4WCVA

Haloalkane dehalogenase dhaa mutant from rhodococcus rhodochrous (t148l+g171q+a172v+c176g)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
293
structure length
293
Chain Sequence
IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARELFQAFRTADVGRELIIDQNAFIEQVLPKGVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Balancing the stability-activity trade-off by fine-tuning dehalogenase access tunnels
doi rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
total genus 102
structure length 293
sequence length 293
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wcvA00
4LIPD 1ZI8A 4BAGA 4HXGA 3VISA 1DQYA 4X91A 1PV1A 2BUCA 2ES4A 4E46A 3BJMA 4E14A 3DJYA 1N5MA 3I2JA 4U2FA 2QZPA 2VJCA 3NWOA 1UKCA 2WUGA 4YPVA 2JGMA 3F96A 4CCYB 2JBWA 1XRLA 5JYCA 1UOQA 1SCQA 1R4ZA 3D2CA 4X90A 4BVJA 4LXHA 5AKIA 4Q34A 5C8VA 4L3WA 4JEIA 2GBGA 4J0KA 4AN1A 4EY7A 2WHPB 2XUJA 4P93A 5HF5A 2JGIA 1IUOA 1JKMA 1W1IA 2R8BA 5D6OA 3RM3A 5AI9A 1EXWA 1ZOIA 5ISMA 1QOZA 4UBIA 3DS8A 2J4CA 1ODSA 2P8SA 4FNGA 3V1LA 2XQGA 5F4ZA 4OCZA 1AKNA 1YAHA 4UFNA 4I3FA 5ALRA 2HU5A 2WFLB 3QH4A 1Y37A 3KWFA 2FUKA 5FRDA 5HQ3B 1N8SA 1ZGCA 2OGTA 1CFJA 4KRYA 2JIDA 1I6WA 4QDUA 1QE3A 3QPDA 5ALPA 5ESRA 4FDMA 4DSZA 5ALNA 5CW2A 5JALA 5C8XA 3TRDA 1XKLA 4FLFA 3KOOA 4HXEB 2DR0A 1K8QA 3R3YA 5KWIA 1YS1X 1UOOA 4PSCA 3JYHA 1UOPA 4CCYA 1TAHA 1R9MA 1L7AA 5ALHA 4CIAA 1ORVA 1GPKA 2I3DA 2PUJA 5ALXA 3BIXA 3DD5A 3UMJA 4AZ3A 5AK6A 4X97A 3WL6A 3WK6A 1XLUA 2V97A 3QBJA 1CUJA 2WHPA 4UFOA 4Q3KA 1E5TA 4PV7A 3ZWQA 2IITA 4GECA 3PF8A 2WSLA 1K6EA 2HU7A 1QLWA 3ZPXA 5HK9A 3BXPA 4FKBA 2Y6VA 4AXBA 2WFLA 4X94A 3WK9A 1XKTA 5HQ3A 5DYTA 5T4FA 4QE3A 4OPMA 2XUOA 4B7ZA 4WJLA 2CBGA 5C8ZA 2HFJA 5KWJA 3H2IA 2OPHA 2OG1A 2XMCA 2VJDA 2ZJFA 4CIBA 1BEZA 2QR5A 2RONA 1X2EA 5CXXA 5JASA 2XQIA 3DKKA 4M0MA 5D3KA 3ANTA 1BEEA 4PQEA 5LZ9A 2LIPA 4K5QA 1YR2A 5AI0A 2XUKA 4AX4A 2XLCA 3LS2A 5CRIA 5ALJA 3A70A 2RHWA 3ICVA 4H35A 3FVRA 4JH0A 4ZRDA 3WYDA 2WLSA 1XROA 1AURA 5E2IA 2ZSIA 1QONA 4QZVA 2WJ4A 4ZWNA 5LLSA 4QA9A 1WHSA 2C7BA 4YASA 7YASA 1GPLA 4J0CA 5AK5A 2PSJA 4DLNA 2O2IA 4B0OA 2XB6A 2XUQA 5FKJA 5EHNA 2WU3A 1LLFA 4KRXA 5ALDA 1GQSA 1R3DA 4W1SA 5A7GA 3QVMA 1J07A 3I6ZA 4X00A 1C4XA 3AILA 1UT6A 1X2BA 3C6ZA 1LPOA 4J0IA 1AMNA 5IVDA 1LBSA 2DHCA 5CT6A 4I4CA 5T4HA 4H77A 3UUFA 3G7NA 1QGED 4KAAA 3IVMA 1QIGA 4BDTA 5CTAA 4KR0A 5EIHA 3EF3A 5FPPA 4G8CA 4Q05A 2PL5A 2QJRA 2V98A 4G9EA 1MTZA 3G9XA 4EY5A 4FLEA 3AIOA 4ROTA 4BTVA 4G8BA 1SCKA 2PUHA 2WIDA 1TCAA 4C01A 2QKYA 2QUAA 3BF7A 3VJKA 1BE0A 2HRRA 2XLBA 1CIJA 2ONCA 4U2EA 3LLCA 2EDAA 3R3WA 3Q0TA 1CUDA 2J4FA 5EHXA 2DCMA 2V96A 3S8YA 5EIAA 3HRHA 5DJ5A 2VF2A 1E8DA 5ALMA 4G4GA 5A7HA 3L1IA 2QUBA 4N8SA 1CUUA 1AGYA 1WB6A 3HSSA 4JYPA 2XDWA 1QFMA 1LGYA 5AKHA 4DNFA 3O4JA 1MT3A 4DSAA 3IUNA 3O9MA 4B85A 2XMRA 3KDAA 4FFVA 2HHAA 4K2AA 4ZREA 2WIKA 2IX9A 4DNPA 4INZA 2DHEA 1THGA 4FLMA 2YASA 3WMRA 3H17A 2HA0A 4H18A 1DWOA 4JUIA 2OQVA 4OB6A 2DHDA 3H2GA 5KREA 4PNZA 2PPLA 3SK0A 3G9UA 2C5FA 2XE4A 4Y2XA 1ODCA 1XZLA 4EHBA 4XWGA 1YCDA 4UPDA 2VAXA 2O2HA 1A8UA 3FCYA 3UUEA 4KEAA 1YA4A 3EBLA 3R41A 4U2CA 2WUDA 1CV2A 1ZI9A 3CXUA 1MX1A 3BL8A 1JMKC 4RE5A 4UBKA 1QIEA 3F67A 3RARA 5CXUA 4B0PA 5AOAA 1VJ5A 4BYMA 2OQIA 4W1RA 3RK4A 1HPLA 2WJ3A 5CT4A 1LPNA 2WIFA 2AJBA 1FJ2A 2BUBA 4EBBA 3QMVA 1XZBA 4Y7DA 2WIGA 3VKFA 4UHFA 2X8BA 1LNSA 2JGLA 1IZ7A 2VATA 1WPXA 3HZOA 2EDCA 5YASA 3C6BA 5ALQA 1MPXA 2XUIA 3H1BA 2CZQA 3ESCA 3FYUB 3D5EA 1H22A 4E15A 3FYUC 5K3AA 2BJHA 2OAEA 4AQDA 3BDVA 1Y7IA 3G8YA 4X85A 1AC5A 3PI6A 4KACA 4CFSA 4ZXFA 4FBMA 5CT8A 2FX5A 4CG1A 4DGQA 3WA7A 4ZV7A 2HA6A 2HM7A 3N2ZB 2HA3A 1ZJ4A 1MAHA 5K3FB 4F0JA 1T2NA 3BJRA 2XI4A 3W05A 3JWEA 1XRQA 1TCBA 2W6CX 4F60A 2OCGA 4BCCA 4AB1A 1ZICA 4K6HA 2WUEA 1YB7A 3WK5A 5JZ9A 1J1IA 3W9BA 2QVBA 3I2GA 4X92A 4IH9A 5AM0A 1BU8A 3FYUA 1C7IA 4MEBA 1QJ4A 1SCIA 4OSEA 3STXA 2PSEA 5ALTA 1Z68A 5AM4A 5AJHA 4EUSA 5AM2A 5LZ8A 1JJFA 4EY6A 2C0PA 2OCKA 5J3JA 3EQ8A 2NW6A 2VEOA 3F8SA 1XQWA 1UK8A 1H2ZA 1HLGA 3R3UA 5K3FA 5JZSA 5E4TA 1ODTC 2WJ6A 3A2LA 3GELA 2WG0A 4BP8A 2PKYX 4M0EA 3IUJA 5DYWA 2VA9A 5FOQA 2HDWA 3ESBA 1JU4A 2PU7A 3STWA 1CEXA 1L7RA 1E8MA 3PICA 3VDXA 1LPSA 2K2QB 1NU8A 5BV7A 1S8OA 2C5GA 2HL6A 2Y2VA 4EZIA 1N1MA 1IVYA 3C5VA 2XUFA 4G1FA 1XZGA 3GFFA 3PFBA 3WIOA 4F21A 3I2IA 5LIPA 1BS9A 3KSRA 1T4MA 2ZYHA 5DNWA 4AMZA 5AI8A 4KAJA 4TVKA 2J3DA 2CJPA 2WFMA 5HCUA 4C88A 3DDUA 3VJLA 2BFNA 1VA5A 3H2KA 4G9GA 4GBGA 1QO7A 2CMFA 2G4LA 1EVQA 3BF8A 5AKEA 4H7IA 5JARA 3FSGD 1WB5A 3BDIA 5A62A 3FYTA 4Y2QA 5EHQA 4ZI5A 1EK2A 2WQZA 3FOBA 5KBYA 2BKLA 1IUNA 3L1JA 3WQHA 5EI5A 5E4YA 4FFWA 1G5FA 1XRNA 3KD2A 2HA2A 1H2YA 5AICA 2WU4A 1VE6A 2WUFA 3PE6A 4BC1A 5JANA 4BZZA 4RPCA 1GT6A 3ILSA 1CRLA 1K5PA 2XMDA 1U4NA 3C5WP 1VLQA 5CT5A 1R1DA 2VT6A 3LIPA 1ZD3A 2ZSHA 4HRYA 2O2GA 3SX4A 4X71A 3DYIA 4F5ZA 1DTEA 3S2ZA 1CPYA 2XMGA 5ALSA 2YYSA 4G4JA 4BRZA 4J0DA 3C8HA 4N5IX 4DMKA 1XZDA 4Y2SA 5FV4A 4XVCA 1ISPA 3W06A 3WKEA 2D0DA 2Z5GA 4XJVA 2I78A 3C8DA 2FJPA 3AIKA 3FLAA 1UKAA 5AK4A 1VKHA 4QWWA 1GGVA 1GQRA 2ZYIA 2JGFA 4UHHA 5EGNA 4U2GA 5HFNA 1MX9A 4H7EA 3FCXA 2I03A 2WHRA 1EH5A 1IZ8A 3IIIA 1EB8A 1O6FA 4WDRA 1XZHA 1XQYA 1XZAA 3DQZA 1THTA 1FFCA 3HACA 3O4HA 3WKDA 1TCCA 5AKXA 5JAHA 1QIKA 2PSHA 3CCCA 2PX6A 4M0FA 3FAKA 1Q84A 3H18A 3WK4A 3AINA 3AUKA 1SFRA 5AO9A 5K3DA 4DMHA 4QWMA 4B81A 1YAJA 1DT3A 5AKZA 4P9NA 1GXSA 1AUOA 2Z3WA 4TPKA 5AM3A 1JJBA 2VJBA 2XQJA 3GZJA 5LZ2A 4ARAA 4AO7A 3ZLTA 1CUHA 4X6UA 5A7FA 1LPPA 5EIEA 4FOLA 3R3VA 2O7RA 3ZLUA 2GYVA 1JMYA 1BCRA 4V2IA 5AOBA 1Q83A 5AK3A 1SOMA 4FMPA 4Y9SA 4LXIA 2H9YA 1CUEA 1QTRA 2RI6A 4DNOA 4BVLA 3H1AA 4UFPA 1EVEA 1XZCA 1HDEA 3QPCA 4XX1A 3C87A 1AQLA 4C4XA 1KU0A 3C6YA 3HABA 5CH3A 2B4KA 4N5HX 1QIHA 4QDXA 1XZIA 1W76A 2ROQA 1GKKA 2HADA 3P2MA 1E8NA 4RGYA 5K3CA 3BWXA 2GZRA 1LZLA 1WPRA 2E3JA 4YX9A 4FWBA 5CH8A 1UXOA 4EB0A 2RIPA 2XMQA 4NVRA 2ACEA 5JAOA 4C87A 1CR6A 4C4ZA 1D07A 2YH2A 3G0GA 2OGZA 2WG1A 5AI6A 3DOIA 3VXKA 2H7YA 2WHQA 2BAGA 1EX9A 2DQYA 2PSFA 5FLKA 2WM2A 3D59A 3ESAA 3VVLA 2HA4A 3VVMA 3ANSA 4MQMA 5D3ZA 3M82A 3KWJA 3OPMA 4I19A 4BRSA 2XMZA 3WKBA 3WKAA 3EIOA 1TK3A 3WLAA 3WWEA 2JGEA 1UK7A 1MN6A 3G0CA 1MJ5A 2X5XA 3I6MA 3QMWA 4MYSA 2QMQA 4L9AA 3WL7A 4QEKA 1JU3A 1E66A 1BRTA 5ALUA 3H0CA 4WDQA 3F9CA 4H7JA 1ACJA 5IH7A 5DYYA 2B20A 3DL4A 2H7XA 3E0XA 2OGSA 1VA4A 2Y2UA 3H19A 1HL7A 3RKSA 5ALGA 3V1MA 2BGRA 2AJ8A 3FNBA 1IMJA 2DFPA 4D9JA 1SC9A 5FUMA 1CUCA 5JATA 3NUZA 2ACKA 2GYUA 5HF9A 2PM8A 3IA2A 3A2NA 1DX4A 3V9AA 1HKHA 4X6YA 1XZFA 2HU8A 3B5EA 2W22A 5D7BA 1LBTA 3K2IA 1CUBA 5AIBA 4UBNA 4LYEA 4BBZA 2EEPA 4Y2PA 1HBJA 5DWDA 3IDAA 4MYDA 5SYNA 1MNQA 2QT9A 5FXMA 4UHBA 4XIIA 2WKWA 2OXEA 3ED1A 3QITA 5C81A 5JAUA 1TIBA 3EQ9A 3GA7A 2C58A 2ECFA 1JI3A 3MVEA 2HFKA 4B84A 3FWHA 4PSUA 1DWPA 2XUDA 4BZWA 1J2EA 5I7UA 4AO8A 5FPQA 1JFRA 3I2HA 5ALWA 2XQFA 4Z49A 1YA8A 3L1HA 3PFCA 2G5TA 4OD0A 4CG3A 5K3EA 4HXFB 3A2MA 1EI9A 5ALEA 4O08A 3FLBA 5AI5A 1QZ3A 2OAGA 3SWWA 3C70A 4BE4A 3G0DA 2GBFA 5FP0A 4BTLA 3H04A 3VJMA 1CUXA 4OYLA 3T52A 4E11A 1U65A 5AM1A 1NU6A 5HK8A 1XLWA 4AN0A 1R50A 1FFBA 1CUAA 4HRXA 1WB4A 5JD6A 4H0CA 3OM8A 4MEAA 3X3HA 5FDFA 1K4YA 4P08A 2RHTA 2BGNA 1MNAA 4G4IA 4J3JA 4BDSA 4UBMA 3RLIA 1VOTA 3LCRA 4FTWA 4X6XA 4QLOA 4EA6A 3I1IA 4BCDA 2QJWA 4X95A 4DIUA 4OU4A 1L7QA 3F98A 3GROA 2QS9A 3WK8A 4MWSA 3TJMA 5K5EA 3HLKA 1LPMA 1ZI6A 4A16A 2Z8XA 2Z3ZA 3W2TA 2QXUA 5AI4A 1QIFA 1ORWA 1KU6A 1IUPA 2YXPX 3IB3A 4B9EA 3TGLA 2DQZA 4OUKX 4UHEA 3STYA 2OLEA 5LZ7A 3I28A 3I2KA 1R9NA 2ZJ6A 4P92A 5ALIA 1HQDA 4DMCA 2B61A 4NZZA 4ETWA 4GW3A 5ALZA 1B41A 3M83A 1RYYA 2ORYA 1P0PA 2Q0XA 4LXGA 2IIVA 1F6WA 5HZGA 4OYYA 1VE7A 4OB7A 2Y1KA 3HYSA 1VZ2A 1A8QA 1UKBA 1EDEA 1EB9A 3T4UA 1FSSA 3ZI7A 3O4GA 1X70A 1MAAA 1H23A 3BIWA 1E3QA 3K9BA 5C7YA 3TEJA 3G9ZA 3V1KA 1XZJA 4Q1VA 4AO6A 1QIMA 3EQ7A 4A5SA 2I3ZA 3H2JA 4DTCA 4AZ0A 1MX5A 1DWQA 4MQLA 5AM5A 1W52X 5ALLA 3WL8A 4B80A 4UHCA 3D7RA 1A7UA 4IH4A 1QIDA 1XRPA 4Q3OA 5HKBA 1DX6A 2XMSA 2GYWA 1DU4A 2QTBA 3B12A 3G0BA 1ZJ5A 1TKRA 5JAPA 4H7FA 4WFIA 4FHZA 3AZOA 1G42A 2FJ0A 3V48A 4J7AA 2CKMA 2XMBA 1CVLA 2QXTA 4EY4A 2ZVDA 4KE7A 4BAUA 4HAIA 2AXEA 5BWCA 3GBSA 5AKYA 1C7JA 4OB8A 3D2AA 1EK1A 1XZEA 2C4HA 5A6VA 4IH1A 5JD5A 1GZ7A 5T4EA 3G9TA 4L0CA 2BUAA 3CCBA 4C4YA 2JEYA 4B6GA 4S0XA 1OCEA 1UFOA 3HEAA 1EHYA 2AJLI 2D5LA 3IUQA 4GXNA 3WYNA 3MUNA 4IQ4A 4DYHA 1ZIYA 4MWTA 1VXRA 2Y6UA 2XUGA 3DL7A 3QYJA 1JT2A 1XRMA 3NOXA 1A8SA 5LKRA 3CN7A 2ZYSA 1RWQA 4WFJA 4DM7A 3PF9A 3AZQA 4BC0A 4ZV9A 4JYMA 1TRHA 4B83A 4BCBA 4U2BA 3QMMA 5E4JA 1A88A 2AJDA 5BOVA 4WY8A 3HC7A 3DKRA 1BN6A 4CCWA 3PUIA 3A6ZA 2XQKA 1QFSA 2GBCA 5ALYA 1BCSA 1FFDA 1TQHA 2G5PA 4EY8A 1ZGBA 5AKLA 2GBIA 3ICWA 3O95A 4PW0A 1W4LA 2CUTA 3K6KA 4DMFA 3WWCA 1YB6A 1WM1A 1H2XA 1UZAA 1YASA 4UBOA 3BE8A 1P0QA 1XZKA 3FLEA 2CB9A 3O4IA 3OOSA 3M3DA 3I2FA 2ZJ7A 1WOMA 4GI1A 3IURA 4RNCA 5CH5A 3DEAA 3W9UA 2PVSA 5DNUA 4C89A 3DOHA 5LKAA 1F8UA 4KJXA 4QDOA 1Q0RA 1LZKA 3WJ2A 4QLAA 1U2EA 1CQWA 1DT5A 2WILA 4HZGA 4FNMA 4U2DA 1BROA 1ZIXA 2CEKA 2PBLA 1K63A 1R88A 4W1PA 1LPAB 1UWCA 1QIIA 3OC0A 4WFKA 5ALOA 3FVTA 3JW8A 4X7BA 3W04A 3WWPA 5AOCA 4UUQA 4H7KA 5AH0A 5JD4A 3WA6A 2GZSA 4J0GA 1FFEA 5H3HA 5LZ4A 1CLEA 2QRUA 4MXDA 4W9RA 5HF6A 3QPAA 1GPNA 4Y2JA 5BWBA 4J0HA 2H1IA 1CUGA 3YASA 5A71A 3ZLVA 1CUYA 3WZLA 2G63A 3AJAA 3E3AA 1F0PA 5EFZA 4N8EA 5JZBA 3N0TA 1CQZA 3WWOA 4NMWA 2VT7A 3D3NA 4H7DA 4UBLA 3DLTA 3AIMA 5T4BA 3HJUA 2HA5A 3STUA 2B9VA 5AHXA 5IVIA 2WIJA 4OU5A 3M81A 1KEZA 1AZWA 1W75A 4J0JA 4X3CA 5I8PA 1YSCA 2XUPA 3LIIA 3DYVA 1QTIA 4BVKA 5AP9A 1W6RA 4KE9A 2UZ0A 1USWA 5IKXA 3C43A 5CT9A 1DINA 3U0VA 3WK7A 5AIAA 4CG2A 3O0DA 1Q0ZA 4NS4A 3E4DA 2HA7A 4W1QA 2H7CA 5DNVA 3WI7A 3CN9A 5ALVA 1U8EA 3FBWA 1CUVA 2WTNA 1UK6A 4WCVA 3PDCA 4PSDA 4JNCA 1B6GA 4Y2VA 4LYDA 1ZD4A 4BATA 3WKCA 5JADA 1FFAA 4A23A 1XZMA 3R3XA 2QOEA 3STTA 3R3ZA 2JF0A 2XT0A 1CUWA 4G5XA 3B3QA 3GUUA 2XUAA 2JGKA 4FBLA 2WTMA 4Y2RA 3R40A 3WZMA 2JGJA 4N8DA 5LZ5A 5JIBA 1CUZA 1E89A 4RE6A 4BP9A 5CURA 1H2WA 1BN7A 2VAVA 2WFZA 6YASA 5AKJA 3F97A 1CUIA 2OCIA 4GHWA 4BB0A 2DSNA 1YS2X 5ALFA 2RAUA 1MU0A 2XUHA 1MO2A 1XFDA 3NGMA 2R11A 3WIBA 3ZV7A 2C0QA 1N5RA 4HS9A 1LPBB 2Z8ZA 4W63A 5HFAA 1EA5A 3D2BA 4K6GA 4Y2UA 3HI4A 1Y7HA 1ZD5A 3OG9A 1OXMA 4AMYA 1P0MA 4LKOA 1NX9A 2PU5A 2AJCA 2HRQA 4Q3LA 1GKLA 3QM1A 5DLPA 5K3BA 3D0KA 3I1YA 1XQXA 2ZYRA 3Q8WA 3MGAA 4B9AA 2VQ6A 1EDBA 1EINA 3IULA 2PSDA 1O6GA 5A2GA 5IVKA 2V9ZA 4UBJA 4Q82A 4HTAA 4PO3X 3D4LA 1M33A 3E1GA 4IO0A 2VSQA 3O9VA 1F0NA 4J03A 5IVHA 4L72A 4Y2TA 2BCEA 3IBTA 1ETHA 3DNMA 1G4HA 3G02A 4BE9A 4CI9A 1XRRA 4MJ3A 3KXPA 3FSGA 5LP1A 4GLBA 5SYMA 5LYYA 3WJ1A 2J3QA 4QDTA 1RP1A 1AX9A 4K6KA 1ZD2P 1QO9A 1JJIA 4QDZA 3C45A 1XLVA 2OCLA 4GEGA 1J06A 4X93A 1XQVA 3R0VA 1PFQA 4ZGBA 4PF1A 2X76A 4ITVA 2VTVA 4KE6A 2JEZA 5HF8A 2O7VA 5ALKA 5DTJA 3MUOA 2RGUA 4WY5A 3PUHA 4G8DA 2QM0A 3LP5A 3ESDA 4UHDA 1CUFA 3I6YA 1P0IA 1VZ3A 4KAFA 3HXKA 4DNQA 4IHAA 4TGLA 5AKGA 4ARBA 4KE8A 5AKKA 3G0IA 4BAZA 5EHZA 3IUMA 3OTQA 3SC2A 3WL5A 5CMLA 4LHEA 1G66A 4Y2YA 4C6HA 1QIJA 1ACLA 5DTIA 2HIHA 4GWLA 2WG2A 1CUSA 3AFIA 3STVA 1WHTA 1WCYA 4HVTA 3AZPA 3OURA 5HKAA 4YK7A 4B82A 1UK9A 3H2HA 3V1NA 3QZUA 3DCNA 3WWDA 1OILA 2VJAA 5CBKA 1VXOA 5I9IA 1DQZA 1PJAA 3C6XA 3U1TA 4QNNA 4H7HA 1EDDA 4GDMA 4KYVA
chains in the Genus database with same CATH superfamily
1HNZB 3HVIA 2E4UA 3Q7PA 3VISA 1EG2A 2ZFUA 5HS6A 1DQYA 1WSDA 2BVNA 4QO8A 1WO8A 1RZRD 3UMMA 2ATEA 1PV1A 2ES4A 3GJZA 2QTCA 4ZQFA 4E46A 1GL3A 2CXRA 4G9BA 4H60A 4MYRA 1N5MA 5DN6A 3T38A 2YRXA 2QT1A 1XB2A 3K0FA 2YXEA 3PFHA 1Y34E 4ECAA 3UUGA 3KQWA 3MSXA 1RACA 3HA7A 1XNHA 1N2OA 3O8QA 2IZ0A 4E4YA 3AC0A 1M0WA 4YPVA 1MUUA 3GFRA 2F3UA 2JBWA 1FRVA 1P1RA 3GR6A 3K1JA 3NONA 2DERA 3QLUA 1R4ZA 3D2CA 3BXOA 3F6SA 4X90A 5EWMB 4YUVA 2ID7A 3I76A 1AZLA 4JP5A 3CWQA 3LZDA 1CY1A 1Y9AA 3VZPA 4RZXA 3KS9A 1AQUA 1E20A 4IDBA 1Y6QA 4Q34A 1J2RA 1GPUA 5CJPA 1OGYA 2AD1A 4EYGA 2GBGA 2WWRA 1QKJA 1BDHA 2IIPA 2B3TA 4KFRA 3OQJA 3QOXA 4H3HB 4NDAA 2WJIA 4O4JA 2ODEA 5HF5A 1IUOA 1JKMA 3AERB 1B3BA 3I9NA 4QXPA 1EWKA 4MV7A 4WOPA 5DOVA 4F1JA 3UFBA 1FP4B 4F4FA 4IUCS 3ZK8A 3NGXA 4CLOB 3PXDA 4E5UA 1PR9A 2YHUA 2IL1A 2R8XA 4M1OA 3V4ZA 2ZRQA 2C29D 5ISMA 1I4TD 3OU6A 4KWCA 2ZAIA 1H5QA 1EQUA 3DS8A 3LLSA 2FG5A 1L8QA 3AF6A 1ODSA 3ENKA 3OZCA 4M1WA 1PGNA 3T94A 1V1RB 1DBVO 2GESA 2A1TR 2J31A 1AKNA 5C53B 2Z98A 4I3FA 1K6MA 1ESDA 3IT1A 2E48A 3ZJYA 1Z38A 1K3TA 3FTQA 4US0R 2IYUA 1BJRE 3PVSA 4JBHA 5B1DA 4LRYA 4B82A 5HQ3B 3TD2A 2H16A 2BTQA 1ZP6A 3O6VA 4RFSA 2Q1XA 4KRYA 2KMLA 3KQQA 4N82A 2FEPA 2AMLA 1PSDA 2IWRA 3GJ3A 4CMBA 4UPVA 1FSPA 1SU4A 4FYMA 2I55A 2P4SA 4IEFB 1QE3A 3PD7A 3DMRA 4GBMA 3NS7A 5ESRA 2V0GA 2RBKA 4FDMA 4QPJC 1Z34A 4DSZA 4EF6A 1DIOB 1T0BA 3FHCB 3GGCA 2PKXA 1E2KA 2MINB 2Y0PA 3AHIA 5DCLA 3ZY5A 4QVKA 2IPXA 2H5EA 2UKDA 5EQTA 2AXNA 3KOOA 3GJ8A 3LPLA 2DR0A 2OSBA 4HXEB 4XPZA 1XE3A 1JG6A 1PJ2A 3R3YA 4MWGA 2KLHA 2X7JA 3OEED 4MH0R 1HNWB 3QOWA 4HEHA 3BZWA 1S4QA 4IZOA 4LPSA 4OLJA 1UOPA 1A8IA 1Z2DA 1KYXA 1NVVR 3K0CC 4XFJA 1UMBA 3ZE7A 2IHYA 1NVFA 5BPHA 1GDTA 5K0NA 5AVZA 1R9MA 2KM1A 1FFYA 3BRCA 1GPKA 2I1VB 2PUJA 3QF4A 5ALXA 4ZCIA 3PNYA 1II0A 2V3WA 3EXHC 3LPNA 1B1AA 1L3BA 3E22B 4X97A 2PBRA 2PJUA 1YZVA 4YMHA 1CEEA 3ANMA 3QBJA 4I9UA 3ZDCA 4YUAA 4LSMA 5IM4A 1CUJA 3BSSA 1JR4A 1M73E 5KO2A 4OOEA 4RELA 5JBIA 2V7WA 1WDMA 4PPNA 4RTKA 3KKOA 1E6EA 2R79A 2V5AA 3C3BA 3MBOA 3MMPA 4BO5A 2FMHA 4JB3A 4JX8A 2F3SA 5DM60 4PV7A 1TF5A 2O2CA 3BWVA 4B8YA 3ZWQA 3OTOB 4TMWA 5B7NA 1I5OA 1RPNA 3TNFA 1VSUA 4PSAA 2SKCA 2WSLA 3JAKB 5AJUA 1TW3A 2XZDA 1YDFA 1Y8RB 2XVXA 3A3PA 2BGLA 3A1WA 1JQKA 2AQIA 3ILHA 4GX5A 1RI2A 4KNVA 4LXYA 2XTAA 3EOAI 4Z86A 1SZPA 2MIIA 4KXWA 1WHSB 3BXPA 1Y7TA 3RFUA 4LG1A 3RVNA 4BL5A 3FOFC 4AXBA 1Q19A 5TX7A 5IASA 4MS1B 3ICQB 2BEWA 4MVJE 5K2OA 3WK9A 4EJFA 4HNTA 1KXJA 1LJLA 1IEXA 2QMEA 1XKTA 3LWZA 3HV0A 2WVAA 3PQ7A 1RLOA 3TOVA 3VM6A 3H97A 4XA8A 1FMCA 4CEJA 3ASVA 4G3XA 4P0QB 4XWAA 4WJLA 3KLPX 1QSGA 2CBGA 2O48X 3EXG1 3DT9A 4Q7LA 2G0AA 2X1LA 3TQQA 1Z83A 4CIYA 2POCA 2PFSA 3CUEF 3H2IA 5K0CA 3OHMA 2E18A 3OP4A 4YBRA 2OWDA 5BSMA 1B4DA 2ZIVB 4OIFA 2VJDA 1WETA 1CNMA 4DLVA 5DNAA 1G5IA 3OE4A 1RI3A 1R0WA 2J3HA 2EATA 2QR5A 4TSFD 5CEEA 2NMVA 3DQQA 2H3EA 3ST7A 4FIZA 1X7WB 3MWGA 3WLLA 2QM3A 3C4JA 2XQIA 1VGQA 4M0MA 1P77A 2OHXA 3QYAA 5IHPA 2OR3A 1AQYA 4PC3A 4TMYA 1BEEA 5GIOE 4PVCA 5F21A 3CRW1 1NSFA 2XZTA 3A4MA 3H9GA 5FI5A 4KDFA 5AI0A 3R7NA 1DPFA 4ZGWA 4JR1A 1G7SA 3OIVA 2FRDA 1TD9A 4HN2A 1BWRA 4V3BA 5CRIA 5KSOA 5CLIA 4WASA 2RHWA 5JAMA 4Q7JB 2ERXA 1V9CA 2Z2XA 3NQ41 1R6VA 1ONBA 1JDVA 4MV5A 2KJQA 5L3QA 3FVRA 4JH0A 2VNKA 5DGCA 3NEAA 1XROA 1AURA 1TPYA 2X4LA 5LBUA 3WNVA 1QYDA 4DMUB 2H5IA 3QVKA 4G0WA 1VYHA 4B31A 1YH3A 3IJRA 2R96A 1NXPA 3OBIA 1TMYA 2AC4A 2WJ4A 4Q12A 3DV0A 4ZWNA 4R3WA 4XLLA 8LDHA 2UUCB 1K88A 2CNDA 3P0IA 2VHYA 3KOMA 3ELWA 2G6BA 1L7XA 4HDAA 3EY4A 5DASA 6PFKA 5LR6A 1NVDA 4F71A 1LSUA 2QSYA 3EYAA 2C97A 5LA6B 3RUEA 1YVEI 4D45A 2CB0A 4YP6A 1PAUA 5CVCA 1L8XA 1ZH4A 2QB5A 3DM5A 1J5PA 3WYGA 1WRBA 1WVIA 2O2IA 4GI5A 2XUQA 1VHQA 2P1RA 3ETJA 3ADBA 3Q3HA 4KRXA 4R98A 2P9FA 1GQSA 1BNCA 2IK8A 5ERGB 1KTIA 4W1SA 4G0XA 3ZTYA 5F5XA 1COZA 1KO5A 2NWQA 4UTRA 3I6ZA 5AVXA 3AEUB 5BNWA 1Z5PA 4LZWA 3PSAA 4X00A 5JZVA 3CVWA 4KLAA 4YFVA 1XK6A 2E89A 2CWDA 3RU9A 3V80A 5HKKA 4L22A 4GLFA 4YRMA 5ITSA 5JS6A 3I52A 1DQNA 4BNUA 3AKCA 1QF9A 4GR9A 4JZYA 1LPOA 1C1DB 1OKKA 1KYWA 2ZQYA 4RMNA 2WYIA 5IVDA 2ZUFA 2C9ZA 4FOOA 3U4QA 1LI4A 2HJVA 3P19A 3FDIA 2ZDQA 1HI9A 5CT6A 1ZUHA 2GAOA 4X63A 2Y67A 1M7BA 4LYFA 3Q8KA 4M8LA 5CFMA 2KBEA 1PYDA 2Q9CA 2JI9A 3O75A 2OCYC 3PL5A 2XNSA 1VPDA 3H8VA 4L9RA 5T4HA 1I0ZA 1T5SA 3UGJA 1GAJA 5H0IA 2WPDA 3N74A 1USIA 5M2QA 5HJEA 4IMJB 3G7NA 1KGDA 3GP3A 5G1PA 3LOPA 4JIGA 4FGJA 3S7ZA 4Q9AA 4TYNA 1ZD8A 2G1PA 2G9UA 2Y8EA 2J1LA 1U0OC 4KQ9A 2P7IA 4U7DA 3AVQA 4MIKA 1JHRA 4ND5A 4Y98A 3WYFA 4EHNA 3WYCA 1XMJA 2O2EA 3V46A 1CZOA 3EGOA 4WZZA 2LGJA 4LDAA 2ZP1A 4IIUA 4MYHA 2PDAA 2V58A 4KR0A 5SV2A 3WIEA 3GP8A 3RYFA 1NJGA 2EBUA 1F2UA 3CUYA 1J8FA 3QUTA 4YP0A 1IY9A 2GRJA 3AVYA 2VHTA 4M9CA 2BJVA 4U7WA 4EYOA 2H4JA 4D25A 3F2IA 1YBAA 1JIQA 4Z99A 2A4KA 3HJRA 4DDUA 4Q05A 3UHAA 2NTNA 3TE7A 1WEHA 3RFXA 1J00A 1VL8A 1YZHA 1Z17A 2PL5A 1QXSA 1IJFA 2V7TA 3TLEA 3ESRA 4AUEA 1E64A 3HVJA 5EESA 1KJWA 4EY5A 5H83A 3DE4X 4ROTA 4BTVA 4YDHB 4G8BA 3DBRA 2PUHA 4W5TA 2WIDA 2RK6A 2RMKA 2V7UA 5ER6A 1LLCA 3LZCA 4U00A 3KTAA 1G8HA 3QU7A 4OP3A 3CXRA 3T54A 1TCAA 4WCFB 4WT7A 3TDMA 3WHIA 2I65A 4DMMA 4C01A 1GFZA 2QKYA 4PHCA 5A3QA 5I4CA 1ENOA 1YR8A 2E85A 4FYVA 4RK6A 2EP5A 4A0SA 1EP2B 3JWJA 3HR7A 4URXR 2B94A 3O3CA 3L8FA 3JVIA 4W9MC 2AZXA 1E1CA 4ZOLA 2BWJA 4U2EA 5FEUA 3LLCA 1H94A 2GZMA 4MNTA 4MIEA 2EDAA 3R3WA 5IJZA 1KK1A 3BBPA 1XPOA 2FUG6 5DTRA 4MKIA 4Y2HA 2DCMA 2V96A 3FHLA 3MJEA 2FHPA 4IDOA 5CIYA 4DPMA 1GPAA 4D79A 3HRHA 1SBNE 1J56A 2QX4A 1I2CA 2VF2A 2IEIA 2OECA 2W6ZA 3S4YA 2DETA 4JXKA 4P5EA 3UK2A 2VHZA 4FZ3A 1O6ZA 2DP4E 2DC1A 3TOXA 3AG5A 1O87A 2OORC 4MHTA 2D00A 3T5BA 5B1SA 5BMOA 4DCMA 5IDXA 3INRA 4U63A 2XDWA 1QFMA 1ULZA 1DSSG 2IVZA 4HATA 4ZC1A 5KTPA 2FVYA 5IUKC 5GZ6A 2QMHA 3O4JA 3QENA 2AOVA 4IDGA 3VNQA 3SGLA 5CK4A 2UXBB 3UJBA 5JSQA 2I91A 2O9JA 1IBRA 4UE6A 3SC6A 1IIBA 2GLUA 4B85A 3C6MA 4DDKA 2I7CA 4EI9A 3OQIA 2J5XA 3GCDA 3QJ5A 2WD8A 1FDUA 1KI3A 1P5FA 2MSWA 3A28A 3DEYX 3GUYA 5CVJA 4OLHA 4A0FA 2P2CA 3VNRA 3RYCB 3IOCA 1X1TA 2CKDA 1Y1RA 2E4AA 5AESA 3ORSA 3Q7EA 4QIHA 1XTKA 3PVCA 2DF8A 5KWEA 5TC4A 3OJOA 1JPJA 5FBZA 2PA3A 1XEXB 4HYEA 2AD5A 2CXNA 2BFFA 2IY8A 1D9XA 1SM4A 1EEHA 3BQNB 5K0GA 3ND7A 1IOZA 1G5TA 1ZLXA 1DXYA 3L49A 3M8KA 3O1JC 1IHPA 4GOMD 1UZMA 4KXYA 4MCJA 4TKVA 5KU1A 2QTWB 4C7OB 1T2EA 2HEIA 3AFGA 2QR3A 3EVEA 1LJUA 3I5UA 3M5WA 5DKFA 1P1FA 3EEOA 4GM0A 5FUVA 3L9XA 4G0MA 4F84A 3OQOA 3SIPA 2CVHA 2DG2A 4K6MA 2ZRBA 4D8YA 3ZHXA 5KREA 1TF2A 4X8MA 3INGA 3G9UA 1TIKA 4UTPA 2XE4A 1VIYA 3O4RA 3OEHA 1XZLA 1C9KA 1JMVA 3VPBA 2F1OA 1CDZA 2GJKA 1RQRA 1SPXA 3KQHA 5DB4A 5D85A 3F5SA 3KHSA 3CF2A 1XTTA 4UPDA 5DTMA 3WYAA 4TMXA 4ZEOA 2W4MA 1KA9H 5TQJA 1FXWF 1CR1A 3NVMB 4LV8B 5FJJA 3RG2A 2FX3A 1B7GO 1E2EA 4RYLA 3UC9A 3AF3A 3NJ8A 3Q3EA 4KEAA 4MV1A 4XX0A 4M4SA 1K2WA 4JLAA 1GU7A 3E6AA 3JQDA 4TKZA 3M9XA 3G8DA 4MR7A 4WECA 3V55A 4R0VA 1LSSA 3BDAA 5DGTA 4A8JB 5B1YA 2X7HA 3LL7A 4IJMA 2DWOA 2X9LA 2CUNA 1FDTA 4KQKA 4R1NA 3J80A 4NU0A 2V6MA 3W1VA 9ABPA 2K5UA 3S81A 4LGMA 3HK2A 3GP5A 2O8FB 5CAEB 1W2HA 3R09A 2VOEA 1E4EA 4EL0A 1H6AA 3MERA 2R6AA 4O4HA 1STOA 1E9RA 3N0XA 4RULA 1K8RA 1T1GA 2H2HA 4W1RA 3AI1A 2VP3A 3FYDA 3IVAA 1PJ4A 3MAAC 5DHUA 2WJ3A 3BSFA 7AT1A 2FOLA 1W8IA 4G37A 4DWOA 3PDIB 1SZJG 3MN1A 4JYZA 3K5IA 4G84A 2CK3A 2WDPA 5EJIA 4B3IA 2NVUB 1CKEA 2BZSA 2VR1A 2WR8A 4W5JA 3OAAA 2AEMA 2C7QA 3FDXA 5KU7A 3JSAA 1UM9A 2C5LA 5EJ5A 2WV7A 3EMKA 2ZBFA 3WQQA 4MCAA 4OIMA 3V3TA 3QXHA 3QMVA 4ABYA 3CUWA 1VHJA 5KTMA 2HYIC 3FAZA 3H4VA 3JYQA 4P54A 3QA9A 1NUAA 2WIGA 3RHZA 4PYJA 1JHZA 3Q3VA 3X44A 2DRIA 3FYHA 1NQAO 5K8VA 1UPCA 3Q85A 5JPCA 1LNSA 2LXNA 3ENQA 2QE6A 3ZCPA 2FPXA 2VKTA 2X4GA 1SA0B 4KITB 1KOFA 2VATA 2QYTA 3DGFC 2REXB 1IZ0A 1H0RA 1P4AA 2RGGA 4OA5A 1M2HA 4R1MA 1MPXA 2PBZA 2XUIA 4Q3AA 1PQPA 3A31A 1I0IA 4E5YA 5A9SB 5CNIA 2YKGA 4DCCA 3WBKA 4QRHA 2TRSB 1MZPA 2HPZA 3T9BA 4R8SA 3FYUB 3IDOA 2ZJ3A 3ZGVA 2D2IA 2YXDA 5CA1F 1GZ6A 2BHNA 3FRJA 5FWDA 1OJ7A 4E15A 1G21B 1K5DA 4IF4A 4HVAA 3INYA 4UE3S 2BOVA 3BDVA 4X85A 2F62A 4I50B 2CBZA 3KJGA 3LGAA 4JWTA 3ZS9A 2OGUA 2C4VA 3COSA 1BHJA 1L8OA 1TIPA 4ZXFA 4G0UA 1S2GA 1M2OA 3D6HA 4IIVA 2ZTSA 3TLYA 3SU8A 1SWWA 2FX5A 2W2VA 1D1SA 4NCKA 4IHKA 3WO0A 3Q8LA 2AS0A 4C0SA 3B1XA 4MI6A 3UH0A 3QI7A 1JUDA 1RE0A 4WOBA 4AN4A 1UOEA 4YJGA 1IQUA 2FZ5A 1TF7A 5CYOA 2YY5A 3MD9A 4WGFA 5F35A 2HA6A 1NNI1 1SJ9A 3PYXA 1HWYA 2HM7A 4CUKA 2BD0A 1ZJ4A 1NXQA 3L93A 1FSZA 1MAHA 5IUNC 4DA6A 2A0YA 2NU7A 2Z5FA 1RRCA 4ENTA 4ON9A 1ZZGA 1T2NA 1Q0LA 2ZIUB 3TTWA 5ITWA 2Z57A 1KZHA 3PNOA 2IHBA 3JZFA 2DEUA 1NW6A 2V8BA 4NCBA 1P7YA 3I3OA 5IBQA 2XI4A 3W05A 4CW7A 1ORRA 2V59A 4C08A 1TCBA 1P4SA 2C3MA 2OENG 2ATIA 4R8RA 2P0AA 3CC8A 5DBOA 3MA0A 3NTRA 3AHFA 5TVKA 4AB1A 1FEZA 1F2TB 4ZCTA 1GARA 1GNQA 1UJ5A 4CM1A 4XDGA 3PJGA 1W47A 1YB7A 5CFNA 5JLJA 4RY0A 2VSFA 3ZU4A 1OX6A 4R51A 3KZXA 4O6VA 4AIRA 4DSNA 5JZ9A 4L3OA 3DBIA 3LT1A 3UAYA 2G40A 1R27A 3FZGA 2XHEA 3IAXA 3BFPA 3FDFA 4ZK2A 3KKNA 4M9UA 3L84A 3BULA 3IP1A 4X92A 1VPLA 2GPJA 5ARCA 2FLWA 1BU8A 5LOVF 3ZCSA 3I6IA 4RHFA 4ZCSA 4JU9A 4I5DA 1OFGA 3K0FB 4FMCB 1NLFA 3AR9A 4MEBA 5K1ZA 5B2FA 1PNRA 1QYWA 4OSEA 3STXA 1P7CA 1DXOA 3FHTA 2I6XA 1W4AA 4QFDA 4TLEA 1FP7A 3HDGA 3BSWA 4ESOA 2EKPA 2W83A 4S2UA 2RGEA 5E9AA 3T3NA 2ANCA 1MF7A 2L0XA 3EUAA 4QGSA 4ZVLA 3ZNNA 4AJJA 3TKLA 5CDTA 2J08A 3EH2A 2XGSA 1YS9A 1P44A 2ODAA 2GN2A 2OLJA 4UEQA 4EF5A 4RDIA 4BX0A 4ZVPA 3LQ1A 4JR0A 4EY6A 2ORVA 1E92A 1R6BX 4MGEA 2NW6A 1HNNA 1KYYA 2Z9CA 3MTGA 2VEOA 1W5TA 1XQWA 4IMPA 1VIVA 5D8DA 2AMYA 2GF0A 3ER6A 3GN1A 5GONA 5TJ9A 2QMYA 1UK8A 1H2ZA 3BL5A 1EK5A 3CTMA 3N8IA 4K7JA 4P5DA 1ISRA 3WNZA 4F2DA 2Q49A 1KFEB 1QGUA 1KQNA 4JT8A 5D86A 3UA4A 1F2DA 1N6RA 1WSWA 3GCWA 4NEHB 1BXZA 1K92A 1P62B 1Q50A 4HZIA 2DGDA 3KAPA 4O2RA 4RHXA 5LJIA 4NICA 4CYMA 3GELA 5B58C 3PVZA 4NOMA 1J9GA 3KQPA 1JJ7A 2E4WA 1EE1A 2PKYX 2O3QA 1TO2E 2QNRA 3HZZA 3IUJA 4M0EA 1GEGA 1OHHD 3SSOA 1DEHA 4EI7A 3WDMA 3IAHA 1JHDA 2D1YA 4HAZA 4DV1B 1J9ZA 1G3QA 1NAHA 4NCIA 1AKQA 4BBAA 2D0IA 5AJYA 4QLBA 1I2BA 3BBLA 4QNRA 2A5LA 3SR3A 4QUHA 2A7XA 1OYWA 2HCJB 1CEXA 1L7RA 2YWCA 4RFSB 2CLFB 1U2DC 3E3NA 4CL8A 1XG5A 1M6VA 1IY0A 3DMDA 1MDBA 1O5OA 5B12A 1GY8A 3E53A 3O8OA 4GUAA 1M8KA 10MHA 2GD6A 2GCOA 1NU8A 3NORA 4TLDA 4A8TA 3ZCTA 2IS1A 3BGWA 3I4LA 5M29A 5KNBD 4JI0B 3T3DA 3VSBA 2OLKA 5DM1A 1PQWA 4JMPA 2SECE 2YXLA 5EP1A 4DUGA 5ADHA 2P3OA 1IVYA 4BS9A 3W78A 4EIWA 3UIEA 1USVA 1L7VC 3AU8A 3F3SA 2XKJE 3GFFA 3WIOA 4B1FA 3EGDB 4IRXA 5C35A 1M8GA 1N6OA 2QY9A 3AL3A 3GF4A 1B76A 3AFNA 1GLGA 1Z4NA 3BN3A 2J8ZA 1M76A 4XB6B 4YXWD 5J47A 2FG7C 3AFMA 3IODA 1ONPA 1REQB 3NYIA 4DLUA 5CB4F 4E4TA 2QT0A 5KSPA 3VR0A 4KQ2A 1YONA 4KHZA 3GLGB 3IQDB 3HVRA 5LD2B 4KAJA 4TVKA 3G49A 4TZ6A 2OXIA 2WFMA 5TLSA 2DECA 1T9HA 2Y68A 3KSUA 1T4GA 1Y82A 4C88A 2QK4A 3U3OA 4BIIA 1E9FA 5IKEA 4H4DA 2V6IA 2FWBA 1X74A 2BEKA 2IRWA 1N5JA 3ZWDA 3RRXA 4GBGA 1CHDA 3RUHA 4OA8A 4R05A 3REQA 3K30A 1Y89A 2WWYA 4NYIR 3KKQA 2D62A 3EK2A 1ZINA 2XE7A 4Y1RA 4E08A 3S2YA 3C3XA 5AKEA 3KFVA 4MKZA 3KALA 2KSQA 2QYOA 1AXGA 1HYGA 1JWBB 1A4XA 3JWGA 1E3IA 3RJMA 1MXFA 3F9RA 3VYRB 1KJIA 4AXXA 2BLLA 1TZCA 2QW0X 1ODFA 4EB3A 2P5YA 1GG8A 2JJ2A 3IP7A 3BC1A 4UZFA 4P4GA 2BEWB 2NZWA 2EEZA 5HZKA 5LLTA 4BIMA 2O1XA 2WQZA 1KI6B 4FFMA 4L3VA 1Z63A 3GFSA 1DBIA 1LDNA 4QAJA 3D0QA 1ADBA 4CEJB 4AJNA 2C03A 1I0LA 4RORA 4UCQA 1ZGZA 3L1JA 5FUWA 4YAEA 1VCHA 2KQUA 4KLZA 3OE7A 5BWOA 1DTSA 1I7PA 3GLVA 1LKZA 3QSGA 5EI5A 3LPMA 4B74A 3T1QA 4O33A 3AEXA 5A4FS 1CNFA 2PKQO 3EPPA 1SVLA 3UWKA 5E4YA 1ZNQO 2W00A 3BD9A 3DO5A 3P9NA 5IBPA 1F3LA 3GX1A 4EGFA 1BMFA 1XRNA 5IDVA 3ZGYA 1VLLA 1I10A 2XA9A 1NE2A 1R00A 2OCDA 1JV2B 1D0VA 2O3SA 3KD2A 4PS0A 1DOHA 2NSLA 2EFJA 1AMUA 2FF7A 5DFAA 2N42A 2VN8A 4ZI2A 4DQUA 1RBZA 2EX0A 1DIRA 2PGLA 4LRTB 2DLNA 1DBSA 2NX2A 4P81A 3ILSA 3Q12A 4K1LA 4BV2A 2YDYA 3C5WP 3P26A 1IHDA 4MROA 4CCAA 5CT5A 2E82A 1P1JA 4FZ5A 1MC4A 2RBEA 4W4TA 3WGHA 4URYR 3UQZA 1VL2A 4DEXA 1EJ2A 4MWZA 4II7A 2I4RA 1MO3A 3NAMA 3AQ4A 2Q5LA 2ZDHA 3GJ4A 3ZHYA 4EKNB 3X1WA 3MFQA 5TDHA 2DT5A 3JRWA 1LBQA 3GCXA 4PCAA 3S2ZA 4BYGA 4CQMD 1YJBA 5ALSA 4Z9BA 1OZAA 4L50A 5HWSA 5J23A 4TN1A 2JEOA 3LBYA 2XRYA 2BMJA 3VR6D 2A9RA 3DHVA 3VYSB 2QN6A 4FYJA 1WDKA 1RYNA 1XZDA 3PC6A 3RC8A 3N2NA 1AG9A 1N6IA 3NM4A 1O9BA 4WK6A 8GPBA 1AV7A 2XDAA 4LJRA 3NV7A 3PLRA 1T8PA 3UGQA 2Q5JA 2Z5GA 2YJ3A 4TTTS 4NZOA 4XJVA 2PL3A 3G2KA 3IIEA 2JHGA 3AOGA 3LUGA 3NASA 4QDJA 1U0JA 4DWWA 3LUCA 2CLKB 4WEQA 1GRRA 1UPTA 1AV6A 2B34A 5B37A 2OFXA 1I3KA 1TADA 2PH1A 2J07A 3TXXA 4MWEA 2ECQA 2D13A 1GQRA 1SELA 2ZYIA 4RXTA 3NGLA 1VJRA 4HSEA 1N0IA 1YGPA 1B00A 3JQFA 3F6PA 1BHSA 5HFNA 5F12A 2C2ZA 4D3XA 4H7EA 1WAMA 1Z3CA 4XB1A 1NUTA 1UZNA 3K70C 5JSYA 2DHQA 4QL3A 3TRFA 2Y1LA 1BCRB 2YY6A 2DFVA 4KU4A 4L4XA 5ICGA 4EKDA 4YJ3B 3U4CA 1YA6A 4LF7B 2ZIFA 4JUCA 3WVNA 4HK4A 4G1VA 4MPJA 3IIIA 4R2IA 3CLHA 3TM4A 1R4NB 3HDVA 1KVQA 4WDRA 2FFJA 1G3RA 5IXYA 1VHLA 2UAGA 1VLZA 1XQYA 5LP6A 1ZL2A 3A6HA 4P1ZA 2W2NA 5H59A 4BJ6A 3NYWA 3DQZA 4MRMA 3SX0A 3U4QB 1OI4A 2VSXA 2ZYWX 1CERA 3PZBA 1IL0A 3NO4A 4L07A 1I30A 3HACA 3O4HA 4NK5A 5DX8A 2PY6A 3LO8A 5AKXA 5JAHA 1EWQA 1QYIA 2DR3A 2PSHA 2EP7A 4BP3A 2PX6A 1JFFB 4WY2A 1KDOA 3TCKA 3BG5A 3ASZA 3FAKA 1F8XA 1WPQA 3UBMA 1U3VA 2EKDA 3GNQA 3ZE9A 1PS0A 1IXKA 1NNSA 3TVTA 1YZQA 5BN4A 3H18A 4MR9A 2IPAB 4R68A 1MAWA 2VTEA 4EYEA 4PQRA 2WTXA 3BUSA 2R6R1 3HN6A 1SFRA 1XVLA 2IS2A 2I7XA 3LTEA 2LCFA 4DMHA 1O54A 2QRLA 3NZEA 1QP8A 2VLIA 2Z95A 3ABZA 3MWKA 4GM4A 4O4LB 4B81A 1CF4A 1DT3A 2DPYA 2QAIA 5EMNA 3RYFB 1T4CA 2A86A 2WB4A 3AF0A 3ZDQA 4F91B 1RAFA 3T3GA 4BZXA 3LQKA 5B36A 2HF8A 2O4CA 2Z3WA 4P58A 5GGXA 3SLRA 2GN8A 1YQDA 2VJBA 3CVOA 4HDSA 1AGNA 2ZPTX 3DOUA 4MLZA 5B6IA 2NAPA 4EG3A 4LBZA 1TTPB 1CUHA 3U3ZA 3S2EA 2FN4A 1F8GA 1LPPA 3AP2A 3L8GA 4CQJA 1K98A 3AW8A 1NIJA 1R8XA 4PAGA 4QM7A 5CIQA 2FW8A 5EIEA 4YJFA 5DDIP 1JWLA 4BQSA 3OZ7A 3NBUA 2V6GA 1EGMB 3FJYA 3PENA 3B7PA 3NIGB 4NG5A 3VTKA 1UCFA 2PMKA 1SHKA 3L6DA 3Q5DA 1ZSYA 4WKNA 3V8VA 4N41A 1JMYA 3QVXA 2C78A 1M34E 1T36B 3MB5A 2I6QA 1V11A 1WW3A 3K9NA 2WD7B 3LQQA 4ZYZA 3R9XB 2O8DA 4E09A 2H9YA 1NI4A 1CUEA 4C4AA 3UANA 2JLRA 2RI6A 4D3ZA 2PBFA 3ZD8A 1R0ZA 2GKGA 3B1VA 3UK7A 2I76A 1BGXT 3V32A 1NVXQ 2G82A 1QVRA 1Z2AA 3HCOA 1HFJA 3H1AA 4NOKA 3SFTA 1EVEA 3P9ZA 2W37A 1DKLA 3EDMA 4MLDA 2R2GA 3H5TA 4FDAA 4RS3A 1TUBA 1SEVA 1XCLA 3B6MA 3MIZA 4G6ZA 4WAUA 3A1VA 1M1YE 4ZAVA 2JAOA 4V1CA 2YMQA 3G8AA 4HH4A 1AQLA 3TGWA 2JIOA 3C6YA 4F4DA 2QX6A 5E6RB 1O95A 1PFWA 2QE7D 3E7WA 4PR0A 3BSYA 2VDNB 5LMUB 2YC2C 1PS9A 3FFBA 3IC5A 3PKJA 4AZWA 4I3HA 3DOFA 3BAZA 4N5HX 3QVGB 1XZIA 2PO5A 4QJ3A 1A1VA 1A7JA 2CDBA 2ROQA 1C3JA 1RI1A 1OLSB 4HDCA 4MVCA 3EFHA 4CL2A 1GGNA 4PGMA 3BWXA 1ZFNA 2GZRA 1AK9A 3A25A 3RS4A 1P3JA 2E3JA 3OCCA 1CIVA 2V5VA 2VDRB 5JJLA 1X9HA 4M55A 4BFTA 1DRKA 1BH6A 3M5PA 3OQIB 1G20A 3HBLA 4BX3A 5CH8A 3L6UA 2QRZA 3EDYA 3SNKA 3K9LA 3DSRA 2EJWA 3AU9A 2ZSAA 3IAFA 2Z3VA 4FZJA 4QTZA 4RXMA 4BX2A 1HMYA 2AYYA 3ADKA 3HH8A 4IQFA 3DUWA 4NC9A 3CLSC 1VE3A 1EFRA 1SC1A 2HK7A 1U98A 1D2NA 1W73A 2GSDA 3LQ4A 4II2A 3HKDA 4NECA 1MLDA 4B47A 4F3NA 1IY8A 2QN8A 4PHTA 4LHSA 1Y3FE 4ENRA 4RHYA 4KGVA 3BHNA 4CMIB 4X8OA 3FTDA 4HH0A 2QTRA 1TZJA 1CR6A 1DRWA 4C87A 3DLHA 2QTVA 1RWVA 1PR6A 3DR5A 3VGPA 2OGZA 3B51X 2C83A 1PX2A 3IP5A 3PR1A 4EHIA 5D51S 2C59A 1XU9A 3H86A 1Z2EA 2VBFA 4LECA 2WHQA 2XD9A 3VXKA 3V4RA 1KVUA 2WQ7A 4D96A 5BMVA 4D9IA 2ZM5A 1EX9A 1Z7YA 1KMIY 1FFXA 5K8JB 3OQMA 3KAJA 5LUAA 1Q1ZA 3MXTA 4P4SA 4DT1B 1NW7A 2VNJA 3N6RA 2AYZA 1VG1A 2AOXA 2HA4A 3H8SA 3OOEA 4XIYA 5HTKA 4XWOA 2BI7A 3M82A 3SXUA 3TR0A 2FWNA 2PV7A 2HYDA 3QWAA 1M0EA 3PD0A 5D2CA 3JWPA 1AGXA 4ZPJA 3WGNA 3HB7A 3KPVA 4BRSA 1LLUA 2ZB3A 4HTFA 1II8A 1WUIS 3EVNA 4TS9A 3O8LA 3CF4G 1U02A 3PNLA 3VKGA 2J5QA 1E6UA 3DZHA 1JZSA 2JGDB 4F4JA 3L04A 3CVVA 5A0TA 3PB3A 2IZZA 4XX0B 4LMPA 1EP3B 1T0IA 2FFQA 4YWJA 4X62B 2XRFA 3M6WA 5ABPA 1OIWA 3M6XA 2HLDD 2IBMA 2ZRGA 4JI3B 4EUKA 2JGEA 2ZZNA 4YONB 2HRZA 1RPTA 4PPFA 3SX2A 1ZU4A 1MN6A 2J9FA 1ORHA 4HI0E 4P82A 1MJ5A 1IAVA 1OX4A 1NZFA 3A1EA 3E8XA 4QO7A 1P75A 4C0LA 3G23A 3FGOA 2VBCA 3KUCA 2CN1A 3EXG2 3EFOA 4B6EA 1JQ5A 1Z82A 2ZTVA 3ECSA 3SJAA 2P91A 5EJ6A 3ESZA 1Z2OX 1DC6A 2GTHA 1LH0A 3GPDG 4QT0A 3VV3A 2CDCA 2O7NA 1UDBA 2V3VA 3KXLA 1E7YA 5ALUA 5EE9A 2EC5A 3UM9A 4RVNA 1SVKA 2PMDA 1FYVA 1GN8A 2VIIA 3KOWA 4I1RA 3LV8A 3HU5A 3BX1A 3H8WA 3WGKA 4V0KA 1VSBA 2FR8C 2GJSA 3P94A 5DCWA 1INLA 1JSZA 3E7DA 4JASB 5G2OA 3NTLA 1OBHA 5DXJA 8ABPA 1P91A 1CY7A 3AVWA 3FTNA 5WRFA 3B38A 4IV8A 2GFIA 4J2TA 4PNEA 1RMQA 3FTEA 2P3QA 2IWHA 2GILA 4CMJA 1OLUB 4HAVA 1EMDA 1M2JA 1VA4A 3C1UA 2Y2UA 1QX3A 2AFIE 3AHHA 1CRWG 4KUGA 1U5AA 4DM3A 3SMVA 3V1MA 2DSTA 1UJ2A 3UAWA 1E2PA 2AJ8A 2JKZA 3ZK7A 1IMJA 1OA0A 2D2VA 4ZJYA 1Y4UA 621PA 2UV8A 3LXRA 2NVOA 4GOKA 5EE1A 5TPZA 4BJ1A 1NV8A 3CLTD 1KO8A 2MYNA 4BQRA 1ELOA 2H3HA 3BIJA 3UB3A 3WRVA 4DHEA 1LJ8A 1N2JA 3FNQA 3U7JA 4L8VA 1Z5VA 3GLHA 3ZHQA 2DVMA 2GYUA 3W5BA 3FPJA 2BGJA 1DAOA 1ECJA 4PFSA 5ANRB 3NM5A 4MVJP 1CJUC 3EPKA 2QNIA 4OFBA 3ITNA 3V9AA 1N75A 3MLAA 4X6YA 3UVEA 1XCGB 4HLUC 3IKVA 2EJTA 2WZDA 1U9IA 1KSJA 1WY5A 1LBTA 1JR3D 3B3JA 3K2IA 3EH1A 4G4SP 4DCJA 3P2JA 2P77A 5AIBA 3UHFA 4RK1A 3QWBA 4LYEA 2IPOA 1EFHA 3LRPA 2DWUA 3U19A 3EOBI 2ZWMA 3CA8A 4U7FA 3U1BA 4L4YA 4IRUB 3HO8A 1M2OB 3GMIA 1T6BY 4Y2PA 1E5XA 3ABRB 3IDAA 1NW4A 4PC1A 4MYDA 3EWNA 2PZKA 3FUWA 4OUDA 3V2IA 1MNQA 4YCCA 4MW4A 5T41A 1J0BA 4G0PA 5FXMA 2WKWA 4Q7MB 4IVRA 1B6RA 1JZTA 4FFDA 4UXIA 4YJGB 3SICE 2BC9A 4ARCA 3JZDA 4HBZA 3BVPA 3DE7X 1JQJC 1TQ2A 3PTZA 1X0XA 5AW8A 3NYRA 2V7QA 4TT3D 1AM4D 5BWLA 3IH5A 4BKUA 4GO1A 1L9KA 5FYQA 4C6RA 3AKZA 4B3RB 1RTKA 2O0HA 1JI3A 3GZ4A 2PS3A 3AJRA 3MVEA 2HTFA 1YQGA 3RQIA 5ADUS 4O2BA 4PSUA 4P31A 4BZWA 2ATVA 3O1HB 5I7UA 1J7KA 2YVLA 1U80A 5FPQA 4L6AA 4WZAB 4YCDA 3WADA 1G7CA 2KHZA 5ALWA 4K88A 4Z49A 2EBFX 2VXCA 1N6PA 3C3PA 3OLVA 2ZDGA 2WAMA 2CLMB 1Y8QA 2FMTA 2OV4A 4WADA 1QU3A 1R18A 2JH8A 1XVIA 1ZLYA 3KHTA 3MELA 2PUBA 1PFGA 1US8A 4BMXA 5K3EA 3U7RA 3FCUB 3DMYA 1TA4A 3OKAA 4R81A 3A2MA 1EI9A 1S2OA 4NJOA 5ALEA 5P8WA 2AGVA 1RADA 4XVRA 4C0BA 2NM0A 4D8XA 3FLBA 1JPVA 1R2QA 1V41E 5KTYA 4EATA 3EC7A 5EZSA 4Y6QA 3UV6A 1F7VA 4Q1FA 5K8CA 3FDJA 5DE3A 1E0AA 1KP9A 3JAWA 1QC5A 2PLWA 3DLCA 1JZQA 2Q5QA 4FXPA 3UGKA 3K1YA 4PLPA 1XHEA 5BN3B 4OHRA 1CY6A 1A5TA 3WBBA 3LKZA 1NVVQ 3VPDA 1S8AA 2VYNA 1E1RD 4I36A 1ULHA 3FCEA 1YZYA 2G09A 4MDYA 4OYLA 1FP2A 5EJ2A 1G9SA 2EV9A 1ZWKA 2Z4TA 1ZRNA 3L3BA 3PWTA 3UT6A 2VYVD 1THMA 4NJMA 4CF7A 2EZ4A 3CE9A 2NUTA 2Q3JA 3CZQA 2IEYA 5AM1A 4W99A 1NUQA 3NKVA 3KDSE 3QKRB 3ROQA 1J8DA 1XLWA 4UNSA 3UG6A 1M2VA 3P4YA 3EC2A 2BMEA 5FWYA 1CUAA 1IM2A 3G0OA 4Q9IA 1WB4A 1HTWA 3G1UA 3JQGB 2KE5A 5A05A 1QS0A 3CISA 4H0CA 3MUFA 4QBHA 3FZYA 4CL0A 4TTVA 4HHEA 1K4YA 4IWXA 4ZZ1A 4P08A 2BGNA 3OZGA 5CA0A 3K94A 1NI3A 5D3MA 3H3FA 2R8PA 2GAJA 3TDKA 5KYXA 3ME5A 2WKPA 3UN1A 2PTHA 4CLRB 1VOTA 2EWWA 1KJYA 1G1AA 1FYDA 3EAFA 3FPHA 2YHAA 4X6XA 2IUFA 3S2UA 3MBKA 4JYCA 2B83A 1DQSA 3RSZA 1RMYA 2IYFA 1JLKA 2V6FA 4UMEA 3T7EA 2NO4A 4QJBA 1JG7A 2QJWA 3NRBA 3AHCA 5AQEA 3CSDA 2ODBA 3AY7A 3NKLA 3LPAA 4OU4A 1GHTA 1AVTA 5IF9A 4YMLA 1R0RE 1DIHA 3LP8A 1UANA 4H15A 4Q0MA 1N36B 5C4IA 2DZDA 4ZEMA 4O3FA 1IQPA 3EF1A 3TJMA 4JI7B 3T5TA 4GE3A 3L0IB 4I55B 4AWBA 1LPMA 3PUVA 2OZVA 1ZNYA 4RF2A 4PFKA 5IN5A 4KKXB 4GNRA 4MQFB 3RSHA 2Q3HA 2QXUA 5JCPA 3QW2A 3ZCXA 2XEDA 5TR9A 2B5OA 2IYSA 5E9JA 4C3VA 2J9XB 1ORWA 3IEIA 4G1CA 2VAWA 4YRTA 1W93A 2QM8A 4F5DA 2E4VA 3IB3A 4W7HA 2VDWB 3SY8A 4B9EA 4OUKX 3HEMA 4KIFA 3C8UA 2I7TA 3D8HA 3AL0C 1Z5WA 2I22A 3ABOB 4DCGA 2QPOA 1QUEA 1Y5NA 2BHSA 4JDUA 2EKQA 3I2KA 3HLYA 2G88A 2WKRA 3PUJA 4G26A 4R31A 4S3MA 2A5JA 1R9NA 5B2EA 3VFDA 2ZJ6A 3CURA 2QG4A 4KR9A 2XY4A 4DDTA 4RTOA 2E1PA 1U0FA 2O5RA 2FDXA 1ORDA 4MULA 2GPNA 1GUAA 5D5PA 5HBGA 4CM8A 4EG4A 2JB9A 1BMTA 3NAQA 1E2UA 1I80A 1S3IA 3FR8A 2PWPA 2VK8A 2FZKA 3ADCA 1V9SA 2X6QA 4R9VA 2HDNB 3M83A 1Y81A 4IEIA 1ID8A 1G6Q1 2C0CA 4QQRA 1M6WA 2R60A 2VK1A 5ECYA 4AY3A 2AVDA 4LXGA 4OH7A 3WMWA 3K9CA 5FH9A 4RACA 2ZREA 1QG4A 2EX4A 4Y1RB 3OJFA 4OB7A 1LK0A 1K7EB 1W1UA 2YYAA 3HYSA 3LT4A 3PHGA 3QUQA 5B1IA 2PA0A 2M9MA 1QTNA 3ULKA 2JLUA 3MJCA 1VZ2A 3FPKA 3HQ4O 1P1HA 2ZE7A 5E7QA 5DHAA 3RSSA 1EB9A 3AK4A 4A15A 1LRLA 4QHTA 3L4KA 2ZXEA 1Z73A 2V1XA 2ZRJA 4IEEA 1FU8A 1I8TA 1X70A 1MAAA 1O94D 4GWKA 4OI4A 1H23A 2W98A 1JN0A 1TC1A 3I61A 4X54A 3BIWA 4TWIA 1DUVG 1E3QA 2O07A 3IR7A 1AUVA 1FRNA 4MWBA 2QIPA 1NQUA 2ZB4A 2GTPA 3WNDA 4HGPA 3SZMA 5JFOA 1WZEA 4P80A 5DULA 3Q6IA 5EQJB 2CHVA 5EKDA 4BQEA 1V9LA 4LGYA 5JXWA 1E62A 2XNHA 2B7LA 3EQ7A 1E9VA 4C0XA 5EIBC 1Y33E 2NAFA 4CCSA 4A1FA 4AZ0A 4F2GA 2WVHA 4RKEA 4CQNA 4N76A 1Q0UA 4LVNA 5IYZB 1H1TA 4AZSA 4TMFA 2GEBA 3JR3A 3HM9A 3QVOA 4AY5A 1JDBB 3GT3A 4N40A 5AM5A 2F6RA 1W52X 4XQGA 3K8ZA 1QYRA 3GUVA 3UT0A 4XKJA 3FDZA 3D7RA 4MUJA 3MTIA 3BICA 2OV1A 1A7UA 1X1CA 5CBPB 3OIFA 3QOYA 1KS9A 4PTYA 2VJMB 4Q3OA 1IPHA 1VP3A 4K05A 5HKBA 2VCEA 2QTFA 1KYVA 1IWBB 3COWA 3HWSA 3UATA 2EZTA 2RCNA 4QOIA 2CL0X 2GYWA 4HRVA 1MJFA 2QTBA 3T9FA 5AUOB 1A9OA 3M6FA 5F3DA 3D4BA 3GIWA 3ANLA 3ZI0A 3S55A 4O1MA 1EBUA 1GQQA 3FOZA 3D6MA 1JXQA 3A0RB 5KYUA 3V1YA 3V8BA 3GCGA 4TRRA 1T0UA 1L5MA 2IV2X 1D4OA 1AK1A 2REBA 2ZIAA 3FTCA 1WLSA 3ISTA 1IQRA 1P3DA 1V1MA 3DV2A 1WXXA 3GVHA 1M67A 3JPWA 4IGIA 4KZPA 4PZYA 2FJ0A 5CDUA 1NQTA 5IK2D 2O5VA 1DEOA 1AQ6A 1T8YA 3LU1A 3M0EA 4TRMA 3JVUA 4FP9A 5E6SB 3WICA 4ALJA 2XMBA 3AX6A 1N2CB 5JBNA 5KSZA 1BDMA 3PPYA 2HNBA 5TV2A 4ZDJA 2Y92A 2ZVDA 1SNYA 4JP1A 4KQJA 1KVSA 4HNGA 2DBQA 5D6OA 3QVWA 2GS9A 4FS3A 3ZVMA 1QHGA 3G2NA 1JSRA 2EW8A 2VWQA 2BMDA 2WOOA 4PONA 1T9AA 1JEAA 1U2QA 5J4HA 5JS1A 3HCPA 1MQSA 1FOEB 3B8HA 4WESA 1A2KC 3VZCA 4XOUA 4B3TB 5DK4A 2R5FA 1EK6A 1YBMA 4ZYTA 1SHJA 4OB8A 1U9JA 3MOGA 2J45A 2PUTA 2WWVD 1XZEA 2C4HA 4OK3A 2I2XB 3EIEA 3E05A 4TROA 3ROZA 4BLVA 4IH1A 5HVNA 3OX4A 1P0FA 1E1MA 2BFCA 1XTZA 1KMNA 2C3YA 3MXOA 2Q4TA 3ONEA 4PEVA 5T4EA 4HV4A 5BUQA 4BXOA 1C29B 3OZSA 1Z22A 1RVV1 2HO4A 4L73A 1E7SA 4HEA1 4EDFA 1ISHA 1KPIA 2QMUA 3P1JA 4MRMB 4OXIA 3V4VB 4NCHA 1U28A 1V3QE 1L7PA 1PWXA 2D59A 2OD9A 4I08A 2HQOA 1PQUA 1UFOA 1JHPA 1P2DA 3F5DA 2A59A 3JYLA 4Q3EA 5BSRA 1HC7A 3IUEA 3NTOA 3OTWA 3Q3CA 2QX8A 3EIHA 1EHYA 3HYLA 3SZ3A 1L4NA 3TLGA 5KUTA 1FFGA 1RM3A 1YIOA 5HCIA 2B69A 5DM2A 2D5LA 3IUQA 3TW4A 3WRYA 3WYNA 4F85A 4YQFA 1ZM3A 3WAJA 4M38A 4ND4A 1ZIYA 2F3TA 5F9MA 3TFWA 4DYHA 5A3JA 2YWRA 5GJBA 5EUBA 4UVEA 4S05A 1TEXA 3AM4A 1MA3A 4AKSA 3D4NA 3G7UA 2R25B 4ZVMA 2YX1A 5CCBA 4G07A 1Z2NX 3RVSA 4UUAA 4NP6A 5C9ZA 1EPUA 3MINA 3LF2A 1MABA 3E58A 5CX4A 1NIPA 3I9MA 4WXYB 1MOSA 1H3FA 2ENUA 1DCMA 2M6RA 4M3NA 1A8SA 4EZBA 1I4WA 3D54D 4IDEA 2W4QA 4MUFA 1UMDB 4YDRA 4HDSB 1RPAA 4DLAA 1YE5A 2DH5A 5BR1A 4LY0A 2BFPA 4JXJA 4DM7A 1W48A 2MMCA 5JAIA 4LHXA 4OHPA 4ZV9A 4QBIA 1KZYC 2I4IA 5F33A 2Q8PA 4JYMA 4Q7EA 3SHVA 2IU4A 4QULA 3IMEA 3QMMA 1FP6A 2SCUB 4UD2A 4XW2A 1UT5A 3Q3IA 1F2VA 3V2GA 4BWVA 2X0NA 4AIIA 1DADA 2XVZA 4DF3A 4IKPA 1Q7BA 2YXNA 5HDQA 1DAHA 3UT5A 4PLGA 1PV2A 5JO0A 3A7DA 3VBEA 4IG4A 5L7WA 2NSHA 4R5MA 2Q1UA 3OM0A 5JV5A 3DZJA 4DANA 2VFAA 3CNNA 1XCMA 4JGBA 2R62A 2JVKA 4GMFA 3WGIA 2V6BA 5EIOA 2BF7A 4TMKA 2XQKA 1QFSA 4OM7A 2OO5A 2GD1O 3TWOA 1GRNA 1LQUA 4M87A 3CUKA 4AICA 2RAPA 2VYQA 4ZOQI 2PANA 2LBPA 4WBSA 4X44A 4BWGA 1TQHA 4ZI7B 4YRDA 1XN1A 1Q7CA 3NBMA 3ONNA 1DP4A 1EM8A 3TI7A 5JQGB 4JLWA 3HCRA 1R12A 1JSCA 5EZQA 1T15A 3T4PA 3C6QA 4EY8A 3BZUA 4YNBA 2F67A 2VRNA 2ZBUA 4LVOA 3CB2A 1E6LA 2GBIA 1RCTE 4KRFA 1DVRA 4E2WA 5FNVF 3C14C 4K6CA 1D2AA 4GQIA 4LCBA 5F3WB 3O4VA 4F11A 2IHVA 2CUTA 3HB5X 1X1QA 4KFCA 2BSQA 1ZQ1A 3IEXA 3NHYA 3NETA 1WM1A 2P9EA 5KQSA 2ETXA 3QVSA 1EXVA 2HCRA 1JKFA 3LJKA 1SXJA 1YB5A 1C1HA 2CJYA 4BQFA 2EZ8A 1G20B 2H1LA 4UBOA 3BE8A 5JD3A 2V0CA 3PCTA 5J2UA 4X1IB 4CEIA 1RWMA 1I01A 2XIJA 3EC1A 1KIMA 2YZKA 3ZZ0A 1S8NA 1V45E 3MQ4A 2OD7A 1YRHA 3K7EA 3KQMA 3HBNA 5CDSA 3M3DA 4NCXA 1CB0A 3I2FA 5FPYA 2ZJ7A 3ETNA 4NSNA 4WK0B 3Q8XB 3IJPA 2EQAA 2X5KO 3D4IA 3IURA 3JQEA 5CH5A 2OL4A 1BQEA 1RJ9A 5IFKA 3TQOA 4BFUA 3DEAA 5BQPA 5C34B 3BB4A 1D5WA 3GRAA 1QRSA 2C98A 4KN9S 1ENPA 2TS1A 4EKGA 5HKOA 3W9UA 4MQUA 1EZ4A 3MS4A 4F6RB 5BMVB 1C3LA 2LW7A 3DFFA 1FFXB 1K7XB 4C89A 3DOHA 3ACCA 4P4SB 2VTBB 1WZNA 2O59A 1F8UA 1QOQB 4QDOA 2FXVA 2IYWA 2DHRA 5JSUA 3CS3A 2C99A 1LZKA 1N3BA 1X80B 4JSYA 1E2IA 1NZJA 3QX8A 3FGNA 4PZEA 4MGIR 1HK7A 4J90A 4TL6A 4HZGA 3V42A 5DBGA 2QXYA 3KL4A 4FNMA 1ACMA 1GO2A 4U2DA 5MFZA 3K6SB 3B1KA 2GGSA 4HTFB 2IF2A 4I9GA 1OWLA 3DOJA 4BBPA 1D3AA 2CEKA 4OJNA 1YQXA 4UOQA 4R0NA 1WCXA 1XYGA 4QUIA 4W1PA 3ROEA 4CNBA 3B1YA 1UWCA 3PX3A 1NY5A 3V00A 2BH9A 3LDUA 4DUZB 3TQTA 1FIUA 2C8JA 3E9RA 4NABA 4IQ0A 1YJQA 4PVDA 5A06A 2Q1TA 4X7BA 1RFGE 2QQEA 3UBTA 4F92B 4JCCA 4EA7A 1HMPA 2FPOA 1GUYA 2JZCA 2WP8J 2J9FB 1P61B 3NDIA 2HJSA 4OXRA 4QUDA 1L1FA 4IXMA 3ZZTA 1EGAA 1M6YA 5GOTA 1X0VA 2C1XA 2QLBA 3GHHA 1GDDA 5CJJA 1FFEA 3W79A 1GL7A 3QW4B 1Q74A 1RAIA 1CLEA 2QRUA 1S2DA 2BELA 3VKUA 1RZVA 2A88A 4HAUA 5JJ5A 5LN1A 3E7FA 2B7BA 3R23A 2G5CA 3JQ8A 4RA9B 3QPAA 4ZOCA 2TYSB 4QBGB 5BUZA 3HADA 2O8EA 4J1SA 2JCGA 3X1MA 2XIQA 5IAJA 1DDOA 1Z06A 1JHYA 1S9DA 2XXBA 3D9QX 4JXZA 4ND6A 1J2JA 4RSGA 3EGWA 1M8PA 3ZLVA 2DWPA 5E2BA 1Z0DA 1GCUA 4BQNA 3I32A 3KQYA 1XTVA 5GAJA 4EO9A 1J5XA 3T5CA 5BQFA 2HNKA 4WN9B 1VGVA 1MIOB 1EUCA 5IEJA 3AETB 3WZLA 3SYNA 1U6IA 1XQ9A 2G63A 4RNDB 3TBFA 3AJAA 1G7TA 1F0PA 2ZVPX 4KYTA 4B7AA 1QCDA 5KHOC 2CHUA 4JI8B 3HMQA 2YVAA 5KINB 1OE0A 4N8EA 2I87A 4X3OA 4PM4A 4PG5A 1M10A 4S1NA 2VPXA 4PZAA 1F4LA 2GERA 3PQ8A 1LRKA 4NBTA 1RQ2A 4JWKA 4NMWA 3FBGA 2J4DA 4MA0A 4PQYA 1KQGA 1RYFA 3DMTC 4L5AA 3DLTA 3AIMA 5H9VA 2H63A 4AF8A 1Z4LA 2AK2A 1OF1A 3R8FA 2ZE6A 3JQBC 1NP6A 2WMNB 3AP1A 4TTPA 2GXSA 3AI2A 2B9VA 2JAXA 5KQGA 2W2LD 2CC2A 4B3MB 5AHXA 5B3KA 4DPLA 2IGTA 3L0ZA 5LL6P 1IM5A 1V16A 1U04A 4JUDX 5T64A 4DCUA 1J0DA 1Z25A 3CEHA 3HCWA 4DQ0A 4XUDA 1PR2A 2GN9A 4BQQA 4BKPA 3WLSA 1AZWA 1RZUA 3OX3A 4X3CA 3UAVA 1TAUA 5C1BA 1O89A 4R01A 3TK1A 4A6XA 4MLPA 1GZHB 4IMRA 3GAFA 1OWPA 2QV0A 3LNCA 4OKNA 4DLXA 1QV9A 2PCJA 3NG1A 1TEZA 3LIIA 3FWKA 3OUTA 1KL7A 1WP9A 2PXCA 4N7JA 1DGQA 3H11B 1JDUA 2VHUA 1T13A 1QTIA 4BO9A 4INAA 2NO0A 4U1RA 2HW8A 2C2XA 2QN1A 4IJ6A 4C6TB 4DC1A 3MS7A 4Z3KA 1LI7A 3EA0A 3GNSA 2GM4A 3A6LA 4BGUA 1USWA 1QK4A 2C4NA 4IIHA 4NMHA 3I9LA 5JDCC 3SKVA 5KKCA 1U31A 3SLKA 5IJAA 3U0VA 4WA8A 4OYHA 5CLLA 2UU9B 3MT7A 4CKWA 4TUYF 4CG2A 4ENUA 4AS1A 1A9XA 2AOTA 2P11A 2P30A 4O2BB 2C95A 3E4DA 4NS4A 1NDHA 4PYIA 4BO6A 1MVLA 1O0CA 1KIFA 2NQ2C 4W1QA 2FFBA 3BL6A 2R87A 3L7YA 4B2LA 2BP7A 1K68A 1Y3IA 4LYHA 2H7CA 2DAPA 3UPUA 2OUKA 1AOXA 1ZPDA 5BWNA 5JI2E 1V25A 2BLNA 1U8EA 3FBWA 2B8JA 1CUVA 2UVPA 5DX1A 2OESA 3EASA 2EKBA 3OO1A 1ZN2A 3EHDA 5KJEA 5I4BA 2ZUCA 5GJWC 1AU9A 1GIAA 2OYCA 3SXJA 4GM1A 5A4MS 3RIMA 4QOFA 2PIAA 2RHBA 4RHUA 1VIMA 1X38A 1ZD4A 2FEKA 1SB9A 2Y0CA 2NO1A 5FAKA 1ADFA 1D6MA 3RI3A 2ASEA 3PL1A 2VHEA 1IN5A 3TSOA 4D43A 4XYLA 1NBWB 3DL0A 4NYJQ 5DSZA 3JAWB 4Q3DA 2N9UA 1VSVA 2X8AA 1GYPA 1MKYA 1Z6AA 3R3ZA 4FHDA 1O0BA 3UOGA 3CWCA 4YRKA 2FZEA 1QVZA 1W4BA 5AW4A 1FRFS 1GV1A 1QGOA 1QF6A 2JGKA 1E63A 3CLRD 4FBLA 3VPSA 3S44A 3U9LA 4DOMA 4TN5A 4LYYA 3U5ZB 1JA9A 4LHVA 4N01A 4NL4H 4NG4A 3QU2A 3LF1A 4NJMB 3UFXB 5KCMA 5KDOA 2V1UA 1V3TA 4MS3A 5H02A 1CUZA 5EZ6B 1OIVA 3MM4A 1KDPA 3E9NA 1H0SA 1QR2A 1BVYF 1H2WA 3IYLW 5DCYA 3VU1A 4AJLA 4BHTA 2UXCB 1CS0A 1HFKA 1RSZA 1UXIA 1ECFA 1JXAA 3KPYA 3MWDB 3PG5A 3QRWA 5G53C 3RU2A 4U02A 5AKJA 4EVIA 1TNDA 3D1VA 4ND8A 5B53A 3TQCA 5F9FA 4RESA 1CUIA 4QYXA 2OCIA 2ZBRA 4HGYA 4LZZA 1ST3A 2DSNA 3W3AA 3I1JA 1YS2X 4QOEA 3MSCA 1MOPA 2XTMA 4TLBA 5ALFA 3HL4A 4MDHA 4V0ME 4Y18A 1AXRA 5KYXB 1BZYA 2O3TA 3F46A 3B85A 2AE1A 2D5BA 2Z1DA 3M2PA 3NP7A 4PHGA 1U3FA 2R11A 3WIBA 2BEUA 2GPAA 2IQ5A 2ZR8A 1AB6A 5B6PA 4G97A 2D1SA 2OBBA 2WZCA 1V7CA 3SKXA 1UH5A 4JT9A 3N2IA 4KVFA 4BNDA 4RD6A 3L6RA 3OQVA 4HS9A 2W90A 2Z8ZA 1BMDA 1EA5A 3D2BA 1N0WA 2IYQA 1I7QB 1JEQA 3WGVA 4HWRA 4EHKA 2AN9A 4OHKA 3LT2A 4B6JA 4DIOA 4D9CA 4U7HA 2XNKA 3FGPA 1Y7HA 4M36A 1T5DX 3KHKA 1Y8CA 1Q3KA 1UQTA 1DIBA 4RH3A 4XD2A 4B5LA 3BXGA 4M76B 4YP7A 4D99A 1UKEA 2HQRA 2CDRA 3ANNA 4F1KA 5H9WA 4RY9A 1XMQB 3NHRA 2WJPA 1K06A 2OO3A 2RG1A 4AMYA 1P0MA 2RDMA 4LKOA 4G5FA 1VPWA 3L6OO 1N0VC 4C4OA 5P21A 1ZEMA 1W4RA 2AJCA 1EIWA 3IQGX 3CGGA 2YJ6A 4RMHA 3Q9SA 3KFXA 5IAGA 1GKLA 4EJSA 1S9HA 2ATCA 4F45A 3QOFA 1F8YA 3D0KA 3VYWA 4F4HA 1QZZA 1XQXA 2I8CA 1X1SA 4I1OA 3KK0A 3SSMA 2P1ZA 4B9AA 2VQ6A 3COYA 1W5BA 3R3HA 2VI5A 3OWOA 4JENA 5J5AA 4WBNA 3IULA 4IIJA 4US2R 4JU8A 1J8VA 3O8RA 4RY8A 4LISA 4OKIA 5JR3A 3I73A 3WLFA 5AHRA 4EABA 1AIPA 3ZW8A 2NVWA 2FMXA 4FOPA 2ZE5A 2R3SA 4GX1A 3ZCVA 3UPTA 3U31A 3ZV4A 1IOWA 1R5OA 1T9BA 3UMRA 1CLUA 1ZM2A 2HRBA 2BCJQ 3RLFA 4PO3X 3V2UA 1UPUA 2X5NA 1XF1A 3E1GA 3A6GA 5BP7A 4L8WB 4IO0A 5LQRA 2MR5A 3KKKA 1OWMA 2A5FA 2ET6A 1VGRA 4HN9A 4W9NC 2ZS8A 2HQSA 2RGAA 2RARA 4REQB 1AKUA 1BE1A 1F0NA 3KELA 4J03A 3O8CA 4L72A 3OI7A 4BFYA 4Y2TA 5KKAA 2V03A 1Z9BA 4CQMB 5LVAA 4RENA 4X20A 4BQOA 6ADHA 3CLUD 2L82A 1G4HA 2RHLA 3DNMA 2B92A 1GCIA 4O1HA 2DTXA 1UJNA 1ZK2A 3CG4A 1MOZA 4HPJB 3UNXA 2IYYA 2UYOA 3KXPA 3M6AA 1DEAA 4MJ3A 1YB4A 4OQPA 4A10A 3ZHSA 2XNDA 3JZMA 1TM2A 1UBEA 2YY7A 3FSGA 4F9TA 5LP1A 3F5QA 2OP0A 3DXXA 5DMHA 4A2QA 2LUOA 4D74A 2PGIA 1KTVA 5DGXA 4URVR 4QXQA 5LYYA 1YE8A 1C3EA 1M72A 4ZYWA 4HL6A 4QDTA 1RP1A 2IHUA 4FILA 3C7CB 4O1IA 4K6KA 4MQ4A 5I4IA 5IJ0A 1AZTA 4OH1A 2AZDA 3NALA 2REQB 4D0GA 2GZ1A 4QDZA 2F8LA 1HKUA 2C92A 1W25A 4JC5A 1EHIA 5EERA 4G0QA 16PKA 3ZIAD 4DMGA 5CLFA 4GPZA 4KO3S 5JG7A 4QBTA 3VNBA 1GLVA 2JFYA 4F8YA 1DIGA 5K3SA 3JD0A 4PSKA 2PD4A 2YNMC 3W5IA 4DV3B 3PTLA 2VTVA 4LOJA 5DBEX 5HF8A 4EH1A 2I66A 4N5LA 1ZMTA 2FQ1A 4BRWA 2O7VA 2ZAMA 5JH7A 2VHJA 4D41A 3TZLA 1JDZA 1QDLB 3LKDA 1WVMA 2BKXA 5K4AA 3KETA 4EQ6A 2GBLA 4PYQA 5BVGB 2BR4A 3PEEA 1VJGA 4WA7A 3K35A 1CE8B 1Q92A 5TF4A 3NPMA 1E9SA 2QJTA 1NRJB 1G21E 3RPEA 1K6JA 4EA8A 2HO5A 3RVPA 1GOTA 1DKPA 2A9OA 2CFIA 3GWGA 4PX5A 1P0IA 3T5MA 1MRNA 1RS0A 2VS1A 3KWLA 1DI0A 4NENA 4J3NA