1WE2A

Crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with mgadp and shikimic acid
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
165
structure length
165
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of shikimate kinase from Mycobacterium tuberculosis reveals the binding of shikimic acid.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Shikimate kinase
total genus 63
structure length 165
sequence length 165
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2004-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1we2A00
4PPQA 5A0FA 1UFQA 4Q01A 3AM1A 2O8DB 3C41J 3C15C 4R7ZA 4GI7A 3SOPA 3AH8A 4NYMQ 1I4TD 3LBHA 4I99A 1QF9A 2QQ0A 4A0HA 4ZCMA 1DELA 1G4UR 3KXLA 4V0ME 4D2IA 1AQUA 5CLQA 1TUEA 4AKGA 1SVIA 3CF2A 3QXSA 2N46A 2J1LA 3KQHA 1G7CA 1NJFA 4LYJA 3FHOA 4DLYA 1UKVY 3BBPA 1W5TA 2VP6A 1KMHB 5LB4A 2D3WA 3WYGA 5SZKB 1JXMA 1IM2A 2ZRGA 2X2EA 4U02A 1KIMA 1UPTA 5G3YA 1JBKA 3PV0A 4Q9HA 3AF0A 2XZOA 1G7TA 3BERA 3RAPR 3BH7A 2ZI3A 1MOZA 4GP6A 2A9KA 2PJRA 2X1VA 1PZNA 2PMKA 5JEEA 1XD8A 4TLCA 3B9QA 2AKYA 2DBYA 3K70D 3QF7A 1YZNA 3LXRA 1N5IA 3SJZA 3X1WA 3WYFA 2JASA 3T1QA 3QE0A 3KJGA 3ASYA 1TL7C 4IJMA 4Q47A 2QROA 4D4JA 2B7CA 4QGAA 2YZ2A 1N6LA 2JDIA 4V02A 3RLFA 4DLZA 5IF9A 3GMTA 3K1JA 4TSFD 2PCLA 1GNRA 2XSZA 4YMUA 1R8SA 2QGZA 2BJVA 2P2LA 4Q19A 1F5NA 5KSPA 3FWYA 1JR3A 4JYCA 5KU1A 3LLMA 1FPMA 4PC6A 2DFLA 1XTQA 4QBHA 4G0NA 2AFHE 1VDZA 1EFCA 4LJ6A 4QNRA 3MUFA 2VPPA 2XSZD 4M1OA 3CPEA 2FEMA 3L2OB 4O2RA 2H17A 3A1TA 3GEHA 1YR9A 1OH5A 1W47A 3U3RA 4M1KA 2W6IA 1ZC3A 3GLHE 1OIXA 1Z8FA 2W0SA 3M4YA 1I2DA 4B3DA 1OFIA 4NCKA 3DPUA 4JBWA 4Q7KA 2HCJB 1M1YE 1E79A 1RJ9B 1AS3A 2FX3A 4PHTA 1YRBA 4H1UA 2F6RA 1ZM3A 3DOFA 3TR5A 1GAJA 4QNMA 3AKCA 2NO1A 2ZYWX 4NH0A 3ECCA 1G5RA 1S3SA 1OXUA 1RZ3A 2V4ZA 3L8YA 4IOJA 3I92A 1E79D 2IYRA 4PSKA 1YKSA 4HUTA 1TQ4A 5FH9A 4A0FA 3SBEA 3RDPA 4OHYA 4GNKA 1K8RA 1MR3F 4JVMA 3OFND 2A2ZA 2W2TA 1GKIA 4OK5A 5FUVA 3A37A 3SBDA 2B92A 3DDCA 3E5HA 1D9ZA 1KI2A 1ZAKA 2BDTA 3QEOA 3GLIB 2IYLD 4KODA 4WXRA 2ODNA 1TEXA 4IOLA 4UXHA 4MH0R 3BFKA 1TQ2A 1Q21A 3K0AA 3LLUA 4M4SA 5EXSA 5EP3A 1NP6A 4EQ6B 2ZS7A 4O25A 3FHCB 1N0VC 2IXEA 1IY1A 1DAIA 1R0WA 3HU1A 1KJWA 5JJLA 1CIPA 4G5GA 2H18A 3BORA 3C14C 1KKLA 4D81A 3UATA 2A30A 1FQJA 1EFRA 1W0JD 4DDTA 3QPUA 4JSTA 4EPWA 3BFXA 4FMBB 4LY6A 4A1FA 2FSIA 3OIVA 1EXMA 5B64A 1NVVR 5SZHB 4US0R 4A36A 4Z51A 4W9MC 3FMIA 3IBYA 1T6NA 1D5CA 4NKRA 1U8AA 4L4UA 4AYXA 3LD9A 1J8MF 3BGWA 3K0CA 2JLWA 2QM7A 1XJ0A 3GPLA 4Y0AA 2PZFA 2IK8A 1U99A 1U8ZA 3UG6A 1QG4A 1DO0A 1P2TA 2DWOA 3SNHA 3K0FB 5KNBA 4EFNA 1P9WA 3SC3A 4IKEA 1RE0A 5K8TA 1DAHA 1CS4C 4IXNA 4M2LA 2AKAB 1FX0B 1UADA 1S9HA 2WSSD 3IQWA 2OHFA 4BECA 4CEHA 4AKEA 3M1IA 1E9DA 4JS0A 3F3YA 2Z4RA 3AF1A 3L0OA 3I8SA 2W6ID 1E4VA 2WAYA 2BBOA 2EWVA 2WSSA 4A82A 1SHKA 3TQCA 1MV5A 4C0LA 1G291 1W7AA 4DXAA 3IBGA 1C9KA 4JLMA 5CYPA 3T1OA 3VKWA 4ERNA 3V00A 1DOAA 2Q3MA 2VIIA 4OI0A 5E7MA 4QFMA 4TLDA 2G88A 2IYQA 3QQ5A 3PITA 4GZLA 5FL3A 3K8YA 2YWHA 3CNLA 1KI3A 4EJSA 3CR8A 2FG5A 4JBYA 3PCRB 1HQYE 3D6TB 5FBLB 4ASUA 4D0GA 3RNLA 3BD9A 1H8ED 2ZJAA 2GDJA 2RGXA 1Z06A 4A2QA 1Z0DA 2F43A 3NH9A 4Q9IA 4AI6A 4G5SA 2QSYA 3QSYA 4C0KA 4Q1CA 3AVTA 2ZSDA 5EZ5A 2PX3A 4B34A 2I4IA 1XCMA 3NEYA 3I32A 2CL7X 1KK2A 2GRJA 3AVPA 3CM0A 5B2ZA 3VHLB 1EWQA 3HYRA 2UVQA 3ZD6A 4FIDA 2OBLA 2GCPA 1I4DD 3FVQA 1A2BA 2P6UA 4TYNA 4M22A 4IDPA 3AGPA 4CT5A 4MGIR 5FBVB 2QP3A 3R8CA 4UXIA 1QHXA 2DPXA 4WZAE 4XVQA 1NVXQ 2RHDA 1P9RA 3K70B 4Q1AA 1YQTA 4HAXA 5JEDA 1VYTA 5HZHA 2VP0A 1KSGA 4DEXA 1F2TA 2ZROA 4D4LA 1Z6TA 3AVUA 4A2WA 5FR2A 4GOJA 1E1QA 2BHRA 2DFNA 2QT1A 4O3MA 3AP3A 3R20A 2OXCA 3FMOB 1FOEB 2WWFA 4IDQA 1UKZA 3EWAA 3IIKA 5EE0A 3CNNA 1A5TA 3GEEA 1OSNA 5J4VA 1ZM9A 1XWIA 1G8GA 3SJBA 4B71A 3EWSA 1NN3A 1X8KA 2MMGA 2WAXA 1N0WA 3ZDQA 2BOVA 2YYZA 4OL0A 4P4UA 4RD3A 3W6PA 3MJRA 3L82B 1MRNA 2ZRIA 4DDVA 2ZRDA 1GITA 3IEVA 3C4JA 3OZXA 4G5QA 1R5NA 2ZJ5A 4TYQA 4RVCA 2OBMA 4WOPA 1ZU5A 2GWHA 2YOGA 2A3RA 4G5OA 4M9QA 2KJQA 3SJAA 2WOJA 2ZRLA 4BZQA 3B1WA 3PVSA 1ZW6A 2C2HA 2HJGA 3EASA 3EG5A 1OHHD 2OCBA 3FMPB 4XIGS 3Q85A 1G3QA 2AR7A 4CW7A 5KHOC 2JLQA 4LZZA 2IYYA 1RJ9A 4UKDA 2Q6TA 4C2TA 1T9HA 2G1JA 1T4GA 5F9HA 3GJ8A 1WA5A 4DBLC 1E9CA 5JRZA 4JLJA 3SR0A 2ZIAA 2RGCA 3E70C 4JT4A 2ZREA 4UNRA 3PJRA 5LD2C 1NVWQ 3NBZC 3NTUA 5AUNB 2IYUA 2ZUBA 2ZRHA 1VCOA 2GXAA 1ZNZA 2QUZA 1WCV1 2F55A 4CEIB 5C2JB 2RGGA 2QMUA 2QRZA 4EDHA 5D3MB 3TRFA 2QRNA 4PO8A 1F60A 4PSVA 4NHOA 4ZO4A 4BLSA 3HYTA 3NBYC 2J0QA 3TUZC 2W6JD 1OJLA 1Q1EA 1RYHA 1KDTA 3KJEA 4DCVA 5J4YA 2GNOA 1H8HD 4PZLA 3K0AB 3W5IA 4JSYA 2GF9A 2J5XA 4DT1B 2FA9A 2QP4A 4HLDA 2GCOA 4NYIR 5BN3A 1NLZA 3BXZA 1D2MA 3VR2A 1YE8A 4LV5B 5EP1A 4HZUB 2ZR7A 1N5KA 2LKDA 4LX0A 1X1SA 1P5ZB 3VR1A 4P3YA 4Z54A 1EESA 2E1RA 2FDCA 2X19A 3A58B 4B35A 5DHFA 4Q1EA 1XEWX 4NCHA 5F9FA 1HYQA 4OKSA 1WMSA 4ITRC 1M74A 2VSXA 1IXSB 1SHZA 1M8PA 4W5JA 1S2MA 3TQFA 4CIDA 2PX0A 5B30A 2G6BA 1HH4A 4LJYA 2ZI7A 1EFUA 3FKQA 2XOKA 4Q1FA 2JEOA 2BIFA 3CLVA 1XD2A 1CU1A 5FI0B 1KO5A 2VF8A 4OJKA 4TYWA 4OHXA 3Q8XB 1E9SA 1TU4A 2A5JA 4HZIA 1W4RA 1P2UA 2OG2A 4HAZA 4L5BA 3W5JA 4RKFA 1QRAA 2CK3A 1ZUHA 3T5DA 3RWMB 3U61B 4CEHB 1Z0IA 2ZUCA 3HDTA 2ZSFA 1WRBA 1XMIA 2FFBA 4NZYA 2GEVA 3WNBA 4GDFA 2QPAA 4GOKA 3LWNA 2OFWA 2CHGA 3AUYA 2IT1A 3DZDA 3WXMA 3QXJA 3VFDA 3CRQA 2CBZA 2O8FB 1GWNA 2EYQA 2IWRA 1T0HB 4CGZA 4IVRA 5ELXA 2XAUA 4FXPA 2IYTA 3GFTA 4GMDA 3W3ZB 5CJ2A 3RSLA 3FKSD 1TAGA 4ASUD 1FQKA 1NF3A 3C8UA 1DEKA 4IXMA 4PANA 4TT3D 4AYWA 4DDWA 2GA8A 3EX7C 1E2PA 1CRQA 3JZMA 2JJ1D 1Z3IX 3C5HA 1T3SA 1E0KA 2ASEA 2CJWB 3I8XA 2AK2A 1OKKA 1F2UA 2XNDD 1IOZA 4HLCA 5JBQA 1Q3HA 2QBYA 2JJ1A 2YHSA 1ODFA 4M9XA 2QAGC 4QJ3A 4CEJB 5CB8A 3DM9B 1ZIOA 1G8HA 3SEAA 1T8TA 3CIOA 1LVGA 3UMFA 5EE5B 1YU9A 3AGQA 3CRRA 2QZ4A 1ZU4A 3THWA 1IAQA 2VO1A 1IN4A 3R9XA 3KQLA 1Q1ZA 2QQEA 1FMJA 4KFTA 3GLGE 2QN6A 3CX7A 2GILA 2FWRA 1TEVA 2G1KA 2F1RA 1E2FA 4D0NA 3KXKA 3GLFE 4C0JA 1XTJA 4ILEA 1XXHE 4HAUA 1RW4A 4JT2A 4HB3A 3G5UA 3HWSA 4E09A 4IVPA 5CK4A 4C0AC 2EQBA 2F43B 1ZM2A 1K6MA 1E4YA 4V0MA 4OHWA 1F6BA 1WE2A 4L9WA 3RWOA 4GL2A 2G83A 3AB3A 3U5ZB 2ZU6A 2VYFA 3A1UA 5GJBA 4X8LA 2CJWA 2MSEB 1Z29A 1OV4A 4TQ9A 5AJYA 4PHFA 1QHHA 1VG8A 2H16A 2QMEA 3CX8A 1NSFA 1HEIA 1FTNA 1AK2A 3QKUA 3UMSA 2J0SA 3IO5A 1W36D 1SVWA 2ATXA 4FMCB 1PVOA 3C5CA 4K46A 1W5SA 1XZPA 3OHMA 4RY2A 4MUBA 1YHNA 1RYFA 1GZSA 4PAQA 4NCNA 4Q4HB 3GLGB 1Z47A 5FTNA 3WHKA 1KO8A 2CXXA 5EJEA 2B6HA 2QU8A 2EW1A 5CK5A 3LXXA 3RYTC 5DNYB 2XZLA 1SGWA 2C95A 4TL8A 2OFXA 2BKEA 4A0RA 2IC5A 2QAGB 4DLWA 4Z8XA 1IY0A 3SYKA 1TQDA 1KDPA 2CL6X 3CBQA 3GJ6A 1J90A 4M1TA 2EFGA 5JHGB 2BMJA 4NTZA 2ZU0C 3KJHA 2A7QA 4QL3A 2PLRA 5IK2D 1N3BA 1Q1BA 1W48A 4YC7A 1VG9B 1M7BA 2VBCA 4N0EA 3AEZA 2G0NA 4A9AA 1YRAA 2ZR9A 2OCAA 4QHYA 3OE7D 2JATA 2WJIA 3B5JA 3K9HA 3Q9LA 4Q1DA 3EA5A 4F38A 4DIDA 4MYHA 4X8MA 1TU3A 3DO6A 3WYAA 2WWHA 5KO2A 1NLYA 5GJCA 1G6OA 1XNJA 3U7HB 3W9YA 4NL4H 1DG1G 4B6FA 1FP7A 3BB1A 2ZI9A 2JIZD 3KX2A 3ZIAA 5DN6D 3KKOA 2C9OA 2D2EA 4LYFA 2ZUDA 4B2PA 1L4UA 1HA3A 2FOLA 3A1SA 3PEUA 2WMOB 5G40A 4AD8A 2J3EA 4Q4HA 1R6BX 1XZQA 3LBNA 1DBSA 4DLVA 4BFVA 3TE6A 3FHTA 4DLRA 2OCYC 2FPKA 2IS2A 3U60B 1E2JA 1KI9A 4TTPA 4XD7A 5DIFA 2WIAA 5M04A 3UMRA 1ETUA 3CF6R 4PTLA 1T3LA 2V6JA 2J7KA 3ND9A 4RD4A 1HE1C 2KB0A 3IIJA 4OJQA 4A8JA 4KO8A 3KTAA 1BYUA 2QPOA 3RS5A 3FB4A 3AV0B 4RD6A 2JLZA 1CKEA 3Q7PA 1T8UA 3B6EA 4M0LA 5A4JA 4RFSA 1OH6A 1GSIA 2BKUA 3SE0A 4G3XA 1IQPA 1E32A 2CCJA 3NHBA 1HT2E 3BFVA 3I4LA 1Y63A 2F3TA 3A6PC 4NCJA 1LF0A 2ZJYA 4A6XA 1XRJA 1K5GA 2EFCB 1EFTA 5FPSA 4BLQA 4LHVA 4XWAA 4IOKA 1VKJA 2OSBA 1GTVA 4KJZA 2A78A 4Q02A 1T3HA 3VHXA 5FPKA 1D2NA 3H84A 5JFGA 821PA 2PJZA 4V0KA 2D62A 3IIMA 4IEIA 4DLSA 1DARA 1H8HA 1P61B 5AWFC 2UKDA 3A1WA 5GJWC 2ZRMA 1ZYUA 5KUTA 2F9MA 3CF0A 4QC2A 3AF4A 3RRNA 3Q7QA 1XPUA 4ZDKA 4B32A 1JAHA 3B13B 3MGCA 4B2IA 1TF2A 4S2EA 1Z6XA 5CDFA 1R5OA 3O47A 3AKEA 3K9NA 4PZYA 5JSZB 1M34E 3WBKA 4HAWA 1V43A 1F2TB 4OI2A 3FOZA 1VYVA 4U00A 3EPJA 2RGAA 1SVOA 1NVVQ 1O3YA 2ZPTX 2VF7A 5FL7D 3X2SA 1I2MA 2CVFA 4JVSB 3TLXA 2IWHA 1YZQA 3EIEA 2H57A 1Z28A 4JJZA 5GJVC 3EXAA 1JEDA 1G3MA 3D7MA 2JIZA 2YV5A 4PX9A 5DN6A 3FTQA 2GJ8A 4V03A 4DB4A 3WMEA 1T5IA 2W58A 1CR0A 4PHHA 4B3GA 1SKQA 1YZTA 1IBRA 1ZJ6A 2J0UB 1IJFA 3CR7A 3LNCA 4CEJA 1BO6A 3MFYA 4WA7A 5KYKA 3W34A 3ICEA 4GP7A 2DFTA 5CIWA 2QGNA 2B8WA 1U0HC 3CZQA 1BYIA 1T0JB 2HDNB 2IS6A 1KHTA 2CE2X 3LAWA 5E95A 4LBYA 4US2R 3FPAA 1E2HA 4DSTA 4QOSA 2LWIA 4GT1A 2XXAB 3PUZA 4D26A 1D6JA 4Z8YA 3ADBA 1JPNA 3NKVA 1W0JA 4Q9LA 4JKYA 4TMXA 5E4FA 4XSGA 1VCNA 2BBSA 5DI3B 4DSOA 3TAUA 1UDXA 2TMKA 4WAUA 2CLCX 1GRNA 5KSYA 1II8B 4CDGA 2GJAA 1XFAA 2DWQA 4MRSA 2BEKA 4TN1A 2IXFA 1GIAA 2GZDA 2G9NA 3RANA 2O8EA 4HDOB 5H68A 1BMFA 5C18A 3CX6A 5HTKA 1VMAA 1QHNA 1UBFA 1ZC4A 1NLFA 5LPNA 3IKJA 1XMSA 3GLHB 3REGA 1W0KD 1BH2A 3KFVA 4M53A 621PA 3R8FA 3WMGA 2V1UA 3GD7A 3W8NA 2GTPA 1E2LA 1MO4A 4F4IA 3AKYA 1Z0FA 2C5LA 4DT1A 4EPVA 1KI6A 5P21A 3KKMA 3REFA 4JBXA 4DSNA 3U44A 1LS6A 2FZ4A 1RRPA 3ZVNA 3LX5A 1KNXA 3K09C 1R2QA 3PFIA 3CH5A 5FOTA 4C2UA 5KPDA 3PUXA 1XCPA 5EXPA 2P6RA 2XXAA 4C30A 3KUDA 4Q4JB 1CJVC 1TF5A 2ZRBA 2GVZC 4MDEA 2O0KA 1YVDA 2IYWA 2ZE8A 4FINA 3CW2A 2KE5A 4EPRA 5FOVA 3KDSE 5CDFE 2WWXA 3FGNA 3DEFA 1CBUA 3OESA 3PIRA 4JL8A 3H1TA 1ESNA 1RC8A 2AFIE 3C16C 3GLFB 4MGKR 4BFSA 1G41A 3LY5A 1COWA 3N70A 5C4MA 2JCSA 3GQBA 1GNQA 2ZRCA 4OK3A 1Z0AA 2IHBA 3OIYA 2OT3B 3SYNA 3VAAA 5AUPB 2X8AA 4MITA 5HKKD 1NKSA 1YZKA 1KSFX 1E9FA 3M6AA 1OFUX 1FX0A 1IHUA 2DWPA 2V54A 3MLEA 2D2FA 1Z08A 2ERYA 5BQ5A 3RS0A 1DE0A 5BYKA 1IY2A 1XJQA 2AXPA 5TVKA 3VX3A 3QKSA 4NYMR 4HB2A 1G19A 1FZQA 2BJWA 3MWJA 2RAPA 2IS1A 4RCZA 4IDHA 2ZRNA 4Q21A 4E07A 1Q0UA 2HCBA 4L15A 2KBFA 3ZZUA 3NDPA 2P65A 1LS1A 2Q0HA 3BAFA 2FGKA 2HLDD 1VPLA 4DRZA 3QVUA 1UEJA 4PC1A 5AR1A 4ZI2A 2I3BA 2J46A 3W90A 1NNEA 2Z83A 4C4PA 4Q9KA 1X8LA 1V5WA 3B1ZA 4D4MA 3FE2A 4KLZA 4IRUB 3QF4A 3QKRB 2PEZA 1B0UA 2A5GA 4XWKA 4LCBA 2ZJ8A 1GM5A 1II9A 1Q57A 4BLOA 2YJTD 4A8JB 1N5JA 2GBLC 2V6IA 4MA4A 8OHMA 2AN9A 1ANKA 1G3IA 1W4AA 5HCNA 4Q4AB 2R6AA 2GESA 3NH6A 5J4KA 1NRJB 4D25A 5F2EA 1VIAA 2WKRA 4RFSB 4B33A 2QPTA 3QNUA 2VA8A 2WVJA 2ZYVX 1NSTA 3BIFA 5DYGA 1CP2A 1AGRA 3CKLA 1QBKC 4P33A 3RRYA 1ZP6A 4OYHA 3QKSB 5IRCD 2VEDA 2OBNA 4KHZA 5E7JA 2QTFA 5A5GA 2ZSBA 4PQFA 4EPXA 721PA 1XTRA 4XVRA 5KSOA 1CJUC 2P3SA 3R7WA 4HUQB 3OEEA 2V7QD 3I1FA 4HAYA 2IYZA 1KK0A 4JMPA 2BC9A 3IHLA 3SZRA 1NMZA 2JJ8A 2OLKA 5EP4A 3EZ2A 4RZ2A 4MQBA 4R98A 3FFBA 2FZLA 1KYIA 4E22A 4GRAA 1NN5A 4KU4A 2W2XA 1XF9A 3QKRA 1COWD 4Q9JA 1WBDA 4MYCA 1KI7A 4OQXA 5K8IA 1S3GA 1G4AE 5K8LA 1HY3A 2C78A 4UJ3A 4BE7B 5GVRA 2C96A 3OEHD 3LBIA 2VHUA 2J0UA 3TAHA 4D82A 2O8CA 1YZUA 4MYTA 3WRXC 2NOAA 4Q4AA 4Q7LA 3ZVRA 2ANBA 4NP6A 1OE0A 1ZIPA 2X2FA 4POAA 4QHTA 3J81k 5FUWA 5KSZA 2W00A 3RS3A 1PUJA 4E03A 1S1MA 2KBEA 3CRMA 4AG6A 421PA 1KOFA 1GRQA 1CJTC 2HUPA 2AXNA 2QMOA 3NBFA 4YMWA 3UIEA 1NBMA 1C4OA 4FD2A 3KKPA 4C7OB 3BB4A 4PHGA 3WP1B 2WTUA 3B1VA 1US8B 2GJ9A 4HEJA 1OXSC 2ODBA 1G8YA 2HJVA 5FFMA 5CB6A 2WZQA 5FPYA 2VLIA 4B3BA 1XTSA 4G5RA 2CLSA 4FN5A 2V8OA 2ZSAA 4QBGB 4DC9A 1WP9A 3TVDA 5L3QA 4MYUA 5EE3A 4CEIA 5TXGA 1UJ2A 2ZYTX 1CULC 1U2RA 1J8YF 2QTHA 5D3MA 2XTMA 5TDHA 4DSUA 4CF7A 2CDNA 2YOHA 4Y0VA 3ICQB 2CL0X 1W44A 2DR3A 3HU3A 3TGPA 4QBIA 2XITA 1W2GA 3QXHA 1KK1A 1QHIA 4FWTA 2ZI5A 3QOFA 1CJMA 4HLUA 2XJ9A 2NPIA 1XTIA 4D0LB 2HV8A 5FUXA 1PLKA 4N3NA 3P27A 4KLNA 1MH1A 1MO3A 1S96A 3QY0A 2ZVPX 1D9XA 4ZDJA 1UBCA 2NO7A 4JLVA 3THYA 4HYYA 3B85A 2RKOA 2ZJBA 4OK6A 2BMDA 1OFTA 2QG6A 4ZKEA 1A4RA 2IEZA 2V1XA 3BH0A 3EPKA 1LFDB 1US8A 4LBVA 3SFVA 4I1VA 4AG5A 4LSGA 5JHHB 2RMKA 3OAAD 1G1MA 4RZXA 4TT3A 5DO9A 4HB0A 3RS7A 3K0SA 4KV9A 5KTYA 1MABB 2MMCA 3AVQA 3ZJYA 2DFKB 2IX3A 3IHWA 1TMKA 2ZE6A 3MMPA 4DJTA 1CLUA 2QE7A 3U44B 1Z2CA 5BW8A 4LYAA 5GVSA 3K53A 3U3JA 4UQOA 2I1QA 5J47A 1GDDA 4Q00A 2QE7D 4Q4JA 2LCFA 5DI9A 2QORA 4EPYA 2O5VA 3EA0A 4NYJQ 1E1RA 1OH8A 3CRW1 3KUCA 4QRHA 3PEVA 4PO9A 2AD5A 4IHQA 3WBJA 1EGAA 4PC3A 5CJPA 1GKUB 1NBME 5AJXA 1X1RA 1PUIA 5JLJA 4PO1A 1S9DA 2ZI6A 1Q12A 3PG5A 4I4LA 3ZZ0A 1IN6A 4MKIA 2J7PD 2HLDA 2J45A 3GJXC 2XTZA 1BMFD 3TUIC 2IYXA 3GLFA 2BCGY 2GEUA 3G82C 3ZS9A 5TB5A 1Q3TA 5JCZA 3RSOA 4DLUA 1W0KA 2H8KA 5UKDA 2J41A 3O8BA 2OV2A 1JR3D 2Z6VA 4B74A 2FV8A 2ECKA 2JJ2D 4PAOA 4FCVA 3UANA 2GZAA 2AWNA 1A82A 4UXJA 3KZ1E 1Z2AA 2WOOA 3X1XA 3KFXA 1RKBA 4FMCF 2RHMA 2QENA 3SHFA 5DSZA 3DOEA 4OHVA 4XOIA 5KOYA 3JVUA 1GL9B 2AD1A 3CWQA 1HTWA 2PLFA 4WZBE 2FFQA 4O2LA 3BS4A 4L16A 2HT1A 1ZM7A 2R65A 2XNSA 4BASA 4KYUA 2ZI4A 1E2KA 4AWXA 4OQLA 4FCTA 4MGYR 1BKDR 2OM2A 4RCYA 3LRPA 2NGRA 2ZEJA 2IXGA 3DHWC 1JR6A 3NC1C 3OEED 2DCUA 4YONB 1CR2A 3L0SA 1L7VC 3GCGA 2QSZA 1E0SA 1VHTA 3F0TA 3EC1A 3QF4B 1KNQA 1OYYA 4DLTA 3OFNA 3F5FA 1F3OA 2CCKA 1G3UA 4I1SA 2OAP1 1R8QA 1KDRA 2QNRA 2ZSEA 5JWHA 5HKKA 1MT0A 1NIJA 4DZZA 1E99A 2IYVA 2JLYA 2C9CA 3P32A 4R71A 4WZ6A 3OEHA 5EXXA 3S1AA 3BC1A 3VMFA 3PXGA 1P9NA 3SYLA 4LBZA 2WJGA 4I1UA 4B3FX 4BWYA 2P5TB 4XSHA 1Q1QA 2PL3A 1I4LD 3B82A 2YKGA 4FWIB 2ATVA 3SQWA 3NG1A 2DHRA 3U7GA 1CTQA 3IUYA 4IVQA 2J0VA 5FR1A 1Z07A 2XX3A 2ZE7A 6Q21A 2P5SA 5FBQB 1NL3A 1W2HA 1YR8A 2ZETA 3UKDA 5FTKA 4HZUA 1SXJE 3PR1A 4LWZA 1II8A 1E1RD 4BFYA 3T61A 2XB2A 3ZQ6A 2A5FA 2ZJ2A 1KAGA 1TNDA 3RS4A 1NI3A 4BFZA 1AKYA 2Q9AA 4BLRA 2PT5A 4UNPA 1E1QD 1WB9A 1OYWA 2PZGA 2R9VA 1VCMA 2REXB 5AUQA 2BV3A 3UXMA 1EX6A 4AIIA 2K5UA 5C1BA 2OILA 5L3SA 2IL1A 2QY9A 1U0LA 1R7RA 2WJHA 5J4HA 4Q7MB 2WWWA 1KY3A 1GP2A 2ZANA 1FNNA 3HPQA 3LW7A 3EC2A 2O8CB 3GFOA 4BRUA 2GCOB 1DADA 2ZRKA 4LUCA 2PH1A 1YR6A 1U9IC 4TMTA 2OUKA 3OF5A 4N1AA 4DEYA 2ANCA 2P0EA 3BOSA 4DLXA 1R4AA 4CT4B 4A2PA 3DVLA 4LOAA 1P60A 4TL7A 3LA6A 3TKLA 1KO4A 3CB4A 2RH5A 4D80A 5KDDA 2WV9A 3FKSA 3PUVA 1E2QA 4LHWA 4QKQA 1OHHA 2REOA 1AKEA 1NIPA 2VP2A 1GL7A 1GFIA 1N6PA 2IS4A 1ZBDA 2AL7A 1RRCA 5L3VA 4B3CA 2EU8A 1JECA 1NY6A 3KKNA 1LNZA 2KSQA 4LHXA 3QKTA 1S0UA 5H8WA 3L8ZA 2RGNC 2WPDA 2BEJA 5BXQC 2BCJQ 2CMKA 3HU2A 1A7JA 4QXAA 4O0MA 1ZM4A 4B48A 4Z1MD 4C3ZA 2FN4A 4TLAA 1SXJB 3PEYA 1TUIA 3QBTA 3WHLA 3EAQA 2WMNB 4DKXA 5B58C 1P62B 4RZUA 2WJYA 1JALA 1HQCA 1N0UA 3RVBA 2VHTA 1Y3AA 1E94E 1Q22A 3E1SA 1II0A 4TWZA 3AF3A 1FFHA 1P75A 3WP0A 2N42A 2OXRA 4M9SA 4TQAA 3THWB 221PA 1SVSA 3Q5EA 1G3RA 4URVR 2Q3HA 1SVMA 3AP2A 3L0PA 2R6DA 4EJSC 1AA9A 1D8TA 1E2IA 3B60A 4DVGA 1CRPA 1G7SA 1PLJA 1XEFA 1LY1A 4MRRA 2BM1A 4RKEA 3K9GA 4AY2A 4YDSA 3CWZA 2JA1A 2HEIA 5JJIA 4AKHA 1KZ7B 2MSDB 3D3QA 1HV8A 3P1JA 4CVNA 1M7HA 1W1WA 3TBKA 3QBVA 1AS2A 4YXWD 5CYOA 1M2OB 5IHPA 2QAJA 4I81A 2B8TA 2QM8A 2NG1A 3K0FA 3LW8A 4M1WA 4MKHA 2UZIR 5HPYB 3MJHA 3LDAA 1J99A 2XB4A 2ZR0A 1E96A 1N6HA 4G01B 1LF5A 5SZIA 2VRWA 4NDZA 4YMSA 2FH5B 2F1IA 3VKGA 1GKYA 4ESHA 1KMHA 3LO5A 2NZ8A 1QHHB 4GFDA 4KCGA 1DAEA 4L8GA 2WWIA 4UNQA 3IO3A 4ZCIA 5JRJA 2CK3D 3U6BA 3KQNA 5KNDA 1QHSA 3PQCA 5AJWA 3FDIA 2GEDA 2A5DA 2VP9A 2QP9X 3B78A 4B44A 2NZJA 3U6KA 2SHKA 4KYIB 1E98A 4WXPA 1TPZA 2LKCA 5CM9C 4M9ZA 3VU9A 1ZCBA 2IEYA 2V55B 4EJSB 121PA 3GLGA 5HCIA 2G0TA 2PZEA 1SVLA 4KSBA 3VKHA 2C98A 2GAOA 5IK2A 3O8RA 1E69A 3ZVMA 3W6OA 5JJKA 3TSWA 3LQRA 2ZM5A 1VHLA 2IF2A 4OBEA 4ZPXA 2WPDD 4D4KA 3OE7A 4OI1A 3JVVA 3M0EA 5DH9A 2CHVA 3RS2A 2WSMA 4FI3C 1NY5A 4PPGA 2EFHB 2HYDA 3ZVLA 3AUXA 3EIHA 1SZPA 3K0EA 5H70A 4X8HA 5HE8A 2CE7A 1N5LA 3U3OA 4KSCA 4URZR 1G9XA 3NC0C 3PUWA 2HF8A 3DKPA 5LBIA 4HDCA 1JNYA 5LDDC 4TTQA 1Z83A 4B73A 3DL0A 1LTQA 1A2KC 1WQ1R 4DB2A 4LK2A 2ONKA 2OE2A 5B57C 1CEEA 1X3SA 1EWRA 2ZAOA 1X86B 4F4CA 4NU0A 1N6NA 3NBXX 4A15A 2Y8EA 2BWJA 1W4BA 4C0SA 3VU9B 1XU4A 2HYIC 3GLHA 4KITB 1FUUA 4P0TA 4ZCLA 1S4QA 5C46F 1WDTA 3MAAC 4KVAA 1AM4D 1GG2A 1NN1A 4RSGA 2CVHA 3W6NA 4ZKDA 1JR3E 4LJ5A 3UPUA 1FNMA 5C4GB 2YC2C 1N6OA 1Z5ZA 3V9PA 4DCSA 1SQ5A 3P4YA 1WF3A 2VQSA 3MRSA 4Q4LA 1SKYE 2IF0A 1KY2A 4A0GA 3DKVA 4F4JA 2GJKA 3ZLJA 3ZS8A 5HE9A 3ZZTA 5CM8B 4ZDIA 4Q5IA 4QHSA 3U4QB 2FPLA 2Z4SA 3ZYCA 1S1CA 4MKGA 1G6HA 1AN0A 1UAAA 1AIPA 1AQYA 1U9IA 3I5YA 2WIBA 3ADCA 4TZ0A 1K5DA 5FI1B 3B7GA 5EE1A 2WJVA 3GLIA 5FBRB 3QXXA 3GEIA 5FTJA 1BIFA 3OIUA 2ZJZA 4LJ4A 3QVVA 2GZHA 3Q72A 3LVQE 4ZDWA 4QM7A 2YC4C 3RC3A 5E7IA 4JLDA 4KAXA 1J2JA 2ZXUA 1E2EA 3KTAB 4EUNA 1SXJD 3WMFA 2QBYB 2Q9CA 2R8RA 1UBGA 4KXFB 1OKKD 3AF2A 4HAVA 1ZNWA 3SI7A 4AC9A 5EUMA 2FE4A 1E9BA 2C04A 2CLDX 2ODWA 2ZQ5A 3OIWA 2RGDA 5TY0A 4Q7JB 3EZFA 3GJ3A 4EFLA 2NO9A 5ANRB 3WNDA 4J0QA 2RB4A 5KNCA 1Z22A 3K70C 2V9PA 2FFHA 3TIFA 3AVXA 1L8QA 3IEUA 2O8BA 4RJLA 3TVTA 2HF9A 2GXSA 4G1UC 4TMZA 1J7KA 2YWGA 3QEJA 4QGFA 2JLXA 1EFRD 5F3WB 4A4DA 1NKTA 3UWKA 1HE8B 2V3CC 2VTKA 2FSFA 4CZ2A 3V4RA 3UWOA 3VR3A 3VTKA 1DAKA 2REBA 5E3HA 3T35A 2XJ4A 3EPLA 2NPFA 4PQRA 4F93B 4MUAA 1MO6A 4RD1A 2IUSA 5TV2A 4P4TA 4II7A 3SS8A 1TADA 4IFBA 4PC7A 1U94A 3T5GA 4XJXA 1ELOA 2XTNA 1DAFA 2CNWA 4C0QC 1ESMA 1XD2B 1P72A 2BBTA 3SFZA 1JQJC 4BFWA 5DE3A 3IGFA 2H7VA 4BEBA 4C0HA 3RRMA 2CHQA 4N0DA 5JCPA 2JLVA 4K8OA 4LJAA 3GP8A 4Q48A 1KO7A 2OZEA 4LHYA 2CNWD 3H4MA 2GKSA 5FPHA 2KI5A 1KO1A 2JLRA 4PXAA 3AVOA 1E2MA 2OCPA 1Z0KA 1FMLA 2OO7A 4HATA 3U7EB 1RPZA 1NG9A 1GOTA 1UDWA 5BYJA 2J9RA 4A8JC 1E9RA 5DI3A 2PBRA 2VH5R 4BRWA 1YZLA 3R7WB 4B3XA 3NDBB 2AX4A 3TW8B 4R9UC 2IW3A 2Z5FA 4QG7A 5G41A 2D74A 3QENA 4E5UA 5EP2A 3ASZA 1ZD1A 4D6PA 1IN5A 4TYPA 2W6JA 1D2EA 1ZINA 3I61A 2ZJOA 1H8EA 1U98A 2PMDA 4IFEA 2GK6A 1TTTA 2QA5A 1AZSC 2VP5A 1L2TA 1QVAA 4LJ9A 1G8FA 4QBFA 2ZITA 1XEXA 5CIQA 3KQUA 3CRVA 4GMXA 4M21A 3EARA 1OPXA 1G20E 1EX7A 1LB1B 1E3MA 3VR6A 4GSYA 2C8VA 2J87A 2VSFA 2ZYUX 1ZVQA 4L9SA 1P3JA 4QJ4A 2JDID 1JXOA 2RGBA 3BE4A 1ZD8A 3HR8A 1ONBA 3QJYA 4WIAA 1XMJA 2GXUA 5L3SB 3AP1A 3RRZA 1TF7A 1JQLB 1DAGA 3QIAA 2AHOA 1MKYA 3B9PA 1XXHB 2GCNA 3QG5A 4YXWA 3TSZA 4TQUS 4XTCS 4GBMA 4HSEA 4BFUA 4LC1A 1AZTA 5JWRA 2WWGA 4PC2A 1LW7A 3ZH9B 2BBWA 3KKQA 4F7WA 2QT0A 1VTKA 3MWYW 2VHQA 2B21A 4URYR 4KBFA 5DYIA 1QDEA 3NXSA 2QMHA 2ODEA 3ZD7A 1WXQA 4URXR 3I3SR 5HR5A 1GRRA 2GBLA 2GK7A 1R10A 2PCJA 3IDQA 3B8HA 3DM5A 2FU5C 1QHGA 4HB4A 1FUKA 1XEXB 3VR5A 1W36B 3T1VA 2VP4A 4FW9A 3TH5A 2C9YA 2HXSA 2IA5A 2RCNA 2PEYA 4URUR 1R5BA 1KSJA 1P4SA 3TW4A 1O87A 3FMFA 1OXVA 5JI3E 3THOA 2WM9B 2IHYA 4FCWA 1DO2A 1RIFA 4KFUA 2IBMA 2ZRFA 4LRWA 1QG2A 4WBSA 4JLKA 4DHEA 4PSAA 1DAMA 2W83A 2AK3A 3CH4B 4AURA 3C7KA 2E87A 3HJNA 5FOSA 1SXJA 1UM8A 3CNOA 3BJIC 2JJ2A 4FMDF 1MABA 3DMDA 3ETLA 4PR0A 1GVNB 1X6VA 3BRWD 5J40A 3TNFA 4EAQA 1GILA 1XEWY 2H1LA 5DLQC 5FTMA 5KDLA 2O8BB 1XTKA 1E2GA 3WRYC 3KJIA 2WWYA 3TUJC 1KJZA 5G53C 5LB2A 2D06A 4Q1BA 5L8VA 3DZ8A 5JSZA 3VX4A 2ZRAA 4LHZA 1IXRC 3L0IB 1KTVA 1OIVA 3BB3A 4LGMA 4M1YA 4PPNA 4KFRA 4WVFA 3TK1A 1E6CA 1CXZA 1OF1A 3U4QA 3T34A 4U5XA 4PQYA 4LV8B 2C77A 4Q66C 3MWLA 5JMTA 4URWR 4NE2A 4MRNA 2F9LA 2HXYA 2ZAMA 2R6CA 1KDOA 3QPWA 1EG7A 2ZS9A 4YLGA 4JZKA 4W5HA 2F7SA 5CLLA 2WICA 5L3RA 4ZIRB 1XCGB 4ABYA 3I5XA 3A4NA 1RVDA 3E2IA 3K9LA 5FL7A 3N5CA 3VQTA 2NMVA 4GPTA 5DHAA 2XEXA 1JI0A 1DS6A 3LH5A 1GL6A 4XD7D 2EFEB 4IOMA 4A6PA 1OXTA 2YWEA 5AUOB 2FF7A 3FFAA 2P6NA 1HURA 2NIPA 1N6IA 3CPJB 1NJGA 3ZQJA 3T1TA 2P67A 2GJSA 4MKFA 4XH9B 3PENA 1CR4A 4JL5A 4DCUA 2ZRPA 3MD0A 4W7SA 4KFSA 3WNCA 3GLIE 1EFHA 4BFXA 4DIEA 4ZI3A 1F2UB 4LBWA 1TQ6A 1VYUA 2FJUA 2H5EA 2NTYC 5FUYA 2L0XA 1HT1E 3GJ0A 3UK6A 3AQ4A 4Q03A 3P4XA 3MSXA 4HLUC 2CCGA 3X1DA 3LQQA 4TLBA 2O8FA 1FTSA 1CJKC 3K0CC 3ADKA 4TTRA 4R2IA 1QZXA 2UZ3A 1JJVA 1Z6AA 1L4YA 4BEJA 1N25A 3I73A 4RZ3A 1Z6GA 1ZNYA 4FMDB 1J70A 1ZD9A 2ORWA 3W3AA 1NMYA 5FBWB 2CEAA 4UNNA 4JJKA 2OESA 3CO5A 5SZJA 4ESVA 5TARA 3A36A 3D8BA 2JLSA 1KI4A 5K8UA 1XPRA 4JIMA 5G3ZA 2A5YB 4B76A 4JLNA 2GXQA 4TMWA 4V0LA 4ZIRA 2F3RA 2Q21A 5EQTA 2C03A 4TMVA 2GVDC 1R0ZA 1VECA 3VR4A 4OI4A 3B1XA 1JAIA 3ONWA 4PAMA 2GETA 2D4HA 5DGXA 3QUSA 2RGEA 3AKDA 2NO0A 3LV8A 3W8RA 1YR7A 3IQXA 3O8DA 4TL6A 3H2YA 2QTVB 1G5TA 4NMMA 5BWMA 521PA 3R9WA 1WBBA 4GOXA 1KGDA 1G18A 1VG1A 1M7GA 4LJ8A 4CYMA 1UBEA 1P2VA 3H0KA 1OLOA 2YWFA 4ON9A 3ND8A 1E9AA 3ZIAD 3KB2A 1DVRA 3EZ6A 3SDZA 1W49A 5IDVA 4LYHA 3SJCA 1G16A 2O52A 3UG7A 4DCNA 2W2VA 5KPJA 4MRVA 1XMVA 5FOXA 2E9SA 1XBTA 2DYKA 4B43A 1JB1A 2FFAA 3QG1A 4RD2A 1T5LA 1OXXK 3LVRE 2FPMA 2R2AA 1CF4A 1OFHA 2Z0MA 1KI8A 3BH6A 4NYIQ 3G0HA 3LX8A 2V7QA 1OB5A 4P4SA 2GHIA 4BLTA 2OFOA 4JLPA 4JVLA 2ZTSA 1OB2A 1N2CE 3VNUA 3WY9A 2R6FA 4B47A 4QM6A 2FNAA 1BOFA 3P20A 2J59A 2QAGA 2WKQA 3PUYA 1XB2A 4A92A 2FSHA 1EK0A 2X77A 3TMKA 1CR1A 4M1MA 4H9GA 2G77B 4OHZA 3NHAA 4RD0A 3NIBA 1XP8A 3THXB 5KDOA 2O0HA 4LPSA 2Z43A 3R9IA 4BUJA 1FW6A 2N1BA 2ZRJA 4JLOA 4BGDA 1G5PA 3MWKA 3THYB 2YINC 5EZ6B 3MCAA 2KWIA 4LC0A 1N6RA 1VIYA 4UJ5A 1PV4A 2O0JA 2WHXA 1RFLA 2Q9BA 4QJ5A 3EIQA 3EPHA 2VHJA 5TMPA 1E9EA 1ZMXA 2EYUA 3EZ9A 4M8NE 3AVYA 4I1OA 1IXZA 4PFSA 1U8YA 3N2EA 4DCTA 2BM0A 3MG9A 4TSFA 1W46A 3L43A 4H1VA 4PPFA 4XWOA 4TZ6A 2O8EB 5LD2B 3HR7A 3T12A 4BZPA 5CITA 2F1HA 4BFTA 4BZXA 2ZE5A 2D7CA 4AK9A 4DDUA 1XJCA 1OT3A 1TX4B 1VCIA 4IDNA 5GADl 1U90A 3A8TA 3EZ7A 3H86A 4HDQB 2JLUA 1OIWA 4F91B 1E0AA 4NONA 4PZZA 4AYTA 1W36C 1DTSA 3TR0A 1G8PA 5JI2E 2OLJA 4EPTA 3RC8A 4BLPA 2YVUA 1KI6B 1Q20A 1KMQA 4V0NA 1BS1A 1SXJC 2H92A 2ORVA 1G64A 1B23P 1P7CA 4RFVA 3CPHA 3A4LA 2O8DA 2PT7A 3D31A 2YNMA 3KL4A 2FSGA 2MSCB 4HUQA 4OQNA 4BQSA 5HZKA 2XZPA 1KKMA 4GZMA 1XD9A 2ONJA 2OAQ1 1KI1A 1E2NA 1XPOA 1RRFA 4NYJR 5AJZA 4ARZA 2F1JA 5BN5A 4F92B 4IDOA 3KXIA 5JECA 3F8TA 4KBGA 2XOKD 3T15A 4R2HA 1SULA 4KVGA 3TSOA 1UKEA 2EVWX 3OAAA 4V0OA 5EE9A 1C1YA 1SKYB 1OH7A 2WBLC 4YMVA 3GJ5A 2B7BA 3QPVA 2BVNA 3TJZA 4XTRA 1ZNXA 1KK3A 3S1AB 2HT6A 4NPHA 2IUTA 1N6KA 2I1VB 2QEQA 3T06B 4DUGD 5J5CA 4P32A 1U0JA 1R0XA 3GFPA 3U3KA 4C7OA 1NN0A 2QL6A 3GJ7A 2QI9C 5AK0A 1AS0A 1ZUNB 1T91A 1GUAA 4IEEA 3Q5DA 3I62A 3QI2A 4JLAA 3ZGXA 4TMKA 1NBMD 3N2IA 3SHWA 1M6NA 2R6GA 1G17A 2WKPA 1U81A 3Q3JB 1SVKA 3HPRA 2BMFA 2FEOA 2NQ2C 5JWOA 4TYYA 4ACBA 2FGJA 2DY1A 4K81B 5EUQB 5FPTA 3ADDA 2RGNA 4ARZB 4CRWB 5F98A 4JVNA 3FYHA 3SU8A 2EWWA 4YQFA 2YOFA 4JL6A 3B1YA 3A4MA 1G21E 2ZVQX 5D3QA 1AJEA 1NVUQ 2XNDA 4TLEA 4S35A 3RHFA 4YDHB 4QGGA 5FOWA 3GJ4A 4DWJA 1VG0B 3U3MA 1UKYA 1YZGA 1KSHA 2JAQA 1F48A 2AWOA 4UNSA 1DPFA 1FP6A 4LJ7A 3KQKA 1MRSA 1W4CA 4US1R 5J4LA 1NG1A 1UEIA 2W0MA 5DISB 1ZCAA 1ZUIA 1IN8A 1S8FA 4EIWA 5IT5A 1JEEA 2ORIA 3O8CA 1JPJA 3DMNA 4LV6A 2VL7A 3SN6A 3X1ZA 1MO5A 3I72A 4EKDA 5JS7A 4C0BA 1PLLA 1QVRA 1YJ5A 4JLBA 4Z1MA 4AKIA 4LDJA 1XXHA 1XX6A 1A1VA 1PJRA 3V4FA 1Z0JA 4NBSA 4EQ6A 1JJ7A 1Q44A 3K09A 5FOUA 2XGJA 3JZAA 3LFUA 4OQFA 4Q18A 1P6XA 4U7DA 1FL9A 5H1YA 1G7RA 4M1SA 4YMTA 4B2LA 2C99A 2EFDB 1P2SA 4JKIA 3U2QA 2IUUA 1RRGA 5FTLA 5EXTA 2ERXA 4P31A 1P73A 1H65A 2D7DA 3BK7A 3X1YA 3HP1A 1DG3A 3IPYA 1R0YA 4X8OA 2R44A 3KB1A 3AVVA 3P26A 5JS8A 1XDBA 3NVAA 3THXA 4B6EA 5JZVA 1E0JA 3IPXA 3NWJA 1X8JA 3BWDD 4C9BA 4DUGA 1Z6YA 3A1VA 3NEJA 3VNVA 3QXCA 4B75A 4ZV4A 1IN7A 1KJYA 2G3YA 1KAOA 1E2DA 1IJEA 2J7PA 1LV7A 1IONA 4P4SB 1HUQA 4MRPA 3IILA 2R62A 4MGZR 3EW9A 4HI0E 4LPKA 4W5WA 1GNPA 3CONA 4OQMA 3U7FB 4WW0A 4KI0A 1ZRHA 2GAAA 4QGHA 4NCIA 3SQXA 2Q3FA 1AGPA 1Z63A 1NMXA 5L3QB 2WJJA 4ACAA 4JYBA 2NO6A 4XVUA 4BPBA 2VHCA 3B2EA 2IYSA 4MDFA 2DB3A 2JGNA 3CUEF 1KZGB 4IW3B 3CZPA 2OEPA 2VSOA 4HLQB 3AVWA 4LI0A 4EFMA 1QHYA 2FMXA 4TL9A 3PEWA 3RABA 2BMEA 1UF9A 2ZS8A 5BN4A 5AJVB 1OW3B 2GF0A
chains in the Genus database with same CATH superfamily
4BNZA 4HTFB 3A1CA 4LOLA 1T2CA 1AHIA 3OZ7A 4X62B 3RTBA 4JOBA 3OKAA 3L8EA 1JBQA 5GZ6A 1ISPA 3F5DA 5TQJA 2FZGA 3RQIA 5CFZA 1T5SA 4B7XA 1TQ8A 2DAPA 1L7AA 4R7ZA 1ULHA 2H1IA 2RAVA 4MLZA 4YJHA 3VH4A 3F3KA 3UOAB 3AH8A 4D3YA 1NGSA 1I4TD 4Q3AA 2GKGA 5COBA 3IAS6 3DQPA 2NVWA 4ZCMA 1PR4A 4KSYA 4DTIA 1DELA 3OM9A 1Z4QA 3KXLA 2AF4C 1AKTA 5LUAA 4QJIA 4U7JA 3R3HA 1TUEA 4J4HA 1QYDA 3QXSA 4KIJA 4OGGA 3ZE1B 4IZIA 5B3LA 4CKEB 1V2HE 1W9MA 3UJCA 4M83A 1NJFA 2IKSA 2H3HA 4L7VA 1UKVY 4LYJA 2XDQA 3W5DA 1KMHB 2CXTA 1V5IA 2WD7A 5LP6F 3D4BA 1J9GA 3PDCA 1GPBA 2WZDA 4U02A 4OV6B 1AC5A 5HF6A 3K9BA 3OCWA 5LOVF 1MOZA 2HREA 2P2SA 1XVIA 2X1VA 1PZNA 3D54D 1XD8A 3H2BA 4Q3DA 2DBYA 3CUVA 4FYHA 2QLTA 4K6KA 5DSXA 3TTYA 4AUNA 1N5IA 4ER0A 1JIXA 3JQBA 4HEA6 1OGYA 1MQ8B 5AM0A 1FSZA 2QWXA 3QYFA 4IJMA 3KYDB 4MPDA 5I45A 5IF9A 1TI7A 3GO4A 4V02A 3HO1A 3KOUA 2LPMA 1QB7A 4JI1B 3NU1A 5KWSA 3QOXA 4NC9A 2AOUA 5AVOA 4HNTA 1JP7A 5KSPA 2BHNA 3FWYA 2XA1A 4JYCA 4FHCA 3LLMA 3CH6A 3K7EA 2DFLA 2AFHE 3AO0B 1L4BA 4F9FA 4P4NA 1LBHA 3MUFA 4M1OA 4COKA 1TD1A 1A9QA 1C3JA 2C7GA 2OLEA 1HDIA 2H17A 1SBNE 4M1KA 3SDBA 2R00A 5JZOA 4ZK2A 3GLHE 1SELA 2HSGA 4FBLA 1RCFA 2R5NA 3M4YA 4RMJA 1I2DA 3DLAA 3OZBA 4NCKA 4Z3DA 3PA8A 2QDKA 2AW3A 2HCJB 1M1YE 2VPXA 5DJ5A 1CUAA 4ZAWA 2FX3A 2Z6UA 1CVIA 2GEJA 4IG9A 3WGHA 2F6RA 3DHNA 3DOFA 1WZ2A 2V03A 3AKCA 4LS3A 1NZJA 4NH0A 2IEBA 1RKUA 3KIPA 4FE4A 4RAOA 4X1OA 3PSAA 4DLNA 1A9RA 1MUUA 1S3SA 4QODA 4BP9A 1E58A 3BCUA 3I92A 2E21A 1RXSA 2IYRA 3UAYA 1TQ4A 2R8YA 3UYKA 4F9TA 4PN7A 3SGLA 1Q0TA 3U81A 4OLBA 2IYPA 2Q5HA 4GNKA 1IZZA 2GB4A 2VNIA 4IWXA 3SNKA 3OFND 4KYVA 4CTOA 3STXA 1ODCA 1GKIA 5EYPA 2GJ4A 1YVRA 3B1FA 3E5HA 4RTNA 1SCBA 2DERA 2YCLA 4S1TA 1PG2A 1FSGA 4EOGA 5AM3A 3MBIA 4CWAA 3GT0A 3IOEA 3PYLA 5ER9A 1QYWA 4AUMA 2GN8A 2A7XA 2CXRA 4NZNA 4XWTA 4MQUA 1LRKA 1ZK4A 2Q3LA 2P5YA 8MHTA 3LLUA 2GRAA 2Y6UA 3EIWA 4LGYA 3PGA1 3IKLA 1Z36A 1R88A 1X42A 1LPPA 3QYJA 3H65A 3TYXA 2BONA 2EL7A 4MJ3A 4CM9D 1DAIA 3ENVA 3HU1A 4ZP1A 4DNXA 3R5HA 4CQMD 4W9MC 2IW1A 1CIPA 3TRHA 4YRSA 3BORA 1PYOA 5F5XA 4CMEA 4D81A 1R9GA 1FQJA 2A30A 3B7WA 4JSTA 3CGGA 4AJPA 2I54A 4LY6A 1XZLA 2AEEA 1UR5A 1JSCA 2FSIA 3AY3A 3GRYA 4ZQGA 1Y7PA 2C4WA 2GAFA 2PUDA 1C1XA 5DCWA 1V9CA 1MG0A 1VJTA 1TJ5A 3ER6A 2WM2A 3CWCA 1E2BA 5F23A 3RKRA 4G89A 4L4UA 4AYXA 2QNBA 3P2EA 4U2BA 4JI3B 5CEEA 2OO5A 4EYGA 4C20A 3GPLA 4BJ1A 2O19A 1M72A 4XGRA 4JP8A 2QTCA 4R83A 1GPMA 1ZW1A 2PZFA 2UXCB 3L84A 5ICEA 1GJRA 4C08A 1QG4A 5LMCA 1P2TA 3AHJA 4YJGA 4XRGA 2DWOA 3LE8A 4ZMSA 1F06A 5KNBA 1ISJA 3WWPA 1RR6A 2Y71A 4NZMA 4BLUA 2C5GA 2Z5LA 3KVRA 4MWDA 3TX6A 2VAXA 1ZVKA 2YRWA 4IXNA 1O0SA 1IUNA 2AG8A 2EZ4A 3DTVB 4LQLA 3KQQA 2J6HA 4D8TA 4FGJA 4CEHA 1RQ7A 4ZVMA 4D8VA 5LJLA 4OXQA 3TINA 2GPNA 3H16A 3WLJA 1E9DA 4Y0NA 4JS0A 3F3YA 3KT8A 4BCBA 2Z4RA 3AF1A 4YIHA 4KE9A 2W6ID 4IJQA 2JZNA 3TTVA 3LYAA 3UHJA 4CMIB 2WSSA 2FP4A 5K0CA 1CEXA 1MB3A 5E2IA 3CUSA 1XYYA 4FGKA 4GZ6A 1OAOC 3RRXA 4IH9A 2QX9A 2Y1OA 4YPVA 2HWWA 4DXAA 4JLMA 2X4LA 5L40A 4ERNA 1W7AA 2WC1A 3V00A 3PTAA 2VIIA 3TIVA 3WRXA 1Z5GA 1ZK3A 4TV9A 5E7MA 4MGHA 1XJWA 3ZKAA 4N3AA 5DOVA 5FBHA 2G88A 4L3VA 5CFNA 2DETA 2C7RA 1YI0A 5FL3A 3K8YA 1QGAA 4AKTA 1WJGA 1NATA 2HD4A 2I4TA 2HIMA 4GX2A 5BN5B 2HLPA 3WGLA 1A2OA 1R4NA 3H8WA 3ZEAA 2CNNA 2ZJAA 3FJYA 1GLVA 5K0EA 3F4LA 2RGXA 1Z06A 1Z0DA 1HNNA 5AI8A 2NU6A 4FFNA 2A33A 5IH3A 4MW4A 4IZHA 2QSYA 4INAA 4LGCA 2ZWOA 5NLLA 3UUGA 5C1OA 2OHVA 5KC9A 3QSYA 5EZ5A 4MIKA 4M36A 4DJEC 1ZKMA 4BQOA 4NQZA 5HUQA 1KK2A 1GV0A 3AVPA 3CF4A 1EK5A 1A97A 2HA0A 2V6GA 4ZI7F 3HYRA 3ZD6A 4JXXA 2H7YA 1P5JA 2JH8A 3PVZA 5AW3A 3FOFC 2IH2A 3IMEA 2WRZA 1NXXA 3I9FA 4ZZIA 2P6UA 1MZPA 1ULZA 2ATIA 2H2HA 3GGPA 4IDPA 2FSVA 5TNXA 1DLIA 3L18A 4D3XA 2X1LA 5F33A 5BV7A 2TRSB 5FBVB 4K1XA 2HDOA 1ACMA 1UBUS 3AUFA 1U2GC 1QHXA 3NNDA 4ZVSA 1NVXQ 1YQQA 2H1HA 3MUEA 5JYEA 3KZVA 3S27A 1K8ZB 1YQGA 2IV7A 3AF5A 1VYTA 5HZHA 3LPLA 3LUPA 4H3KB 1F2TA 5FAXA 1KSGA 4IQ4A 4D4LA 1TW3A 3EDOA 2NV6A 2ID9A 3FROA 1GT6A 4BGEA 3RIYA 1BMQA 1QG6A 1RZUA 5JQGB 4IDQA 2MSKA 1AQLA 3IIKA 4HGNA 3SF8A 1CT9A 3PQ2A 2CMHA 3MCTA 1OSNA 2OGSA 1GPWB 1ZM9A 2COUA 3FNQA 3H9CA 3K3PA 4V1CA 3SJBA 5JQWA 3P9QA 3DBHB 4XPIB 3BHNA 2FEAA 4UAJA 2ADOA 1Q15A 2R3SA 2W2KA 1EVQA 3IALA 4ALLA 3TNDA 2CYBA 2YWDA 2BOVA 3ZLTA 1JLLA 1L7MA 2XRMA 1UQTA 1KQNA 2WVAA 1WV0A 4E32A 3MM4A 5K6TA 1R5NA 2FWJA 1GCGA 4S1PA 2CFCA 1Q7EA 2V7WA 3GLTA 4E2WA 2QX6A 1ZL0A 1ZU5A 2GWHA 2YOGA 4M9QA 4BZQA 1CUIA 5B36A 5DB4A 3UV3A 4FE3A 1MD9A 1WEHA 2C29D 2ZCVA 3CEAA 3UOGA 4XIGS 1IPFA 4R2JA 4B9EA 4CW7A 3HXOA 4BVBA 2DG2A 2QL9A 5KHOC 2H06A 1WETA 2HSJA 2JLQA 4EITA 1FRNA 4HKTA 4DZRA 4UKDA 5LQJA 1JLSA 4IL5A 2PKQO 3OQMA 3GJ8A 1EP3B 3HNOA 2IUFA 1E9CA 1F6WA 1IHDA 2RGCA 4BXOA 4IIDA 4KGVA 3WJAA 2REQA 1XZ8A 1U1GA 4EVQA 3GP5A 3U7JA 1CY7A 2QZJA 3GG9A 1K08A 1KIFA 2FPGB 3HMKA 4L27A 5EL0A 3DXYA 3WZ2A 4DRYA 5BWOA 3U56A 1ID1A 1PDVA 3R23A 1PNRA 2G09A 2O2GA 3FUTA 3MQ2A 1V16A 3BWVA 1V9SA 4CEIB 1JLMA 2J8ZA 3K32A 4NAVA 2RGGA 3I2FA 2CHUA 2N9UA 3OJEA 4LY9A 3TAXA 3V4ZA 4BX9A 1H0RA 2XW6A 3AYXB 3MYYA 4DGSA 4LXTA 4DEVA 4P0PB 4NHOA 3UJ9A 1R4MA 1N1EA 1NBOA 2QL5A 3NBYC 3NUQA 3P0HA 4R9VA 1DKNA 3G7NA 3EGEA 3TUZC 1RYHA 1KDTA 1Y4ZA 3JXEA 4IDEA 5ECWA 4DCVA 5CG1A 2XOXA 1H8HD 2YY7A 3O4JA 1RYZA 3K0AB 1QX4A 1S8OA 2IOQA 4DT1B 2YN4A 3KVOA 2FA9A 1MORA 3BMOA 4LVOA 4LZPA 2G9VA 1CV2A 3VR6H 3TQHA 1NLZA 3ZCVA 1D2MA 3VR2A 1GZHB 4FDLA 1V6AA 4LV5B 4YEDA 1N5KA 2LKDA 4MS3A 4L02A 1OI7A 3AJ9A 5DWQA 1P5ZB 3L6OO 1OFUA 4C14A 3MWFA 5IN4A 2X19A 5CHYA 4D9EA 1NFFA 2VYVA 3PRYA 5EMJA 2ZJ6A 3OLVA 4JUIA 1W6RA 3FPJA 4U2DA 2H48A 4D96A 3ABOB 4BJ5A 1PR0A 1HYQA 2PA3A 2XYRA 4OKSA 1IVNA 4MUKA 3HUTA 1G5IA 1M74A 3QVSA 3K92A 4FNGA 1I1NA 4IXDA 4QU8A 1C0LA 1S2MA 1TAQA 3TQFA 3WQRA 4AMZA 5CFLA 4FR5A 4I6GA 2PX0A 3T5CA 5B30A 2XE6A 1EFUA 4KLRA 1ACLA 2NUTB 4Q1FA 1CCWA 1TVEA 2JAOA 3QVMA 1GUDA 4JR0A 3SCZA 4ZOBA 1Q95A 3ROGA 3CVYA 3LUFA 1YQUA 4HDAA 2FW7A 4OJKA 3VAYA 3P19A 1E9SA 3L07A 1W4RA 4ESOA 4P35A 4WLUA 3TSAA 2XRFA 1MJ5A 1BXRA 5B37A 3O75A 1QRAA 2CD9A 1ZUHA 3OA0A 1IXYA 2FMHA 3TFOA 3KZXA 1M2NA 1D4FA 1XMIA 1DP4A 2FFBA 2ZPUA 2ZSFA 3LHDA 4I8IA 1JWLA 2QPAA 2AQKA 4Y1GA 2P2ZA 3AY6A 2OFWA 3NHJA 4AMUA 4WXEA 3GT4A 2IT1A 4B3MB 3DZDA 4K05A 1XVVA 3VFDA 3WXMA 1VHWA 2QM3A 4R2XA 1Z7YA 2PNFA 3DT9A 2O8FB 4PEVA 1T0HB 3G2LA 3OD1A 4ZVRA 4DA8A 1Y1PA 1Y4AE 2DF8A 3N0XA 4EHHA 1YZYA 5HK9A 1E64A 2PMFA 3DDZX 2WA2A 3FKSD 3RTGA 4HN2A 3ICVA 1DEKA 4IXMA 1G38A 3E22A 2D00A 4DDWA 4FWBA 5F73A 4AYWA 5DBHX 1E2PA 7REQB 1SXHA 4WFQA 4WCFB 2X9LA 1PD0A 1T3SA 1E0KA 1R0LA 3G7SA 3IXQA 4D9CA 3FLEA 1M2GA 1WSDA 1DV2A 5C34B 1F12A 1QGZA 5LZ7A 4E5YA 4YDQA 2O5EA 4JIGA 3OKCA 1WSBA 3NDJA 3OCCA 3I58A 3EXFA 2QAGC 2JF0A 1FNSA 1P17A 2J5RA 4IHJB 3SEAA 1LVGA 1O97D 1QC5A 4EHKA 3TNYA 1SD1A 4E70A 1G5FA 3AUTA 3BRQA 5D00A 1ZU4A 3THWA 1XRPA 4LY3A 4LOIA 1V3UA 2J30A 3I12A 4MICA 3I01A 4JVOA 2JK0A 3HDVA 3PHCA 4PCVA 5BQOA 4F8JA 2GILA 2FWRA 1JSZA 2G1KA 2PLAA 2F1RA 1E2FA 4LRUA 3ZCSA 3KXKA 1LDMA 4BIIA 1XTJA 3AHFA 1PFGA 3PQDA 6ABPA 1Q74A 4BZZA 4JT2A 2R60A 3OO0A 5CVEA 3VR3D 2DT5A 2OPHA 1JHUA 2R00C 4IZOA 3C43A 4GEGA 4BU0A 1KQ3A 3SDSA 1Z16A 1H9BA 4FYMA 4V0MA 1BD4A 4U1RA 5ICFA 4OHWA 1F6BA 2ICAA 1QFYA 1JFTA 5DT9A 4L9WA 4OVKA 3RWOA 1VSQA 4GL2A 4UM5A 3GEGA 2VPYA 3U7IA 3ZWPA 3Q7TA 1SUCA 3T54A 2ZU6A 2CSUA 2QU7A 3C5EA 4HQLA 3TL2A 4BVHA 2VYFA 5K03A 1JW9B 4XUDA 3RJMA 3BMCB 2MSEB 3PB3A 3V9PA 2A9VA 4RGYA 4E11A 1AQJA 4CKXA 3GC6A 5IMBA 2A6PA 2D2IA 4KXMA 3OZFA 2FZVA 1QHHA 1VG8A 2H16A 3LQFA 5KYGA 2E2WA 2IELA 4L5AA 1Y6GA 1WM1A 1KWGA 3QKUA 4A8HA 5LMZA 3FOBA 3UMSA 5H3CA 3IO5A 1Z82A 3OLCX 3ZE7A 3GGDA 4LVUA 3U13A 2ATXA 1P45A 3Q40A 4BO4A 3V3KA 3M33A 1OR8A 1O57A 3LCJA 1XZPA 3ZGNA 1LSSA 4BUCA 1E60A 4RY2A 1M1NA 4XSVA 3LY8A 1WO8A 2PAAA 1RYFA 4BQQA 1NVFA 4O2BB 3C6ZA 4EW6A 4JQZA 5EEGA 4Q4HB 1HQKA 4WH0A 4TKVB 1Z47A 1BDJA 2IYAA 1N33B 5DEOA 1J8QA 5DXJA 5GZ1A 1TIBA 3R3YA 3EUEA 4X63A 5EC8A 1G8SA 1K6EA 3DL7A 4EYSA 3S81A 4WT7A 1KYWA 1E8NA 3D4IA 2FW1A 3T3MB 4CKWB 4OXYA 3DPIA 1XCBA 5IP5A 1YQWA 2QAGB 3SEZA 4Z8XA 1IY0A 3CW9A 3GJ6A 1KDPA 5CDGA 5FQOA 4H4CA 1BE6A 3PGVA 4ZQCB 4BJ3A 5I7SA 1G5QA 4ZD6A 5FAKA 1GA4A 1W59A 2WYWA 1VIVA 3R0VA 3KJHA 2A7QA 3BRWA 3IQFA 4NTZA 4PX3A 1J22A 4POOA 3R6DA 4IIVA 2FDXA 4UPEA 2FKNA 1N3BA 1Q1BA 3L6UA 2FSSA 2HC9A 2I2FA 4QDUA 2A0FA 2VBCA 3A9UA 4MWCA 5JVDA 4OP1A 4AO7A 2OCAA 4QHYA 2WU1A 3IP8A 4IHJF 3AWDA 3K9HA 2BGUA 4BE9A 4WTOA 1XN1A 4RJIA 3WYAA 2WWHA 4F9EA 5KO2A 1NLYA 3GUHA 4HVTA 3EFEA 1XNJA 4BY9E 3NDIA 2PK3A 3DT8A 3MS2A 1OY1A 4KQGA 4B6FA 3JALA 3LPMA 1FP7A 1ZD3A 2BH9A 2HI0A 3BB1A 3KX2A 2JIZD 1I4EB 5DN6D 5K0ZA 3KKOA 4I9FA 3HCRA 1E4OA 3NT2A 4OSOA 4R7GA 1YGYA 3A1SA 3PEUA 4HO1X 2NU8A 4MQEA 4AD8A 4DLVA 1XFDA 1R6BX 1XZQA 1DBSA 1EEXB 3WQQA 5K0TA 4BFVA 2Q8QA 4M37A 2PRYA 4BO9A 4DLRA 3FHTA 2PH7A 2XD4A 2IS2A 1LEHA 3U60B 3I30X 4CMAA 1QQBA 1R4MB 2V7EA 3BL6A 4B8YA 4XD7A 3AM4A 3SVTA 1J33A 3R7SA 4TMFA 2JG3A 5M04A 2WSIA 4LE0A 3UMRA 3UBTA 4PIPA 1JA0A 1DOHA 4FSHA 4DR2B 4PTLA 3AL0C 4RD4A 3ND9A 3DAGA 3IIJA 4Y2TA 5BWNA 3T3OA 4A8JA 3PUIA 3D4OA 3KTAA 4KO2S 1BYUA 1T24A 2QPOA 3FZEA 1ZUWA 3FB4A 1A96A 2QYSA 5AMXA 3T4PA 3LZCA 4PLGA 2A1TS 4HYEA 1EM6A 2SBTA 3AFGA 2XNCA 5BR7A 3LC1O 4WVLA 4REQA 2GPYA 2QJFA 2BI8A 1L5LA 3UNXA 4AU1A 4UE3S 1EBUA 4TV9B 3DMTA 3A9VA 3AXTA 1ZLXA 1IQPA 1L9KA 5G4KB 4UREA 2VJOA 4QOJA 3WLLA 1Q11A 3NBMA 3O0TA 5AI4A 4B4OA 3VVLA 1RTKA 4ZVNA 4W1RA 3EFHA 2CWWA 4RL4A 4Y2UA 2FUCA 1P2FA 3HN7A 1TRKA 4R6XA 4WLFA 4HG2A 1Z6ZA 4ARUA 3JW8A 4PLHA 3D8RA 1ZMTA 4HGOA 4IJ5A 1PSWA 3E35A 4LAFA 4AY6A 1HMPA 4R0MA 1C0PA 1PT5A 3QOWA 4C76A 3ZU3A 4BKOA 2GH1A 1GTVA 2BKXA 2JJYA 4JJ8A 4ZT3A 1UP6A 1XKTA 2A78A 2FVXA 1QZZA 1T3HA 3NJ8A 1QK5A 2OPBA 3QWIA 5IBRA 4BYGA 1L4EA 1M6WA 1UMDA 2Y0DA 821PA 3CS3A 1T9DA 2D62A 3IIMA 4HRAA 3OQ1A 4IEIA 3C6YA 1P61B 2IDMA 3VDMA 4J0CA 3A1WA 5GJWC 1ZXLA 2F9MA 3CF0A 3HKDA 5BORA 3OBIA 3L3BA 1SHLA 3RRNA 1KZ9A 4ZANA 2ZT8A 5L95A 3JY6A 1DRWA 1UBMS 3B13B 3ZWCA 1XHFA 4DV1B 1FFBA 4KWHA 5CDFA 2VUIB 3QU9A 4Q3LA 4RESA 4WK6A 3RROA 3K9NA 4K6OA 3HZOA 5A71A 4IGKA 3VYVA 1WR8A 1GZ3A 3X1JA 1F2TB 1TLFA 4C78A 2XCOA 2ZBEA 4PY2A 4UUAA 5EHGA 5C1DA 1VYVA 5E7QA 5KYUA 4MZDA 1UCFA 4NX2A 1NVVQ 5IZCC 2ZPTX 4GWKA 2VF7A 2GN2A 4JVSB 2IWHA 3VNAA 3ZWOA 4Z4GA 3DOOA 4DF3A 3DEYX 1PV1A 1LC0A 5GJVC 2BSAA 4V03A 1U5BB 3E5RA 1T35A 2FVYA 2W58A 1CR0A 3LECA 4KVFA 2HHAA 5A6SA 2E5FA 5I4IA 1FNCA 3LVFO 4PHHA 2PUGA 1RLJA 3NFRA 5FO1A 3GAMA 1M1ZA 1TXGA 5HR5A 1IJFA 3LNCA 2ZBUA 3M6UA 3FSJX 1U3TA 3W34A 3BQ9A 3HHEA 2QGNA 3CZQA 1BYIA 1OYVA 2QL7A 1OJ7A 4XEHA 1NYRA 3BKWA 3U4DA 2IS6A 4O4JB 4DR4B 3WA6A 4LBYA 3FPAA 1RVV1 3FWHA 2BFBB 1CHNA 1E2HA 2QLNA 3AB7A 1K97A 3P9YA 4KOAA 2M6SA 4R2LA 3JQAA 1QVZA 4JH0A 4QXRA 3S44A 3MXOA 3SXUA 4RTLA 1D6JA 4DANA 1U02A 3L7OA 1UPFA 3NKVA 4NMHA 1YVUA 4JKYA 1FDVA 2AFIA 2E37A 2ZKIA 3PNKA 5E4FA 3QUQA 4MMXB 3T7IA 3WGYA 3P9XA 1VCNA 3AFHA 1UDXA 3E0XA 1OBFO 1ZGBA 1PR5A 4O4LA 3RYIA 1JN0A 1TJPB 3SZ3A 2FZ5A 3O92A 1II8B 4DJAA 3H1GA 3UXEA 4JI0B 1QRRA 1XFAA 3HZRA 4BL5A 1UDRA 1PFWA 2C9ZA 3OJLA 2DVMA 2GZDA 2G9NA 1SO8A 4G65A 5H68A 2WT4A 1ZI9A 3DFKA 1VMAA 3ICEA 4RAQA 1HFKA 1QHNA 1ODJA 1UBFA 5LPNA 3IKJA 1TW2A 1XMSA 1P4HA 3F7MA 1CF9A 1TAUA 3B53X 1W0KD 5L4SA 2CL5A 1JZTA 3KFVA 4JOCA 4M53A 3DNMA 4OXIA 3QM1A 2WU8A 4EYOA 2ZTMA 4ETNA 3GD7A 1E2LA 1DXHA 3OC0A 4YRZA 1P7ZA 4F4IA 1HFWA 3WBFA 1Z0FA 4XB1A 3OKFA 4D46A 2WIJA 1MOPA 2BGNA 3F71A 1JIKA 3U44A 4W8GA 4G0OA 3EH2A 3NGLA 4B83A 1NXPA 4LDZA 1O95C 1R50A 3UB4A 5KYTA 3LX5A 1GYPA 1Z5OA 3RD5A 4G67A 2ZGVA 3IA7A 5SY6A 1JVSA 5KPDA 3GZNB 1V96A 3PUXA 4O4HF 1TCBA 1XCPA 4FC6A 1QPZA 1Z39A 3KT3A 2P6RA 2XXAA 4OLAA 4Q4JB 3ZUGA 1BXZA 2VK1A 4ZQIA 3AESA 4MDEA 5CVDA 2O0KA 2CF5A 1PK8A 1NRXA 1YVDA 2ZE8A 4IKOA 2OORA 3RIMA 5CEFA 4GOOD 5ARBA 4EPRA 4AJEA 1W35A 2HBYA 2O3UA 2WWXA 1NSYA 3FGNA 1TRHA 1XZBA 3KE8A 3OA2A 1H0SA 3HLYA 3PIRA 4JL8A 1U5CA 3ANLA 2WV7A 3GWGA 1N57A 4BFSA 3LY5A 2WHPB 3MMSA 5C4MA 2NUTA 2PKEA 1QQAA 1GNQA 2OV3A 4LWOA 2POQX 1A9YA 2MTBA 5DYWA 3U4MA 1T9GS 3OIYA 1C8VB 4GXTA 2HADA 4QU9A 5TMBA 3SIXA 3MT8A 3V4LA 3VAAA 5AUPB 2BUBA 2X8AA 4TSRA 5DMXA 5HKKD 1NKSA 1YZKA 4XDYA 4P1ZA 3ASVA 1FX0A 5K99A 1JVBA 4UAGA 2BJHA 4J0FA 1C4XA 2G40A 2ERYA 5BQ5A 3TIXB 4ICIA 1J24A 1GU0A 1XC7A 4LJLA 3I53A 2EHJA 3VX3A 1NC1A 1JLKA 5B7NA 1FZQA 1J8FA 5B6IA 5FWNA 3MWJA 2EIXA 3E9EA 4AECA 5HIKA 3WKBA 3DMYA 3NIGB 4RCZA 1EP9A 2ECQA 3BXEA 3FZNA 5J9FA 3TW6A 2J32A 3ZZUA 2L69A 1Z8NA 1LS1A 4LSMA 5KVVA 5IX8A 2NYVA 4FFBB 4EL0A 1UEJA 2ZIXB 2AVDA 2QYOA 1BFKA 3CHYA 3DG9A 4LMPA 1NNEA 2Z83A 5K0BA 4QUEA 1A77A 1V5WA 2Q8PA 3IR7A 1V1RA 4D4MA 5BPHA 4RPIA 4L74A 3CGWA 5KREA 3GJTA 4RYLA 2YMQA 2O6LA 3KEMA 3EJWA 1GM5A 4LCBA 4L72A 1RMTA 3QVWA 4IDCA 3KZMA 4CLEA 1Y4DE 3KOOA 4A8JB 2A84A 4EF4A 3FLBA 4EBFA 2HMWA 1ANKA 1RPAA 1YS1X 3OT1A 3IAS1 2R6AA 5IKOA 3E3LA 1DUVG 3D43A 5U4QA 4ZYTA 3NORA 5DHQA 2VT2A 9GPBA 3SC2A 2WKRA 3DMGA 2HLNA 4FFVA 4IAOA 3OE1A 2DHDA 1WW8A 3IBSA 1PNQA 3O84A 2CZQA 2WVJA 3IPLA 3KWMA 3PI7A 4Y6OA 4C03A 3BIFA 3ONNA 1ZD4A 2VCHA 4XA8A 1ONOA 1ICIA 4MUYA 1CQPA 4CKZA 5IRCD 2VEDA 2BFWA 4I5DA 4Y2SA 5E7JA 1YQXA 4RXMA 4EMSA 1AGXA 3EOZA 1G6KA 2NXNA 4DLBA 2WIKA 4LF7B 2C3OA 3KDAA 3WDLA 1LPAB 3N7AA 4EPXA 721PA 4EM6A 3KSZO 3ANYB 5I3CA 4XVRA 5LZ2A 2P3SA 3OIGA 1BJTA 4FKZA 5DHPA 5LKRA 2XV1A 4IH1A 4JI5B 2QVXX 1W8IA 1KK0A 3LDGA 3N0TA 1Z8DA 4D9MA 1E8MA 3CXRA 4ND5A 4YVFA 1VJDA 5E1MA 4MQBA 4R98A 1I3OA 3FFBA 3JPYA 3FCAA 3OECA 1SFRA 5G1OA 1SKBA 3RGGA 4GRAA 2E55A 4BAZA 5K05A 2MHCA 1NN5A 1CNEA 4YPOA 5JNVA 4I36A 1XF9A 3QKRA 4XXHA 2GLTA 1JYFA 2W7TA 2E82A 3G2KA 4PNHA 4EUFA 1KI7A 3F67A 3SZMA 1FLVA 3OJOA 1HY3A 1IHYA 2PYDA 2Z2KA 3WKCA 1OGJA 1ZGGA 2C96A 2YV2A 3FJ1A 3LBIA 1I30A 3KQKA 2PVPA 3DKRA 4UNIA 1L7PA 4QOGA 4Q4AA 3VH3A 2RHCA 2ANBA 1OE0A 1Z7GA 1IB0A 1I94B 4WBXC 3DF7A 4HXGA 4Z3KA 3J81k 3PJGA 2QQGA 2V8BA 3GLVA 1PUJA 5LOVA 1VC2A 2UVPA 4OUKX 1HEYA 5TQ0A 2OB1A 3R3ZA 1N2GA 3C3JA 3RYHB 3L7JA 1NBMA 3MVEA 5HFJA 1ULUA 3JYNA 1J9EA 4M89A 3FDZA 3BB4A 1SQFA 5AHWA 1AOXA 4N8DA 4AMYA 1US8B 2H11A 2OWDA 3LSTA 3OCVA 3IT0A 4XW2A 2ODBA 4MEJA 2OC9A 2NUBA 1DJPA 2JAPA 2HJVA 2BFEA 2PGNA 2H0AA 3B5EA 4N82A 4EY6A 1B00A 2WQ6A 1QIIA 3LHIA 1ORRA 3I09A 3KZKA 2CLSA 4U6SA 1ZHOA 1GNTA 1USGA 1ISIA 1EMDA 3FETA 1LPMA 1ZI8A 2X76A 4MCJA 4X45A 4XQEA 1UJ2A 2ZYTX 4LOJA 5CCBA 9MHTA 1J8YF 6AT1A 3ZYZA 5D3MA 2ZG6A 2LVBA 1CQZA 2XTMA 4X71A 4C4OA 1XVAA 4CF7A 1MJNA 3ETGA 3NTRA 4REOA 1A4XA 3ICQB 1PJ2A 1NBEA 3DZHA 1M8GA 3PXCX 3VGJA 4NG4A 2F1OA 1KWKA 1WHTA 2P9QA 4AJ4A 3WK6A 2DBQA 2JAHA 4QBIA 1QFJA 1QO7A 1P9LA 2BGTA 7MDHA 5K4GA 1KK1A 4FWTA 1CJMA 3MCZA 4HLUA 2VHVA 3KAPA 4PBRA 3G5LA 3HCOA 4D0LB 1PGNA 1WUJS 5FUXA 2XCRB 1N2EA 2G1PA 1MO3A 3QY0A 1R1DA 4O4HB 4YJ3B 4JYAB 2ZIZA 2JGDA 4ZREA 2YL2A 5T8KA 1UBCA 2BEWA 1ZZGA 3UPTA 4NCBA 2XCLA 3B85A 3N87A 3HCPA 1QGUA 3JWIA 3VZSA 1JIVA 1XTBA 2HMUA 2V1XA 3QKWA 4MHTA 1LWOA 3HYNA 4G23A 4LBVA 1IBMB 5B1IA 4UVIA 4PZCA 1ZAYA 3W7AA 5JHHB 2RMKA 1G1MA 2Q1YA 10MHA 3ENKA 1JDNA 3EXEB 2FY8A 4KWIA 4MO9A 5ALJA 4LECA 3WVNA 3K0SA 3LFHA 2GDZA 1MABB 1QG0A 2B9VA 3CF4G 2MMCA 3PCTA 1UM9A 1NE2A 3AVQA 3CLHA 4GZ3A 3M3DA 2IX3A 4Z7NB 2P7IA 2FPPA 1QCDA 2ZYGA 4IO1A 3KQMA 4LE1A 4GXQA 4M8IA 3U44B 1LK7A 1Z2CA 2Y1KA 4LYAA 3L05A 5KQPA 4RTPA 1U2DA 4UQOA 3ZDZB 1YSCA 5J47A 5FJIA 2FW8A 3RWBA 4D79A 4Q00A 2ZB2A 5M2QA 1UWKA 5BPFA 2XCUA 3EA0A 5JMWA 1E1RA 3PEVA 4PO9A 5F1PA 2AD5A 1IFXA 2DLNA 2HJSA 3FBWA 1EGAA 4H15A 1EK2A 4PC3A 3O74A 4DVJA 1Z4JA 1PUIA 3F5QA 3GFBA 3A05A 1MHPA 4AMGA 3PG5A 4I4LA 4ZAGA 1ECPA 4RQTA 1UAGA 2J7PD 3V7WA 1D0VA 1YDHA 1E8DA 2XTZA 3TUIC 1NOKA 2WU4A 2NNLD 4F5EA 2JGJA 3LPAA 1N5RA 4MVJI 3WS7A 1RAIA 4E4RA 3QTBA 1VQ1A 4FSDA 1PZEA 2ZZMA 5B2EA 1PK7A 2PGDA 1ZUD1 2VVTA 4B74A 3VPGA 4FCVA 5EWJA 1WCYA 3PGMA 1Z2AA 3UJAA 1PJ3A 4GLOA 1TIPA 1K8YB 4GBED 5EERA 3MCUA 2JBHA 1VL5A 4WADA 1Y34E 3DOEA 2VNHA 3F7TA 4OHVA 4TKUA 1TFUA 4YCLA 1WB6A 1YK1A 2OOSA 9LDBA 1Y8CA 3E3OA 4M55A 1LLCA 3VZCA 2IGTA 2GT1A 1GAEO 3CUKA 3FNEA 1NU6A 1R12A 3C4VA 4B80A 1JSLA 2FFQA 5A1TA 4DV4B 5K09A 4P0QB 4L16A 2HT1A 1IB6A 3JQFA 3T1HB 1ZOOA 5DTJA 1OTYA 3LY9A 1RNLA 1TE2A 2D1QA 2ZI4A 2C5SA 1AKMA 3AUJB 1YQEA 3NRJA 4MGYR 4OQLA 1E77A 5BMOA 2OM6A 3O2NA 3BT7A 4JGIA 4HH0A 3NC1C 1MC5A 2VRCA 1TGYA 2OZPA 4IINA 4YONB 5K20A 4LSZA 3DBHA 1IATA 2B9EA 3EC1A 4MWEA 2C4HA 1YCDA 4DLTA 1N77A 1L5KA 3RARA 3STYA 3GUVA 3OFNA 3TNJA 1QYIA 2A1UB 3LQ1A 4PRZA 2P3QA 5ITVA 1JT2A 1UK9A 2FPGA 2R8OA 3OCYA 4FGLA 3ILVA 2KM1A 3IV9A 1G3UA 2AFVA 4Y2PA 4XDHA 2QNRA 1N2HA 1NAHA 3TKYA 3T3NA 1NIJA 2H4FA 1WPQA 5EKXA 4A23A 1T36B 3QI7A 4DZZA 3IAFA 4G37A 3C45A 1ZGAA 5MN4A 2P1DA 1DBVO 4RV9A 2C9CA 3RFUA 4KXYA 3F47A 3KSRA 4WZ6A 1TJ4A 3HL0A 3S1AA 3PXGA 1P9NA 3SYLA 3VPBA 4BWYA 2P5TB 4XSHA 5KQGA 1YCFA 4HRXA 2ABWA 3L7LA 2P0YA 3ZDEA 2W22A 1SCUA 1DQNA 4D9GA 3NG1A 2DHRA 3IUYA 5ITZA 3UKOA 3TLCA 2XX3A 1WKVA 3LO8A 5BP7A 6Q21A 1W2HA 3OIFA 3QITA 3WLNA 1DGQA 4NR0A 2OV4A 4LWZA 1U7UA 5GMOA 1E1RD 3EEOA 2Z2IA 4Q3EA 2X8JA 1O96A 4LWQA 2H8GA 4DJ5X 1TNDA 2G5GX 2R5WA 4MVJD 3HBFA 2P78A 4RDCA 3RS4A 2Z2XA 2PT6A 4MVJE 2HN9A 3K9QO 5CVUA 3U40A 1Q0ZA 1WB9A 2PZGA 3WK9A 2FN8A 3EISA 1J6UA 1L4MA 2BV3A 1WDMA 1EX6A 2FQ1A 2NVUA 3H2GA 3PF8A 3UXMA 3W5SA 3WRVA 4AIIA 1JAXA 1DI0A 3VPSA 1U0LA 2WJHA 3TX2A 2PSHA 3EY4A 1KY3A 1GP2A 1SUAA 3HPQA 2NZXA 3EC2A 1C14A 2O8CB 3GFOA 1T5DX 2ZUWA 1TKAA 1JJBA 1HSZA 3PPVA 4WY5A 3T4EA 3ZI0A 1ZRSA 5K01A 2PH1A 2R4TA 1U9IC 1BDBA 4TMTA 1PJCA 3RTDA 3BOSA 4GWGA 2P0AA 2QJWA 4CT4B 1QNLA 1SPXA 1SU4A 4IDBA 3DVLA 4B4WA 3L8HA 4P7FA 1KAHA 4PGHA 4DIOA 3MTDA 5K45A 4N3GA 1M34B 4MEBA 1LC3A 3CB4A 1JWBB 1N7HA 4QPPA 1U28C 4HUJA 3LPNA 4LHWA 2DUJA 2EKLA 2BGJA 3I2KA 5CT8A 3CLSD 2VJMA 1NIPA 4M9RA 1CUFA 3H0EA 1AURA 2VP2A 4KREA 1O6ZA 1GFIA 2XYQA 4NENA 1E3SA 1A9XA 2ZBVA 1VRVA 1PQWA 1RM0A 1UXKA 1KZ4A 1ZBDA 2AL7A 4P82A 5TEVA 4ZICA 5L3VA 1KQGA 1RRCA 1D2HA 1NF9A 1NY6A 1VCHA 3ZY2A 1KYZA 4EKNB 1BU8A 3IMCA 1VPWA 1S0UA 2R7NA 1TZBA 3TTWA 5H8WA 1GPAA 3ANMA 3HY3A 2WPDA 2BEJA 3OQJA 5BXQC 1VMEA 1A7JA 2BFDB 5FLYA 1P4GA 1N8KA 1X7HA