1O5TA

Crystal structure of the aminoacylation catalytic fragment of human tryptophanyl-trna synthetase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
378
structure length
378
Chain Sequence
SAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Human Tryptophanyl-tRNA Synthetase Catalytic Fragment
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Tryptophanyl-tRNA synthetase
total genus 128
structure length 378
sequence length 378
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2003-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1o5tA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1o5tA01
1QRTA 3DV2A 4PBTA 1T6ZA 2PZBA 3MXTA 4KPUA 1OWMA 3F3MA 1JIIA 2V0GA 1GTSA 1Q77A 3N2YA 2ZUFA 2A1TS 3H05A 1WZ2A 1Q19A 4ZT6A 3D6UA 2DXIA 1ULHA 5J59A 1NUQA 4NAHA 1EJ2A 4G6ZA 1N2GA 4MVYA 1EFVB 4HJXA 4NX2A 4DDMA 3H9CA 1XJQA 4KR9A 5LFAA 3IVCA 1JZSA 1NP7A 3IOEA 2WB2A 2ZP1A 4U63A 3N05A 1PG0A 1TYAE 1KH3A 2CSXA 3IOCA 3HV0A 3AFHA 4MWBA 1IVSA 3INNA 1QRUA 2CYCA 1N1DA 3IUEA 4YP5A 3Q4GA 1J1UA 1OWPA 3AG5A 3COZA 1NSYA 2JAXA 2E89A 4G5YA 3KFLA 3CVYA 1ZH0A 1O0BA 4NATA 3P0HA 5DB4A 3COYA 2X3FA 1S4MA 5TEWA 4DDHA 3LE8A 3UOWA 2QUIA 1N78A 1O95C 4MUNA 2PXHA 2E21A 4XFDA 1NURA 4ARCA 3U1VA 2YWBA 3HGMA 1M8PA 3UK2A 1N2BA 4X0EA 1VL2A 2HMAA 3ZXSA 1U7DA 1X6VA 3FY4A 1LI5A 3HFJA 4ZT3A 3ZGZA 3FH0A 1YIAA 4MUHA 1IH8A 5TEVA 1IFXA 3H9BA 4EG3A 2J07A 3CVUA 2PFSA 4I6GA 3K9WA 1MAUA 2QUJA 1KORA 1R6UA 1QJCA 3N8HA 4ZCPA 1D2RA 4JZYA 3RBAA 2QTMA 1IQRA 3ND5A 4R0NA 4YP6A 2CV2A 1YUMA 4MW2A 2QUKA 2O8VA 4Q16A 2PIDA 1KAMA 4E1AA 5EKDA 2ZUEA 3AL0C 3X1KA 4MQ6A 3AKZA 1U7XA 3FDXA 1JILA 3UC5A 1JGTA 1N2HA 4ZCTA 2CYBA 1J09A 1MB9A 3UY4A 4CDMA 1NUTA 3CLTC 2GM3A 4KKVA 1O0CA 1H1TA 1KQOA 2Z08A 3IMEA 4EGAA 4CDNA 1WQ3A 3RJZA 5DEOA 1QTQA 4MAFA 4PBSA 2A1UB 2PZ8A 1X8XA 2B7LA 4YBRA 3ND6A 1M83A 1WXIA 2X0KA 2CYAA 4ZT4A 1WQ4A 1YI8A 2NSYA 1GZUA 4GU5A 1PFVA 2IP1A 5KHAA 1IQ0A 1T6YA 2IELA 1R6TA 1OD6A 4ARIA 1JZQA 2D5BA 2JANA 1ZUNA 2WSIA 1RQGA 5FO1A 3S3TA 4AS1A 4MUEA 4MWEA 1KR2A 1GAXA 3TZEA 4DJAA 1NYLA 3FHJA 3MLBA 1PG2A 4AQ7A 1KH1A 1QRSA 2OQ2A 1J1ZA 1JIJA 1F4LA 2E18A 1I6KA 1WXFA 3FOCA 3LOQA 3TQIA 1KKUA 3NBKA 3HMQA 1O96A 4FZJA 2VXOA 3OTWA 3TNJA 2DERA 4OJMX 5IJXA 5TGTA 3ZJUA 1I2DA 5KWVA 1CT9A 2QJOA 3IDFA 1A8HA 1J20A 3I05A 3GUZA 1MRZA 3ND7A 3BL5A 4MVCA 4G5FA 1O97D 2DR2A 4P2BA 3RHSA 2CUZA 1N75A 4RPIA 2A86A 3VRHA 2CFOA 2C5SA 2RD2A 1OBCA 3RK1A 1VBKA 1Q15A 3H97A 1EUQA 1GPMA 5HUHA 3G6KA 1LI7A 3GLVA 4EG4A 1EUYA 4EG8A 2HZ7A 4MW0A 2X1MA 2WQ6A 4EG6A 4EG5A 1JEDA 3QTBA 2EL7A 3AG6A 1SURA 3SZ3A 1KQNA 1NI5A 4KR7A 5BNZA 1N2JA 3JXEA 3CLSD 3NBAA 3ILVA 1XNHA 2RE8A 1QQTA 1XNJA 5JBNA 2QJTA 3Q12A 3VGJA 4MW4A 4BWVA 1MBZA 2YXNA 1JEEA 4ZT5A 1R6XA 4R2LA 4NDAA 1K4MA 1WXHA 2A7XA 2IJGX 3K32A 4R2MA 3PNYA 1K4KA 4RUKA 5K0SA 3P52A 1H3FA 2I1LA 1OWLA 4EF6A 3IUBA 3QTTA 1MAWA 3FIUA 2VTBA 1KP2A 2JA2A 1VBNA 1PFYA 3FWKA 4WSOA 2DETA 3ELBA 4A91A 4MLPA 2A1UA 1O94D 3AIIA 1JHDA 3IVXA 5H16A 1J21A 1V8FA 4I6EA 3SDBA 2XRYA 1M1ZA 4H3SA 4DE5A 3HL4A 4U8HA 1N2EA 3KT8A 4K03A 5HUJA 3IMGA 1O5TA 1PFWA 2A88A 3RFFA 1N77A 3CLRC 3SP1A 3A04A 3L93A 4DNXA 2DUMA 5HG0A 5AHWA 1GLNA 1P7PA 1NUSA 4J76A 2O5RA 1GN8A 2J08A 1WOYA 4XSVA 1WJGA 2J5BA 4YMIA 1O95D 1O96B 3IMCA 3MLAA 4U7JA 4ZCSA 3SEQA 4HK4A 2X1LA 3CVXA 3KT3A 3IOBA 4GRIA 1G8HA 4L2IA 3CLSC 3OP1A 2EJCA 3UMVA 3Q10A 4CQNA 1V47A 3ZXIA 1NUUA 1Q11A 1IQUA 3FG9A 3HZRA 1ZJWA 3SZGA 4XFJA 4MULA 1U0BB 2GOYA 4MUJA 4MW7A 2H29A 2AZXA 1EFPA 1T6XA 1TYBE 1DNPA 4MUKA 1I6LA 2AG6A 1MJHA 4EG1A 2E0IA 3RK0A 2NZ2A 3E27A 3KT6A 4EG7A 1LW7A 4DLPA 1KAQA 3IVGA 4ZT7A 2DLCX 3G5AA 3P0IA 2DEUA 4ND6A 3ZJTA 1M8GA 1QNFA 4MW6A 3CVWA 1U3DA 2QJFA 4MUFA 4QBTA 1EE1A 5H7XA 3CLTD 2A4MA 1MOPA 1KH2A 4DDKA 1G59A 1YIDA 1JIKA 4S1OA 5TS2A 4KR6A 2HGZA 3CLRD 3TZLA 1ILEA 4OUDB 5J58A 3LCJA 2H2AA 3DLAA 4ZT2A 3VU8A 1I6MA 3M5WA 4ZCQA 3X1MA 2QUHA 4F4HA 4MVWA 3D6VA 2VTBB 4J75A 1GTRA 4JXZA 1HYBA 1XNGA 1H3EA 1IHOA 1QU3A 4KPUB 2OV4A 4I6JA 4MW5A 1WXGA 3CLUD 2Z09A 3SYTA 3CA8A 3QE4A 4WNYA 2XRZA 4QREA 4MUGA 2D13A 1F7UA 4JYZA 4F3RA 2G36A 3PNBA 4PBRA 3P0JA 1ZH6A 1TYDE 1N2IA 1IRXA 1FYDA 1J70A 2TS1A 1OWNA 1FFYA 3CR8A 1EFVA 1MC1A 3MUEA 2Z3VA 1JECA 2V0CA 2BYTA 1PFUA 4TS1A 1Y42X 1M8FA 5LLTA 4UZFA 3A05A 2J4DA 2DPLA 4QRDA 1O6BA 4JXXA 1G8GA 1OWOA 3TS1A 1TEZA 1TFUA 2YY5A 3IH5A 1WY5A 4HPWA 1TQ8A 1VBMA 2CV0A 1OBHA 3H99A 1JMVA 1N2OA 4MUIA 1H3NA 1YUNA 1COZA 1T9GS 4L2IB 4NAUA 3DPIA 3A4IA 2CT8A 1KP3A 4MW9A 4ZCRA 1U3CA 3A2KA 3L92A 2PG3A 3N9IA 4JFAA 4Q93A 2AKEA 3C8ZA 3G59A 1NZJA 5KCMA 1F7VA 1KQPA 1WKBA 4YP7A 3COVA 3DO8A 3ISJA 3NV7A 2BTEA 1G8FA 2D54A 5FO0A 5F23A 1EFPB 3ZUGA 5DK4A 1BS2A 3IODA 1O97C 2A84A 1YULA 2GKSA 2YWCA 4EFKA 1TYCA 3CLUC 4CT0A 3TQOA 1T9GR 4ND7A 3ZIUA 1M8KA 1EXDA 3SEZA 5IHXA 1K92A 4NZPA 1B6TA 4UZEA 3KT0A 4PY2A 2WQ7A 2R5WA 1MB2A 3X1JA 5DASA 4K0RA 2A1TR 4MVXA 3GMIA 4HJRA 3PRHA 3MMXA 1WXEA 2PZAA 1VLHA 3PXUA 3FNRA 1K97A 1N3LA 3FETA 1F9AA 4MW1A 4MWDA 1NUPA 2CV1A 4OUDA 2J09A 5K0TA 5LM3A 5J5AA 3FI0A 2QTRA 3PNVA 1O94C 3COWA 1M8JA 4MWCA 3ZJVA 2QTNA 3CVVA 1QU2A 5FNZA 1UFVA
chains in the Genus database with same CATH superfamily
1D6MA 5ALYA 3KSRA 4E22A 4HGYA 1QORA 2I71A 3H3JA 3KBOA 4RK5A 2GM5A 4LXTA 2PV7A 3MT9A 4DIUA 1MP0A 5CX4A 1C9NA 1WZ2A 3KKQA 3A2MA 2XECA 3KOOA 4J29A 3VKVA 1B00A 3DO5A 1F5NA 3EC1A 1RQNA 1J07A 3MJHA 4JD5A 4Q4LA 4RK0A 3O8RA 1ODJA 4JYBA 2BEUA 2P0YA 3IVRA 1RKVA 3OWOA 3LRXA 3C1AA 3JRXA 1JBEA 1ZI6A 3KNZA 3UH0A 5BN1A 2Y1OA 4MTLA 1UP6A 2ZBFA 3AHEA 1C4OA 4I1SA 5KEIA 3LGSA 4ZYZA 2V74B 2NT3A 1VZ3A 3N28A 1XU7A 1A9YA 5E1MA 1TMOA 3BCHA 2FN9A 1XZQA 4HDAA 1EFDN 1W4RA 1MVLA 3DYIA 4XARA 4D99A 1ZU5A 5EWMA 5EINA 1XX6A 3ZHVA 1YRHA 3IHWA 3ZDEA 4EPTA 1AQYA 4KVFA 1X7YA 4NONA 5EIWA 4W8HA 5JSKA 3FCCA 3FBTA 2X6TA 5T3YA 2XYHA 5FORA 4DLZA 1U99A 5EUMA 3HR4A 3O92A 1SZJG 3RVMA 3H2ZA 4YRLA 1QGUB 3K4QA 3I5XA 1ZH0A 1ICEA 3HZHA 2CJWB 1QB7A 3UOAB 4IGEA 1NNUA 3V8QA 1DJOA 4AKEA 1G8YA 4L4ZA 4ESVA 4RXTA 2PKCA 1DG3A 3RSSA 2G5CA 1QK3A 4OSEA 1NC3A 1E2GA 1KSFX 3HGTA 2N47A 1MKYA 3FYSA 3LX4A 4FYMA 2VNAA 1UBMS 3TX2A 5BVHB 1U2QA 3NWPA 1EG2A 4MQFB 4FBLA 1A88A 3ZXSA 3AP1A 4KQIA 4TKVA 3BPSA 4JKYA 5HKKA 2OVBA 5B37A 3GQBB 4ZT3A 3WYNA 3ZCQA 4I1YA 2VHUA 1AA9A 1NZFA 3IPYA 5B6IA 1J8VA 3WOVA 2EKPA 4QG3A 4OPMA 5JZOA 2FLKA 2C2WA 2ZRHA 5AUNB 4BNUA 5LD2B 4NU8X 4WLNA 3G2HA 3KYJB 3RUAA 3S0JA 4TQUS 4BAUA 1XYGA 1NONA 1XP5A 3PT9A 3DFKA 1DAOA 4I46A 5LP1A 1JFFA 1WPGA 1O9HA 2CJFA 2J0VA 2QUJA 1ZWKA 2ZT8A 4TLDA 4WOKA 5AKYA 2ZR8A 5JFOA 1TGYA 4E88A 4NRDA 3RADC 2HI0A 5I9BA 3FDIA 1U7PA 1GITA 3RBAA 5AI4A 2Y1EA 3CLVA 4BU0A 2WJAA 5ALNA 1RWXA 1XMXA 5KNDH 2PS0A 3GFBA 4P92A 5AUPB 2QUKA 2KX7A 4WKOA 2OFFA 4AUMA 2M6LA 2GPBA 3R7LA 3W0LB 1X92A 3F9RA 4J0KA 3TCKA 5LMUB 2VEDA 3O31A 1P73A 3ZC3A 4BFVA 1LTHR 1GVNB 1JDJA 2ZRDA 1KJ9A 3PFKA 4K81B 5FQOA 5JSUA 1XEWY 4NG4A 3TRDA 4OMUA 1JILA 1Z6PA 3N58A 2CYBA 1J09A 1MB9A 1XZJA 1Y80A 2GFIA 4CDMA 1M2NA 3MT8A 2OZLA 4LMAA 3R3ZA 3IR7A 3WKEA 5BY2A 2BGKA 2YINC 3IMEA 4XB2A 4ECAA 2REQB 1E3LA 5G2OA 5GAJA 2QMUA 2BTQB 3PHCA 1A4UA 1CRWG 2WJHA 4ZO7A 2BUBA 2P6UA 1WQ3A 3E9CA 1ECGA 3VPFA 2C07A 4DLWA 2FH5B 4O4IB 2YFKA 3B3FA 2R2GA 2A5JA 2NG1A 5FL3A 5C5DA 4DB4A 2UAGA 4IIBA 1YFZA 1TK9A 3RSLA 1DEKA 3PGKA 3UV3A 3OOJA 1C1XA 2O2CA 1ZH8A 2A5DA 4TKUB 4XYMA 4ISBA 1DXHA 1PFVA 3PJRA 5L3QA 2ZCJA 1T6YA 2XWSA 4TXMA 2GEVA 4OMDA 1U0NA 1K5PA 5FH9A 2P62A 3JQAB 2VL7A 3QJGA 4MUEA 3OFNA 3UB2A 3F78A 1RZVA 2ZJAA 3KZOA 2BGLA 3E2PA 4DM3A 1L8OA 2XB9A 4KXFB 2FN8A 3DMDA 5CA0F 3RSZA 1ZGBA 4KQHA 3TL3A 2W2NA 1N1GA 2CVPA 2RH8A 4JY7A 2H63A 1SQSA 2IDKA 4Q1DA 4BTVA 2IZ5A 2F55A 3HKDA 4Q7KA 3JR3A 3ZI7A 4PLPA 1BYUA 3D8UA 3TW0A 3ELYA 1US8B 4XWOA 2PPLA 2YHAA 2UYYA 1Y9EA 3AILA 2JNWA 3ER9A 2EFDB 3T5MA 5BRNA 4LRXA 1VL1A 1NBIA 2CDNA 4ZQBA 5KX5B 3IP8A 3R7AA 2REBA 4EFLA 3S5UA 2JKYA 2PXAA 2ZTMA 3AF0A 3DWGA 5C32A 4CJXA 2YN2A 5LZ2A 2KLBA 5EIBD 2VKQA 3M3HA 2WYOA 4U0JA 4AMBA 4C29A 4P2BA 3DM5A 4YQZA 2I33A 4C3UA 1BE1A 4M4SA 1LLCA 1PS8A 1YKSA 2B5VA 4ND8B 3AOGA 4HQOA 4I55A 4GL2A 5BSVA 1UDRA 4ZQEA 1L5KA 1JI3A 4KMMA 4QJIA 1DDIA 2HHLA 4Y2XA 4CMBA 1CZKA 1II8A 4DCUA 2RAPA 1Z6QA 5IN4A 3GQBA 1NBME 1C3EA 2JFGA 4EG4A 1C1DA 3B12A 5P21A 3W5IA 5K8JB 1BE8A 2QTVB 2NQTA 4ZTZB 1BDMA 1NE2A 2G40A 2I66A 3L0YA 3L8FA 4UHCA 3S99A 4XQCA 3BXHA 5GY7A 3FNHA 4UUBA 1HQDA 2DZDA 3FKSD 1KAGA 2HCRA 3EDCA 3LYUA 1UDAA 3SZLA 2Z57A 5FULA 3LZDA 1U65A 3DMYA 4BNXA 1A82A 1KYTA 2IT1A 2AOVA 1VCIA 3H87A 4C07A 1H66A 3KJHA 4KRGA 4OK3A 4B2PA 2RGCA 3JQGB 4C7VA 3BOSA 4YFVA 2OZPA 2QTGA 1G38A 2VP0A 1E0DA 1HTTA 1I3OA 2WIBA 4QU9A 4IVRA 1C30B 3Q12A 1M2GA 2F48A 2A59A 2Q3CA 3IESA 1NN3A 3TZBA 1OBFO 4II3A 4O4HF 3P0RA 1Q2XA 2VOEA 3CUUA 3OCYA 1NMYA 2VDOB 3UUWA 1Z16A 3SG0A 3I2YX 4DF3A 3L7BA 3NM6B 2W83A 4PNPA 2HWKA 3JQAD 4RMJA 4PPGA 3K32A 4PW0A 5AM1A 3W7BA 3WNDA 2AE1A 2XA1A 4ZQFA 2VQEB 2OORC 4FYHA 4KVZA 5D6NA 3WLOA 3AR6A 3TBKA 5IT4A 1QIEA 3J81A 4NBWA 3K6RA 2HIHA 3AEUA 1F8XA 4LNHA 3QPCA 4FXPA 1V41E 2QD5A 4TXNA 4UASA 5ALPA 4PZUA 5E38A 5DNUA 5CEEA 3G49A 1O94D 3BWYA 1JHDA 3PWSA 1E1NA 4HGQA 4NFYA 5CMLA 5EP3A 4TYYA 1W87A 2OHOA 2QN2A 2RB4A 3HNRA 1IZ0A 4HLCA 4QPDA 4R1NA 1DWPA 3HSYA 4AJ4A 4JI2B 3BIJA 3DM9B 4TKUA 3X1ZA 4EB6B 1I5OA 1HMPA 3JARA 3KJEA 2QZZA 3SZOA 2A33A 3JAKB 1JAIA 2GN0A 1GPBA 5A1TA 4ZOBA 4Z7QB 3ZY3A 4QVKA 3K7EA 2A88A 1DBSA 2YDYA 3RFFA 4V2IA 5LXTF 4E33A 5K05A 3G1WA 4P7BA 2CVZA 5KQGA 5BUZA 1NV8A 3BIOA 2IU0A 3KXPA 5DPMA 3KFVA 5DTRA 4A8JA 1MRNA 4IJ5A 5AKKA 1WHSA 2I65A 4RPKA 1A97A 1IOWA 4LV6A 1REQA 3QU5A 1H0KA 5GJBA 5AVKA 1Z5WA 4F86A 4ID9A 2Q9CA 1ZINA 1GA4A 4FWIB 2C5EA 4LPSA 1DO2A 1A2OA 4HWKA 4C2AA 4PS0A 4B6OA 3MLAA 5CFLA 1CP3A 2R7MA 4V02A 3GP8A 1OY1A 1RJFA 1K6EA 3I04A 5KTRA 3MG9A 4EA8A 1GN9A 1QGED 5LUAA 1NQVA 4Q4JA 5DBOA 2Y0PA 3KVYA 5ICEA 3ODGA 2PRYA 3JWEA 2H1SA 1BXKA 1DJMA 3ROPA 3SVLA 2GETA 3JD1A 4QHSA 4G4SO 3DTVB 2GFQA 1R0RE 2PT9A 2ESRA 4C0JA 5DXJA 1BCSA 1LJUA 2R7KA 1POWA 1WCIA 2PD4A 5FNVA 4DSNA 1M54A 1AA6A 2GZ3A 1T6XA 3HA7A 3WDSA 2OG2A 2QRJA 3GLQA 4MVJH 3U44A 4KTTE 3WIUA 4DBLE 5G0TA 2AG6A 1CYEA 2A57A 1D1TA 1DG9A 4OHOA 1HZJA 3QW2A 2PZMA 3P4YA 5I6DA 1QIHA 3RBZA 4U2KA 4YV2A 1V9SA 2W58A 2YZ7A 2W0MA 4P31A 3UUFA 1OAKA 3DEJA 5EHGA 3SR4A 1KXJA 3H11A 2IXFA 3ZJTA 4MYUA 4OYLA 1Q1NA 5BUSA 5G0WA 3RI3A 3V4SA 2V0NA 3A32A 1L3CA 4GLJA 1XPUA 1A27A 1U3DA 2PUJA 4AX8A 4YCCA 1NXSA 2CHEA 4PCUA 4EITA 1F8YA 1Z5UA 1JVBA 2BHTA 5TSDA 2XMRA 1AV7A 4IDBA 1HKHA 3TQQA 2W2VA 4W1RA 3VC7A 5TS2A 5JNUA 3I0MA 1R0LA 3OOWA 3PK0A 3QLVA 4DLAA 4DLXA 1EG7A 2C2KA 2UYQA 2HJSA 3HP1A 3IS3A 4JIMA 4OHRA 3ZJ4A 1AT1A 1FU7A 2CVFA 1J56A 1H1LB 1ZK4A 2YUIA 3L8DA 1W93A 3VU8A 4EHLA 4EVIA 2FMUA 4NY1A 1AC5A 1AQNA 4E30A 1G66A 1Z4OA 1SBNE 2A9RA 2OILA 2QAGC 2I6FA 3UICA 3JQCA 5JAOA 1GTRA 1RE0A 3EEYA 4J4HA 2CE2X 3B6MA 5K0JA 2FI1A 1QYDA 4MW5A 1M0WA 4P4LA 1VIMA 4BXOA 1CUJA 3BTUA 5HIMA 2D3TA 5C7LO 4NV0A 3I12A 3AYZB 3EUFA 1IBLB 3VISA 2VTVA 3NDJA 3GXOA 3HO8A 1IEQA 4LZLA 2P68A 3QY0A 1M0EA 4NTZA 3LBAA 1VLJA 3HWWA 4XH9B 4Y0AA 5TQ2B 3HCBA 4AQ7A 4D44A 2BSQA 4D4KA 5KPDA 2ZSAA 1HLFA 3VFDA 3K1AB 3IALA 1YR6A 2OFPA 4H1UA 1SXPA 2D5LA 2R79A 2BTOA 3CR8A 4LYAA 2Y2UA 3RKRA 4P54A 5CLJA 5SY6A 5EIAA 5K3FB 3MGAA 1XTUA 4A0HA 1Y42X 3GUUA 3MK31 1WDMA 2NV0A 3A70A 2GB4A 4LWQA 4MYTA 4R8VA 4AWAA 2IS1A 2XNSA 4FYVA 3VPGA 1GFWA 2GBIA 3K1TA 3LBNA 5L4SA 3DP7A 4LDZA 3M6IA 4BYGA 1TQ8A 4MMZB 1UBGA 2Z1DA 5G3YA 2FAXA 1PFKA 4L50A 1W581 1ISMA 3WMEA 1VBFA 4ENRA 3D0RA 2VDKB 5H4GA 4EKNB 4HBZA 1G3IA 1V71A 3AVTA 1R8SA 4YCLA 4YN3A 2WE7A 4NAUA 5FJJA 2YHUA 3RC2A 5CIYA 2X4IA 4RTNA 3OCUA 1GNTA 3L92A 2CL6X 3HJRA 3R2JA 2Q28A 3PLRA 4Q1FA 4RV5A 4ENTA 1E2IA 2BFBA 1AV6A 2JJ2A 5CA1F 1JKFA 3JVUA 4K7JA 5GOZA 3STXA 2XDWA 4JOCA 5FUYA 4D0SA 3PFHA 3I73A 4RE6A 1J5XA 5D85A 3CH5A 2P9QA 3E53A 3ISJA 4JB2A 4M7WA 3BEDA 4MITA 1BOFA 4NENB 4WZBE 5AKZA 1I0IA 2YJZA 4ZAZA 2O8EB 3SSAA 4DRZA 5BW4A 5C7IO 4H59A 4FNOA 1NKSA 1GLVA 1T2VA 4ZVTA 2IPMA 2V6IA 3I4CA 3ODPA 1HDRA 3V8MA 1WXDA 4B3JA 5I51A 2ZJ4A 3ORFA 4L85A 4DC1A 1QZ3A 3T9DA 3W7VA 1CQXA 5CAEA 3CB4A 4Q3DA 4FYWA 1IY0A 4AIRA 3CQ9A 1G5PA 1SEVA 1WLSA 2CF5A 3I8OA 5CDHA 2HADA 1QG4A 3GD7A 4XOIA 4HNTA 5ITSA 3ENWA 2PUWA 2JHGA 5LPNA 2Q6VA 4GM0A 2PQ6A 2C8KA 2VCYA 3E35A 4C4SA 1K8YB 4NZPA 4JYCA 1ENZA 4NHEA 1KOGA 4BGDA 3AZOA 2FKNA 3KDSE 4UFNA 2DHEA 2V8BA 1Y9ZA 2R7LA 2XUFA 3QITA 2IY7A 4Q7JB 4HRXA 4HJRA 4RMGA 4ZHQA 2OHJA 2X41A 4HFRA 3QBVA 3H2YA 4WV3A 3C5EA 3PXUA 3CF6R 4B32A 1XCPA 3PSHA 3W5JA 1NW4A 4G85A 1DCKA 5ETJA 4JA2A 3BSWA 3INYA 1TPZA 3MHTA 1P1JA 4I4TA 1NDHA 2A4KA 3K0AB 1ODLA 5CNMA 2IZZA 2EJBA 1P74A 2D0PB 1X1DA 5DSZA 5JD3A 3UG6A 3HRIA 1NLZA 1XALA 3PNVA 4KMOA 4KQ2A 1DKQA 4MPJA 4O2LA 3L0ZA 3AEQA 1E1QD 1FNBA 1T8RA 5G0SA 4DJTA 3KPWA 1X42A 1ZHHA 1S7CA 2VHJA 4OYHA 1MT0A 3BFVA 2JCYA 4L8WB 3WFIA 5FUXA 1T36B 5T6MA 2RHRA 2O6LA 2FF7A 3HCRA 3R3VA 1G21E 3DV2A 4RX1A 3WZLA 1W4AA 3ZCTA 4HV4A 2JIBA 1QRTA 1JIIA 1RRVA 3NJ4A 3VPSA 3UENA 3GJSA 5B1SA 4MI6A 4MEBA 3L8MA 2HCFA 2WU3A 4YUWA 3EBOA 2Q2QA 3CE6A 5GV8A 4Z4EA 1PKXA 3MOIA 2FPOA 3DFUA 4D8WA 3KS9A 4NBNA 5IN5A 4LXUA 4BN5A 1DQNA 1UOOA 3U40A 3VPBA 5JCPA 4NAHA 4WN9A 4TM8A 5JATA 5DHPA 4OQFA 3GLTA 4XUCA 4O4JF 1A9OA 3P9NA 1FDUA 1XTVA 1ADGA 3FWZA 4CM9D 2OLJA 4JJFA 1OXUA 5CJJA 2RJNA 1HT0A 4RH0A 4KR9A 1Z75A 1NIPA 2BM8A 5HTOA 4MRNA 1JZSA 3O8CA 2ZRJA 4W6ZA 1GZ7A 1DV2A 4YDQA 5K3OA 2HJVA 3F90A 4KQ1A 2VP4A 3R5FA 4DIEA 3IEMA 2KHZA 2ZTSA 4GYJA 1Q20A 4AZ0B 1TIBA 5IDYA 4O8ZA 1K08A 5J43A 4KR2A 4YP5A 2GPNA 1AUOA 4MV4A 1BAPA 3K2EA 2IYXA 1DFGA 1J1UA 1ULUA 2O23A 2XIQA 3G13A 1XI2A 4LBVA 4OSOA 2JAXA 4PRZA 5F78A 3RARA 1KI7A 5HP4A 4O3MA 4TZ6A 4ITRC 2C8VA 2J0UB 1SIWA 2PX6A 2ECFA 1ORHA 2VP3A 3AH8A 5CBKA 3P0HA 3OTQA 1KJJA 3HCCA 4K6GA 2LIVA 3DKPA 1U31A 4UHKA 1W52X 2BFBB 5B64A 2NU9B 4PLGA 4MS1A 4YONB 3FHTA 1ZMBA 5PGMA 2WFMA 4HQKA 3VYSB 2ZT7A 4X0EA 1NSFA 3ND8A 1GNVA 5FYQA 2W2KB 1QZZA 3RLFA 4AO6A 3THYB 1U0FA 1R0XA 1ONNA 1RKBA 2MINA 1DUVG 2OGTA 2Q3BA 4FB5A 1PZFA 4Q21A 1OLUA 1X19A 3NO4A 2YXEA 3LRPA 5HOEA 5JADA 4W5NA 1JMYA 3H5LA 1CE8A 4E14A 3U19A 1M0SA 1ZW6A 1JFRA 1IH8A 2EYQA 1V37A 3UMJA 2O1XA 3GP5A 2H0AA 5JD6A 5DTMA 2DVMA 4K1LA 1DCMA 3GPBA 4PCVA 4P5PA 5FWAA 4CMHA 4IXWA 1T9DA 3KHSA 1SH7A 3ELWA 4EENA 5LD2C 5FPQA 3A6ZA 1E59A 3KVRA 5ECWA 2V7QD 3PNKA 4QJ3A 4Z51A 3O2JA 3S7TA 1MOSA 1FRNA 1ZNZA 2AFVA 2A0UA 3MJVA 4AJNA 4C76A 4KPEC 3EY9A 4JMLA 1YVPA 2G88A 4IFIA 4U8GA 1MT3A 4BJHB 3PEYA 1ZN2A 5JO9A 2G3YA 3NH6A 2AW5A 1GPKA 2IYZA 1Y9JA 2Z0MA 1IB0A 2GXUA 3UM9A 4D4IA 1HX7A 2N42A 2O8DA 4F3CA 5BOSB 3F2IA 2AN5A 4LJ6A 3MWLA 4TYMA 1XEWX 1F2DA 2CWWA 4MWTA 5IARA 4GICA 1JGTA 4IDOA 4BQPA 1SCUA 4ZCTA 1DG1G 3GBVA 5HFJA 2C84A 2GM3A 2OGUA 3DJYA 1LVGA 1RPAA 1H1TA 1DAGA 1DDOA 2AI3A 3HSSA 2WSYB 2QTTA 3OE4A 3EGXA 2YOFA 2FPMA 3JQ8A 1XIVA 3BXOA 5JH7B 2LVBA 5I45A 3DG9A 2NVOA 2ZSDA 3P9ZA 4KSCA 1A1VA 1ZL0A 3R1IA 4G2NA 3EVBA 4C88A 1W73A 3T9FA 1BGVA 1VSTA 1ZD2P 2D74A 5DNAA 4E5PA 5AW6A 3CBGA 5BMVA 4RTMA 3VNVA 3SQOA 1U8TA 2CLMB 5F21A 1WXIA 3VXKA 2YHSA 1IZZA 3WMRA 3JAWA 1X7WA 1Z6GA 2QM7A 2XE6A 3PR3A 4MHSA 1LZKA 3JARB 4GR4A 1IXSB 4JN6B 3JASA 3TLXA 3UKJA 3AP3A 5K09A 4Y7CA 4OH7A 1KXZA 3BERA 4LRUA 1T15A 4ONEA 1JZQA 3L1JA 3KWJA 3TLJA 4KXLA 2JANA 4KOAA 3IP1A 1E60A 1OQAA 1Z8DA 2FZLA 4AS1A 3WMWA 1VGQA 4XRGA 1K6MA 3KZVA 3SBOA 3ESZA 4CCAA 4FGLA 2RHGB 2BBOA 1T25A 5DNCA 3NIFB 3DKKA 2W8ZA 3NATA 3QMVA 2IEZA 4KLNA 3U39A 1GRCA 1ZD4A 1CRZA 3MWKA 1AZSC 2NUBA 2W00A 1P91A 1JJIA 1I6KA 1R0CA 1VSBA 4US0R 3OHSX 2RHMA 1H6CA 1PYGA 1CIJA 3GLIA 5GQSA 5F4ZA 2RHHA 2WSSA 5IKXA 4OAPA 1W7AA 3LHSA 5AOCA 4BLSA 2X13A 1E5DA 2IU6A 1JDVA 1JHOA 2RB5A 4NEHB 4EGFA 4RZXA 1HLDA 2JASA 1GTL1 5KWJA 3LKBA 1AHIA 5H81A 1RQXA 2QXYA 4EP1A 1RI1A 4P58A 2ZBRA 4CKBA 4GZLA 2WSSD 3CPJB 1A8HA 2DR3A 3AWDA 5E4TA 3RVDA 1CUXA 2HV9A 2G82A 4FUQA 2PA3A 1Z3CA 4CCSA 1HBJA 4MPPA 1BCSB 4A6DA 4LK2A 2GBPA 2ILTA 4QATA 1BQEA 1Y8RA 4XB1A 4REQB 3AY0A 2V7BA 3VVLA 3GFOA 5TT0A 4PAWA 4TTIA 1BHO1 4MEJA 3VC2A 4BZPA 4EQZA 3P5SA 3MAGA 3DC2A 3OF2A 1D2NA 4V0LA 4XEUA 3ZH9B 4UNRA 4DV1B 9MHTA 4RV4A 2BELA 2GK4A 1PJSA 2DC1A 3IFSA 5A4KA 4KHPB 3OM9A 1AKTA 4AC9A 4M1YA 4P53A 4RLSA 4YPFA 3VA7A 1DTEA 2OCGA 3AG6A 3KL2A 4DMFA 2JHPA 3QA9A 3OJEA 5BXYA 1XXHE 3KSZO 3BMQB 3AB3A 5DHRA 1E9SA 5DHQA 1U0RA 1FQWA 3PC8A 1IEWA 3BORA 3Q3EA 4QTXA 1EJ6A 2CMFA 3LXUX 5AKXA 5TXGA 1KOLA 1XOIA 5I7EA 2IF2A 3LT0A 3F74A 3V8NA 3LTNC 5GM2A 3D0KA 1RXUA 2Q9UA 3NBFA 3VGJA 3UMYA 3OZEA 4RF5A 2E4ZA 3TLAA 2ONKA 1ZNYA 4GKBA 1II9A 1VE1A 5LXTB 2HXGA 3MCZA 4KQJA 3C4QA 3PIIA 4ZT5A 1FTSA 5BOVA 2VSFA 5HFNA 3U7QA 4YRIA 3EH2A 4BRWA 3B3JA 4KLZA 2IVZA 5FF9A 2CBGA 5EZYF 1JLMA 1K9VF 4N12A 4R2MA 3ZQUA 1IULA 1ZIPA 5AVQA 3WA7A 1HL7A 4KN8A 3RABA 4EF6A 3IUBA 1MAWA 2Z8YM 1KDPA 2R1VA 5HFAA 1KRHA 1PFYA 2I8CA 3GZ4A 2FW0A 2HMUA 4QICA 4RK4A 3W2EA 5A0TA 1XVTA 5GJCA 2HFJA 4RIGA 1NLMA 3VNBA 2NXEA 5HIAA 3BKXA 1FFHA 1LJ8A 3VSAA 4EKIA 1U2PA 1ABFA 3BAFA 3HCWA 5I9NA 3S68A 2EZUA 2NO4A 2PUHA 2OYSA 5C34B 3CB2A 4HVCA 4Y9DA 2QVXX 2Y93A 4LGYA 1KZ4A 2O8BA 5LB4A 5E8RA 3CO5A 1CVLA 4CMJA 3EXHC 4OBWA 5CW2A 3VSBA 3X3HA 2WSBA 4ESHA 2ZBUA 1V3TA 3B8HA 5CEJA 2PS9A 1EZZA 2IZOA 4YP0A 1KTVA 1F3OA 1WVIA 2FFHA 3GG9A 4ZI7B 2YX1A 5HKAA 5JLJA 4HSGA 4KTVE 1I80A 1NR7A 1KSHA 2J08A 1G18A 1M7GA 2Q21A 2Z83A 3MWJA 4L5JA 4GI1A 2HWUA 3OQ1A 821PA 8OHMA 1JHXA 2ZYAA 3CR3C 1QBGA 4WKNA 2VPIA 4OLBA 4RJIA 3E7XA 2X1LA 4YQFA 1L1RA 5I7AA 3E2MA 3NAGA 3QX8A 4GZ5A 4ZALA 3I5YA 2G5GX 3T3PB 3ZIDA 3THWB 1JYSA 3HR7A 2HK8A 3ZVKA 5ALDA 1ECLA 1Z2NX 4QHYA 5HIIA 1ZJWA 4INZA 2I4LA 1Z56C 4W5JA 3NHBA 3H16A 4I55B 5A06A 3SD7A 4LE2A 3B2NA 4PRLA 1X1SA 4NENA 5BWMA 2UUOA 3VYVA 4XYLA 1DADA 2WI8A 1AXEA 5F7ZA 4ER7A 4DRXB 3UIEA 3EPRA 3KZKA 5FV7A 1CY2A 2P27A 2VQ6A 1CZRA 4B3IA 1YQEA 1OH6A 4QO8A 2JL1A 1JE1A 1I4TD 3O7MA 4QJ5A 3MUOA 4PIVA 4CLOB 4G07A 4C0HA 3TXAA 2I2DA 1FFEA 3DBVO 4RZIA 4IOLA 5B1DA 5JNSA 4OGFA 1NBHA 5K2MA 1H0SA 3FLBA 1PT5A 1DTWA 3NWBA 4Y1FA 3KETA 2DLCX 2AW3A 1THMA 2Y4NA 2Q7DA 4B83A 6REQB 1SOWA 2IOQA 4GPIB 2QW0X 3QKSB 1TM5E 5KNCD 3A3KA 2IUTA 2CZGA 5IXJA 4K6OA 1Z7EA 4AJLA 4KXNA 1D8AA 4F2WA 1WS6A 4QBTA 2O7SA 1IG3A 3UTCA 5CA1B 2EGHA 2C54A 2CUKA 2XB6A 4WVFA 3V9PA 3NTQA 3N53A 1XQVA 4PGAA 3BXZA 4ZYTA 2DP4E 1LBTA 3IL2A 5CLLA 1FK8A 3FYUA 1O5OA 1I1NA 2W8BA 3K0AA 3TVTA 2N46A 2X22A 2HYDA 2BGMA 4HDMA 1W9MA 4OM7A 3CCFA 4YXWA 4XJXA 3SZRA 3ROFA 3M5WA 1N5KA 3CBQA 4LC0A 1XWIA 4D56A 1N5RA 2VTBB 3GLKA 1ADCA 2ATVA 4ABTA 3K20A 1UAAA 3VC1A 1T9ZA 1GXSB 5LOVB 1NMSA 3D6MA 3OETA 5IZCA 3M2PA 4YGXB 4BVEA 1V9CA 1Z17A 5KNDA 2C4MA 1KGDA 5KTKA 2G7MC 3WBKA 2I54A 1SOMA 3EGDA 3HXLA 1RIIA 4Q4HB 5JCJA 3SYTA 4K1XA 1THGA 4E6EA 3EDRA 2WEKA 3F6CA 3BE6A 1DMRA 1RCFA 4EB6A 2EX1A 1DV1A 3RHFA 2M6RA 2ENWA 4NPCA 3SIXA 1SD1A 4RFLA 3IULA 2NU8B 3KK0A 4H08A 3E84A 3O4HA 4HC4A 4AO8A 2DB3A 3W5AA 3M33A 2HGSA 2TS1A 1KJIA 4M89A 1MA3A 5LA6F 1MC1A 2V0CA 2WZDA 4Z9XA 4M9QA 3EULA 3FCOA 1YVDA 4G1MB 4RPLA 1W34A 1AN0A 1GNSA 3V1MA 1RKUA 5CDSA 3STUA 3PUWA 3A05A 1T2NA 4BNIA 4KI7A 2OB1A 4J7AA 3F47A 4JHLA 3OEHD 1UUFA 1ECCA 4FHGA 3DSRA 4RM3A 2RJ3A 4D5EA 1FS6A 1I24A 4RVNA 1YR9A 4GOJA 1Z2DA 3EOBI 3DLCA 3WP1B 3ZBQA 3E61A 1JMVA 3KPJA 2VZEA 4J0CA 5IFLA 1U7WA 2WYUA 4NNOA 4R84A 1THZA 3U3RA 1T9GS 2UVPA 4XIYA 3FWYA 2FWBA 3QYPA 4UE2A 5ED0A 3WMFA 3ZY6A 4DMMA 1X7GA 1CULC 1PGOA 5JW6A 1NOIA 4YH1A 4IFTA 1Q0QA 1D4OA 3NTLA 1Y5LA 3NCTA 5CH8A 3UBMA 4D6XA 4MS1B 4DWOA 1N2XA 2H31A 1KQPA 1WMDA 1WKBA 5C8VA 3KV3O 2W6OA 3HKBA 1O94A 3IX7A 4ID3A 4G0NA 2IW3A 5KUTA 4ENVA 3VMMA 1BX0A 1MJGA 3KE8A 1ESNA 3OEHA 1EFPB 2D00A 3PHBE 2B6NA 3Q3GE 4FFBA 4IYRA 1LVHA 2BFAA 1ONBA 5FPPA 5LCXA 4RYDA 5JAMA 3IVMA 1NXOA 4NJMB 5F9MA 4FR0A 3D64A 1EK6A 3ECCA 4KODA 3V32A 2KMLA 1WO8A 3ED5A 5AKJA 1U3WA 3VHXB 3SHWA 5JXGA 4FFSA 4YYZA 4ZYXA 4R1OA 5AW4A 2FWPA 4D98A 5AOVA 3MBOA 2C9BA 1TYEB 3L84A 3G1TA 4N48A 1M8KA 4B44A 1Z06A 5IW8A 3S28A 2OCYC 1WDTA 4DR6B 5KVQA 2ENUA 2LCFA 5DIZA 3TSYA 2JDID 1FFXA 1E5VA 2HLDA 4RD3A 3ULKA 4B5KA 5JWRA 2ICAA 3GJ3A 3IBCA 1XPJA 2D1SA 2VQDA 3GGGA 4MTCA 1OU0A 4V0NA 1QH9A 1U81A 2OCIA 5TMEA 4YCMA 1W1UA 2BGNA 3BVPA 3LO8A 5FBKA 3SEFA 3T4PA 5BR8B 2CV1A 5DM60 1Z7YA 5LM3A 2P5TB 1S2IA 3BCSA 5LMNB 2ACWA 3M1AA 1UMBA 1FXWA 1MG0A 3MQ4A 3OIDA 4RKEA 1YZYA 1OJ7A 3BJMA 3VMFA 4QU5A 4F9TA 1O57A 4N3CA 5EHXA 5EJ5A 4PPQA 5ALUA 1CERA 1JLHA 1XZMA 3LW8A 3V1KA 2F3RA 1PLJA 1QHIA 1GXSA 4CL3A 3DQPA 3EZGA 1SC6A 3HABA 1GU0A 1XPRA 3DL0A 2PU5A 3NASA 3TF5A 3I01M 4CMCA 3L5OA 2VQSA 5EJMA 5JXHA 3P9YA 3VTFA 1O4WA 4NCAA 1Q0RA 3H05A 4RY2A 1IPEA 3CUVA 3RG8A 3DMGA 3QVLA 1D2GA 1QV9A 3IILA 4BFUA 4BMXA 2YXBA 1PFQA 3FR8A 1FPMA 3EVAA 5LNK6 2MR5A 2R9VA 3CFYA 3RIEA 4RDCA 5HDQA 3U80A 1QKIA 4EJMA 5SY9A 1W36D 3X44A 1UK7A 4DEVA 3AUFA 3ETCA 3PJFA 1VGVA 5E1OA 4YRTA 3ZDDA 2GR9A 1X13A 2BSXA 2GO1A 4V0RA 5IJ9A 2XOKA 1YQWA 3TDKA 5KJ1A 3ITDA 1NJGA 2BJHA 3WISA 4I08A 4A26A 3WTBA 4QTZA 1Z5PA 4ZOCA 1U4NA 3IOCA 3B3QA 4CG2A 3HV0A 1NN0A 1Y7IA 2ZWOA 3D6NB 3H2BA 1DRJA 5AJZA 4EW2A 4E15A 2QN9A 3P9KA 3UXEA 1WMEA 2IOFK 3EIOA 3M1YA 1N2CA 1RHJA 3ZYCA 4QIHA 4ZQIA 2PU7A 3CT6A 3AX6A 1NSYA 3L04A 3M83A 2E89A 4GWGA 4W5WA 3K9FC 1C2YA 1QR6A 4H27A 3OTOB 2FZWA 2V9PA 3A14A 5AVJA 4BQOA 1E2MA 1R9NA 1NG1A 1AM4D 1TJ3A 2AV6A 3LH5A 5GGYA 5J2TF 1Z0DA 1DQZA 1P72A 4IJ6A 1GZ6A 2XWJI 5CM8B 3N2NA 1EVKA 4Z3DA 3KQYA 3T4UA 1AZWA 2GYYA 2YWBA 3V48A 3VDNB 3L49A 3P2YA 5EP4A 3VOSA 1SZCA 3WIEA 1KWKA 1KEKA 1NDQA 4OI2A 4N7JA 3IPAA 2JFOA 5G4LA 3TLMA 1AU9A 3JWPA 2OHFA 2I3GA 2FRDA 3O8QB 1EI9A 2QX6A 3OQHA 4JMPA 1RDFA 2YN0A 4G5SA 3NUGA 2UZ3A 8ATCA 1YR8A 2HTEA 4WNCA 3KP1A 1MUUA 1PDVA 1Z0FA 1JTFA 4DT1A 1YOVA 3H9BA 1SCNE 4IILA 1ZGHA 4Q82A 5E9JA 3J80A 4O2AF 2KQUA 4Q7MB 5FL7D 2CD7A 5CPFA 5ALLA 3SXUA 4D4MA 1J8YF 5E3JA 1KQFA 2B2NA 5JTTA 1CUFA 5FUWA 2DE0X 1XCLA 3JSXA 4OV6B 4Y2VA 1A7JA 3DYBA 2OFWA 2B78A 2QDXA 4HI0E 3LQQA 2IDJA 2IF0A 4POOA 3KSBC 1ILWA 1V3QE 3O9MA 4K5QA 2CV2A 3WGLA 4DNFA 2ODQA 1OR8A 2QMYA 3HFSA 4M36A 1I5RA 1ZOOA 3KXDA 4AZTA 4DYDA 2X7XA 2C7GA 2HPVA 5A5DA 1QDEA 4MA4A 3CRRA 5A7GA 3PJGA 4MQ6A 4L8FA 1PVDA 2GXAA 1P2TA 3PCTA 3K1YA 4RKRA 3EF0A 2RKWA 5TB5A 3W8RA 1FP6A 4BQQA 1JHRA 2OVFA 3QPUA 1AQJA 1AD2A 1SQFA 3OTIA 5E4YA 3WHKA 4EFNA 2YYAA 2X23A 4HNQA 4JH0A 1PZMA 4ILEA 1RJEA 4G0ZA 3ZZ0A 5FUQA 3D1LA 3K9LA 3EZFA 1Z45A 2IOYA 3H0EA 1SUEA 3L0BA 2P75A 5GM1A 4E70A 1IHPA 4NQRA 3ZLJA 4MR9A 4CDRA 4PBSA 1EUCB 1H2WA 1LLDA 3TD6A 3JYNA 3AF3A 5GINE 2W37A 2EP7A 3OIGA 3KTFA 1NQOA 4C6SA 5BR4A 1SO8A 5SZHB 1XP8A 1Y1RA 2EIHA 4C1BA 1J2RA 1TM1E 3F5DA 2MCFA 2HF8A 1UANA 3VBCA 5KNLA 4YJDA 4LKOA 1ITZA 4Y2JA 3I6IA 3W6OA 1RU3A 1UBEA 1XZEA 1QG0A 2IELA 3E9RA 3I6BA 1R6TA 2JGIA 3WJ2A 2QT0A 1JXOA 4B7UA 2E37A 4E09A 5K0BA 4HO1X 1TDJA 1GG2A 4E94A 3LVQE 4Z4FA 3V4ZA 2HL6A 4FMPA 4JBHA 1AMUA 4IVNA 3OZBA 4PYJA 3OY7A 2GN4A 2QZ4A 4CWAA 2NP7A 4I66A 1NQUA 3V7YA 1XKQA 4XI9A 1D1QA 1E2JA 5EJ2A 5IJWA 1YR3A 5JUWA 1JAZA 1C0IA 1T4CB 2E18A 2YXLA 4AZ0A 4LEIA 5HVNA 2P91A 3WJ1A 4BY9E 1I4OA 3J7AC 5EAIA 1HO3A 1X7YB 3HKCA 3HTXA 2FPUA 3DNMA 1W5BA 3N2EA 4XIGS 1HWYA 1S6YA 2JFYA 4YJ3A 5AR1A 3JQ7A 1W5AA 2XNDD 4W5HA 1LV7A 2FSGA 3H5RA 1DXYA 2FN3A 5JQGA 1BWPA 4RTRA 3QI2A 2EW2A 2PV0A 2DPGA 2IGBA 4DMHA 2XQVA 5EZ5A 1U98A 4H15A 4IW3B 4B48A 4RVFA 2Z5LA 3THWA 5CU7A 2PCLA 5LJIA 1X77A 1QFZA 1HQYE 3ND7A 1AUVA 2WKWA 1SBTA 2B1RA 2GEDA 4Z4IA 2CUZA 5HK9A 3JZAA 3Q11A 5DWDA 5B58C 1LXCA 2ZUBA 3W4JA 1F1JA 4KK4A 4NFHA 5DHFA 3A26A 3BS4A 3HY6A 1FDWA 2B3DA 4JELA 3ESDA 4AY3A 1DKNA 1HOTA 1VBKA 2VYVD 2ZSIA 1JLSA 1KBOA 1CUYA 5I7RA 4L9AA 2QLJA 2Y71A 2BEVA 2GBLC 4R51A 4EOGA 4XYEA 4Y2SA 3U5TA 2JCGA 3DPUA 4G8JA 3CEAA 1RXCA 2ORWA 3DAFA 1BX3A 4QXOA 4UVGA 4F6RB 4BO7A 3NRCA 4BMOB 4ZOLA 1E18A 2I5PO 3IEKA 3HU3A 3NIDB 3FRHA 4U9UA 3CEMA 1UZMA 5ADUS 5K9ZA 2WJPA 3JPYA 4QKQA 4Y2PA 2HNKA 3QKSA 4RKYA 3RFUA 3ZXXA 2TMYA 2FRXA 2TYSB 1PEAA 2YFHA 4IIYA 2RHDA 3G2JA 4W9NA 2WWWA 3CLSD 1FXSA 4IZIA 1S8OA 3ILVA 4X6LA 4ER0A 2PSEA 4ZVKA 2QKYA 1YRAA 4ZYUA 3PWZA 3P0EA 3AR8A 2AX3A 5T5QA 2YTZA 3JATA 3H1EA 2FSSA 1R8XA 1JEEA 1URPA 3C14C 3B89A 4M0MA 1F17A 1L7EA 4TZKA 1N36B 2VN8A 1FFWA 5DCWA 1XXHA 5EJ9A 4KIFA 1UBKS 2H52A 3VR5A 3VNAA 1QMGA 1Z88A 5AVRA 3I1FA 3ZK9A 1NHGA 2I7XA 3QTTA 3FIUA 1UKVY 2WKPA 3JQFA 1N6KA 2BM0A 1QGOA 2IHJA 4L0DA 4PC1A 2PH7A 2K7FA 1VBNA 2C82A 4JC5A 3DDUA 4REMA 1OPXA 4W5QA 3E4DA 1CF9A 4A3SA 4OREX 1NR1A 3DUWA 1QP0A 1A9SA 3PGXA 5FYDA 1CQIB 1CWUA 3U09A 4Q4HA 2ID7A 2PCJA 4WH0A 1MTOA 3A3NA 2B5OA 3T3NA 4OAQA 2XE4A 2C29D 1HLPA 2HB6A 1HR0B 2RHJA 2R00C 1N7JA 2ZJOA 5GP1A 3HYCA 3OPYI 4HXEB 5EQTA 5CFOA 1Z8HA 1NAHA 4PC6A 1U7ZA 1WU7A 3NOOA 2H0RA 3B48A 2R5NA 4C08A 3UZUA 1T5OA 2YJ4A 4X84A 4M0EA 5C51B 1F6DA 2F4NA 4GVPA 3R5TA 4AMVA 5HF8A 4CIAA 3C1TA 2DH6A 3KBBA 1JHZA 4YJFA 3E22A 5DN9A 5K3AA 3WS7A 4CUJA 4TMVA 1YBFA 1H8ED 4DY6A 2W70A 1B6SA 5LR6A 3K71B 5JJBA 2BGJA 2F1OA 4ER5A 3LPMA 1RWBA 3EHEA 5EMHA 2JI8A 2C99A 4HX5A 3HB4X 5EC8A 5L45A 1ZXBA 2H4XA 5HTKA 2OAP1 2C4HA 3J81k 1Y6GA 1KPHA 3QV1A 3OD1A 3I23A 1EQUA 5DGIA 4WCFC 2QF7A 3RC8A 3MJEA 1G8SA 1KFCB 1IZ7A 2WJYA 2X2PA 4URFA 5G40A 1Q22A 3VBEA 4CKBB 1CQPA 1P7CA 3K6SA 2QX7A 4FN4A 4W4TA 5D5PA 4GPBA 2R8BA 1XZGA 3TI9A 3U31A 1E1RA 3DZKA 5TJHA 2E9SA 3YASA 3PGJA 4DA0A 1M34A 2VPQA 5E6SB 1QGZA 5I7FA 4ENWA 2IU3A 1UWLA 3PGVA 5LKAA 5COBA 1GNPA 2R751 4M1EA 2FPLA 2XIJA 4REQA 5JRDS 1ZIDA 3AJRA 3L7KA 2OPBA 4WA8A 1ISHA 4TXJA 3W5HA 4Q1AA 1KTIA 3DHWC 4L72A 1IY8A 4IQGA 3EFOA 4RC9A 5CDUA 1X80A 3G0BA 1TPYA 4DIFA 2IPLA 2QQ5A 4K87A 1E9BA 4N01A 1VG0B 5ULLA 1V7ZA 4A7PA 4DLPA 1KAQA 5F73A 1GL9B 2EX0A 4ZT7A 1Z7WA 4WVLA 1DAIA 1G7RA 1VPDA 3IQZA 1I7QB 1NX6A 2FJ0A 3SK0A 2GJSA 4P0QB 4ND6A 3WYFA 5DGDA 4WBXC 5JE8A 1JBQA 1G42A 4JEHA 1QQBA 2IHNA 1QNFA 4PAMA 1PLLA 3WJ7A 1N3BA 1RRKA 2AMJA 2B7BA 5FWDA 3GJ8A 4DMUB 1HY3A 1Y8AA 2ACKA 1W76A 1UBHS 3A6FA 1KH2A 1TRKA 1U7TA 1XKTA 2FHSA 2GK6A 1VJRA 2A92A 2OHHA 2WTBA 3CKMA 3A6PC 1JEAA 1ONOA 2C78A 3BE4A 1K1EA 2BR5A 4I99A 4R5MA 4Q9KA 1ZNQO 3RR2A 3TSAA 5BO5A 3OQPA 2O59A 5BSUA 1AS2A 2FRDC 3RIGA 3OEYA 1WW3A 3P8ZA 1DBIA 4PSCA 1GCOA 1TRHA 3O47A 3OIVA 1G7TA 1ZCAA 2G63A 1CLUA 3FPEA 3AEQB 5ERYA 2PGLA 3L0OA 3KUDA 3TINA 2YXDA 4B1FA 2WMDA 3NQ41 3UJ8A 4QU8A 3MJDA 2O8FA 2N1BA 4KAFA 1C8BA 1YNSA 5EJFA 1HYBA 1XNGA 5HXAA 2BSAA 2BF7A 5LIPA 1DC4A 4QEDA 2BDEA 2W6MA 4JLOA 1QE3A 1G5QA 4MIOA 2XCTB 5JJLA 10MHA 1MNAA 1P62B 3ORYA 5I8WA 2Z09A 1JHQA 3HDTA 4DZTA 3T5TA 3N86A 5LQSA 2Z4TA 2HF7A 4MKIA 1T3HA 2RJOA 3QE4A 4WNYA 5BP7A 2YC4C 4QPNA 5DYIA 3DXYA 3D6TB 3PNBA 3BH7A 4XDZA 1PSWA 3FUVA 4WFJA 2V6BA 2OQIA 4DCVA 3EVEA 4GPTA 2NNWB 2D2FA 2VAWA 1E2PA 2C7VA 1EFVA 4BFWA 2HLHA 3GRZA 3Q7TA 2CK3A 4C2TA 1CJUC 2FPGA 3B2EA 5INTA 1ID8A 4B47A 3OC6A 5AJXA 3DLPX 1IQPA 5T8KA 3F8SA 4EVSA 3E9QA 4G81A 4WE3A 1QONA 3MTAA 3U0BA 1YRWA 3PXGA 5DYWA 3DE7X 4R2JA 3G9UA 4N8SA 3FA2A 1E6KA 1ZPDA 3A0UA 4OHMA 4V3CA 4M8LA 1WY5A 3OZWA 4HDQB 3ZHXA 3W5CA 3VKHA 2GS9A 4MWGA 2CV0A 2P2CA 5EPUA 3IT2A 3BK7A 2XBLA 3I76A 3EHDA 4ED9A 1OH5A 3LAWA 4IIDA 3ZWXA 2BN4A 3LPAA 4HNHA 1GGHA 3RKSA 5A0VA 4R2KA 2DWCA 4ZD6A 1X1TA 3DEAA 3FZNA 4FKZA 1GKLA 4WCDA 3IEVA 3IJPA 5JNRA 5KYKA 5GVSA 3N8KA 3A4IA 2QR2A 2HYIC 4LA4A 4FC7A 4W7HA 1HDXA 3V4PB 3SSNA 3K05A 2I1QA 3QXJA 4B40A 1DC5A 4MZXA 3K3PA 4RTOA 5LA6A 5FLEX 5H9VA 4M99A 3DDWA 1ORIA 2CNLA 1WMAA 2VHVA 3LQ1A 4N47A 5C5IA 1JG4A 4X1IA 1OI7A 2ZR7A 5TPWB 3IYLW 3SN6A 3P0FA 2YWRA 3FN4A 3RYTC 4Z3KA 4JXJA 1UADA 3KKEA 5DWQA 1XQ9A 1J0CA 4HFJA 3RWMB 1NVVR 5D7NA 1G0OA 1RADA 4L9WA 1T2EA 3EMDA 3I61A 1GRNA 4OIMA 4ZVVA 1P4HA 3PC4A 1YHNA 2QBYB 3C7DB 1W2WB 1MXHA 3ICQB 4AZWA 4LI3X 1V1MA 2QSYA 4EABA 2P40A 4WECA 1T9GR 5HE9A 4Z86A 4HMOA 4PAQA 1C9YA 3IOYA 3WX0A 1G3QA 3ANNA 1RWVA 3VZCA 3ZZUA 5IHXA 1K92A 2AWOA 3C15C 3CZRA 1EXDA 1SXJB 3BWVA 1MB2A 1OLOA 2HJ9A 1M6EX 3NOVA 3IV9A 1VI6A 3T15A 4BE4A 5H4HA 2A14A 4FE3A 1U2TA 1S1MA 4M6WB 1KMIY 3HE3A 2EERA 2PKQP 1P7WA 1VLHA 3C3KA 1BA3A 1LPSA 1YONA 4EM6A 1USIA 1VP3A 2G0AA 1F9AA 1UPAA 3G2NA 3HDJA 2AB0A 1TUBB 2NADA 1QUEA 4MV1A 2GZ1A 1EXWA 4JT4A 1IHYA 3L0CA 4FYIA 1U2DC 1YBHA 2XMDA 3D4NA 3OT1B 3AUYA 4QJ4A 2OXTA 3GCWA 1J5EB 5A4DA 5JYBA 3HJAA 1QHHB 1Z38A 2Z3WA 1H85A 4FP9A 4BO0A 3AR9A 3EODA 3AFNA 1JG6A 1VM6A 2QY6A 3KJGA 4K26A 3HK2A 2AEFA 3PWKA 3G2MA 3HB5X 5JCZA 1G7SA 3MXTA 3S27A 3EOAI 1Q0TA 3GYBA 3R5SA 1M6VB 1QB8A 4KLCA 3HY4A 4LC1A 1L7XA 3LP5A 3BGIA 3AYXB 5KNBA 1KZYC 3QV2A 4J0JA 2B4QA 4X6XA 1PNQA 1FP2A 1SQ0A 1E2DA 2H18A 3AW9A 1RKXA 3D6UA 3RIXA 2O1EA 2VC2B 4Y6RA 1DT5A 1FFCA 5JECA 3AKYA 3LL4A 2VCHA 4UUOA 2R85A 4R3WA 4ZA2A 3RS9A 1AKVA 1UODA 1ZAKA 5J9FA 4G6ZA 4F0JA 3UK6A 3R76A 1ZOLA 1YZLA 3LCUA 3RE1A 1B3RA 2BUAA 3G5MA 3K5IA 3QFTA 3U0VA 4O3FA 5GTDA 2C3YA 3V2IA 1QM5A 2C9DA 4UM8B 3TE7A 2B4TO 4JX9A 4DYHA 3F6YA 5ITWA 3T3HA 4ZAWA 3UK1A 3N05A 2AFHE 2CUTA 4WK2B 3UAYA 4EVQA 1PU2A 1UT5A 3CURA 3VX4A 1A5TA 4F3YA 4G4GA 2B98A 1PD1A 1X7HA 4FPXA 2Z2YA 3Q4GA 4U5QA 1VL8A 2I55A 3RVSA 4EUKA 2Z30A 2PQMA 2DULA 2Z8ZA 3QXGA 5CFNA 3G82C 1DC8A 2B4RO 3GMSA 1L4HA 5DDIP 4R98A 5EJGA 3CPSA 5CM2Z 3R6LA 4Q3KA 3HJFA 2FZEA 2OCPA 2GFHA 1IU9A 4EI7A 1GTG1 5JSQA 3O1IC 3UOWA 1FS5A 5FOTA 4DR3B 3D8BA 4LJLA 3R75A 2PXHA 3I4LA 5IM4F 1JFVA 1ZCZA 2XITA 4S04A 2AFHA 4CKXA 4IHJA 4YV1A 4GOOD 4MO9A 3NGLA 4Y6GB 4GPD1 5DRYA 1OLXA 2G4VA 1B3BA 3GJXC 3D3KA 1XVAA 2WJ6A 1O77A 3EYWA 3II6X 4FT4A 1GA6A 3GJ5A 4I3HA 3SI7A 3JVVA 1Y1LA 2EC5A 3JV7A 1ZESA 2GK3A 3GT0A 4WFIA 4Y3UA 3T3MB 3VZBA 4CR8A 5HR5A 1Z4IA 2AC2A 2AUTA 4C6TA 2QTFA 1NATA 4M1WA 5HS6A 3RROA 1QGAA 3N2GA 1ZR2A 3QWFA 4UJ3A 3EUEA 4A2PA 3JSAA 4UVHA 4GSLA 3M9WA 1YS6A 3T4EA 3TAXA 1BQ3A 2PLAA 1SKYE 2YHIB 2YWDA 3FOWA 4AMGA 2WTEA 4P3XA 3H2GA 1VIVA 4W1QA 1GAXA 1PQ4A 4U2BA 2QDKA 3IO5A 1E66A 1M33A 4X97A 4JP2A 4EZIA 1Y8QB 2TRSB 3DWEX 4H0CA 1K0FA 2ISSD 4ZK6A 5BYBA 2PZGA 4ZAYA 3STTA 1U7XA 1TUBA 3CG0A 2VDUE 4E4TA 3A6KA 2OM2A 3M9LA 5CVCA 5JDCC 5HUHA 1XTTA 2PSSA 4BC0A 1QG2A 3MCUA 4BX8A 5JO0A 1BS9A 1JQEA 3FCXA 3H0KA 3PJEA 3PNPA 4ZMSA 3PGMA 1MABB 3RC3A 4HAWA 4EUSA 1TCBA 5IF9A 1K68A 1TM7E 3CX6A 4AULA 4CDNA 5JWOA 5C1PA 2ZT5A 2A3NA 1LJLA 3D5QA 1ULZA 4RORA 1JWAB 5KNCA 1E2HA 4JI5B 3MMZA 5ELLA 3HQ4O 4W5OA 4N3GA 2RHTA 3ZEIA 2ERYA 3HRHA 3I2GA 3ANSA 3OM1A 3L1HA 5FUBA 5G0UA 1NJSA 5JDIC 4BE9A 2PX5A 1XQXA 1IQ0A 1I8TA 4GZMA 5CT9A 4D45A 4N8EA 4X91A 2ZRLA 1QFYA 3SXJA 1B6GA 3QTLA 5CT8A 2WSIA 4XASA 1JXMA 4G67A 3D6HA 4JITA 1B76A 3U6KA 2FQYA 3CWCA 1L5HA 4BFYA 1J90A 4KXXA 5J40A 1NP6A 3N8DA 4K9QA 3DHVA 4C7BA 3TGLA 1W2GA 2YYZA 4P4SA 5T7BA 2H7XA 2YJ3A 2QA5A 2VJDA 2PX0A 4O63O 4GM4A 2JRLA 4UM9D 3R3SA 4Z9YA 3RJ5A 2HX1A 3RWOA 1H2XA 4NBUA 1VKOA 1ESMA 2R1TB 2VLIA 3PDCA 3SJAA 2OECA 4QPPA 1XNRB 4GWKA 2GYWA 3OJXA 4JI7B 5IZCC 5F52A 4AUKA 3SQMA 3EAGA 1U0TA 1KU6A 4WJZA 3MGKA 1FXWF 2P1RA 1XZKA 1V8ZA 2R96A 5IBQA 1YKFA 5TGTA 3I9NA 3HY3A 3ZJUA 5KWSA 1I2DA 1TQ4A 3H5IA 4MINA 5D3MA 5K8UA 2P0EA 4GO1A 3E9YA 4P80A 3G5TA 1GARA 2I87A 2X8JA 1L4NA 2JCXA 4YHHB 1SU7A 4UKDA 4LF6B 1M34B 3NDRA 3G0CA 1Z6YA 3E82A 4AZ3B 4MZDA 5IPFA 2B94A 1J9EA 3INRA 3UJPA 1W85A 3C39A 4AJIA 3F71A 4EKGA 1J8MF 3AJDA 3PDUA 4IGFA 1OFHA 3LWDA 3DF7A 3DV0A 3ID6C 3OU6A 3NT5A 2WSLA 3LTEA 3M5DA 2E7ZA 4X7BA 3W1VA 3WWYA 5K0ZA 1SPXA 4N82A 3FCEA 1EUYA 2VHYA 2EDCA 4L78A 5HMLA 3BWBA 3FPAA 4YAFA 2XT9A 4QLAA 3U60B 1Z33A 2ZM5A 1EX6A 3SZ3A 1GNQA 2R6CA 1JU3A 2D2IA 3B1KA 2GDJA 3FMFA 3H11B 2IEYA 2V65A 3MMSA 3T52A 1N2JA 2Q6IA 3WGJA 1ZLXA 3A37A 5F1YA 3T06B 4YRSA 4QAJA 1H8EA 1BU5A 1E20A 1E32A 1RXVA 3HJCA 1RWPA 4P32A 4ZU3A 3L7JA 5E2IA 1Q92A 1D4ZA 1PEKE 2HA6A 3DB2A 3HFGA 4WEOA 2IXGA 2IIBA 1SVNA 1GVHA 2GLXA 1FMFA 3CRNA 4HTFA 1MRSA 4TKLA 5DSTA 5IC6A 4N5LA 1K4MA 3OJCA 1WXHA 5FA8A 4RUKA 4I4IA 1T9CA 3GU3A 4C0QC 4WT7A 3VR6A 4JBWA 3AM1A 1IEVA 4OQXA 1MABA 4RHFA 4B7XA 4DWVA 2HRQA 4B4WA 1H93A 4C7OB 4HLDA 5A9SA 2AOTB 3AI1A 4ZEVA 4MAAA 4MLPA 1G2QA 3EGCA 4M7OA 4E7OA 5JCXA 2DKOA 4KL8S 3S4YA 1E8NA 4IMJB 1Y4SA 3JVEA 5LDGA 2PLRA 4B2YA 3WB9A 1NJ8A 2QVCA 3AR5A 1PT7A 2XRYA 1M1ZA 1A69A 4H3SA 4ZAFA 3V2GA 3ZWKA 4DE5A 1IBMB 3AF4A 2BGTA 1E6EA 2NU8A 4J2HA 2FXVA 3EFHA 5D2CA 5K8LA 3EGIA 3BZWA 4KXQA 2P9TA 4G1CA 4GLLA 4MVJI 2XCUA 3JQAA 3LG2A 4EVRA 1AQLA 1FY2A 5E6UB 2PLWA 3E2IA 3RVRA 2HJGA 3HBNA 3U9TA 2CBXA 3A1SA 4JUIA 1E4OA 4CNQA 2OBMA 1QX3A 5H3HA 3EEOA 1IY1A 5TGZA 2O3SA 1A98A 2Z6AA 1SKQA 7MDHA 5AHKA 3D7SA 3V97A 3IXMA 4JGIA 4M1OA 5JEEA 1AZLA 1RFLA 2IHYA 2V7GA 3K0HA 3DAYA 3L01A 4QG7A 3FWNA 4XSVA 4NZYA 4XWAA 1H8HD 2O07A 4QULA 4HCJA 3CUTA 1YL7A 3M70A 4HL6A 3WYAA 2JLSA 4G9EA 4HH3C 1SU4A 3KT3A 5EFZA 4DLVA 4ESEA 1WCWA 3A9TA 3CLSC 3HBMA 1WB5A 2I8LA 2ZUSA 1NTRA 4M1KA 4PLTA 5EWLB 2L42A 5LP6A 4UDXX 2C2HA 4AS3A 1EFCA 2WBLC 1X9GA 1Y1PA 3KUKA 4RVOA 1ZLYA 4K3UA 1IQUA 1ST2A 4L8VA 4G4SP 4R68A 4BO8A 4TL8A 1D6SA 2VPWA 4UBKA 4JI6B 1AZTA 1UBRS 1W8IA 4U2CA 4KC0A 3ENVA 4UBJA 4XFJA 4F92B 2L17A 2D5CA 4QT0A 4MW7A 3ZE0B 5AXCA 5H3LA 2GCIA 1OT3A 2B2XA 2I3ZA 4FXOA 2GM4A 5EMMA 3DV0B 1QZUA 3DW1X 4EGJA 3LJKA 4AAYA 4OAOA 3K15A 4UEKA 1I6LA 4DCPA 4EG1A 3A31A 4PRKA 2CHFA 3KG2A 4NOMA 5CURA 5CAEB 2EEPA 4HWRA 1WV0A 3KQHA 1KERA 1CY0A 3LFUA 1SVSA 1ZVKA 5CGQB 3BMCB 4G4JA 4LHVA 1QLJA 4O0MA 1JLRA 1SVLA 4QD3A 3UT5B 5CFRA 1S89A 3CUKA 3R9WA 4ZRDA 3WGIA 4AG6A 2C9CA 4JJZA 5A02A 4BNDB 3AVXA 2NTNA 3AR3A 5C1OA 1JFSA 2JARA 2NXNA 3OTHA 2DTEA 4QDJA 2GAIA 4DHEA 1SQGA 5FAXA 1V7CA 2JIMA 3DD5A 3K9QO 1GADO 5D3QA 4EPWA 3D43A 3EZXA 2AWNA 4ND5A 5ALFA 4XLLA 5IVPA 1E1RD 2WZQA 4Q48A 4JR0A 5BWNA 5I9MA 4QDKA 1EE2A 3KJZA 3KLPX 4RWEA 2SKEA 4RIHA 2J5RA 4PCLA 4YT2A 1P5RA 1DO8A 1XXHB 2VAMA 2JB9A 3HLTA 6ABPA 1VLZA 1BJKA 2QJWA 3DOOA 4IICA 1ECPA 2VPZA 1TD9A 3HP7A 4JKOA 1NW6A 4B31A 1CDDA 4IJWA 3STVA 3BTVA 3EBPA 5LYJF 1D4AA 5LBTA 2QTHA 2IVFA 3WJAA 2RK3A 2P1ZA 3OO0A 1E3DA 4BBJA 3CGGA 5AKLA 3O83A 3BWEA 2OV4A 2OP1A 2BGIA 2O0MA 1HETA 1WZCA 4Y0NA 2RAUA 1RZRD 3EMBA 1JQAA 2BFDA 1VG8A 2ZSHA 4PS1A 3I9MA 9ATCA 1QF6A 4CLXA 4LX8A 3A0RB 5REQB 2NU7B 1NJ1A 5ECDA 1WVGA 1B0PA 3AFOA 3AZQA 4E46A 2R11A 3JAKA 4DGSA 4ZGWA 2VUSA 4I1IA 4IUBS 4QFCA 3TLBA 2WAOA 3TZQA 1E7RA 3KKOA 1HF3A 1T1RA 1AHHA 1VB3A 2VYQA 3HNOA 4WNIA 1V16A 1W0JA 1ZD1A 4RACA 4E31A 4V1CI 2FY8A 2I76A 1YV9A 1M72A 1GZSA 3F4KA 4GKVA 5ENZA 5FBWB 4WFKA 1HDYA 1PEDA 1R4NA 1SIBE 2X6QA 4L51A 3ROZA 3S2SA 3BZUA 3K0EA 3RFVA 3V6LA 4D0LB 3MC1A 4LQ4A 2IH4A 4UZFA 2CDCA 3N59A 3RJMA 5KB3A 2PQ2A 2Q9BA 2ZYUX 2JS7A 5C37A 2QSJA 4B9EA 2X2FA 5BQPA 2R65A 3P2EA 3DAHA 1QS0A 4D9MA 3QWBA 4OQMA 3LQFA 2CFIA 1CV2A 4OL0A 2PRIA 3EDOA 4LWZA 3VJKA 1S7GA 5EJ8A 2AZMA 3EUWA 1HE3A 2FOIA 1YIOA 2C7PA 4U5XA 4F6LA 2H92A 3EZNA 5F2EA 4MUIA 1FIUA 1W29A 1YD7A 4NPAA 2YVLA 5BNIA 1MQSA 2WT4A 1NNEA 3A2NA 4PYNA 1OBVA 1SB8A 3B9PA 4LDAA 3OQIB 3GXBA 4MUBA 4WJKB 5TV2A 4DC9A 2PSJA 3QUCA 2QPAA 5DE3A 4AN0A 2QP9X 4ZCRA 1J7JA 4QXQA 1SOUA 4JIGA 5HIKA 4JFAA 3A1EA 4YUZA 1KHHA 1S0UA 1T6BY 4PZYA 5DW3A 3HCAA 4II2A 3GEDA 4CG0A 4DPLA 2HDOA 2OXFA 3E70C 5B4UA 5BVHA 1L4MA 5ESRA 1YCFA 2WIFA 3IAXA 4FUTA 2PDAA 1W1IA 1B1AA 5THXA 1EVLA 3W5DA 4DCGA 3T12A 2ZIGA 3RYIA 3NDBB 1BS2A 3LV8A 1KEVA 4RVUA 3R3YA 1ZMXA 3VR4H 2QAJA 1DTSA 1I4EB 3ABOB 4K6CA 1YULA 5LQAA 2P2LA 1VKJA 2YWXA 4H1TA 5BSTA 2R6HA 2HREA 4G1EB 4Y18A 2JAUA 3UHFA 1T5SA 4A8JC 2LDBA 3UV6A 5IUNC 1IY9A 4HVAA 4D74A 3T94A 1Q2UA 1FX0B 4DCSA 4F85A 4BNDA 1PZGA 2B30A 5ISMA 3CMCO 4BV2A 5B3KA 1GPAA 3KT0A 4RF3A 1YZTA 3LL7A 1VIYA 5DULA 2EJWA 5DASA 3TLZA 4E7PA 4ZYLA 4EKYA 1R18A 4CLRA 1T43A 3GMIA 3DDOA 1HSZA 4PONA 1R3DA 4QEKA 2QSUA 3HB1A 3QVTA 1OA0A 3MINA 1DJQA 4MB0A 1ENYA 2QN7A 1COWA 2YYYA 2GI4A 4N03A 1E1QA 2GXQA 3D8HA 1FLDA 5L7YA 3U3KA 3AM5A 4BFXA 1PFGA 2Y1DA 3HKEB 4HGPA 4ZGBA 3ADBA 4FBGA 4OVKA 2CEKA 3QKRB 5J5AA 4MV3A 1XJCA 3ES9A 1K6XA 4MK4A 1EM8B 2HA4A 2FEAA 3O84A 4MRMB 2Z9DA 4TTVA 3TB4A 4MWCA 1ODKA 1TCCA 4L3WA 4Y9SA 2RH5A 3AZPA 5BQOA 1DBVO 4LVUA 4WLFA 5FNZA 2ZJ8A 5FWNA 1OUMA 3ZV7A 3KOZA 2H5LA 3D8TA 1NVXQ 2Q5FA 4R8LA 1M75A 4OXKA 4YLYA 2YJ5A 2HT1A 2E49A 3ONNA 4ES6A 4NZOA 3RS0A 4AJOA 5IU6A 2BI8A 3LLUA 2QB5A 1EUCA 2Z2IA 3Q6NA 1TB4A 1A5SB 1A7AA 4Q03A 4S1NA 1E4YA 3SHVA 5CFZA 3DNPA 3DZGA 4FB4A 2X7JA 1ZQ9A 4A2CA 3M89A 5I8PA 3PD7A 1YS7A 1XD2B 4I9HA 3VYUB 2W2MA 2ZWVA 4M1ZA 4R0MA 4ZDKA 2C04A 4DR5B 3FMIA 3KTDA 4LV5B 4HPXB 1M0TA 3GJTA 2QQGA 3K9NA 3JYHA 9LDBA 3NX4A 3PEFA 1THTA 2EW8A 5E6RA 1ID1A 2DFTA 3CE9A 2YQZA 4L6IA 4LF5B 1PNTA 2NZ8A 1E6LA 3DXZA 2ADMA 3MFYA 4V0KA 5IAGA 3R7WA 5F51A 1ZI9A 1PV2A 2TSYB 4U63A 4YI3A 4YAGA 1LK0A 1IDN1 5DNYB 1CQZA 1US8A 4EGCB 4PYKA 1JH9A 1WBBA 4LWPA 3IUEA 3MOSA 1KDVA 3EISA 4RTSA 3V5NA 2H1FA 2ZRMA 3U7GA 3NORA 4J16C 4DV0B 4PG7A 1UAYA 2L18A 2WJVA 3H1FA 1E0AA 2MJLA 4DJ5X 4H60A 2KJQA 3IP6A 4GPEA 4YVFA 2AF3C 3KFLA 3EDYA 4NATA 3SHQA 1UFOA 4DY4A 4QUEA 1N78A 3E5HA 5CHEA 1JPVA 2IYTA 2JJQA 2GTHA 2AMLA 3GT7A 5EUCA 4ZVSA 5LA6B 2WINI 4BKRA 3AV3A 5M04A 1LC3A 1NURA 4ARCA 2JFHA 2X5JO 5KKNB 3GA0A 1I6WA 3DYVA 2O06A 3D1JA 1RAAA 3GJZA 1VL2A 2RHCA 1U7DA 3P2KA 4MROA 3RTBA 721PA 1SXQA 4YX9A 1RMQA 1E3TA 1F6WA 1YDGA 3L8YA 4KH0A 3HFJA 2OFOA 3FUTA 3H9EO 4Q34A 5F2NA 1MQ8B 1P3JA 2XY4A 4HUQB 5DCUA 1Y3CE 4PO1A 5L40A 3SQWA 3WLTA 1EZ1A 1C50A 2QU7A 3OLXA 4FEEA 3LP8A 4WA7A 1L4EA 2XF2A 5TEVA 1IBSA 4UHHA 3S8MA 1P3Y1 4BMYA 4EG3A 1ZNXA 3PQ6A 1MEJA 1UIMA 3BD7A 1QQ6A 1T2AA 3GZJA 3KAKA 4HNGA 4FDUA 5DGCA 3TLYA 2COKA 1FNNA 4JLPA 4EMSA 3CG4A 3FGOA 5DCLA 3QFHA 2R8YA 1P1IA 2ZIAA 3QBEA 2CUNA 5JPDA 5EE1A 1QVZA 3N0XA 2G8NA 2HDWA 3BB1A 3BKWA 4M54A 1NXTA 1UFRA 5B3AA 2JLYA 1ELOA 4M46A 4NU5A 4C5AA 1AKQA 3LWBA 3LLMA 2QTLA 2BCGY 4CV2A 5CVVA 1ESCA 3FUWA 4A1OA 4MCHA 2AXNA 2HA2A 2PANA 3H5OA 2WM3A 4F21A 4UBNA 5IG2A 4URZR 4FHZA 1T8YA 1R50A 1U2RA 4F2DA 3U13A 4HX2A 4K46A 5TVKA 1RAGA 1ZVJA 1YS9A 3I8XA 5B1HA 3USES 4W1PA 4ZI5A 4JZKA 4EPYA 3W04A 4B3TB 3E9EA 3OT1A 2AEEA 4TV8A 3OCWA 3M6VA 4X95A 3L1IA 2FETA 1UAGA 2CXUA 1EVEA 4JC0A 1JN0A 4GHWA 3CMMA 3KEMA 4QODA 4LRYA 2NTYC 1SA0A 2R1VB 2QRUA 4FWBA 2ZVJA 1W5EA 3TTXA 4LY3A 4B7ZA 4EYEA 1NBMA 4QPJC 3T0IA 1G60A 1Y3HA 4RIFA 4NI5A 1Q0ZA 4PHCA 4DB2A 1YZQA 4K6MA 1ISGA 3OPQA 3QM1A 3IR6A 1H9BA 1W0CA 4H77A 4WZBB 5KHAA 3ROQA 4FMDF 4OKIA 1NFFA 1OKKD 3ZNOA 4YRDA 4DXAA 5FI3A 1NVFA 3ZE1B 2XNCA 3R41A 4AIIA 3U3MA 1O89A 2Q50A 2D7JA 3A6HA 1LQTA 1Z2AA 3FSRA 4KWIA 5EY5B 4ZGGA 3IV7A 4HATA 1MA0A 1VXOA 3IEUA 4K6HA 3X43A 4D26A 3P4XA 5DBGA 5EJIA 3MLBA 3RD5A 3Q7SA 4YJFB 3HWRA 1VG9B 1WHSB 1CJVC 1X14A 4X8MA 3RSOA 2GQ0A 4Z99A 2ZXUA 2GPWA 3RUIA 4LMPA 1F4LA 1SHKA 1E9CA 3P27A 4EDHA 6CHYA 4GMXA 2R6AA 2GWRA 4CE6A 1R12A 1S2GA 2Q99A 4K6KA 2DM6A 2NQ2C 1JG1A 3RUHA 4JSRA 1NYRA 1U9ZA 3SQNA 2O1SA 4KI0A 1NRIA 1V35A 1I1OA 1LSSA 3A3PA 4MWSA 4OJMX 4WXPA 2HTFA 3TZCA 3SFVA 4C6HA 1U0SY 2W11A 2ACEA 2CJWA 4EHHA 4QT4A 1WD5A 1ZL2A 5ECGC 1Z29A 1NMEA 2BR3A 5IYZF 3RSFA 4N5NA 4EECA 4EW6A 4MYDA 3NNDA 2WWXA 3AW8A 3AONB 1GAQA 1UZAA 2OV1A 3E58A 1GPUA 3KEOA 1F48A 5DT9A 1JI0A 2IK8A 2J6HA 3IE2A 2OXRA 1SC4A 3LBHA 5EJ4A 1JDNA 5HRAA 5K7SA 1X87A 4Q9HA 2COUA 5JSFA 1PHRA 3NOXA 4AS2A 3EG9B 2RD2A 3AQ4A 1OBCA 4MR8B 3TKYA 1GSHA 5AIBA 2IHKA 2Y3IA 2P5SA 1UOPA 5U4XA 2WR8A 3GAAA 2ZAGA 1Q15A 4LJ7A 3PFBA 4ERNA 5C80A 1H23A 5JARA 2Z6QA 1U90A 4EI2A 3PZRA 3GCGA 3MAJA 2VATA 1FW6A 2C9OA 2YNMD 3ZDQA 3AJ8A 5EN4A 4EG8A 3T1NA 2DBQA 3F73A 2QRGA 1UBNA 3ESCA 1F2UA 4EA9A 2G6BA 2DYKA 1GGFA 1M6WA 3RRJA 1W1WA 2E6KA 1LBQA 3U49A 1T8PA 4JLAA 3N2GB 4NBSA 4B73A 3G3EA 4FK8A 1WCV1 1NXQA 3B1JA 3L05A 4LNUA 1P5JA 5EOVA 4ZXFA 2C1EA 4Q1EA 4OFXA 3ZUPA 2LZ0A 5CVDA 1NI5A 2L2QA 2ZJBA 2UUPA 2ZB3A 3L79A 4Y2HA 1TAQA 4NBTA 3VR4A 4NH4A 2VYFA 3VZPA 1IC6A 3OT4A 3BXGA 1Z6XA 3LIIA 5C31A 2ZYTX 1BD3A 1UIRA 5DNVA 3LPDA 4CKCA 1J5PA 1USVA 2OB2A 3V8EA 3OM0A 5HDBB 1LDEA 5T41A 2IZ0A 3Q7RA 3TNFA 1RJDA 3EWIA 2J46A 1R6XA 2X0IA 4FGZA 2VUUA 2J85A 1P7VA 5AKIA 3RRBA 1WBDA 3QNMA 1NY5A 3QPAA 1RC8A 1T0IA 1ADBA 1TL7C 3GGSA 2I1LA 3PF9A 4G5QA 2XF8A 4MGHA 2YMQA 2QYSA 3EA5A 4IEFB 3TGWA 5ESXA 3IUQA 3SY8A 1FFGA 2CNNA 1QK4A 5A7FA 3V8RA 1EWVA 3OURA 1NMXA 1R9JA 1UQUA 3ER6A 3AIIA 3PRYA 3DTYA 3IBYA 2GZAA 5CDFE 2NPFA 3ITKA 3PUZA 1J21A 4Z4CA 4X71A 2DQ4A 1RM3A 3DBHA 1WHTA 3PE4A 4YUAA 1DKOA 1SHZA 4P93A 4IDPA 1J7KA 1JDZA 3EY4A 3K94A 4R81A 2CXXA 4EFDA 1LWNA 3OSZA 2ID9A 2I6XA 3IQEA 5SYAA 2IZ6A 1C2TA 4ZK2A 1AB5A 4AP5A 1X9IA 3GRFA 3VAYA 2BGGA 5J4YA 4KJZA 1MMFB 3RVLA 1UWCA 1HG0A 1FSFA 4DNXA 1EUZA 2WAYA 4I8DA 2NO1A 3R8XA 4B4UA 1ISPA 1ECBA 2VYNA 4IGAA 3N2KA 3KAPA 1XMIA 4F38A 2Y68A 2ATXA 2IITA 2OLEA 1IUOA 4R7GA 4D46A 5HPYB 2FWMX 4HH1A 4P0TA 2I4IA 2FMIA 2JF0A 5CTAA 3K70C 3N75A 3W3AD 3DEFA 4BGUA 2FUG6 4IUYA 1G8KA 2WD7A 2TMDA 2H59A 4NBLA 1TT5A 1DOAA 3OLZA 4J03A 2J0SA 4L2IA 1S2LA 4FJ0A 3QEMB 1T5IA 1P9WA 4C30A 1QXSA 2WJIA 1Z74A 4UXJA 5ITVA 1BEUB 1P0FA 3KEGA 1VHDA 2FQQA 1MVOA 1ZMTA 2PH1A 1NUUA 1OV4A 3ET5A 3KWFA 4RPGA 5ALWA 4PEVA 5K4HA 4TZ0A 1TVMA 3KSMA 3SKYA 4WOPA 4FSHA 2Q5IA 3UUEA 4FM9A 2XV1A 1J49A 1HZZC 2QRMA 2Q6TA 3OY2A 1JR3A 3SZGA 4Z3OA 3DMFA 1RKQA 3UHOA 2VHEA 2V6FA 2QENA 1T13A 4P35A 1NN5A 3G1UA 2AZDA 3COJA 4B7CA 3LXRA 1DKLA 2EWVA 2NACA 2OENG 2X0JA 3GZTB 4J4TA 4ROTA 4TXHA 3UAGA 4C4RA 2H54A 1RMTA 3N76A 2ARKA 2IRWA 2YVUA 3C1OA 4KLAA 5BSHA 1DAHA 1AX9A 5HRCA 5J5CA 3ZHSA 4QVIA 4HDNB 4UTPA 5IT9A 4RKQA 3A2LA 2GLUA 4M8KA 1UF9A 3N7UA 1JA0A 4AD8A 3G5AA 5MGNA 1I1HA 3LA8A 1ZH4A 2DEUA 4AG3A 3L7CA 2JGMA 4D92A 2PRJA 3W4KA 2XMSA 2BI7A 4ARZA 4XM0A 1G8AA 3T7EA 2FEOA 4XQGA 2ZW9A 5ENDA 4J0EA 1FVXA 4BEBA 3SJZA 4S3MA 4M8SA 1RQRA 4BNLA 4M87A 3VDMA 2JA1A 2ZJ5A 1Z83A 1IWOA 2HSZA 3QXHA 1L7QA 3IDOA 3ONWA 3HPQA 1A0OA 3LSYA 3LC1O 3QLJA 3BCUA 1NHWA 4HLUC 5J58A 4RF2A 3PX3A 5ALTA 4K9RA 1L6IA 4CEHB 1Q7RA 2ZYWX