4WCVA

Haloalkane dehalogenase dhaa mutant from rhodococcus rhodochrous (t148l+g171q+a172v+c176g)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
293
structure length
293
Chain Sequence
b'IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARELFQAFRTADVGRELIIDQNAFIEQVLPKGVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Balancing the stability-activity trade-off by fine-tuning dehalogenase access tunnels
doi rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
total genus 102
structure length 293
sequence length 293
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wcvA00
3EQ7A 2VA9A 2FUKA 1IZ8A 2WUGA 2WU4A 4PO3X 3R40A 3WKEA 1FSSA 2WUDA 3WJ1A 4KRXA 1BCRA 4WFJA 1LBSA 1C7JA 2XUIA 1PFQA 1XFDA 3LP5A 1MT3A 3I28A 3IUNA 1CUGA 2BGRA 5AO9A 3BF7A 1E5TA 3DNMA 5JYCA 3DKRA 3L1IA 2PUJA 5ALJA 4DNFA 1UOQA 4H7IA 4CIBA 1ZIYA 4UUQA 1AURA 3KD2A 5AM4A 5K3FA 3DLTA 2DSNA 4DMCA 2HU7A 5CH8A 1JJFA 4G5XA 2Q0XA 5HZGA 1CLEA 1RWQA 1W1IA 3V1KA 4ARAA 4BAUA 4NS4A 3G0IA 2GBCA 3F96A 1DWOA 4IHAA 4GWLA 4BTLA 1M33A 1T2NA 3G9XA 1VA5A 1AZWA 1P0MA 2PSHA 4GI1A 3WLAA 4FFVA 5I9IA 4DMKA 3QBJA 5FPQA 3VISA 5K3EA 4BAGA 3FCYA 4K6GA 4UHCA 4AB1A 5F4ZA 1ZD5A 5IKXA 3E0XA 3WK9A 2DCMA 4C89A 3WK4A 2WUFA 1MNAA 1QZ3A 4RE5A 5D6OA 5DTIA 2PPLA 4BYMA 4ZXFA 4Y2QA 1C4XA 2ZJ6A 5DYTA 5LKAA 4JUIA 1XZAA 4BDSA 3MUOA 3T52A 4L0CA 4DSZA 3WQHA 5JASA 2XMRA 5FV4A 1USWA 1T4MA 2X76A 4B9EA 3C6XA 1ZI6A 3PICA 5CRIA 3I2GA 5C8XA 4BZWA 4M0FA 1Q0ZA 2BKLA 2QUAA 4X6YA 4IH1A 5AKZA 1XKTA 3C5VA 1ZOIA 5A2GA 3OC0A 4WDRA 4J0GA 1QO7A 5CW2A 1R50A 1Q83A 2K2QB 3HEAA 4OUKX 2WFLB 2J3DA 1OCEA 3QPAA 2O2HA 2ZYHA 4O08A 1CR6A 2D0DA 2X8BA 5HF5A 2ES4A 1GXSA 2G63A 1WM1A 3PDCA 4NVRA 5LLSA 5T4BA 5HFAA 2QOEA 4L3WA 4CCYA 3I6YA 3ESDA 3IA2A 3A2LA 4G4IA 1J06A 2QS9A 1O6FA 4KYVA 2XUJA 1CUJA 2H1IA 3WIBA 5LP1A 2XMBA 4Q1VA 2C5FA 1MN6A 1VLQA 1EX9A 2DFPA 5CH3A 5EI5A 2WSLA 1XZMA 1XRMA 3EQ8A 1CUEA 3DOHA 3I1IA 4UFOA 3EQ9A 1SCIA 5AI9A 4LKOA 3L1JA 1MPXA 3VXKA 3FNBA 3BL8A 4FBLA 4UFPA 3ANSA 1IMJA 2PSDA 4TPKA 3WYDA 4HTAA 3F97A 5CTAA 5T4EA 2RGUA 2CEKA 2JEYA 5JAUA 1G5FA 4PW0A 4S0XA 4UPDA 5C8ZA 3H1BA 3G8YA 4J0JA 5LZ5A 5ALVA 3STUA 3CN9A 2WFZA 1YSCA 3WA7A 5AIAA 3O4IA 3WK7A 1Y7HA 3V1LA 1XQWA 4MQLA 3H19A 2XQKA 3AZQA 2NW6A 4DMFA 1DTEA 4M0MA 4YX9A 1K8QA 1O6GA 3G02A 4WY5A 4WJLA 3S8YA 1EDBA 3R3XA 3I6ZA 3TEJA 4HAIA 4CFSA 1WCYA 3FVTA 4LXIA 3SWWA 5DLPA 1FFBA 3R3UA 4FNMA 1QJ4A 2C7BA 3GELA 3WKBA 4A16A 3I2FA 4EB0A 5AOCA 1P0PA 4U2EA 2XUDA 2HA5A 3BDIA 4QDZA 4BCBA 2PVSA 4BVJA 1E3QA 5ALMA 3G9ZA 5AKEA 1FFEA 3WWPA 5KWIA 3QMMA 4N5HX 2EEPA 2ZYSA 5FKJA 4W1SA 1JJIA 4X92A 5CT6A 3NUZA 2Y2UA 4QWMA 4FDMA 1CUDA 4FMPA 4CCYB 3VDXA 5KREA 4MJ3A 1DT5A 5AK6A 1QLWA 4K6KA 4H7DA 4XWGA 1P0IA 3KOOA 3IUMA 3G0BA 5AKHA 4LHEA 3DJYA 3WYNA 1W75A 2RAUA 1SCQA 5JIBA 1D07A 2WFMA 4M0EA 4RGYA 2HA2A 3BJRA 1WPXA 2GBGA 4LYEA 1LPAB 2Z8ZA 2R11A 3WWOA 4CG3A 4ARBA 4G4GA 2XDWA 3GBSA 2WLSA 2YYSA 2CJPA 2Z3ZA 2HU5A 3UUEA 4BZZA 3KDAA 2RONA 5LZ8A 1G66A 1WOMA 2W22A 4WY8A 3DEAA 3B5EA 4FKBA 3FYUC 4IO0A 5CT8A 1G4HA 4EY8A 1EH5A 4EZIA 1W6RA 5ALOA 1WPRA 3I2KA 4RNCA 4DLNA 3LLCA 1MAAA 1ZICA 1QIHA 1A88A 1XRRA 3STWA 1ZD2P 2I78A 2AXEA 3OTQA 1UK8A 2BUAA 5DNUA 2GYVA 2QTBA 1ETHA 4B0PA 2WU3A 5CMLA 2FJ0A 2WQZA 1BE0A 3QYJA 4NZZA 4C87A 1LZKA 3R3ZA 1UKAA 1EVQA 1BN6A 3Q0TA 3IB3A 1TCCA 3H2JA 1VE6A 5ALUA 1QTRA 1XLUA 1NU6A 2FX5A 1ZI8A 4OB8A 5AKKA 1QIKA 1K4YA 4FWBA 3I6MA 4ZRDA 1YB7A 2XUPA 3ICWA 2RI6A 5EIEA 2VATA 2VJAA 3A2NA 3BIXA 2ORYA 5LZ7A 2C58A 1JMYA 1ZD3A 1CVLA 4D9JA 4QA9A 3GFFA 2PBLA 5EHXA 2DR0A 4WFKA 2B4KA 2UZ0A 3R3WA 4G8DA 2GZSA 1DX6A 1UFOA 2CKMA 5A7GA 1JFRA 2XUFA 2JGLA 1XRQA 1CUAA 2XMQA 4AMZA 3L1HA 3H17A 1H2WA 4U2BA 4PF1A 4CCWA 1THTA 3EF3A 3ESCA 5A7HA 2VT6A 2JEZA 4Y2VA 3IIIA 2CBGA 3U1TA 4Q82A 5ALGA 2WIJA 3AINA 5FP0A 1CFJA 1GQRA 5KBYA 4OU4A 3ICVA 4IQ4A 2AJCA 2RHTA 5AKJA 2IITA 3W9UA 2WTMA 2ZVDA 3JW8A 1VKHA 1TCBA 1QIJA 4QDOA 2WJ6A 5AI8A 3V1MA 5E4YA 5BWCA 5CBKA 4FOLA 1UXOA 4E15A 2XMZA 1VXRA 4GBGA 4DSAA 4FLMA 1HLGA 2QT9A 2OG1A 5CT9A 4N8SA 4W1RA 4MYDA 1NU8A 3CN7A 1SC9A 4B80A 1SFRA 2XUKA 2WG2A 3R0VA 3WKAA 1R3DA 3WL7A 4BP9A 2XQJA 4OD0A 3FBWA 2HA4A 2XUQA 4V2IA 3WWCA 2AJBA 1QIMA 3MUNA 5AI0A 4U2GA 1EHYA 2XQIA 2WG0A 3HLKA 5E2IA 3A6ZA 1E8NA 1ORWA 3D2CA 4GHWA 3ZLVA 2OCKA 1CUYA 1YAHA 2OGSA 3V1NA 5HQ3A 1H2XA 4AZ0A 3D4LA 5K3CA 1XZGA 1LPPA 3ILSA 3HI4A 5JD6A 3A2MA 4FHZA 1J1IA 1MAHA 2E3JA 5AK5A 2HA3A 4KAJA 4OB6A 3FYUA 1TCAA 5DNVA 4QNNA 3QPDA 1A8SA 1N5RA 1LNSA 1H2YA 4UBNA 5IVIA 5T4HA 1KU0A 1UWCA 3QMVA 1UK9A 3ESBA 5ALLA 4BCDA 3WK8A 2VQ6A 4P9NA 1FFAA 2B9VA 3D7RA 3WL5A 3MVEA 3W05A 2WIKA 2OGTA 4Y7DA 5AIBA 3DQZA 1ORVA 1XKLA 3WZLA 1QIIA 5D3ZA 2WG1A 3R3VA 4H7HA 1QIEA 4X00A 1JKMA 1A8QA 5D7BA 3WK6A 5I7UA 2FJPA 5AH0A 5AOBA 3LS2A 2JF0A 1XRPA 4OYLA 2BUCA 2WJ4A 4XVCA 2G5PA 4X95A 3HSSA 5AM3A 4J0KA 1L7QA 2DHDA 4H0CA 3D3NA 3FWHA 2QJWA 4FTWA 4YK7A 1E8DA 1HBJA 1MX9A 1LPMA 3FLBA 4KEAA 3V9AA 3W04A 5JAHA 1GZ7A 3LCRA 2HRRA 4WDQA 1L7AA 1K63A 5LYYA 1EDEA 4HRXA 2V97A 3I1YA 1EA5A 2OCLA 3RLIA 4Y2PA 1ACLA 3STYA 3C43A 2ZSHA 2HA7A 3E4DA 1LGYA 1IUNA 4OB7A 2ECFA 1WB5A 5AKLA 4MYSA 4J0DA 4EY5A 1HPLA 3OPMA 5DJ5A 1YB6A 4YASA 5JAPA 1GPKA 2DQYA 4ZGBA 4F0JA 1CUSA 2RIPA 4MEBA 1HDEA 3O4GA 2VAVA 4AMYA 1MNQA 3O4JA 5HK8A 2BCEA 3AFIA 4HVTA 2JIDA 2YXPX 5ALZA 4UFNA 1R4ZA 5K3FB 4AO8A 4AO7A 2JGJA 4X6UA 2OQVA 5HQ3B 3KXPA 2XMDA 1CUWA 3HACA 4UBLA 3C6BA 5AI6A 1DWQA 4DYHA 3O9MA 1CUUA 4IH4A 5ALXA 2WKWA 2G4LA 3FYUB 4E11A 4BAZA 4EY4A 5AM0A 3R41A 3WK5A 3OOSA 4N8EA 2O2IA 3IULA 1MJ5A 2XT0A 1ISPA 1DT3A 2WUEA 3FSGA 1TRHA 1VJ5A 4Q3LA 5I8PA 2XUHA 2OLEA 5LZ2A 3PF8A 5AI5A 2PSJA 2DQZA 3B12A 3VJMA 1B6GA 4WCVA 1YAJA 1CIJA 3PUHA 2XE4A 4ROTA 1XZEA 2BUBA 3C6YA 3SX4A 4Y2UA 3H18A 2WJ3A 1CUCA 5A71A 4BB0A 3QM1A 1EVEA 5EHZA 4GDMA 4CG1A 7YASA 2ZJ7A 1BCSA 4FFWA 2AJ8A 3VJKA 3D5EA 4AQDA 4Q3KA 2BAGA 4B9AA 1JU3A 1CPYA 3C87A 4FNGA 4ZV9A 5JZ9A 3U0VA 4X93A 3UMJA 3FOBA 2WIFA 5ALIA 3WL6A 2OPHA 3O95A 1Q0RA 4A23A 2C0PA 5AKYA 4CI9A 3C6ZA 3FSGD 4G9GA 3N0TA 4PQEA 2XB6A 1AX9A 1KEZA 4Y2JA 1R9MA 5A6VA 5CURA 1IZ7A 5AK3A 2PU5A 3H1AA 4HRYA 5JANA 5AI4A 3G0GA 1IUPA 3FLAA 2VJBA 1W76A 4UHFA 1UK6A 3ED1A 1JU4A 5ALWA 1CQWA 4C88A 1AC5A 1Q84A 1ODTC 2Y2VA 5FPPA 4PSDA 3M83A 4X91A 2Y1KA 4X7BA 4EBBA 4X6XA 3BF8A 3AIKA 3WJ2A 3WWDA 1F6WA 1XLVA 5IVHA 1XZDA 4F21A 2RHWA 1JT2A 1E66A 3VVLA 3WZMA 2X5XA 1P0QA 3DOIA 2QXTA 4MXDA 3AILA 3IDAA 2BJHA 4G8CA 1GGVA 4F60A 1CUFA 4BE4A 1VZ3A 1XZIA 1YA8A 4QEKA 4BCCA 1EB8A 3BE8A 1UOPA 5ALSA 2V96A 1LPBB 1CUXA 2J3QA 3C5WP 5CXUA 1AUOA 4PNZA 2V98A 1A8UA 4X71A 4BBZA 4HXEB 3WKCA 4ITVA 5JAOA 4AN0A 1HKHA 2QJRA 3RARA 4H7EA 2XI4A 2Z3WA 3G9UA 1ZGCA 2HA0A 4H77A 1JMKC 4WFIA 4KR0A 3JYHA 4EA6A 1UZAA 3F98A 5AOAA 1SCKA 4GXNA 1WHTA 5ISMA 2HM7A 4H35A 1DWPA 2HFJA 1EB9A 5JARA 1TIBA 2GYWA 1JI3A 2VT7A 2XLCA 2C0QA 5ALKA 2DHEA 5ALRA 3PUIA 5D3KA 3D59A 2GBFA 2WHQA 4H18A 3DD5A 2XQGA 3E3AA 1ZJ5A 4B82A 3S2ZA 2ACEA 4FLEA 1W4LA 3AIOA 1XZBA 5ALQA 2ZJFA 3HYSA 4X3CA 5DWDA 4P92A 3Q8WA 4C01A 3B3QA 3HABA 5FOQA 2WHRA 1CQZA 1FJ2A 1MO2A 5AM1A 2PKYX 1YCDA 4JNCA 1DINA 1R88A 5AK4A 1TQHA 2JGIA 2VEOA 5IH7A 3AZPA 4W9RA 3H0CA 4DM7A 1MX1A 4JYPA 3TRDA 3WMRA 2PU7A 4DGQA 1AGYA 3A70A 5LIPA 3H2KA 1LLFA 3D2AA 1QFMA 2EDCA 2YH2A 2XQFA 4AN1A 4RE6A 3GA7A 3GZJA 4NMWA 2O7RA 5CT5A 4B0OA 4ETWA 1IUOA 2VAXA 4K5QA 2I3DA 5AM2A 5BWBA 2B61A 1X2BA 3D0KA 1GT6A 1BRTA 4KACA 3G0DA 1ZD4A 1RP1A 5ALHA 5ALFA 1B41A 4PSUA 2B20A 1E89A 2P8SA 1A7UA 3IUQA 4QDTA 3O4HA 5HKBA 3K9BA 3M81A 3V48A 5AKXA 4AZ3A 4UBMA 4JYMA 1I6WA 3NOXA 3RK4A 4MEAA 3AJAA 3DCNA 5DYWA 4W1PA 1BU8A 3T4UA 2GBIA 4MQMA 2QKYA 3NGMA 5JD5A 3HRHA 3OG9A 1EK1A 4QLAA 1R9NA 1QE3A 2QUBA 3VJLA 3FCXA 1G42A 4INZA 5LZ4A 3ZI7A 1UK7A 3OURA 4Q05A 5T4FA 4L9AA 4B6GA 3HJUA 3G7NA 3DYVA 3WL8A 3D2BA 5HF9A 3YASA 2H7YA 2ZYIA 4J03A 3HZOA 5ALNA 2PL5A 2WIDA 1X2EA 3LIIA 4QLOA 1BN7A 5A7FA 1XQXA 1N8SA 4K6HA 3STXA 5EIAA 4BVLA 1YA4A 3DYIA 4B84A 3RKSA 5JZBA 3H2HA 1XZLA 6YASA 3FYTA 3HXKA 5FRDA 1BS9A 3BIWA 2Z5GA 2XMCA 4LIPD 4PV7A 4Y2RA 1ODSA 3F67A 3WWEA 3CCCA 5CH5A 1XLWA 2R8BA 2HDWA 2JGKA 2QMQA 4U2FA 4ZWNA 3W06A 1X70A 4DNOA 2VJDA 1QOZA 5JD4A 3STTA 4X97A 4KE6A 4BDTA 2XUAA 4C4YA 3JWEA 4C6HA 4B83A 4UHDA 5IVDA 2Y6UA 3C45A 4J7AA 2VJCA 4BP8A 4B7ZA 1CUIA 3W2TA 3QPCA 2I3ZA 1PV1A 4PSCA 3PFBA 1AQLA 2WHPA 3K6KA 1N5MA 1YASA 5K3AA 4ZV7A 1DQZA 3ZLUA 4QDUA 4EHBA 2YASA 3PE6A 4ZI5A 4H7KA 5JATA 5DYYA 4DNPA 5FDFA 1OILA 4A5SA 4UHBA 1E8MA 1WB4A 3PF9A 3AIMA 1YR2A 3I2IA 5ALPA 3ZPXA 4AO6A 2CB9A 3MGAA 3GROA 1QIFA 5AKIA 4JH0A 1H23A 3IUJA 3H2GA 2JGFA 1S8OA 4TVKA 1F0NA 4Z49A 2Y6VA 5KWJA 2Z8XA 1WB6A 3CXUA 3R3YA 5FLKA 4FLFA 4MWTA 3X3HA 3F9CA 4UBJA 4B85A 3C8DA 1GKLA 5ALEA 1TK3A 3BJMA 1VZ2A 5LZ9A 1Z68A 2QM0A 5BOVA 4DTCA 4G9EA 5HCUA 4I3FA 1GPLA 2XMSA 4N8DA 2GYUA 4BRZA 1HQDA 2PM8A 1CUZA 1FFDA 1UKCA 2OXEA 5E4TA 1WHSA 1YS1X 4GLBA 5HFNA 3M3DA 1QIDA 5EFZA 1EK2A 5HKAA 4I4CA 4KE8A 1GPNA 3N2ZB 2V9ZA 4I19A 4KAFA 3FAKA 4QE3A 4Y2SA 2HHAA 2HU8A 1U8EA 4P08A 2HL6A 3P2MA 2LIPA 2D5LA 3WA6A 1CEXA 1YS2X 2VSQA 4Q3OA 5LKRA 3EBLA 3QVMA 4W63A 3DDUA 4F5ZA 4E14A 2G5TA 2H7XA 1CUVA 4OCZA 1QIGA 2CZQA 2JGEA 5CXXA 4H7JA 5EHQA 1CUBA 4J0CA 3QMWA 1EDDA 4HZGA 2J4CA 5JZSA 4Y2YA 1XQVA 2ROQA 5FXMA 1EINA 2XLBA 1XZKA 3ZV7A 4OSEA 4HXGA 1H2ZA 1DU4A 4GW3A 1XZHA 4IH9A 3QITA 1CRLA 3IURA 4E46A 2ZSIA 4C4ZA 1EXWA 3TJMA 5JALA 3M82A 1C7IA 3WKDA 5HK9A 4KE7A 2O2GA 2WHPB 1GQSA 3KSRA 1DQYA 1K5PA 1VE7A 3STVA 3ZWQA 1H22A 2HA6A 1XZJA 1VXOA 5EHNA 3AUKA 2VF2A 4UBIA 2QZPA 3O0DA 2OCGA 4FBMA 1ZGBA 4EUSA 3ANTA 3FLEA 1BEEA 2JBWA 3KWJA 4HS9A 5AJHA 5FUMA 1QFSA 1SOMA 1R1DA 2VTVA 2OAEA 1LPSA 2IX9A 4OYYA 3VKFA 5K3BA 1F0PA 3E1GA 3CCBA 1TKRA 2HRQA 1XQYA 4Y9SA 3PI6A 5IVKA 1GKKA 4KJXA 2XUOA 4UHEA 5AM5A 2PX6A 2OGZA 1EI9A 1ACJA 1U4NA 4CG2A 3EIOA 2J4FA 1F8UA 3C70A 3OM8A 2AJDA 4GECA 3H04A 1VOTA 1QTIA 2DHCA 4U2DA 4DMHA 4DIUA 3KWFA 4U2CA 1NX9A 5C8VA 2CMFA 5AP9A 2WM2A 1UOOA 4Y2XA 5YASA 2HFKA 4OPMA 4K2AA 1QO9A 1J07A 5C7YA 1W52X 2I03A 5DNWA 4KRYA 4QDXA 5A62A 5ESRA 2BFNA 3PFCA 2IIVA 4BE9A 3K2IA 2ACKA 4MWSA 4YPVA 3BXPA 4QWWA 4UBOA 5ALDA 1THGA 5DTJA 3ESAA 3BWXA 1Y7IA 2EDAA 4XIIA 5E4JA 5J3JA 1TAHA 4TGLA 3QH4A 2OQIA 1ZJ4A 1CV2A 3SK0A 1ZIXA 4UHHA 4X94A 2QVBA 1N1MA 2QXUA 5ALYA 2HIHA 4KE9A 4DNQA 3LIPA 5EIHA 5SYMA 1JJBA 1XRLA 3F8SA 3H2IA 5CT4A 3W9BA 4Y2TA 2C4HA 1MX5A 2BGNA 4BATA 1UT6A 4X90A 1HL7A 3IBTA 1DX4A 1U2EA 3O9VA 4BC1A 4L72A 2ZYRA 4ZREA 1KU6A 2PSEA 4AX4A 2ONCA 1XRNA 1LBTA 4HXFB 5ALTA 4G4JA 1RYYA 4G8BA 4J3JA 4XX1A 5K5EA 3VVMA 3WI7A 3BDVA 2PSFA 1U65A 1IVYA 2WIGA 1J2EA 3UUFA 1LZLA 1BROA 2WILA 1K6EA 3WIOA 4AXBA 3AZOA 1OXMA 4JEIA 5H3HA 3G9TA 4CIAA 2XUGA 3IVMA 1XROA 3GUUA 5BV7A 2QR5A 2C5GA 2AJLI 4Q34A 3DL4A 3DS8A 4G1FA 3DL7A 4EY7A 2CUTA 5EGNA 4BC0A 2H9YA 2QRUA 4N5IX 3HC7A 1AMNA 5AICA 1ODCA 4BRSA 2PUHA 5C81A 3QZUA 4J0IA 4LXHA 2OAGA 1LPOA 4EY6A 1LPNA 4C4XA 4GEGA 1ZI9A 4W1QA 4KAAA 4LXGA 4B81A 1XZCA 2JGMA 4BTVA 3TGLA 4BVKA 3I2JA 2O7VA 2XMGA 5JADA 4QZVA 3G0CA 4J0HA 1MU0A 2OCIA 5HF6A 1PJAA 1UKBA 5SYNA 1FFCA 3NWOA 5HF8A 1BEZA 4OU5A 2GZRA 1AKNA 1CUHA 4H7FA 3SC2A 4XJVA 3DKKA 1XZFA 1L7RA 4RPCA 5AHXA 5K3DA 2H7CA 4P93A 3FVRA 3I2HA 1MTZA 3ZLTA 5AKGA 1QGED 4UBKA 4LYDA 3C8HA 2WTNA 2HADA 4X85A 1Y37A 2WFLA 1VA4A 2W6CX 1QONA 3RM3A
chains in the Genus database with same CATH superfamily
4MWOA 5I7SA 3VBEA 4DG9A 4BTEA 2JAOA 1WTCA 3FROA 2VHVA 1W5EA 3G5MA 2FUKA 4GBED 4PGMA 3QEBZ 1R4NA 2WUGA 3E9ZA 2WU4A 3RBZA 4AURA 4PHHA 2XJ4A 1R0KA 5HKKA 3R40A 1XTBA 2W6JD 3VR4A 3RABA 3WKEA 1FSSA 3DWGA 2WUDA 3KEQA 4JS0A 1C8KA 5BSFA 1G8AA 1BCRA 2ZR9A 4RZHA 1Z7BA 1C7JA 2X9NA 4LTDA 4LHXA 2PL1A 2HHHB 1IC6A 4GL4A 5TPWB 3GLGB 1M2HA 3G49A 1NC3A 2G71A 4GR5A 3GEIA 1Y8RA 2VDLB 2E85A 1L4FA 2B2XA 2VJOA 3E9EA 1IHYA 1QGYA 3JYPA 4RK7A 4YAJA 4WOPA 2BGRA 4RQTA 3AM3A 2B8JA 4IMPA 5AO9A 4QX6A 2XDAA 4K9QA 2YFHA 3WYBA 3BF7A 2C5SA 5BQFA 5EJ6A 2DPLA 2EFHB 4B31A 3DLPX 2PZBA 4OMCA 4M99A 4DLTA 3TCKA 5JYCA 1ZHOA 3VYSB 2ODQA 4BMXA 2PUJA 3VH1A 1E77A 4LBWA 1TADA 2JAPA 4FEGA 3U4AA 3WISA 4G0VA 4JJGA 4UUQA 3ZDCA 1HDGO 5A5DA 2Y27A 1SUIA 1Q3TA 2R6GA 1SQ0A 3DLTA 1M1NB 1T2AA 1RPAA 4MDHA 4PY2A 4FX2A 5KC8A 2M1XA 5J9FA 3GEEA 3RYHA 4F6RA 1KI4A 3AOEA 3FIUA 4EL5A 1KEEA 1ODIA 1U2DA 3UF0A 1CW2B 1G8GA 1DLJA 1K4MA 3FTDA 3JD4A 3I45A 4G5XA 5FFFA 2DQ4A 2QU8A 4M1SA 4U39A 4DXDA 7REQA 1RJGA 2NT3A 3RIHA 4FYIA 3SJ7A 1TJPB 5FBWB 2BGMA 1EX6A 2NUBA 4MW2A 4XEHA 5IVPA 1FDWA 5LQMA 1NNEA 4V0MA 3BPSA 1MA0A 4PANA 1Z5UA 5HTKA 4Z9YA 1S2LA 4XVQA 1FX1A 3B1JA 4GWLA 1JE0A 5K0LA 3LW7A 3LX4A 4BJ3A 4OAOA 2CJWA 1M33A 1ZY2A 3IOYA 3G9XA 3NATA 4P4TA 1P1IA 1XAHA 3O75A 1O94A 1ZCAA 2HBQA 4Z54A 1ZK4A 1PG0A 221PA 1AZWA 1NUTA 2PFGA 2PSHA 1P91A 1PGJA 3E2IA 5DHTA 1DPFA 3HFJA 4ZVNA 5I9IA 4DMKA 6REQA 1KSHA 3UK6A 4M88A 4UM9B 4R9SA 4P3YA 1KSGA 3OE1A 4BAGA 3CPEA 4AB1A 5F4ZA 4WVLA 3OUZA 3WK9A 3O2JA 2DFDA 4U7WA 2ZIXB 1CR0A 4CKEB 3EY9A 1ZRNA 3IKVA 2ZJZA 1FJGB 4TRMA 3K1JA 1KP2A 3BIJA 4RE5A 5D6OA 1IOWA 4ZXFA 3LY7A 4D80A 1C4XA 3CLSD 4RU1A 5DYTA 2H2HA 1YZQA 2ZDQA 4JUIA 1W9MA 4RCZA 1KOLA 4XEUA 3W8FA 4TX1A 3SXPA 2H07A 3DZGA 3AI3A 1I9GA 2HWYA 2R3SA 4GZ6A 3BM5A 5DSZA 1T15A 3JU3A 1Q1ZA 1GZHB 4QXQA 2ZSFA 5HQTA 3ETJA 3RASA 5A04A 2WYVA 4JASB 1E3SA 1KZ4A 4MQUA 5KOIA 1B0PA 1AUXA 5JASA 4WVFA 3SSMA 4C9BA 4RWZA 2CE7A 3NDIA 1YU9A 3BD6A 2EIXA 2XMRA 1CRZA 2IVFA 2PWYA 4WEOA 4KXQA 3R0XA 3NOVA 5DTEA 1UEXC 1USWA 2B78A 3JQ9C 4B9EA 4R1SA 2PKQO 2C94A 1QBGA 5KNDA 4YEDA 4ZAGA 1ZD8A 1OI2A 2PYZA 4FJ0A 3S0JA 3ZWBA 3W5AA 2I4IA 4IQFA 4IHJF 3WV4A 3HVUA 4QEDA 4UEWA 3G5LA 3G5AA 3HRKA 5CDSA 2HY7A 4Z0TA 1NVXQ 2I7TA 4M0FA 5TPZA 2V7VA 4YCNA 4MWZA 5M5BA 3CZMA 3VAYA 4X6YA 1N8KA 1J5XA 3ONWA 3C2QA 4JLBA 3GPCA 3UOGA 1AF4A 5AKZA 3ZZUA 2GRJA 3THXA 4DB2A 3OUTA 1PUXA 1GU7A 2IELA 4I14A 5A2GA 5IN4A 5IM4F 2ZE6A 2RGDA 1GUZA 2D1YA 1J33A 2X0RA 1ZITA 3OC0A 1G6OA 4FONA 3VR5H 3KKQA 2HJSA 3A6FA 5ITZB 4AMUA 5D7NA 2BTQA 1RQXA 5A05A 3VC7A 4D5EA 2IDKA 4KTVE 2KPOA 4KR3A 2C4KA 1JEJA 1V11A 1F8YA 2Q3BA 2R6FA 5KTMA 5LR6A 1DKRA 1WETA 1K98A 1QVZA 2BHRA 4UOEA 1UKVY 1UBGA 2OHOA 2C2HA 3ESQA 1S3IA 1FVHA 2A6PA 1JEEA 2XWBF 5B7NA 1AMOA 3W6ZA 4O08A 4Q00A 2FH5B 3SKXA 2CNLA 1R27A 4YI5A 4B35A 5ITSA 1VBKA 4TZ0A 1MRNA 4HJRA 3IRVA 5AW9A 3WLKX 3I3SR 1LB1B 1Z45A 5EINA 3ERCA 5C37A 1U7HA 3HCBA 2IV7A 4KNYA 3KLBA 2ZE7A 3AVTA 1XU9A 1M34E 2HN9A 2VPQA 2FXVA 5MGNA 3B8EA 3ZV5A 3FFAA 4EYSA 3ZHSA 4PZAA 1HM5A 2BM9A 1BCRB 1AXRA 2FOXA 3ACDA 1HYHA 2VCHA 3NHMA 1PKXA 4KLCA 3H84A 4MGIR 4DNXA 3C3EA 2J87A 1TMGE 4NYMQ 1P0CA 3DOJA 4G2NA 1D5WA 1NNLA 4FW8A 5H9WA 1HETA 2QOEA 4I4TB 4L3WA 4CCYA 3ICEA 3H5OA 3ESDA 3MMSA 5BYKA 3A2LA 1TC2A 4CV2A 1DLIA 5BPFA 1JA1A 2FVYA 2ZSBA 3JQBC 2REXB 2CMGA 1V5EA 2G8LA 2QS9A 2YVLA 3EWAA 1O6FA 3QG1A 4IOKA 2Q3JA 4P38A 2QN1A 3C3KA 2W2QA 4EA8A 1M75A 4HR7A 5IP5A 2H48A 3QOFA 3OPNA 3CE6A 4HPJB 4FEAA 1Q0LA 1BE6A 4ZOLF 2GN1A 5C5CA 1WU7A 1Z6PA 2NZJA 2BFDA 2OWEA 3UQYS 4EOGA 4YIHA 1G6KA 3BWVA 3COVA 2C5FA 4FKZA 1MN6A 3TLEA 1TVMA 5LN1A 4LF9B 3OZAA 1IEQA 2SKCA 5L45A 1VLQA 3S40A 3FHTA 3HO1A 2D7JA 2OHJA 4Y1EA 3DVQX 2A94A 4RKRA 2F1HA 4PQRA 4PC1A 2V9PA 2P75A 5I7VA 4XDGA 2H57A 3RYHB 1E69A 5CH3A 1GN9A 5HJ2A 4BGIA 1KEEB 1SN7A 4P54A 1JEYA 3LWZA 3T9DA 5BQOA 4KXLA 4QOIA 1XZMA 1NKSA 3EQ8A 2QG4A 3GY0A 4GKKB 4KO4S 3A05A 4YCCA 2CKDA 3GRAA 1WV0A 1WDTA 3NFRA 3TR5A 1NA5A 2IOQA 2ZBRA 4UVDA 5CFMA 2LGJA 3C4QA 4P4UA 2FOIA 2PUTA 1COZA 3U7FB 3NHFA 2OCBA 5AI9A 1SVIA 3ZGYA 2WJAA 4YCMA 1R0CA 3VXKA 1TW3A 2XD4A 2WJWA 2Z2YA 2XB4A 3MTGA 1KDRA 4Q02A 1FUEA 4R2KA 5DF1A 2CJWB 3DWEX 2RGNC 1N9ZA 2GD6A 1UMDA 3H3XA 1TMYA 1FNNA 5LM3A 4UTXA 4TPKA 2YZKA 3PNLA 4HTAA 3TZKA 4Q4AA 6REQB 1LD3A 4B6OA 4FI3C 3OX3A 1DIHA 5T4EA 4ARVA 2G83A 1H1TA 3VOBA 2XH8A 5GVSA 1G18A 1TKBA 4BY9E 2A1TS 5JNRA 1BWQA 3JVVA 1FZTA 2FMIA 1ZMTA 1G5FA 2Z0MA 3ETDA 4US0R 2VPZA 4E2WA 2PQ6A 2QJFA 2WJPA 4QD3A 4S0XA 4UPDA 4EK9A 3UO8B 1NSYA 1ORRA 3G8YA 3HG7A 3NV9A 2CDNA 4X44A 3D6FA 3I9LA 4ZOBA 2GBPA 3U31A 3VNAA 4IPTA 5LZ5A 3FOFC 1L8AA 1AK9A 2OXRA 3QWIA 3EOAI 1KOJA 4ZDWA 2O4CA 4CM8B 2DBQA 2ZGVA 4UC0A 4WIAA 2PNJA 4GGOA 3SEZA 1YHYA 3KVYA 3D7NA 2VZ0A 1T0HB 2PX8A 2Y1OA 1CRQA 4KV7A 1IOZA 3FNHA 1ZVJA 3UC9A 4B33A 1NPTO 2XXAA 3HUTA 1YZFA 3BRWA 5K05A 1AOXA 3BXFA 1LF5A 4M1ZA 3I37X 1Y6JA 2VUTA 3HDHA 4NBSA 3CR7A 1BDBA 2OCPA 2GS9A 2W6MA 4DIOA 2FEKA 4F8EA 3H19A 5LWQA 4CDMA 4FYWA 2TRSB 4F2HA 3R9WA 3IEMA 1AQNA 1QRDA 3AZQA 3D02A 4TTPA 3TTSA 4LCBA 1DTEA 5DNYB 1AXGA 4IVRA 1YRWA 1AY0A 3MG9A 2NZUG 5GIOE 1UDBA 2HWKA 4F97A 4D4IA 1SCUA 1B0ZA 1W0JA 2R62A 3HA2A 3TGPA 4J16A 4WJLA 1WEHA 2FPUA 2IGTA 5C31A 5LSAA 1QKKA 2ZS8A 3UJBA 3ZZTA 3F7TA 4EQZA 4GYJA 3FPAA 4B3XA 1NI4A 1U3GA 2W4MA 1SU7A 3PDIA 4CFSA 5DM60 9ATCA 3THXB 1FRZA 1PIWA 3PPIA 4GI2A 3LTEA 3B9PA 1FBNA 4LXIA 4NSNA 5ANRB 2IXTA 4C4PA 4D56A 4TVSA 4J6FA 4BU1A 5JMOA 3RADC 2VHTA 4NICA 4K46A 1M74A 1UBOS 2H9AA 1H4VB 1ZC3A 2BTQB 3V8QA 2OBXA 1GKYA 3V8EA 1SBNE 2C7BA 3GELA 4A16A 1V11B 3ESZA 3IESA 3QP9A 2NO0A 2WMYA 1P0PA 4ZAYA 3THOA 2UXCB 3I3OA 2C78A 2O7SA 2HA5A 4PYOA 4EKEA 3IC5A 4IUYA 3AONB 4XCQA 4O02B 4ZC1A 2EZTA 3KOWA 4UTPA 1E3QA 2C2ZA 1U28C 1Z88A 2J46A 2B69A 3GG9A 1WUIS 3MSXA 5ALMA 3ZHBA 5F7OA 3RK1A 5JBNA 1MO3A 4M49A 4HV4A 4US1R 4XR4A 4ZEXA 2IW3A 2V6JA 1RFLA 4IW3B 4ZCMA 2O9JA 3FMVA 4ZYZA 2EEPA 3K7EA 3MJSA 3W8EA 5F3WB 2UYYA 1GPDG 4IXDA 4RTLA 1G8MA 3DXXA 3ZVLA 4EA9A 4W1SA 1BXGA 2GUGA 2SCUB 2MSNA 5CT6A 3RHTA 2HF7A 3W1VA 3X1ZA 1G41A 1LQTA 1VBMA 4GT1A 3AVUA 3F8TA 2I7VA 3IO5A 3RSSA 3FA2A 4DEYA 5KTYA 1NLZA 1ADYA 1GWNA 3DZJA 1RLJA 1EWKA 1R37A 3EA0A 3GT4A 3Q2IA 4OXNA 4Q9HA 5B53A 4MJ3A 4CCYB 1GA6A 3GBVA 4CF4A 1E58A 2ZRQA 1IIBA 4GZ3A 1U8AA 1IVNA 5AK6A 1PWXA 2WP0A 3IFSA 4I8XA 4K6KA 4LMAA 4WLOA 5DRYA 3QEAZ 1XK7A 4XWGA 3TL2A 3OJXA 5GINE 4FFLA 3G0BA 4D7AA 1GLNA 2BMFA 4DE5A 2PQMA 1Z07A 1G16A 3TVYA 3K8ZA 3RSGA 3Q7EA 3PQEA 2BFDB 3UAVA 4D8WA 1YDFA 2FW8A 2ZTMA 3CINA 4G5GA 2NSJA 3ZXUB 1SCQA 3OCYA 4WN9A 4FMBB 3BIOA 3JQ8B 4YIKA 2J6BA 1TO2E 1FUKA 1ZM9A 2P5SA 2WFMA 3MWEA 4K6FA 4M1YA 4OI1A 1A4RA 1SD1A 1TF5A 2HA2A 5DFAA 3SXUA 3TQOA 1L0BA 3IE1A 1Q2UA 1WPXA 2WF8A 4I4TF 4KIFA 2C57A 4U3JA 4MP3A 1VRCA 5ECDA 4LZLA 3HP7A 3SBXA 2IL1A 4CMCA 5KWEA 5KI6A 1I0LA 4BJ1A 1JEYB 1RJEA 1XFAA 3EVBA 4QBKA 2HUNA 4DJJA 2Y1GA 4YT4A 1E2MA 1GDTA 4BKUA 3GBSA 2KLBA 3OKPA 2UUPA 1VYTA 3HN6A 3LVRE 3Q0EA 6LDHA 4GM0A 1IG3A 1N1GA 4LJLA 4CKZA 3O31A 2OBLA 4UPVA 2QTHA 5AXDA 4Q21A 4ALLA 5DI3B 4BZZA 2W2KB 4DR7B 5L3SB 3DBHA 4U7PB 2F00A 2DM6A 4QGFA 4JP3A 2X3YA 2EERA 4NECA 1Q74A 4RHXA 1PR2A 2NSDA 2V7BA 3DZKA 2GM9A 4QPZA 3DPIA 2W98A 5DE3A 3ZIDA 2CK3A 2O20A 1QVAA 4X1IA 2WWRA 3GRPA 1P7VA 3U3XA 2BVNA 4O2AA 1ENZA 1G4HA 3N8DA 2F48A 1WSDA 3QLTA 3F8WA 2J3IA 2MDTA 5IK2A 5ALOA 4HDAA 3NEYA 3OIWA 4PSVA 4RS4A 1F51E 3JYNA 4YRJA 2ID9A 2ZQ5A 5DLYA 3KL4A 1MAAA 1OXKB 1QIHA 4F5DA 1F7UA 2P9BA 3PHIA 4X65B 3CVUA 4D6PA 4YRSA 3PENA 3HL0A 2IUSA 2YDXA 3NKVA 5IABA 1Z6QA 2PK3A 1W4RA 4E09A 4YY3B 3CYFA 1WUHS 3KR9A 1LDMA 3G85A 4I6JA 4LRWA 3RODA 1T29A 1YR1A 3ABQB 2PRSA 5DNUA 1Z2DA 3QEKA 4F4JA 4MK4A 3PWKA 3K0AA 3QLJA 4LK2A 3KJQA 2G6BA 2LBPA 2XXAB 2QTBA 3BIFA 3IAEA 1ETHA 3I9V1 2IDMA 1Z3IX 2ZM6B 5CA1A 2ZOSA 1U2RA 2P1RA 3D7KA 3UICA 2QDXA 3U6BA 1WUTA 3KTDA 3V8NA 4J1TA 5K1ZA 5K6RA 3QVVA 3RR2A 3SBEA 1O03A 2P30A 3MQ2A 1M3SA 3CUSA 3IXMA 3R3ZA 5JS6A 1EVIA 3L5OA 3A9WA 1BN6A 3QVKA 4XYBA 3NBQA 4UCXA 1TCCA 5TVKA 1GZ6A 1L8OA 3A4TA 3NDJA 2QSZA 3T3IA 3DTYA 1MX3A 4MAFA 4RV5A 2OKCA 5C8YF 2Y0DA 2R5FA 1FJHA 2OZEA 1XLUA 3O74A 2WJYA 3AKDA 1P77A 3D8HA 2DH6A 3PDJA 3RUHA 4FGSA 4GM1A 5AKKA 4AMBA 2IBMA 3AVWA 1TO1E 1XHEA 4HN4B 2JFWA 4RVHA 3R9XA 3BFPA 3I6MA 4I6GA 1ESCA 3IEKA 4ZRDA 1NW8A 3W3ZB 2XUPA 2HOQA 1CY7A 1NP3A 3D31A 4Y6OA 4ZALA 1E98A 3OVMA 2FCAA 2Y4OA 2YV1A 1LJUA 3GLRA 1NQWA 1XVIA 4NNPA 2RH8A 2VATA 2VJAA 2A1TR 5EKXA 5AW1A 5K03A 5L40A 1ZH8A 5ILGA 3NEJA 5LZ7A 1US8A 4A6XA 5ADWA 1T8YA 1CHDA 1WTAA 4UM7A 2CXSA 4WK6A 2JG3A 1Z8DA 4MI3A 2ORED 3PGKA 5FLYA 4D9JA 4MLPA 4QA9A 2FR1A 5IDYA 2H2FA 4QARA 1S01A 3PP8A 4BX9A 2Q4OA 4JVNA 2UZ0A 3AJ8A 4Z4IA 2LWIA 2VPYA 2F9LA 3FGPA 3RVRA 4GOLD 1DXOA 4PNEA 1NG1A 2X19A 1QZUA 4W82A 1RLMA 1T1RA 1SUWA 1JAXA 4LDQA 2BFEA 2WJHA 3D6HA 1BXGB 5C34B 2CKMA 5AW0A 4I9GA 2NSHA 1FC0A 3UMSA 2A5FA 2JGLA 1M34B 2VWHA 1EVJA 3A7EA 3QEOA 5BMVA 2IUFA 2XSZD 1I0ZA 5TEWA 2WWTA 3L1HA 3QX7A 3ITNA 1JI0A 3OZCA 4IDPA 5BQ5A 4YJ2A 5D86A 5U1PA 3I6BA 3T4XA 4II3A 4U2BA 4KUEA 3B60A 4D9HA 1XNQB 4NV0A 4RK4A 1THTA 4DBLC 4YAOA 4D8XA 3T5AA 3PUWA 4LTNA 1H93A 2HK7A 3UANA 2EBHX 3ICOA 5A3QA 4HL6A 4M2LA 1XC7A 1AZLA 1EGHA 3ZYCA 2OBMA 3A6PC 2P3LA 5CB4B 2OV4A 2PBRA 2ZUSA 1U0BB 1Y9AA 3EEFA 1XXLA 2R00C 3M5WA 1JJ7A 3BWDD 1MV8A 5DBFA 4DB4A 5ALGA 2IZ1A 1SUAA 2FWAA 3O2NA 4R1TA 4TWRA 4U3JB 3V9PA 2ZRBA 3ODPA 1LC0A 2NU7A 1AHPA 5ITVA 1CFJA 1CP2A 1MVNA 1TVKA 2KM1A 2RHCA 4G0UA 4AJ1A 1E2LA 3SIWA 1SIBE 1WDLA 2CFSA 4ZT6A 1Q3HA 2V7QD 1VB3A 4JKYA 4BVGA 4BZXA 1NXOA 1E2EA 1EFRD 5BXQC 3M2TA 4IDCA 2DULA 4PGHA 2H0RA 1MFPA 3COJA 3S70A 4OIFA 2IITA 2IXEA 3U9LA 3P27A 1ZOPA 2QT1A 4B3RB 4M1MA 1V9SA 2WTMA 3DBHB 4TUYB 3UB2A 4W5RA 2QPAA 13PKA 1FDVA 1TCBA 3UOWA 3LK7A 1RS0A 2HRZA 2N1MA 2WJ6A 5JJKA 4MKRA 4MUXA 5E4YA 3V1MA 5CBKA 4YP6A 1UXOA 3W5SA 4UDXX 4DA0A 3HH8A 4H0NA 5JO0A 1R6BX 3N7TA 3ZY3A 1U3WA 4IICA 3RQIA 2OLJA 2XMPA 3KOXA 4FLMA 3S2GA 5DTMA 2WAYA 4P22A 3DOUA 3C39A 1QJCA 4GOKA 1Z5ZA 4N8SA 4JB3A 4JBGA 4MYDA 1XIVA 4HN9A 1SC9A 2EJUA 3CRZA 3KT6A 5K0GA 3X1KA 3WY9A 3QX8A 4LC9A 2FPSA 5THKA 3JR3A 1EAYA 1VECA 1Y33E 1GNRA 2X8WA 2XADA 3I42A 2GZ2A 3M6LA 4JLVA 3ZE6A 4D82A 5LQAA 1N9GB 1DTWB 3HNRA 4BX3A 1DSSG 3KKPA 5DCWA 4R71A 2SKDA 4DQXA 4J75A 3LGXA 4FC7A 4MGZR 1Z37A 4J4BA 4ODIA 3BH6A 1RJWA 2DLCX 1Y9ZA 1NHGA 2QX8A 3BZBA 1B0AA 2HA4A 3NG1A 3ZY2A 4V2IA 3DOFA 5BVHA 3P2YA 1OWMA 5J59A 3ZGOA 1ECPA 3H5VA 4FPXA 1RE1A 1QIMA 2AYXA 1SUFA 1AHNA 4EO9A 3FCEA 4IIGA 1OZ0A 2FPLA 3DMHA 1FUYB 5J58A 2O8BA 5HPYB 4PONA 4DA7A 2VYFA 1LLQA 1GA4A 1SG9A 2VT3A 3N75A 1ORWA 1UJ2A 3H4VA 4MWCA 4UAGA 4LZNA 3GLTA 3TW8A 3JWPA 1KK1A 2AOTB 1ZMRA 3D3WA 3DE4X 3EW7A 3HCNA 3KPVA 3KTOA 4V02A 3B82A 4CNQA 5KNBH 5JYEA 4F3TA 1RLTA 3QVXA 3UMFA 2I1LA 3F6SA 3CZPA 1T25A 2H2GA 3IP9A 3ONEA 3TZQA 4ZPXA 5LXTF 1J42A 4FOPA 2GN2A 4FZ5A 3GVCA 4XWYA 5F2KA 4OF4A 3RJ5A 1RWXA 1D2EA 1YL5A 3TBFA 3ZCPA 5HQ3A 3R9XB 3ZBPA 3E22A 1HDIA 1RRPA 4ZIRA 1R18A 5D85A 4EVRA 1IN4A 4YFYA 3H5LA 4JOBA 3GGPA 3TE7A 1RD4A 3A2MA 3ZWPA 2PKQP 1FMTA 1ONPA 1U8CB 1EFCA 3A9TA 5AK5A 3IMKA 4EJFA 5LLDA 3TYXA 1Y80A 2PH1A 3K0CC 1YVPA 1F60A 4OYRA 2HCJB 2XGJA 2BLLA 1CT9A 1ICIA 2ORIA 4UEKA 1UP7A 2NNWB 3ZWWA 5FCDA 1E96A 4LI0A 1TCAA 3NPMA 3KSDO 4FWIB 4PYIA 1KL7A 3PC8C 2H4JA 5DNVA 4OP3A 2IS2A 1V1RB 4QNNA 3AHIA 3QXSA 3LF2A 4AUKA 4QGHA 1AUVA 4YV1A 2B1IA 1SOAA 3RE1A 3VPDA 2XCIA 3GJSA 2H8GA 2BFEB 4L22A 2VDNB 3ER8A 5IVIA 4DVJA 4FHEA 2IPNA 5F2OA 4TZKA 1KU0A 1VIDA 1FTWA 1H8EA 1UK9A 3ESBA 5BMVB 1X1TA 3HCOA 2MMCA 3G6KA 5MFZA 2E1PA 3BA1A 4F4IA 3ZTWA 4YJ2B 4IJVA 5BQ3A 4WN3A 5B2EA 4QT4A 4OM7A 3WK8A 3Q2KA 3JSAA 4OQFA 2FPGA 1SBCA 3WRXA 4O8CA 3V5NA 2OYRA 4B46A 5FEUA 1NVAA 1CERA 3KKOA 3MVEA 3TIXB 3IOCA 4RLHA 3EG9A 5KSOA 4HQLA 1TXGA 1U9IA 1YO6A 5AIBA 2AN9A 4OGWA 2NVUB 4F4CA 1PAUA 3MAGA 3VR4H 1ACMA 3LVBA 3L7BA 2FWJA 4FDLA 3R3VA 1SMKA 2D0OB 4LY0A 2AQHA 2BGUA 4PVDA 1G7CA 5KVSA 4X00A 1OKKD 3GGJA 1PZGA 3H3FA 3CMCO 5BR8B 5IAKA 2AXNA 4BFLA 5CB0A 3E15A 1K7SN 3OIFA 4LHWA 4R7ZA 4RKYA 1TVKB 5AOBA 4IJQA 5KCZA 3NV7A 5JQWA 2JF0A 1XTVA 1KVQA 1WXEA 1XRPA 3BMNB 4OX9B 2BUCA 1QK3A 2AQIA 4I0WB 3M6MD 1I1QB 1TK9A 2YY6A 3QWAA 4H6VA 4KLNA 4OH1A 3K1YA 4HEJA 3VMMA 4JJEA 3UMMA 4PHCA 1EXVA 4X95A 4WL0A 2AD5A 5F1YA 5AM3A 4I2VA 4MDYA 1T2FA 4H0CA 4P3XA 1DCMA 3V3TA 3RYCA 4IIDA 3KYIB 5CB4F 1J99A 1N8TA 2QJWA 2J45A 3H2BA 4R9UC 1RHRA 4UAVA 4B6FA 3VR5D 1W25A 3WOHA 3K0HA 5I9LA 1X7ZA 2VDOB 2YQ4A 5AUNB 1CS4C 3EUWA 1YQWA 3LUJA 2C9ZA 4P7KA 4ZVPA 3UWPA 4Z4HA 5KYWA 4QBGB 2XWPA 3FLBA 3HYCA 4KVGA 4RF4A 3RF7A 5JWRA 1U99A 5CTJA 3F7OA 4ZJUA 3QK7A 4O2RA 4M0DA 4JI6B 3AETB 2HQSA 3RF6A 1I7QB 4OL9A 1GZ7A 5JJIA 2PV0A 3L6BA 1LFAA 1EUCA 4IJMA 3PCTA 3EEOA 1IPHA 4P3NA 2BKEA 3LUGA 4DCTA 4QVIA 1L7AA 3E3OA 4BNIA 1EDEA 3QLVA 2KLHA 4HRXA 2LTAA 3I1YA 3FSEA 5K8JB 3RLIA 2WTUA 1ACLA 2O4UX 2YWBA 4HGPA 1XT6A 1KTVA 4TUYF 3STYA 2ZSHA 3HV0A 4D4JA 4ZI2A 4N39A 4OGKA 3EASA 4QYIA 4GP6A 2EVWX 2XX3A 2WF6A 4GPEA 2PZGA 3QG5A 2AZXA 4OHYA 1AK2A 3E4DA 2WNIA 3P9YA 1I2ZA 1X1BA 4NZOA 4TTVA 5B3AA 4DLPA 2ECFA 1M1ZA 4MRRA 1DJQA 2HIAA 1O77A 1SEPA 3OPMA 1YB6A 1YUBA 3OKAA 1GU1A 3L0PA 2IIPA 4UE3S 3N39C 5BURA 2VXBA 5DP1A 1FU8A 3ZQ6A 1VJDA 2LW7A 1JG1A 4KLAA 3TEFA 5BVHB 4CKYA 2W2TA 4NX2A 5L6LB 2BFFB 3M6WA 2WHEA 5KHAA 4NJEB 1P2SA 1T3HA 1HDEA 3N05A 1CQXA 3FTNA 4CMIA 1HE1C 4IIHA 3UAXA 4AJHA 4EB3A 2RHMA 3DFUA 3AFIA 2O8BB 4NCIA 2JIDA 1XA0A 3MMZA 2ZTVA 3DLAA 3TOVA 2FPOA 2O2YA 3K6RA 3QJGA 2QSJA 1GZ4A 4RD3A 4X6UA 2HDNB 3AKYA 2B4QA 3BE4A 4ZTZB 3TW8B 1NUQA 2OK8A 2PMBA 1B2LA 3N74A 3VA7A 4D3YA 1SXJE 3RTGA 3FYSA 1R4ZA 3OCXA 5AMXA 5K3FB 5BUQA 2CUNA 4P2BA 1GITA 5G4LA 1KDOA 1YIDA 4GKBA 3O4FA 5EZ6B 3EWNA 1JA0A 4NK5A 5HQ3B 4ZIRB 2PUAA 2GVDC 1CUWA 4EW2A 1DGQA 1JHVA 1BA3A 2QP4A 3CZCA 3EXFA 1P9NA 3HE3A 3LCJA 4DWWA 5I3CA 5JJ5A 4MDEA 3CJQA 4U7FA 5KNDH 4HVLA 3IV6A 3QBDA 3C6BA 2Q7DA 4PM4A 2A5LA 4QODA 3O9MA 4N5MA 3T5MA 6NULA 1IULA 3HB5X 2DPHA 1RBQA 1TJ5A 4E2YA 2EJBA 1UDWA 1YULA 4E13A 2JLBA 2I0FA 2WDZA 4E11A 3BSSA 4D26A 3IHLA 3MJEA 4BAZA 4OV6B 5AM0A 4EY4A 3WK5A 5BPHA 2FSSA 1F8GA 4PXAA 3NORA 7AT1A 2XT0A 5PGMA 1V5GA 1DG3A 1IY8A 1DT3A 2WUEA 5EJFA 5AVZA 2OD9A 4WNCA 3BXOA 5KSYA 1CJVC 5FL7A 2AE2A 2H1SA 5TF4A 2G70A 2GH1A 2PD4A 2XZOA 4KHPB 1T4DA 2OLEA 4DR6B 3GNQA 1X74A 2GPAA 2OCAA 2JCVA 5AI5A 2ZZKA 1I0IA 2FMFA 4GE3A 4P4GA 2NAPA 1XMVA 2PSJA 2I3BA 1PF7E 3NCTA 2DQZA 2VBCA 3B12A 1NATA 1BD3A 1YAJA 1K5DA 3K1AB 1EWQA 1T1JA 2PKWA 3PUHA 2GILA 3QLUA 3TO5A 1SEVA 2XE4A 3DOCA 1XZEA 4ROTA 1EBBA 2QAJA 1Q1BA 3AWDA 3C6YA 3H97A 1C9MA 1GGKA 2XRMA 2Q49A 3EGCA 2VJNA 3MS4A 4E30A 3EG9B 5AW6A 5K9ZA 1GPH1 2FEWB 4DM3A 3RIEA 1E9BA 3LKVA 4PPYA 2WUVA 3SICE 1QH1B 1WXIA 1LI4A 4JLWA 4LJAA 4TN5A 4R2HA 1FDRA 1E0SA 1UC4B 3WYGA 2XVAA 2JLUA 1RPJA 2VHEA 2R79A 2DBYA 4YJ2F 3H13A 4AQDA 5JTUA 2BF4A 2NZ2A 5FJJA 2A0FA 4JZYA 3P2EA 4W8OA 1V3UA 5IASA 3QU2A 4B9AA 1JU3A 4DAOA 2YRXA 3OWOA 2L17A 4KO2S 4GYWA 3CURA 5JZ9A 5L95A 3WLMA 4B4KA 3IDFA 4X8LA 2WIFA 5ALIA 1RYHA 5ED0A 2OPHA 2GWHA 2TMDA 3RU9A 5JS8A 5EEGA 1ZNZA 1QAMA 1SCBA 3UBTA 5ICEA 4OSPA 1I7LA 5E8JA 4BKPA 4WK2B 1X7ZB 2O50A 3CSUA 3OA0A 1U9ZA 4JJAA 3DONA 2KHZA 4LY3A 4NFLA 1YZHA 2FGKA 2W58A 2V45A 3C6ZA 2XRFA 4M6WA 5DULA 2ADOA 3QF7A 3WVNA 4AC9A 2P0EA 4PNHA 5TR9A 1VI5A 1JAHA 2XQVA 2EXXA 2AMVA 3INRA 3K9QO 2XB6A 2ZETA 3Q98A 4C4OA 3QUBA 1AX9A 3RVPA 4MW0A 4MPRA 4P32A 3EB9A 4Y2JA 4ANFA 5JBIA 2BONA 2CW5A 2Z2JA 4B87A 2A57A 2BZSA 4YUAA 4R2WA 3RUCA 1NASA 2Q3FA 2AFHE 1HEUA 3Q7PA 5JCOC 1IZ7A 5AK3A 3NKLA 1YJBA 2COUA 2VHXA 3HWX1 3Q3HA 4AP6A 4AJEA 3AF3A 1PJ4A 1PS9A 2GHQA 3G82C 1ZCFA 2HH9A 4GUDA 4HRYA 4I2NA 4QYIB 5JANA 2PMCA 1CY2A 4RZSA 1TTTA 4LWQA 4GIBA 3ND6A 2HC9A 1NKVA 2XXBA 4J6EA 1R8XA 2IP4A 4IYRA 1BOFA 1HMYA 2OFWA 2W11A 4GNKA 5JMPA 4UHFA 4JOSA 1D1TA 5D84A 4AJPA 2ZRPA 2D2FA 1B8VA 2CHVA 2VDPB 3S8MA 3ONVA 5KVAA 3KUDA 1V95A 1V26A 4OHRA 1Q84A 1GAJA 3QQ5A 3BK7A 3AI7A 5CCXA 3KG2A 4CFYA 1PLLA 2QE6A 2AW5A 3LO8A 5IC6A 2XWJI 2F9MA 4F4DA 4X7BA 3M6VA 3HU5A 1C7RA 4KDCA 2KI5A 4X6XA 5T6BA 4Y18A 1J70A 3ELDA 3WJ2A 4CMIB 1EE2A 3A31A 4DR5B 1YI1A 2O1SA 1EP1B 3X2EA 3AJRA 1F6WA 2JEOA 5IVHA 5EJIA 3Q87B 2IH5A 1KR2A 2REBA 5E6RB 4F8JA 3PGA1 3QBTA 3WYAA 3MW8A 3GDFA 2D13A 4Q9KA 1A71A 5EHIA 2GEFA 3PEUA 2WT9A 4H6XA 1RM0A 2EKPA 2IYXA 3LPDA 1I2MA 2PJUA 1VPDA 2QXTA 5AW8A 4FM9A 5J63A 1X8LA 1FOEB 1XWWA 4MXDA 1G21E 2OHGA 3AILA 4GP7A 4KW7A 4RLQA 5BWOA 2PUDA 2B0JA 1T5TA 2WVAA 4L50A 1OYVA 2P6PA 2X8JB 1ZN8A 1NVTA 2YXNA 3I53A 1KFKB 3OE5A 3IHWA 3VGJA 3EXFB 3DE0X 4RD2A 3RU7A 4F60A 3L7OA 1JZQA 1GV1A 1VZ3A 2VOJA 4QT0A 3ROGA 2IPAB 1XZIA 3TSWA 1TUGA 1F0YA 1LXCA 2OMEA 3D64A 3BE8A 4BCCA 4Q4CA 5ALSA 2BRUC 4B7CA 3DMFA 4S0ZA 3GRYA 4E5NA 2B7LA 4J1SA 4KU4A 4PLHA 2C5LA 4XWTA 4X84A 3UWDA 3N07A 3B13B 2HJ9A 4Z1MD 1TAGA 3T5PA 4Q3DA 5T3UA 1PP4A 2B30A 1R8JA 1M6HA 3EHDA 3HCEA 5C53B 5DEOA 1ARZA 4PNZA 1KI2A 2OESA 1TUIA 4YRIA 4LZJA 1A8UA 5EUBA 1WZNA 4BBZA 4WXHA 1B1AA 4ZCTA 3SQLA 2P90A 5TLSA 1JEOA 2FUG1 2VF8A 3FY4A 3WC4A 2EHDA 5G0SA 1FSPA 4E22A 2PLWA 1N4AA 4F71A 1FMCA 2AYZA 3BFXA 1NQOA 2Q3DA 2RHJA 3P9CA 2LCIA 3FHCB 1ES9A 3HCAA 4AK9A 4AP5A 1KVTA 4QUDA 5ED4A 4R1NA 2Z3WA 4EDHA 2QYTA 3R5JA 5G4KA 5HJ5A 5IHPA 3LE8A 5BN5A 1JLHA 1V4VA 2WJZB 5C7OO 1Y7PA 4UEQA 1KQNA 2CZGA 2FZ4A 1FVFA 2RGEA 2ZBUA 4HGYA 1JXAA 1KAGA 1QQTA 2QY9A 3COPA 5JC8A 3F3YA 3AVOA 2UUBB 1YTUA 1M2KA 3MJTA 1AQ6A 3TL3A 4WFIA 2C0CA 3BK1A 4U2KA 5CEEA 4BVHA 5KJCA 1UZAA 4Q18A 3W5HA 5CFOA 1U3CA 4LFCB 5FQNA 6ADHA 3GRKA 1K2WA 3AFMA 2P4QA 1YGPA 1SCKA 4ZYYA 4C0XA 1ST2A 4Q4LA 4ETMA 2W2LD 1ECBA 1P2DA 2CXUA 1FNMA 1A5TA 3CH5A 1DRVA 1O54A 4RTKA 5C51B 1WHTA 4CUKA 3KOUA 1SNYA 1AHHA 3C4VA 4P3OA 2O8CA 4HYYA 2HRCA 4WRRA 1Z63A 1Q7RA 2H4YA 2AQKA 2EZUA 4ZZ2A 3IB6A 1GPMA 4O59O 2J7PA 4Q4HA 1V6CA 4PX9A 5JARA 2VP6A 1D6NA 2GYWA 2PZMA 3DMGA 4NENA 1YFLA 1OBOA 4LGMA 1DFHA 3T12A 2QRNA 3EHEA 4M0LA 3GXBA 1L5LA 2C0QA 1M6YA 2CGEA 3L6OO 4KI0A 4MQEA 4YV2A 5MN6A 4NONA 3ZD9A 1WVMA 5IJZA 721PA 3Q40A 1AGPA 5MN5A 5B1IA 1X77A 3VKWA 4GSYA 4KQKA 2R86A 3KS9A 4C5BA 2GBFA 2HWUA 3KQUA 3ECCA 5FJIA 2B4AA 2I6FA 4M6WB 3DD5A 4MSUA 2H31A 2QUJA 2Q1WA 2O2ZA 3IUYA 1OGJA 4DHEA 3EFOB 1B76A 4FLEA 4KIUA 1Z0IA 3L7KA 3I6QA 3N2YA 3CNOA 1PEKE 1BA2A 1XMXA 2AEFA 2ZJFA 1P2TA 3HYSA 3V2IA 4BNJA 1SQGA 5IZ4A 5IAEA 2I6QA 3HR7A 1B6SA 1FFHA 3Q8WA 3E81A 4HB2A 3RJMA 1UBNA 1VP9A 3Q8KA 5FTJA 1U6JA 2WHRA 5GMOA 5GOTA 3QU4A 3IBCA 3G6WA 2AC2A 2AWNA 2OQ2A 4LX8A 5IARA 2PKYX 3IPXA 4K9OA 1ZUHA 3ZY4A 5IT4A 5BN3A 1DPGA 1JLRA 3VNSA 2ISCA 1KQOA 4JNCA 2C97A 1CZOA 2Z2IA 3G8CA 3F90A 5EZYB 3MT7A 3W5CA 3P96A 1A50B 1EUYA 5LFAA 4ZGWA 2EP5A 1XVUA 4YMVA 1NJ5A 4CTOA 2XEXA 4JYPA 3WMRA 4DGQA 2YYYA 1CF9A 1JYSA 2OZKA 3F6CA 1W96A 4B2LA 1NBOA 3DW3X 4IR7A 2V54A 2CYBA 5KKAA 6AT1A 5IYZA 1D6JA 1T9GR 2ZJ5A 3H2KA 3KKKA 421PA 5J1TB 3CX6A 1PFGA 3LQRA 1SKMA 4MQ5A 5KQSA 2RC5A 1C8BA 1NTRA 2GXQA 2W8BB 2YBEA 5F9HA 2B99A 2XQFA 1XWFA 1FZQA 4RFSA 2BGIA 1UFVA 4Z4FA 4ETIA 4RE6A 2A4MA 3M2PA 1NZDA 1BRMA 5KB3A 5KVVA 3DAYA 4YAEA 2O7RA 1LX7A 5CT5A 4EMUA 2YJ4A 4KQMA 4K5QA 1SXHA 1CYEA 5EYPA 1NURA 4XGRA 1I9CA 3QOYA 2GZ3A 3RIMA 4IXMA 1O9HA 2CY0A 4MQFA 3IP8A 1OGIA 2ISQA 2L18A 5CM9C 3HXLA 1EFLA 4P98A 5CYPA 4PICA 4NDNE 4ZO4A 1RAHA 3KAJA 1SXJB 4G09A 3W5DA 3N0RA 3UJAA 3EF0A 1QB7A 4C30A 1ZD4A 2XA1A 5FFMA 3CF6R 3U81A 2QZJA 1HDOA 4QUEA 4PSUA 1O89A 2ZTSA 5LNK1 2VYVD 1HY3A 1E89A 3GOHA 5WRFA 3CIFA 2I8LA 3Q3CA 5LDGA 1L7VC 4EHAA 3X44A 5JXWA 1KNXA 1MZPA 4EABA 2PR7A 4YI3A 3KVOA 1IN8A 1N2IA 1Y1SA 3O4HA 1RYDA 1NMEA 3K9BA 2CCGA 4L8YA 4ENTA 5GZ1A 1KTIA 1PJRA 1TC1A 2I2DA 2YZGA 3NBXX 3FPLA 1FRQA 4M9QA 5AKXA 3V48A 3AR6A 1RM3A 1V4BA 1D2MA 3KPWA 1KPIA 4R5HA 4Z9AA 1U6IA 2C54A 1QF7A 5KWVA 2PO7A 1HO3A 2ZR8A 3W5UA 1DJPA 3FYDA 4L4UA 4MUIA 3RK4A 1RHJA 3DCNA 3F6YA 3OKCA 4NMHA 4W1PA 3I01A 5DYWA 1QHIA 3NETA 5EXEA 4ARSA 2B37A 1M2OA 5G4KB 3BGSA 4YS6A 4WHMA 2O8NA 2ORWA 1T9KA 3R6WA 3EZ9A 4MPTA 2DWUA 3NGMA 4I8DA 3V6MA 3HRHA 3QJ5A 3TCNA 1EK1A 1YRHA 1VMKA 1YIOA 4QLAA 1GG5A 1R9NA 3CNNA 2H16A 3IKJA 1OU4A 2NX2A 3A6JA 1NVWQ 2YTZA 3M1YA 4CM9A 3SAJA 5HMMA 1T9DA 4FFBB 3DW1X 2ZRCA 3DP9A 3NC4A 4FN5A 3V8VA 5LMNB 2JJ1A 3FCXA 3K1TA 4GOND 4UM9D 1M67A 2GDZA 5T5QA 3AY7A 5LZ4A 1UK7A 1PGPA 5AVWA 1MRSA 2CLOB 3E3LA 1M0SA 3OH8A 4N7RA 4C7XA 1WHTB 1S2NA 3ZJVA 2O8CB 4L9AA 4B6GA 1RZRA 2PX5A 3B6MA 1NBIA 3G7NA 4YDHB 1RRFA 3QHQA 5DHSA 4V1CI 1WVGA 3D2BA 2A0UA 3IBYA 2ID7A 1YZVA 3AR4A 2AMYA 2F4NA 2Y77A 2P5TB 7MHTA 4ALIA 4FS3A 5DTIA 2ZYIA 3ESYA 2QNIA 3PQ5A 1YK0A 4RV4A 2W2PA 4LF8B 4J03A 2D6FA 1U7OA 3V4PB 4X41A 1A96A 3I1JA 4H60A 4MQEB 4GL2A 3GZTB 3QF4B 3GN2A 4C07A 2WIDA 3BD8A 2AUTA 3N0WA 1X2EA 2AKAB 2AN3A 2Y93A 4U7GA 3UG6A 4RLFA 2Z30A 4NMLA 5LD2B 1X8JA 2PT5A 2PS9A 2PMEA 4DWJA 2ZRGA 1AD2A 1ADBA 3NIGB 2AEJA 3V4LA 2PEYA 3TG2A 1KBOA 4LHVA 1MT0A 4Y6SA 1Y8ZA 1X8KA 2D1QA 1V48A 1W4CA 4INAA 1BTOA 3GJXC 4M1KA 1CYDA 3LBAA 3UNXA 4GMKA 1LK0A 1OIWA 2AOVA 1YA4A 2I4LA 3F4KA 4HADA 3OJEA 3QKUA 4PO1A 3RKSA 1RRVA 5E9WA 4Z4QA 2Q21A 3WIVA 3IELA 2A2ZA 1DJLA 3LAWA 3HXKA 4LOIA 5FRDA 4ILEA 3ENQA 1NWCA 4GRIA 1DMRA 1JR3E 4QOEA 1RQ2A 4JV5B 4B73A 3TLKA 1QS0A 3ZW7A 1WUYA 1RXCA 3F67A 4Q24A 3M6IA 1EJ6A 4HNTA 5CH5A 4IMIB 2F17A 3VR3D 5BN3B 1L4YA 3EARA 1XLWA 1KPGA 4JVOA 1VLLA 4DDMA 2AFHB 2JK1A 2JGKA 2QMQA 2IXDA 2IODA 2WT8A 1LDYA 1GCIA 4NBUA 4ZWNA 4PQGA 2VYNA 3FPBA 2JLZA 3P20A 1M7BA 4R1MA 4DS3A 4LVUA 4WW0A 4P7GA 3WAGA 1DIRA 2CT8A 2JFPA 3ROTA 2R65A 4DIEA 1SRRA 4OREX 2Q4DA 3C8ZA 4RBNA 3DV9A 3CSDA 5ER9A 3HV2A 3AU8A 4J4HA 4K3VA 1KQFA 2IT1A 4KX5A 1BXRA 1ZMOA 4X1YA 3E03A 3MS7A 1KARA 1YZTA 4ZK2A 2CFTA 4BDTA 1QP7A 3I5MA 3RJZA 1A1VA 1XCLA 1NPDA 3JQAB 4HAOA 4YXWA 4GVPA 5HKKD 5K8TA 5EZYF 4NBTA 3JWEA 4MYHA 3IIJA 1W9HA 4QOFA 1QKIA 4C6HA 4E7PA 2VZEA 1J0XO 1XXHA 4C0HA 3RS4A 4UHDA 4UQLA 1LS6A 3SOZA 2JAXA 3VH4A 2C7RA 4O33A 1QHGA 2Y6UA 4TQUS 4B1FA 1Z38A 4UZFA 1QK5A 4GICA 5BRAA 3HCDA 2ZAIA 2ODNA 1KZHA 2C7QA 1CX9B 1UBJS 1ULBA 1UQRA 5ELLA 2V4UA 4FDAA 4JXJA 1XI2A 2Q99A 3L9XA 3H9GA 4M0CA 5D00A 3ZDBA 2WOOA 1E6WA 3HZZA 1CUIA 1G21B 1UDXA 1E2DA 1A2BA 1PV1A 3PFBA 1FJXA 1AQLA 3A1WA 2HXGA 3U7IA 3H83A 3OJCA 2HBYA 1Z22A 4PTZA 5HS6A 3RS5A 3K6KA 1YASA 3QFCA 2V6IA 4JB0A 4ZV7A 1L3CA 2O0LA 1F6DA 2WF7A 1ZONA 1MC5A 1TFUA 3O3NB 4EHBA 9LDTA 2YASA 4NLLA 2XVXA 4PRZA 2BI8A 3CONA 1NJFA 4QICA 4ZYXA 4K6OA 2FTKE 1N7HA 3WXMA 2YDYA 3V80A 5DYYA 3MRTA 4DKXA 4WA8A 1N75A 3OE7A 3ER9A 4LJ4A 4U7HA 2Q3MA 1GPWB 1WVIA 3AP1A 1FUUA 4A5SA 3SYNA 4XUDA 1K9SA 3PF9A 2QUKA 8ADHA 3LT1A 3ZPXA 3D4IA 1OASA 1WBBA 2CB9A 4X24A 1N3LA 4YJ3A 5HRAA 4KR2A 1DTSA 3MSCA 4WKCA 5LBIA 3RSZA 5BSRA 4JH0A 1KO8A 2ZRDA 3K5HA 1AQJA 2QAGA 2DAPA 4BFVA 3BQMB 4BMCA 2J3LA 1PWZA 3VI4B 1TCUA 3NAMA 4CM4A 1T5DX 3FW1A 5COAA 5B36A 1F0NA 1T9BA 4Z49A 3RUIA 2F55A 4YAKA 3EYAA 4K8RB 1Q1GA 1WB6A 2PAAA 3KB2A 4TVOA 3K09A 3NHRA 3KQKA 4TWIA 4IDEA 1Y1QA 3A11A 4HGOA 4P8RA 3MHTA 2K87A 3QWFA 2JLSA 3S1SA 5CIQA 4BCBA 1PNOA 2EJWA 5LMZA 2DT8A 3F9CA 1ILWA 2AOWA 3C8DA 2R6ZA 3QWHA 3SNHA 3T95A 3BJMA 1T5SA 1HYBA 4YECA 4TMVA 1CFZA 1T3LA 1W94A 2WIAA 1MJGM 2VHZA 1OFVA 4G1CA 1VZ2A 5L3VA 1BDJA 4N54A 4ON9A 3GQVA 4YT2A 4AQ7A 1FRFS 3QUAA 1RT9A 3AM4A 3IAXA 4Z4EA 1X1RA 3D8UA 1I80A 3NAQA 1KMHA 4G9EA 3ZX4A 5AW7A 2ZRNA 3EOBI 1O6CA 1T2EA 1PD0A 4FWTA 3BK2A 1UODA 4PCLA 4B6QA 5KSZA 3VHXA 2C82A 1XAGA 2HLDA 4MX8A 1N6PA 5ENZA 1JPNA 3K4QA 4HWTA 4KK4A 1QE5A 1F7VA 3TDMA 2CVFA 4GFDA 4JLAA 1GPLA 4AZTA 2OHVA 4M0KA 5JS1A 1FP2A 4GKAA 2ZU6A 1TNDA 4KPYA 3PUXA 3RVDA 3I73A 1HQDA 1TOAA 2PT6A 4Y9DA 1CUZA 1QC5A 1SUPA 2PG3A 1RWBA 2N46A 4NZ9A 4AZ0B 1UKCA 4C5CA 2HF8A 3ZI4A 4M98A 5JJCA 5KNDD 4KQWA 3U5ZB 1OLXB 1O6ZA 4HLNA 1FTYA 1WHSA 3DV0B 3E2MA 4BNGA 1QIDA 3EQZA 4RO0A 1ORDA 4NF2A 5F3DA 3IBSA 3IT0A 4LG1A 2Y1FA 5EEHA 1B4DA 4KE8A 1GPNA 1JU9A 1Z73A 4HH0A 1G1AA 3PJRA 2YHIA 1Q6ZA 4MV9A 1GTL1 4HC4A 1NMSA 4RACA 4YUWA 1JHPA 4ZMSA 1D09A 4QQRA 1GP2A 1YB5A 4B6PA 4CM9D 3G5UA 5C1BA 3ZXSA 1JR3A 3L0SA 4KR9A 1OX4B 4P08A 1ML3A 1JKJB 3FZEA 4TXMA 4HAZA 4LXUA 5FO0A 1IG0A 2D5LA 1CEXA 1XMQB 4OKSA 3M6AA 4XOIA 3L7AA 3L7JA 1TEZA 1ZHFA 1ZVMA 2FFJA 3VKGA 2QVLA 1M66A 3EXG1 3HN7A 4HATA 4F5ZA 3LWDA 3QVWA 3RSQA 4E14A 3IDSA 2LRHA 3VZBA 4WUVA 1PG2A 4HH3C 3VKVA 3UMYA 4URWR 3AEZA 4IJ5A 1UJ4A 3E4CA 3UAYA 5H81A 5CK5A 4J0CA 1PT8A 3E18A 4K1XA 1BXRB 2QK4A 4HBZA 5FB3A 2L0XA 2P77A 2JCYA 5SICE 2J4CA 2VL7A 3EEBA 2WYUA 1WDWB 5DBGA 4C03A 5JZSA 5FPKA 4E08A 3W6PA 2QVCA 1P7YA 1P4AA 3RJTA 2ROQA 3Q11A 1RDFA 4FSXA 1XTSA 4EKDA 1SVSA 1TJYA 2P9HA 1XXHB 3FMGA 1XEWX 1XZKA 3D6JA 3ZV7A 3VHQA 3QY9A 1N2XA 4EMSA 1YF3A 3HKDA 2UVDA 4C0LA 3OZFA 4HXGA 3A3PA 1ISFA 1H2ZA 3I9JA 3OIGA 4BNTA 1JKXA 3IURA 1XD8A 1E2GA 4BO6A 2Q27A 1GT91 3BZWA 1MG5A 4PXYA 1NBWB 1Y3IA 2ZTLA 3ND5A 1Z6YA 2C1ZA 1C7IA 4HDNA 2W93A 5HKOA 1Z7YA 4UD2A 3A1NA 3AHCA 3GN1A 1MABA 3T7TA 3D1VA 1DC4A 1S2GA 2O2GA 4LE2A 4RH3A 1G3QA 3LNCA 2BSXA 2LVBA 4EKNB 1KNQA 3A3KA 4H31A 3NWEA 4CNBA 1NW5A 2Q5CA 2CL7X 1ZVQA 4K8OA 4DWVA 5D51S 1MQ9A 1DQYA 3Q8MA 1K5PA 1VE7A 5CFQA 1ODLA 3Q3VA 4K9KA 2C3YA 2PLRA 3O8LA 4HMQA 2IP2A 4U1RA 2RSLA 1N2GA 3CHYA 4N40A 4Q66C 3OLXA 1UZUA 3U7GA 4KLRA 1XZJA 1VXOA 5CVCA 3AFNA 5EHNA 2EKBA 4F56A 1UL1X 1XCJA 5CBPA 1J6UA 3HDJA 2WR8A 3TSOA 3VZPA 3CX3A 4L3VA 2FSHA 4B17A 4PG5A 4FQ5A 1QYWA 1SKAA 3O0DA 5DW0A 4XPIA 1PLKA 3HADA 2GCNA 4IEFB 1U8UA 3P71T 3ANTA 4IJUA 4DXHA 5BSGA 2QTLA 2GPJA 3A4IA 3KU1A 4GLJA 4AULA 2QAGB 5LMCA 1YQTA 4YNBA 3V00A 2IYUA 1MOZA 3R5SA 4L9SA 5DGHA 5FYDA 4RVUA 4P0QB 1Y98A 3NH9A 4HS9A 2BSQA 4E4YA 2Y1WA 5B2ZA 2V6GA 1Q1AA 2DX7A 2AYYA 2VDKB 3NTOA 5KU1A 5K6AC 1OZGA 1RNLA 1ODFA 1YTLA 2ON6A 2X58A 3S1AA 1J20A 2O48X 2VTVA 4W6ZA 2BD0A 4MWBA 5LYJA 1ZHHA 2NUAB 5BORA 3ZCQA 4XWKA 5C5EA 5MF6A 1R0LA 1GAQA 1LPSA 3H9EO 3VKFA 2LP4Y 4Q19A 4BNXA 1DCTA 3IL2A 3LUAA 2G1PA 1UKYA 3C7KA 1MQAA 1TKRA 1YZYA 1QQ5A 4PG6A 4YR7A 2G08A 5HIKA 2N47A 3KBBA 4E21A 3HJBA 4EX6A 5D3MA 2NV2B 3EGDA 4TKLA 2XUOA 4B76A 5EG5A 3HGMA 3L1KA 1KI8A 1P73A 4EHFA 4TRNA 1YRQA 3VO1A 1T10A 1P17A 2GXUA 4KBGA 4WKGA 5JH7F 1U4NA 1A8HA 4FIDA 4M86A 5THXA 4CG2A 2ZZMA 3OTIA 3AF2A 2B25A 3EIOA 1VJCA 3F6BX 1RZ3A 3IP3A 3QX9A 2FOLA 3DMTA 3P1JA 3BD9A 4M9RA 1VOTA 1N6KA 3V4VB 5D87A 3IKLA 1R6TA 4BL5A 4MUYA 4UUMA 4DMHA 4DIUA 5CFNA 1DAGA 4NFYA 1GL3A 4IHQA 1HQKA 1XKXA 3G68A 3IPLA 2I7CA 2IEIA 3F78A 2Z3VA 1SY7A 2VDQB 5HG0A 2EWVA 1SZCA 3T38A 1C80A 1QR6A 4U2CA 1OX5A 2X4DA 3UGTA 4YUYA 4R2MA 4L7VA 3VDMA 1QC5B 1OC2A 2CMFA 2XKKA 4M1QA 1KZ6A 2WM2A 4Y2XA 4MB2A 3WRYA 3B2EA 1Z0SA 4JA2A 1IEWA 5DV9A 4J91A 4IX9A 4Y0NA 4NG5A 1LTQA 4GVXA 1QX4A 4JJ7A 1W0JD 1NW6A 2APJA 3CZQA 1TM7E 4MI9A 4R6XA 3ZU4A 5ICCA 3LGSA 3P4YA 2X2OA 2E48A 1AO3A 1CJTC 4ARUA 3AUJB 3R3JA 5IZCA 2H52A 1X7HA 5T57A 5A62A 3IP1A 3COWA 3INYA 3O47A 2O5RA 3B1ZA 3GJ8A 1OD6A 3AIIA 4PGGA 2NP7A 1FFYA 4JLJA 3LQ2A 4WPGA 3RUAA 3QE4A 3R6DA 3O73A 4NG4A 5JDCC 2ACKA 2Q2QA 4MWSA 4B09A 5AW2A 5I4CA 1O0CA 1PE0A 4RYDA 4F1JA 2FWRA 2JJ2A 3BGOS 3KLOA 4C6SA 4D8YA 1CVIA 3TEMA 1Y6FA 1OUMA 3OLZA 4ZKDA 3AU9A 5ALDA 3RYFA 4KFUA 4BFSA 3AQIA 3T1OA 1YFZA 5J4VA 1XCBA 3BWXA 4HB4A 1W4BA 2QL5A 1PYGA 3QKTA 1Y7IA 5AXBA 4H2DA 4URVR 2GCIA 2PLAA 1KEPA 5K2OA 1U0NA 1ZLXA 1IBKB 8ABPA 1SRQA 1GO2A 2EFDB 1DBVO 2DH5A 1XDSA 2ZT8A 4A73A 5LNK6 3RU3A 4FT2A 1JP7A 3EQ2A 4P0TA 5FOVA 2I7XA 2BEUA 2L19A 4GWGA 1XV5A 2ZUEA 1XWIA 4CN8A 2IYYA 2DF8A 1WU8A 4GZ5A 1MC1A 1NXWA 3U4IA 4O63O 1J09A 1OTXA 4FBGA 4KGVA 1SBHA 1N1MA 4WV3A 5TGZA 5CLGA 3ENKA 3H5WA 3KOMA 4XTCS 2QXUA 3SZMA 1C30B 3HKDB 3ZHYA 4YR9A 3S81A 1YIAA 2BYTA 4JBHA 8MHTA 4HTFA 1TVEA 3PHJA 3TRFA 4D8TA 4DNQA 1EESA 5A4AA 1EUDB 1PI3A 2CDCA 2O54A 3VM6A 2EF0A 1P7CA 1C8VB 1G0OA 3K2EA 5SYMA 1ENOA 4EI9A 1WMBA 2JNWA 2WWFA 1HLDA 1M5TA 3F8SA 1QR2A 2E4UA 1J7KA 1G5IA 3H2IA 3LM8A 2HHLA 4EIWA 3JARA 5JCJD 1MX5A 1G98A 4MCIA 1L4HA 2Q3EA 1EVKA 3H16A 1INLA 4RHCA 4X63A 2VP0A 1R9GA 2XF8A 3FDZB 1TECE 1XCGB 4JR1A 1YKGA 4MA5A 5E7MA 1UT6A 3CUVA 2NIPA 3EIHA 4YHHB 1PNRA 3RTAA 4X90A 1ISRA 4D99A 1E1DA 1N78A 2WSSA 2O07A 4WE3A 1SUBA 2CXTA 4ZK6A 1WXQA 3O9VA 4R6WA 5JE8A 4B3CA 1PZXA 5IWCA 4RTRA 1KDVA 1YVEI 1E9DA 2E2WA 3S44A 4YRNA 5LP6B 2AMLA 2E4AA 2PSEA 4LDNA 4A2WA 4MVCA 2I2XB 4JMLA 4PZDA 1XRNA 1LBTA 4U0JA 3TFQA 2YICA 4TSKA 2R85A 4DIKA 4XX0A 4PG7A 5BV0A 5EN4A 2CV2A 2VYQA 1ONOA 2P78A 5ALTA 2NN3C 4NCNA 5FIUA 2NTVA 3VZRA 4JNKA 1RKBA 4D9GA 3WGQA 1YBAA 5CIWA 1NSTA 3PX7A 4GC5A 2Z58A 1K8ZB 4I50B 1D9ZA 1OYOA 4EVSA 2XIJA 4XFJA 4YMHA 4A2CA 4MGHA 3V42A 1E6UA 3CF4G 3HI6A 3WFZA 1F5NA 3NRCA 2A0XA 2WP8J 4GO1A 1QHHA 3UUFA 2I8AA 4C43A 3NZEA 3VQTA 2P2GA 4RVDA 3W5BA 1WLYA 2WILA 3FPJA 5IWAB 1QHXA 2RFLA 1IHPA 1W48A 1F9AA 2CK3D 1U9YA 2FSIA 2JGDA 2C4UA 2VNSA 1RMQA 3D6TB 1JHOA 3G9TA 1TQ8A 4FDTA 3I5YA 1DELA 2QE7D 4CIAA 5LYJB 1A1SA 2AV6A 5EP1A 3DDZX 4Y0VA 4PFKA 1KSFX 1PEDA 4Q37A 3S68A 4JUBA 3IVAA 4KYIB 4KFCA 5G1NA 1HFKA 1F20A 2AJLI 3EAQA 3MJ4A 4KV9A 3II6X 5L6MB 4NHOA 2OO5C 4BE7B 3EGDB 4L5YA 2B0CA 3IMEA 4EY7A 1OIVA 3NOQA 3PRKE 2CUTA 4FJ2A 4W9NA 4BC0A 1J0BA 3PTAA 2IKSA 1QYXA 5E6SA 6CHYA 2R47A 1KOGA 4HQ6A 1USIA 1BQ4A 4QSMA 4WK0B 2NUTA 3FF1A 1AMNA 5AICA 3FOZA 3SCZA 1MGPA 3DVRX 2E82A 4ZZ1A 3B36A 3OLQA 1M1YA 1WV1A 2A9VA 1VM6A 2WWHA 3EH2A 4J07A 1PV2A 4Y6QA 5C81A 1ZISA 1S2IA 4TL7A 4EJ2A 3BTSA 3QFRA 4LF6B 1HRKA 1GZ3A 3G2HA 1X92A 3KT0A 2LUOA 1LSOA 4JJKA 1EG2A 2AZ4A 1Q20A 1Q17A 2GK7A 4EY6A 3WQBA 2XVYA 2G1JA 2W9XA 4C4XA 4X8HA 4W5OA 2AX3A 2QZZA 4MUFA 5GY7A 5C5DA 4W1QA 1OVMA 3ZTTA 4KAAA 1ZFNA 2W6JA 2QN8A 3TS1A 2VTBA 2BDEA 4LECA 1KI9A 1NE7A 4BTVA 3F4BA 1ABFA 2FSVC 2BP7A 1I2AA 3HYLA 3OIVA 4PZLA 3JATA 4LC0A 2R7NA 2QZSA 1G5RA 2FCRA 2RB4A 3ORYA 1E4YA 4BVKA 5BNTA 5BWMA 3CLTC 1GHTA 4TT8A 1QCCA 2DBVO 5B3JA 3JWGA 2GEUA 2ZB4A 4FB5A 1VIAA 4DZZA 4CLOA 1MU0A 3RC1A 1QDUA 1S7GA 2UV8A 5HF6A 1YOVA 1NOIA 1H3EA 4JOQA 4CUJA 3CW8X 3D5QA 1UEIA 1XRSB 3Q85A 1KS2A 1EFUA 1BQ3A 5HF8A 1BH6A 1XSEA 4NU8X 3RYFB 3DLBA 1L9XA 2AG8A 2GZRA 1A4XA 5AJVB 4LX0A 1IHXA 1CUHA 1S9DA 2GQ0A 3G13A 4H7FA 1LW7A 1U7ZA 5CLJA 3MAJA 1PR5A 4QATA 4HP8A 1J5PA 4IGIA 3ROMA 1JGTA 3DKKA 3DTTA 4MRAA 1QG6A 4ZKEA 3MUEA 1NRIA 4KQFA 4RPCA </