1WE2A

Crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with mgadp and shikimic acid
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
165
structure length
165
Chain Sequence
b'APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate kinase
publication title Structure of shikimate kinase from Mycobacterium tuberculosis reveals the binding of shikimic acid.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 63
structure length 165
sequence length 165
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2004-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1we2A00
1BH2A 3X1ZA 1E2IA 3CX7A 2IEZA 2FEMA 4XWAA 4CDGA 1JPNA 2IBMA 5KSYA 4D4KA 1AZSC 1IN5A 2FZLA 2ZRBA 1NJGA 2F3TA 3I73A 3NWJA 4LPKA 1SHZA 1CP2A 1RPZA 1NF3A 1W2GA 2GEVA 2RMKA 4RD1A 5GJVC 3AVTA 4NYJQ 4TQAA 3GP8A 4OQFA 5TVKA 1UM8A 4YXWA 3PUVA 4PZYA 2OEPA 3L0SA 1JBKA 3GEEA 3SI7A 4URXR 1QVRA 4QJ4A 3U7GA 2XTMA 2WSSD 3ZS8A 2QSYA 4BLPA 2ZETA 2HV8A 1OXSC 3OIYA 2FA9A 4XD7D 3UG6A 3WP1B 2QA5A 3TAUA 1VYUA 4G5GA 4A8JB 1E0JA 4URWR 1HURA 2QQ0A 4Q21A 1UDXA 1E79D 2ZRIA 3VNVA 2HJVA 2JLQA 4PHTA 2QEQA 1N6HA 5A0FA 3AF4A 4A6PA 5JRZA 1OKKA 4B76A 1E2DA 4ZCIA 5EP1A 3OIVA 4S35A 3PEUA 1KTVA 2QBYB 2ZAMA 2YWEA 1ZD9A 1F2UB 3B9PA 4B3FX 4QBIA 5EE3A 2Q3HA 1L4YA 5JWOA 4FCTA 4A2QA 2D3WA 2MSCB 1GIAA 5CYOA 4QRHA 3NEJA 3PXGA 1BS1A 2WIBA 1T8UA 4JJZA 3LY5A 5JWHA 3P26A 1R0XA 3U6KA 4US2R 2CK3A 3CLVA 1IOZA 2V54A 1G4UR 2CCKA 5C4MA 3A37A 2KBEA 2PZFA 1KSGA 4HSEA 3LBNA 4YMVA 2VF7A 3IQXA 1P60A 3IBGA 5JEEA 221PA 3MUFA 4Q4HB 4EJSA 1NVVR 4MGZR 1BMFA 4LJ5A 1F5NA 1JR3A 4KYUA 4I1VA 3I8XA 3FKSD 2BC9A 4I99A 5BN3A 1GKUB 3O8CA 1XFAA 1TQ4A 1TF2A 3AVUA 2BVNA 2CHQA 2XTNA 4X8HA 2ZSFA 2Q3MA 4ARZB 2QTFA 5K8TA 1UKVY 2GJSA 3L8YA 3LQRA 4MRSA 3T1OA 4C9BA 1OFUX 1P4SA 3NTUA 2NO6A 2V8OA 3TSWA 3MCAA 3BERA 2NO0A 4OQXA 4CT5A 5LPNA 4HLQB 4XWOA 5KNCA 1BYUA 3BC1A 1NSTA 5C1BA 1US8B 3L2OB 1VCOA 4LHWA 1UBCA 5FOWA 4Z1MD 3RS5A 3BOSA 3KQLA 3UIEA 4AWXA 2OCYC 2W58A 3ASYA 5FBRB 4EKDA 3MRSA 1NMXA 5JZVA 3BJIC 4JT2A 6Q21A 2R6CA 2IL1A 1DAIA 3NEYA 2KJQA 5HCNA 2CVFA 5KPJA 2ZRCA 3K70D 5TB5A 2KSQA 3A4NA 4LV5B 3AF2A 4HAXA 3U7EB 3T5GA 1Z0JA 2NZ8A 2XAUA 4K46A 5KTYA 4AK9A 1D2EA 1G3IA 1Q20A 1G3QA 3NIBA 4DC9A 3LXXA 3DOFA 2GKSA 3EASA 3SYKA 3NBXX 2F1RA 1YRAA 2EW1A 4YONB 3KJIA 4WW0A 3GPLA 3QF4A 1LF0A 2QSZA 4CF7A 1E1RA 1ONBA 3U44A 4B3XA 4PSVA 5P21A 2W2VA 3QKTA 2BCJQ 4N1AA 4PSKA 4A0HA 4Q1DA 2GZHA 3CNNA 2F43A 1JPJA 1MO6A 1GKYA 2GNOA 5FUXA 4UJ3A 3HP1A 3I4LA 2ZVPX 4D4LA 1A82A 4AI6A 1KK0A 3H2YA 3SJZA 5JCPA 3PEWA 3RDPA 4IOKA 4DHEA 2XITA 4IW3B 1E9SA 5GJBA 2VSXA 1KY2A 1ZU5A 3EZ6A 4TZ6A 2ZR0A 3PEVA 2BJWA 4L15A 3VAAA 2ZR9A 4BFZA 1ZIPA 1MKYA 2QG6A 1E32A 2J45A 4DB2A 3AVQA 2WWXA 2PZEA 3IHWA 4BFWA 4C4PA 2D7DA 1G6HA 3C41J 4RD3A 4FCVA 4IEIA 4QGGA 2ZTSA 2AK2A 2OM2A 2X2FA 3NBZC 3T15A 1ZP6A 2YYZA 2FV8A 2ZRDA 4L5BA 1KGDA 4IDQA 2VF8A 2FH5B 4L9SA 3CF6R 4QNRA 1UF9A 1GDDA 2DFLA 4OBEA 2F6RA 4QBFA 3MWYW 4Q7LA 3UG7A 2D7CA 2RGBA 3P4XA 1HQYE 5IK2A 1E0SA 5EP3A 2A5JA 1NBME 5B58C 2YNMA 5UKDA 4HLDA 3GLHA 2WKRA 5LBIA 2VP0A 4PSAA 2V6IA 2GXQA 4HAYA 4UJ5A 1NVWQ 2GAAA 2VHTA 4FMCB 4RD6A 5AJYA 1P2SA 2ERYA 5DYIA 2C04A 2HCBA 5FOTA 4XTRA 4RZUA 4DKXA 3FE2A 1E9FA 1SVWA 3DVLA 4RZ2A 3H1TA 5HPYB 3KQUA 1QBKC 4IHQA 1ZW6A 1CIPA 4DIEA 1WXQA 3C7KA 4QC2A 4MGKR 2O8BA 2JLRA 1ZUIA 3AKCA 4KBGA 1TQDA 4P3YA 3P1JA 4EAQA 4DLYA 1IAQA 2GESA 1XMSA 3MSXA 4GFDA 2OLKA 1G8GA 4C30A 4GOXA 4EJSB 2IT1A 2RGDA 1G7TA 1H8HD 1QZXA 4LYJA 1DG3A 721PA 2XJ9A 2P0EA 1E1QA 2PLRA 2VA8A 2IF0A 4UXIA 3LX5A 2PJRA 4Q1EA 3TAHA 4TSFD 1HUQA 4Q1AA 4RCZA 3RYTC 2XSZD 1RJ9A 5BYJA 5DH9A 4BLOA 4TMXA 3REGA 2W6JD 1G291 3BAFA 5CLQA 1OH5A 2GCOA 2Z4RA 4JVSB 2ERXA 4Q18A 1QHHA 4M4SA 3FPAA 1NVVQ 1KMHA 1J8MF 4M1TA 3LLUA 4TN1A 4KSCA 2FGJA 1WQ1R 3EZ2A 1SXJC 2JLZA 1YJ5A 5EQTA 4XWKA 3RNLA 1W4RA 1KDTA 1SKQA 1KYIA 1ZNYA 3JVVA 3RWOA 4BLRA 5KDOA 4V03A 1G64A 2CBZA 3ADKA 3KB1A 2D2FA 1KK1A 1NLYA 1S9DA 1Q1BA 1NIPA 3OFND 5FTNA 4ZI2A 5FOSA 3NH9A 3KKNA 2VHCA 2C95A 1XTIA 1Q57A 1YR8A 2OXCA 5DHFA 3AQ4A 4PO1A 5CDFA 3R9XA 2VBCA 1F48A 1W4AA 2GRJA 2JDIA 3MWJA 3ADBA 2OESA 4AKGA 4EFNA 3QF4B 4DJTA 1SXJE 2H92A 4N3NA 3THXA 4DCNA 2CHVA 2WMNB 3VNUA 3U44B 4E09A 4URVR 4C7OA 4Q66C 3VKHA 1L2TA 2IA5A 1ZM7A 1X1RA 4A9AA 1L8QA 2QE7D 1RYFA 4R7ZA 2R8RA 3QKSA 4O2RA 2F43B 4BEBA 4B47A 4QFMA 1OYYA 2C9YA 2HF8A 4M1SA 3CF0A 1AS2A 4EPVA 3AVPA 2ORIA 1EXMA 2WKQA 2I4IA 2FWRA 3TBKA 4A1FA 3B1YA 121PA 2QRZA 3RC3A 1UAAA 4RCYA 4FINA 3ZVLA 1G18A 1RKBA 4OQMA 3U5ZB 1U8ZA 1G8FA 4US0R 3G5UA 1NMZA 2AKYA 2IYXA 2XEXA 1B0UA 1M2OB 3GEIA 4QL3A 4IJMA 2ORVA 1W5TA 4HLUC 4S2EA 5FPHA 3RRMA 1KY3A 4HEJA 4QBGB 5C46F 3BRWD 1KKLA 1P61B 4R98A 1CR2A 4ZKEA 2MMGA 1T6NA 821PA 1CJTC 1NBMD 4HAVA 1DO0A 1P5ZB 5L3RA 4PC6A 4QXAA 4CEHA 3QI2A 2GK6A 1E3MA 3EX7C 1Z6TA 4KODA 3L82B 3LVRE 3SQWA 4HAZA 1G8PA 3GLGA 3GEHA 3HPRA 4MUBA 1KJYA 3RS4A 3SHFA 2OAP1 1AQUA 3FTQA 2J41A 3E1SA 3P32A 4JLPA 3GLHB 1IY0A 1W5SA 1E0KA 4Q4AA 4M8NE 2C8VA 3UANA 3I5YA 2A30A 1N6RA 4KSBA 3DZ8A 4AYWA 2EFEB 2F9MA 2P5SA 4EPYA 4CW7A 1ZAKA 2FOLA 1CR1A 2CNWD 2IXFA 2JAQA 5H68A 4GZMA 2GJKA 1N6KA 2YC2C 4U02A 5J4HA 4NTZA 2REXB 2O8BB 1FL9A 1S2MA 5KPDA 1A1VA 3AVVA 1PUIA 3ADDA 2B8TA 5ANRB 1OF1A 2EQBA 1QHSA 2QROA 2EFHB 5HKKA 1KKMA 1FFHA 4NCIA 3RS3A 5DHAA 5BW8A 2RGEA 3QUSA 1KI9A 1XMJA 4DLZA 4PFSA 4LJ7A 2A2ZA 2WTUA 2XNSA 4A0FA 2P6UA 1YZGA 1AM4D 2BBWA 2OZEA 4Q1CA 2YV5A 5DSZA 3CKLA 1NIJA 1ZM3A 1N25A 3ETLA 1OB5A 3OEEA 2PMKA 4XIGS 1XPRA 1RJ9B 3BIFA 3FDIA 4KO8A 5DN6D 3EW9A 2GCOB 3AVYA 1QHHB 2XB4A 1G19A 1KMHB 5DYGA 1DAGA 2CHGA 2HXSA 2JLYA 3LBHA 3ZVNA 4DLXA 4OQNA 4B3CA 3JVUA 1M34E 3A1VA 4DCSA 1QVAA 1E4VA 2O52A 1KSHA 3KQHA 1Y63A 5CIWA 1U0LA 1ZCBA 3KX2A 3GJ6A 4MRVA 1E2JA 4QHSA 4B43A 3DKPA 1SXJD 3LA6A 2F9LA 2JIZD 2WPDD 4ZCLA 2J0SA 1OHHA 1LV7A 2D62A 2C9CA 2Y8EA 4I1SA 4B3GA 1Z08A 1XX6A 1IXSB 1E6CA 1VKJA 3RRNA 3GJ5A 5EJEA 4CEJA 3S1AA 2W2XA 5KDDA 2OBLA 1AIPA 2R9VA 4TMVA 3THXB 2W6ID 3O8RA 1G5TA 4C7OB 2REOA 2EWWA 4UNSA 3TNFA 1OE0A 5K8LA 2JJ2A 4PAOA 5FUVA 3RS7A 3QKSB 3QPVA 4ZDIA 5LDDC 1P6XA 2X77A 1BOFA 1ANKA 4NYMR 3WNCA 4PZZA 3IBYA 3NG1A 4Z8XA 2BOVA 4BASA 1COWD 1MR3F 2HLDD 2E9SA 3AP1A 3Q7QA 4Q1FA 4BUJA 1U90A 2DWPA 4IDHA 3H4MA 5HE9A 1MO3A 1YZUA 1CJUC 3LBIA 3SFVA 2FN4A 3CRW1 4LJ8A 4D2IA 2ZSAA 1XXHA 3NKVA 2BHRA 2CE2X 4TZ0A 2R62A 3VHXA 5JBQA 3GLFA 3U60B 4GT1A 2VSOA 2P6RA 1UBGA 2JEOA 2AXNA 4XVQA 4B73A 2VRWA 3UMSA 5FPSA 3SBDA 4LHVA 3AF1A 4F4JA 4HB0A 4CEHB 2DWQA 4OHYA 2V1XA 1BIFA 1IN8A 1II8A 1WDTA 5JSZA 1N5IA 4JKIA 1NG9A 3KFXA 4UQOA 3IPYA 3GLGB 1XDBA 5K8UA 1G1MA 4YMWA 2P3SA 1M1YE 5FL7A 4US1R 3EIEA 4IRUB 1JQLB 1VIAA 5D3MA 4R2HA 2IWHA 3RLFA 3TQCA 3T06B 4BFYA 4DCTA 4Q4AB 1M7GA 2L0XA 4XTCS 3SEAA 2GXSA 4ILEA 2O8EA 3PUYA 4FXPA 3CNLA 1EFHA 2IHYA 2OFWA 4LYHA 1SVSA 1ZMXA 4LI0A 1XJCA 4LBWA 4Q7MB 1CJKC 5ELXA 2B21A 4AYXA 3EPJA 2AX4A 2X19A 3CONA 4CYMA 1CF4A 1KDRA 2ZRMA 3T1QA 1GRQA 3K0SA 2GTPA 2OFXA 3QXSA 4L9WA 1Z28A 2V7QA 4P32A 4KV9A 4A92A 1X3SA 4PXAA 4NH0A 1NI3A 1OW3B 1T3HA 2PMDA 2QENA 3WMEA 1Z5ZA 3AP2A 2ZYTX 3Q85A 5KSZA 4G3XA 1YVDA 1H8HA 3QE0A 2V55B 5F9FA 4LBZA 5DISB 1SULA 2QORA 5L3SA 1CLUA 3D6TB 4V0KA 2OO7A 2J7PA 4C0SA 1N2CE 1VYVA 2OCAA 4TT3D 4ZIRA 2PJZA 4UKDA 5LD2C 3GFOA 1MABA 4C0JA 2H57A 2GDJA 2XOKA 1Z83A 3AKDA 3X1DA 3Q3JB 2RH5A 3R9WA 2W6JA 2BMDA 2DWOA 4JLKA 3TSOA 1CU1A 1OPXA 3EG5A 3T5DA 5CB6A 1ZINA 3QPUA 3DMDA 2NZJA 3A4LA 4RD2A 2X2EA 3RABA 5AK0A 3FMFA 2W0SA 4Y0VA 5FPKA 2I1VB 4WXRA 5SZHB 1QF9A 5FOXA 1TU4A 1Q1EA 1NKTA 2ZI9A 2OG2A 3P4YA 3A1TA 4DLSA 3K0FB 1T3LA 5IHPA 1MV5A 5AUPB 1G16A 4CEJB 4A36A 1V43A 1KK3A 3S1AB 2XJ4A 2QNRA 3J81k 4PO8A 5TARA 1S9HA 4G5RA 2ZITA 2FF7A 1FW6A 1GNQA 3F8TA 1F6BA 1Z07A 4O25A 5EXTA 3OF5A 2ZUDA 2WWFA 3IKJA 4C3ZA 2QL6A 1JXMA 1QHGA 4PO9A 1P62B 3MJHA 1ZM2A 3KQKA 1I4DD 1WRBA 3PENA 3QXXA 4IFEA 2HF9A 4KVAA 3KJHA 1XF9A 3C5HA 1KI1A 1PJRA 1F2TA 2VP5A 3AVOA 4LJ9A 2FFHA 1XTKA 3LQQA 1DAFA 2ZIAA 3SE0A 2ZPTX 2QI9C 3KXKA 4RFSA 4Q19A 3W90A 4MRNA 3BORA 1XXHB 3K09A 2ZE8A 3B13B 1UKZA 2WJYA 4PAQA 4PHHA 3GLFB 3REFA 2HJGA 3OEHA 3K0EA 4WZAE 4QG7A 3ZGXA 4G0NA 1P72A 4AYTA 1E2LA 2ZI6A 2PEYA 2FJUA 3OZXA 2WOJA 2EFDB 5FR2A 2EFGA 2QPOA 1II8B 1H8ED 4PHGA 5JSZB 5GJWC 4C2UA 2C2HA 4FD2A 2VH5R 4QHYA 4XVRA 3IPXA 1TNDA 3U4QA 1LW7A 4OHVA 2QP3A 4MYHA 4MITA 4BZXA 5EP2A 4A8JC 3LO5A 2ZE5A 1GRNA 2FMXA 2ZJYA 2IYZA 5D3MB 3HU1A 3RWMB 1PZNA 4AKHA 2A5YB 1W36B 4V0OA 4D26A 4LWZA 4M9XA 5DO9A 2O8EB 4QKQA 2ZEJA 5JRJA 2WJJA 3WYAA 2Z0MA 2WAXA 3EZ9A 2IYYA 1I4LD 4HDQB 1U94A 2FG5A 2N46A 2R6DA 2QPTA 2CNWA 2EVWX 3NHAA 4JIMA 2NO7A 3MG9A 5CK4A 2D74A 3JZAA 4KHZA 4TMWA 3BD9A 4LSGA 4HUTA 1FMLA 4JSYA 1N0WA 1NSFA 1P3JA 3I3SR 1XEWY 3QPWA 4L4UA 4V0ME 1G17A 1Q1QA 4II7A 3AKYA 4LUCA 1KJWA 4F93B 1KK2A 1CRQA 1Z22A 4B32A 4JLVA 1FQKA 2V6JA 2F1JA 4D4JA 2H5EA 5FTJA 1NL3A 5G3YA 1T0JB 1WA5A 4IVRA 2G83A 2J0UA 5L3SB 1RZ3A 4DDWA 5L8VA 4MKHA 1DADA 1VG9B 3EC1A 5JS7A 1VHTA 4ZIRB 1M8PA 1OLOA 4LX0A 3LDAA 1MABB 2E1RA 3SN6A 2R6AA 3B78A 4BGDA 2FPKA 3EPKA 3ZYCA 1DE0A 1OYWA 1XCMA 5F9HA 5F3WB 4CT4B 3AB3A 2XNDA 2C03A 3N5CA 3FWYA 3W8RA 4LJ6A 4MYCA 3NBFA 2FPMA 2JJ1D 2VP2A 2RCNA 2GVZC 1W2HA 3W3AA 4DDUA 1G3MA 1TUIA 2A5DA 3PCRB 2ONJA 3QBVA 5EE5B 3WHKA 3SNHA 4JYBA 1JJVA 3GJ0A 1SKYB 2ZJ2A 3AUXA 4LV8B 2RGNA 4FW9A 1U2RA 4PQYA 5AUQA 1SVIA 1NRJB 3RSLA 2IX3A 2XZOA 4Q9IA 8OHMA 5CM8B 1SVLA 3OE7D 4OI2A 5FTMA 1IXRC 4EPWA 3K0CC 1R0WA 2JIZA 1PLLA 4QBHA 4W5JA 4HAUA 3TIFA 4DUGD 1FX0A 2IS6A 1Z6GA 2ZE7A 2AL7A 4Q03A 1X8KA 3A4MA 4WBSA 3MWLA 3TGPA 1PV4A 1ZM9A 1U99A 2NO1A 3PFIA 4ACBA 2YWGA 2W6IA 4FMCF 2NOAA 2CCGA 4Q9JA 1ETUA 2NPIA 3RVBA 1Q21A 1U0HC 1W0KA 2O0HA 4D0LB 1NN3A 1KAGA 5GJCA 2XTZA 3CRMA 1F2TB 2ZREA 3EPHA 4MKIA 1KDPA 1ZD1A 1TPZA 1YRBA 3HU2A 2MSEB 1W0JA 4RFSB 1AJEA 1IJEA 2CLCX 3TMKA 4IOLA 3EWSA 4K8OA 4M22A 2ANBA 5DI9A 1X8JA 2AFHE 3AUYA 1W44A 1FZQA 1AA9A 5K8IA 1F3OA 1YR6A 1N5LA 3VX3A 3TE6A 1ZIOA 4CEIA 1N0VC 2AN9A 1VCNA 1KIMA 2AFIE 2ZJBA 3SJCA 3NXSA 521PA 1KO1A 2OXRA 4AG5A 4M1WA 1G7CA 4DDTA 1CULC 1P9NA 3VFDA 3U4QB 3CRVA 2ZYVX 3U3RA 1PLJA 4HLUA 3K8YA 1CEEA 1GILA 1XD2A 2XX3A 5FTLA 4DCVA 3T1TA 3QSYA 1N3BA 2GCNA 1VECA 3GFTA 3WRYC 5BXQC 4DVGA 1JAHA 2P65A 3CZQA 2J59A 1YZKA 4MKFA 1E9BA 2HCJB 2QM8A 4TTQA 2YC4C 1KHTA 1YZLA 2PLFA 2CLDX 1EFRD 2J0QA 2AD5A 3X1WA 3VX4A 1KI6A 1UJ2A 3BE4A 4DLUA 4V02A 2WICA 2IK8A 1HE8B 3T61A 2B6HA 1VYTA 5E7MA 3QKUA 1XMVA 1J2JA 2NQ2C 1TQ2A 2IUTA 2LKCA 1JALA 2ZUBA 3GCGA 2QTVB 3PG5A 3OAAA 1A7JA 5CM9C 1O87A 1KO8A 1TTTA 4B6EA 3K9LA 2XZPA 5HZHA 3LVQE 1Q3TA 3ECCA 5IDVA 2ZROA 4EJSC 3KKOA 2XB2A 2ZRFA 1XCPA 1OH6A 1KI8A 4LCBA 1MRSA 1HT1E 1KO7A 3W34A 1XP8A 2PX0A 4JBXA 2AXPA 3ZIAD 1K8RA 1A2KC 5KOYA 3DM9B 2J0UB 2LKDA 3I62A 4ABYA 1JJ7A 1SVKA 1G8YA 4LZZA 4MDEA 2O8DA 1E2HA 4ZO4A 3E5HA 5KU1A 1ZJ6A 1GM5A 4HB3A 2OAQ1 1KAOA 2P67A 3UMRA 2JCSA 1ESMA 2KWIA 1Z0AA 2EU8A 3HWSA 2BM0A 3PUZA 4AG6A 2YKGA 3N70A 4PAMA 3W8NA 1U9IA 4M53A 3U61B 1XJ0A 2GF9A 1JR3E 1G3RA 2RGAA 2CJWA 3QVUA 2YOGA 4AKIA 3BH0A 3CR7A 5TDHA 1Z6XA 3EA5A 4MUAA 3ICEA 1P73A 4RFVA 3K53A 1W49A 4GDFA 4FMDB 4KU4A 1VDZA 4DEYA 1R0YA 4W7SA 2ZRPA 2BBOA 1C4OA 3ND8A 3SHWA 3UKDA 5FBLB 4YDSA 4GRAA 2NPFA 3THWA 3F3YA 1FX0B 1OIXA 2A9KA 1HYQA 3QJYA 3BH7A 3AGPA 4AIIA 2ZI3A 4GSYA 3U3JA 2HXYA 1J70A 1P2VA 1VG8A 4TQUS 2WWYA 2R44A 5H70A 3AM1A 2BIFA 2ZYUX 1T4GA 1NVXQ 2IXGA 4BFUA 4P33A 4XSGA 2MMCA 1XEWX 2WZQA 4G1UC 1OV4A 2A3RA 3B1XA 1K5GA 2JLUA 1QHIA 3WNDA 4IFBA 3E2IA 3FFBA 5C4GB 3B85A 3B60A 3RANA 5TMPA 4MGYR 1U8YA 1II0A 4U7DA 1D2NA 1TF5A 4NONA 5C18A 4NE2A 1P9WA 5FBWB 3RS2A 2AD1A 3X1XA 1KO5A 4OJQA 2ZI4A 1JR6A 2YOHA 4Q9HA 4QM6A 1NLFA 2AR7A 1JAIA 2OE2A 1ZCAA 4OK3A 4UXJA 5GVSA 1ZYUA 1Z0KA 1RC8A 4CEIB 3CH5A 1HA3A 4YXWD 3VR3A 1C9KA 4BECA 3CZPA 2ASEA 2WSSA 3WBJA 1HEIA 3CPEA 3WNBA 2ODEA 3M1IA 2ORWA 4A4DA 3TVDA 4NPHA 3UWKA 1DARA 1VPLA 2PEZA 2V9PA 5FI1B 4DBLC 2LWIA 4XD7A 3W3ZB 4KCGA 2IC5A 1G7SA 1U8AA 4DXAA 1MH1A 4X8MA 1GITA 4YDHB 1XD2B 4NYIR 4D25A 5J4LA 2TMKA 5EXPA 4GNKA 4LDJA 1E96A 1ZM4A 3KJGA 1E79A 1JB1A 5EE0A 4LRWA 1P7CA 1AK2A 5EP4A 2ANCA 3MLEA 4TQ9A 4OYHA 1IN7A 1HQCA 4JLJA 4TYNA 4NCJA 4UXHA 4JLAA 5AR1A 4RD4A 3CWQA 1KI6B 2BEJA 2Z4SA 1Z6YA 5CIQA 4WVFA 2RHMA 2WWGA 4KFUA 3LW7A 4KLZA 3DZDA 1WBBA 4RZXA 3CRRA 3B9QA 2W2TA 1XEFA 1RYHA 4BRUA 4GPTA 4I81A 1Q12A 4RD0A 2ZQ5A 1TEXA 1IXZA 1E2GA 4MQBA 3ZD6A 1NKSA 5JJKA 4D80A 2B8WA 3GLHE 1U0JA 3G82C 2CK3D 4CIDA 3ICQB 3IUYA 4PC2A 1VCMA 3L0PA 4RSGA 5KNDA 3AF3A 1E2NA 4HATA 4Q00A 3W9YA 2UVQA 3I72A 1QHYA 2QPAA 3QEOA 3SQXA 4JL6A 4JZKA 1OH8A 3FKSA 3K1JA 3WY9A 3Q5EA 4B2PA 4G5SA 4TMTA 3TUIC 1BMFD 3FB4A 1OH7A 1TL7C 4URZR 3EWAA 3PV0A 4LBVA 2DB3A 4C0KA 1GSIA 2O8DB 2Z83A 3UXMA 4DWJA 2OCBA 2OILA 1ELOA 5JMTA 1KOFA 2GF0A 4LK2A 2VLIA 4CRWB 5KO2A 1XZQA 3SR0A 4B33A 1E2PA 1U81A 3WXMA 3GLIA 4JVMA 1Z0DA 2GETA 3EA0A 3I32A 2QTHA 4I4LA 2FE4A 2Q9AA 2AK3A 3A1WA 5FBVB 4Z1MA 1P2UA 4QGFA 1RIFA 2PT7A 3NC1C 1KZGB 1T3SA 4TLCA 1JXOA 4M9QA 4DLVA 1LS6A 3BS4A 4HAWA 2ZM5A 3CH4B 4R2IA 2GBLC 4PX9A 1Z47A 1ZD8A 1ZVQA 5HR5A 1G4AE 1I2MA 1M7BA 2BKEA 3GJ8A 3THWB 1Z29A 4BWYA 4P31A 4FWIB 4E5UA 2IUSA 1Z3IX 1R4AA 4IVQA 1YQTA 5EE1A 2O0JA 3U2QA 4OK5A 2QMHA 4U5XA 4W5WA 2NGRA 3GFPA 1OXUA 3FGNA 1Q1ZA 1NN0A 2QAGA 2WOOA 3TW4A 4D82A 3VR2A 1JNYA 4B6FA 1FQJA 1NN5A 1X86B 2P6NA 3AVXA 2A5FA 4B35A 4IOMA 1SQ5A 1NY5A 1CTQA 4M9ZA 4ZPXA 5E7IA 4NP6A 4EFLA 2BV3A 1E1RD 2GK7A 3C14C 4JT4A 1AS3A 4KYIB 3QNUA 2RAPA 2FPLA 1FNNA 2DHRA 2Q0HA 2QGNA 3NH6A 2CEAA 5CDFE 3IDQA 4GBMA 4LHZA 3SOPA 3VU9A 4DSNA 2IW3A 3KUDA 4JKYA 1RRCA 2C99A 2D2EA 2ZSEA 5JWRA 4M9SA 2WWHA 1FUUA 3RAPR 2G1KA 3PEYA 5JS8A 4ON9A 1RRFA 4G01B 4OI0A 2HT6A 2JJ8A 4F91B 3DMNA 5AUOB 1JQJC 1DAKA 1L7VC 2OT3B 2SHKA 4YLGA 3BWDD 3KTAA 4WAUA 4PHFA 4URUR 1A2BA 1EK0A 1GNPA 2VL7A 3BFXA 1EWQA 3TK1A 3K0AA 4URYR 2BBTA 1IY1A 2R6FA 2BM1A 1TF7A 4LY6A 4O0MA 3TRFA 1I4TD 4NMMA 4Q7JB 4JBYA 2CMKA 5EE9A 2ATXA 5J4YA 4BFXA 3B1WA 3LWNA 3ADCA 2IHBA 2GCPA 2ZRAA 3BH6A 4QOSA 3WRXC 1U98A 1GVNB 1DEKA 4NHOA 5FI0B 1O3YA 4A2WA 2ZUCA 4H1UA 3NVAA 1XCGB 2WSMA 4KFSA 4NDZA 4WOPA 4IKEA 4BLTA 1D5CA 4AURA 4IDNA 4B34A 3B7GA 1Z2CA 1N6OA 4IVPA 4AC9A 4EQ6A 3CPHA 5FBQB 5IK2D 2FFBA 4PC7A 2J1LA 1ZRHA 3VKWA 1XTQA 2IYWA 1G21E 2X8AA 1T91A 3WMGA 3FYHA 2H18A 4LJAA 5KUTA 1R6BX 4NYIQ 2ZRLA 4UNQA 3GLGE 1R8QA 1DPFA 4I1UA 4Z54A 2IS2A 4EPXA 3VR5A 3P27A 2VP9A 4AD8A 4GP6A 2XZLA 1F2UA 2PH1A 1AQYA 1M6NA 1E2FA 1TUEA 2QMOA 1E69A 1FTNA 2WVJA 4Q48A 5J4VA 1Q44A 2OHFA 2QQEA 4Q9LA 2XXAA 1R10A 2HYIC 1UBFA 4MH0R 4Q5IA 5DGXA 5FL3A 1D9ZA 1EFCA 4FI3C 3LAWA 3TVTA 3ZD7A 3CB4A 2W0MA 2ODWA 3MWKA 4TSFA 2HUPA 3CWZA 1OIVA 3LX8A 4KFRA 2GXAA 4B3DA 1E1QD 4E07A 5HZKA 1R5OA 3UATA 5IF9A 3CR8A 1XTRA 1DS6A 1KO4A 3GLIB 3DL0A 3U3MA 2C96A 2XSZA 2YZ2A 1J7KA 4ZCMA 5KNBA 2QP9X 3ZQ6A 3AP3A 1J99A 1Q3HA 2HEIA 2IUUA 4BFTA 5J40A 1G9XA 4TTPA 5AJVB 1KJZA 1DTSA 4KFTA 1E9CA 5FOUA 3FMOB 3R8FA 2N1BA 3QVVA 3K9GA 4LC0A 1ESNA 2A5GA 3IILA 3KXLA 4FCWA 1R5BA 1WF3A 2XGJA 4JLOA 3K70B 1Z0IA 2GWHA 4NBSA 1S1CA 1SHKA 4A15A 3PR1A 3OFNA 3KKQA 4PANA 2BWJA 1IM2A 1LTQA 3ASZA 3KKMA 2IYUA 4Q4LA 5G3ZA 1DO2A 2WJVA 4LHYA 2BEKA 3W6OA 5EZ5A 1M74A 1CKEA 3BFVA 3CNOA 5CLLA 5KSPA 3ZJYA 1R7RA 1CXZA 2G77B 3RC8A 1S4QA 2QAGB 2H8KA 1H65A 3ZH9B 1AKEA 1OXVA 4DLTA 4OK6A 2B7BA 1P2TA 2IF2A 4CVNA 1W4BA 1X6VA 2JDID 2Q9CA 3BBPA 2QE7A 4XOIA 3RRZA 1EWRA 1XD9A 3ONWA 4LYAA 1UEIA 1BO6A 5BQ5A 2J46A 4D0NA 2J5XA 4M1YA 1BYIA 2CVHA 2ZJOA 4KAXA 1SGWA 2OBNA 1Z63A 4P4TA 1W48A 2G3YA 3VU9B 1AZTA 2VHUA 2NMVA 5HTKA 5BWMA 4B44A 3AV0B 1E9AA 2FEOA 3C5CA 2QMEA 1NMYA 2IXEA 1HY3A 3CX8A 1YHNA 3I92A 5IRCD 4TYYA 3FHCB 3W6PA 3ZZUA 2EYUA 1KSJA 3EC2A 5SZJA 2D4HA 2PX3A 2FGKA 3KTAB 1OT3A 4NYMQ 4OHXA 4Q02A 5FR1A 3ND9A 1T0HB 1VG0B 3SC3A 1GUAA 1WMSA 3K0AB 1FTSA 1XU4A 3EARA 1J8YF 2O8CA 1MO5A 4DSUA 4TL8A 3SYNA 4HDCA 4X8LA 1G6OA 3TR0A 1NBMA 4ESVA 4JL5A 1GG2A 3A8TA 2IWRA 3QEJA 2FX3A 5AUNB 3IEVA 4OHZA 4DLRA 1G41A 5J47A 2QMUA 1VG1A 2PT5A 2GILA 1ZUHA 3O47A 3THYA 1XXHE 4JLBA 4NKRA 4N0DA 2EFCB 5KDLA 2FFAA 5CITA 3IO3A 2JA1A 2B7CA 1OJLA 2Z5FA 3KKPA 3PITA 3GLFE 1W36C 4MGIR 4DSOA 3H86A 2RGCA 3UPUA 1LY1A 4RVCA 2VO1A 3LLMA 4B74A 1T8TA 1NG1A 2VIIA 4EQ6B 2Z43A 3CW2A 3Q9LA 3ZZTA 4IXMA 5B64A 1RRGA 1GOTA 1XNJA 1X8LA 4OL0A 1CR4A 3QY0A 2FDCA 2JLWA 3AGQA 2GJ8A 3HR8A 4Q47A 2EYQA 3GJ7A 4MRRA 1HV8A 5CJPA 1ZBDA 3VHLB 1E9DA 2WM9B 4NU0A 2BBSA 1E99A 2ZS8A 3DPUA 3WBKA 4A6XA 4TLEA 3CIOA 2G0NA 1XTSA 5L3VA 5JCZA 4OKSA 4MA4A 4BFVA 1NY6A 4GZLA 3SBEA 1F60A 1HE1C 2F3RA 2OBMA 2ONKA 5JEDA 3GJ3A 1LB1B 5G41A 5JI2E 1G7RA 3WMFA 1C1YA 3CBQA 4Z51A 4D6PA 2I3BA 4TL7A 2XXAB 4Q1BA 4JJKA 1GTVA 1NVUQ 3B5JA 3KZ1E 2GJ9A 5HKKD 3I61A 4LV6A 2ZRGA 2H7VA 1PLKA 2CCJA 4ASUD 3M6AA 5AWFC 2VQSA 2J3EA 3WP0A 4U00A 3BGWA 2YVUA 1WCV1 4BEJA 4FMBB 5JFGA 2HYDA 1JEDA 2MSDB 4DRZA 4FWTA 3FHOA 3LNCA 1IN4A 1P75A 5M04A 5DN6A 1XPUA 3TR5A 3OEED 1DG1G 4TWZA 2R6GA 4YC7A 1RRPA 4ZDWA 4ZKDA 4QGHA 4QJ3A 2YJTD 2I1QA 1GL7A 1AS0A 2QP4A 4Q01A 2QUZA 5EUQB 4B71A 3MJRA 3ZS9A 4QHTA 5BYKA 2UZIR 3U3KA 1GP2A 2VSFA 3IQWA 3QG5A 1E9EA 4KBFA 3W5IA 3LH5A 2QT1A 3SFZA 4TL6A 3I1FA 2ZAOA 3UMFA 2QGZA 3K9NA 4JMPA 1G20E 4GMXA 1Z2AA 2ZXUA 1EGAA 4KXFB 1SXJA 5HE8A 2WPDA 3T35A 4HUQA 3AKEA 5FH9A 1XPOA 2H16A 3NDPA 3X1YA 1PUJA 5JI3E 1N6NA 1OHHD 5L3QA 2NTYC 1XTJA 2VEDA 4MDFA 1TAGA 2IS1A 1XB2A 1S96A 1IONA 3L43A 5LB2A 3CRQA 3M0EA 5DI3A 1GFIA 5EXSA 3WHLA 5DNYB 4C0HA 3LD9A 421PA 1GKIA 4EIWA 5KYKA 1QHXA 1Z6AA 2VHJA 3O8BA 4DT1A 2ZRKA 1SKYE 4XJXA 3WYGA 3WYFA 4YQFA 1UEJA 1VHLA 2YOFA 3C16C 2JJ2D 2VTKA 4WA7A 3BK7A 1LFDB 3L8ZA 1ZC3A 1COWA 2CL6X 3HDTA 3Q72A 5FTKA 2PZGA 3RSOA 3B82A 2HLDA 1R0ZA 2BKUA 1EFTA 1VMAA 4P0TA 5FFMA 2DYKA 1B23P 2VP6A 1R8SA 2OUKA 2ZS7A 3JZMA 3K09C 1N0UA 3N2IA 2OSBA 2P5TB 4LJ4A 1DAMA 1DOAA 1E2KA 4Z8YA 2CLSA 1X1SA 3PJRA 4GP7A 1W4CA 4TMKA 1FP7A 1OFIA 1GRRA 2IEYA 3EIQA 1UKEA 1ZNWA 2O8CB 2J7KA 5B2ZA 1L4UA 2PL3A 3CX6A 5CJ2A 5BN5A 4TYWA 5AJZA 1FP6A 4IXNA 4OHWA 1E98A 1KSFX 4V0LA 2VPPA 1CR0A 1KNQA 1JI0A 1P9RA 1XWIA 2ECKA 4G5OA 4KLNA 4MKGA 4GI7A 3T1VA 4ZI3A 2GA8A 2V1UA 1TADA 3THYB 3AH8A 2YWHA 3Q8XB 2AHOA 2RHDA 4W9MC 2KB0A 1GNRA 4PPNA 2ZRJA 3A1UA 1G8HA 1XD8A 4MRPA 2K5UA 1N6IA 3EAQA 2GZDA 1JECA 4PPQA 2AKAB 2WJHA 5FL7D 2ZU0C 2WJIA 2ZRHA 3Q7PA 4F4CA 2ZJ5A 3HR7A 1W36D 3SU8A 4FMDF 4WIAA 3NDBB 1XZPA 2PCLA 4BQSA 1N5KA 4JVNA 4NCKA 1VCIA 1VIYA 2ODBA 3VR1A 3NC0C 4P4SA 1XEXA 1OIWA 5E3HA 2WKPA 3EZFA 2WBLC 3MMPA 4B75A 2DPXA 4IDPA 1T9HA 4LJYA 3TJZA 4KVGA 4F38A 4I1OA 1YU9A 2Q21A 1LNZA 3A58B 4R71A 1HTWA 2F1IA 4ACAA 4OQLA 1KI7A 1XRJA 2NG1A 1Z8FA 4GOJA 1G3UA 2V7QD 1XMIA 5A4JA 2C9OA 2P2LA 4Q4JA 1IBRA 2BMJA 4P4UA 5JJLA 2KI5A 2KE5A 4IEEA 1MT0A 4LOAA 4R9UC 2GEUA 3PQCA 3QG1A 2IYVA 3HU3A 4M1OA 3B6EA 1KI2A 3IHLA 3K9HA 1DELA 2IYQA 2FFQA 4TT3A 3R7WA 1XBTA 4C0QC 3MFYA 4OJKA 3HPQA 3E70C 3M4YA 4NCHA 2J7PD 1IY2A 2OFOA 2DR3A 3BB4A 2A7QA 4EFMA 4TMZA 1IJFA 3GD7A 3EZ7A 1D6JA 4JLNA 1EX7A 5FUYA 2PBRA 3H0KA 2O8FA 2XOKD 3CPJB 2OLJA 4B48A 2G0TA 3FMPB 5G53C 1S1MA 4GOKA 3IIKA 4TYPA 1ZNZA 1W46A 3EXAA 4O2LA 1FMJA 3OIWA 4DIDA 2ZU6A 4YMUA 2EWVA 1SXJB 2RGNC 1SVOA 3VTKA 4HUQB 3RHFA 3X2SA 5F98A 3V00A 3U6BA 4BLSA 4EPTA 2QY9A 3IIJA 1HT2E 2KBFA 5L3QB 3W5JA 2DFKB 1DAHA 2R2AA 3FKQA 1DAEA 2FSFA 5KSOA 3ZLJA 2GBLA 3F5FA 1YKSA 1NN1A 4OI1A 4LHXA 3C15C 1AKYA 5DI3B 4BLQA 1NP6A 1D9XA 2GEDA 3D31A 4ZDKA 2GXUA 4TLAA 1ZU4A 2V3CC 1II9A 3SJBA 4M2LA 2JASA 4DT1B 1Z06A 3GJ4A 5DLQC 2NO9A 2H17A 2WV9A 1NJFA 5E4FA 4PZLA 3V9PA 5TY0A 1W7AA 2DFTA 1W47A 4JYCA 3THOA 4B3BA 4ESHA 2ZRNA 4BE7B 1I2DA 1E94E 2GHIA 1WB9A 2G9NA 5GADl 2VHQA 1MRNA 2F1HA 2X1VA 4ITRC 4TTRA 3KFVA 3ZQJA 4A0RA 2DFNA 4DEXA 1N6LA 3KB2A 4RKFA 4L8GA 3QXCA 2CXXA 5CB8A 2JLXA 3HYTA 4LGMA 1YZTA 2JGNA 1JEEA 3EIHA 2UKDA 3CO5A 2Q6TA 1QDEA 3VR6A 3MGCA 1Q0UA 3BB1A 3OEHD 3QOFA 4HB2A 2A78A 2QU8A 2F7SA 4JL8A 5TV2A 2JLVA 4RZ3A 2J87A 3LXRA 1FNMA 1H8EA 2G1JA 1YE8A 1BKDR 5HCIA 4FN5A 2WJGA 3MAAC 3H84A 1RFLA 2YWFA 4ERNA 5H1YA 1UFQA 4GL2A 3I5XA 4ZDJA 2OV2A 1EX6A 1GZSA 2QZ4A 1LF5A 5SZKB 4DLWA 1YZNA 3A1SA 5D3QA 2IYLD 1OKKD 4HYYA 1DBSA 2H1LA 5E95A 4CZ2A 3QBTA 3FMIA 4PQFA 4H9GA 4A2PA 3LV8A 3OIUA 4P4SB 4K81B 4YMSA 4D81A 4EPRA 1XEXB 2GAOA 1CJVC 1TX4B 1N6PA 4JLDA 4PQRA 3SYLA 3KL4A 5BN4A 3F0TA 5JLJA 2HDNB 1QG2A 3U7FB 4JBWA 2QM7A 2ZR7A 3IIMA 1TEVA 2IYRA 4CGZA 3T34A 1HH4A 4AY2A 4FIDA 4C0LA 3GMTA 5H8WA 3KJEA 5DIFA 5F2EA 5AJXA 1OFTA 2Q3FA 2QN6A 5TXGA 4Q4JB 2B92A 1JR3D 1RW4A 1R2QA 2C78A 2ZYWX 3FFAA 3B2EA 3L0OA 4PTLA 4LBYA 1EG7A 2ZSBA 1K6MA 3C8UA 1EESA 2CE7A 1E0AA 2JLSA 1ODFA 4ASUA 3R7WB 5EXXA 5G40A 4POAA 2BJVA 2RGGA 1A4RA 5E7JA 4TL9A 2WMOB 5A5GA 2CJWB 4A82A 1U9IC 5SZIA 4ZV4A 5EUMA 4UNPA 3Q5DA 4Q7KA 2HT1A 3ZZ0A 2WHXA 2DCUA 4M21A 2O8FB 2XNDD 2BCGY 2J0VA 1OB2A 2J9RA 2JJ1A 2RB4A 4WXPA 1GL6A 2FNAA 2BDTA 1S0UA 2RKOA 2W83A 1QRAA 1CJMA 1S3SA 2ODNA 3BB3A 3B1ZA 3AVWA 3LW8A 4NL4H 1FUKA 4HZUA 4QNMA 1Z0FA 3OE7A 1RVDA 1KMQA 3MD0A 1NNEA 5GVRA 1IHUA 2ZE6A 4YMTA 1K5DA 4C0AC 4W5HA 3U7HB 4DUGA 3TW8B 1Y3AA 4C2TA 1CBUA 4NZYA 4PPGA 4DSTA 4IDOA 4PC3A 2ZI7A 4QGAA 2QT0A 3QXJA 2G88A 1UBEA 3TQFA 3R20A 3OHMA 3O8DA 3EPLA 3K0FA 2NIPA 4LYFA 1GL9B 4NYJR 5KHOC 3VR4A 2VP4A 2O0KA 3A36A 3BFKA 4WZBE 1TMKA 3SJAA 3V4FA 1WBDA 4IOJA 5EZ6B 1KNXA 1AGRA 2GJAA 4EDHA 4TLDA 3I8SA 2WWWA 5J4KA 1YR7A 5J5CA 1WE2A 3QKRA 4KJZA 5FPTA 3KQNA 2YINC 4XSHA 3TUJC 1QG4A 3LFUA 4M0LA 2E87A 1W0KD 2AWOA 4HI0E 1LS1A 1R5NA 3QF7A 1E9RA 1W0JD 1NLZA 1MO4A 2ZI5A 3DO6A 4V0NA 3ZVMA 4J0QA 2FZ4A 2IS4A 5LB4A 4TYQA 2FSIA 2RGXA 1T5LA 3KUCA 4E22A 1LVGA 3DKVA 3ZVRA 3PVSA 2AWNA 3TLXA 4BRWA 4DB4A 3KXIA 2GVDC 4L16A 1S8FA 4JLMA 3T12A 3VQTA 1KI3A 4TLBA 1GWNA 1AN0A 1DVRA 3DHWC 2Z6VA 1ZC4A 1E4YA 4UNNA 3DEFA 1N5JA 4HDOB 1GAJA 2CL7X 4HLCA 1ZUNB 2G6BA 2LCFA 4F7WA 2JATA 4JS0A 4KITB 1MOZA 3VKGA 1OXXK 1OSNA 5AJWA 2REBA 5JJIA 1OXTA 2C5LA 2W00A 4A8JA 2DBYA 4D4MA 4B2LA 2ZJ8A 5JHGB 2ZVQX 3NHBA 1W1WA 1EFRA 1KDOA 2ZS9A 3FHTA 5CK5A 4M1KA 3IEUA 4V0MA 1Q22A 1UADA 5FUWA 3DOEA 2WAYA 4RJLA 3R9IA 2ATVA 3D8BA 4Q9KA 3V4RA 1SVMA 1V5WA 2FSGA 4E03A 2QRNA 1TQ6A 3CUEF 3FVQA 1E2MA 3ZDQA 1S3GA 1FPMA 2QBYA 3HJNA 1RE0A 3LRPA 5FOVA 4WZ6A 5FPYA 3GJXC 3RS0A 4BZPA 1QHNA 4M1MA 1XJQA 2GZAA 3HYRA 3R8CA 4BZQA 1YR9A 1D2MA 1IQPA 1E2QA 2ZJAA 4GMDA 621PA 5B57C 3D3QA 3B1VA 2C98A 4Y0AA 1AGPA 3RRYA 1A5TA 3OAAD 3TSZA 3AEZA 1VTKA 2WWIA 1J90A 3W6NA 1UDWA 2PCJA 3UWOA 2V4ZA 3BXZA 4PPFA 2D06A 3ZIAA 4Q4HA 2F55A 3TUZC 4JSTA 3NBYC 3DDCA 3D7MA 5DE3A 3AF0A 4DDVA 3P20A 1KI4A 1ZNXA 4MYTA 4BFSA 4XVUA 3QXHA 1FOEB 4EUNA 3OESA 2ZANA 4HB4A 4ARZA 4QJ5A 4F4IA 2Q9BA 1TU3A 1T5IA 2ZSDA 4D0GA 3CF2A 3IGFA 3SS8A 3UK6A 4KI0A 4PC1A 5IT5A 3SZRA 1SZPA 5LD2B 1IN6A 1E2EA 2IYTA 1KZ7B 4N0EA 4O3MA 3GQBA 3PUXA 2N42A 5CYPA 1US8A 2R65A 4JVLA 4HZIA 1CRPA 4MYUA 1EFUA 4BPBA 5JHHB 3L0IB 2FU5C 3K70C 2BMFA 4HZUB 5B30A 4LC1A 1CS4C 4RKEA 1WP9A 3TKLA 4PR0A 4AKEA 4QM7A 3GLIE 2UZ3A 3QQ5A 2C77A 1YZQA 2ZJZA 4OI4A 1D8TA 2O5VA 2OCPA 3QENA 4RY2A 3IO5A 4A0GA 2YHSA 2DY1A 4G5QA 2CL0X 3SDZA 2VYFA 3C4JA 3G0HA 2CDNA 3K0CA 5C2JB 3FOZA 3PUWA 4DZZA 1PVOA 2IYSA 1G5PA 2QAGC 3A6PC 4LPSA 3B8HA 1OFHA 4F92B 4NCNA 3N2EA 4XH9B 3U3OA 3VMFA 2QAJA 4C0BA 1UKYA 2WIAA 4DCUA 5JECA 3TH5A 4H1VA 4X8OA 3QIAA 3PIRA 4UNRA 1M7HA 1UPTA 3KDSE 2FSHA 3DM5A 3QKRB 3CM0A 1G5RA 4B2IA 2BMEA
chains in the Genus database with same CATH superfamily
3TKAA 1BH2A 4UBKA 5LYJF 3D0QA 1ISHA 4D4KA 1EI9A 2H59A 1C8KA 1YB7A 2EGHA 2FZLA 2XUQA 4RS3A 4YO7A 1W9MA 3TRHA 2ZXEA 1UWKA 3I73A 2GSWA 3AJEA 3NWJA 3IQGX 1CCWA 2WEKA 3L7LA 5GJVC 3DDZX 2PGLA 4G67A 4Z4CA 1O5TA 3FSEA 2PSSA 1Y6ZA 1C7EA 2HU5A 2I8CA 1JIUA 2KLBA 2H3HA 3A6FA 1Z74A 2FHPA 3EAGA 3JQPA 3PC3A 1V11B 3I5AA 3PRYA 3E5NA 2OXIA 4D4GA 1FQOA 5I3CA 2OEPA 3WRWA 3LT5A 1PZXA 1U9ZA 3SI7A 4HDKB 1QVRA 4RIGA 3V42A 3DKIA 3EIXA 2VYCA 4ZQGA 4QODA 3T9FA 4TKUB 2I80A 3U7GA 5ICFA 4BO6A 1NV9A 3GELA 4IHJF 1GGFA 2A92A 2WSSD 3OPYI 3PTZA 1Y1PA 4O4IF 5HS6A 2WHEA 1J1IA 1M1ZA 3KB6A 4ZU6X 3T3IA 1FDTA 2CXNA 5IZCC 3OIYA 3D1VA 2VJYA 2FA9A 1V39A 4KWCA 1ES9A 2Y0DA 3WP1B 3ZLBA 3TAUA 1T2EA 2VYVA 3I2HA 5K8CA 1AMNA 3HRKA 2WT8A 1KMNA 1K27A 3RIGA 1SBQA 4JBIA 3H8SA 3DH0A 4BB0A 5DGIA 1X1CA 1I4WA 2CKMA 5INTA 3LE8A 1HYGA 2BW0A 2P1RA 3K16A 3OM9A 3ZHYA 3FJ1A 1UPAA 2QEQA 3FZGA 2DQKA 4OY3A 4RJJA 1R00A 1V95A 3K5PA 1CR6A 3A2NA 1P18A 1UPCA 5JCXA 2AC2A 2IZOA 4JOQA 4GYJA 4MOWA 5EP1A 3RVJA 2DEUA 1L4BA 3UAGA 3GGDA 4QQKA 1EEXB 2QBYB 3B6MA 2X5OA 1XLVA 3NVDA 3B9PA 4MR9A 4DR6B 2FR8C 3EIFA 2Q3HA 3A9SA 3KC2A 1L4YA 5JWOA 2GAIA 2D59A 2MSCB 2OPBA 4V3BA 3M8KA 3TN7A 3EHDA 1T8UA 2O8VA 4JJZA 3LY5A 2I2AA 4WT7A 4CN9A 2MYPA 1EGHA 1TD1A 4JUFA 5I9SA 3CLVA 5BVGA 4HEHA 2F8TA 5C4MA 2X9GA 5D2CA 1PX0A 3ESBA 3FYSA 4HSEA 2WP8J 1FCJA 1P5RA 2VF7A 4IX1A 1P60A 2CUZA 3OC0A 1M2JA 4LGCA 221PA 3BUSA 5KNDD 4EJSA 1QF6A 1NVVR 2ZAYA 3ECAA 3T9BA 1BMFA 4YS6A 3OJOA 3OQHA 2VQEB 3IERA 3RSQA 4OJYA 5B1SA 2BC9A 3BMOB 1M2NA 1WULS 1EEHA 1H2AS 1GKUB 4CLXA 4RENA 5HF8A 3O8CA 3W79A 3CVXA 3OY2A 1E3SA 3AVUA 2DHDA 3GVIA 4B45A 5FI5A 1OY1A 3GRYA 5KYTA 4MRAA 2QTFA 5K8TA 1E6EA 2WZDA 3PNOA 1OAOC 3NTUA 2V8OA 2Q4DA 2EIHA 3TSWA 4CT5A 3KWFA 4OQXA 2K87A 3E0QA 4HLQB 2WINI 4XWOA 1JZQA 1Q0LA 3N2NA 3I83A 4TXJA 2P9BA 1Z4JA 1I3OA 2LCIA 3ORHA 1FMCA 1VCOA 4IIEA 2X5XA 5FOWA 1MJ5A 4Z1MD 3N8KA 2AG5A 5KOYA 7REQA 2YH2A 4GE3A 4AWXA 2OCYC 3MSCA 2H52A 3EF1A 5DCWA 4EKDA 1YMVA 2NW6A 1E89A 4QDJA 2H00A 5DVZA 2BGWA 3JD1A 4I08A 4I50B 1FVFA 5IHXA 5HS4A 1HEYA 1X1QA 5AM0A 4EKYA 1UZNA 1VB3A 1DAIA 1JZTA 3NEYA 3KTFA 3PQFA 5A5VA 1BRMA 2KJQA 5HCNA 1TO6A 2CVFA 3DUWA 3IP7A 5KPJA 1NW9B 3QUQA 3E53A 2KSQA 4G8DA 3TLJA 1SUDA 4LV5B 3TS1A 5CFLA 3AF2A 3L6RA 3U7EB 5A5FA 3LBAA 2H7CA 1AGXA 2ISSD 1U7HA 2M1ZA 2XAUA 3T5GA 3V7YA 4C0XA 3B9BA 3O90A 3G8DA 1KERA 5EHNA 4AK9A 4NI5A 4IDCA 1MN6A 2QZ9A 3SLGA 1M2EA 1SO8A 3I9JA 4HTFB 3UO8B 3E7WA 2J9FB 1VPTA 1YRAA 1JHMA 1RYBA 5JS6A 2UUPA 1HSOA 2AFHB 4RK5A 4WW0A 4KAFA 4F3TA 1G2IA 2XGSA 3JU3A 2VJAA 4GNRA 4LNHA 4PWYA 4RAQA 3TXYA 1ORTA 3ID6C 2PKRA 2PY6A 3KWJA 5JVDF 3A9WA 3LL4A 3PICA 3UT0A 1VJRA 2HQSA 5K3SA 3CNNA 2BHTA 2ZSJA 3M2TA 1PK7A 2O7VA 3MTAA 1P3DA 1T2DA 1ZMOA 3K72B 2QUJA 5A7HA 1GYQA 5L9AA 3HP1A 2OGUA 1KEZA 2W6QA 4E08A 1HDEA 1KK0A 3H2YA 2QKYA 1U2TA 4L85A 3VGJA 4IOKA 3ER9A 1Y6FA 2R3SA 4BDSA 1Y3CE 2HWWA 4J7UA 4IW3B 1E9SA 5FFNA 4MICA 1YAJA 2Y9MB 2BMVA 3OQJA 5HF9A 1TFRA 1OUMA 3EZ6A 3Q9UA 5LCXA 4D8TA 4TZ6A 4HXEB 1GPBA 1EVYA 4M0FA 4L15A 4BFZA 2H2GA 3EG9A 1WUJS 4GI5A 3E84A 4K9RA 3O4JA 1C0LA 2JL1A 1M2OA 3RBVA 2JNWA 3ZJ4A 2DPHA 3THRA 2Q8QA 2PZEA 2VBIA 4KRXA 2W9XA 2NU8A 3VJLA 4CBVA 3F6PA 3C41J 1FDOA 1KFKB 3C6QA 3MUOA 3NI2A 5DNWA 3WDKA 4IEIA 4QNNA 1J33A 4DIUA 4JYPA 3FPLA 1QE3A 4UCFA 3DOIA 1SU6A 2X2FA 4O3FA 5ITWA 1ZP6A 2ZRDA 3I1IA 2PYZA 1C80A 3WL4A 1Z88A 3DD1A 3VHRA 1KGDA 1KMIY 2JGRA 2A3NA 1THZA 4NY1A 1RACA 3FAZA 3O4IA 5GGYA 3K6RA 4B7ZA 4TM8A 3KU1A 1ZK3A 4LY9A 2ST1A 3FTFA 3RBAA 1KHHA 3D0RA 3E6AA 1U7WA 3HYSA 3HJCA 1E0SA 5EP3A 1THGA 1LTKA 1XKXA 2X58A 2XMPA 2YNMA 5B58C 4HLDA 4YY3B 3KRTA 4IX9A 2GXQA 4I5DA 3O82A 1WUIS 1A5AB 1GZVA 4MR9B 4E6PA 2G9ZA 2X7XA 4JOSA 2ERYA 3ML1A 1PQYA 2C04A 5FOTA 2CT8A 4GHWA 5HPYB 3DVLA 1SVWA 2AEEA 3KQUA 4LG1A 4IHQA 1ZW6A 1LSOA 1H1DA 3WLNA 2XY4A 1WXQA 4H77A 3LVFO 3P96A 4QC2A 2A9VA 5BVGB 1KWKA 1HLPA 4BZZA 4RIHA 4WCDA 3QX7A 4ITUA 2JLRA 1ZUIA 1RI4A 4FU0A 1TQDA 1L5VA 2XGOA 4P3YA 4R51A 4WL0A 3URKA 3DEIA 4H1TA 1BHQ1 3IEKA 4EAQA 3MWFA 4K6GA 3RIXA 1X80A 3VO1A 4EJSB 1M6YA 2VT3A 2EARA 2ONZA 1TT5A 1V3UA 2GTHA 4I4IA 2Q8PA 4TZKA 1KP2A 2X0RA 1UXKA 2CYCA 2XYRA 5BO5A 1UJ5A 2WNSA 2EQAA 4ZZ3A 3LOPA 1J6UA 1E1QA 1E8NA 1FU4A 1PO7A 1XWFA 1F0NA 2VA8A 3LX5A 4RSRA 5ALJA 1MQAA 2YN2A 4FYKA 4TSFD 5ALZA 4YYZA 4B3MB 1ILWA 5F9MA 1KEKA 4YAGA 3WYBA 1G63A 1EZ4A 4Q1AA 3N87A 4RCZA 2XHEA 2BD0A 2OHXA 5DTEA 4B6GA 1JLLA 1WS6A 2Y0PA 4F8YA 5KNBD 1MMFB 3GA5A 4X6XA 5DH9A 5EPOA 2XCSB 1HTTA 1VL1A 2A84A 2W6JD 5CLQA 4ND4A 4I6JA 1DQZA 1QF7A 1T35A 2GCOA 4FQ8A 4JVSB 4I1IA 2ZYRA 1JR4A 4ALIA 4DAOA 5HZMA 3TLMA 7REQB 4LAFA 3JQ9A 4OF4A 1J8MF 1OTYA 1JHAA 4DA9A 5IP5A 1XO1A 3PX3A 6ADHA 1WOYA 3B3QA 1PYGA 4UPVA 1SUCA 1VGVA 3EZ2A 3F46A 3HBFA 1YJ5A 4P92A 1SIWA 3TO5A 1UJ4A 3OZVA 5IM5A 5LKAA 1H5NA 1A7AA 2BEUA 1BRTA 2CBZA 3D43A 3DSRA 4HQ6A 4V03A 2EZ9A 3H83A 3HCEA 2D2FA 5J5VA 1PJZA 1S9DA 1FYDA 1Q1BA 3BULA 1CQIA 2JFFA 3OFND 3OY7A 4WZZA 1PFYA 2OSVA 4XXHA 5HIMA 3VPBA 4OPMA 3KKNA 4AZSA 2P7IA 4QFDA 4EG5A 1JH8A 3A7EA 4J2TA 2FR1A 5BQPA 3SX2A 4B40A 1Q57A 5AKZA 1UMCA 2OD9A 2CFSA 5JYDA 3R9XA 3BX1A 2X42A 5FB3A 4M60A 4D57A 1HDGO 4UARA 3AXTA 2AZMA 3FYUA 2OESA 3K7EA 2BCEA 3GGCA 3N07A 4PXSA 4EFNA 2CV1A 3Q4GA 1PD0A 2CHVA 3JWHA 4OYRA 4HF7A 2AJDA 4URVR 4RF3A 1GARA 1RQLA 2IA5A 5AP9A 2YMPA 4WPGA 3QPCA 1L8QA 4R7ZA 1RYFA 4KN5A 1VKNA 3RSFA 4W1QA 2R8RA 4OQQA 2Z8ZA 4O2RA 4D9HA 1LBEA 4B47A 2HF8A 2C9YA 3HZRA 3MXTA 2I71A 1YHYA 2H5LA 3N58A 3QVJA 1AS2A 4QXMA 4H15A 4R1MA 2ORIA 3IXMA 3VZRA 1Y81A 2RSLA 1I1OA 3GOQA 4D99A 1H6BA 1Y1KE 3LBFA 2Q4TA 3QLUC 4YECA 4QOFA 1JQEA 2BE7A 1ORWA 3C97A 3QZUA 4HQOA 1RKBA 3GH1A 3W77A 1G9TA 1T0PA 4OQMA 3U5ZB 1NYLA 3JZIA 1G8FA 4US0R 1VPVA 3EG9B 3TLKA 5HUHA 1FQWA 1M2OB 3OETA 4O08A 1LX6A 1S2NA 1RQXA 2IH5A 1NUAA 3KPWA 1MXHA 5TQ0A 2NU8B 5CA1B 2ACKA 3JYLA 5FPHA 4HEJA 1TKBA 1E5DA 5C46F 4CCSA 2GZ3A 1DSSG 1VE9A 1SRRA 2QNIA 1Z7GA 5CXSA 1U8EA 3DLAA 3H8WA 5L95A 3LZCA 4K88A 1EDEA 1KVSA 5EZYA 4PC6A 4CEHA 4XUDA 4X1YA 3EYAA 1BU8A 3HHEA 1SBNE 3L82B 3LVRE 3WL6A 1Z0UA 3LHKA 1P1HA 3DFIA 5JAOA 1G8PA 3U56A 4YT8A 4IIXA 4B4DA 3L06A 4EKIA 2XRYA 3FTQA 1K3TA 4LMAA 1P7WA 4CMAA 4YRDA 1M0EA 3V8BA 4ZK2A 2RHCA 1YNSA 3TSYA 3GDFA 2OCDA 4IRXA 3I5YA 1BZYA 1Z4PX 1J8DA 1WXWA 1C7RA 1MA0A 5LVAA 1OT5A 2HGZA 4S3MA 3SLRA 4DCGA 3QY9A 4WA8A 3ZWAA 1OGYA 4EPYA 3ISJA 3JW8A 1ZAKA 1CR1A 2CNWD 2IXFA 1J5EB 4DDKA 4MQMA 5H68A 1NUSA 1THMA 1Z62A 2GPNA 2GJKA 2Q50A 3NBUA 4BX0A 4U02A 5LZ7A 5J4HA 2REXB 4L74A 2QTZA 2HNAA 3LPMA 1DZ3A 3L49A 2VZ9A 1PUIA 1QUEA 4FFPA 4RADA 4EJMA 5LKRA 5KPDA 1E7SA 5DK6A 1OF1A 5EWLA 1T8RA 1AXEA 1WCYA 5TR9A 3TVYA 2H06A 2QROA 5IT0A 4AY6A 1A98A 1X80B 3E9RA 4FNMA 3RREA 4CM3A 2XRMA 4NK5A 4O4HF 3KKEA 5DHAA 1NUUA 1QBGA 1L6IA 2IELA 3ACCA 2PRJA 3ROKA 1TT5B 1XMJA 2WMDA 2FXVA 1PJCA 2A2ZA 3IKVA 3K2BA 3NR2A 4WDRA 5LOVF 2CMHA 3PWTA 4XFDA 5JH7F 1EINA 2P6UA 3L93A 1QRTA 4JC0A 3V1TC 1IEQA 1YZGA 1AM4D 2BBWA 3ZBTA 4B3JA 2WABA 3M6MD 1PG0A 2C5AA 3M83A 3CKLA 1OB5A 1TC1A 3VO9A 2PMKA 3WLEA 1XC7A 1JLLB 1CNMA 2JIPA 2WMYA 3BIFA 4MNTA 5CLGA 4E30A 2JFXA 3OJWA 5DN6D 3IQDB 2GCOB 2P6PA 3HA3A 4EW3A 4JMLA 1P39A 1ZH2A 4LOKA 5AKEA 5K0TA 1G19A 2YY6A 2ZUSA 3FNHA 1E7MA 2RH9B 2B8EA 4X97A 3DV0A 5A71A 2HXSA 5KSYA 1U0GA 2JLYA 1DC5A 3ZDBA 5FOQA 3K3PA 4FFNA 1SZDA 2BEUB 2O52A 3T5MA 4MW0A 1HTBA 4JB3A 3TZCA 1ZCBA 5L45A 1EE2A 4QHSA 1CQIB 1Q91A 2JKVA 3DKPA 4Y18A 4OA5A 3RHZA 3RUIA 1HX7A 4XM0A 4ZCLA 1UK6A 4Q37A 3V97A 3B2QA 2JGIA 3TW0A 4ENSA 3WGMA 2C9CA 2JHPA 4I1SA 1Z08A 3DL2A 1UMCB 1HFKA 4EO7A 3LY8A 3R9XB 3KOZA 2DBVO 1QXSA 4X93A 3DZHA 3A05A 4EUFA 3PGA1 4IS3A 3FYUB 4CEJA 2WAAA 2L19A 4JEIA 2Q1YA 1B0PA 4RZIA 5SY9A 1NP7A 3LSTA 2Y6UA 1GAQA 3CLSC 2CXQA 2EWWA 3QWBA 4J9VA 4UNSA 2JZOA 4ZT6A 2R8OA 4ZDIA 3ZE9A 5IAOA 2FG6C 2C9DA 4YV7A 3WNCA 2WM8A 5D1NA 5HP4A 4OIMA 4Z8XA 2BOVA 2LGJA 1PJBA 4GMFA 4CIWA 5ICEA 2NVUA 2ZB4A 4Z3OA 2CY0A 3I9OA 1DKNA 1UKBA 5C7LO 2VNJA 3WGYA 4FYXA 4B6OA 1QUFA 1EHYA 1MAWA 2FHSA 5CW2A 4F6RA 3RVMA 4AJPA 1RWNA 3JD2A 1NONA 3MQ4A 3WJ2A 3SC2A 1ONNA 3SFVA 2DGDA 1MW9X 2FN4A 2I6FA 3F2IA 3W5BA 1XXHA 3LQ1A 4I9HA 3NKVA 2BHRA 2CE2X 2XV1A 3VHXA 5TQ0B 3J7AC 3NIGB 4LE1A 4W5NA 1RP1A 1Y42X 2VSOA 1UBGA 3M81A 3VZCA 4B73A 3NRJA 4TWIA 3GOHA 5FPSA 5ESRA 5CD9A 2QRLA 1QE5A 3AF1A 2GRAA 4PNHA 4HB0A 3WSVA 3ABOB 5EZYB 4EL0A 1GVHA 4P34A 2EHDA 4CEHB 3GFVA 4N4AA 5AHKA 2V1XA 2X14A 4X1YB 1IN8A 1II8A 2I3DA 3DMYA 4TXHA 5JAPA 4FEYA 4FOSA 1BKSB 3OFSA 3HCWA 1NG9A 4FUQA 2O2GA 3C2QA 1L7NA 2GJ4A 4KSYA 4EGFA 4FNAA 2R86A 3EEBA 2P3SA 3FIJA 2OV6A 4Y2RA 1PJTA 2BFFA 3R3JA 4QRDA 4US1R 4WLOA 1CVIA 1JT9A 3EIEA 2XWPA 1IDN1 3GUVA 2GYYA 3IAAA 3JZFA 3Q7TA 4G0YA 4M3NA 2VCYA 5D3MA 2G76A 2IWHA 3RLFA 3F67A 3T06B 4DCTA 1AN9A 2BONA 3SEAA 1KZYC 1OTXA 5E4TA 2V65A 3OTQA 3STHA 2VUUA 3PFHA 2CLIB 1XCJA 4FPXA 2O8EA 2EJTA 3GNLA 1ZD5A 2IHYA 3HSKA 5CDHA 1SVSA 4RACA 2AI2A 3ZXIA 1XJCA 2YWDA 4Y2QA 2DPMA 1NOKA 4LBWA 4J0CA 4IDDA 4QTUB 4AX4A 1RKQA 2AX4A 5C35A 3GT0A 1UQUA 3T1QA 4FYMA 4ZREA 1SJ9A 4QELA 4RIEA 1Z17A 2HMVA 5EWLB 2W4QA 3IUPA 2GTPA 4OSOA 4HG2A 1KH3A 1Z28A 4HNQA 4YUAA 1U8UA 2V7QA 4P32A 1PT6A 4ESVA 1MGOA 1X3SA 3O1IC 4U39A 2WIFA 2H4ZA 4WVLA 3VOTA 2COKA 3UUFA 5CIYA 1T3HA 2PMDA 2I5PO 2QENA 4FLFA 4ZD6A 4FD3A 8GPBA 5AQEA 3FRJA 1VP9A 3HKBA 3BN3A 4MW6A 3NBQA 3WMEA 4YAFA 2UUAB 2B6NA 3MWDA 4EF4A 1WSWA 4G3XA 1WWKA 2W6ZA 3VKFA 1DOHA 2LIPA 4HMPA 4IDBA 4JGIA 1W19A 4UZSA 3AR6A 3UAOA 1LBIA 3GBSA 1L5YA 5L3SA 1CLUA 1R0BA 3IUJA 1D0VA 1DL5A 3L0BA 4WH0A 1Y9AA 2OCAA 3DW1X 5BOVA 2PJZA 2O9JA 3ZWPA 5ECYA 4EAAA 4J3NA 2I66A 4A27A 1YBHA 2BHNA 1SXHA 1P81A 5DXFA 4C0JA 2QPLA 3GGGA 2MJLA 3ESYA 1X9HA 2ZTLA 1Z83A 3AKDA 4GO1A 4KUHA 4N5LA 5TPWA 3DV0B 3WLPA 3WJ1A 4ZZ2A 3X1DA 2W6JA 5KYGA 1KEWA 4Y7DA 4YASA 1OOEA 1XP5A 5GAJA 2EG5A 4G84A 2VOEA 4GWLA 4K3UA 1JDJA 3C1UA 1YDGA 2WU3A 3V7FA 3N53A 1BW9A 2JCXA 5C1PA 4RD2A 3O4RA 3FMFA 2W0SA 3EVAA 5FPKA 4PM4A 4QVGA 1ZIDA 3U3ZA 4DM4A 2QSJA 3HB7A 5AI9A 1QIKA 4FFLA 4Y3UA 6PFKA 4PLWA 5AKYA 1JF8A 4A03A 4DLSA 2G17A 4FEAA 2AVDA 3I3OA 3K0FB 3RGGA 3S29A 3DLTA 3P9ZA 1MV5A 3JRXA 2YYSA 3UF0A 4CEJB 1V43A 4RTJA 3S2ZA 4FEGA 1B4DA 5TARA 1S9HA 3ADPA 2H9YA 4RK0A 3KSAC 1VMIA 3F8TA 5BURA 4IR7A 1Z07A 2PHZA 5DLPA 4OX9B 1TYCA 2ZUDA 1HLFA 1VKRA 1Z0SA 3VVCA 2C2KA 1Y6QA 1KU6A 1J1ZA 1LDGA 1ZA2A 4MCAA 4WLVA 4ZT5A 3ICPA 4ANFA 4PO9A 1UT6A 3MJHA 3PT9A 5CFNA 1GG8A 1JHVA 1I4DD 3QXXA 4S05A 4HVTA 4EHJA 2NVUB 2Y1FA 3DQZA 3PGJA 2GAJA 3I6ZA 5CX4A 3C5HA 3OE1A 1FFEA 3G2JA 1W35A 1DWOA 4TKLA 4F6RB 2IGBA 2P91A 4NBUA 3CVUA 2H1OA 4YCBA 1P0FA 4G0MA 3LQQA 5ERGB 1RWMA 4BMSA 3SC2B 2X4LA 1ZX1A 2B30A 3A2KA 4G0WA 2PFGA 3BORA 1XXHB 4RETA 2ZE8A 3B13B 4H4EA 2QW0X 3E1GA 3VHXB 2WJYA 1UJBA 4PAQA 4PHHA 2IV2X 4GMKA 3REFA 4DEVA 3ETGA 2HJGA 4TQGA 2LVBA 4IZOA 2AMJA 4FYPA 4LX8A 3B3JA 4ENTA 3VH3A 1G6Q1 3ZWYA 4G8JA 4CMJA 2Y71A 3VR6D 1E2LA 3QA3E 5GY7A 2PEYA 1WUYA 1NXOA 3FI0A 3OZXA 4XGKA 2WOJA 3V8RA 5LP6F 1O94A 1MB0A 4Y6RA 1XF1A 2PSEA 3H75A 4DADA 2XWBF 3UXHA 1II8B 1H8ED 4PHGA 3ROFA 4C7VA 2C2HA 3SHOA 1FFDA 4TRJA 2WAMA 2VH5R 2JFNA 4HH3C 4JSRA 1DXOA 1Y7PA 2O7QA 2AG6A 1M5RA 2WZCA 2P3LA 3PQ3A 5B2EA 3M2PA 2BFFB 4AKHA 1GRNA 5D3MB 3RWMB 5BQFA 3D3WA 5AVUA 5E3IA 3K31A 1AD2A 3SCZA 4CODB 4D26A 2JLAA 1ZS9A 1OWMA 3L7IA 4M86A 4L3VA 3FR7A 4P2BA 1QIIA 4ZZ1A 1KAMA 1D7AA 4RMHA 2O8EB 3HBLA 5AVZA 5JRJA 1WO8A 3AFNA 2FR0A 5CHEA 1G2PA 1L3IA 1N4DA 2IYYA 3TYXA 4OB7A 3LQ2A 4UM8B 4DG9A 5KYWA 2QDKA 3DG9A 4HDQB 4CR7A 1U94A 4ZGBA 3V48A 3TEFA 1GGVA 1B42A 2CNWA 2Z1MA 3HGMA 1Y8RA 2RIPA 4JIMA 3PX7A 3MG9A 4LE2A 2BR5A 1P4RA 4N18A 5CK4A 3LQYA 3T7JA 5BPHA 5L7TA 4CU2A 3KHSA 4AZ0A 4HUTA 1C9YA 2H48A 3NGMA 1N0WA 1P33A 1O95D 2PN1A 3OU6A 1RR6A 1W1UA 1E7WA 1XEWY 1SBTA 3D8TA 2WR8A 4L4UA 2CWDA 3R1IA 1NVBA 4LUCA 4NZPA 4EL5A 1H2ZA 1KJWA 2B5VA 3C6XA 4LZNA 4QBTA 3HKBB 4JLVA 1VRVA 3MWDB 3YASA 4HBZA 3HDYA 1PGNA 3JQ6A 4HNRA 2H5EA 4RH0A 2Z08A 4UHHA 3RUEA 3UOWA 4D4JA 4BVJA 1C41A 2G83A 4IVRA 5ICMA 4K9NA 5L3SB 4X44A 2QXUA 2Y4NA 1ODCA 1JZSA 1VG9B 1TYAE 3SOZA 4F04A 5JS7A 5L8VA 2R6HA 1M8PA 2BI8A 3HZZA 3DBVO 1SOMA 3SD7A 3KOXA 2E1RA 1ATIA 2G4LA 2Q0XA 2R6AA 3B78A 3MF4A 4GS5A 4Q3LA 1T1SA 1DE0A 3AB7A 2E48A 3B89A 3L92A 4GDMA 3WV4A 1JFFA 2VDNB 3DV9A 3GFQA 2IQ5A 5TPWB 4CT4B 5F3WB 2C03A 3QFHA 4LJ6A 2CF6A 4EY5A 3NBFA 4BB9A 4C89A 2REQA 4RSHA 3RK4A 3STWA 4XVCA 1BW9B 4Z7QB 1P1JA 2GVZC 1EWYA 3Q6NA 4DVJA 3JD4A 1G3MA 3CG4A 4MPDA 3S40A 3PQ8A 4WCFA 4EYSA 2G67A 1YB6A 3GRZA 3OKFA 4GEGA 4JC8A 5H9VA 5TT1A 2Q07A 3PHIA 4DC1A 3EVBA 4FW9A 1KVUA 5AUQA 3AUKA 1GPKA 4IWXA 2AJ8A 1L5SA 2VLBA 4RBNA 3SG0A 1PP4A 5U4XA 4DMFA 2SKDA 1ZGZA 1OFGA 3LCMA 5B4VA 4EPWA 5HJEA 4R83A 1UJNA 3AI3A 4QBHA 1RBQA 1FX0A 3CZ4A 3DMPA 4UATA 1ZI9A 1TVEA 2CDBA 3SR4A 2CB9A 3ZK8A 2ZE7A 5KTMA 2AL7A 4Q03A 4UBOA 2ZIXA 3TGPA 2ZCVA 1SBZA 1FXWF 1KDYA 2B83A 3IBSA 2I9KA 3FWHA 2MIIA 3GY0A 1QQTA 1U99A 4JLSA 5LA6F 3HRHA 1PGOA 3PFIA 2BTQA 4YUYA 4EH1A 3NHRA 4LQLA 3W2EA 5B2FA 1DKMA 3N74A 3Q2KA 2D1YA 1ZITA 4ER5A 4Q9JA 2VFAA 4MHOA 5A4DA 2GTIA 4ZQBA 5FAKA 3GJQA 3GP5A 3AX6A 2YJ4A 3OEYA 4CF5A 4IEFB 1KPHA 2HJHA 5EXEA 5D3ZA 3EPHA 1ECLA 3CEJA 3B5EA 3FX2A 1YRBA 4FZ5A 1KZ6A 3I8OA 2VP3A 4LYEA 4PW0A 1UBSB 4IOLA 4Y2JA 3TMKA 1W1IA 4K8OA 4HUJA 4RMNA 4X92A 1USWA 1HZZC 3CN9A 3L0DA 5B6PA 2ANBA 4ZVOA 2VJMA 2BH2A 1NMSA 3PFFA 1DCTA 5K8IA 4FBGA 3WLMA 2PJUA 5EESA 3QWAA 1P5HA 4CEIA 1VXRA 3OPMA 3O0DA 1VCNA 1AK9A 1J2TA 2AFIE 3IUNA 1WY5A 3NXSA 1Y89A 5D00A 3O2QB 1LU9A 3K05A 4L50A 4Z9FA 521PA 4LMRA 3VSBA 3Q0IA 5BWNA 4AG5A 2ID7A 3PYMA 2VKQA 2R68A 3HI6A 4K6CA 3ZPXA 4RIIA 1P9NA 4QU8A 3F8SA 4R0VA 3VFDA 4DXHA 3CQ9A 4ZT7A 1PLJA 3NYRA 4HLUA 2O3QA 3K0KA 2YWXA 4C87A 3GBPA 1TYDE 2XX3A 3FUCA 4HGZA 3HBJA 3WWZA 2J3QA 3D3WB 5BT8A 3CUTA 2H51A 2F4NA 4UVIA 1ENPA 3BE8A 5HKLA 4OTZA 3WRYC 5HFNA 2WQ6A 5BXQC 3AIMA 4NAHA 1I0LA 1JAHA 3KD2A 2CFIA 2BKLA 5LMZA 1Y1TA 3CZQA 2WUDA 5E2IA 1YZKA 4L72A 4MKFA 3TRKA 4JBNA 3GGOA 1L1QA 1RI2A 4O1MA 5KYWB 2I65A 1VA4A 5CBKA 3X1WA 4D8VA 4MVJP 5ALDA 5DTRA 1UK7A 3KE8A 1ISPA 1DBRA 3FLAA 2DP4E 2EGUA 2GZ2A 2PRZA 1H23A 2WICA 1HSZA 3AFOA 3H8VA 3IAS6 1TZMA 3K92A 4UTXA 3RT9A 1Y8RB 3T61A 4UFNA 5L40A 4GWKA 2F1KA 4OGFA 1NYRA 5JZMA 1XMVA 3HSSA 4Z9BA 3ILHA 3IIIA 1TQ2A 3AR3A 3H9BA 4GSLA 1YFJA 1JALA 2ZUBA 3TD9A 1R0KA 5B1DA 3VSDA 2ZVJA 3C70A 3ZGVA 3PG5A 4Q24A 4AZ0B 3H5OA 2AC4A 4P7GA 3WB1A 4YR7A 5E2AA 3TGWA 1ILEA 1YGPA 1B8VA 4B6EA 4PLTA 5GM1A 5HZHA 7YASA 3ECCA 3R4CA 2OYCA 1W52X 2E6UX 3WB9A 3NHMA 3QU2A 1XIVA 4IGFA 4YIHA 2OECA 1TJNA 3A9TA 4I8DA 3FHJA 4QU9A 1HT1E 1XQYA 3SZGA 3OZSA 1QH1A 2AXPA 2G1PA 3BRCA 1K8RA 2IHNA 4KPYA 2XDYA 1B2RA 1SVKA 1G8YA 1RD4A 4KMRA 4BP9A 1FTWA 1E2HA 5A4MS 4ZV7A 4IXDA 1WAMA 3OA2A 1KAOA 1QPBA 1JEAA 2P67A 2ZUTA 1MIOA 1ENZA 1JFFB 4IUDS 4NAVA 1ZBQA 1WM1A 4L2IA 4AG6A 1PEYA 1Z0AA 2EU8A 3PUZA 4EB8A 5C1OA 3F47A 5E6SA 2YKGA 1PEKE 3TDMA 2Q1UA 4TV9A 1E3TA 2E4AA 1XJ0A 2HRZA 1JR3E 2QYSA 2REQB 3HG7A 2Y6VA 3JYOA 5C7IO 7MDHA 2RGAA 4YRAA 3ZDAA 2YOGA 1C2TA 5JADA 3BH0A 4X64B 3CR7A 1ZZGA 4NS1A 2QLMA 3EA5A 4WCFB 1VXOA 1P73A 1V7ZA 1T9GR 1Z8DA 2IFTA 5TMDA 4JI5B 4DYDA 2GQ0A 1XN1A 2R0QC 4GDFA 3UQZA 3T7KA 1VDZA 1TKRA 3S0JA 2ZKLA 3L01A 4EMBA 1IK4A 5JJ5A 4Y98A 1ZRMA 4N82A 3ZEAA 3FD8A 3PXDA 3ND8A 2JGLA 3EMKA 5HKAA 3SHWA 3P2IA 4J0HA 4IFTA 2VDPB 1MB9A 1AKWA 4GRAA 1FX0B 4HDAA 3OPVA 3PD7A 4GPBA 1F4PA 1TECE 3BH7A 3AGPA 1B6RA 1OJ7A 2ZIXB 1PS8A 3C6MA 3H5IA 2ZI3A 2VJLA 4AIIA 5FNVF 5BN4A 1ZKDA 4HC4A 2HXYA 2HNKA 2VKTA 2VEOA 4TKMA 3OFVA 1UP6A 1P2VA 2C7PA 4PX3A 1VG8A 4TQUS 5H70A 1LJLA 1RWPA 2BTQB 2FQ1A 1DHRA 4JD5A 3RCBA 1UIRA 4BMPB 1T4GA 1NVXQ 2IXGA 2PZAA 4BFUA 1P2GA 3HY4A 1A27A 4TMFA 1XEWX 4NU5A 3TL6A 2WZQA 4G1UC 4RTMA 2JBWA 4NF2A 1MQSA 3WNDA 1R0CA 2DHQA 4MVJE 3FFBA 1U5CA 3IR7A 3CWCA 5C4GB 3RANA 4ZAZA 1HOXA 1VI2A 4C20A 1II0A 5D84A 4RQAA 4RNCA 2DBZA 1NATA 5C18A 1GUBA 4X0EA 2HU2A 1FYFA 1KQPA 2AD1A 3X1XA 4DQ0A 3V46A 4OJQA 3GF4A 1SM4A 4GE0A 4XKJA 2BGMA 2VJMB 3L8CA 4Q9HA 1KQGA 3FW1A 5CNJA 1JAIA 2OE2A 1ZCAA 4OK3A 5GVSA 4OATA 2AS0A 3U3XA 1XK6A 1GHTA 4C6SA 2XIJA 1E3JA 3IBTA 3OKAA 4JC5A 1GGMA 1EQ2A 1LPNA 4CEIB 4YXWD 3VR3A 4EBBA 1E6UA 5JD4A 3AMVA 1T6BY 2ASEA 4MMZB 3WGJA 5HVNA 1WCWA 3IAUA 3WNBA 2NPOA 3M1IA 4TVSA 1HDXA 4RQBA 1Z4OA 3Q40A 3BK1A 2V59A 2BY4A 2OM6A 2PEZA 5BORA 2V9PA 5CTJA 4XD7A 1F8XA 5KVSA 1G7SA 1MH1A 1GITA 4NBRA 3WKBA 4BNZA 4HNHA 4YJ3F 5ALVA 5J4LA 1Z2EA 2TMKA 1KXJA 2OCLA 2QMYA 5EXPA 3VAZA 1TZ2A 1U2ZA 3ORYA 1ZM4A 4Q05A 5LM3A 1OREA 1MC4A 3QP9A 5C81A 1P7CA 5K0EA 1XCOA 2VZEA 4LKOA 5EP4A 1I80A 3MLEA 2RAVA 3AR2A 3LUAA 1I7QB 4RPLA 7ABPA 3H19A 2JAXA 3V4SA 1DUSA 4NCJA 1WJGA 1ZOLA 2X9NA 5CFZA 1DGQA 4MKXA 1PV1A 3O8LA 4X24A 3RADC 1Z6YA 4MROA 1SQGA 3NWOA 5CIQA 1BE6A 1K4MA 2RHMA 3I52A 5AYVA 3LL7A 1LA2A 4FGUA 4V2IA 4JYMA 5A2GA 1WBBA 4RZXA 5A4IS 2J3HA 5AXDA 1U0TA 3M4NA 1I36A 2D1FA 4Y67A 2XZDA 1QV9A 2W2TA 2ATCA 2ICAA 4DIKA 1YULA 5BPFA 1B41A 1D4ZA 3FPCA 3O1LA 4FJ2A 4WSOA 4XQGA 2DKFA 1IXZA 3HCNA 4ATNA 3ZD6A 3NWEA 4U63A 4EJ2A 4BIMA 3IX7A 4FHGA 1QGZA 1Z0ZA 4PC2A 2FQXA 1NBHA 4X85A 4AL4A 5DNUA 1R8YA 5LDHA 1VJCA 2VZ0A 1O95A 3FSRA 1LD3A 1EE1A 3MTJA 2OQIA 2ZUWA 3F71A 4H31A 4JL6A 4QWMA 4RXTA 4D1YA 1QH1B 1V3TA 3KPJA 3W6UA 2BP7A 1PR2A 3EXIA 3KB8A 2W2QA 4TMTA 3R2JA 2AUMA 4EZEA 7ADHA 1DRJA 2M2IA 4IDFA 1GSIA 1GY8A 2P9QA 2W48A 3LLVA 3UMYA 2OCBA 3TZHA 3U1BA 3ZC3A 2CV2A 1Z5NA 5JMTA 1UBTS 1MIOB 2BF4A 4RVHA 5CPFA 2JAUA 4QYTA 5DCYA 5BNFA 2P9EA 2CVZA 4L2IB 4B33A 3WXMA 1RSZA 5E6SB 4BWFB 3GLIA 3L9XA 1Z0DA 1HR0B 1YUNA 3B7PA 5F23A 3HFGA 4TV9B 1BE0A 3WDSA 1MP0A 2ZUEA 5FBVB 2VUHB 3A1WA 4A2CA 4C7BA 3AOGA 4QGFA 4FHDA 2CB0A 3R7NA 2WIJA 1RM3A 3CB2A 1MDFA 2HMWA 3ANMA 5F52A 4QPDA 3R7DA 1H2YA 3UK2A 3ICCA 2D7JA 3B8EA 1LS6A 2XNJA 1O4WA 2P9GA 4HAWA 4HGNA 4ME6A 2ZM5A 3BRQA 3CH4B 2ZTHA 4PX9A 4Q6WA 1PZGA 4K9DA 2JFYA 4HKTA 5GWXA 5KNBH 2YZMA 2BKEA 1BOOA 3LUBA 4P31A 2ZUFA 4EG6A 4OHMA 5CXQA 3F96A 1DQSA 2IUSA 1QC5A 1Z3IX 3LPLA 1JDZA 5JBNA 1GU7A 4BMVA 3CPSA 2PPLA 5CYGA 3MTBA 1NF8A 2Q3LA 1D1SA 5EJAA 4UTVA 3T95A 3TRIA 1NGSA 2FCAA 2QMHA 3D7RA 4MO9A 3N7UA 1P8JA 1R16A 1XVAA