2GILA

Structure of the extremely slow gtpase rab6a in the gtp bound form at 1.8 resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
161
structure length
161
Chain Sequence
FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the extremely slow GTPase Rab6A in the GTP bound form at 1.8 resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-6A
total genus 52
structure length 161
sequence length 161
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gilA00
3AF2A 2GBLA 2JLSA 4MA4A 2ZJOA 4AG6A 4QBIA 1IJFA 1NRJB 3MAAC 2WJHA 2C04A 4EPYA 4Z54A 4YONB 4BASA 3GEEA 2VBCA 3T35A 3TAUA 2GJ9A 2I4IA 4AURA 4P31A 2CDNA 4UNQA 5FTKA 2W00A 3ASZA 1XTRA 2QT0A 1Z0JA 3LY5A 4EJSC 2XXAB 2CL7X 5BW8A 3W6PA 4D25A 5EQTA 1ZNZA 1T8TA 4OQLA 2P5SA 2UVQA 4JLAA 2C2HA 1YR9A 3SYLA 3CNNA 4NBSA 4QJ4A 2O8EA 3GP8A 1JAHA 3G5UA 3VHXA 1W7AA 1E2LA 1N3BA 2J1LA 3W6OA 2XTNA 1E0JA 5KNCA 2OE2A 4LJ9A 3DMDA 4XSGA 3NC1C 4PANA 1YQTA 3Q9LA 3UMRA 4L9WA 3K70D 1QHYA 2IEZA 4LPKA 1KJZA 3A4NA 1I4DD 1TAGA 3SHFA 2PX0A 3LBHA 4LK2A 3WYAA 5IHPA 3TAHA 1KO5A 4HB4A 5TV2A 4GFDA 2OFWA 3PJRA 2R6FA 5DNYB 1T5IA 1XEWX 4IKEA 1KSGA 2OG2A 5AJWA 4PC2A 2BEKA 2HDNB 3KJHA 3I8SA 4IEIA 5M04A 4JLDA 4JT4A 4PSKA 1JB1A 4QGFA 2J0VA 4DCNA 1L8QA 4HLQB 5SZJA 2ZJ8A 2OXCA 2AK2A 3I73A 1DOAA 3GEHA 4AKHA 3AVOA 3ZS9A 1SVWA 1AM4D 2DCUA 3S1AA 2O8BB 2G0TA 1FPMA 2HCBA 4AIIA 3DM5A 1NMXA 1QHGA 5FBWB 3AVVA 4IW3B 3HU1A 4JKYA 2IYZA 3AP1A 1E9EA 2IYYA 5GADl 1P9NA 2ZR7A 1OXSC 1NLYA 4GNKA 4B35A 2WIBA 1J7KA 1JAIA 1JEDA 1GSIA 2P0EA 1XZPA 2P6NA 3Q5EA 2WWGA 4DIEA 3UPUA 1YJ5A 1MO3A 4JMPA 3PUZA 4GP7A 2FMXA 3FMIA 2JJ2A 4FCTA 2EVWX 4CRWB 4D6PA 1JNYA 2LKDA 1S0UA 2NOAA 3RRMA 2CHGA 2QP3A 4Q00A 3KUDA 4IDNA 1FTSA 2J59A 1U94A 2PLRA 4M1SA 2ZJYA 3T61A 1Z6TA 1LFDB 2B7CA 4I4LA 4B74A 3C5CA 1VHLA 1UFQA 3R20A 3W34A 4XVRA 2HT6A 2ZRMA 4M1TA 1VG9B 1IXSB 2WMOB 2CEAA 1ZM9A 2G77B 2C9OA 3Q72A 1C1YA 4C0SA 5ELXA 3SFVA 1WB9A 3KXIA 3TUIC 4DSTA 3GJ4A 4LBVA 1IJEA 1SHKA 4F92B 3D8BA 5HTKA 3GLFE 1QVRA 4UNSA 4D4JA 3H84A 4XOIA 1RIFA 3OZXA 3WP0A 4BGDA 1SKQA 2AN9A 1XEXB 3KFVA 3FTQA 2QAGC 4QOSA 1M34E 2ZE6A 4TL9A 2QZ4A 1Z3IX 2J0SA 4NCNA 4FMBB 1G7RA 1VTKA 1IN6A 2A2ZA 2DFNA 4KHZA 3IPYA 1AS2A 3RC8A 3P26A 4KITB 3MLEA 3PUXA 4NYIR 4Q02A 5DGXA 2X1VA 3KQNA 2N46A 1D8TA 3GJ8A 3RANA 1GZSA 3GJ0A 1G8HA 1FTNA 3M6AA 2WKPA 3DOEA 3IQXA 1YR7A 2FF7A 1YHNA 3HP1A 2Q9CA 3UK6A 4KYIB 3E5HA 1X6VA 2WHXA 3AB3A 5BN5A 4ON9A 5IF9A 2XB2A 3N5CA 2VEDA 1R5OA 3FHOA 4FMCF 1KZ7B 4M1WA 3VKWA 1RW4A 3QBVA 1NF3A 2YVUA 3WRYC 3UANA 1N5LA 2QORA 1T0HB 2DPXA 3FMOB 3IQWA 5GJBA 3C15C 3QKUA 1AGRA 1WF3A 5DI3A 3BAFA 3MWYW 4ESVA 4NYIQ 3EIHA 1S1CA 2HXSA 5C1BA 2QPAA 2O0HA 3LX5A 2P6RA 2WZQA 3CX8A 3EC2A 2WJGA 2GZAA 4HDQB 3EIQA 2BCJQ 5EP1A 5J4HA 4CEHB 3SR0A 2F9MA 5CK4A 4F38A 3AF3A 1XCMA 3ZIAA 2BMJA 3U4QB 2ZITA 1E94E 2OAP1 2YHSA 3UMFA 4Q1FA 2O8DA 2W0SA 4LJAA 3X1ZA 2EQBA 5P21A 1EXMA 2GRJA 5FBVB 3K0EA 3Q7QA 4LYJA 4JKIA 5K8IA 4NYMQ 5KTYA 1RZ3A 2QEQA 5EE5B 2X77A 5KDLA 2IX3A 4BZPA 1ODFA 3EZ7A 1GNRA 4TLDA 2BKEA 4XH9B 2OCBA 1WQ1R 1A82A 4BFTA 2YWGA 3PCRB 4A92A 3AV0B 5C4MA 2B21A 3PEUA 3Q3JB 1NG1A 3H86A 2J0UA 1BMFD 2BV3A 4TMXA 1Z6AA 3TSOA 4B75A 5FPYA 5CYPA 4CIDA 3TRFA 1SVSA 2FEOA 2NZ8A 4LBZA 1XP8A 1MR3F 2ZEJA 3GLIA 1E2FA 2VF7A 4JS0A 3L82B 4ACBA 4EPXA 2CHQA 3ZGXA 3A4LA 2OV2A 3B13B 1GM5A 1R8QA 3EX7C 3U7GA 2H5EA 1P72A 1HE1C 1UDXA 1FP7A 2F3RA 3WNBA 1BO6A 1R7RA 4JT2A 4V0LA 1KO7A 1RKBA 3AF0A 2GXAA 1B0UA 4AG5A 2ODEA 4MRRA 2X19A 1W2HA 4URUR 3A1SA 2GXUA 3B1WA 1E0KA 1GG2A 3B82A 4CGZA 5EE1A 1Q21A 4RFVA 5JJIA 2RGDA 1H65A 4HI0E 1NMYA 1T8UA 2ZU6A 3B85A 4GP6A 3ZH9B 3KTAA 2JEOA 4YMSA 4RY2A 1DPFA 4DXAA 3U44B 3A8TA 3BGWA 3DOFA 5KDOA 3GMTA 2IUUA 1QG2A 2HJGA 3GEIA 5FR2A 5L3RA 2P67A 1CU1A 1KGDA 1G6OA 2OSBA 4IOLA 3BJIC 1R5NA 1JXOA 2AX4A 2G0NA 2OLKA 3EWSA 3OIYA 1ZW6A 1VCNA 2YC2C 3RC3A 4C3ZA 1NL3A 3OHMA 2W2VA 1S4QA 5CLLA 1JR3A 1XU4A 4GMDA 1OH6A 1QHIA 3IGFA 1H8EA 3UMSA 2DB3A 1N6PA 4HLDA 4RZUA 5JLJA 2XTMA 1G8GA 1S3GA 2EWVA 2GF9A 3SE0A 5IDVA 4ZV4A 1KI9A 3NBFA 1EG7A 1WXQA 2W83A 2QRNA 5H70A 4OQFA 4F4JA 2FDCA 4HAUA 3QOFA 3U4QA 3KQHA 4EAQA 4FMDB 3P1JA 3H4MA 2ZI6A 3IO5A 3OF5A 3H0KA 3CH4B 1VG8A 1HQCA 5DH9A 4DT1A 5AUOB 3MWJA 1N6KA 2RGEA 3A36A 2GAOA 4IVQA 4P4SA 1XF9A 1LF5A 1N0UA 5JECA 1AQUA 3DMNA 1XNJA 1FMJA 4RD4A 4LY6A 2WV9A 4MDEA 4Q9HA 4PZYA 2VH5R 1KDOA 1GL7A 1CEEA 3U3KA 5FPTA 4HLCA 1NKSA 1EFUA 1UBFA 1ZP6A 1AKEA 1EESA 4TQ9A 4JVLA 5FI1B 4P4SB 1E2EA 2QBYB 4L5BA 3D3QA 4A2QA 1IY2A 5HE8A 1Q57A 1Z6XA 1GIAA 1UPTA 4MKIA 4AYWA 5FI0B 5A0FA 1LTQA 3MFYA 3ZZ0A 4ACAA 1G19A 4DCTA 3K8YA 4U02A 3QXJA 4HB2A 1G3QA 3UG7A 4MUAA 1GFIA 1YKSA 3TIFA 1KHTA 2CNWD 521PA 1X1RA 1OXUA 2ZS7A 3QPVA 1P2TA 1E32A 4LGMA 1NY5A 3UIEA 1A2BA 2IXEA 4OJKA 1KO8A 4LBWA 2YOFA 1NY6A 4MKHA 3PXGA 1F2TA 2IF2A 5FOXA 5CDFE 2ZYUX 4ERNA 4DDUA 1P73A 1R0WA 2V3CC 4PHFA 1G8FA 2ZAOA 3AF1A 2FSFA 3SNHA 3PIRA 5EUMA 2O52A 2DWPA 2QMOA 4FCWA 4MKFA 1TU3A 2P6UA 2V4ZA 5AJXA 3ZS8A 4ZDIA 2VLIA 3TLXA 5GVRA 1Z8FA 5L8VA 4KJZA 4JVNA 1HQYE 3GFPA 4P4UA 2ZE5A 4CEIB 2GJAA 4FWTA 3A1VA 3OAAD 3LV8A 3TE6A 1N5KA 4B33A 3AVTA 1TEVA 4CZ2A 4V0MA 4HB0A 4E03A 3OEED 2Q3MA 2DWQA 2A30A 4A4DA 3P32A 4CW7A 2YV5A 1U2RA 4PPFA 4Q19A 3QE0A 3L8ZA 2H92A 4IEEA 2IA5A 1KMQA 8OHMA 4E09A 4F4IA 2QMUA 5AJYA 3THYB 2XEXA 4ZCMA 2G9NA 1WCV1 1V5WA 4R2IA 4ZO4A 3G82C 3N2IA 3PUWA 3AVYA 3CBQA 4FXPA 4MGYR 4KXFB 5FBRB 4DUGA 3ADCA 1YZQA 3P4YA 4G0NA 3BH6A 4PAOA 1ZUHA 4H1VA 3SBDA 4IXNA 4IVPA 1NVVQ 5JI3E 4Q4JA 2HUPA 1S1MA 2RH5A 4CT4B 3SQWA 3QKSA 4YDSA 5CK5A 1GL9B 1KI4A 2I1QA 3EG5A 3F5FA 4RD2A 4V0KA 3WY9A 3THYA 2ZS8A 4I1VA 4B2PA 1T3LA 2JJ1A 1R6BX 4GOKA 4Q4HA 4X8LA 4URYR 2KE5A 2PZEA 4ILEA 3PQCA 4PAMA 3LW8A 1UADA 1IN5A 4XTCS 1XPOA 3LQQA 3RRYA 1HYQA 1RYFA 1CJMA 1EFHA 2OBLA 1OYYA 1WRBA 1XEFA 4JVSB 4B3DA 3QSYA 1G3RA 1AGPA 5CJ2A 1CULC 1G16A 2ZS9A 4IDOA 4TYPA 3LD9A 4KLNA 2NIPA 1DS6A 4HZIA 4XWOA 3LXRA 3AP3A 3D31A 2JLZA 1P5ZB 3DKPA 1X1SA 1NSFA 5JS8A 1Z29A 3R9IA 3QUSA 4JYBA 3M0EA 3ASYA 1XMJA 4B71A 1NNEA 3C4JA 4DLTA 3RSOA 4AYXA 2PT7A 2N1BA 3E1SA 2BC9A 3TW4A 4NMMA 5JCPA 4ZKEA 2MSCB 1ZD8A 4A8JA 5G40A 2F9LA 1J99A 4URVR 1JBKA 4N0EA 3FFBA 5J47A 2ZROA 4MYHA 3KFXA 5TDHA 1II8A 4K46A 4OHYA 5JMTA 2AXPA 2BM1A 3CWZA 3GLHA 3SBEA 4BRWA 4KVAA 5B58C 1IQPA 1Z83A 2IF0A 1W4RA 3CRQA 2CJWA 4CVNA 4BEBA 2GJKA 1ZIPA 2EFEB 3OIUA 4QBHA 3CRW1 3B1ZA 2RHDA 2QQEA 3A1UA 5FUVA 5BXQC 3DL0A 1GL6A 1SZPA 1NKTA 4GL2A 2ZSEA 1KNQA 3CF6R 4PSVA 1QHHA 3ZQJA 2ZUCA 1FFHA 2WVJA 2W2XA 1OPXA 1Q44A 2XJ4A 4OYHA 1I4TD 1HA3A 1OFTA 4M53A 4DCSA 5FFMA 3NKVA 2H7VA 3WP1B 4IFEA 4GZMA 1KI8A 2J46A 3REFA 3KKMA 3BIFA 3TUJC 3QVUA 4PPQA 5H68A 4M1OA 2GA8A 2ZRDA 4EJSB 2P65A 2GK6A 1NVXQ 2BMDA 1OYWA 1E2NA 4Z1MD 2ZJZA 1OF1A 1RRGA 1S2MA 4GDFA 4QC2A 3LBNA 4HAVA 1CS4C 5CB6A 2ZJ5A 1AS3A 4OI2A 2GZHA 3FVQA 4C0KA 1AS0A 4URWR 4B2IA 3VR6A 1CRPA 1ZD9A 2IL1A 4PX9A 4CEHA 4Z8XA 3E2IA 2XSZA 1F60A 1XCGB 1ZU5A 2CJWB 2GHIA 2FPMA 3C5HA 4DDWA 4EFMA 4KVGA 3KQLA 3ZVNA 4MITA 4ZCLA 3TUZC 4DLSA 4P0TA 5LB4A 2XZOA 5AUNB 1P9WA 3IO3A 2D74A 3W6NA 3CB4A 3KQKA 1A2KC 1VIAA 3C16C 3EC1A 3L0IB 4EIWA 4M21A 4KBGA 4TL8A 3G0HA 3TQCA 4MRPA 1JR3E 2RB4A 2AFHE 3LDAA 1HT1E 4Z1MA 4HEJA 4WXRA 4NTZA 1MRNA 5KNDA 2O0JA 3LX8A 1Q3HA 3ZYCA 3BK7A 4L15A 1MO6A 1N5JA 2BHRA 5FOVA 2VP0A 2YC4C 1OHHA 1QHHB 4URZR 1OH8A 1FUUA 1MT0A 2J45A 4C2UA 1QHNA 3QKRA 3DEFA 2QUZA 4C9BA 1G18A 2FPLA 3GLHE 2ODNA 3OFND 4FW9A 4QNMA 3LQRA 2OT3B 3U3RA 5JFGA 2O8FB 1OHHD 4JJZA 3AP2A 4M9SA 3WXMA 4TMWA 1LB1B 4DHEA 4NE2A 3BXZA 2J7PA 2ZU0C 1Z47A 1ZM3A 4DLZA 2CL0X 2R65A 3OESA 1MABA 3FWYA 1W4AA 3K9HA 3VR2A 1XD9A 2OBNA 3QNUA 1E0SA 3K0AB 2WAYA 3I32A 3OIWA 3BD9A 3GLGE 3CO5A 1SGWA 3SOPA 4LUCA 5F2EA 2OCAA 2W0MA 4C30A 2EWWA 4JLOA 4DDVA 4AKGA 3EARA 2IYXA 2YWHA 1T6NA 1UKVY 4PC1A 2ZRFA 2PEZA 4QXAA 1G17A 4WZBE 1T3SA 4JLPA 4US1R 4OHXA 3U6BA 4TYYA 3CLVA 4TZ6A 4JVMA 4FD2A 1KI7A 4O3MA 1Q0UA 3R8CA 3A1TA 4CF7A 1NBMA 2ZRPA 1E4VA 2UKDA 3CR7A 1PUIA 1XMSA 3THXA 1DAEA 3ZVLA 4HZUB 4HUQA 2BEJA 3IPXA 1GITA 3LH5A 1EK0A 4QFMA 4D82A 4XWAA 2RKOA 2RCNA 3T1QA 3TGPA 3KX2A 5B30A 1EFRD 1O3YA 2ZSBA 4B2LA 2QE7D 3WNCA 2WJVA 5IT5A 2ATXA 2QP4A 2LKCA 1OIXA 2QTFA 3REGA 4DB4A 3MGCA 2HYIC 4RCYA 1XJQA 2EFHB 5E7IA 1CJTC 4B32A 3P4XA 3SEAA 4BUJA 2JGNA 5GJWC 5G3YA 3U3MA 3QENA 2O8BA 1M7GA 4C0LA 1QG4A 1F2UA 2FGJA 3QKRB 3L43A 2CLCX 2C99A 3AEZA 5AJVB 5TB5A 4RZXA 4A6XA 3VU9B 3CPHA 3I8XA 3AKYA 4QBFA 4DEXA 2IWRA 2VQSA 1KSFX 1OB5A 2B7BA 4GSYA 1FOEB 1QDEA 2R62A 4MGZR 2BMFA 2V6IA 2KBEA 1W46A 4OJQA 2QPOA 4S35A 3WYFA 2G83A 3MRSA 3DHWC 1Z0IA 4LHWA 1K6MA 2JDIA 2RMKA 4EFNA 2VP9A 2ZVPX 2OCPA 4ARZB 4NP6A 4XIGS 2A5DA 2PEYA 3LVQE 4N3NA 4TTQA 1ZU4A 2OEPA 2WWWA 2VHCA 3RWOA 1XJCA 2QMHA 2SHKA 3QIAA 3SJBA 4AKEA 5LD2B 4CT5A 4PHHA 2GEUA 4DLVA 4V03A 2IYLD 3LNCA 4HLUC 3HPRA 5FTJA 1AJEA 1KI2A 2CLSA 1KKLA 1S96A 1L7VC 1YR6A 4M2LA 2QM8A 2I1VB 2GCOB 3MD0A 5JSZA 2F1JA 3B8HA 2XB4A 3QQ5A 4F4CA 1CBUA 4G5QA 1W5SA 1A7JA 2VP5A 1R4AA 2IYRA 2ZRAA 1ONBA 1UEJA 4LDJA 2QI9C 4PC6A 1F3OA 5FOUA 5SZHB 1JI0A 5JI2E 3CONA 1NIJA 1NBME 4B43A 1RRCA 3PR1A 4C4PA 4NDZA 2IUTA 2D2FA 2CXXA 3QJYA 1ZNYA 1M7HA 1X8LA 1N2CE 1H8HD 3CZQA 2WWYA 1LW7A 1XTIA 4BLSA 2Q9BA 3IILA 4LJ7A 1XEWY 3U7FB 2ODBA 1RRFA 2CCGA 2EYUA 3SJCA 1IOZA 4A15A 3EPHA 3GLGB 1SKYB 2OLJA 3SI7A 5EJEA 1Z0DA 3KJGA 4Q18A 5HKKA 5B2ZA 3T1VA 4G3XA 3U61B 4FINA 2GESA 3CIOA 2MSEB 1AN0A 1ZAKA 4XD7A 3T5DA 1RC8A 2A3RA 1J8YF 5BQ5A 2CK3A 4H1UA 4PFSA 1FX0A 2DR3A 1MOZA 2C95A 3CH5A 5FPKA 2QNRA 4A2WA 1N5IA 3VHLB 4C0QC 1OB2A 2DY1A 5EP2A 1RRPA 2W58A 2L0XA 3LWNA 2QGNA 5JZVA 1KDRA 1P61B 2JAQA 4I1OA 3A4MA 4PC3A 2YJTD 3RWMB 1GRNA 3V4RA 3IIMA 2KBFA 1OFHA 1VYTA 1OKKA 1H8HA 2CE7A 3QKSB 2AK3A 2N42A 3GJ7A 1QHXA 1U9IA 4W7SA 4B6FA 1UKYA 1X86B 3AQ4A 3AKCA 4JSYA 6Q21A 3EA5A 1KK2A 4Q48A 1Q3TA 1KO4A 2PJZA 2BJVA 4PZLA 2IYWA 4Q9KA 3SFZA 1U0LA 1TU4A 2AKAB 621PA 5DE3A 1P6XA 3RS0A 4WA7A 2VHTA 4ZIRA 2BOVA 3O8DA 3CRRA 5C2JB 1DO2A 1ETUA 2QM7A 4M9XA 3R8FA 5EP3A 2FNAA 1GAJA 4LBYA 4XD7D 2HXYA 2Q21A 1TPZA 4DSOA 3AH8A 1CR0A 4YXWD 4MGKR 3WRXC 5SZKB 3RLFA 2FFAA 3MG9A 4XJXA 1OXVA 1GDDA 3OE7D 4JLKA 4ZDKA 4ZIRB 1XTKA 1KDPA 1E6CA 1OSNA 4PTLA 2VTKA 1OE0A 2Q6TA 5KOYA 2IC5A 1UJ2A 1XWIA 1V43A 3SS8A 4EPWA 3A6PC 3ADDA 1D5CA 2EW1A 1CR2A 4TZ0A 2G88A 1XRJA 4V0OA 2XJ9A 2OO7A 4HAZA 4IDQA 4TT3D 3HPQA 4TQUS 4TSFD 2C9YA 3O8RA 1TQ4A 1M1YE 4M4SA 3UWKA 1SXJE 5DN6D 1E2JA 1IHUA 1AQYA 2G1JA 2YYZA 2ZANA 5FUWA 5K8TA 2JLRA 2DFTA 3JVUA 1M8PA 5FPHA 1SULA 2QT1A 4HUQB 2J5XA 4UXHA 3AVPA 5BYJA 3RSLA 2ORIA 1G7CA 4LYAA 4B47A 4W5JA 1VIYA 1ZM4A 1W49A 2CHVA 4TL7A 1HURA 3IUYA 3LLMA 1L4YA 1NP6A 2B92A 4EQ6B 4OQXA 1E98A 1T0JB 1UM8A 2BBWA 3CPJB 1G291 1X8KA 1LS1A 1AK2A 4KODA 4A6PA 2XGJA 4RFSA 3VFDA 3GLIE 1IAQA 2CLDX 4Q9LA 3LO5A 3OEHD 1IBRA 4F7WA 4URXR 2FEMA 2QBYA 2IS2A 1J2JA 1O87A 1AZTA 3CF2A 5TARA 1ZCAA 1WE2A 1TL7C 3T06B 4B34A 3PEWA 2LWIA 3UG6A 4DLXA 1LNZA 4L4UA 5FR1A 4A8JC 3K70B 3CNLA 1G3UA 1WP9A 4WIAA 4WBSA 1FMLA 3L8YA 5E4FA 3PVSA 3BORA 2QAGA 4O2LA 3Q8XB 3TR5A 2V7QD 3GFOA 2Z5FA 2HV8A 2PX3A 3EZ9A 4DB2A 3QVVA 2GK7A 5EP4A 2V6JA 3F3YA 4ITRC 2ZUBA 1PJRA 2ZYWX 4FMCB 3FDIA 4CYMA 1ZM2A 3K9NA 1XZQA 2J3EA 3FKQA 2BMEA 1XD2B 3JVVA 4LHZA 2FN4A 4GRAA 5DI3B 4WXPA 3IEUA 4HLUA 1OFUX 3GQBA 4G5GA 4Q7LA 2FU5C 1S9HA 1G3MA 1SVLA 1COWA 1X3SA 2KI5A 3RS5A 1Q1BA 3H2YA 2ZI5A 2HJVA 3ZLJA 4JBXA 3RDPA 4QJ3A 4RKEA 3BH0A 4TYWA 2JA1A 1Z0KA 3I5YA 1KJWA 4B44A 4US2R 5C18A 3K09A 1ZMXA 2D7CA 3TH5A 3EWAA 3KJEA 4MUBA 2ZPTX 2BJWA 3R7WB 3QY0A 1KYIA 3GJ3A 4Q4LA 2A7QA 3BS4A 2QU8A 3BB1A 2O0KA 1UBGA 1Q20A 2V7QA 2ZI4A 3IBYA 5FOTA 4R71A 4AI6A 1DAIA 5A4JA 4JBYA 4TTPA 1GKUB 4C2TA 3AUXA 3BFXA 4LSGA 5DHFA 2JJ2D 4KLZA 2XTZA 5FTMA 4DEYA 1T3HA 4QNRA 1PZNA 4JL8A 4ZPXA 3K9LA 1G8YA 2A78A 5GJVC 4HATA 1II8B 5DHAA 2G1KA 5J4LA 1OXXK 2X2FA 4D0LB 1TNDA 2C96A 3PUVA 2NO0A 1MV5A 2ZJ2A 5A5GA 2KJQA 2XOKD 3EZFA 1VCOA 5L3QA 3RAPR 3FPAA 3K09C 3QXXA 1VHTA 3AVQA 2JJ1D 4OI0A 3AVWA 2V1UA 2FFBA 1GNQA 1JXMA 4TMZA 3B60A 4BFVA 2HYDA 5KUTA 2ODWA 3TJZA 1D2EA 1OIWA 2IEYA 1U81A 2AWNA 2ZRHA 1E69A 1M74A 5EXPA 4NL4H 2J87A 4NZYA 1G5PA 4U00A 4GOJA 2ANBA 5AK0A 5LB2A 5TY0A 2WSSA 4JSTA 3VAAA 3KKQA 5FTNA 2O8CA 4J0QA 5L3VA 1U8ZA 1NN0A 1N6NA 3NC0C 5GVSA 3LFUA 1E9CA 2ZXUA 3KQUA 1OFIA 4O25A 2VP2A 3QF7A 4UNNA 1R0ZA 3BERA 1CR4A 4OK5A 3MWKA 1K5GA 1LS6A 3WYGA 4B48A 2ANCA 2ATVA 3P20A 4B3GA 4CDGA 4BFXA 1E2HA 2GKSA 3CPEA 1XBTA 2HF9A 1PV4A 1NG9A 3VKHA 4ZKDA 4Q9IA 3GPLA 2JIZD 4A1FA 1GKYA 2CVFA 4EPRA 2P3SA 1EFTA 3B9PA 4ASUA 4D80A 3R9WA 1ZCBA 4Q4JB 5H1YA 1EGAA 1Z0AA 5HCIA 4BQSA 3JZMA 3B78A 3EIEA 2MSDB 3LRPA 3QBTA 2D2EA 2GCPA 4Q7KA 4UNRA 1GVNB 3MJHA 2NO7A 4Q66C 1XPUA 4PHGA 4IOMA 4Z8YA 5HPYB 2BDTA 2CE2X 5AUPB 2GVZC 3GJ6A 1T91A 2AD5A 5AJZA 1N6LA 4OQNA 4OI4A 3PENA 1DO0A 3THXB 4RD3A 2FE4A 2XSZD 2WKQA 4M0LA 1YU9A 2WAXA 2FH5B 4G1UC 1GILA 3GJ5A 3AVXA 1XXHA 1BS1A 4NYJR 5HZHA 2QP9X 1F5NA 3LVRE 3B1VA 4PQRA 4Q5IA 3PFIA 1U90A 3RS4A 2FFHA 3AKEA 5G3ZA 4ZI2A 1TQ6A 1TQDA 721PA 4NH0A 1KAOA 1ZBDA 1YVDA 1IN4A 2OBMA 4Q47A 4BFYA 1ZRHA 1G5TA 2Z0MA 1MRSA 1ZUIA 4R7ZA 2OM2A 2PMDA 2PH1A 3Q85A 2ZE8A 4LRWA 5EZ5A 4C0JA 3X1WA 5DLQC 3VR5A 4D4KA 2IYQA 3GJXC 2O8DB 2VHQA 1Z5ZA 4YDHB 2OAQ1 1SXJB 4JBWA 3FMFA 5EUQB 1XEXA 2GEDA 4G5RA 4ABYA 3OE7A 4QGAA 3V00A 4C7OB 4YMVA 1Z22A 1KI1A 4LHXA 3BWDD 1VG0B 4PPGA 2TMKA 1PLKA 3KKOA 1VCIA 1EX6A 2FA9A 4UKDA 2RGNC 3SU8A 2PBRA 2V54A 1G20E 2RGXA 2FZLA 3DKVA 3ZDQA 2C9CA 4R9UC 4A0GA 4TT3A 3EZ6A 1S3SA 1LF0A 2FZ4A 5JS7A 2PZFA 5KO2A 2DYKA 2OUKA 1W0JA 1XPRA 4JL5A 4W5HA 3NBZC 4LJYA 4R2HA 1ZD1A 3T1TA 1C4OA 2EYQA 1KDTA 3HDTA 3HYTA 1W48A 4V0NA 1FL9A 1SXJA 3KJIA 2CBZA 2YKGA 5FBLB 2QL6A 1W44A 5B57C 4EQ6A 5FL7A 3U60B 1NLFA 4YMUA 1SXJD 1HY3A 1B23P 1A5TA 1HE8B 3AUYA 1KK0A 2FFQA 1PUJA 4A2PA 1F2UB 2J7PD 1SKYE 1Z28A 1HH4A 2FJUA 1RPZA 2PMKA 2JLXA 3X1YA 2QSYA 2FPKA 2F6RA 1DADA 4LI0A 4DKXA 5JWRA 1G5RA 5J40A 5HCNA 1VMAA 3V9PA 121PA 5EXTA 2D62A 2R6CA 3DVLA 3ETLA 4Q01A 2J0QA 2NPIA 1DG1G 2A5YB 4HDCA 4KO8A 2ORVA 2Q9AA 3DZ8A 3S1AB 3CWQA 3K70C 4JL6A 2DHRA 2XX3A 4I99A 4BWYA 5KPDA 3ONWA 3CX7A 1UAAA 2VRWA 1BH2A 5JHGB 3MMPA 1UF9A 2PL3A 2BWJA 4CEJB 1Q22A 2V8OA 3ND8A 3VR3A 1UDWA 4B73A 4P32A 3SJAA 4DIDA 4EJSA 1RJ9A 1N6OA 1VCMA 1KSHA 4NYJQ 1KAGA 2ZYVX 2YOGA 3BH7A 4KI0A 1XMVA 3O8BA 1OIVA 2DWOA 3I4LA 4Q03A 3V4FA 2QN6A 3SHWA 3W9YA 1Z6GA 4UQOA 3FE2A 1KOFA 2IHYA 3KUCA 1U8AA 1E2KA 2WPDA 3ZZTA 1E1QA 2VIIA 3EPKA 1E1RD 3Q5DA 2C5LA 1MKYA 3FMPB 4M22A 4B3BA 5L3SB 5FOSA 1NI3A 2J7KA 1ZYUA 4LYFA 1YZLA 2RGAA 2WPDD 2OILA 2VO1A 2WKRA 2WM9B 1FZQA 3BBPA 1BYUA 4X8OA 4POAA 4QM6A 1E1RA 2BCGY 2ZR0A 2PCLA 5KSYA 4NCJA 4OHVA 1T9HA 4LPSA 4HAXA 4MYTA 1S8FA 4MYCA 3KXKA 4IOJA 5FUXA 4A0HA 1E9DA 1Q1ZA 1KY2A 4OK3A 3OAAA 5DYGA 3RRZA 3EAQA 3NWJA 1YZNA 1R0YA 2GJSA 3WBJA 2ECKA 1SVKA 2XNDA 3KDSE 3GD7A 1KTVA 3M4YA 1QZXA 3L0PA 3RHFA 4DCUA 4LJ5A 3I61A 2RAPA 4QHSA 5E7JA 3VMFA 4DDTA 3CR8A 4FWIB 3ECCA 3ADKA 2IT1A 2QY9A 2REXB 3U7EB 1TMKA 5G41A 3MUFA 1HV8A 3KKPA 3BOSA 2EFDB 1E1QD 1UKZA 3KB1A 3U7HB 2KB0A 2V9PA 2GETA 2NGRA 1ANKA 1E2DA 2WTUA 4GI7A 1R8SA 5JWHA 2BBSA 4JZKA 2D06A 4XVQA 1JQLB 3LXXA 1SVOA 1P60A 3SQXA 3THWB 5AUQA 1TF2A 1FW6A 2QTHA 4RCZA 4CEJA 1MH1A 3CKLA 3PV0A 4AC9A 5JWOA 5F9FA 1UBCA 3MSXA 2RGCA 5FH9A 3ZIAD 1E99A 4DCVA 5C46F 1RJ9B 4BFUA 3WHLA 1CF4A 4B3CA 2QROA 2ONKA 4KYUA 2HF8A 3FB4A 1MO4A 2C77A 5FL3A 1G7TA 3K0AA 2QG6A 4AD8A 1E79D 2ASEA 3C41J 4TMVA 5GJCA 3FOZA 4KV9A 4RZ2A 1KK3A 1L4UA 4OKSA 3KL4A 2B6HA 2G3YA 1NVUQ 3R9XA 2GDJA 3J81k 3NBXX 2JASA 1PLJA 2NO1A 3U6KA 4TYNA 2IK8A 4I81A 3NG1A 3NEYA 3HR8A 2FV8A 2Z6VA 2WSMA 2JLQA 4US0R 4NHOA 1A4RA 1KJYA 3L2OB 3PEYA 1N6HA 3KKNA 3RABA 4AYTA 3NDPA 2IS6A 4IXMA 2Y8EA 4B76A 3DO6A 1BOFA 2R44A 221PA 4NKRA 2HLDA 4BFZA 2ORWA 3NDBB 2R6GA 3AF4A 5JRZA 1DAFA 1QF9A 2NG1A 1G41A 2VHJA 3IKJA 5TXGA 4AWXA 1XTJA 1P62B 4QL3A 2QAJA 4Q21A 5KHOC 4P33A 3FFAA 3B7GA 5L3QB 2D3WA 2UZIR 5IK2A 2HLDD 4PAQA 4LCBA 4WOPA 2YZ2A 3SYNA 4M9QA 5JRJA 1KIMA 2F3TA 4B3XA 1DAGA 1XB2A 1U8YA 3CW2A 4L16A 4BPBA 2F7SA 3LW7A 2ZE7A 2KWIA 4QKQA 5HR5A 5D3MB 1NLZA 4NONA 3QXCA 1FNNA 2QAGB 3PUYA 5EZ6B 3P27A 4YXWA 1G4AE 4BEJA 3ICEA 1E0AA 1P7CA 4IVRA 5D3MA 2ONJA 3QG1A 4EFLA 5JJLA 3CNOA 1II0A 4G5SA 1TX4B 1RYHA 3HR7A 3L0SA 2QA5A 4S2EA 4EKDA 1ZC4A 1D9XA 4A0FA 4GOXA 2IS1A 3QPWA 1NJGA 1IXRC 2R2AA 3A1WA 3WMFA 1XXHE 4PPNA 2XITA 4TLEA 2Q3HA 4WZAE 1NVWQ 1E9AA 4RFSB 1E9RA 2A9KA 4P4TA 1XXHB 1QRAA 4TSFA 4QG7A 2ZRJA 1FQKA 3B2EA 1JPJA 5DN6A 2AR7A 2FSGA 5KNBA 4I1UA 1N0WA 1DAHA 1DEKA 1K8RA 1P2UA 5CM9C 5JEDA 4TYQA 1ZM7A 3I72A 1OV4A 4BE7B 5DIFA 1CLUA 2QGZA 4KFRA 3W3ZB 1Z2AA 3LLUA 3TSWA 4TLAA 1VG1A 3DM9B 2CK3D 2GBLC 1US8A 4QGHA 3QPUA 2NMVA 2DFLA 2NZJA 2VSFA 4K8OA 4MGIR 1TTTA 4MRSA 1E9SA 3K9GA 3B6EA 4QM7A 3EZ2A 3K1JA 4YMWA 3OEHA 1TF5A 1GKIA 1Y3AA 2D4HA 4NCKA 1KK1A 2ZRLA 1OKKD 1FQJA 1KI3A 1CIPA 4D26A 4JLNA 1M7BA 2RGGA 1N6RA 1RE0A 3QKTA 1TUIA 3NIBA 4M1MA 5KSPA 1UEIA 3RS2A 2ZI9A 421PA 1WBDA 4EPTA 4DLYA 4QGGA 3W8RA 2P2LA 1DVRA 1CXZA 4PHTA 3C14C 4LOAA 1AZSC 3GLFA 3U5ZB 4FN5A 5CYOA 1S9DA 2IYTA 1DTSA 2PJRA 4A0RA 3O47A 2J0UB 3VX3A 2G6BA 2AWOA 2GF0A 3T34A 3IEVA 5DO9A 4II7A 2ZI3A 3QG5A 3T12A 5B64A 4H9GA 3NBYC 1BKDR 1IY0A 1W2GA 4JIMA 1TEXA 4LV6A 4Q9JA 1J70A 3BC1A 3ND9A 2WBLC 3NHBA 5CM8B 4UJ5A 3QI2A 4MDFA 4PQFA 4TL6A 5FBQB 4O2RA 4W9MC 4L8GA 2W6JA 2IWHA 2CVHA 3IHWA 1Z0FA 2RGBA 4DVGA 2V55B 2OXRA 4TTRA 2ZJAA 1YZTA 2W6JD 1IY1A 3X1DA 3C8UA 1KO1A 2ZQ5A 5J4KA 1U98A 3RNLA 4RZ3A 2F55A 3RYTC 2PZGA 3F8TA 2QRZA 4NYMR 5DSZA 3TKLA 5C4GB 1T4GA 3CZPA 1LY1A 2ZYTX 4UNPA 5FUYA 5CB8A 3KB2A 4QHTA 3OFNA 1GRQA 2QPTA 2IW3A 3K0CC 5BYKA 4TMTA 4AK9A 1FUKA 2GAAA 3GLIB 1Z07A 1ZC3A 5AR1A 4Q1BA 2H8KA 1SQ5A 1HEIA 3EPLA 4OBEA 4OHWA 4WAUA 1I2MA 1OXTA 4KFUA 2J41A 2REOA 2VHUA 1P2VA 1W4CA 3R7WA 1FNMA 2R6DA 4WW0A 1R0XA 2FGKA 2LCFA 1XX6A 3HYRA 3MJRA 4HUTA 1KZGB 1D2NA 2QE7A 1GRRA 2OZEA 3KXLA 4Q1CA 2FOLA 5EE3A 3SYKA 1F48A 2FSIA 5CIWA 4MKGA 5G53C 2HCJB 3B1XA 4IDPA 4BLTA 4A9AA 4IDHA 5DISB 4X8MA 1IN7A 4DUGD 1NN5A 5LDDC 5UKDA 4D2IA 1WDTA 1DARA 4C0AC 1D2MA 1NBMD 5KDDA 4K81B 1Q12A 1KNXA 1Z2CA 2PLFA 2BKUA 3DZDA 3OEEA 4C7OA 1JEEA 1JJVA 1NIPA 2F43A 4RKFA 1EWRA 2MMCA 2WWHA 1F2TB 3TMKA 1XJ0A 2JLYA 1P75A 5F9HA 2GXQA 3UWOA 1FX0B 5JBQA 2WJIA 2VL7A 4RSGA 3VU9A 1N6IA 1K5DA 5EE0A 3EPJA 5KU1A 1XD2A 4HDOB 1D9ZA 2X8AA 3VR4A 4QBGB 2CCJA 2C98A 4UXIA 3AM1A 2HT1A 2VYFA 3GFTA 1JR6A 4C0BA 1E9FA 1Z6YA 3W5JA 1COWD 3TK1A 3I92A 3M1IA 4HYYA 4RD6A 4RJLA 4TLCA 1PVOA 3CX6A 2ZJBA 1ELOA 3Q7PA 1W47A 4DWJA 1F6BA 4G5OA 4BLOA 4N1AA 4PO9A 4OQMA 1FP6A 4E22A 2ZVQX 1CR1A 4Q4AB 4ASUD 1AA9A 1W4BA 3W8NA 1KSJA 5CIQA 2R8RA 1ZUNB 4D4MA 2JLUA 1EFCA 4ZI3A 1OH7A 1G8PA 4HAYA 5SZIA 2ZM5A 3U44A 1SXJC 3CF0A 4FIDA 4Z51A 3AVUA 1JECA 4DJTA 1QBKC 4PO1A 5J5CA 4GBMA 3GCGA 3OIVA 1W1WA 3A37A 2WWIA 4QJ5A 2C8VA 1YZGA 5FPSA 4LX0A 2JDID 4LHYA 1Z06A 4QHYA 4A8JB 2YWEA 2XAUA 1Z63A 2AD1A 4D0NA 1YR8A 1OJLA 2WJYA 3AKDA 3D6TB 4LJ4A 3WHKA 3K53A 2F1IA 1I4LD 2ZI7A 3U3JA 4B3FX 2FG5A 1CTQA 3T1OA 1XD8A 2A5JA 2BBTA 2REBA 3CRVA 1WMSA 1U9IC 5KSZA 3K0FA 1YRAA 2JJ8A 3IDQA 4DZZA 5L3SA 1P3JA 4F93B 1J8MF 3JZAA 1DBSA 2OHFA 2E9SA 1KMHB 4NPHA 2IXGA 5EXXA 2H18A 1IN8A 3ICQB 4A36A 1CJVC 3UATA 5EE9A 3NXSA 4PQYA 1XCPA 1Z08A 2AFIE 3TW8B 3ZQ6A 2A5FA 4KSCA 3I5XA 4RVCA 1GNPA 5IRCD 4E5UA 4L9SA 2GTPA 2X2EA 4Q4HB 2ZIAA 3VTKA 1DAKA 2GNOA 2OCYC 4WVFA 2WMNB 1OW3B 4GT1A 2O8EB 2O5VA 4A82A 2AXNA 2WOOA 5J4YA 1UKEA 2WWXA 1JR3D 4Q4AA 2XZLA 4OHZA 1YRBA 3LAWA 1U99A 2IYUA 2ZRBA 2XXAA 1W36B 3VR1A 5HZKA 4XSHA 1MO5A 2Z43A 4LZZA 1GUAA 1R10A 1G21E 4DLUA 4XWKA 2QQ0A 4JJKA 3TVDA 3BB3A 1AIPA 4DC9A 1E3MA 1OH5A 1P2SA 2CCKA 3LBIA 4E07A 4AY2A 4RD1A 2ZRKA 1W0KA 3DDCA 4LJ8A 4FMDF 2OESA 3QXHA 1NJFA 1US8B 821PA 5D3QA 2IHBA 4X8HA 4IJMA 1Q1QA 2F43B 4JLMA 1L2TA 2D7DA 1GTVA 1JQJC 3K0CA 3EA0A 2VPPA 2K5UA 1CJUC 2AHOA 1U0HC 2E87A 1BIFA 1TF7A 2FSHA 3LA6A 1OT3A 3CRMA 3SC3A 1DE0A 4M1YA 2NO6A 1CJKC 3K0SA 4PZZA 3ZVMA 2EFCB 3I3SR 4QRHA 1OLOA 3MCAA 2IUSA 3VKGA 2JLWA 3T15A 4D0GA 1Q1EA 3QXSA 4GMXA 5J4VA 1H8ED 3TBKA 2VA8A 2NTYC 4MYUA 4M8NE 4M9ZA 2GXSA 2E1RA 3IIKA 3QEJA 4LC1A 3FHCB 3PEVA 1G64A 4Q1EA 1VYVA 1ZNXA 4V02A 2ZSAA 1ZNWA 2YOHA 5FL7D 4BLRA 1M2OB 2UZ3A 4NU0A 4NCIA 4TWZA 4TQAA 2JLVA 4G01B 1DELA 2A5GA 4DBLC 2P5TB 3TR0A 4TLBA 1GOTA 1HT2E 1YZUA 2GEVA 1E2QA 4KCGA 1LV7A 2ERXA 3GLHB 2XZPA 1YZKA 1IXZA 1E2PA 3RS3A 3W5IA 3N2EA 1Y63A 2GJ8A 2Q3FA 1N0VC 4LWZA 4BFWA 4C0HA 4FI3C 2VF8A 3TQFA 3FHTA 2WICA 4OL0A 3BE4A 1SHZA 3QEOA 2I3BA 3CM0A 2BVNA 4Q1DA 4N0DA 4U7DA 1VYUA 5LBIA 3U2QA 1EFRA 2QTVB 4NCHA 4BZQA 3O8CA 4ZCIA 4PO8A 2ZSFA 3WMGA 2H17A 1D6JA 2AL7A 1W0JD 4JLJA 2YWFA 3NH9A 4YQFA 2PCJA 1G9XA 1RFLA 3HU3A 1TQ2A 5CITA 4IRUB 1R5BA 4BECA 5BWMA 4O0MA 1G7SA 1CKEA 3I1FA 4HB3A 3T5GA 1E4YA 2VSXA 4DSNA 3H1TA 1TUEA 2GCOA 4M1KA 2W2TA 2WIAA 2CNWA 1NSTA 1YE8A 3UXMA 5JCZA 2EFGA 3X1XA 5LD2C 3DPUA 3AGPA 3BFKA 3U3OA 1TADA 3PG5A 2C78A 3EASA 1PLLA 4P3YA 1JJ7A 4F91B 2JATA 3VNVA 5ANRB 3A58B 4LV5B 4KSBA 4KAXA 5E3HA 4D4LA 5FTLA 1E2GA 1ESNA 4DSUA 2JCSA 1ZVQA 4FCVA 4LV8B 3TVTA 4ZDWA 2V1XA 2Z83A 4HSEA 1WA5A 3B5JA 3NVAA 1W36C 5JEEA 3B9QA 1CP2A 4IFBA 4W5WA 3SJZA 3SZRA 2XNDD 4LHVA 5DYIA 5F3WB 4U5XA 2IS4A 3WNDA 2BIFA 2VSOA 5FOWA 3CUEF 3E70C 1W5TA 3MWLA 2PT5A 1E2MA 3THWA 2CMKA 2O8CB 4MH0R 1E79A 3ZZUA 3KTAB 2ZRIA 2CL6X 3QF4B 4Q7MB 4Q1AA 3W3AA 4OK6A 3W90A 3WMEA 2H1LA 1UBEA 1U0JA 1XTSA 4Q7JB 5K8UA 3QF4A 3ZJYA 2ZAMA 4KFTA 4HZUA 2ZTSA 3D7MA 4I1SA 1E96A 1NN1A 2WWFA 3AGQA 1NVVR 3NTUA 5TVKA 2ZRNA 4DLRA 3THOA 2ZSDA 3HWSA 3EW9A 4ESHA 4LJ6A 2R9VA 2B8WA 2GZDA 3IIJA 3K0FB 5HE9A 2FX3A 4RD0A 3BRWD 1KY3A 4ZDJA 1VKJA 2R6AA 3KZ1E 3IBGA 1G4UR 3HU2A 4Y0AA 1KMHA 4JLVA 2BBOA 1IM2A 1VECA 2GVDC 1CRQA 3GLFB 1G3IA 4PXAA 2QMEA 1T5LA 5DI9A 5AWFC 4BFSA 2IYVA 1MABB 1EX7A 3TNFA 1A1VA 2IYSA 4YC7A 5EXSA 2Z4RA 1W36D 2B8TA 5E7MA 1QHSA 1E2IA 3I62A 1C9KA 2C03A 2VP6A 2EU8A 4R98A 4OI1A 5IK2D 4GZLA 4YMTA 2J9RA 5K8LA 5LPNA 2WOJA 4PC7A 3NEJA 4WZ6A 3F0TA 1IONA 1SVIA 2WSSD 2BM0A 1XFAA 3NHAA 3X2SA 5CDFA 1XTQA 2XOKA 2HEIA 2W6ID 1GP2A 3ADBA 4BRUA 2H16A 2MMGA 2VP4A 4LYHA 1DG3A 4MQBA 2NPFA 4AKIA 4HAWA 2YINC 2KSQA 2ZR9A 5H8WA 5CJPA 4Y0VA 4DRZA 1I2DA 1VDZA 1KI6A 2ZRCA 4XTRA 1E9BA 1RVDA 1SVMA 2F1HA 4KU4A 5E95A 4BZXA 3HJNA 4PR0A 1WBBA 2XNSA 1J90A 4UXJA 4BLQA 1ESMA 2IBMA 2QSZA 4IOKA 3VX4A 4V0ME 4YLGA 1ZIOA 5CLQA 1G6HA 4B6EA 1N25A 3VQTA 3BFVA 3FKSD 4D81A 1XMIA 5HKKD 1KKMA 3C7KA 4KFSA 1G1MA 2H57A 2ZRGA 3FYHA 4XVUA 3NH6A 1VPLA 2GWHA 4DLWA 2O8FA 4GPTA 2ZREA 2Z4SA 4MRNA 5JSZB 3FGNA 4JYCA 2ZUDA 3ZVRA 5F98A 2FWRA 4BLPA 3TSZA 3IHLA 1BMFA 2IXFA 2W6IA 5KSOA 1XDBA 2OFXA 1EWQA 2AKYA 3SDZA 5BN4A 2ZETA 4JLBA 2JIZA 1BYIA 3RS7A 3ZD7A 3RRNA 3VNUA 1AKYA 1HTWA 5JHHB 1NMZA 4KBFA 2ERYA 2GILA 2OFOA 3B1YA 4ARZA 5KYKA 3RVBA 3ZD6A 2YNMA 3PITA 1LVGA 3GLGA 1KI6B 1JPNA 2F1RA 3EXAA 3WBKA 4CEIA 2RGNA 1DAMA 2RHMA 3L0OA 4IHQA 4EDHA 2NQ2C 3UKDA 2Q0HA 2DFKB 4MRVA 1QVAA 2WJJA 4EPVA 4DT1B 4EUNA 1JALA 4TN1A 3BB4A 1P9RA 1II9A 3FKSA 5BN3A 1M6NA 1R2QA 2DBYA 1NN3A 1P4SA 1ZINA 4LC0A 3N70A 1W0KD 1X8JA 5TMPA 1ZJ6A 5KPJA 4PSAA 2NO9A 2QENA 1HUQA 2GCNA 3SN6A 5JJKA 1GWNA 4TMKA 4UJ3A
chains in the Genus database with same CATH superfamily
4J0GA 2E6KA 5HJ7A 2YRFA 5LSAA 2JLSA 4QUBA 3O1JC 4FSXA 1FS6A 2QVYX 3MAAC 3N2ZB 3AL0C 3FYUB 5AK3A 4YMGA 4I55A 4G0XA 3ZDFA 2H4ZA 1OVGA 3GEEA 4K2HA 5AW3A 2VBCA 4PSDA 1YA6A 4YP5A 1W2WB 3TAUA 2GJ9A 5K0TA 2IYOA 3S1SA 4DY6A 5F52A 4P31A 4Q4DA 2CDNA 1Z82A 3MBKA 3TTWA 4NJMA 4DM7A 1YDMA 4EJSC 3LY5A 2JFYA 2PRJA 2XXAB 4GX0A 1OBVA 4QPJC 1A27A 4CIAA 4RY0A 3ISTA 3KHKA 2VXYA 5HQ3B 2GLUA 1RR6A 1YIOA 1T8TA 2C5HA 2QUKA 2O7NA 4KIGA 1K7SN 2ZXEA 1Y8QA 2UVQA 3GMIA 4BQPA 5LP1A 3P0HA 1EDDA 2I4MA 3BWVA 2PGDA 3CNNA 3JASB 4NBSA 5AYVA 3TNDA 1SEVA 3GP8A 3Q0TA 1UXGA 1VZ3A 2YZNA 1Z8HA 2DHCA 2EW2A 3G5UA 3I0NA 4Q6BA 4QODA 1N3BA 1O58A 3K1TA 3ACCA 2W6NA 3N07A 1PBTA 2OE2A 1ORWA 16PKA 1DDOA 4XSGA 1YQTA 3Q9LA 4PIMA 3G0CA 1LSOA 1GPBA 1RI3A 2IIQA 1AUPA 5I9LA 2P2CA 2IEZA 3G6WA 3HCWA 1O94A 4L3VA 4LPKA 1KJZA 3SF8A 1WMEA 4MVXA 5L40A 4LCJA 3R3HA 3HXMA 1YS7A 1YQXA 2NXNA 4LK2A 3IP8A 4M98A 1KO5A 3BWEA 5BWNA 4GFDA 4XQ0A 4ZTBA 4LDZA 2R6FA 3OT1A 5DNYB 4Q1VA 2X41A 1KE1A 2G09A 1KSGA 1A50B 2LE0A 4PC2A 3RCBA 2BEKA 2QX4A 3ESXA 4GQIA 1G98A 4BXOB 5LQSA 5M04A 4JLDA 5FWDA 1JB1A 5KSWB 3EVGA 1BE0A 1SUBA 2ADOA 2C5AA 1GQOA 2FF5A 2FYTA 3MJEA 4ML3A 2ZT8A 5SZJA 4DV6B 2AK2A 4PYNA 2I8LA 3GEHA 4Z3DA 4EF6A 3ZS9A 1QO9A 2GYYA 2VDNB 2XWQA 2JI8A 2JZNA 4OUKX 1AM4D 2DCUA 4Q05A 2G0TA 2LDXA 1FPMA 3KQQA 5CXXA 3OLXA 2WYOA 4GYKA 2AYYA 1QHGA 4CV3A 5I7WA 3P9PA 2WB2A 3PQ7A 3AFNA 4IV5A 4IW3B 2IYZA 3AP1A 5JXHA 2IYYA 2BHTA 3GCXA 2GEJA 4JEMA 1G8SA 4WLFA 4KR7A 3OOEA 3ZGYA 2V6FA 2R1ZA 4S1NA 3E4DA 2I3AA 4GNKA 4J0FA 4R01A 3W9UA 1XZPA 1OWLA 5ALVA 2PYDA 2XQJA 2WWGA 3CF4A 4DIEA 4I50F 4Z53A 5DU2A 1EK2A 3ZNNA 2JJ2A 1GEEA 3K16A 4Z5XA 3IOYA 4QVGA 3VU0A 1KJ8A 2VJMB 3D1VA 4ZAFA 3TN7A 4F3NA 1JFLA 2CHGA 1N75A 1Z75A 2QP3A 2N0SA 2QG9A 3VR2D 1FTSA 5I3ZA 1DX6A 4D8WA 4BGUA 3JQ7A 3QZUA 1GUYA 1Z6TA 3D4IA 2ZIGA 4IHKA 4X71A 4B74A 2PMFA 5IW8A 4IV0A 1VHLA 1VGQA 4BX0A 4BBJA 1FLAA 4YRCA 3R20A 3HDQA 2JD0A 1QSGA 2ZRMA 2JK0A 1V2GA 4M1TA 3H4VA 4WLOA 2WMOB 2AUTA 2IDJA 3ZE6A 1XZKA 4P7BA 1KQOA 1OZ0A 1ZM9A 3CHYA 3LIPA 3KYCA 3KTOA 4FBMA 4S1VA 1W30A 5ICFA 2PLAA 4DC0A 3LKBA 4A5SA 4DV5B 5ELXA 1Q17A 1IJEA 4G07A 1T4CB 5FPPA 1VJ0A 1DKNA 3QHPA 2Y66A 4UMDA 1QIMA 1QVRA 2WG1A 4JH0A 4UNSA 4D4JA 5GZ3A 3K9CA 1FFYA 4XOIA 1JQBA 3OZXA 3PXDA 4IWNA 4NZZA 4BGDA 1QK4A 2Y4NA 1SKQA 2HJHA 4QOSA 1A9ZA 2QAGC 5AOAA 4I5FA 2R7NA 4TL9A 1LA2A 1ND5A 1Q7RA 1R74A 1I2CA 2QZ4A 2WAMA 1JU3A 1DQYA 1TDJA 2XCOA 4NCNA 1X7YA 5C51B 4IIEA 4CG1A 2PZ8A 4J4BA 1IN6A 1JAZA 2DFNA 4K6CA 4QQ8A 5AI6A 4ZQHA 1AS2A 4RIGA 4H7EA 1DINA 5CDYA 4BNTA 5GINE 4PLHA 4U2FA 3R7FA 1NQ5A 1D8TA 2JJQA 1AKVA 1X1EA 3GJ0A 2OQIA 4PX3A 1FTNA 3QVSA 1NDUA 2WKPA 2XH8A 3IQXA 2C2WA 1YR7A 2VUUA 4O8ZA 5D5HA 3SJUA 4HRAA 1M6WA 5J3JA 2XUGA 3A9VA 3UK6A 2C7PA 2I2FA 3DLHA 4R1SA 3CB2A 1Y7IA 5C1PA 3MB5A 2FUCA 2WHXA 3EJWA 1GQFA 1YBMA 1H9BA 4OU5A 2OV8A 1OI3A 4NV3A 4ON9A 1UWKA 2ZKLA 2VEDA 1R5OA 3FHOA 2NO4A 1JW9B 3AZQA 3GL9A 4K6HA 3ZHYA 4CE6A 5CA1B 2XVXA 3QBVA 3SYRA 1RQRA 2YVUA 3KB8A 3ZGLA 1JHVA 4JVOA 5DOZA 3GZJA 1WU7A 1N5LA 1ZMTA 4UVHA 3TKYA 1V0JA 1ZGJA 1YS1X 1PGQA 1REQB 4BGEA 1VB3A 4BFLA 3C15C 2HJWA 3DGFC 3QKUA 4NBVA 1WF3A 5DI3A 1SCBA 3A3PA 3EC7A 3F67A 4FNGA 1ACJA 2EF1A 3EIHA 2NV0A 4JT8A 4L74A 3LX5A 4LZLA 4P36A 3CX8A 2C94A 1RRMA 4LIPD 2VDMB 4HDQB 4BZWA 5EP1A 1CV2A 4FU0A 2P7HA 5AM5A 3KAKA 1E3JA 5DMXA 5AW7A 4BE9A 1XCMA 4FE3A 5LC1A 2EKBA 3WLTA 5FUMA 3U4QB 1P8JA 4CIWA 5E1DA 1HFWA 3BMXA 2YHSA 4M38A 5M3BA 3CTMA 2GFQA 1WKVA 2I4OA 1E3QA 5COBA 4M0DA 6GPBA 3X3HA 3L0YA 2VJPA 4OY3A 5BW4A 4L7VA 1B4DA 3Q8MA 5K8IA 2LW7A 3GD5A 2YWRA 3I9NA 5KTYA 2Q0SA 2QEQA 5BR4A 1U9YA 3GT0A 2QTLA 5DCYA 1GQYA 2Q46A 1P2GA 3FI0A 1K7EB 1Q6ZA 2BKEA 2VWPA 3D4LA 2B3DA 3H2ZA 2VWHA 2OCBA 1ST2A 4HNRA 1V3UA 2EGHA 1WQ1R 1A82A 4JX8A 5I7UA 3GEDA 5C7OO 1AK9A 1SD1A 1YVUA 1Y5MA 3PCRB 2XB9A 4F6RA 3MN1A 3Q3JB 1AU9A 1QH8B 3HFRA 4IWYA 3SR3A 1J20A 1Q74A 4TMXA 1YMUA 2NYAA 3TXXA 4B75A 1YI1A 4N65A 5FPYA 1W5BA 5CYPA 1EGQA 1U02A 2HHAA 1QTQA 3KIPA 4WZAB 1VI5A 2CUZA 5EIAA 4CM4A 2Q1TA 5G0VA 5ADUS 4YAGA 2FW7A 3COZA 3AM3A 3AR4A 3PDUA 1JSXA 1ZOIA 2O57A 1ZGAA 2OV2A 1CRLA 1IK6A 1Y9AA 4M8KA 1JDBB 4YWJA 3Q11A 4WOCA 3SVZA 2H5EA 1DJLA 3JQEA 3G8DA 5CLHA 4CMGA 4MUIA 1BO6A 2QYTA 3N2LA 4JT2A 5AM1A 3SHOA 5BR8B 2F8TA 4V1CA 1OTYA 1RKBA 1J2EA 2EP7A 3AF0A 2GXAA 3B7WA 4N8DA 2QIPA 4JIGA 3A1SA 3B1WA 1E0KA 2CLMB 2TMDA 1E5VA 1OPRA 3ZWAA 1GG2A 2RSLA 3DD5A 5HXAA 2FPPB 2RGDA 1PYDA 3Q87B 3X1KA 1U1CA 1P1BA 5DHTA 4ZT6A 2R8PA 4E51A 1NMYA 5JCXA 4OLAA 5JQWA 2JRLA 2WU1A 1I01A 2HU5A 1VIMA 1XQYA 3GFQA 4GP6A 2JEOA 4P53A 4X7PA 2D8MA 3UWDA 3ZU2A 4F5DA 2X1MA 3U44B 4WY5A 2HAEA 4V39A 1EIWA 2Z58A 3DOFA 3BQNB 4RS4A 1QG2A 4OF4A 4OMDA 2A94A 1D0VA 1KGDA 3JYOA 1C50A 1XZAA 4WN3A 4XX1A 4MMXB 4X94A 5I7SA 1PGJA 2G0NA 1VHWA 1MJGM 3EWSA 2VHWA 3DMYA 4MUHA 4WTOA 2JCBA 3DTVD 5J59A 4RTRA 4KRYA 3WA7A 1NL3A 3IE0A 2QDKA 4M8IA 3KKZA 4IDCA 1K7CA 2W2VA 3O92A 1S4QA 4OGWA 4UATA 1JDBC 4ZQFA 1Q84A 3MM4A 2EJBA 1QHIA 2HRRA 2OHXA 3ESDA 2RBGA 4LVCA 1OH6A 1UBLS 4RK6A 1ODJA 5G1NA 4INZA 3UMSA 4YXFA 1D3AA 5DIZA 1JT9A 4X62B 5ICCA 1TMGE 1SBIA 1T1EA 4G2TA 3M70A 2GF9A 4HXYA 3W79A 4Q15A 3WB9A 4CV2A 3VSCA 3SE0A 3TQRA 3OSUA 1Q0HA 5IDVA 4V1CI 2XMSA 3CUVA 2YVQA 3F6BX 1EG7A 1WUJS 3E48A 5KNDD 3D0KA 1EVYA 4IXDA 1E5TA 1H0SA 4DQLA 1VJRA 5ILGA 2SCUA 1N92A 1NJ2A 4FK8A 5DT2A 1SBYA 1KYXA 4FDVA 4HAUA 5CLGA 3QLUC 3KQHA 2BONA 1ZVVA 5DLYA 5T8KC 3U9TA 1WKBA 2Q5CA 5HHTA 1XMXA 1WO8A 1AQIA 1JSZA 3RHTA 4D98A 1PT8A 1W34A 2PS0A 1VG8A 3QX3A 5CB4A 2XMQA 5JAIA 2FSPA 1QTNA 1O6ZA 1I94B 3NO4A 1F0KA 3FM9A 4CF5A 5KI6A 1RYNA 5JATA 1LF5A 1X8XA 2RC6A 1YF3A 1ONNA 1FMJA 2FX2A 3TTVA 4AUKA 5A06A 4QOGA 2RI0A 3E82A 2VH5R 2ZUWA 1M54A 4LVNA 3ME5A 1KDOA 4R1MA 1YRLA 3RIYA 5FPTA 3A32A 1EFUA 2CFCA 4PLWA 4BAUA 1UFKA 3BPSA 1RWPA 1ZP6A 3RIXA 1AKEA 4LDAA 3ANLA 3EXFA 4MPTA 3U09A 5FI1B 3LBAA 3D54D 5FWXA 4L5BA 5FJIA 3G5AA 4C1BA 1T5OA 3UJNA 1GUZA 4AXBA 4MKIA 4D3DA 1BD3A 1HDZA 2GGSA 3DYBA 1Y9EA 4UE2A 2FUNB 3K8YA 4YV1A 1THTA 3QXJA 4HB2A 4KN6A 4KQ1A 1GFIA 1W88A 1OD6A 1YKSA 2ZCVA 3FYUA 4O4IF 3VYVA 1TLTA 3FNBA 1U1GA 1MJ5A 2I76A 2WA2A 4IMPA 5E6UA 4WGFA 3QPVA 1E32A 1FFXA 1WXXA 2G36A 2QF7A 4JA0A 4RVNA 1ZDMA 3URMA 4YCMA 3WGVA 5BR1A 4QDZA 1FE8A 5HEKA 1F2TA 1C7RA 2ZYUX 1R0WA 5BR7A 3TQHA 1DEOA 5BURA 1Z36A 2YUIA 5BVHA 1NT2A 1GHTA 5ENZA 3B9RA 1UJMA 1YB7A 3E3OA 4X95A 2O52A 4D1YA 1NXVA 1S2GA 2QMOA 3V46A 4RA6A 4UOZA 4ZDIA 2YBEA 5LJLA 5IM5A 3KB6A 2JRCA 4GPZA 2IZOA 4JVNA 4EG4A 2UVPA 3JD4A 2FVXA 2AI1A 3JQQA 2D1YA 1UAGA 1N5KA 3AZOA 3H5TA 1RKVA 3FCOA 1WCWA 1TEVA 4GM0A 4LJSA 3AVTA 3G8CA 1QGAA 4V0MA 4YQZA 3LRTA 4TVKA 1TRKA 2QLTA 5A4KA 3QRWA 4AM8A 1X42A 1DJPA 4MEAA 3T7IA 3TPFA 2A30A 1P0MA 3VPDA 2M1XA 3G8YA 1FFSA 1IIRA 2GZSA 2YV5A 3F90A 1U2RA 1C8VB 5JSKA 1E66A 1UP6A 3LNTA 4OMFG 3ACDA 3L8ZA 4M7OA 4XWYA 2H92A 4GHWA 4KGZA 4QOEA 4B6FA 1N1MA 4RDXA 4MWOA 1LRKA 3MD9A 3JWEA 3ZWKA 3AOGA 4DIKA 4F4IA 5LZ4A 5AJYA 2OGZA 3THYB 4CKZA 3N8GA 4BNJA 1VB5A 2Y2VA 4R2IA 1ZHOA 4FYHA 1WABA 3DH0A 2DOKA 2VPXA 3ZJTA 1DAPA 3V1NA 3EWIA 1JT2A 3DDNA 3CBQA 4FXPA 5LXTB 4DUGA 5FBRB 1YZQA 4W4TA 5ALJA 4PAOA 4YYEA 2YN4A 1T36A 2Q0QA 1DV1A 4IXNA 2JK1A 4EJ6A 5D8DA 3ZWVA 3TAXA 4Q4JA 4X1KA 1S1MA 3OPMA 5CK5A 1GL9B 1PK9A 3F5FA 4MCAA 1C9EA 5EMJA 4V0KA 5F7OA 3V6LA 3BRQA 3N2GB 4KPYA 1T3LA 1R6BX 3FR8A 3JATA 2G82A 4PAMA 1IN5A 3OMXA 3FWHA 1ZH8A 3RBZA 1OYYA 1XNGA 3EGXA 3IT1A 3HO1A 2XQGA 1UT8A 4JVSB 4KVFA 2JGJA 1G16A 2ZS9A 3PTLA 4IDOA 3LD9A 4PYQA 4U2DA 2NIPA 1FU8A 4RGBA 3ZCXA 1YK1A 1MZVA 3D31A 3PA6A 3DKPA 4JI1B 3WJ7A 4OB8A 2VNKA 4ROTA 3Q10A 2AJLI 3UEOA 3CMMA 1B76A 3UCXA 1VJGA 3FGZA 3MMXA 4KO3S 3QUSA 2QTAA 4JYBA 3MBOA 5LMNB 3ASYA 1XMJA 2HNBA 4B71A 1ISJA 1FVOA 2G7ZA 2J4FA 3QOXA 4AYXA 1E5DA 2N9UA 2AG6A 2N1BA 1DIBA 4YNBA 2O2DA 3PD7A 4ZKEA 5T3YA 2ISSD 5JCPA 1OC4A 3JTEA 5CH5A 5FO0A 5LMCA 1XMPA 1U2EA 2C5SA 3V2GA 3HJTA 1Y5LA 3DTNA 4HHEA 4E2YA 5I01A 3BRSA 5JTUA 1RWNA 1U2GA 1G0OA 5KJ6A 2E37A 4MUGA 4N0EA 4TWAA 5T4FA 2ZROA 3OC0A 3UYLA 3EF3A 3AM5A 4R1NA 4PS0A 4EY5A 2Q7XA 4JDPA 2BM1A 3CWZA 1NUAA 4KVAA 4I1YA 1BROA 1SAYA 2C00A 5K6AC 4PQEA 2QW8A 1BE1A 5BSEA 3EOAI 1W4RA 1PE0A 5AHXA 1VLHA 3SE7A 1H23A 4A8HA 4BEBA 1UZMA 1ZIPA 3OIUA 3KPVA 3U17A 4K0KB 2DUNA 3QUTA 1YE3A 3K8QA 3UH0A 4BX9A 2AEJA 1M6YA 2W4MA 2G5TA 2JKYA 3DL0A 2F1OA 3AEUB 1FNDA 4MQ5A 3EZGA 1E1CA 3DNFA 4FKBA 5LZ5A 2ZUCA 3R7SA 4RFLA 5FX2A 1XOIA 1O77A 4EG3A 3WA6A 1OFTA 4M53A 2C7VA 4WZBB 2RHGB 3UF0A 1NPYA 4AJOA 2H7VA 1GAQA 3ZK8A 4Y1EA 3LC2O 2J46A 5ADVA 3PNQA 1I30A 1ZOPA 3KKMA 4PZUA 5DB4A 2QRVA 5IVDA 4AU1A 4Y67A 5H68A 3D6FA 5E1BA 2ZRDA 1SXGA 2P65A 4EJSB 4OIFA 1V26A 4FPXA 4PINA 4NMHA 3Q4GA 4CWAA 4DR4B 4ZOLA 3DE0X 2H65A 2IODA 1ZXBA 1RNLA 2CT8A 3D64A 3LBNA 1LDNA 1FW8A 1J8DA 1I6MA 4RENA 2ZJ5A 3A7EA 1AS3A 5BMVF 2AR0A 3AI3A 1Z18A 1PEAA 1T6BY 3KJZA 3OLYA 3Q8LA 4HDKB 2PO7A 3DCIA 1IAVA 5BVHB 4PCUA 4WA8A 4UDXX 5AKYA 4PGMA 4CEHA 1GZUA 3SX2A 4Z8XA 1MAVA 5E7QA 3BDAA 3TOSA 2XT0A 5HWSA 1SZJG 1XCGB 4DR1B 1WULS 2GHIA 2X5OA 2ADFA 1U7OA 5E8RA 4DDWA 4G63A 4KVGA 2XKBA 2B83A 4F1JA 3TUZC 2KLHA 3GDWA 1XT6A 5LB4A 1HM5A 2GK4A 3AR5A 4RKRA 2D74A 1B3RA 2I3DA 4HH0A 4XQ9A 4U6SA 2VT6A 4AO8A 3QV1A 1A7UA 3C16C 2FZWA 1TAHA 4YUAA 5I3CA 2BFCB 3NBUA 1AGNA 1GY8A 4KBGA 4WLVA 4TL8A 4JNCA 3BSSA 4B4DA 3G0HA 2J3JA 3OF3A 4UM9D 4LN1A 5L4NA 4Z1MA 2PUVA 4RYDA 1ZIDA 3HCEA 5ISMA 4OXIA 4B3HA 5KNDA 2O0JA 2QLNA 4LXHA 3SP1A 1C7IA 1Q3HA 3CA8A 4OHPA 1U8UA 3BK7A 4UREA 3TG2A 1N5JA 4MXDA 5K4GA 2VJKA 3DHVA 5FOVA 1XZFA 4XPIB 5K7SA 4OEHA 2MIIA 3NOQA 2KW5A 1JG7A 4U9UA 1OLUA 3NLLA 1FUUA 3R0IA 2J45A 1BS9A 1H6CA 1POXA 4YBRA 4C9BA 4E31A 3NGLA 1U65A 4XWWA 2OKGA 3CVJA 3QMVA 2V4UA 4QNMA 4QICA 3C97A 3LQRA 1AKRA 2CEKA 1WIWA 2OT3B 1SCUB 4B4UA 3GNLA 3QKIA 1APBA 4W1QA 4BC1A 3H65A 4J6FA 3GH3A 1NVDA 2YIMA 2ZSJA 2ABWA 2H51A 3BILA 4HBGA 1NI4B 4JENA 1Z47A 3X1MA 1JUDA 3OESA 1M2JA 4P08A 2BTEA 3FOAA 3WKBA 4JJIA 1CC1S 3V8NA 4JJAA 2XMCA 5D51S 1C7ZA 3K9HA 3RUCA 5A4FS 2VUHB 1E0SA 4K9LA 5EPUA 3I32A 3LF2A 5ILQA 5CFQA 1V8PA 5HRUA 4DJDC 2JIPA 2W0MA 3INYA 5F2EA 4C30A 1QM5A 4FEYA 2XXJA 4DDVA 2VJAA 3TPZA 4Z7QB 2A9RA 2ZRFA 4RF4A 4WZBE 1G17A 4OMUA 4O2AF 1ORTA 1J33A 3OQPA 3RAFC 4P5DA 1PX0A 2DP4E 4FQ5A 4NBUA 4ZZ3A 2C20A 3A1NA 4WN9B 3CLVA 1YOVA 1T29A 1TZBA 4JEUA 3ILHA 1ZH4A 2PLNA 3R8CA 1R9GA 3C1UA 3D0RA 3UUFA 3WJ2A 1U5AA 4CIXA 4CF7A 3A9SA 4TV9F 2V6GA 1E3DA 2ZRPA 4ALJA 5IFKA 1UOQA 2BLNA 1AKQA 1PUIA 1XMSA 2NWQA 3AIIA 3B52X 3WYNA 5LL6P 4MIYA 1I7LA 3MCUA 4L02A 5CVVA 3ODPA 2BEJA 3LH5A 2GR9A 3DTYA 5DM60 1U3GA 5HG0A 4XWAA 1SVNA 1ULZA 4BX8A 3DXYA 3TGPA 3KX2A 3RADC 5B30A 1EFRD 4HH3C 2HMWA 4KXXA 4AQYB 3PFHA 2W8BB 3L8MA 1SG0A 1OH5A 1HWYA 1Z0SA 4YB8A 3DBRA 3G5MA 3GUCA 1R88A 2LKCA 2QLMA 1U3VA 3ANXA 4J1TC 3WJ1A 5JAUA 2X6TA 4ZODA 2FRVA 1XJQA 4D0RA 4DB4A 4N82A 4I3FA 2HYIC 2EFHB 1U4NA 5IC5A 1NMEA 4C3VA 5GJWC 1MB3A 5U1PA 1XRMA 3ZDCA 5JUWA 1M7GA 4DYHA 1SQGA 1U1FA 3V1UA 5LDDC 2SKDA 4C0LA 1YVEI 2HCRA 2CV1A 1F2UA 2VUSA 4GZ3A 2BRUC 2CLCX 5E0OA 4TV9A 1PJSA 2PA0A 4YIKA 1XZDA 5AJVB 4D99A 2C0CA 3P2YA 4HN9A 4MCIA 1NOKA 5KMGA 4CQMD 2I6UA 1YMQA 3I9FA 3FAZA 1ZITA 2RGUA 4IF4A 4OM7A 1L7XA 1T9DA 4IHJA 2VTVA 4AO7A 5BW6B 5BV0A 2JGLA 5HM8A 3MT0A 3DAOA 3EUWA 1QKIA 1UT6A 2FSSA 1JFTA 3QKWA 3NFYA 4CNBA 3DULA 5JAZA 4GSYA 1RLOA 2G6TA 4PWZA 3JARA 2R62A 3VZBA 3WGTA 1L7DA 3OQVA 1W46A 2C8KA 3GJZA 3C8DA 2BFWA 3FDJA 3OY7A 1WB4A 4RA9A 3H2GA 2XRZA 3MRSA 2WD7A 5I8PA 1E62A 1NBEA 4AKTA 3EZNA 2RMKA 4GKKB 2VP9A 2ZVPX 2OCPA 1V6CA 3IAUA 1IPEA 1P4JA 5DKFA 5TS2A 3JRXA 4NP6A 4ARZB 3CSSA 4HQ6A 3IELA 4W6ZA 4Q3DA 4A8TA 5JXIA 8ADHA 3QUCA 3LVQE 3H1EA 2JH9A 4TTQA 4UULA 1YUBA 4KXWA 2OEPA 5BN4B 5CLJA 2CV0A 1SU8A 1XJCA 3QIAA 2SHKA 4AKEA 5ITWA 1YK0A 5LD2B 3VBEA 2HK7A 3ON5A 2CUTA 4PHHA 4DDMA 5JARA 1GPNA 1JZTA 2H7CA 4HLUC 5LU8A 3HPRA 3NYQA 5FTJA 3GAMA 2QUBA 2CLSA 4GI5A 1S96A 1YR6A 2QM8A 2I1VB 2GCOB 2BEWA 2F1JA 4F4CA 5NLLA 4R6WA 1A3CA 4G5QA 4IKOA 4O4LA 3RYCB 1OASA 2AFIB 3OFVA 1DG9A 3PQEA 1UEJA 4LDJA 1GKLA 5SZHB 1ODCA 2ARKA 2WSLA 5ERYA 3MA0A 2QZPA 4MHOA 1NIJA 1IOVA 3EXFB 3VDQA 3IAM1 3SVTA 3GROA 4ZT3A 4AZVA 5JCJA 1I5OA 1FUYB 2IUTA 2CXXA 5F1YA 1M7HA 1P3DA 1T13A 3HA3A 4N5IX 1T15A 1X8LA 1VLLA 3CZQA 1JZSA 3I28A 3P9IA 3PGMA 4GKAA 1N7HA 1CJSA 4HPWA 3PEWA 1XTIA 2O50A 2CXPA 1V8BA 1WSBA 5F35A 3RREA 3IILA 1W0CA 3N7AA 1KQGA 1DLIA 3V7YA 3GARA 2ZSIA 3DCNA 3W6ZA 1K5HA 3HK2A 1A8HA 1IOZA 2GPWA 4OXXA 2Z4TA 4YACA 3GLGB 1SH7A 2B1GA 2OLJA 1T9GS 3IDOA 3X44A 5C8XA 4X41A 3KJGA 3S7TA 4QTUB 5DULA 5HKKA 5JNRA 3T1VA 1V7CA 5CAEB 4CF4A 4URHA 5T4BA 1LTKA 1MJGA 1ZI6A 3CIOA 4FINA 1AN0A 2VZ0A 4LNAA 3HCDA 3T5DA 4IY1A 4HGZA 5H3HA 3FTEA 1BGVA 1RHUA 2CK3A 3B5EA 2V59A 3DZKA 1IB0A 4HOYA 4ZD6A 1NQWA 2NSJA 4UD2A 5D3ZA 2QDXA 2QNRA 3ELUA 5DM0A 3VHLB 4TMFA 4C0QC 4DA9A 1O9BA 2DY1A 3A2NA 5EP2A 3IV7A 2L0XA 3LWNA 4X1YB 2CMDA 1XZLA 1EDOA 3LC0A 3RLIA 3NPMA 4E46A 3FR7A 1VL6A 4PC3A 1GRNA 3V4RA 1WOMA 4EYKA 1M2FA 2KBFA 1YJ8A 1VYTA 3F5SA 4RMJA 1OKKA 1H8HA 3QKSB 4RIEA 2OFPA 3GJ7A 1U9IA 2EQAA 1T2FA 2QIOA 1ZICA 1X86B 3AQ4A 3BJEA 4JSYA 4OCZA 4Q6WA 4RVGA 4ZAYA 1ZD5A 2Q3EA 6Q21A 1KK2A 3NU1A 4Q48A 1Q3TA 1KO4A 2RH4A 2WFLB 4PZLA 4MSUA 2IYWA 3PDJA 1VA4A 3ZU6A 5LWHA 4CLDA 3H5WA 3L7DA 3MK31 4GRDA 1GPJA 3RS0A 2NNWB 4AP5A 1BXZA 2F00A 4CM7A 4GVPA 3WKDA 3N8IA 4M9XA 4CL8A 3EODA 4QUKA 3X1JA 4B0PA 4MVJH 1TKRA 1ILWA 1NP3A 1P19A 2A4MA 5DX1A 3FMGA 5HBGA 3UB3A 1T9GR 3RRJA 4YXWD 3WRXC 3ZHOA 4MP8A 3Q1KA 3G5TA 5D84A 3RLFA 3MG9A 1UJ6A 5I8ZA 2IXTA 2FZCA 3OF2A 4I8IA 3RPEA 4DHWA 4ZDKA 4XQGA 2HHHB 5CGZA 1C3XA 1ZW1A 3T4EA 1HK7A 3BXOA 1XTKA 3C85A 2XWJI 1OSNA 3WB1A 4RKYA 3EGWA 1WVIA 1OE0A 1WVGA 2R79A 4AJ2A 4MW5A 4QEKA 1O5IA 2NUAA 3PXUA 4TZ0A 4ICIA 3GGPA 5ALEA 2I2AA 5KJEA 3WAKA 2GWRA 3T3PB 1XRJA 3LCVB 2J3QA 3AEKB 5AK0A 1I14A 1CW2B 3VJKA 4ZYWA 1BU8A 2XJ9A 3L01A 4HAZA 4TT3D 3HXQA 2IQIA 3QWBA 4HFRA 1X7DA 3LC7O 4CLRB 1FDSA 2X58A 3O8RA 4M4SA 4RHUA 2VCHA 1SXJE 1U3CA 2ATIA 4HGYA 5DN6D 5JSUA 3C87A 4WCFB 2ZANA 3JYNA 3II6X 2A92A 1HTBA 2DFTA 3JVUA 1R9MA 2GAFA 2O54A 1PWZA 1XF1A 3PPYA 5FPHA 4QSMA 3HB4X 4F9FA 1UJ4A 2OBYA 3C5EA 4UXHA 3RBVA 5EKUA 1FBNA 4NXNB 2BFFB 1Y3DE 1BFDA 3B6KA 4LYAA 3M2TA 4ND7A 3U26A 2J3IA 1ZN2A 4NOJA 5JCOA 1E8DA 1JQDA 3IUYA 3KT8A 3FI9A 1L4YA 1NP6A 2B92A 4EQ6B 1K6EA 4BMCA 1SIWA 3ILVA 4RM2A 5TT1A 1UM8A 1EGHA 1LS1A 2VDOB 3EDYA 4ZCRA 4X20A 3VFDA 1Q19A 3NIGB 1IAQA 2F3PA 4Q9LA 5J5VA 3OEHD 3IHKA 1IBRA 2HSDA 3FPCA 3GLQA 2EJCA 2G9UA 3UBMA 2QBYA 3IUJA 1SIBE 4C05A 1DEAA 2HA4A 4NICA 2WRZA 2YFKA 2EV9A 3M3PA 2DCMA 1H2XA 2WTBA 2VDQB 5IMBA 5BY2A 4S05A 3R76A 2PWYA 2O20A 2B78A 4P80A 1LNZA 1JVNA 3LCCA 4L4UA 1NUPA 1Z5PA 5BYAA 2I4NA 3ETNA 1B8OA 1G3UA 1WP9A 2OGSA 2NSYA 3L8YA 2LPMA 4I9GA 3UB2A 5DOVA 4O2LA 4IINA 3TR5A 2QUJA 3VR3D 5FDFA 2P4EA 2HV8A 3EZ9A 4YV7A 3K20A 4IAOA 3ZQKA 4NJMB 3CVWA 4WUTA 3RI3A 2GK7A 1VFNA 1NJ1A 2JANA 3HSYA 1LJUA 2HSWA 3F3YA 3KRTA 3O4FA 4KWIA 4G4SO 5CURA 2VZ9A 2ZYWX 2LRHA 2FZ5A 2IY7A 1KA9H 5EJGA 4YWHA 1PWYE 4EI7A 4H59A 1B0ZA 2XI4A 3OH8A 4MR7B 2UYQA 1YL5A 3FNFA 1ORHA 4XIYA 1OFUX 4HVAA 3SJ7A 2GBFA 3BL8A 3V1KA 4G5GA 2FU5C 3TB6A 1S9HA 4Z86A 1SVLA 3CZMA 1COWA 2BSXA 3M9LA 5ITZB 5BV8A 5KOIA 3HZHA 1QP0A 2OLEA 3KEFA 3LYLA 1U0BB 2UXDB 4GR9A 1Q77A 5FLYA 2ZI5A 3WIEA 3WMRA 4E1BA 4JBXA 1IQUA 3WQQA 4PEVA 1HT0A 2H1SA 4U7HA 1SIUA 1QG0A 3BH0A 5B1YA 2JA1A 3WRYA 4KVZA 4XE5A 4F7DA 4UCWA 4US2R 3SCZA 3E81A 4LF5B 1G6Q1 1UEXC 5FNVB 4U7PB 4K9NA 5C52B 3IALA 2ZPTX 2BJWA 1XDZA 4O5OA 2YHIB 4FYKA 5C3UA 2OY0A 3Q9SA 3SPXA 3GJ3A 3L0CA 4X85A 1G5QA 1NYRA 3BXFA 3LLVA 3BB1A 4Z1OA 5LQRA 5FOTA 2ZUFA 3OE1A 2WG2A 2ZUUA 3E22B 3NHLA 5YASA 2D1RA 2XMBA 3JPYA 3SZOA 3V8VA 4TTPA 5ITZA 3AUXA 1RZRD 1C8LA 3WSTA 3RTCA 4LOHA 2C3YA 1XRPA 3AFMA 3CG0A 4RHTA 3T9DA 1YR2A 4XCQA 4I4IA 4TTIA 1PUXA 3T7EA 5CD1A 2F1KA 4C22A 5THQA 4QNRA 1GTJ1 1PZNA 3IA7A 3K9LA 2A78A 3A9UA 5F2KA 3EDMA 1SUWA 4JBLA 2DMRA 1J00A 3HP7A 3RJ5A 5LA6A 2XGSA 1QKJA 5ELMA 1KQPA 4XD2A 4HC4A 1MC4A 4R68A 1Y7LA 1SR8A 5FBKA 3HB0A 3OM8A 3EF0A 3AEQA 2GVNA 3R5SA 4QUGA 3IIIA 3F71A 1ZJZA 1UJNA 4ZQIA 1RWMA 1RQLA 1AKMA 5L3QA 3TTXA 2XMGA 4FJ0A 3CXRA 1MJFA 3WV5A 1I3CA 2F59A 3OCUA 2VBFA 2NU9B 1C30B 2FZEA 1N2HA 1CUDA 1TM3E 1KXZA 1VHTA 2L69A 3AVQA 5HZGA 4P86A 1NT4A 3SHVA 4L3OA 2XD9A 4C76A 2V1UA 4A2CA 4BFVA 4UTVA 2HYDA 1N2CB 1H1DA 4UE3S 4IIUA 1U81A 3K2IA 2C07A 3GO4A 1MAUA 1NF9A 4OQYA 4QXOA 3RK4A 1E69A 4BNFA 1M74A 4NZYA 4YJ2A 3IPAA 3IMCA 3JSAA 4W8OA 2CLEB 1C1XA 1F12A 4U00A 5AOVA 1I51A 5LB2A 2FWNA 1GU0A 5IJWA 4KR0A 3FYTA 4BO7A 2O8CA 1PW5A 5IH3A 1U8ZA 3RW9A 2AXEA 1P9LA 1V16A 1OZAA 3CIFA 5AIAA 1XZBA 3DOOA 2B8NA 1OFIA 3QF7A 4UNNA 4BB6A 3D4PA 3FPEA 1CR4A 2A9FA 3TQTA 1K5GA 1YCHA 4B5KA 2ANCA 5CA0F 3M4NA 4UMVA 3H6KA 4YAEA 4FHEA 3I0MA 4CDGA 5HUQA 4B3GA 1CFZA 1GPH1 2O7RA 1HGXA 2ZT5A 4CKEA 4MAAA 1XBTA 2NU7B 1E8MA 4IIXA 1UBNA 4MW4A 3GPLA 5CCXA 2ZVJA 4EPRA 2CVFA 1EQUA 1K98A 2DM6A 2P3SA 4KTVE 1NTOA 3B9PA 4QU9A 4UUPA 1VHQA 4N0MA 3CKKA 3D3JA 3HGMA 4JZYA 2ODPA 4EKIA 1D7OA 1Q95A 1IOLA 4BB9A 2CFSA 5HCIA 1YWGO 3JZMA 1TVKB 4RO0A 5HA5A 4BQSA 5JZMA 4Q7KA 2NW6A 1A4UA 5GIOE 4YIHA 5EKSA 3WLMA 3CZAA 1PDWA 3PS9A 2NO7A 4Q66C 5JAQA 4NAUA 5TNXA 2JEYA 3NONA 1A2OA 4EHFA 4DR5B 1VE9A 3U19A 1PJZA 2GVZC 5K0EA 4FHCA 2OZKA 1T91A 5AJZA 1N6LA 1QPBA 4I1RA 5SY6A 2PKRA 3PENA 1DO0A 3R09A 4LZJA 1RYEA 5IKEA 2XVMA 3EVTA 2WKQA 2AZXA 2BP7A 1POWA 4G8JA 3OJ0A 4I3HA 1GADO 1UZAA 5LMZA 1X3LA 1GG9A 2Y0BA 4OAOA 3TL6A 1MIOB 1RQGA 4L4SA 3CEAA 4J75A 4NYJR 4BS9A 2QP9X 2BUBA 4NEHB 3CR3C 5BSVA 3RUHA 1UOOA 2FR0A 2YHAA 3LVRE 3B1VA 2MOKA 4PQRA 4E15A 4EX6A 4AUNA 3RS4A 5CMLA 5DWQA 2OSVA 3SQDA 1TQDA 4CR8A 3LPMA 1ZBQA 1KAOA 3CPSA 2DSNA 3SM9A 4JB3A 5FNVF 2X7JA 4G89A 4U2EA 1TAQA 2Z0MA 1UXJA 1ZUIA 1E5LA 3ODGA 4ZOQI 1PFVA 4WLEA 2FMKA 3C45A 1V5EA 4YUVA 3RG2A 1ZK1A 3F3KA 2Y1LA 3K30A 3MUEA 4MJLA 3VR5A 3X1WA 1GXSB 3MJCA 4R31A 2IYQA 4IUCS 2AJBA 1QMGA 4FVTA 4D4KA 1KQFA 2VHQA 2ZUEA 3CY6A 1SK8A 3DUFB 5A0TA 3L7IA 5DYNA 1OT5A 1SXJB 4JBWA 2ZUSA 5EUQB 2G0AA 3FZGA 3OZSA 4ABYA 4JI8B 3O31A 2Z04A 2B4TO 3IT2A 4XQEA 3R75A 5LQDA 4Y0NA 4R8LA 3U37A 3WRWA 1IZ8A