1O5TA

Crystal structure of the aminoacylation catalytic fragment of human tryptophanyl-trna synthetase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
378
structure length
378
Chain Sequence
SAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Tryptophanyl-tRNA synthetase
publication title Crystal Structure of Human Tryptophanyl-tRNA Synthetase Catalytic Fragment
pubmed doi rcsb
source organism Homo sapiens
total genus 128
structure length 378
sequence length 378
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2003-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1o5tA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1o5tA01
1N2HA 3L92A 1M8KA 3LCJA 3COVA 3LOQA 1F7VA 1EFVA 5EKDA 2I1LA 1OBCA 3CLRD 3UK2A 3ZJTA 1WQ3A 1J20A 5AHWA 3TZEA 1QTQA 1ZUNA 1IVSA 2DERA 4H3SA 3QTBA 2DPLA 3IDFA 4U8HA 3VRHA 1JZSA 4MW9A 1TYCA 4JZYA 3RJZA 1N2JA 4MUGA 1M8JA 2XRZA 4HPWA 3CR8A 3L93A 1MC1A 2QUIA 3RK0A 3CVUA 1IH8A 1T6ZA 1M8GA 1ULHA 3UMVA 3FNRA 3H97A 3FETA 4OJMX 4KPUA 5J5AA 3AG6A 3NV7A 1GTSA 3TZLA 2XRYA 4MUKA 1JHDA 1TEZA 2Z09A 1GZUA 1TYDE 2A4MA 1T9GR 3AIIA 3ILVA 4MUHA 4ZT7A 4X0EA 3G5AA 4YMIA 4NAHA 1QRSA 4F3RA 5KHAA 1QQTA 1JMVA 4OUDA 1RQGA 4I6EA 3ZGZA 2A1UB 2QJOA 1NURA 2O5RA 1H3FA 3N05A 1NZJA 1DNPA 1JIKA 2PXHA 3H9CA 2BYTA 3KT0A 1R6TA 4I6GA 3PNBA 3UC5A 1WOYA 2J07A 2CUZA 4MW0A 4EFKA 1KQOA 3AKZA 1N2OA 4ZCTA 1FFYA 2JANA 1S4MA 3SEQA 2WB2A 5HG0A 1M83A 4L2IA 1U7DA 5DEOA 2IP1A 1IQUA 4JYZA 1VBKA 1O96A 3IMGA 4ZCSA 3X1MA 2CSXA 1XNGA 3A05A 1J21A 1UFVA 2H29A 1JEDA 2X1MA 1I6MA 4R2MA 3HZRA 1OD6A 3ND5A 1K4MA 4MULA 2PG3A 4ZT2A 2X3FA 1YIAA 5KWVA 1O6BA 3A2KA 1U3CA 1D2RA 4S1OA 1EFPA 1O5TA 1VLHA 2NSYA 2J08A 1KP3A 3RBAA 3HFJA 3RK1A 4UZFA 2IELA 1PG0A 1OWPA 4MWEA 4EG5A 5KCMA 4U63A 2CYCA 1LI5A 1N2IA 2VTBB 3FWKA 2H2AA 3IOBA 3VGJA 1JIIA 4MWDA 1O94C 5TGTA 3RFFA 2CYAA 1ZJWA 1WKBA 3FY4A 2YWBA 1G8HA 2QJFA 3ZIUA 1N2GA 1COZA 1G59A 1KQPA 1YULA 1VBNA 1A8HA 3SDBA 5DASA 5LLTA 4MUFA 1Q77A 4MVXA 1GN8A 3MLAA 3C8ZA 2IJGX 1K97A 2ZP1A 2QUJA 4ZCQA 1M1ZA 2G36A 5BNZA 1GPMA 1N75A 3HMQA 1PG2A 1H3EA 2QTMA 3CLSD 1O95D 4MWBA 4ND6A 3NBAA 4CT0A 5K0TA 1TYBE 1WXEA 5FO1A 3PXUA 1I6LA 2Z3VA 4CDNA 2ZUEA 4K03A 1EJ2A 1J09A 1T6XA 4DDHA 1EUQA 4Q16A 4GRIA 2GOYA 1I6KA 2CFOA 4NATA 2J4DA 2YXNA 3F3MA 1IRXA 1LW7A 3CVYA 2QJTA 3D6VA 5FNZA 3SEZA 4Q93A 2GKSA 1B6TA 2V0GA 1O0CA 1QJCA 1EXDA 1NP7A 1U0BB 2X1LA 3FDXA 1OWLA 3KT6A 2YY5A 4MAFA 4QREA 2A1TS 2C5SA 1JEEA 4KR6A 1J70A 3CVXA 1O0BA 1O94D 4ARCA 3AFHA 3Q10A 5HUHA 1MOPA 1G8GA 1K4KA 4TS1A 2JAXA 4J76A 4EG8A 2X0KA 1N2BA 4J75A 2YWCA 2TS1A 1F9AA 3X1JA 1KKUA 4RUKA 1XNHA 2E89A 3FI0A 2PFSA 1WXHA 4ZCRA 1WZ2A 3MMXA 1JILA 4G6ZA 3CLTC 3G6KA 3NBKA 3CVVA 3IMCA 2QUKA 5LFAA 3IVXA 3ND6A 1KR2A 1JGTA 3N8HA 2V0CA 4WSOA 3N9IA 3FG9A 1KAQA 3P0IA 3S3TA 3DV2A 3A04A 1R6XA 4HJXA 2VXOA 4ARIA 3TS1A 1V8FA 4EG3A 1X8XA 3HGMA 1GLNA 3N2YA 2EL7A 4MW1A 3TQIA 4EGAA 1ZH6A 1NUSA 4DDKA 2B7LA 4F4HA 4YP6A 2PZ8A 2DLCX 1N1DA 5TEWA 1H3NA 2EJCA 3CLSC 4CDMA 1O95C 2RD2A 3P0JA 4MW6A 3H99A 3IUEA 4A91A 4JXZA 2VTBA 4MW5A 1N78A 1Y42X 1PFYA 1Q15A 1LI7A 3FIUA 2E18A 1O97D 4I6JA 1EUYA 2A84A 4G5FA 4DDMA 3ZJVA 1NUQA 3OTWA 4YP7A 2QTNA 4DNXA 1MB9A 3BL5A 1VBMA 3JXEA 1N77A 3FH0A 2DR2A 2CV1A 4OUDB 4ZT5A 1JECA 3PNYA 2CYBA 3CLTD 1ILEA 3ZXIA 1WJGA 4XFDA 4E1AA 2Z08A 1MJHA 4KKVA 4MLPA 1G8FA 3CVWA 4ZT3A 2D54A 4ND7A 3CA8A 3MUEA 1ZH0A 2JA2A 4KR9A 3RHSA 1OWOA 1JZQA 1BS2A 3MXTA 3KT3A 5IJXA 2AKEA 3SZGA 2WSIA 1Q11A 1U3DA 4FZJA 5K0SA 1Q19A 4MUEA 2J5BA 2GM3A 4K0RA 4EG6A 3U1VA 3IODA 2CT8A 2DEUA 1MAWA 4NDAA 1XJQA 3I05A 4NZPA 1EFPB 1IQRA 4MUIA 4MUNA 3E27A 1HYBA 4AS1A 3FOCA 1GAXA 2E21A 4MUJA 1V47A 3IVGA 3KFLA 4UZEA 1WXFA 2A1TR 1OWMA 3LE8A 4ZCPA 4WNYA 1KP2A 1QRTA 1KH3A 1NUUA 2J09A 4YBRA 1F7UA 5IHXA 2A1UA 1NSYA 5FO0A 4R0NA 3TQOA 1CT9A 3Q12A 3X1KA 2OV4A 2PIDA 4MW7A 1GTRA 1O97C 2WQ6A 3MLBA 1OWNA 1PFVA 3IUBA 1X6VA 4P2BA 4PY2A 1KORA 1TYAE 1TFUA 3DO8A 3HL4A 1KQNA 3PRHA 2QUHA 1EFVB 1FYDA 1MB2A 2DXIA 1NYLA 1M8PA 3SP1A 4QBTA 4ZT6A 4MVCA 5HUJA 4JFAA 4BWVA 1QU3A 2BTEA 2A7XA 2D13A 4ZT4A 2HGZA 1MRZA 5JBNA 3H05A 3CLUD 2AZXA 3GMIA 4EF6A 1MAUA 1T9GS 5DK4A 3SZ3A 3ZUGA 1J1ZA 4XFJA 3ZXSA 1N3LA 1T6YA 1VL2A 3ND7A 4KR7A 1J1UA 1M8FA 4R2LA 1IQ0A 1K92A 4NX2A 1MBZA 3ZJUA 4PBTA 3IH5A 2HZ7A 3UY4A 5LM3A 1R6UA 4DLPA 2R5WA 2HMAA 1WQ4A 1PFUA 1I2DA 2PZAA 4KPUB 5F23A 4MWCA 4QRDA 3Q4GA 1U7XA 1NUTA 4U7JA 4YP5A 3AL0C 4DJAA 3QTTA 1TQ8A 3IOCA 3SYTA 3H9BA 1F4LA 3K9WA 3INNA 3D6UA 1IHOA 2A86A 1QU2A 3A4IA 3HV0A 1XNJA 3DLAA 1OBHA 3G59A 3FHJA 3COYA 5DB4A 1QNFA 1SURA 2DETA 4CQNA 1KH2A 2DUMA 4MQ6A 2QTRA 3M5WA 1JIJA 3CLRC 5J58A 1IFXA 4MVWA 3ELBA 3KT8A 3GUZA 4HK4A 1YUNA 4G5YA 4MW2A 5J59A 2ZUFA 1KH1A 5TS2A 3VU8A 3TNJA 1H1TA 2O8VA 3OP1A 2AG6A 3P0HA 3PNVA 3COWA 3IOEA 2A88A 3GLVA 3IVCA 4DE5A 5TEVA 1WXIA 4PBSA 1PFWA 5H7XA 4EG4A 1NUPA 2OQ2A 4HJRA 1WXGA 2E0IA 4JXXA 4XSVA 3IMEA 4L2IB 2CV2A 1P7PA 1O96B 2CV0A 4RPIA 2RE8A 3UOWA 2D5BA 1NI5A 4EG1A 1KAMA 4MVYA 3COZA 1YIDA 3K32A 1N2EA 4NAUA 4EG7A 2WQ7A 1QRUA 1WY5A 3CLUC 3DPIA 4MW4A 5H16A 2PZBA 3QE4A 1YUMA 3AG5A 1YI8A 4PBRA 4AQ7A 2NZ2A 4GU5A 3ISJA 3P52A 1EE1A
chains in the Genus database with same CATH superfamily
4NBKA 4IM7A 4RW0A 4Y2PA 1XCGB 4KOAA 5CIWA 5ECWA 1QHEA 3R7NA 1FMFA 3IPCA 1FF9A 2F8LA 2O50A 3ANNA 4TUYF 2H4XA 4FB4A 3K4QA 5JS1A 5JT1A 1OBCA 1E3WB 3IKTA 1Z13A 2CMFA 3ICCA 1V7QA 3QWFA 4R1SA 5LMNB 1SUEA 1NLFA 4WRRA 2CXNA 3REQB 3SZRA 4J0QA 1N6IA 4J49A 4LNHA 3RJ5A 1SMKA 2JFFA 1E9VA 2YTZA 1P9NA 4IPTA 3EIQA 2G08A 4YT5A 3UO8B 2XSZA 4D3DA 5JSHA 1AGNA 2JH9A 4KIGA 4CKXA 4OB6A 3VUEA 5JH7F 2CJPA 5DO9A 5I9SA 3LSYA 4W6ZA 4IQ0A 1JDSA 4PXYA 1DUVG 1S8NA 1KFBB 5ELLA 4IJVA 4FFSA 3D2CA 1M8JA 1A9TA 5A1JA 1TTQB 3U40A 3H1BA 4JKYA 3UAYA 3UJ6A 1M6EX 3TBFA 3TLGB 4CL8A 2XCSB 3KCNA 1XZIA 1JBEA 3REOA 1JAZA 5IKMA 5JJ5A 3TJRA 1XOIA 1YFLA 1FW6A 5EPUA 3STVA 5DXJA 2FUNB 3CCFA 2RGUA 1KVTA 3UGTA 3FETA 3WIEA 1LBEA 5BWNA 3T9EA 4DG9A 2UU9B 1O6ZA 2H7YA 4UD2A 3IP1A 2HHAA 5TQ2B 3M6UA 4JI6B 5K3FB 3PKIA 4BO8A 3L4EA 1YJ8A 3CX7A 3FOBA 4NU0A 4QLAA 3I6YA 1FP1D 1XTQA 1SB8A 1DEOA 1GXSA 3UJDA 1FPQA 1JT2A 1UMBB 1OXBB 1V3TA 2WG0A 3F98A 1QK3A 4MGHA 3GLGE 4UTZA 3D0RA 4OMFG 1CNMA 5FBQB 3BA1A 1GAQA 2OHGA 4NAHA 4O4IF 1S02A 5BQ5A 4CZ2A 5KREA 3PIRA 5LBIA 1EX6A 2WF6A 3QY0A 4Y2YA 4AG3A 4UTRA 5G1NA 4YMGA 2WSLA 1T35A 3CUKA 1V0JA 1RQXA 4X6LA 3N0RA 1JPNA 1G17A 1PX0A 2FZGA 3N70A 3PPVA 1O89A 3SCZA 4LRSB 5JAUA 1DJNA 1PUXA 1U8EA 2IQ5A 3FNHA 3FWNA 1KIMA 3MIZA 4KN8A 1T4BA 1WULS 1DNPA 2IZ5A 1JDTA 2QLTA 2WNHA 3G2HA 5FOUA 5BYBA 4ERNA 4ZHQB 2G1AA 3HJAA 2VC2B 4XWYA 4YUXA 1K89A 3QUAA 4BAZA 5CCXA 1F0KA 3RC3A 4EMSA 5F3WB 2ZYTX 1BW9B 1UBOS 3IDZA 4B44A 7MHTA 2O8CA 4Y6PA 4MVJH 4V0RA 2YRXA 4LNUA 1ZRSA 3QELA 1XQYA 2HJVA 4QSMA 1BFDA 5IWCA 3DE5X 4ACAA 1FTYA 4AJNA 2JLUA 2GRAA 1L3IA 1U7DA 5IM4F 3B9BA 3L9XA 2PQ0A 1CBUA 1OT3A 2PA3A 3IMGA 3IB6A 1H4SA 2WHRA 4X94A 4CM4B 3LH5A 1XAHA 5KVAA 1JEOA 1JQAA 1M0SA 1PEDA 1JYSA 3PNQA 2OHOA 2RIPA 4MULA 1Y4AE 2G04A 4KO3S 3ONVA 3O82A 4L50A 3P97A 4P3NA 4W9NA 3TFWA 4B0PA 2R7KA 4AS3A 1L5LA 3ZTYA 3CW2A 1CRPA 1H0KA 4KEAA 3QXHA 4EMUA 4KUEA 4F45A 1D07A 3EDCA 2OD2A 4BE9A 3KL2A 4A1FA 3FKSA 2OV6A 2HF7A 3BE8A 4GZ6A 5GADl 1F2UA 4TS9A 2PL5A 4LRQA 4L4YA 4XM1A 4JP3A 2JL1A 1PUJA 5BXYA 1RXWA 2OCLA 1O94C 2XLCA 3HB4X 2JFUA 2OM2A 3L0DA 1NW3A 5KVVA 5EE9A 3X1ZA 3R6DA 1A2KC 3RRXA 3SXUA 3T4UA 1QO0D 1A2BA 3A6LA 3PV0A 3WYAA 4JCOA 3RSFA 4HS9A 1L4HA 3K0CC 4MWZA 5A9SB 1ZHFA 2QT0A 3OTOB 2MYPA 1PT9A 3RADC 4HG2A 3JQ9C 4Z49A 3C7AA 2JFWA 3DLIA 4WERA 5JALA 1WMBA 4PZZA 1KMHA 4XDHA 2YIJA 3GGPA 3VMMA 4R9VA 3CE9A 4GIBA 4NQRA 1OIVA 1T1EA 1B6RA 3TKLA 1QONA 2ZIWB 4KQ6A 1M2HA 5EPOA 4NIMA 2FZCA 3SR4A 2J85A 3GAFA 4EPTA 1RRMA 4WT7A 2YVAA 4JCCA 3GEPA 3W2GA 4CF7A 4J3NA 5FLXA 4PHHA 4I8XA 4XX0B 2ZBEA 3PX2A 1CZHA 5L45A 1JN0A 4PS0A 4QXAA 3T5CA 3DLHA 2PMEA 4CRWB 1SJ9A 3TX2A 1V7PC 4HKTA 3P0EA 4IW3B 4MGYR 2GYWA 3H5NA 4O4LF 3DKRA 5EZQA 2D0IA 4C4AA 3D6VA 4DBVO 4F5WA 1IPFA 1IYZA 4HXFB 1OA1A 4HXEB 4XDZA 2GJKA 1YR6A 1SCIA 2ZB7A 4XGKA 3GZJA 3BFPA 5TT0A 3KETA 4CKEA 3L5KA 4J2HA 4NJEA 3VPAA 4DM3A 2H5LA 3HKDA 1K2WA 5I01A 4G37A 3MOGA 2DF8A 5G1OA 3T7IA 1OWLA 1ABEA 2HF2A 4KW7A 2I7DA 4R8RA 4AICA 4Z3DA 3U7HB 2GERA 3JQRA 4UW9A 1HYGA 2WB4A 2HCTA 4BNDB 1H4VB 2ZRHA 4L6IA 3IIIA 2Q45A 1VB5A 2CKMA 1E5TA 3QLEA 5FUYA 4BQQA 5CA0F 3TINA 3WLLA 1G8GA 1A3CA 3MTAA 1QO7A 4ND2A 1TVCA 2FJPA 2ZCUA 3NEPX 2GCPA 1BE6A 3LDHA 5FP0A 5FPPA 5T4HA 4BFSA 4YCLA 2YWGA 3TPZA 4FS3A 4LDZA 2LW7A 4PZCA 1TF5A 3L8MA 4Q39A 5JADA 3GVXA 1L4LA 3OZIA 5F76A 4G0XA 1II8B 5CDFA 3JQ8B 1UMDA 2OK8A 1EDOA 2CJXA 2I76A 2PGJA 2W6ZA 2GN1A 3AI7A 2YHSA 3K5PA 3MYYA 2OTCA 4YPVA 5K7SA 3NJ8A 2XOKD 4KFSA 3UNXA 1KJQA 4ALNA 5C1BA 1AMOA 4TQ9A 3OESA 4MYHA 4KBFA 4AZTA 4Q3KA 3ND6A 1HX7A 3FKJA 5ALSA 2J45A 2NO7A 3AR8A 4KX3A 1TZBA 5AJZA 2A59A 2Z83A 3BFXA 4TYQA 3RHFA 1ABFA 1MF7A 1VKOA 2J5XA 4FMDF 1Z7EA 5JCPA 2CJFA 4UASA 2PD6A 4INPA 1DBVO 1TECE 5EL0A 4WECA 4DMKA 2K2QB 5JWOA 1LV7A 4GP7A 5BOSB 4CMKA 3P2MA 2YZMA 4MRSA 2OBYA 3WQBA 3NS7A 1MO3A 4HATA 4IQFA 2LD4A 4TTVA 1WD7A 3VR3D 3CNLA 5LQKA 5I8PA 4KFCA 1FE8A 2AOXA 2H2DA 5DNYB 1N8KA 3TI9A 3BT7A 3N8DA 1PJ4A 3F4LA 1ZHOA 3EGVA 3E1SA 4JC5A 2VRBA 1CKEA 1PD0A 1ZAKA 2XDQA 2J3JA 1YBMA 3QFTA 2ODQA 2Q1SA 3TZBA 3BFVA 1E60A 1UJNA 4QPNA 3IE1A 4Q3BA 1PS0A 1NBMD 2JCGA 4ISBA 2I87A 5BQFA 3PQDA 4BMDA 2YS7A 4WEQA 4MQBA 4B47A 2E18A 2ZI9A 3IXMA 3QKIA 1V9CA 4P8RA 1HEUA 1Y5RA 4LXUA 5DWQA 1F8XA 3KPJA 3VPFA 5JFOA 3FPAA 1LFAA 4GBED 2GS9A 4UKDA 4AWXA 5JHGB 1XFAA 2BEJA 2Z98A 4LJLA 1JLKA 2AFHE 4UOQA 2HYIC 1Z2OX 3NETA 4C14A 1JECA 3VR6H 4Z4CA 5DTMA 1TM4E 1Z5WA 5HRAA 5J4HA 3P9NA 4RY8A 3NYRA 3M6LA 2X6RA 2Z08A 3DNPA 1V6AA 2PUCA 3I76A 4PXAA 3Q88A 1CY8A 2ID7A 3SHFA 1H4QA 1SWVA 4OG2A 1U7OA 2FY8A 3LFTA 3C45A 8LDHA 3H3JA 1MQ8B 5GZ1A 1OCEA 2A9FA 3VVBA 2HIAA 4N3GA 5E9QA 1Z0DA 3FMPB 3TQQA 4EL5A 5HYVA 2YZNA 4OGKA 4UEOA 1L5VA 1NXQA 3TZKA 2EQBA 1OA0A 5I7SA 1KJJA 1A8PA 1YKFA 4OB7A 3TLKA 2HHHB 1SC3A 1D6NA 1HDEA 1JPUA 1HMYA 4CR7A 5BORA 5IDQA 1PZFA 2GNPA 2N1MA 3RVJA 1UADA 3W8FA 5A1TA 2I7CA 2QW1A 3WDMA 3QVKA 5DN6D 4FOPA 5ABPA 2OMKA 2Y1DA 3PQCA 3QLTA 4HQLA 4G0OA 3GMTA 4Q05A 4XM2A 1Y37A 4BV8A 1EEXB 3ROFA 4CL0A 1V1RA 2W2VA 3Q7PA 3JQPA 1V1MB 1T3ZA 3HLYA 3ER6A 2WF9A 4HQ6A 4MA0A 1OKKD 5JAQA 1LQ2A 4BGIA 1XNQB 3O4IA 4Y8VA 4FYVA 3O83A 3WYDA 1L5OA 1OLUA 4UM5A 3HEBA 2YIVX 4DLKA 5U1PA 1KJWA 2WR8A 2ZFUA 4O2AF 3I5XA 5AR1A 4EARA 2VZEA 3BXZA 4TN1A 5E2AA 1GPNA 1XEFA 1XKXA 5B6JA 1DAOA 1UPFA 3FLMA 2R48A 2VZLA 4MS4B 4KVFA 2QV0A 3B5JA 3JRWA 3HRKA 3OI7A 4YAEA 3HRHA 4ENWA 4RD2A 4GSLA 1BKSB 2Q7XA 3EGXB 3RFCA 4JASB 4N7RA 1UQTA 3F8WA 4E14A 4YHHB 4EKEA 6CHYA 4K9SA 2NSHA 5AQ1A 5LBUA 1L5RA 3TEFA 4BMSA 3EPHA 3OURA 3U4MA 2A5LA 4CTKA 4BZQA 1NUUA 2B30A 3PGA1 4AB1A 1UF9A 1CR0A 5K51A 5JDIC 4PLGA 4GT1A 1FNSA 1XELA 4IS3A 3M4ZA 5ALYA 2NTJA 4J0HA 4RXUA 5TB5A 4D9IA 5BSHA 2O8FA 1K6EA 4OSEA 3E5HA 3MLBA 4C76A 1EUZA 2CDCA 1SCAA 3AR6A 1YZLA 2UZ1A 4RD6A 1H23A 3H04A 1LWOA 4URYR 4JI5B 2A3NA 1BFUA 5K0CA 4E7OA 1E1QD 1G20A 1COWA 1UAAA 2YV1A 3Q2IA 3ZW7A 4DYDA 1MD9A 2DG2A 3MT8A 2ZWVA 4H0CA 1NYLA 3TFQA 1WUYA 2PYDA 3HJBA 4YH1A 5TF0A 1E63A 1OLSB 4BWVA 1SD2A 2Z4SA 3H1EA 1RWNA 4LRTB 3AB3A 4LI3X 1G6OA 4WLNA 5DYGA 1TK9A 2N9UA 3N7UA 1FU8A 1J0EA 1Y9AA 4LYJA 4XYBA 4U0KA 1MPXA 4ARVA 4CU2A 3HA7A 3IGFA 4IV8A 3VJLA 2WUVA 3L82B 3CLUD 2PQ2A 1LLQA 1ZP6A 5EVJA 2FCRA 1KWGA 2J41A 2P9EA 2B37A 4KHZA 1VL2A 1XZFA 2AOTA 3QLJA 1XJ0A 2FFBA 1U0EA 4OHYA 3TGWA 3NUGA 4TUYB 3EC2A 2VAPA 4XIGS 2Q27A 3RUDA 4DWVA 1OFHA 4RVGA 3WWDA 4X8LA 1TCAA 2XQIA 3VNUA 2GCIA 4QFDA 2HXYA 3F8SA 2Q6OA 4U9IS 1U7XA 1VHDA 3H0CA 721PA 1UKEA 3QPWA 5F9HA 1MX3A 4AO7A 2FRDA 2WUDA 5TR9A 2D4AA 3QTTA 4FR2A 3WGGA 4RAOA 3IPLA 3NHSA 3D6UA 2R86A 1A5SB 2RHRA 2Q5IA 3F46A 4GXNA 3UWKA 1K9SA 1G5RA 1U5BA 1PWYE 3ELUA 4BMPB 1XNJA 1U9IC 1CZNA 4JP8A 3FHJA 3FJYA 1J90A 3UYLA 4BCCA 1ND5A 4BEWA 1L8OA 2BBTA 2C88A 2WJGA 1U3UA 2ZW9A 4FGZA 1I24A 1VIVA 2B21A 4XWGA 5A62A 5I9NA 3IA7A 5EXDA 2HT6A 1FXWA 1GDHA 3TTTA 4IRUB 2GH1A 3NANA 3LXUX 4MIEA 1A96A 4PG5A 16PKA 4RL4A 2AFIE 2EKDA 2QE7D 1XWIA 4AJKA 3W8NA 4KNVA 2Y99A 2RHWA 3ZI0A 4I55F 4X3OA 1EPUA 1UH5A 2QENA 4KUGA 4R8MA 2CC2A 2ZRKA 3AF1A 5FAXA 5CDYA 2ZUFA 1GT6A 2REQA 4NZYA 1EGHA 1ORDA 4RY9A 1TMKA 4ESHA 5A3VA 2KE5A 4W7HA 2W37A 3L79A 3MILA 5ALWA 1AMUA 1FDUA 1DXQA 2B5VA 5K8VA 5KIAA 1GJRA 4TM8A 2HMUA 3CW9A 1R0XA 3I0NA 2PNJA 3U31A 1BMQA 1WUKS 3G5TA 4W63A 4YUYA 3VR1A 2QG4A 4BFZA 1HOTA 5FJIA 3Q8MA 3LC7O 1YCGA 1IEQA 3PR3A 2G07A 4FCVA 4G0UA 1PJ3A 3KQHA 4JBWA 1MABA 2RE8A 1RJDA 1CYDA 2DFTA 2J8ZA 1GPJA 4BMNA 1PU2A 1WXWA 2B4AA 1UMCB 4EF4A 4ENTA 2YQ5A 5BNIA 1SXJB 3IV9A 5KQMA 1I3OA 2AR7A 2RONA 1E9BA 3DMHA 1I5OA 3P9ZA 3I9MA 2J6HA 1THZA 1X7ZA 1N9ZA 4PZ0A 4KE9A 4MRMA 4QXPA 2CMHA 2YNMC 4CUKA 1ZJJA 3GLFB 2C4KA 2V7UA 3NDBB 4LEIA 1N7HA 1SQFA 4JBLA 2BZ1A 4MI9A 4QWMA 1NN5A 2VLIA 1VFPA 5I7AA 3RS7A 3LRPA 4IJ5A 3V8QA 1P4GA 1ID8A 1J0DA 3FHCB 1EWKA 3QXGA 1E6EA 1BXZA 4C2AA 4AX8A 3JWPA 5ECGC 1TAQA 1T0BA 4W1RA 3VISA 1OIXA 3NHUA 5D7NA 1EVQA 4CFZA 1RM0A 1P2FA 1W4AA 4XIJA 3TOZA 4IMRA 3SJZA 4D9MA 5JNRA 3GFTA 1I3LA 2C2HA 1PR1A 1Y3CE 5CVDA 1D0SA 3PQ5A 3ZHZA 3D8NA 2WT4A 5LYJA 1RBYA 1MXFA 4K3UA 5CJ2A 1OR8A 2DQSA 5H82A 5AJWA 4MO2A 4GGMX 4F71A 4XVCA 2GCEA 1OBOA 5KOYA 1X1DA 4V0QA 4A8TA 4HMOA 2IOFK 3CNOA 4LZAA 4OHPA 5I4IA 3EG9A 2FPLA 1ZOPA 2QR5A 4Y2QA 1K6MA 5FPYA 1DO2A 4IFBA 4L74A 5EZ6B 5EZYA 1RKXA 2P8SA 2Q5EA 2RG1A 4GYKA 3GBPA 5KPJA 4H4CA 4UUMA 3KQTA 2XRZA 5JS6A 3A9TA 1C7EA 3I0ZA 3P45A 1MC1A 4F3KA 5THXA 5I3CA 1VL1A 2NU6B 4DWWA 3CM0A 1M8GA 3EAFA 3K0FA 1ULHA 2P4EA 2R4TA 3FNRA 1HC7A 2RFLA 5E7JA 2GLUA 4KPUA 4MUBA 2YXDA 3JCZA 4R3NA 4RA9B 1ZEJA 4ALKA 2R751 2B35A 2FWMX 4LWOA 4BPBA 5ESWA 4EQZA 3G0OA 3FNEA 4Q47A 2ZJ2A 2VK4A 4BFTA 2ZDHA 3KTDA 4OQPA 1H2HA 3SYLA 2BJHA 3HYSA 4WOJA 4Y9DA 4PLVA 1I2ZA 1T9GR 3MWDB 2FK8A 4U02A 5IKXA 1CQWA 3C3DA 3MYRA 1QDEA 4RYLA 5D2CA 2R1VA 1Y8QA 1FL9A 3ZVNA 2GASA 4QD3A 1HMPA 1ST3A 4XARA 1ODJA 3FZNA 1Z4IA 4AY5A 2IK8A 3ECSA 2XTJA 2OZLB 5KHAA 1GDDA 4TV8F 2A5YB 3G2OA 4UCQA 5HZMA 1YO6A 2A1UB 4HWRA 2O2JA 2J32A 1BOFA 3U19A 2IU0A 3GDFA 1YHNA 2HLHA 3JQFA 2CCJA 1XB2A 2HDOA 3B1ZA 5I7EA 1NZJA 3H87A 1PWXA 1ZGAA 2GWHA 5EJ2A 3ESZA 3DT6A 4Q01A 1N5RA 3Q7IA 2CL7X 1XPRA 3R3UA 5ALMA 4QOJA 3PNBA 4BJ5A 3RUCA 4ZJUA 4QO7A 2C2KA 2ASVA 3ZY3A 2O1WA 2CUZA 3B3QA 4BXOA 4DIKA 3PTLA 1L7DA 3MB5A 5B4TA 1SEVA 3GMDA 2XE4A 4KIUA 1ZH2A 4NBNA 4Q0MA 1FJXA 1DX9A 5L8VA 1S4MA 2BTOA 3CNEA 1WMAA 4DNOA 2FEOA 1IE3A 4FMBB 1WDTA 3KZKA 2ONKA 2INGX 3ZKAA 4AYXA 5CA0B 3G2IA 3WL3A 5KVCA 4KV9A 5JSKA 2OT3B 3NBMA 4R40A 2REXB 1UFVA 2CNWD 5FI3A 4FBLA 3ZNOA 4AY4A 4B4WA 2GUGA 1H6BA 3H5TA 3IE2A 3NOVA 4GC9A 4P84A 3U3XA 2H9YA 3AW9A 5FWXB 3ZJYA 3OFSA 1ZQ9A 2GZAA 2H1VA 4F04A 4LN1A 4QLBA 1VLHA 3C8DA 3H13A 3TB4A 3BXHA 5J2UF 2XWSA 4JJ6A 3KVYA 3OT5A 3PUJA 3T7DA 4PYRA 4H7KA 1DTSA 4B6PA 5FBZA 1M6YA 4DDVA 2CYCA 5KYNA 2P3OA 1NNSA 4HTFA 4FMDB 4MARA 2W0MA 4JOCA 3K8YA 3UW3A 3VX4A 5ALVA 3KUUA 1XE3A 2AXQA 2XNDD 2E1RA 2KI5A 1Y1LA 1JXQA 3R7SA 1HDZA 5C4IA 4OGFA 4AECA 1A9OA 1TK2A 5IN5A 4KR3A 4QOIA 2IH4A 3JYLA 4K6HA 1U8YA 3V4VB 3RH0A 1P17A 4ER5A 4IIFA 2WFZA 2XUZA 2R85A 3DM9B 1EFKA 2FLVA 5AICA 3FOFC 2RGYA 1G2QA 2BJVA 4UTPA 2R2AA 4Q03A 3TRIA 1XLWA 2QTMA 4HVAA 3SNKA 2HIMA 4QC2A 5DBOA 3IEVA 3S29A 1Q84A 2FWNA 2HCBA 1XF1A 3D3QA 3HCAA 3DJYA 3O7WA 3O9ZA 3RFUA 2ZZMA 1KI3A 4NYIR 3WHIA 2HK8A 4N0DA 5AQEA 4QUBA 4HHEA 2JGJA 2XA1A 3FNGA 3QLVC 1VSBA 4J9VA 4O2LA 5IASA 2NUAA 4LF8B 1T3TA 3IC5A 5T5QA 2B83A 4PEVA 3I61A 1KOFA 3NPAA 1BGVA 1O4VA 1O95A 1P19A 1SA0A 1UBUS 1YBVA 2OECA 3CT6A 1ZHHA 4PANA 4RBNA 5FA5A 3ZWQA 3DQPA 1DG9A 4BKMA 4BQRA 4F06A 3S0JA 4G1EB 2QP4A 4UQOA 2EVWX 1WBDA 1J0AA 2Q5HA 3EVTA 4GPTA 3SEZA 1Y6QA 4Q93A 4P1ZA 3ZY6A 1HFJA 3RD5A 2WF8A 4RDHA 1J2RA 4DZZA 1AS2A 1OLOA 5FBRB 4UBKA 1DBRA 2EKLA 2UV8A 3Q87B 2OXEA 1W9MA 3B60A 1AGXA 1D4ZA 4UMDA 1FP4B 1NXXA 1X42A 4PYKA 3OZRA 5TQJA 5BYAA 2C8JA 2YV2A 1DOHA 4JSTA 1T8YA 1L2TA 4KR6A 3WMEA 2HNAA 3CVXA 1A7JA 4O3MA 5LMZA 5AIBA 2Z3ZA 3GJYA 1GDTA 1ACMA 1G64A 2G70A 3SSOA 3U0BA 2AUMA 3Q10A 2D0OB 4OV6B 5CBPB 3G0CA 3ESAA 2KPOA 2GXQA 3QOFA 2NGRA 3RKSA 5AW8A 1EP3B 2JAXA 4J0EA 3LK7A 2RHTA 3W2HA 2UUCB 1WB6A 1M7GA 5A7FA 3DW3X 5JJIA 4P6VF 1RQNA 1U2SA 2WM2A 4FHGA 4KLZA 4RO0A 1PLJA 1OV4A 4B3IA 1MRSA 5E8RA 3JYHA 3B20A 4XUEA 4J0JA 1XAJA 3ETLA 2JD1A 1OPRA 4UU8A 2IU3A 1RYNA 2FPIB 4CKWB 3CLTC 3RYIB 2YY7A 1GGEA 3OPYI 3JYPA 3EW9A 5CB0A 1IG3A 1THGA 3M4NA 4PICA 4M9RA 4CI0B 3UAGA 4TRJA 2GQ0A 2ZWOA 4E13A 3NIBA 2D2EA 2JRCA 3DUFB 1GD1O 2WIDA 4IMIB 4N03A 3P0IA 4O2AB 4R8LA 4WSOA 3RSZA 3IAS6 5KO2A 1QLHA 4UAGA 1Z6ZA 3SX0A 2WV9A 4RGVA 2H1OA 4QM6A 4W7IA 1ENZA 2BHSA 2OQRA 3OM1A 3TLYA 1CY6A 2G8LA 5IAOA 4RPHA 1W35A 1P3DA 2XNCA 2EZUA 1J2UA 3JAWA 1A1VA 2PUVA 5F7JA 2BMEA 4UBLA 2LWIA 3MJRA 1OIWA 4UREA 4ZEMA 2FMFA 3GUUA 3ZDYB 5AJHA 5JQGA 4A0HA 5AVSA 4PN7A 3DWFA 2EJCA 2A57A 4RE6A 3L7DA 2P65A 4WEOA 4CDMA 1SXJD 3OUUA 1DE0A 4I9HA 4M7WA 1LBQA 1TQ2A 3CZ4A 2FEPA 3NX4A 1LKZA 4A91A 4B81A 4GFDA 1QV9A 4DLNA 4B8WA 4YYEA 4GYJA 3ZV4A 2Q99A 5E6SA 3WKAA 4Q82A 2X40A 3EZLA 4E07A 4I4LA 1DX6A 4RTMA 3ICVA 4G5FA 2GK4A 2P77A 1A9ZA 2EX0A 3R4VA 5A05A 4DDMA 4HZGA 1ZIPA 5FLEX 5FD8A 1STOA 1TKCA 4BCDA 3KS9A 2EFGA 4HDRA 5JCZA 2RI0A 4I0WB 1Y3AA 4IJMA 4NHOA 4F6CA 5A0TA 3RUFA 2XVAA 1SK8A 1RKUA 3PXXA 3R24A 1G21B 1Z33A 3UHPA 3U17A 3GLHA 4MCAA 1U3TA 4ZIRA 1EDBA 2H9IA 2F9LA 1SQ5A 5ECDA 3IERA 2F3SA 3NHZA 1M2FA 1P2BA 3WYBA 1I30A 2VH5R 4FOTA 1U3FA 4MJ3A 4E2ZA 4ZHSA 2XCLA 5JNTA 4FKMA 3Q8WA 2O2YA 4COKA 4XVHA 1SKQA 4GX0A 4C2TA 2FSFA 3A4MA 4GP6A 4FSHA 4I4TA 2V7TA 4M4SA 2X5OA 3OPMA 4KR9A 3G7SA 3VDRA 2JA2A 2VQSA 4RZIA 3K0KA 4V2UA 2FN8A 2IOYA 3ZGLA 4V0MA 3D4PA 1W85A 3M6WA 2JG3A 1K8QA 4Z4GA 2QEQA 3NM4A 5JMOA 4I9NA 4P5PA 1K5PA 1JR3D 3ASYA 2WYUA 2XW6A 3C1OA 2YVLA 1APBA 3AFNA 4Y1FA 3RAGA 1RBQA 2ZDGA 2JBAB 1OBVA 1L5ZA 2H57A 2J1LA 5KTSA 3R6GA 2XDYA 1PHRA 1SIOA 2WWHA 3LGXA 5CFRA 1TAHA 4F91B 1JKFA 3PFCA 1EP9A 1GCOA 2QIOA 1ZH4A 3NNDA 2AJCA 5KTRA 1Q17A 3A4VA 5KTKA 4Q9DA 1NQWA 1IJKA 4CT5A 1W48A 4WDRA 2J3LA 1WE2A 1HYBA 1A27A 1Y5IA 2VDMB 3W77A 3C5CA 4CMAA 5J47A 2J0UA 1XEWY 3D3JA 3JQ7A 1G7CA 2AC7A 2G1UA 1L7QA 6LDHA 3IVGA 1EVJA 1DRJA 3AVOA 1T8TA 1WXFA 2ROQA 4U9UA 1MVLA 1A50B 4I55B 4N54A 5H9VA 5KSWB 4UJ3A 2VJNA 1EM8A 3N2GA 3R44A 4WJLA 3DMTA 3TDMA 1A9XA 4D4KA 3P0RA 2GX6A 3C3WA 3KZVA 3L40A 2NU8B 3X1KA 2QYOA 3PB3A 4A03A 5A4IS 3H7IA 1JQBA 2FEXA 3ILYA 4Z9AA 1PVVA 1NRWA 4MYDA 3VMFA 1GTRA 2QG6A 1BIFA 1PWHA 2NXJA 2X0JA 2YZ7A 1IBLB 2NG1A 4UZSA 2I4MA 3BWMA 4C2BA 3O9VA 5EUMA 1XZKA 2VSNA 4IOJA 3L1JA 1TJ3A 1VKNA 3HR8A 4IHKA 1DCMA 3EQ8A 4UAJA 3PRHA 3EMDA 3UB2A 5K03A 3EPJA 2IOFA 4F4DA 4AMYA 5H9WA 4M1ZA 1PR9A 1RKBA 1RAAA 4F4FA 1Q44A 4D44A 2QAGC 3BRCA 3DDOA 4FSXA 1OC4A 2WF7A 4S35A 3RVLA 3AL3A 3LT5A 1THMA 3QUCA 3OCVA 4ZT4A 1U9CA 2C77A 1OTXA 3T7TA 5LPNA 3AUAA 4J7AA 2R44A 4KK3A 2A35A 4AP6A 4FGLA 3PUHA 5C5CA 3D6NB 3DNFA 2X77A 4AKHA 3LUCA 5JCOA 2JAOA 5TPZD 1BN7A 1WF6A 3I45A 1XCLA 4DSZA 2C4HA 2FFAA 1QG0A 3CNNA 2K5UA 3S6JA 3T38A 1MO2A 3VYTB 1L5HB 4R3UC 4BN4A 3OCXA 4YB8A 3UJPA 3K0CA 4JGGA 4QJ4A 1WZEA 2A78A 2GPJA 4X1OA 3UJAA 4CMIA 1V5FA 4CIDA 4N3AA 4XLTA 1CFZA 2IT1A 4EA6A 2IBTA 5JNWA 3PLRA 4DA0A 3JQ9A 4Q3OA 4BEVA 4KPFC 1VTKA 3TSCA 2PWBA 2VQDA 4IWYA 3BFJA 1NRXA 1RQ7A 1VXOA 1QYRA 3ZE9A 4AZ0A 5PGMA 3PQ8A 1KO4A 2A6PA 1CB7A 3I5AA 5KOJA 3L6CA 4IV0A 4LSMA 1N2CA 2VHWA 1JIUA 3TZQA 3O93A 4M0KA 2MCFA 4CETA 1CY2A 3DOOA 1F4LA 2O57A 3PGLA 1NLUA 1GXSB 2K6GA 4DCSA 1NW9B 3DAPA 3PQ3A 1Z56C 2UUOA 3R7FA 2FGJA 2ZB3A 4X20A 4XB2A 5HRUA 4HH1A 4KU4A 3QVJA 4RXMA 5GJVC 4YRGA 1BX1A 1JNYA 1NBIA 1W73A 4Q4JA 4R1UA 4HSGA 4RCZA 3JASB 4YRFA 1E6MA 1YZHA 4M0CA 1JKJA 1WW3A 3LCRA 1DOZA 5EMHA 2H2GA 2H4JA 3V4LA 5CB4A 5L6MB 5C0OE 4GQBA 4OX9Y 1VJDA 1R12A 1CRLA 1LLUA 1ZVJA 2RSLA 2YJTD 2BGLA 1EBFA 2PS9A 1M7HA 4UEKA 3KB1A 1RPJA 3CLRC 3IP7A 2OA0A 4F5ZA 1ZCJA 3LUDA 3HKEB 4B6FA 2LIVA 3TTXA 2E49A 1T6NA 4FYMA 5DVZA 4ZMRA 1TLFA 1UFOA 3MWEB 4OF4A 3IKJA 3IAUA 3VU8A 4JJ7A 3OQ1A 2FOLA 2AG6A 1FFBA 2PX6A 1HT1E 4M2LA 4PX9A 4RA6A 3PNVA 2W6OA 2O8CB 4M89A 5JO9A 5ALTA 1LS1A 1EZZA 1IN6A 4TL8A 4DLVA 5AD1A 3QELB 3M7IA 1CCWA 1I9CA 2C2MA 4B6QA 4RZSA 4NCAA 3UV6A 2D7CA 2VPPA 4TV8B 1GY8A 1UEIA 2XODA 3BJMA 1P7PA 4L8WB 4L72A 5JZBA 3GW8A 2CXXA 4LQLA 4RGBA 4D8YA 2CV0A 3IP5A 2ODAA 5EQDA 1E3EA 1XZMA 4YAJA 4OK3A 3WGQA 1YC2A 3OTQA 5JPCA 2RKWA 4JLAA 4MVYA 5LYJF 1KYQA 4G0VA 3A9UA 4GC5A 5IX8A 1QYXA 2CJYA 3MMNA 3LYHA 4LHYA 1SKYB 1OV6A 1QRUA 4HNAB 4M22A 1U98A 4C01A 5J4YA 5K0GA 5J43A 3OP4A 3COJA 4RX1A 1OAOA 1CUDA 1PZNA 1W5TA 3AG5A 4GKBA 2DHRA 3T8YA 3VO8A 1MO5A 3R5SA 4AQ7A 2OGUA 3I2GA 4S1TA 3ISJA 1V7ZA 1Z18A 3TB6A 3VOTA 4ZGGA 4WK6A 1F2UB 3BRWD 5AOVA 3COVA 4BRZA 1TADA 3JWJA 3OZXA 4YMSA 2ST1A 4CMHA 2A0YA 2ZRNA 1NBME 3LVQE 4YP9A 2CNOA 2VJQA 4R7ZA 3BEOA 2PIAA 2YZ2A 2QDXA 4UFOA 1OFIA 2SKDA 2YDXA 3TEMA 3PCRB 1HL7A 2SCUA 3EZ6A 3KV3O 2BIFA 1YKGA 2AB0A 4YDRA 3F5DA 5E6RA 1WLYA 2V9PA 3KPWA 2XPCA 4LK3A 1YB5A 5J2UB 2AZ4A 1D1PA 1LBTA 3PUIA 4B34A 3RVPA 1KMHB 4MUGA 1T9DA 2GCOB 3JQQA 4AROA 1KAOA 5IAKA 4ECEA 2BMAA 3UVEA 4NCBA 3LLUA 3IT1A 4FXOA 4WLFA 3CF4G 1E2UA 3EEYA 2IYSA 2Q3FA 3C5WP 3R6WA 2CFSA 1NT2A 1T6ZA 3A7DA 4BP3A 4F6LA 3F6PA 3HDQA 3R7WA 1B42A 2PWYA 2C57A 4FFVA 5JXHA 4DKJA 1VG1A 1TW2A 3OZGA 4DG5A 2ZJ3A 2ZTHA 1EKXA 1MA3A 1YZQA 5TMPA 1CS0A 1JQ5A 3W3AA 4YGXB 4MUKA 5GV8A 3LUBA 3WGVA 4A36A 2X8BA 1TEZA 1KKMA 3KQMA 3AUJB 2FG6C 2ZPAA 4PTZA 1QG6A 4RF5A 3STXA 4AJ9A 4HZUA 4POAA 2E7ZA 2GBGA 3D81A 4NJEB 4YJGA 4RMJA 3H83A 1FU7A 1CK4A 1WPXA 2ICAA 3HKDB 1QH1A 3KPVA 2R1UA 1RJFA 4J4TA 4TMXA 4IDCA 4FZ5A 3KOZA 1UCFA 1UP7A 3IURA 3O21A 4FYYA 3CWCA 4Y7DA 1NTOA 4ZQEA 2BJWA 2OBMA 1XD8A 3TMYA 3MJEA 3IQWA 2RJNA 1LY1A 3ESYA 3TLAA 2C07A 2G9ZA 2B94A 1LZLA 1IZ8A 2PKXA 2TMGA 2UAGA 3I3OA 4MQFA 3VO9A 1WPRA 3LV8A 2BF4A 2FPUA 3NYQA 4GLJA 4GLLA 4RVHA 1UQRA 1W2HA 4YLGA 4L9WA 5AW7A 3G13A 4X8OA 3RRZA 5EYPA 1SVWA 1U7HA 3B1YA 3OJFA 4KQKA 2JVIA 4I6GA 1TIBA 3QI7A 5AKJA 1AK2A 3B85A 3WRXC 3UC5A 4C0BA 1P7WA 2D1RA 4QG3A 1G5QA 4ZGWA 2IEBA 2XMPA 2CY0A 3DHNA 3G2NA 4HADA 1PVDA 1YJ5A 2P9QA 3M6AA 1SOMA 1NVEA 2J4CA 1DAPA 2W6MA 4OJKA 1MT0A 4BNZA 3B48A 3GG2A 1LUAA 2IP1A 2DBVO 4LF6B 4M8LA 2Q1TA 4U2CA 1U8AA 5FFNA 4P93A 5EVCA 1QIMA 1U1FA 1C1DA 1VQ1A 2FA9A 4KI0A 4WXHA 2O4UX 1W36C 3EF3A 4EB6A 3ZHBA 4PQEA 1U9ZA 4UATA 3HVRA 4NK5A 4Z6KA 1YRBA 3JWEA 2B8JA 2R8BA 5ESXA 5AW5A 4YLYA 2D1QA 2X3FA 5C52B 4OQFA 4EY8A 1UK6A 2CNNA 4B3JA 5JDIA 3LM8A 2B34A 1IU9A 3ET4A 3JWHA 3FGZA 1JVBA 3WGKA 3UXMA 3I2KA 2A3RA 3WLHA 1EIWA 3DMYA 3PHHA 5KTNA 3KJZA 3A1EA 4C0SA 3G2KA 4Q7KA 4CU5A 1F0PA 4GXRA 2P3SA 3D7LA 5BV8A 1MR3F 1BH2A 4QWWA 2XDQB 3DEZA 4RJTA 2PMKA 1Z0SA 1RHUA 4N7JA 3QUQA 2BFWA 2R5NA 2QN9A 3UANA 1RKVA 3EAQA 1B4DA 5DNDA 3SXJA 4QHSA 3C98A 3JYNA 4AI6A 4S1PA 5A4DA 3GVPA 1T5HX 3SFVA 3WK7A 1I3MA 1YRWA 2FQQA 2ZJ1A 1ZJ5A 1COZA 3FFXA 3HP1A 3B9PA 5IM5A 4BVJA 2CLCX 2J9GA 1QP0A 3N8NA 3MLAA 3P9XA 4PLZA 2VJDA 5KYYB 3PJGA 1NW4A 3BORA 3EUAA 5DNVA 4HNVA 1JLMA 5JNSA 2J46A 3WWPA 3T0FA 4IGAA 2PZGA 3H2SA 3LT0A 3WA7A 3ZKWA 1ZUD1 3W6ZA 4WN3A 1NE2A 1RAGA 4LFAB 3NTXA 1EGMB 2QRZA 2HA4A 2BGGA 3AETB 3CIOA 3NBAA 2C1EA 5HQ3A 1E8DA 1YB1A 2OMEA 3HA3A 4L3OA 2I67A 4A0FA 4C08A 4XYEA 5FO1A 2XSZD 5DTEA 3TI7A 1T1SA 3E5MA 1UKBA 3EDYA 4LX8A 1DWPA 3LKBA 2IS4A 1LX6A 5AUQA 5M04A 1UZUA 5E1OA 2Q4TA 4RENA 3EGEA 4TXLA 2RJOA 1P9RA 3IMFA 3GEIA 1UAYA 5DYIA 3V4SA 2ZT6A 4I3GA 1J56A 3D5TA 2ZWPA 3PQ4A 3ADKA 4BLQA 3MOIA 5I4CA 4PRYA 2LKCA 4HGQA 4CM3A 4LGCA 2AI1A 3W5DA 4OP2A 3KE8A 4F2WA 1R0RE 5TVKA 1E5LA 2I2CA 4LXXA 3SIPA 1U0OC 1AHPA 1FYWA 2B8NA 3JQBC 1VL6A 1OLUB 1NAHA 4L8GA 4M1WA 2WTNA 1KI9A 1AHIA 3AX6A 4NDNE 5C7IO 3RGGA 4HB3A 3N1UA 3KC2A 4OQYA 2ZKIA 4MLZA 4BBJA 2FE4A 3NTVA 4ESVA 4BNGA 2RH5A 3A1TA 1C30A 3OQ6A 1NA5A 3W3ZB 1JEAA 2QDKA 3FPJA 2VHQA 5TVGA 1B8PA 1H66A 1JFLA 1WOMA 3AZPA 4JOQA 4U5QA 4G1BA 3W1WA 5JQGF 1KDOA 3WAKA 3IKLA 4INJA 3L8EA 3RYHA 1G41A 2IY8A 3KJGA 1IONA 2QUKA 1WB5A 4EI7A 5LFAA 3U3OA 2MSLA 2C5LA 1JWAB 3OKPA 3Q72A 3B1FA 3FGPA 4AD8A 4C87A 3R5FA 3MXOA 4HWTA 3S3TA 2O8FB 5KTPA 1P2SA 1F1BA 1AQIA 1V8FA 1CDEA 1SBYA 1X8XA 2R84A 1C1YA 2PUJA 3BERA 3L1UA 3PSHA 5SZJA 3WGUA 4ER6A 5AM4A 5DNCA 1IWPB 5K6RA 4DV7B 1R5NA 1OYYA 4DILA 1LPBB 3VJMA 4J29A 2GARA 5AP9A 2JLSA 2CGEA 1J2EA 1EVYA 1FP7A 2FP4A 2PRKA 2Y66A 1HQCA 4MHSA 3ZV6A 1SCBA 2RGRA 1VLLA 1QSGA 5HP4A 3V8BA 1ADJA 3KFXA 1J99A 4DIUA 1W76A 4D8XA 4RVSA 4EEKA 2ZVDA 4JGIA 5AKGA 2OO7A 3AVPA 3Q7EA 3ZE1B 1ZRHA 1VP3A 3WYGA 4FN4A 4JXKA 1RBZA 2JI6A 2VT3A 5JCJA 3PU6A 4JY7A 1IOLA 1K5DA 1ONNA 1RSZA 3ZU3A 3THYA 3RVOA 4GR9A 1E3QA 5ER9A 2F67A 4KXWA 4RFSB 1E3TA 5FOVA 4EDHA 1YK0A 2AOUA 2WSMA 1EUYA 2XIQA 3FKSD 4Q37A 2GEKA 4ZJPA 3CU5A 5AVJA 3OTWA 5COQA 3OQMA 3W4JA 1RS0A 1ZYUA 1MB9A 3BL5A 3P96A 4HZIA 4GZ5A 3B70A 4FXPA 2GT1A 4MZXA 2EFYA 2LVBA 1WHTA 3PWSA 3QMPA 4OXYA 1H9AA 4WKBA 2J3KA 3OIUA 4OFBA 1HE3A 1WPGA 2VHYA 3OZ7A 3AP1A 3O3NB 4NFHA 3UJHA 4LXYA 4D92A 3O75A 2FX5A 4XX1A 1R16A 5FI1B 4G0QA 4Z4EA 4PX2A 5EE0A 5B36A 4UXJA 3HSYA 2X4LA 3V4PB 3FWHA 4IHJB 4Y1EA 2OKCA 3DFKA 4Q4CA 5DTIA 4I19A 3G9ZA 1O08A 3GAZA 3RJTA 3GNLA 1TRHA 3QKRA 4RQTA 4IQ4A 5E95A 2A7QA 4QUKA 1CQIB 2QRVA 4RJKA 4G0YA 4XE5A 5HTOA 1E18A 5HKBA 2HA3A 3Q7RA 3QBEA 2FZEA 3M34A 2OCYC 2QX4A 4GOOD 2B20A 4QQKA 4MCIA 1YI1A 5CVEA 5AO9A 2VWGA 2D00A 4A3SA 4B76A 6Q21A 2V3CC 2HWYA 3PXGA 3EXEA 2RH4A 3N0TA 4QUEA 4U6SA 2HWKA 1KNXA 1S3SA 1ZXBA 2Q5LA 3ASVA 3WFIA 2VSFA 3K5WA 3MUNA 3FDJA 1U04A 3AESA 3TJMA 3G02A 4IJKA 1IOZA 1JFFA 1P8JA 2QLLA 3L8CA 1FQWA 5BSUA 5AI4A 2CFRA 3TAHA 2HMWA 2REQB 4X41A 1AE1A 5F33A 2HSWA 4UFPA 2V7QA 1Z37A 3UJCA 1FVOA 1E5XA 2ZJFA 5ECYA 3K35A 5AOCA 3ZU5A 1TEHA 3A1FA 4FINA 3RBXA 5IHPA 4BX0A 5L51A 5CCBA 1YGYA 3FVVA 4MR8A 4MS1A 2GPYA 4X1IA 3UKJA 4CF4A 1ZMBA 5JMWA 5LXTA 5GY7A 3ZU4A 1L4UA 2Q5JA 3WLAA 4K7JA 3QG1A 1M67A 1LSOA 4UTOA 3ZZTA 1XP5A 3S2YA 4XWOA 2Q28A 4CJXA 2CUNA 2QL5A 2F4VB 1WL8A 2EATA 4K81B 4OXIA 4UHDA 3EXHB 1PJRA 4KN6A 1JHXA 1PTJC 3CO5A 3EQZA 3WG9A 3CN9A 1KI4A 1X7ZB 3A9SA 4MRMB 2A9VA 1O9BA 2I6XA 4ZYWA 1XYYA 1SAYA 2XUJA 2SHKA 1AZTA 3JD4A 2OWDA 1PJCA 4BLOA 1J8FA 2VPQA 2OXTA 1E4EB 2X0EA 1KIAA 1D5WA 1OWNA 4KFUA 4PZDA 2JHPA 2XYRA 3IMKA 1PZXA 1L1QA 4O4HF 1KORA 4PY2A 1GSIA 4LE2A 1UJ5A 3EE6A 1KSHA 2Q41A 3HWX1 5HE8A 3T12A 3PNMA 3HJCA 1Y3BE 3V1NA 2DXIA 3HFRA 1NXOA 1SRQA 1PX2A 1SUBA 4FFDA 4TWRA 4A8PA 1WSBA 4YRZA 3QF4A 5LYJB 3DR5A 1K6XA 2DKFA 1Z8FA 1GZ7A 2GVNA 4O02B 3FFWA 3E7XA 3D6MA 4ZO7A 5L40A 3KD3A 1ABBA 4LV6A 4DAEA 4L0CA 1NQXA 1E9SA 3M5CA 4IDFA 4B46A 1XVLA 2PMFA 4MAAA 2JGKA 2JHCA 1PNVA 4AKGA 4CMCA 2GBCA 1JSXA 2JAWA 1UXIA 5DLQC 3MINA 5F9FA 2W2LD 1XLTA 5CB4F 4PBTA 3ZJUA 1E89A 2HZ7A 1RQLA 4I1IA 1LPAB 2NADA 1JEYB 4MP3A 4GBJA 3RC9A 1DLIA 1I2DA 4KPUB 4V3CA 4MPDA 1R50A 3DE3X 3PUYA 4C4TA 3LPNA 1FRNA 4H7FA 4MUXA 1SIBE 3HR4A 1MJFA 4ALJA 1IOWA 3PQEA 3G2MA 3BH6A 3B2NA 2ZR7A 3VSEA 4CG1A 3QQ5A 2I03A 3RSQA 3WYFA 1ECBA 3KJXA 2FLWA 1KO8A 3G0GA 4P4UA 1LDYA 1KJ8A 1A9QA 1E4VA 1G4AE 2DWQA 3Q5GA 3QLVA 3RC7A 2DZDA 1GL9B 3BS4A 2OHFA 3AHDA 1Z36A 3ENVA 5IANA 4YRPA 1D4AA 1K5GA 2FMHA 3P7MA 4MJLA 1ZW6A 4EY4A 3LX6A 1YR2A 1ENOA 5DB4A 2CB0A 3SJCA 4KGXA 3FFAA 5C8DA 2W58A 1JXOA 3PD0A 3TRFA 5LQMA 3QPVA 4BKRA 2IS1A 4KR0A 1T9CA 1MLDA 3ESCA 1CR6A 1K66A 1FNMA 2WFMA 2ZRBA 3CEPB 1EH5A 2NXNA 3LDUA 3U26A 1FFGA 3FYUA 1YL5A 1WXQA 2WWTA 5EUBA 5J58A 3ZCQA 5JAIA 3UGQA 3JZIA 3QVVA 4JV5B 3ZWCA 7YASA 1RU3A 4MYRA 1AQJA 1RRCA 1C4KA 3D8BA 3OWHA 5TS2A 3RV3A 3KQSA 5D01A 3OP1A 1A4XA 1UR5A 3ZE8A 1XCJA 2I3DA 3FI9A 2JKYA 2B25A 3GK3A 1Q92A 4M0LA 3COWA 2CVFA 4BXOB 2REOA 1NU6A 4OLAA 5CT6A 2VP9A 4M1TA 1P4HA 2LP4Y 2I6GA 1OXUA 4TTTS 1E9EA 3I1FA 4CLXA 1YOBA 1LS6A 2Z56A 4KG7A 1TUBA 2FW1A 3L01A 4K6KA 2HU5A 2XCIA 3WLFA 4CTJA 1XDWA 2UZAA 3FRHA 3D1JA 1V39A 3VHXB 2K7FA 3LDAA 1PJBA 3EH2A 3IP3A 5HFNA 2AX3A 1BCRA 2BFMA 3WSTA 4J2TA 4OBWA 5JO0A 1B73A 1M3SA 3K53A 3A1DA 3UFXA 4AURA 2JARA 1GTMA 1U7ZA 1B8OA 2F1RA 3OF5A 4HRYA 3ABRB 3ZDZB 4CODB 5JNUA 3RTGA 1W88A 3CJRA 2VATA 4TQGA 4O2RA 3IHKA 4PO3X 5BSGA 5KVSA 2O14A 2CFCA 1EE2A 1A8IA 3T3IA 3BG5A 4GOJA 2I2BA 2JCYA 4MOWA 4RHTA 2X5XA 4JGBA 1G98A 1TC1A 5BSKA 5MHTA 4O0MA 1A9RA 3Q5DA 2XZDA 1QIHA 2OO3A 2IP2A 2WHPA 1LPOA 4TKUA 3H17A 3ROEA 1X7GA 1C3XA 4GSYA 2B3TA 2M6RA 1F7VA 1P0CA 4W5JA 3H6GA 1M54A 1CX9B 2C2OA 3BREA 4NPHA 1CUHA 3GLFE 3LMKA 3O3OB 2VDKB 2HKIA 1AO0A 1O4WA 4PC1A 2BPOA 2WKQA 3GDGA 3H84A 3MLEA 2Z2XA 1KK1A 2A67A 1L5KA 4B9EA 4WY2A 1COWD 3PC7A 3DF9A 2XD4A 2NZJA 1HI9A 3PKZA 4PZLA 2DKOA 2FQ1A 2ZSUA 4BEJA 5EUCA 3SMVA 4F84A 3B1VA 3QI2A 2V6MA 2WOJA 4JZYA 5HQJA 5LQAA 3WO1A 4N8DA 2Y0CA 2IGBA 5B1IA 3C3YA 1BYIA 1M34A 3CIFA 3BRSA 3L5OA 4C4YA 3SY8A 4CW7A 3ODPA 2Q8PA 2CN1A 4PZYA 3JU3A 1J39A 4EJFA 1LA2A 1MTOA 2HLDA 1PLKA 1T2UA 1ML3A 4FFBB 3DL2A 1JU9A 3CVUA 4O5AA 4OMDA 4EG0A 1K3FA 1DFGA 3ORHA 3EFHA 4FR0A 4RS3A 1WF3A 4ZYZA 1NMEA 1UBKS 2JFYA 4O6VA 3RS3A 1HTTA 1JU3A 1SA0B 3W78A 1KAHA 2GBLA 4MVJP 1BC5A 1BQ3A 2C2YA 5BN4A 2EJUA 2D6FA 3GJ4A 4ENRA 3ETJA 1UJMA 3PGMA 3N74A 2XF8A 2WBLC 4I1VA 1L5YA 1XZLA 3MRTA 2P2GA 4Y2HA 2GVDC 3ILVA 3DZDA 2V3WA 3PUKA 2AT1A 1RWOA 1ZITA 2O05A 1MFZA 1JR3E 4DMRA 3IAAA 1KYVA 2VYVA 4HDCA 2TMYA 2GZ1A 2UYCA 2XYVA 1ZN8A 1VMKA 1YRQA 4EO9A 4JI1B 4B84A 4ZYVA 1Z9BA 4I6EA 3BTOA 4DLSA 4DV5B 1TPZA 3O3MB 1GRNA 1WV1A 3SEFA 3ZNNA 1BXRA 3H5WA 3PRKE 3ROTA 4MKZA 4A15A 2B1IA 2NTNA 1B76A 4ZARA 3PZRA 4UHHA 2W6PA 4E2FA 1G0OA 5J63A 3QFCA 4RK4A 2B1JA 1LXCA 4IKEA 1E61A 4QYIB 4OK6A 3BXOA 2FSIA 2VOEA 4B2PA 3F0TA 2BYTA 1T8SA 4NEGA 4P5DA 5LZ9A 1WOYA 3F3KA 5ERYA 4YAGA 4FYJA 4JL8A 3WRYA 5HM6A 5A5EA 2QI9C 3JQAA 4LRWA 1J5EB 3BB3A 2ZRLA 3PXBA 4WCFC 1FFYA 1YR7A 5FTKA 4QGGA 2WJJA 3TMAA 2O1EA 1WB4A 2G0NA 2RB4A 4TLMB 1E79D 1OPXA 3WQQA 4M21A 2J3DA 3K8QA 4G09A 4MV0A 1GM5A 5KTMA 2X14A 2QJWA 5CT8A 5E0OA 3LWBA 2CUTA 3SYNA 1I6MA 2ZM6B 5E8JA 2V7BA 4LFBB 1XSEA 3F5SA 5F1PA 2DLDA 3A70A 1CUSA 2P5YA 1PR3A 4KQGA 5CM8B 2BT4A 1ANKA 3G9XA 1YIAA 1X87A 2IW3A 3FPHA 1O6BA 2XD9A 3ISTA 1O9GA 5CHYA 1PNOA 4UNIA 5JQGB 2FEWB 2FPSA 1W5SA 4QU5A 4EJ0A 4DF3A 1S7CA 3RJMA 4IEIA 1WMDA 4Y18A 4TS3A 3VHLB 4MQ5A 5IC6A 3OCUA 4BS9A 2HO4A 3NPMA 1D9XA 1GAEO 1RYFA 4ZXFA 4QPPA 4UDOA 5KCMA 4PYMA 2WFAA 3CUEF 3ELWA 3FWKA 3VR2A 4JJIA 3IOBA 3VGJA 2DWCA 3CXUA 1JIQA 3UMYA 1BVUA 3LQ1A 1HL3A 4TN5A 1CNFA 3BIWA 1CETA 2FGKA 1NGSA 4BUZA 5JZSA 3EVNA 1H2FA 4GAEA 2BE7A 5IVIA 3ZHCA 2W2QA 1G59A 3SDBA 4FJ1A 4AN4A 5LLTA 4QEDA 2EAUA 3UBTA 2IJGX 4CKCA 2E4VA 5IH3A 1ZM9A 2EARA 4HDRB 4ZCQA 4EGSA 3EVDA 3LXMA 4WKCA 3HADA 4Q1VA 1W4BA 1AMNA 2NVWA 221PA 1YZTA 3GJ6A 3ZGNA 2VHTA 3NNNA 2EZ8A 3KLPX 4TTIA 3F3SA 3GLHB 5ETJA 4ZIRB 3OKFA 1FVFA 4IINA 3EMVA 4UNRA 1KNQA 2V5UA 4C6TA 1B74A 2BZ0A 3KQVA 5B57C 3KQQA 3AXSA 1C1XA 1WVIA 4KO4S 3A6EA 4KVZA 3A6KA 3G6WA 4QYSA 5KNCA 2NQ8A 3QVWA 1TD9A 1WCWA 1PZMA 3ZZ1A 3HUEA 3KUDA 4IGIA 1XP8A 4B7ZA 3H8JA 4IO0A 2PS1A 3ITKA 4E5VA 1C4XA 1EE9A 1YAHA 2X86A 4P7BA 4LTMA 4TYWA 3CVYA 2NNLD 1W85B 1A7KA 4IGKA 1EI9A 1YU6A 1XWWA 1B6TA 3W5CA 1QG4A 3HLTA 1YCDA 2KLBA 4K9OA 1HT3A 2OBNA 1BA2A 1SUSA 3GAMA 3ZU2A 5HKKD 2VNSA 1I13A 2YY5A 3A8TA 4WNIA 1GQOA 4D4LA 1KVUA 4GOMD 3VR4H 1NX6A 1O0BA 2PBZA 4CDRA 2ZUUA 3JWGA 4C29A 1U2DC 4XPIA 1DEAA 4ESEA 1MOPA 1FDSA 2HRQA 3GZNA 2ZTUA 1VA4A 4J76A 2O20A 4N8SA 2ECKA 2X0KA 1Y9DA 2IUYA 3GRZA 5C32A 3HHPA 3CTPA 3HEAA 2Y3IA 5I7FA 2PUBA 2O7NA 5EKUA 4X60A 3HDGA 1CR2A 1YWGO 2G72A 3JQ7B 3LD9A 4U2GA 3H19A 4YRSA 4IUBS 5EXEA 4R2HA 4XLLA 3PK0A 2E89A 3QH4A 3OETA 2PFSA 1WZ2A 4F4CA 4GQIA 4NFLA 3WWEA 1P0PA 2IIPA 3G6KA 3NBKA 3LA6A 3AM3A 1QVZA 1EM8B 1TM5E 3O91A 4EVIA 3N2GB 4XYLA 1CF2O 3WGNA 3BX1A 1JH9A 5TMDA 4MTCA 4Q9LA 1B8NA 1O2DA 3B5EA 4RDXA 2GZHA 2O2SA 2R6R1 3FG9A 6ADHA 3H4MA 4BFCA 4KBYA 1B14A 1Q50A 4LXTA 1OUMA 2DPMA 4PNZA 4CM9A 2XWJI 3AJDA 3WMRA 5LQNA 3I6MA 2H2WA 3A6FA 5ILGA 3PXCX 1JA9A 2VNAA 5K4AA 1HNXB 3ROQA 3MPOA 1GGNA 4F21A 3LDFA 3OSZA 3QMVA 5HDQA 2ZETA 1QIDA 3KAQA 1U81A 4EX6A 2DX7A 3NRCA 1BMTA 1KZ6A 1N34B 1JXAA 4N3CA 4MNTA 1P0FA 3OIGA 3CLSC 2LCFA 4OKIA 3ZE6A 4AY3A 2O3QA 3E82A 3V8PA 1R2QA 5BYKA 4G1CA 5JISA 3RVNA 1GQ2A 1WWKA 5GM1A 1RAFA 1RDFA 3H16A 3G8CA 5DTRA 1C9YA 1YB7A 1AT1A 1T5SA 1E77A 3BGWA 1LDGA 1QVRA 4MW5A 5A02A 3NOOA 1C14A 4E0BA 4XI9A 3NBUA 2GN4A 3HYTA 3HJNA 1UWKA 1F0NA 3N2KA 2Z1MA 1QPBA 4FX2A 1SUWA 5CITA 4O4HB 3UGKA 4MI6A 3QKUA 4IIYA 1RXUA 5E7IA 4M0FA 1YA4A 2LZ0A 3G9QA 3Q2OA 1X15A 3JXEA 4ENSA 5A6SA 1E2GA 1X1EA 1HYHA 1K63A 4R01A 3WNVA 5DCLA 4RNDB 1AXEA 1VZ2A 5D1NA 4ZA2A 1R9MA 2CYBA 1FFDA 1X9GA 4OMUA 4OY3A 4AZ0B 1O9HA 2FJUA 2PRSA 1UFQA 2L0XA 2ZULA 4GOKA 5F5NA 2CE2X 5AW6A 2AE2A 2IEIA 2YUIA 3CVWA 3U1TA 1ONBA 2Q6VA 5IBPA 2C8LA 1NZFA 3G3EA 1WP4A 1YD7A 2IDJA 4GRAA 4UU0A 1JHAA 3WLNA 4Z3OA 1WP9A 1P81A 1THTA 4X20B 3R75A 5BWBA 5F7XA 2Q3DA 1XEWX 3KWMA 4M9CA 2GKOA 2O9JA 1L5GB 3LBIA 1TFRA 1IZ7A 3A7EA 1GGHA 4M99A 3NVKI 2B98A 2I9PA 2JLZA 1JKJB 4R2WA 3ZGVA 5CAEA 3UB3A 5CB4B 1BGWA 2PLRA 4YJKA 3AEXA 4TOIA 3KB6A 4I81A 3IPRA 4PAMA 2P5SA 2I8CA 5AVXA 4A6EA 2VP0A 5K8JB 5CVCA 2Q5FA 1YRYE 3S2UA 4Q02A 2PRIA 2WSIA 4BNFA 1SHKA 1Q1AA 1YRAA 2WAYA 3CJTA 3F7TA 4GXTA 2J5BA 1E6WA 3LVFO 1TIPA 3TD9A 2KQUA 4KE7A 3GD7A 5TGDA 3AHEA 4DQXA 3HP7A 4NNJA 4HUQB 4ZVNA 4EEZA 4QOEA 2R8YA 3C6KA 4MUIA 4MUNA 1QRRA 5ALKA 5C37A 4GG1A 1UZNA 1M6VB 3OD1A 5D87A 3KQUA 5T6MA 5IF9A 2O07A 3OX4A 1Z8NA 1VMDA 4FCWA 3AZQA 4IDGA 5BSMA 5ICEA 1BE0A 2ZXEA 3OZEA 3B78A 2NV6A 1GNTA 3EIUA 5EWMA 3TVYA 3OJXA 4LC9A 2O3UA 1R7RA 2B1QA 5E4JA 2HK6A 4DIOA 1ULBA 4Q9IA 3VZCA 3GLIA 4Q66C 4UHJA 3K9BA 4WLEA 1QKJA 1E3MA 4QFMA 2JKZA 1HE5A 4ZCPA 1ULAA 4CIWA 2ODPA 1V8DA 2Q1XA 1BX0A 3CE6A 3OWXA 5JZ9A 1TL7C 1NT4A 3N5KA 5LKRA 1YQWA 2HFKA 4GKJB 3OPVA 2ACEA 2B7BA 4P38A 4R0NA 4R1PA 4LF7B 3D8RA 3EFOA 1Y63A 2LPMA 3K5IA 3KSUA 3RFXA 4UULA 4OHVA 1JMKC 1USUA 3ZI4A 4YT2A 2HL6A 4OHZA 2AMVA 3L7AA 4ZALA 1W87A 4Q6BA 3T1QA 3GN2A 2PJZA 3IVMA 3EA0A 3P0FA 5DYYA 2AYZA 3E3AA 3P19A 3DM5A 1E3SA 3VDQA 4L8FA 1CYEA 1XQXA 4YO8A 1RPZA 1RWVA 1RRVA 4MITA 4YAWA 2DQ4A 3GG9A 3I1JA 3K1YA 4D9GA 3PRYA 5JQWA 4ENVA 3IQHX 4TX1A 3TLMA 3JD1A 3WLRA 4BMOB 4QBTA 1TJ5A 1YE5A 5DM2A 3ROMA 4OQMA 1IUOA 1DOAA 3BQNB 2FVXA 2JDIA 2XVXA 5LQUA 4B3TB 5KZMB 1QU3A 4EPWA 4E31A 2A7XA 4XJTA 2SCUB 3W9UA 5A03A 2E82A 5E6RB 1GUZA 2HGZA 2BFCA 3OLWA 1WDMA 3H05A 3BUSA 2VUSA 3IX7A 4FYWA 5E2IA 2OBFA 2AZXA 1L7VC 5EERA 2W6CX 2VFAA 1EWVA 3H8VA 3L7NA 4G5RA 3K30A 1GQYA 4MQLA 4UEJA 1GNLA 5EMMA 3ZE0B 3ED1A 4JN6B 4RCVA 4WNAB 4BJ3A 1H42A 5AXBA 5DGDA 1JDZA 2J33A 3AH8A 3WBJA 2BVNA 4W4TA 1DKLA 3NNSA 4PC3A 3O95A 9LDTA 1HLFA 3AEUB 1NUTA 4CL2A 4V1CI 1RR6A 5DXAA 4Z51A 1CS0B 2HSEA 1ZIDA 4K6MA 1U9YA 1OF1A 2H06A 3MT9A 1A71A 5BWLA 4BGUA 3IHLA 2IV2X 5LUBA 2XXAA 4RJJA 1KZ9A 1Q0HA 5CK5A 3NTLA 1DCTA 4HZUB 2FAXA 2ENUA 3LCUA 4JB2A 3KYBA 1N5MA 1Z3IX 2IVFA 3V8NA 3ZWKA 4BQEA 2EW1A 1JB9A 1QB8A 2NXEA 2HCFA 2POQX 4TV9A 4WX2B 5COBA 4QVIA 1QH1B 1Y48E 4OIMA 1R4ZA 1SKMA 1N36B 2PSFA 3FCSB 3NMUF 3ER9A 1NUHA 3G9UA 2DBYA 1IHUA 2Z6QA 2G40A 4WZBA 3VU1A 3STUA 5KJFA 1UM9A 1KO1A 1K0FA 3GCGA 2GPNA 4DSAA 4BO6A 2ZIXA 4OXXA 1MB3A 1NF3A 4LRYA 1S0UA 1MQ9A 2H0QA 5JDCC 1VJTA 2P7HA 4WK4B 1IFXA 1DRWA 1VYHA 2PANA 3RQSA 3QA9A 4TZ6A 1QZ3A 1KYTA 5E3JA 4DCGA 2HQOA 5EYPB 4OHBA 1E58A 2AV6A 1RHKA 5JAHA 3GUHA 3JQBA 5H1YA 4DMFA 1G4HA 2C99A 2J7PA 4A2CA 2M98A 4QNRA 4UNSA 1BS9A 5AXDA 2XGSA 1N1MA 3A6ZA 3BHJA 2VTDA 2HTFA 3PF9A 4KODA 4RK7A 2NP6A 2PUFA 1NNLA 4I8IA 1DI0A 2EW2A 2VWPA 4B3CA 2XB2A 3TL6A 4HJRA 3C85A 2GF2A 3ESDA 4L27A 4LBWA 3ZHYA 3L0IB 4YR7A 1XMIA 2NO5A 3QE9Y 3KKOA 4IIGA 2BN4A 3O47A 1SXIA 5CM2Z 1PL7A 3GOQA 3TLXA 4F86A 1C1DB 1QS0A 2QD5A 2HLNA 2P9JA 3N0XA 3UOWA 1NI5A 5K0EA 4NKRA 1L4EA 4PPYA 4OYHA 2W2OA 1RLMA 3VHRA 3JR7A 4OJYA 2EOAA 4PV7A 4JDUA 4EG7A 3GUCA 4KC0A 4NZOA 3DPIA 3FYTA 4MW4A 5AKZA 4PSUA 4ZU6X 4YJFA 3U5TA 4HY3A 3FHLA 3BAZA 5ANRB 4PPGA 3TUJC 2WYIA 1JDBC 3E1GA 3H5RA 4ZAFA 1I9GA 2F62A 1BJKA 3TVDA 1GQQA 2P9GA 1I4EB 4AF6A 4CCYA 8AT1A 2XGJA 1E96A 4W5QA 4UUAA 3VKUA 1ZUIA 4YV7A 1E2DA 3R7BA 3SIXA 3AJAA 4GPIB 1EFVA 5C8XA 3FDZA 1QFMA 2FWBA 4KH0A 5H02A 1X3LA 1UDWA 2GDJA 1R64A 3F2IA 3ZQ4A 4CF5A 2QP9X 1K3UB 1MQAA 2ZI5A 4TLBA 1HT2E 3IDFA 1XWFA 4O29A 1VPVA 3QIAA 4JITA 2WAAA 4O59O 3J81A 1OZAA 5HQTA 3BF8A 1BYUA 2ZR8A 1DQNA 3DBLA 4DJ5X 3ZKWB 1N2JA 3V80A 5D5PA 4QAJA 3Q3CA 5FTNA 3WADA 3TMKA 1WTAA 1V8BA 1XU4A 2GEBA 1GADO 2YVKA 1Y1PA 3QU2A 4NQZA 3S1AA 1TZMA 3BWXA 3D4IA 5AJYA 1N1EA 2AVNA 2W4MA 1RT9A 1DTEA 4E6EA 3SDSA 3HKCB 2VT2A 3CZMA 4OJMX 4X44A 2HRRA 4RY0A 1F12A 3WLJA 3NV7A 4G07A 1OAAA 4KWHA 3BAFA 1RYYA 2V9ZA 2GFQA 3ANXA 4DFDA 4HN9A 2WM9B 3L77A 4GW3A 4L7VA 4PWZA 2AN3A 3HB5X 4Q24A 2FFQA 3WGIA 3WHLA 3AB7A 3LZCA 5K0LA 4F4JA 1VJGA 4ZVUA 3O8RA 4PGGA 1U65A 1CVRA 2WMYA 3PF8A 1RRFA 1J0BA 3LQ2A 4GI3A 2JIZD 4V02A 1JFTA 4BP8A 2RCYA 3WNBA 4F1KA 4S1VA 4A92A 2VF7A 3TLEA 5AI6A 5CIYA 3QY9A 1BJTA 3RLIA 4DDTA 4IVRA 3H2GA 5CTJA 5CW1A 3E48A 4PSDA 5KYUA 1CULC 3RTEA 4EIWA 5HRCA 3N87A 2QJOA 2QMYA 1ZD2P 4V38A 5ITWA 2CLOB 1IEVA 3W05A 1U0LA 1HQKA 4OQNA 3DEAA 1RABA 2BFDA 2DQYA 1H5NA 3CG4A 1O6FA 3L6BA 3M9XA 4GMDA 4DKXA 4BX8A 5ARBA 4CLRA 4Q3LA 3EVGA 1IK4A 2I29A 1JR6A 1JIKA 2Z43A 4GKKB 4L4XA 1C30B 1T4DA 1XZJA 3JD3A 4TS4A 4NYMQ 5AKIA 2IV7A 3GPDG 3INGA 3JTEA 2IXAA 2VQ3A 3IV7A 5HIAA 5BSVA 5HILA 3TX6A 3V4FA 4FB5A 2D3WA 1S3FA 1WCYA 2ENWA 4IFIA 3NQ41 3GZ4A 1ZVVA 3RYHB 2VKTA 4ZD6A 4H1HA 1NPYA 3DAFA 3ZIDA 5BUQA 1RYHA 4M0PA 1JF8A 1HLDA 3ES9A 1UJ6A 3W6UA 4C20A 2VK2A 2CHEA 4BIMA 1FNDA 1PW7A 3KEMA 4MLCA 4RTNA 1NR1A 3CSUA 2EGUA 2HMSA 3HU1A 1Z29A 5BWMA 1M1YB 1VLMA 4H59A 3AEZA 5CDFE 5B53A 3WTCA 3OQVA 3ZHUA 4DA6A 4OL0A 2ZRMA 2E4UA 3I9JA 2IBSA 3E61A 3K2QA 4YMUA 4ZAXA 4PYQA 2NVUB 3T4PA 2C9ZA 1U3CA 1YASA 5L95A 3IPYA 1YZYA 3O4FA 5DOZA 2H7XA 3WIVA 2FP4B 4R6WA 3TE6A 1QQBA 3CRVA 1E2QA 1UM8A 4MEBA 3H5LA 4QULA 4ES6A 2C9OA 4B3SB 3ZDCA 1LLCA 1LRJA 1XKQA 3RK1A 3IALA 4FFLA 4XM0A 2FYTA 5CVTA 1FQKA 4F2HA 1ZK3A 4WOBA 3MD9A 4ZYTA 1LI5A 3OIFA 5IYZA 4U39A 2NO9A 3TL3A 4JQYA 1JIIA 3FUTA 1GCUA 3QVUA 2ZYUX 4R1LA 4YWJA 5TGTA 1EVIA 1RQRA 1DQPA 4MMZB 4YQYA 3RFFA 4RVDA 4OX9B 4BYGA 4DCVA 3MGBA 1CUUA 4NOJA 2NZYA 1CUWA 3GWGA 4NNOA 3THYB 5DGIA 3R3WA 4B6SA 5DP1A 4GOND 1P3JA 4FKZA 1YULA 3KUKA 3I9LA 2FPWA 1H5UA 3MMZA 4L5IA 4M55A 4MUFA 1Q77A 3E3NA 4KXMA 2CUKA 3M9WA 4KXLA 1PDVA 5KHOC 3WYEA 3BN3A 3SQNA 4G41A 3UMCA 3A3OA 5IBCA 2JC3A 2F3RA 5AH0A 3GL9A 1EFRA 2OY0A 3GP5A 1T9HA 4DRZA 2ILVA 1SBHA 1UZAA 3MWLA 4I1UA 4F92B 1ESZA 1V9LA 4H6WA 5FQOA 3ZY2A 4DNQA 1KOGA 4HAIA 2QTAA 4QBKA 4D6XA 4QVKA 3T1NA 1OGYA 2M32A 5CVVA 2P8JA 3KPUA 3CURA 5KTOA 2EWMA 1L3CA 2PT9A 2X4DA 4A5OA 1JR4A 4AUEA 3I62A 1ZVKA 1EUQA 4TRNA 2GA8A 3QHAA 4Q16A 2ZOSA 3QKRB 2OFFA 4LJAA 3CHYA 4PYJA 2ZCVA 5T4FA 1VLJA 4M7RA 2Z8XA 1LW7A 3OEWA 3PJFA 1QZZA 3ISVA 4QNMA 2VK1A 1UP4A 1GIAA 2V0GA 3BXEA 3FDIA 1TCCA 1S3IA 4HDQB 1S2MA 1V1JA 1JB1A 3OIWA 2WIJA 4DJEC 1GILA 4XCQA 1C50A 1AZLA 1GAJA 4G23A 4INZA 1P91A 4YAOA 4WMLA 3AESB 2XB9A 3R9KA 3W3AD 1PZGA 5B4VA 1J70A 1JFFB 3SJBA 4DBZA 5JYEA 1VSVA 1WCXA 2XCRB 4LWQA 4BRWA 1KXJA 1AD2A 4MSUA 1BE1A 5LB4A 2Z3WA 4N5MA 2APJA 1SOWA 3D3EA 3OECA 4HOYA 1A8QA 2FZ5A 4NH0A 3VZBA 1MOQA 3EBLA 4US2R 4KQMA 1PS8A 5JI3E 1SVIA 3VZSA 1HH4A 3F6RA 4GMFA 1NRJB 4MS1B 2VTKA 4WNCA 4X1IB 1HDOA 1MG0A 1FTGA 1KKUA 3C7DB 5DH9A 4N12A 3FBTA 5HIMA 3QHPA 5CIQA 3FUUA 4FGWA 2IVZA 4PS1A 5JC1A 5JXIA 1CWUA 2MMCA 4WFQA 1RZUA 1W0JD 4Q9KA 4EYQA 5I9IA 3CUUA 3DOIA 1BEZA 3H8WA 4K6FA 2OCKA 2OSVA 1X2EA 4RSRA 3P9YA 3DTNA 1EDZA 5HK9A 1EUDA 1VE5A 6ABPA 5MF6A 1YRLA 2XF2A 1FTQA 2ECPA 3VA7A 1ZJ4A 1TKBA 1AVTA 1D6JA 3G89A 4NI5A 1WUTA 3NDJA 1MENA 1US8B 1YR3A 1YS9A 2ZIAA 3RVQA 4BEBA 2XVYA 2AC2A 1AGPA 2Z5GA 2Q2QA 1P4AA 3LLVA 4L0MA 4NJOA 1EQUA 2QM0A 1N9KA 2ODNA 1X7WB 4F4HA 2AG8A 1GFSA 4YFVA 2DLCX 3T4XA 5CNMA 4L5BA 4S04A 2R8EA 4UUQA 3CLHA 4XWTA 3QF4B 4QASA 4OO3A 1J00A 4OXKA 2XMCA 2ZBVA 4ETNA 2JASA 1IXKA 1NF9A 2YN4A 2AWOA 2HWWA 1IPHA 1GGMA 3K0AA 4FNAA 2JEOA 2H52A 2MOKA 3RU2A 2JIMA 5DWDA 3GPIA 2AK2A 1NW8A 1ZGZA 3KG2A 3H9GA 1QFJA 2W2NA 1E0SA 1IAVA 2IDKA 1ECPA 3LZ6A 1T4CB 4X7RA 5FLYA 3INTA 2FR1A 4NULA 5AK5A 2F59A 1JKIA 3AHFA 4GLBA 4MICA 5T8KC 1I80A 5LOVA 4CGZA 2C0PA 4JJEA 5T57A 4DPKA 4WL0A 4DV4B 1U4OA 3AFGA 2BGUA 5CB6A 1OH5A 2BBSA 2EFHB 3ZEIA 1H8HA 4U3JB 4LMPA 4G63A 3NTOA 5FEMA 1RADA 2RH9B 2ZVJA 4IY1A 5REQA 3ZBPA 4ZO4A 4JLMA 1OI4A 13PKA 1QIKA 4IKPA 2JIPA 1G8FA 1MRNA 4C4OA 3UJBA 3VAZA 3TIFA 1OTYA 2N46A 2AEMA 1X7YA 2PUTA 1B00A 3OCYA 5FFFA 3SF0A 4AF8A 4MMXB 1T0JB 2VTEA 5HGJA 2FU5C 4PIVA 3TH5A 3FBWA 4RZXA 3FTDA 1MH9A 1XJ5A 2YYZA 3KCQA 3CA8A 3FD8A 3HDTA 2YBDA 3PEVA 4G5OA 4IIDA 3FAZA 4YRJA 3D2LA 5E9JA 1JZQA 5EJIA 4N6GA 2BSXA 3TW8A 3I2HA 3S8MA 3LKDA 2P1ZA 1T2NA 1BS2A 2GPAA 2VG8A 1TCUA 5FR1A 4D80A 4JLSA 3FYUB 4CIVA 2GO1A 4AY6A 3OJEA 1E2MA 3DW1X 1CZRA 4IWNA 4C6HA 5K6TA 3VTAA 3MCAA 5K0SA 3AM1A 3FNIA 4ZOQI 3KTAA 2CLIB 1C4OA 1BHJA 2GM3A 2VCYA 4G2TA 4Y3UA 2GK7A 4G3XA 3VJKA 4ZDKA 5JZOA 4MV3A 2H2HA 4NDAA 2XUKA 3KXPA 3EVZA 4PHGA 1A4IA 5B7PA 3QBJA 3W6NA 4KQXA 2JRLA 3OPQA 5CX4A 5KS2A 2J48A 4D0RA 4NZZA 6AT1A 4FT2A 2NU9B 4EEXA 1E1CA 1X8JA 4JJ4A 2HRBA 4J7UA 3D5EA 3VC7A 1N0IA 1AIPA 1YQGA 4WNYA 1R15A 5JAMA 1NXWA 4WCFA 4YS6A 2COKA 3RAPR 1EU1A 3DMDA 4HDKA 4MDEA 5KQPA 2P6UA 3IA2A 4JWTA 4U1RA 1VE9A 3IT2A 3QOWA 4LDPA 1A5ZA 1CT9A 1TXGA 4ID9A 3DSRA 3AVWA 3FB1A 2I8LA 2PT5A 1EK2A 2I3ZA 3DHVA 3DDWA 4MGKR 5T4BA 4BDSA 1IOVA 2A0WA 4MW7A 5FBLB 5JC8A 4I46A 3THRA 2O2XA