXYA 1N9GA 3HY3A 2DBYA 1OFIA 3L4BC 2V6IA 3LOUA 5T6BA 2O5RA 4L9RA 4X61A 3DAGA 4QU0A 2HK8A 3LDUA 3PIIA 4X8MA 1YZQA 1WSDA 4CDNA 3HRHA 1TGYA 1VQ1A 4N3NA 4G67A 4IH4A 1N0UA 5DYWA 2Q45A 1AUVA 3A6DA 4UD2A 1KMIY 4G0NA 5H3LA 1Z0ZA 3BL5A 3NANA 3V4RA 1F20A 2FRVA 2JKYA 3AYZB 3QEJA 3E2IA 2M32A 3DCYA 4WCVA 2HN9A 2JFZA 3PXUA 2ZVQX 4Y2UA 1BXZA 3RS3A 2GH1A 4Z7NB 4Z2AA 1NN5A 1XZDA 2PS3A 1UEJA 1G7TA 3D1VA 3T3MB 1A9TA 3HKBB 2Y8EA 4IHQA 4TV9A 1DJOA 2CKDA 2QRKA 4YJFB 1T9AA 4KQ2A 3F6YA 3Q5DA 2LNDA 1TU4A 4NPAA 3R6WA 3PTZA 5FWDA 1Y6QA 2PGXA 5CA0A 5JCZA 2PUGA 1MW9X 2P8JA 2V0NA 1VCMA 3FYUB 3L8YA 3T4UA 1PZFA 1SXHA 2A7QA 3ITDA 1FRQA 1P17A 4IO0A 4PYQA 4PAWA 3H4VA 4QUJA 4B5KA 5JQGF 1B16A 1N7HA 3MELA 4LDRA 4F3NA 1DMRA 2WHPA 2F8LA 1J8QA 1JTFA 2BFBB 1SQSA 1K1EA 4UHBA 4HL6A 1N3YA 3SIXA 1Z4JA 2W2KA 2NU8A 1X7WB 2YNMC 2AC7A 3AYXB 3K0CC 2G25A 3DOOA 4PRLA 3BGVA 1JFLA 3HCBA 4LJRA 4L74A 5EXSA 4BMXA 4RTSA 2PAAA 1U0FA 2IYXA 5B53A 5GADl 2HSEA 2D8AA 4EGCB 1KXJA 3KKNA 2C9BA 3D3KA 3GL9A 1BVUA 2ZJ5A 2ZUCA 4ILEA 3BIOA 1OD6A 1KORA 4RIFA 4XJVA 4Z1MD 1S3FA 2VDWB 3H6KA 4ZICA 1P5HA 3KPWA 2B92A 1KDOA 2GLXA 1UFQA 2PV7A 2VJPA 3GP5A 5BNZA 5KOJA 3ZQ6A 4B6PA 1YBHA 1L1EA 2C4WA 2ZROA 4M86A 1KDTA 2OV8A 1E3DA 3RIEA 2C58A 1JI0A 1BMQA 1JYEA 1H2RS 1YKSA 2PHZA 4B75A 5H81A 5EZ6B 2X1LA 3NEYA 4RPGA 2J32A 3IPRA 1EP3B 1PLLA 2P6NA 4OF4A 5A6SB 1S02A 3T52A 1VB3A 1P4RA 4Z9YA 1F1JA 4MRSA 4AF6A 2R84A 1JX6A 6Q21A 1YR6A 1J2TA 3GRCA 4M9XA 4BVJA 1PT8A 2JFGA 2GM3A 5H0IA 3WJAA 2XOXA 2APJA 4PV7A 3DDSA 4XEHA 1FUYB 1R0YA 2TMKA 3ESXA 3FWZA 4N5MA 3VSEA 3QVJA 1OH6A 2EZ8A 3QF4B 1NBOA 4IKEA 3WB0A 4L07A 2O2EA 2I9KA 4FYIA 2VNJA 5E6UB 4GOOD 4IJVA 1C50A 1P1IA 1P80A 2W2LA 3UPTA 2PTHA 4BNVA 1O0SA 3P2EA 5DBIA 4QGSA 4PSCA 2DSNA 1Q2XA 1V8FA 1PWXA 4G5SA 3DQPA 1LW7A 4YMSA 4ZP1A 4BO7A 1AQLA 2PKQO 1B15A 4V1CB 5H68A 5DNCA 2VUIB 2I4RA 2ODWA 3DE2X 1HF3A 3LLVA 4M38A 2GNPA 2BLNA 4ER6A 1JMVA 1TLLA 3BE4A 3HA7A 4XJSA 5LCXA 5ALHA 1ZM4A 2R1UA 2YNMD 4MKZA 4RDCA 4D5EA 5H7XA 1JLLB 3IP8A 3R0JA 2P2CA 4G0WA 3ESRA 3L5OA 1E6WA 3S7ZA 4RSMA 5A9RA 1D07A 2QAIA 4HNVA 2AOTB 3HXPA 1E1RD 4HS9A 4GR4A 5TJHA 1ODIA 4ZMSA 3HJHA 3HQ4O 1POWA 1LD3A 3CRZA 1U0HC 3JZFA 4IV8A 4W8OA 1QHNA 1RD4A 3H5IA 3HR4A 3WJ7A 5ALMA 4A5SA 5CFRA 3RUCA 5TMPA 3LWDA 1M2WA 2RI0A 3HYRA 5TQ2A 3UAVA 3JAMA 2IIPA 2X2OA 1RAEA 3HZZA 3QXGA 1DAFA 5K3FB 1K2VN 4G81A 1Y6JA 2LD4A 3M6LA 3KPUA 1A9QA 4YFVA 1HQDA 2E5FA 1PG5A 1U7WA 1QVRA 4JGGA 2VRNA 4AQDA 4ZHQB 4XUGB 4DCJA 3PGXA 4JROA 2HHLA 1P1KA 1RYHA 1ETUA 4K2AA 4RIIA 1QAMA 4ARVA 3VNQA 5B3LA 3BGSA 4WGFA 2C7QA 2GCGA 3SFTA 1FJXA 3ZDQA 1KSHA 3CNQS 1UDXA 2VA8A 1GAWA 1NUTA 1XTQA 2GN2A 2XUOA 2CXSA 2OESA 2OM2A 5CPBA 1JXOA 2WIGA 3KD2A 3F67A 1P0CA 3TAUA 4U7GA 4BMDA 1H0RA 3IQHX 3GFBA 3FSJX 3M6VA 2ZITA 4G24A 4A8PA 1UPUA 4U39A 3JQ8A 4UVHA 2D0OB 1CNMA 4P84A 2P35A 5EWMB 4F06A 1T29A 1SOVA 1V39A 4B8WA 4PFSA 5E0KB 4DLUA 2W4IA 4JVOA 1UMDB 1QX4A 2CDNA 2J5RA 3COPA 1WAMA 3L6UA 4LX8A 4C05A 3C2QA 4J6FA 4MWTA 1URPA 4XR9A 3NWOA 3UJ6A 3KYBA 3PVZA 1E4YA 3LPLA 1OLXB 5I7WA 3I9LA 2QD3A 1A97A 2AZMA 4B3DA 4R84A 5BW4A 4XLZA 4NICA 3FIJA 4WKGA 1F0PA 3F90A 4BNKA 3I9NA 4BO2A 1AO3A 4X85A 2I29A 3ZWWA 2PA0A 2P2GA 4LUCA 4MEBA 4UM9D 4DVJA 1XEAA 1GUAA 2W8BA 3PQ2A 2CXQA 4FDLA 4Q12A 4YQYA 2DY0A 2G09A 1OTXA 2Q7DA 1BKDR 3GGCA 1ZUNA 2Z2ZA 2P9YA 2JKVA 5B58C 3P9YA 4AZ0B 2IH5A 2JIPA 1Z5GA 2JFXA 4LVNA 3L0PA 3G7NA 1JHYA 4RCYA 4GF5A 1EP9A 3EPPA 5B3AA 4XWWA 3HCAA 1NXOA 3A1DA 2AR0A 5DTIA 1C8LA 1QV7A 4L4YA 5B2EA 3NBAA 3VV3A 1Q1BA 2TECE 4QBKA 4B31A 1Y8ZA 3EWIA 4ZJUA 2X1VA 2MJLA 3CBGA 4MINA 3BQMB 2XKBA 5CEEA 1APBA 4R2IA 3Q3HA 5U9CA 4X97A 2Z6UA 4U4AA 3TEFA 4K6GA 4LK3A 3RS5A 3NU1A 3V34A 4BE4A 1V5FA 4Y3UA 3FPSA 1N3BA 4JC8A 1PUJA 4MW4A 4WZBB 4CIXA 3VR1A 1P9RA 1TT5A 3L1VA 1U4OA 3PVCA 1F7UA 1M34B 2H6EA 1S0UA 2AG0A 1C9EA 1G21A 4C7JA 2M6RA 7REQB 2ZXUA 4I1YA 2ZE7A 1WDLA 2ONCA 2CSXA 1EUZA 1MAWA 4EVQA 2HXGA 1KJJA 1UBEA 4WLFA 2VAVA 1X7XB 5JOQA 1GU7A 1NP6A 1WEHA 2PMWB 2EQ5A 3EIWA 4LZNA 4Y2SA 3WHIA 5HF8A 1KRHA 1ID1A 1P7WA 2GEVA 4DEYA 5TPZA 4BVEA 1F5SA 3AIOA 3F7TA 3O83A 1IPFA 1ITZA 3SBDA 1XKLA 1HDIA 3QVOA 1C1XA 2P2NA 3I8OA 4WOCA 4BBJA 4CV2A 1ZOOA 2DBQA 1ZZEA 2VNKA 2YWRA 4DF3A 3M4YA 3PUHA 4NHEA 4HRVA 3S2FA 3S8YA 3VRHA 3P2JA 3VSBA 4FIDA 1DKQA 1ESZA 4HAOA 3TLJA 1EJ6A 3OM0A 5K8TA 1RXWA 3R3XA 3N58A 3UATA 3BBPA 5ALYA 3GNTA 1AK1A 1PL0A 3SXUA 1EDDA 3SZOA 4EJSB 3AW9A 3CVYA 5JTTA 2QZ9A 4F4DA 1U0OC 3UJDA 4JDUA 4RTNA 5JECA 1T36A 3G5TA 4ALJA 3L7BA 1ZISA 4OB8A 1JUDA 2O3RA 3AY0A 1TZMA 3W05A 1Y9ZA 3WS7A 1NIJA 2ZIFA 4C43A 2RBKA 4AP6A 1XZQA 3PNSA 3SEZA 4UMEA 1E3MA 4PLZA 4BLUA 1BWRA 2RK4A 1MR3F 2QYOA 1H2AS 1VCIA 1IAVA 2PGNA 3U3RA 2ZR8A 4X54A 3OE4A 3OD1A 2OBFA 3C5VA 4Y6OA 5LJIA 1NMYA 4TQGA 3SYTA 3CWCA 1BKYA 2JB9A 5ALSA 1Z8DA 2P7HA 4G5FA 1E4EA 5LFAA 4UE3S 5EL0A 1TQ6A 1F4PA 1OYWA 4F9EA 3SEQA 4RESA 1I4TD 4OHVA 4AJIA 4DE5A 4DJAA 2H08A 2HDHA 1CR4A 4BO9A 2V9ZA 4IDOA 2G40A 1DTWB 2PX0A 1RPJA 4L6IA 3OVMA 5FEUA 4UUQA 1I8TA 1CQWA 2C2ZA 1U0RA 4GOXA 1MOSA 5EHNA 2Q1XA 4JOSA 1YOVB 4GQAA 4L08A 1DBWA 4DA8A 1Q92A 1DL5A 2D7CA 4H31A 2QTMA 5DZSA 4A26A 4DYVA 3D6UA 4IX9A 1GR0A 2WJ4A 3FVRA 3NXSA 3TI9A 1XQWA 2PK3A 4B7XA 4HNAA 1S5PA 3V8VA 1UKCA 3W2TA 1VI2A 2A6PA 4AJ9A 4BVKA 3ILSA 4XFKA 4C0LA 5JJCA 5KKCA 2FZVA 1WXXA 2XTAA 4RENA 3AF5A 1J22A 4H4CA 4QYIA 2XJ9A 4UD6A 4URFA 2W2XA 5E1OA 2IODA 4ZVOA 3CXUA 3V9AA 4C2AA 2XWPA 4ZK6A 3SICE 2ZPUA 2OHFA 1PNTA 5ECWA 1JFFB 2L2QA 1N25A 1QVVA 4DWWA 3R6TA 1KSGA 1WCIB 1MD9A 4BQPA 2ZOSA 4KREA 2O2DA 1VGVA 4P93A 4CEJB 3AQIA 1Z7WA 2QE6A 1YE8A 3UH1A 1OREA 2W2OA 5EHQA 3WWZA 4CL8A 1SMKA 5C8ZA 5DM70 1JQKA 4KQ9A 3O6VA 1KQOA 4I9HA 4QOEA 3INTA 4RANA 2YZGA 3EX7C 1SUEA 2CNWD 2H65A 3P2MA 4PLVA 1F14A 4QBIA 3A1TA 4FONA 1YE5A 2FR8A 5A3SA 3E23A 4EZEA 3FPKA 4BCBA 4DV0B 1QH1B 2H4WA 1A9OA 1CE8A 3EXHB 3R3WA 4HZGA 4I8XA 3H99A 3EARA 3DHVA 2FPMA 5JXIA 1CRPA 1J2YA 3GVXA 1IN4A 1HBJA 4HMPA 4UBNA 4DS3A 2QM8A 3L0DA 1IEQA 2B8WA 2RMKA 3F97A 4KMOA 1UBSB 4ETNA 2BP7A 4HPXB 4EPWA 3PENA 3R6DA 1OXKB 1XVVA 1DI0A 1PK7A 1TJ4A 1K98A 1XQXA 3LVBA 1WA5A 2W2TA 3SY8A 4DMUB 1QP4A 3WGVA 4HTFA 1C4OA 3EZ2A 2Z43A 4IZHA 5TMDA 4C9BA 2O7SA 2AXNA 1FTGA 3NPAA 2HT6A 3QLVC 5CYOA 5JTUA 5SYNA 3HLKA 4IIYA 3Q5GA 4HLDA 1BRTA 4NOLA 1B6TA 3Q8WA 3TFOA 2VZ8A 1IFXA 2EU8A 3IDAA 1WU8A 1A9ZA 1FNMA 1JHOA 3DONA 1ECGA 1NMSA 2XV1A 1LVGA 3G79A 3F4KA 3Q2OA 1I0ZA 4LEIA 4YWHA 2A5FA 4RX1A 1W8IA 2K4MA 1VSTA 3MQ4A 3ZKWB 1DEAA 3AXSA 4LYEA 1FBNA 3DDNA 5BSEA 1AO0A 5KVVA 4QSMA 2WDZA 2WJHA 2V74B 4KN8A 1I4EB 2C8LA 3KVOA 1VL1A 3CH6A 1N8TA 1Y7HA 4RXTA 3EFOB 1WSBA 3OPNA 4M55A 3MUOA 5DOZA 1XR3A 2Q6IA 3LVQE 4C3ZA 2NU6A 5IHXA 3VHQA 4CRWB 2F8MA 1E6UA 1Y7TA 1R88A 1YU9A 4TQ9A 3UT5B 5A04A 5JCJD 1JLKA 3QXHA 5KWSA 3A0UA 4M36A 1JQDA 4XWKA 2WJVA 4GR5A 1KOLA 3VSAA 2VWPA 1LBEA 2CUTA 3FGZA 1B8UA 1IVSA 3FZQA 3GG9A 4MV4A 4RZ3A 4BWGA 1ZP6A 3BSYA 3C4VA 2EFGA 5IW8A 2YWHA 2DWQA 4QZVA 1A04A 1JWLA 1RTKA 4J1SA 3IE0A 3IHLA 4LWPA 5I5GA 4ZZ1A 5JROA 1VKRA 3R9XB 2Y0BA 1TUIA 1FP1D 4F2WA 4LXYA 2H57A 3HACA 1RHQA 2F43A 3GJSA 3HR8A 4JLBA 4PAOA 4OMCA 5AM2A 3E3MA 1TX4B 1AXGA 3BC1A 3I9KA 2GASA 4KV9A 1E1QA 5HIMA 3W5SA 3WHPA 4G8DA 5JFTA 2GZ3A 1KI3A 3ANXA 3MJHA 3ZUGA 2H3HA 4OEHA 1QF9A 5D8DA 1HTBA 2DAPA 3A9UA 2XR1A 4LYYA 3RJTA 1TQ4A 5DBEX 2BBTA 4FGWA 1QGUB 2B9EA 4H9GA 5L7TA 4FINA 4OX9B 1M1NA 2YOHA 2YCLA 1HFKA 1T4CB 1WCYA 2CMGA 3I2HA 4XPZA 2GQ0A 2JH8A 2HX1A 2UUOA 4LHEA 3R9WA 4BNNA 3OU2A 1KP2A 1XZGA 2JBAB 5SYMA 1NI3A 1MJHA 2WB4A 4HVTA 4LMAA 3T5BA 1CUSA 2P75A 5AHWA 1TK3A 2C31A 4N0QA 4PQFA 4YUYA 3DTNA 5CA1F 5JDIA 1IZZA 3WBFA 1KJ8A 2AG5A 1L5NA 5EIXA 4NJOA 4HXGA 3CBQA 1X7ZB 3D8NA 1GA6A 2C9MA 2JASA 1SHKA 2X9GA 5SZKB 3WK7A 2ZRAA 5IDQA 2RHHA 4JIMA 1K63A 2HZ7A 4N7JA 4QEDA 3T54A 4B7CA 3DHEA 1AS3A 4ZZ3A 4U6NA 4D4MA 5C5IA 3HSKA 1YA6A 2RC6A 2R9VA 4MPRA 1QIGA 2H0AA 1OIVA 4C4AA 4E70A 1DG9A 4RK5A 5BN5A 3VR0A 4DXDA 1WPXA 1FY2A 1E7QA 1TLTA 1Y4UA 1ZM2A 3JQQA 1WPGA 2QZSA 2Q29A 5E9AA 4MWZA 3RO7A 2FN8A 4AB1A 4JX9A 4C14A 2C3MA 4MQLA 3ZY3A 3QKSA 1T35A 2NPIA 4QUKA 1W0KA 4JU8A 2QPTA 3OQIA 2GZHA 3IYLW 4Z1OA 2DQYA 3LLCA 1ESDA 2PUAA 2OB1A 1UDAA 3N05A 4FYPA 2RFLA 4KXMA 2VK1A 2VOJA 4OJYA 4PYNA 4BPBA 1J1ZA 2YINC 4ND6A 3FCCA 1BEZA 1CR6A 1T9KA 1X1QA 3D64A 3OZVA 4FQ8A 4PHHA 5K8LA 1W0JA 2HK9A 4ZC1A 4M8IA 2E4XA 1VPWA 1FXSA 2CVZA 2LGJA 2HQSA 3MMZA 1Z56C 2O7QA 3NHKA 1T9ZA 4BU0A 3IAS6 2QKYA 2I33A 1D4OA 2CXUA 2HF9A 5AJXA 1Y3BE 4NE9A 2E1RA 3F4LA 4JQYA 5EI5A 3X1DA 1B26A 2QG4A 3CO0S 4MPPA 2YICA 4B40A 5F52A 2E6KA 3V2UA 4C1BA 3BKXA 2O8EA 1RI4A 2PWAA 3SEAA 4EJ0A 1JE1A 2O8FB 5B1DA 3TTSA 3GLGE 4N49A 1NNEA 1E1DA 2OFOA 2QRVA 4DA7A 3BJRA 5ER9A 5SZHB 4E1VA 1UJ4A 1ULSA 1KRXA 3Q72A 1SHUX 3WHLA 2JJ8A 2WMYA 1IM2A 4KRFA 1GEGA 1P3DA 3I5MA 4RD0A 1UFVA 2XMQA 2OCKA 3IXQA 4TMXA 4TRNA 3FI0A 1C0PA