1WE2A

Crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with mgadp and shikimic acid
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
165
structure length
165
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate kinase
publication title Structure of shikimate kinase from Mycobacterium tuberculosis reveals the binding of shikimic acid.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 63
structure length 165
sequence length 165
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2004-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1we2A00
4HYYA 3K0CA 3LLMA 3GJ4A 2QQ0A 4DZZA 4XJXA 4DCNA 3SHWA 1Z63A 1QHXA 1IN5A 2FEMA 3L8ZA 3D3QA 3TKLA 1AZSC 2IK8A 1OB2A 2ZVPX 5HTKA 5IK2D 2PEYA 1U90A 1HT1E 4OQNA 2W83A 3NKVA 3TE6A 1G291 5EE3A 3QVUA 4XOIA 2C78A 3A1TA 5DYGA 4NCKA 1KO4A 1S2MA 1N6OA 3ZLJA 3LQQA 1EGAA 3H0KA 1U8AA 4TL8A 1S1MA 2OFWA 2RGBA 4TMKA 2GJKA 3SDZA 2GJ8A 4Q1BA 3W6PA 3DOEA 5HE8A 1OXXK 4ZI2A 4QGGA 4CZ2A 1H8HA 4KU4A 5LB2A 2O8EA 4TSFA 4QM7A 2GBLA 1MH1A 2DFLA 1FOEB 3Q8XB 4TL9A 3A36A 4LHXA 621PA 3I72A 2XOKD 5TB5A 5GVRA 4MGKR 3U7FB 1RVDA 3CRRA 1S3GA 3GCGA 2ORVA 2J0UB 2ZI6A 1T3HA 1B23P 3LY5A 1IAQA 4LBZA 4NP6A 3L8YA 5E95A 1JR3E 4NTZA 1YVDA 1FMJA 2CNWA 2X2FA 5DLQC 3KQKA 1W0JD 1WE2A 5ANRB 2C9OA 1TNDA 1KK3A 1QF9A 2N46A 1TUEA 1EFUA 1HY3A 2QAJA 3GFPA 4LPSA 2B8TA 4ZV4A 1W0KA 2O8EB 4PHGA 1QHNA 3EASA 4QHYA 4LYJA 5LPNA 4I99A 4PSVA 1X86B 5JHHB 1CRPA 2QPTA 2A30A 4XSGA 3T15A 4B3FX 1OT3A 5J4KA 3QF4A 1N6HA 1UM8A 2IA5A 3JVVA 2HXSA 2QGZA 4GMDA 4HB0A 1IXZA 2E1RA 2J46A 1U8YA 3DHWC 3IQWA 1J8MF 2Q9BA 5TDHA 2WAXA 2VP2A 5K8UA 2JATA 1HQCA 1T6NA 3HYTA 1NG9A 2RHMA 1QBKC 3LQRA 2ANBA 5CLLA 2YOFA 4NYIQ 1E9DA 2YWEA 1TQ2A 2CBZA 4ZCIA 2WKQA 2DPXA 3VHLB 2I1VB 1C9KA 2W0SA 1G5PA 3CWQA 4UXHA 3TBKA 2Q9AA 4F4JA 3U6KA 2NZJA 2OCPA 2CJWB 3GLIA 2EFHB 2B7BA 1GITA 3LRPA 1TF2A 2BVNA 4NL4H 1HYQA 1NG1A 1UKZA 1KSGA 3NEJA 5K8LA 3WHLA 2H1LA 4B35A 3TUZC 3NG1A 4Q7MB 2ODNA 2JJ1A 3ICEA 3KB1A 2EFDB 1M2OB 2ZYUX 2NO6A 3U61B 4A82A 2LCFA 1WBDA 3K1JA 3AF3A 4HATA 3A4NA 4M9ZA 2BM1A 1LTQA 2Z43A 5TMPA 4OHZA 3BH7A 3DVLA 2JLYA 5J5CA 1SKYB 4B2IA 4D4LA 2X8AA 2VL7A 4TN1A 5AUOB 1HUQA 3QKRA 2D7DA 3VTKA 1E0JA 1E2FA 3F3YA 3O8BA 3OE7A 2C9YA 2JLZA 5CIQA 4BGDA 3DM5A 5UKDA 1X3SA 3FHCB 1GKYA 4RFSA 4R71A 3GLFB 1E4YA 3MSXA 5FPTA 4MRSA 4I81A 1AN0A 4IOMA 1DTSA 4Q4HA 2NQ2C 2F55A 4LC0A 2IYUA 5FPKA 3IIMA 1N6RA 4FD2A 3MWJA 3UXMA 4AURA 3HU3A 3NTUA 2YINC 3DL0A 1AJEA 1Q1BA 4RZ3A 2OZEA 1SKYE 3RYTC 3T1TA 1GIAA 2JIZA 2ZJZA 3TGPA 4HSEA 4P4TA 1KNQA 4RSGA 3CF0A 2EQBA 1C4OA 2CXXA 1E1RD 3TW4A 1DG3A 1X1RA 4EPYA 4FN5A 1M7HA 4TMZA 1WXQA 3W8RA 3GLFE 1UEIA 5J40A 4BEBA 2QE7A 4PC3A 3SZRA 5A4JA 1KAGA 3IO5A 5KPDA 4CEHA 2CDNA 2AHOA 1UBFA 2BMFA 1P4SA 1I4TD 1MO6A 4UNRA 1TADA 1KO5A 4MQBA 4JSTA 1EX6A 2NIPA 4ZIRA 3K0AA 4MGYR 4JKYA 4X8OA 5EP3A 5CK4A 1JQLB 4LHWA 3LLUA 4FCVA 4OJKA 1Q3HA 2J87A 1D5CA 3LA6A 1V5WA 2D62A 1UBEA 2C98A 4ABYA 4A2WA 2FSHA 1EXMA 2ZSDA 2BHRA 1BIFA 1OFHA 2I3BA 2ZR9A 4A0GA 3L0OA 4RJLA 4OHWA 4Q4LA 1GFIA 3I92A 4QL3A 4DLZA 2REXB 3SYKA 3CW2A 2XEXA 1SVSA 1G3MA 2WSMA 4I1OA 2VHTA 2GETA 3B13B 1ZRHA 4IOKA 1P75A 5D3MB 2FJUA 2CMKA 3T5GA 2NGRA 2RGCA 3AV0B 1XZQA 3X1XA 4V02A 2FFAA 2OESA 3TVTA 3WY9A 4DUGA 1FQJA 2PZEA 4QXAA 1OE0A 4PFSA 1ZW6A 1SVIA 1E9FA 1NVXQ 4ACBA 1IOZA 1QRAA 2BOVA 2ZSBA 2EVWX 1YR6A 3QKSB 1KI6A 1IN6A 1US8A 1Z08A 2IBMA 2W0MA 4ASUD 4IEIA 1OIWA 3BOSA 4DC9A 1TTTA 1N25A 2C04A 2D2EA 3QXJA 1N6NA 4RZ2A 2Q3FA 4JZKA 2Q3MA 3R9WA 3EPKA 2PLFA 2GK7A 2AWOA 2FDCA 4YC7A 3VR5A 4DSNA 5JS7A 2C77A 4GRAA 5SZKB 3UG6A 2Z4SA 3MCAA 1GNRA 3U5ZB 5JS8A 3Q5EA 4IRUB 2RGGA 1RYFA 4EPTA 5BWMA 3B5JA 1AKYA 3TSZA 5JJIA 4LX0A 2GEDA 1BOFA 3PFIA 2XTZA 1KSHA 1N0UA 2P6NA 2PZGA 3FB4A 2J3EA 1KSJA 3QEOA 4GL2A 4RD6A 1G20E 3H1TA 1US8B 5C2JB 4B3DA 3ZJYA 4AKHA 1XEXA 3C7KA 3WXMA 2AXNA 2EYUA 4TMWA 4PQFA 1NY6A 4Y0AA 4C0QC 3RABA 4BFVA 1G5TA 2X1VA 3C41J 1J7KA 2WWIA 4NBSA 4QFMA 4V0NA 1OHHD 3NVAA 5FUVA 2WWYA 1CR2A 2IWRA 3TH5A 2DFTA 1RYHA 2UVQA 4AD8A 5IRCD 3BGWA 4DCUA 2H18A 2JJ2D 4TLDA 2IYQA 5HZKA 1KDOA 3MJHA 3V00A 3A6PC 1XTJA 3OFNA 2A5DA 5FBWB 1XTRA 3Q7QA 2QM8A 4KO8A 2WM9B 4EPRA 3IBGA 2VIIA 3B2EA 5TARA 4PXAA 3LD9A 4FMDB 4B3BA 4M1KA 2OXRA 2WMNB 2XSZD 4PZYA 3QENA 1R10A 2OV2A 4MKHA 4I1VA 4Q48A 1MABB 5KSYA 2QU8A 1DADA 3K9NA 5CDFE 5EE5B 2A9KA 5HKKD 3LBNA 3QBVA 3M0EA 3KQLA 1Z07A 421PA 4D0LB 1DO2A 3KXKA 2V3CC 3LNCA 2ZS8A 4M9SA 5SZJA 2GF9A 3TSOA 1W5TA 4DEXA 3ICQB 5FTMA 4BFTA 4TZ6A 3ZYCA 1DBSA 3OIWA 3LW8A 1XXHB 2V6IA 1E2JA 3A1VA 4LI0A 3GQBA 2SHKA 3NHAA 4CEIA 4IKEA 3J81k 2GJSA 3IQXA 2BEKA 5JI2E 1G9XA 3EZ6A 4GMXA 4IVQA 1XPRA 4TL6A 1COWA 3PEVA 5AJYA 1IY0A 4V0MA 4NE2A 3ZZUA 4ZKDA 4M9XA 2X77A 3OEHD 4AKEA 2ASEA 4D81A 4LBYA 4DLTA 2RGDA 3IEVA 1E9CA 4ZCMA 3IUYA 2ZITA 4KFRA 4OQXA 4PQYA 2BKUA 4IDPA 1OB5A 3B1ZA 1KI7A 4AG6A 3UK6A 2J1LA 4EKDA 2QGNA 1XXHE 2CCJA 2QMHA 3AVYA 1NBMA 1LNZA 3CPEA 4NYJQ 1PJRA 2DB3A 3CIOA 1G1MA 1W47A 4RD4A 3KKNA 3AF2A 3U3OA 3DPUA 3X2SA 4DLXA 2NO0A 5EJEA 2R8RA 3T1OA 3C15C 4DXAA 1XCGB 3I8XA 2ORWA 5CJPA 1SVKA 3SQWA 3U2QA 2OCBA 1PVOA 1ZYUA 1VIYA 5H68A 4GOKA 1C1YA 5CK5A 1II8A 2IS6A 4P4SA 2ZVQX 3OIYA 1ZC3A 2EWVA 5DH9A 1TAGA 2AL7A 3L0PA 2DCUA 3I73A 2GK6A 1XMIA 2GCOA 1I4LD 1KZGB 2AD1A 3Q3JB 1FZQA 1WCV1 2IYYA 4PR0A 4WZAE 3ZVLA 1KI4A 3LV8A 5CITA 1R2QA 5HCIA 2WICA 5EZ6B 3TAUA 4LV5B 3FYHA 1ELOA 3NDPA 4YMTA 3WNCA 3W6NA 1YJ5A 2V7QA 2W58A 2ZJ2A 4XD7D 1JPNA 5EE0A 5GJVC 3WRYC 2GRJA 4NDZA 1UF9A 2BCJQ 1AQYA 1AS2A 2CK3A 4X8HA 5KSOA 2G88A 1AZTA 2YVUA 3A4MA 1CJVC 1BKDR 3RDPA 3AH8A 1KI9A 221PA 1Z3IX 5AJZA 3H86A 1WDTA 5BYJA 4URUR 1NBME 2YV5A 4PC6A 1SULA 4IDOA 4LBWA 2ZU6A 4JJZA 2WIBA 3KKPA 3D8BA 3V4RA 3CZPA 4JLOA 1TPZA 1DAGA 4UKDA 3QSYA 2FFBA 2YOGA 1FUUA 1UPTA 5SZIA 4B71A 1OYYA 2I1QA 1Z0KA 3B8HA 3GJ0A 5JBQA 1YHNA 1SGWA 1AKEA 1YZNA 1KMHB 2ZSAA 3LX8A 3R20A 1KK1A 1JXOA 4Q18A 5FI0B 3EX7C 2FGJA 3K09A 1PLLA 3T35A 2JDIA 2XXAA 5ELXA 3UKDA 4BECA 3TR0A 3HPRA 3B1VA 4TT3D 3DKPA 1Z6YA 1XU4A 2AX4A 4OKSA 4XWAA 4DIEA 1UAAA 2XB2A 1Q22A 1S8FA 2MMCA 4JL6A 2WKRA 1E0KA 3TQFA 4BUJA 1Q12A 1LY1A 2HYIC 2FEOA 4PX9A 1RW4A 1NKSA 2LKCA 2MSDB 4MRRA 2EFEB 2PT7A 5JHGB 1KO7A 5BW8A 2AK2A 3JVUA 1P9NA 1Y3AA 2RGAA 4NCNA 5EXTA 1ZM3A 4C2TA 3QPUA 5E3HA 3PVSA 1W5SA 1DPFA 3RANA 4A1FA 1N6LA 1JAHA 4URXR 1ZINA 2QP4A 2MMGA 1RJ9A 4FW9A 3FHTA 1CKEA 2OBMA 4P4UA 2BKEA 3ZZTA 3V4FA 4URWR 4N0EA 3THWB 1H8HD 2B92A 3CLVA 4TSFD 1XCMA 1S3SA 1F2UA 1LVGA 5KNDA 5L3SB 1ZD8A 3FKQA 4C7OA 2GF0A 5AUPB 5F3WB 1GRNA 3W5JA 3T61A 4CVNA 2WJJA 1AIPA 1PLKA 2C95A 1U2RA 4OL0A 4A2QA 1WB9A 3S1AA 2ZRHA 5JZVA 4NMMA 1F2TB 2OCYC 4UJ5A 3IBYA 3D31A 2AD5A 1EFTA 3KX2A 2HV8A 5FUXA 4JVLA 2OCAA 2IWHA 3OIVA 1HV8A 4B6EA 2O8CB 2CNWD 4FMBB 3WMFA 1KIMA 1SVOA 4MKGA 4D6PA 1OPXA 1ZNWA 4WXPA 4EIWA 1RJ9B 2BIFA 4JVSB 2F6RA 3IHLA 2RGNC 1AGRA 4KSCA 3A1UA 2WZQA 4UXIA 3K9HA 2WIAA 2ZR0A 2OFOA 2WTUA 3SR0A 4F4CA 1GAJA 2IC5A 1TQ4A 3RS5A 4OQFA 3I5YA 4KI0A 4M1WA 3UWKA 4C0BA 4FI3C 4HLQB 3SBDA 3I32A 3ZQJA 4GOJA 2JEOA 2V54A 4TTQA 5DN6A 2NO7A 4DT1A 3N2EA 2VPPA 4JS0A 2F9LA 4HZUA 3WBKA 1AQUA 1IQPA 3CX6A 2HDNB 3PEWA 4QKQA 1BYIA 3QKTA 1ZCAA 2PJZA 4F92B 3OF5A 4N0DA 1G3UA 3MFYA 3QJYA 4MRNA 2P5SA 3I3SR 2PH1A 3RRZA 2ZRKA 3CRMA 1P6XA 3MRSA 4JIMA 4MUAA 4X8LA 4QHTA 1JBKA 5E7JA 4BLOA 3GLHA 2BV3A 1LFDB 2LWIA 4ZDIA 3NXSA 4JLNA 1OKKA 1G8YA 1E9AA 2IYWA 2JJ1D 4GOXA 3LH5A 4HZIA 4DJTA 4TZ0A 4XIGS 2CL6X 4HZUB 3B1YA 3EAQA 5CYPA 2R6CA 5FFMA 1W4CA 4QNRA 2JLWA 3OEEA 3UIEA 4JBYA 3LW7A 4UNQA 2WVJA 3AEZA 1XMVA 2ECKA 3P26A 4TWZA 3NDBB 3PJRA 1QHIA 2O5VA 1T8UA 2FPLA 3KUCA 1E32A 2RCNA 4M0LA 1BO6A 2ZRGA 1E2LA 3OE7D 3U44B 3KZ1E 3WMEA 1XJQA 4C0LA 3U7GA 1VG8A 4EFNA 2WBLC 4W5HA 2GDJA 2PEZA 2VF7A 3PXGA 4B2LA 2WJGA 3ONWA 2YJTD 1E9EA 4WOPA 1D2EA 3BFKA 2VH5R 3KKOA 2G83A 5EE1A 4N3NA 4BFXA 4ZDJA 2QMUA 3ZIAA 1XX6A 1IONA 4FWTA 4LWZA 4BEJA 4LGMA 5KNCA 1OF1A 4RFVA 3BH0A 4QGAA 3VFDA 2J0VA 1E0AA 5DISB 2C5LA 2YWGA 3EIEA 4W7SA 1CF4A 5JCZA 3K0CC 3C5CA 2JIZD 2FGKA 3VR6A 4HDOB 5JWOA 3NIBA 4FMDF 1BYUA 4GZLA 3GJ5A 2VLIA 3DOFA 4MA4A 3CB4A 2WJIA 2QE7D 1X1SA 4LC1A 3AF4A 4LJ8A 1Z0JA 5EXPA 1QG2A 4PHFA 4AYXA 2GCPA 3LVRE 3TAHA 3UMSA 1KSFX 2IF2A 3LAWA 4KLNA 1MOZA 1YQTA 3BJIC 4YDSA 2YC4C 2UKDA 2ZI4A 5EUMA 4Z1MD 2D7CA 4TLBA 1G3RA 2F3TA 2V1XA 2ZR7A 5AJWA 2E87A 3AKEA 3WYFA 5G53C 3RRNA 2DY1A 2AKYA 5KDLA 4FMCB 2NO1A 1R8SA 1T3SA 2RKOA 5FL3A 2V4ZA 2GBLC 2FZLA 4A6XA 3NH9A 4CYMA 1NKTA 1NNEA 1W4BA 3A4LA 4DLUA 4D4JA 3AP2A 5FBRB 5KDOA 2ZUCA 1YZTA 1E6CA 2ZRJA 3L0IB 2O8BA 1J70A 3EIHA 4HUQA 4Q4JA 1K8RA 2GKSA 1N6IA 4G5GA 5E4FA 4BLRA 4DLSA 4BASA 2ODBA 3PUZA 4KXFB 1XFAA 3THXA 1ZNXA 1NMXA 5FBVB 4D26A 2TMKA 4DUGD 3HPQA 5C4GB 1W48A 1ODFA 1N0VC 2PCJA 4GZMA 4ESHA 1FNNA 1J8YF 1PLJA 1ZNZA 3WP1B 3HP1A 3K70C 4ARZA 2F43A 3TIFA 2RMKA 1L2TA 3QIAA 3AVVA 4D25A 4UNPA 1P9RA 4RD1A 1J90A 2WMOB 3QBTA 3VU9A 2RGXA 1YZGA 3X1ZA 4AYWA 5G41A 2J59A 2BMJA 2PX0A 2ZRLA 3AVWA 3W6OA 2VHCA 1DEKA 4IXMA 1XD2A 3U60B 2RGEA 4KVAA 3LO5A 2WJYA 4LV8B 2NOAA 3SBEA 1YRBA 2IUSA 5AWFC 1NRJB 1Q3TA 4MYUA 4WW0A 3U3JA 2CHGA 3QF4B 3FTQA 2GILA 1HH4A 2BEJA 2W6JA 1AK2A 2NMVA 1N0WA 3M6AA 4PPQA 5JSZA 4HLCA 5FTJA 2F43B 4I4LA 2VSOA 3WYGA 3BBPA 3EPJA 3DMNA 3RS3A 4DSOA 4CEJA 4R98A 4F38A 2JJ8A 4PPGA 3PENA 3EC1A 1UBCA 1M8PA 2OBNA 4TLEA 2GZHA 3B9QA 1E2GA 1KNXA 3IKJA 1U99A 3B6EA 1H8ED 3DMDA 1D8TA 3W3AA 4S2EA 1ZNYA 2D3WA 1ANKA 5H1YA 3GLIB 1KKLA 2WWWA 2BJWA 1YZLA 4IFEA 2JLQA 4JLVA 4TLAA 1G7SA 2ODEA 4M9QA 1S1CA 3VR2A 1II0A 3ZVRA 5J4LA 2YWHA 2QAGA 1E98A 1KYIA 3DM9B 1O3YA 4Q47A 1E2PA 2C8VA 2ZREA 1ZAKA 5KSPA 3BD9A 2NTYC 4UJ3A 5J4VA 2F9MA 4KBGA 3AKYA 4P31A 1KI2A 1P2VA 1VG9B 1XMSA 1EX7A 1M1YE 5C18A 3TUIC 1GNPA 4BLTA 4Q7LA 4B73A 2QAGC 1SXJA 1PUIA 5FOTA 1ESNA 1G3QA 3HJNA 4A0RA 1E79A 4YMVA 2JASA 4OHYA 4BPBA 2VHQA 4QC2A 1VCIA 1MR3F 3GLIE 3GJ7A 3QKRB 5AK0A 3QXCA 1G7CA 1VHTA 2D4HA 3CR7A 3SN6A 4AK9A 5FOXA 3EG5A 2QAGB 3VR3A 4RFSB 1FQKA 2IYSA 2N42A 2HXYA 3GD7A 1UKYA 2NPFA 5FH9A 2R65A 3MJRA 1SXJC 3K0FA 2ZI9A 5EP4A 1XPUA 1LW7A 2GXAA 4PPFA 4Q4HB 1KZ7B 1VCMA 1XWIA 4BRWA 1VG0B 1OXVA 5AUQA 1L4YA 1TQDA 4NCJA 3D6TB 1COWD 1S0UA 4LJ4A 1P3JA 2WSSA 1ZP6A 3B9PA 3RWOA 4AG5A 1Z22A 4U5XA 3SE0A 1BS1A 2GAAA 3FMIA 4UQOA 3X1WA 1W36C 2GZAA 4JLDA 3HU2A 1CR1A 1KI3A 3Q85A 3O8DA 4NYMR 3ZDQA 2IUTA 2QENA 3QXXA 1EWRA 1M6NA 1CR4A 2DWQA 3PUWA 4IVPA 4LOAA 2GA8A 4O2LA 4BZXA 4AY2A 1SZPA 2QSYA 1DAMA 2QTFA 2ZUDA 3FKSA 3Q9LA 1KJWA 3THYA 1A2KC 1Q21A 3OESA 1MKYA 3QI2A 5HZHA 1OH6A 1NBMD 4M1TA 1CJUC 1W36B 2PMKA 4CEHB 2XGJA 3EPHA 1M7BA 3Q7PA 5JFGA 3RS7A 5KYKA 1QVRA 2P5TB 1G16A 4BWYA 4A9AA 3WNBA 5JRZA 3N5CA 3K0AB 4ZIRB 2EU8A 1E9BA 2QZ4A 5FL7D 4GDFA 1GL7A 2DHRA 1OV4A 1NVWQ 2FE4A 4Q03A 3HWSA 2O8FA 4RKEA 2QQEA 1GRQA 2GVDC 4M22A 5P21A 3QG5A 5IHPA 4Q9IA 4EQ6A 1OYWA 1P72A 2XTNA 4NCHA 4MRVA 1KK0A 1Q44A 1NY5A 1D2MA 1HT2E 1R7RA 1XCPA 3FMOB 1NP6A 4MGIR 3F0TA 4MITA 2C9CA 3CNLA 3AVTA 3U4QA 1OSNA 2IXFA 3ZD6A 4C0SA 1CJKC 2ERXA 4PPNA 2GXSA 5J4HA 4XVQA 5LD2C 3BB4A 1DOAA 1E99A 3QPWA 2QMEA 1NVUQ 2V7QD 3R7WA 1XJ0A 3SQXA 1JJVA 1KO8A 2J0SA 1KI6B 2W6IA 1VCOA 2CK3D 3RC8A 2BWJA 2MSCB 1QVAA 1DG1G 1FP7A 1X8KA 1Z2CA 4EQ6B 2P0EA 5LD2B 4B44A 5FOVA 2RHDA 1LS1A 1XRJA 3QPVA 5DI3A 1GL6A 1NVVR 3OHMA 5DE3A 3ECCA 1DARA 3IPYA 2Q21A 2WOJA 4M1YA 2VP5A 3OAAD 4GP7A 3AKDA 1YZQA 3IIJA 3W90A 2WWGA 2B21A 2RH5A 4LK2A 3U4QB 2OT3B 4HUTA 1DS6A 1G19A 1GKIA 2IYLD 2O0JA 3BFXA 5F9HA 3OZXA 1M34E 2P2LA 4PC1A 5DO9A 1XEFA 4QM6A 1E94E 2FWRA 1XEWY 2B8WA 3SFVA 2W00A 1W46A 4GI7A 2JDID 1W2HA 4LHVA 5FTLA 5DNYB 3AVUA 1F6BA 1GRRA 4MRPA 1XEXB 2OEPA 1II9A 1MT0A 2ATXA 2FX3A 4TMXA 4Q01A 2O8DA 4WIAA 1FPMA 3D7MA 1FNMA 4JL5A 4KFSA 5DI3B 3U3KA 1R0ZA 5JJKA 2ZIAA 4H1VA 2C2HA 4G5OA 1Q1ZA 1E4VA 4ON9A 3REFA 3RLFA 4A8JA 4KJZA 2R2AA 2H92A 5KOYA 4EUNA 2J7KA 1A2BA 2IHBA 4LV6A 4C3ZA 3NBYC 3GJ3A 1KHTA 3CONA 3U3MA 1E2HA 5L3RA 4Q00A 2ZS7A 2Q0HA 1N6KA 3WRXC 4LHZA 4PZLA 4BFYA 4GNKA 1Z06A 3ADBA 2OAQ1 2QEQA 4A8JC 2RB4A 2Z5FA 4TTRA 2QBYA 4TYYA 5B57C 4BRUA 1HURA 3ADCA 2O8DB 2G6BA 5B64A 2HYDA 4D82A 1XD8A 3MAAC 2IYRA 4QBIA 1IJFA 2FFHA 4POAA 3EPLA 3AVQA 3RRMA 3TRFA 4DHEA 1BMFD 2C99A 1Q57A 5KTYA 4A8JB 1R5OA 4DSTA 3W8NA 1ONBA 4KBFA 3LBHA 3N70A 4W9MC 1NMYA 2VP6A 4X8MA 4B43A 1Z0IA 4W5JA 3RSLA 2XZOA 2ZJAA 3VQTA 5CM9C 2DYKA 4L8GA 1OIVA 2R6DA 3AGPA 4BLSA 2AKAB 2IX3A 2FU5C 3E2IA 4BZQA 4A15A 1OFIA 3MUFA 2KBFA 4JSYA 2HUPA 1ZM2A 2QBYB 4CEIB 2XZLA 2VHJA 3EC2A 1DAEA 2GZDA 4G01B 4K81B 3KJIA 2QRNA 3O8CA 3HDTA 1IN8A 2ZAMA 4KYUA 3GEHA 4HAYA 2IEZA 3NC1C 2A2ZA 2ZYWX 4AI6A 1SVMA 4BZPA 2YHSA 4Q21A 2B6HA 3P1JA 1XZPA 1QHYA 4L9WA 4QHSA 4QGFA 5DN6D 5CM8B 3R8FA 3KFVA 5K8IA 2ZE7A 1SQ5A 4EJSA 2IXGA 4DSUA 4WA7A 1K5DA 4NHOA 3PUXA 4B75A 1YE8A 1E2DA 2QRZA 3L2OB 2VO1A 2CHQA 2FMXA 3CO5A 1ZMXA 5F98A 2IS1A 1VHLA 2HEIA 3EZ9A 4WAUA 5EE9A 4DB4A 1WBBA 1IM2A 3PEUA 1DAKA 2BBTA 3AKCA 5CJ2A 4ZI3A 2QM7A 4Q5IA 2NG1A 4FCTA 4V0ME 4Q1CA 2G3YA 4EJSC 4PSKA 3BC1A 5HCNA 3ZS9A 1DAHA 2VSXA 3A37A 3DKVA 3IPXA 1X8LA 4DDVA 2WJHA 1XTKA 1JQJC 5DGXA 1OKKD 1AM4D 2ZE5A 3MWKA 1Z83A 4LDJA 5FOSA 3VKWA 1II8B 4KFUA 4M4SA 1E1QA 2HT6A 4P4SB 4EJSB 2KBEA 4DB2A 3QY0A 2ZRFA 4OQLA 2ZE8A 4HAZA 3VX3A 1VKJA 2QG6A 3OEED 2XZPA 2GCOB 1G8PA 1QG4A 2QI9C 1T9HA 3RC3A 2REOA 2ZI7A 4KAXA 3GLGA 2K5UA 4LY6A 3BK7A 3KJHA 4RCYA 1UBGA 2OLKA 3ZVMA 2N1BA 4LSGA 2WWHA 1WP9A 2QTVB 1F60A 1YKSA 1FX0A 2QPAA 4JLBA 4RCZA 4DLRA 1T5IA 4A2PA 2FOLA 2W2VA 4OI4A 1U9IA 4HDQB 2V6JA 2FFQA 1HEIA 3RVBA 1MRSA 4PTLA 1ZM9A 1IBRA 2ZYTX 3K53A 4PAOA 2OAP1 2JJ2A 3KXIA 3ZIAD 4KSBA 1KDTA 2ZUBA 8OHMA 4LJ7A 4B32A 2ZPTX 4W5WA 3K09C 1EESA 2EYQA 5KHOC 2J45A 3R8CA 5C4MA 3KQUA 1KAOA 1WQ1R 2QA5A 4L16A 4R7ZA 3GLGB 2HLDA 1HQYE 2B7CA 1ZD1A 2VYFA 4OHXA 4F93B 3DZDA 3CZQA 1Q0UA 4DLVA 2H17A 2XNDA 2ZS9A 4LRWA 4IOJA 1T4GA 1T8TA 2IYTA 3K9LA 5JWRA 4OYHA 2XXAB 3JZAA 5AJVB 2O0HA 2GVZC 2J7PA 4FWIB 1E9SA 1YU9A 2VEDA 3FFAA 1OH8A 4GSYA 3O47A 4C30A 4QNMA 4ILEA 1LB1B 4GBMA 3AB3A 3T12A 4JL8A 1VYTA 2D2FA 4G0NA 1G8FA 3NBFA 1ZU4A 1VTKA 2IYXA 4C2UA 5M04A 3SJCA 1H65A 1HTWA 2CHVA 3IDQA 2FSIA 2GESA 3PQCA 4NCIA 4DDWA 2GXQA 1G4UR 5FTNA 5C46F 1VYUA 1IN7A 3WMGA 2VRWA 1JALA 3GLGE 4UXJA 1YR7A 2VTKA 4G3XA 1S9HA 5A0FA 3P4XA 2ZRIA 3BRWD 1DELA 2HCBA 4A0FA 2EW1A 2O0KA 2OHFA 3QF7A 4YXWA 3ZS8A 1ZCBA 4I1SA 1GNQA 4XSHA 3K70D 2FV8A 3SJZA 1KMQA 5FOWA 5SZHB 4IFBA 2GAOA 1W0KD 3GEIA 4LBVA 4PZZA 1U0JA 1F2UB 3CNOA 1NJGA 3OEHA 3VAAA 4OK3A 2HF9A 4HEJA 4C7OB 5KSZA 3WP0A 3RRYA 1NN0A 2G0TA 3VMFA 2Q9CA 3I61A 1D6JA 1K6MA 1NLZA 3KXLA 3PITA 5CLQA 3S1AB 2WAYA 4JYBA 1QHHA 1Y63A 1CJMA 3SI7A 2OFXA 1ESMA 1XDBA 4PC2A 4FINA 2YYZA 2OUKA 4YMUA 2QUZA 1XNJA 3MMPA 5DHAA 1NIPA 1FP6A 3LXXA 1VYVA 4M2LA 4WZ6A 3ND9A 3B1WA 2YWFA 1GM5A 1EFRA 4M8NE 1IY2A 1G6OA 1ZC4A 2HF8A 1KJYA 3A58B 1E9RA 5AJXA 4JLAA 4ZPXA 4IDNA 1LF0A 1GTVA 1CXZA 2KE5A 4C0AC 2QT0A 3ZVNA 4PAQA 4UNNA 1U98A 4PQRA 1U81A 5AR1A 3KDSE 1E2NA 2W6JD 1YZUA 3EARA 3U3RA 3IEUA 2OBLA 2PLRA 1EFHA 4DT1B 521PA 4G5SA 3CPHA 5B30A 3F8TA 2V9PA 1G17A 2BBWA 3AP3A 3MWYW 1P7CA 4U7DA 4TYQA 2OE2A 4CW7A 1N5IA 1W4AA 4MKIA 5E7MA 2HT1A 1F3OA 1O87A 2ZJOA 2ANCA 2QN6A 4MDEA 5H8WA 4BFWA 1RRGA 1CULC 4DDTA 3LX5A 4ZKEA 2CVHA 1R0WA 5AUNB 2R9VA 4P3YA 3UWOA 1P62B 4J0QA 1RE0A 1GZSA 3A1WA 3H2YA 3BAFA 3H4MA 2IL1A 4E5UA 3GLHB 5KU1A 1GP2A 3QOFA 2R62A 3LVQE 4GP6A 3GP8A 1P2SA 5LBIA 1E3MA 2ZSFA 4BQSA 4HLUA 3NHBA 4KV9A 1KY3A 5FR1A 3IO3A 4RD3A 4M1SA 3NH6A 4O2RA 2BJVA 4IJMA 3RAPR 1TF5A 4N1AA 3ASYA 1UKEA 4DCTA 5F9FA 2P6RA 4AKIA 2OILA 5CYOA 4ZCLA 3AUXA 2AFHE 4TQ9A 4TLCA 5CB6A 2PMDA 1JR3A 3CRQA 1I2DA 1SXJD 2QROA 3AVPA 1E79D 1NI3A 4TQUS 4TT3A 3EWSA 3CBQA 4CT4B 5BN5A 4LJ6A 1OJLA 4JBXA 2PZFA 1WRBA 3FMFA 4HLUC 5EXXA 1XD9A 1ZIPA 4AC9A 3GLHE 1WMSA 3EWAA 4YONB 4MDFA 3ASZA 3EXAA 3GJ6A 1W36D 3VNVA 3BS4A 3PG5A 1CLUA 1TEVA 1L8QA 2ZEJA 3TLXA 2J0UA 2JA1A 1Z0DA 3IGFA 5LB4A 1Q20A 2BM0A 4Q1AA 3I1FA 3VR4A 4DRZA 3UG7A 4V0LA 5TVKA 1VECA 4MYCA 4P32A 1N3BA 4CDGA 3BB1A 4OI1A 3TNFA 4XWKA 2IHYA 4IDQA 2WSSD 3RS0A 3SYNA 3ADDA 3MG9A 1E2MA 1R5NA 4XH9B 1JXMA 1VCNA 4ESVA 4Z51A 2WWXA 2W2TA 2BMDA 3W34A 1Z0AA 4IVRA 1NSFA 1D9XA 5DYIA 2FPKA 2VP9A 2IUUA 1KKMA 3W5IA 3MLEA 3BXZA 2C03A 4QJ3A 3FKSD 3KJEA 4YLGA 2VF8A 5FI1B 1IHUA 3QKUA 5JEDA 3SYLA 3N2IA 3PV0A 2WHXA 1Q1QA 4LUCA 2A5JA 3UPUA 2R6GA 1LS6A 3AF0A 4JLKA 2WJVA 5JECA 1Z0FA 2JGNA 5G3ZA 4G5QA 4H1UA 4PC7A 1TF7A 1HA3A 2H16A 3ZD7A 2KWIA 3NBXX 3TW8B 2BBOA 2XTMA 821PA 1LV7A 2UZ3A 1CEEA 1ZUIA 2A78A 2CLCX 4ACAA 3QXSA 3MD0A 3VHXA 3FPAA 4GFDA 1E2IA 4OQMA 1HE1C 3FWYA 4DCSA 5KUTA 1IN4A 2JAQA 3CUEF 4LCBA 2EWWA 2AN9A 2JCSA 2W2XA 3PIRA 3E5HA 1UFQA 5G40A 3PEYA 3SHFA 3K70B 1OXSC 4NKRA 2WPDA 2CJWA 5JEEA 2O8BB 1W49A 1TX4B 1QZXA 3E70C 4HUQB 4Q4JB 1JAIA 1FTNA 2DFKB 4JVMA 3ND8A 4AIIA 1TU4A 2QT1A 2CCGA 4JT4A 1G41A 4A4DA 3THXB 5LDDC 4JBWA 4O3MA 4B48A 4F4IA 4QRHA 3T5DA 4TQAA 1OXUA 3TSWA 3DZ8A 1PV4A 4Z8YA 4HB4A 1MO5A 1XMJA 2X2EA 1N5KA 4FXPA 1N2CE 4NYIR 3I4LA 2W6ID 4ARZB 1E69A 1JNYA 3LBIA 3WBJA 1UJ2A 2KB0A 2ZRPA 2R6FA 4QGHA 3UMRA 4OJQA 1CJTC 2ONJA 3VU9B 4Q1DA 4WXRA 5EP1A 4B33A 1G8HA 2YNMA 4Q7JB 2V8OA 1CU1A 2E9SA 3AGQA 2ZANA 1NMZA 1XTQA 2D06A 2ZRAA 3FVQA 4KITB 3T1QA 1XEWX 1M74A 1XD2B 4NH0A 5TV2A 3VR1A 3RNLA 1Z6GA 2VQSA 5BN3A 5EXSA 1D9ZA 4HAUA 3GLFA 3P20A 1E96A 4KODA 3UATA 1UKVY 2JLRA 2QPOA 4CRWB 2XJ9A 2H57A 3OFND 4BLPA 1DE0A 1KTVA 4AWXA 2FF7A 3QE0A 4NONA 5IF9A 5FUYA 5JSZB 3AUYA 1IXRC 4I1UA 1OFTA 4XVRA 4CEJB 1W7AA 2WV9A 4Q9KA 3SC3A 1CBUA 5EUQB 1G21E 2IW3A 1YZKA 3NWJA 3CRW1 4P33A 4F7WA 3WNDA 5BN4A 2IYVA 3KL4A 4QJ5A 2R44A 2IS4A 2VSFA 2NPIA 1RIFA 1MO3A 4M1MA 1DVRA 2FG5A 1OW3B 3DO6A 3T06B 1NLFA 4YQFA 1W1WA 4YMWA 2H5EA 4PO8A 5B58C 2X19A 3CX8A 2LKDA 3GFTA 4DCVA 4RVCA 4R9UC 1FW6A 2L0XA 1X8JA 3U7HB 5C1BA 2C96A 2HCJB 2CLSA 5A5GA 1X6VA 1SVWA 3QG1A 4Z54A 2BCGY 1MV5A 1A4RA 2QTHA 4Q9LA 5IT5A 3I62A 1NSTA 4MYHA 4TMVA 1ZJ6A 1VDZA 2NZ8A 4BE7B 1ZU5A 1XTSA 3SFZA 5IK2A 3BERA 4RZUA 3UANA 3KTAA 3ZGXA 3JZMA 1SHZA 5D3QA 4A6PA 2Z6VA 4BFSA 2GJ9A 4MH0R 2GJAA 1TL7C 2OXCA 4EAQA 2BDTA 1JB1A 1Z47A 1NN1A 2F3RA 2ZAOA 1SXJB 1TQ6A 5FPYA 3LDAA 4H9GA 4V0KA 5CIWA 1G4AE 2FZ4A 1QHGA 2QNRA 1GG2A 5D3MA 4IW3B 4DVGA 4NYMQ 2XOKA 2G1JA 3ADKA 4Z1MA 5TY0A 1SHKA 1EK0A 2EFGA 2XAUA 4OK5A 1RC8A 3B82A 1HE8B 5FOUA 3K0FB 4FIDA 1PZNA 3PUYA 3KTAB 3QKSA 3BFVA 5L3QA 2JLXA 3X1YA 4UNSA 1ZM7A 3HR8A 2YC2C 3L82B 4HI0E 1T3LA 2G1KA 2ZJ8A 4DLYA 3FDIA 3U6BA 3E1SA 4OI0A 4G5RA 1SXJE 4XTCS 1RRPA 1JPJA 1W0JA 3TR5A 4L9SA 3EZFA 2ERYA 1G7TA 2DWOA 1A7JA 1U94A 1RFLA 1DAIA 1NN3A 2PJRA 4US0R 4IEEA 3BWDD 5FPHA 3THYB 1GUAA 4JKIA 2FSFA 2BC9A 4A92A 2P65A 3I8SA 1FMLA 3R9IA 2F7SA 1ETUA 2V1UA 4EPVA 5GVSA 4CIDA 1Z8FA 2WKPA 1YRAA 1G18A 3CNNA 4II7A 5L3QB 2GWHA 5BQ5A 2XITA 2IT1A 2PT5A 3FMPB 4KHZA 4ERNA 4BFZA 2GNOA 1KO1A 4V0OA 3ZH9B 1SKQA 2O8FB 2G0NA 1TMKA 3QXHA 1RKBA 4C0JA 4D0GA 2WWFA 4V03A 3RWMB 2ZE6A 3WYAA 1N5LA 2ZI3A 3CWZA 3SOPA 1W44A 1SVLA 3OIUA 5CDFA 2IEYA 3CM0A 1E1QD 2FSGA 3MWLA 4PO1A 2D74A 1OFUX 4LJ5A 1T91A 5FTKA 3RHFA 4DIDA 3LXRA 4TYPA 4DBLC 2PBRA 3C16C 3B60A 1CIPA 4LJYA 1NVVQ 4PSAA 1MO4A 3EA0A 2V55B 3CRVA 3L0SA 4MYTA 5K8TA 3MGCA 2CL0X 2QSZA 4DLWA 1IJEA 2ZRNA 3C8UA 4GT1A 2FPMA 2PL3A 3B85A 3FE2A 3HU1A 2IXEA 3C14C 3R7WB 3BIFA 5EZ5A 4LJ9A 4M21A 3EW9A 4P0TA 2XNSA 2ZSEA 1VG1A 4KCGA 2QMOA 1MABA 1EG7A 1UDXA 2ONKA 1ZM4A 3NC0C 1TUIA 3IHWA 4GPTA 1H8EA 4RKFA 4C9BA 2GEVA 4EFLA 1A1VA 4QBHA 2NO9A 4ITRC 1GDDA 4LZZA 2RAPA 4JMPA 3CR8A 2QL6A 4HAVA 1CP2A 3Q5DA 3QEJA 2P3SA 4M53A 2AFIE 4DDUA 3GMTA 3G5UA 1G64A 1P9WA 5HR5A 1XPOA 4A36A 3GEEA 1G3IA 4Q9JA 4K46A 2J5XA 2IYZA 4R2HA 3ZZ0A 1P73A 1QHSA 1XXHA 2Q3HA 5CB8A 2HLDD 2EFCB 2QP9X 3CF6R 3KFXA 5DIFA 3KB2A 3THOA 4YDHB 1CR0A 2XNDD 6Q21A 2CE2X 3TJZA 1YR8A 3QVVA 3KQHA 1S4QA 3VNUA 3TUJC 4E07A 2J7PD 5F2EA 4C4PA 2Q6TA 2GEUA 4C0KA 1ZUNB 2KJQA 4U00A 4JJKA 4O0MA 3SEAA 4M1OA 1G6HA 2OO7A 1ZD9A 2Y8EA 4NU0A 2GCNA 3SS8A 2BMEA 4JT2A 5GJBA 1E2QA 3IIKA 2J9RA 4B6FA 721PA 1KY2A 3SJBA 4CT5A 2P6UA 1E1RA 4B76A 4D4MA 1T5LA 3PCRB 1RRFA 2ORIA 3QUSA 4JLPA 1A5TA 3T34A 1N6PA 2A5FA 4B3GA 4AYTA 2WOOA 2UZIR 1P2UA 4S35A 2ZQ5A 5JI3E 2VA8A 4OK6A 4LHYA 1RPZA 3ZQ6A 3C5HA 3EZ7A 4YXWD 3AQ4A 4Z8XA 5JMTA 1GWNA 1PUJA 2AK3A 5KDDA 2YZ2A 3R9XA 1W2GA 5HE9A 4DEYA 1Z2AA 2CL7X 4B74A 1FFHA 1MRNA 4KLZA 1V43A 3GJXC 4FMCF 4RY2A 1Z6XA 1IY1A 3CH5A 3PR1A 2ZRBA 4RD2A 1NLYA 2QORA 4PHHA 1W4RA 3K0SA 4NYJR 2Z0MA 4Q9HA 3W3ZB 3BB3A 2CEAA 1G5RA 1AS3A 3FFBA 5TXGA 1T0JB 2ZETA 3TQCA 3SNHA 1ZVQA 1KDRA 2DR3A 2F1RA 5E7IA 2F1JA 4HB3A 2VP4A 3AM1A 5FL7A 5KPJA 1FTSA 3AP1A 3F5FA 3WHKA 4QOSA 4D80A 1Z6TA 5FPSA 1EFRD 1KDPA 1JI0A 4NZYA 4ASUA 1G8GA 2AR7A 2CE7A 4HAWA 2VBCA 4US2R 4MGZR 4WZBE 1DAFA 4OHVA 3IILA 4HLDA 1JECA 4KFTA 4Q7KA 2MSEB 1U0HC 1J2JA 3V9PA 1NL3A 2ATVA 3VX4A 1AS0A 1CS4C 1R5BA 3FGNA 1TU3A 1Z6AA 4D4KA 1GSIA 1P2TA 1FL9A 1XBTA 2J0QA 3QNUA 3EIQA 2FH5B 5DI9A 3AVXA 5B2ZA 1RRCA 1OIXA 1UDWA 4LYAA 1Q1EA 2I4IA 2ZRMA 4CGZA 2ZJBA 5DHFA 1KMHA 1NF3A 4MUBA 2AWNA 3QQ5A 4QG7A 1P5ZB 5JLJA 4JYCA 5JRJA 3EZ2A 2YOHA 3B1XA 4US1R 5BXQC 2HJVA 2PCLA 2BBSA 5J4YA 2JLSA 4O25A 2F1HA 1VIAA 2QY9A 2A3RA 1Z29A 1U0LA 4PO9A 1OLOA 3OAAA 2XJ4A 2ZRCA 3GFOA 5FBQB 2ZJYA 4ZDKA 4KYIB 1KOFA 1L4UA 1OHHA 5JCPA 2H8KA 4BLQA 3BE4A 1F48A 3FOZA 2OSBA 1KJZA 3O8RA 3GPLA 2ZXUA 4E22A 4IDHA 2DWPA 3K8YA 4B2PA 3TVDA 1JEDA 4ZO4A 2ZRDA 4QBFA 2XX3A 5EP2A 1JR3D 3GJ8A 3KJGA 1L7VC 1AGPA 2ZYVX 2XB4A 4D2IA 3C4JA 3CF2A 1U9IC 3L43A 2R6AA 3THWA 1KGDA 2XSZA 4Q1FA 3A1SA 3X1DA 5BYKA 5IDVA 1Z5ZA 4NPHA 4E03A 1NN5A 5L3SA 1FX0B 2ZROA 4DWJA 4LYFA 1P61B 2DFNA 1M7GA 2KSQA 1JR6A 1DO0A 4HDCA 4XWOA 5HKKA 5H70A 1OH5A 5HPYB 4OBEA 4C0HA 2OLJA 1E2KA 1F2TA 1UEJA 4TYNA 1K5GA 3UMFA 2FA9A 5KO2A 3VKHA 1I2MA 2FN4A 3CPJB 4FCWA 4YMSA 4XTRA 5L8VA 4IHQA 1F5NA 5GJCA 3SJAA 2KI5A 2IF0A 2QP3A 2O8CA 4L15A 2HJGA 4R2IA 3LWNA 4A0HA 2OM2A 2VHUA 3DDCA 4QBGB 121PA 4U02A 2ZU0C 4TL7A 5G3YA 2ZM5A 2IS2A 4OI2A 3M1IA 2VP0A 2FNAA 3HR7A 1TEXA 3P32A 1D2NA 1UADA 3LFUA 2A7QA 1S9DA 4TTPA 4URYR 1OH7A 2G9NA 5FR2A 1CRQA 4MKFA 1BMFA 2RGNA 3P27A 3KQNA 3H84A 3RS2A 4TMTA 1R0YA 3TK1A 3B78A 4B34A 4B3XA 5JJLA 3KKMA 2F1IA 4WVFA 2J41A 1B0UA 1XB2A 4G1UC 1GOTA 1YR9A 4URVR 1XTIA 3EA5A 4ZDWA 3AVOA 2CLDX 3K0EA 3Q72A 4B47A 3B7GA 2JLVA 1J99A 3FHOA 4HAXA 2ZI5A 4PANA 3G0HA 4L5BA 1R0XA 3CX7A 4K8OA 4D0NA 3A8TA 4IXNA 3G82C 4E09A 4PAMA 2ZJ5A 4RD0A 3SU8A 1BH2A 3KKQA 1XJCA 2WPDD 1P60A 4EPXA 3DEFA 5KNBA 1E2EA 1OXTA 3T1VA 2Z4RA 1ZIOA 1GKUB 1AA9A 5L3VA 2OG2A 1G7RA 2ZTSA 1EWQA 4IOLA 1U8ZA 2H7VA 4JLMA 4Q19A 3ETLA 3K9GA 2DBYA 1KI1A 2A5YB 1QHHB 2CCKA 1S96A 1QDEA 3VKGA 3P4YA 4Q4AA 3NBZC 5JWHA 1VPLA 2CVFA 1T0HB 2AXPA 4JVNA 1CTQA 1R4AA 1VMAA 1WA5A 2GHIA 4PHTA 1EFCA 3W9YA 1ZUHA 3I5XA 5EQTA 1WF3A 1IXSB 4XD7A 4Y0VA 3U7EB 4F91B 4BFUA 1RZ3A 3HYRA 3U44A 4TYWA 3M4YA 4AKGA 4JLJA 3PUVA 4URZR 2A5GA 2YKGA 1XF9A 1A82A 1FUKA 2ODWA 3BORA 5DSZA 1R8QA 3CH4B 4LJAA 4HB2A 5GJWC 4B3CA 4Q02A 4Q1EA 1GL9B 4QJ4A 1I4DD 3AF1A 1GILA 2P67A 4LPKA 4WBSA 4DKXA 5J47A 1XP8A 4Q4AB 5FUWA 4EPWA 4XVUA 3RS4A 1Z28A 3TMKA 4CF7A 4LYHA 1NIJA 4EFMA 1NJFA 1E0SA 2Z83A 4RZXA 5GADl 2O52A 3BH6A 1JEEA 2G77B 4KVGA 1JJ7A 4Q66C 1N5JA 4L4UA 2GXUA 1GVNB 3KUDA 2REBA 5FBLB 2GTPA 3RSOA 1ZBDA 3NEYA 2JLUA 1LF5A 3REGA 1KK2A 1KI8A 1R6BX 3CKLA 2PX3A 4EDHA
chains in the Genus database with same CATH superfamily
4HYYA 3K0CA 4DUYB 3LUGA 1O9HA 2R7LA 5KQRA 1QHXA 1GY8A 1Z13A 4RJ2A 3DWIA 2DUUA 2DETA 1CR6A 1XWWA 2NSYA 1B74A 1TCBA 2V4UA 1OASA 1AZSC 3M5DA 1Y42X 3PHCA 1ZH0A 5IK2D 4F96A 2PEYA 3BD7A 1H94A 1RI1A 4IDCA 1J97A 3FVVA 3PXBA 1FFWA 5I5GA 2C78A 3TINA 3AR5A 5IG2A 2B20A 3PUIA 3LQQA 4GIBA 3FA2A 1EGAA 3EUWA 4N41A 1QV6A 1U3VA 3RFCA 1M10A 1RI3A 2VOEA 4QE3A 3LZCA 2QOEA 5K3OA 4ENQA 1P7VA 1OGIA 3IPAA 4GC5A 3RSGA 5AVVA 5HE8A 1E7YA 3EDCA 2AHRA 3HCDA 1JVSA 3ANNA 5AM1A 4RE6A 1TMYA 4F97A 2GBLA 3W6ZA 2JVKA 3MCUA 2DFLA 4FYPA 4XB6B 3S70A 4LF8B 3MINA 1UMDA 2Z6QA 2V0GA 4YK7A 2Q3JA 5CB4F 8ABPA 4FIZA 4B79A 4CLRB 4D9FA 3ZDDA 2H9YA 2O05A 2WAAA 1OC4A 3LHFA 3A6GA 4YGXB 5JVDB 2EHJA 2FE1A 3KT0A 1CT9A 4KC0A 4B85A 3I1JA 2CXOA 2IPXA 4C87A 2WTNA 4P86A 4MPDA 4TKVA 4R7GA 2YS6A 2PRZA 3K73O 2WFZA 4AFNA 5BOSB 3ZW7A 5C4IA 2DR2A 3O7WA 3BBLA 2HY7A 1F4PA 3LECA 2NUTA 2R0QC 3KQKA 4BTLA 2JHPA 5ALNA 4ZVKA 1HQDA 4K05A 1KK3A 2N46A 2JZOA 1TUEA 3VISA 5HP4A 1EFUA 1RWOA 2QAJA 3OIFA 5HQJA 5BSKA 3A7EA 4E4RA 2HV9A 3ST7A 1V3TA 5IDXA 1DDGA 4W8HA 2BFEA 4ND8B 4QHYA 3OZ7A 5LPNA 1BVUA 2FKAA 2VF4X 4TZTA 1RWXA 2V9CA 4EJMA 2CV2A 4XSGA 5B6JA 1EVYA 1PQ4A 4M0PA 4A3SA 3AEKA 3X44A 2HGSA 3GU3A 3VH4A 4B3FX 5J4KA 2UDPA 3QF4A 1N6HA 1XI2A 3EFEA 3ETGA 1UM8A 2HXSA 2AG0A 2QGZA 3E3NA 1IXZA 2E1RA 3CX3A 3DHWC 1XQXA 2NWQA 1O5TA 3N8NA 2G9RA 2ZWMA 2WAXA 2VP2A 5B7NA 1BEZA 1PYDA 5T4BA 1HQCA 3WVNA 3HYTA 3CXRA 8ADHA 2F1KA 1NG9A 3MQ2A 2XYRA 3W5DA 4F9GA 3A9SA 1MQSA 4H35A 4TV9B 5B7GA 2ONYA 1TB4A 1L4FA 3VPSA 1H4QA 1TQ2A 4ZMBA 3TM4A 3I5AA 1C9KA 2E4YA 3T7TA 4FS8A 4CCYB 5IZ4A 1UXIA 4PS1A 3R3JA 4HEA1 4DXHA 1ZK4A 2J85A 4WH0A 3F98A 3STWA 3UEOA 2H31A 1OJ7A 1EFVB 3P5BA 1HYQA 3MOIA 3UXEA 1OA0A 2Z5LA 5GGXA 3K35A 3V2IA 4EB3A 2XDQB 2PS0A 1QVWA 4B35A 4C4YA 1JKJB 3U39A 1K08A 3ZE0B 1L5HB 2Y2UA 4G1EB 2HR1A 2H9AA 3SQMA 1B1AA 2MJLA 3BL8A 5EKSA 2ZYUX 1P4JA 4EA7A 1A04A 5FWYB 3H5TA 3U61B 4E14A 3UAWA 2BGLA 3K1JA 1Z2DA 4FE4A 3BMNA 4XXHA 4M9ZA 1ZA1A 1Z56C 5TMPA 3GLRA 4NSNA 3STHA 2V03A 4OHZA 3FJ1A 3ZE2B 1JU9A 4EI7A 1RMYA 1C0EA 3DVLA 3OM9A 4EUEA 5BUQA 2JLYA 1GQSA 2VL7A 2X8AA 4TN1A 4IMJB 2D7DA 4Z9BA 3RC9A 2ZBVA 5GV7A 1EAYA 3K8OE 3T38A 1E2FA 8ATCA 3O8BA 3OE7A 4KNYA 1T1IA 4NENA 3AKZA 3DM5A 5UKDA 2CNLA 3PGKA 2XTAA 5JT1A 4R71A 3GLFB 1E4YA 3MSXA 3DZKA 3F96A 2AKEA 4MRSA 5ECWA 2ZZNA 2FYTA 4OH7A 1UP4A 2VZEA 3LP6A 3RTBA 3UPTA 3KTOA 4IOMA 2NQ2C 2YHAA 3WL6A 1YGPA 3D8HA 4UTNA 4GC9A 2CUTA 2QQGA 2X3YA 3NTUA 2GARA 1T0IA 1AJEA 1RWVA 5TLSA 1VL1A 3EUAA 1SKYE 5HF5A 1LNSA 1C5KA 4WKGA 3BIJA 3MXOA 2WJZB 4BTVA 4AY5A 2Y0DA 2CHEA 2ZJZA 4RSGA 1UP6A 2Q0SA 2H4WA 3I53A 4YJGA 1C4OA 2C0QA 1E1RD 1Q74A 1W25A 2JIDA 5EHXA 5IS2A 3IL2A 1M7HA 4GSKA 1XMPA 4PYQA 1DP4A 2H2AA 4QNNA 3W8RA 2QE7A 3SZRA 4IS3A 1E5TA 2IIPA 4CEHA 3VNBA 2HJHA 3OJFA 1UBFA 3U1TA 1P4SA 1I4TD 5BWCA 1G2QA 5EJIA 3O31A 4ZGBA 5B3KA 1U7PA 4I1RA 1BX0A 2I7VA 2Q3BA 1SM4A 1EX6A 2JC3A 1U9JA 1U5AA 4MGYR 4JKYA 4P53A 4JCOA 1JTFA 5JO9A 5EP3A 4TQGA 5CK4A 4E1VA 5HQTA 5ILQA 3WO1A 4OHCA 3I04A 4Y1RA 4FCVA 1XAJA 3DTYA 4P35A 5HRCA 4A2QA 1Q3HA 4OQDA 3COJA 1V5WA 2EF0A 5JZBA 4AF7A 2IOQA 3FDFA 1X70A 5CURA 3S1LA 1EXMA 4ABYA 5CA1F 2ZSDA 3MS4A 1BIFA 4JMLA 3BICA 1I3MA 5LSAA 5E6UB 2ZR9A 3LYHA 1GCUA 4H7KA 3EW7A 4OHWA 2VNHA 3EUEA 4JHLA 4J4HA 3LL4A 4WUTA 1MC1A 1V41E 5I48A 1HGXA 4PSDA 2OKGA 4NMXB 1PX2A 1BX3A 3CW2A 3SYKA 4RE5A 4WK0B 1YQGA 2XH8A 3FNBA 4AS2A 4JDPA 2AVNA 3B3FA 2V3VA 1WCIB 4I1OA 5ESDA 4G1VA 2VHTA 4IOKA 3GP3A 1B8UA 4C4RA 2QLBA 2RGCA 3AV0B 4N6NA 3DT9A 4V02A 4YREA 1PR9A 2WU1A 1Y9ZA 3JVEA 5H0IA 1RXEA 3RK4A 1KU6A 2PZEA 3COWA 2C5FA 1SVIA 1YOVA 1IOZA 3PNYA 4DJFC 2ZSBA 2EVWX 1YR6A 3KOWA 1OXMA 1U3DA 3PXEA 3QKSB 4QTZA 4RZSA 5COAA 3ZGNA 3G1TA 1D2RA 3M3PA 3V2GA 4DC9A 1N25A 2KPOA 2YMLA 1BGWA 1EVZA 1XKXA 3GH3A 1XZHA 4L4RA 4UUNA 1V8DA 3NOQA 1EQ2A 3QXJA 1USIA 3L8DA 3J80A 3I9NA 2AIRA 4FOSA 1IJKA 2G04A 4N5HX 3VR5A 4GGPA 1Y6JA 2FSUA 4FOPA 2OHIA 5HRAA 3TXYA 4MVJI 4ZEXA 3FM9A 2JIPA 3U5ZB 4S2UA 3G2QA 3BD8A 2R1VB 3TZHA 2LZ0A 4PRLA 2NUPA 2BE9A 3PFIA 4H7IA 4LMBA 4HH3C 3RH0A 3R0QA 2J3EA 3OM0A 3QEOA 4I2NA 2J33A 3IEIA 5FORA 3H1TA 2FVYA 1UC5B 4QJIA 5ELMA 3ZN2A 2I4OA 3B1KA 1C50A 2AN4A 3PWTA 5DM4A 4ARIA 1MOQA 5LOVA 2QTGA 3ETNA 3RADC 3C7KA 4NLLA 4HKTA 1Q0ZA 1XK7A 3ZR4B 2V6FA 4PQFA 1YBVA 4Y0AA 4YI3A 3ZBQA 3NAGA 4BFVA 4Y6PA 1JHZA 4F1JA 1G5TA 1ZI6A 2IYAA 3C3MA 5FEMA 3C41J 1JH8A 5A6VA 4Q4CA 5FLEX 1WDMA 4V0NA 1V96A 3TSCA 3W5SA 1EQAA 5FUVA 4Y2SA 3X1KA 4HTAA 5EG5A 2WWYA 3TH5A 4JJIA 1RYHA 3OZTA 1K89A 3WLRA 3PUHA 2PT6A 4YACA 5IC4A 1AMUA 4TLDA 4YAUA 3A3KA 4PFJA 4HBGA 3REOA 4FYKA 2I6UA 2FWBA 3AEUB 1KDOA 1UBNA 3ROTA 3S27A 2Q2QA 1Q19A 2EBWA 1NV8A 2EP7A 2XQKA 3RAGA 3USCS 3Q7QA 1QXSA 2FSVC 1LH0A 2QM8A 2WM9B 2YYSA 2ZBPA 3IBGA 1QQ5A 1S01A 3B2EA 4JH0A 4ZOQI 4ENWA 4PXAA 5FADA 3TGWA 2PGJA 4M54A 2Z4TA 4J7UA 2WMNB 2BF7A 4OXRA 3R0XA 3AM4A 2H52A 2OV2A 4MKHA 3QLEA 2Q5HA 5KX5F 2GPTA 1NURA 4LF5B 5CB4A 2P4HX 2FRXA 1Z4LA 4LXYA 5CJJA 3EEQA 3CO0S 4RM2A 1YCDA 3GX1A 4F6RA 2FB9A 5C32A 4QLBA 4EEXA 2GBPA 1K3TA 4LY3A 2GN2A 3QBVA 4IKOA 4JI8B 3N0TA 1OXKB 2WD7B 4O08A 5ILGA 4NJMB 8OHMA 1JWLA 1YR3A 4OGFA 4OO3A 4QTTB 5HZGA 4IX9A 4M9SA 3TSOA 3W7BA 1EJ6A 5KCZA 1COZA 3CBGA 1BXGA 3QTLA 4L50A 1RXIA 5CT6A 3LW8A 3PPVA 3I2GA 1XXHB 2ZFUA 4WLVA 5HKAA 4BKMA 5K7SA 1BHJA 4AY6A 1EA5A 5ICCA 3F4KA 4Z0NA 3TYXA 5JMOA 3NHAA 4K2HA 1ZVKA 2DLNA 4WZAA 1KDZA 3J81k 1I0ZA 3GDOA 3IQXA 2QDKA 4TLMB 4GG1A 4CM8B 4IDEA 1CUVA 3NM5A 3ORYA 3FYUB 4H7HA 3QIVA 4IVQA 3B2NA 3V8RA 3AFOA 5AJYA 4PICA 3HC7A 4NE2A 1D4ZA 1MJFA 1X9HA 4NZPA 3UV6A 3I0ZA 4AKEA 3RVOA 3TRIA 2VZ0A 1FFEA 4DLTA 3C5WP 4EVIA 3L6OO 3IEVA 3F7OA 3IBFA 1YXMA 4OQXA 4ZCQA 2JI9A 2WA1A 4B87A 3DV9A 4UEJA 4YP0A 2Q1TA 2VYVA 3L0DA 3LKDA 4DR1B 1F4VA 2BKUA 2JHCA 2H8GA 1A5ZA 3MUEA 1E59A 1NI4B 4OF4A 4RKRA 1NBMA 1TYAE 3EQZA 4IH4A 5D7BA 3WGVA 1ZH6A 2ZXEA 2DB3A 1SG6A 4W9RA 4D6YA 4F5ZA 4JOCA 5I9LA 3KKNA 2G82A 3G2NA 3AF2A 4KIUA 3ABIA 4MA5A 4FD3A 3L79A 3PQ3A 5F23A 1QGDA 2XRFA 3OTOB 2FQQA 1ATIA 5FNZA 3TOZA 2PA3A 4IRMA 1AX9A 2CFOA 4BKPA 4MS1B 3W6UA 1FLNA 4HPJB 3I8XA 2E6KA 2ORWA 4H4CA 3FAZA 5COBA 1JDUA 2YIJA 3R7BA 3SJ7A 1U6KA 3U2QA 4LWQA 4CDNA 5H68A 3IAUA 3HCCA 2J3JA 2O7NA 1U8UA 3IAXA 3EXFA 1T0PA 1FLAA 1SUEA 1II8A 1ID1A 4I3FA 4X6XA 1OTHA 1DQPA 1B0PA 1I7LA 2MYNA 2W2KB 4RMHA 4UBMA 2YX1A 1ZC3A 4DLPA 2ZB4A 3V8QA 1HDGO 6GPBA 3K1ZA 3U3DA 2H54A 3W5BA 1B4DA 1KETA 2C1ZA 1GZDA 2GK6A 3TBHA 1Z7BA 1D07A 1W85A 4MS4B 5J63A 4PR0A 3Q0IA 2AD1A 1FZQA 1I8TA 2IYYA 4KQ9A 2PZJA 1PV1A 4Q82A 3VO9A 3LV8A 2OD9A 2IUYA 3NS7A 5CG1A 5CITA 3F8WA 4DL9A 2IZ7A 1ZA2A 4LV5B 3FYHA 4DANA 1LPNA 1SXGA 1V5EA 2B1QA 2W58A 3C5EA 4M8LA 3OPVA 5CH5A 3STYA 4WWHA 1SBIA 1XLTA 1UF9A 3LUJA 1NQWA 2A8YA 2D2VA 1OPRA 4YTEA 1XVVA 3QFSA 1AZTA 2AOTB 4NXMB 5HCUA 3OY7A 4D96A 5HZMA 1HTTA 1XZEA 3QUTA 1BKDR 3RDPA 3ZWKA 4CV0A 3DE0X 3DZIA 3FPHA 4FHFA 3AH8A 1KI9A 4O4JF 1WDTA 3M81A 2LCIA 2AJTA 2XKBA 4I3HA 3WLQA 1QH1A 2YV5A 1BDMA 4QYIB 4P3OA 4LBWA 1STOA 2R60A 5LLSA 2C2YA 2WIBA 2XXBA 1XLTC 2H1RA 3U81A 1KHHA 3PNMA 4DABA 1TPZA 1DAGA 3JQRA 4BYGA 1Y3HA 3FPCA 1HT3A 4CMBA 3QSYA 3KRTA 3ZGLA 4B71A 4FN4A 1BA3A 5BYBA 4KEAA 1Z0KA 2CYBA 4D8WA 2RARA 3ECAA 3UFXB 2ZSAA 1YZNA 2BL4A 3PRKE 4PVCA 5FI0B 1JXOA 2FGJA 1J9EA 2CGEA 1PLLA 3T35A 2XXAA 2P0YA 3CN7A 3GJSA 4ZC1A 3KVRA 3U9SA 4AKSA 4HBZA 5SY9A 3A14A 3UGJA 4LF9B 2IDKA 1U7OA 3JQPA 1RYDA 1XU4A 4OKSA 4DIEA 5HYVA 3O94A 2VPWA 4Y2RA 2EJBA 2GA9A 2WKRA 1E0KA 4N5LA 1FUIA 2HYIC 3RRXA 1U2QA 5K3SA 1TVKA 3L7YA 2BE7A 1RW4A 5BR8B 3GELA 2MSDB 4S1OA 1J0EA 1JR2A 2EFEB 3GZTB 4IHAA 3HFGA 1KO7A 2A0UA 2AK2A 1WP4A 4DM3A 5TQ2B 4GKVA 1WUYA 1Y3AA 2QDXA 4FKZA 3KZXA 1BCSB 1P81A 4NCNA 4TKUB 2G67A 4ZQFA 4ZHSA 4C2TA 5JCJA 5CA1A 3L7JA 1RT9A 3QPUA 4D3FA 1RXSA 5B55A 1A97A 4JXXA 1V35A 1B7GO 1RWNA 1Z7EA 1RHRA 1X1CA 2YXEA 4FDUA 1HDXA 4NJEA 4C6TB 1A2QA 4EYGA 5ICMA 5LXTB 1ZINA 4FYWA 2G40A 1X7ZA 3QU5A 1RYYA 3IVGA 4II2A 1RJ9A 4K1XA 4KQGA 3FHTA 2H2FA 3GT3A 1MP0A 3KQSA 4X1YA 4OLAA 1F2UA 1TTPB 4G37A 5G4LA 2W9XA 5AW2A 2IPNA 3KZVA 4HTFB 1CZLA 2GF0A 2PSSA 5FP0A 3PZBA 4GE0A 3I2YX 1JUDA 4TLLB 1VRCA 3T61A 2FQ1A 4I1PA 3OTQA 1P3Y1 3S8EA 1U2RA 2ZRHA 4B0OA 2JFNA 2YYAA 1R0CA 3FVTA 1V7QA 2Q4TA 4UULA 3EXEA 3VPAA 3D31A 3GEPA 2AD5A 3M6IA 4Y98A 1U2GA 5A5EA 2VEOA 3IS3A 4FEYA 4REQB 4BNTA 2WDPA 4FZ3A 2IWHA 2AI2A 1JHXA 2O2HA 1XV5A 2ZJFA 3OCZA 1SC1A 4GLFA 3A6HA 2XYHA 1KIMA 3I01M 2BGUA 4IJQA 3DSRA 3WMFA 2Q3CA 4DR6B 6CHYA 2F6RA 1MXFA 1SD5A 4LZWA 5DULA 1AGRA 5EFZA 2WZQA 1SOVA 3ITEA 3LX6A 4UXIA 4E2ZA 1X3LA 1A8HA 3TTSA 4YRFA 4MV5A 5K8CA 2WTUA 4L73A 1FYDA 1MU0A 1SD1A 2VPTA 1DO8A 1QOZA 2W6CX 2XUDA 3LPAA 1U2GC 1WB4A 3PR3A 2QRVA 1GFZA 1TQ4A 2C82A 4OQFA 4YRKA 3I5YA 3EIOA 4KI0A 4M1WA 2R5NA 2IYOA 3UN1A 3HJCA 1WCXA 2HBRA 1UZNA 2EKQA 3OTHA 4GVXA 1QJCA 5E0KB 3ZW9A 1HNZB 2B37A 2C4UA 4YR9A 4JYMA 5CFQA 2V54A 1G8KA 3VO8A 4TTQA 1JHVA 1BWRA 1SXHA 4PYKA 1KC3A 2E0IA 5FUQA 1S2IA 4JS0A 4X9XA 2G72A 4BWVA 5A04A 4WXHA 5ALYA 3CX6A 1NC3A 4BBAA 2HDNB 3HSKA 3BEOA 1FVHA 1R27A 2PJZA 3HZOA 3NOXA 1G9SA 3MPUA 3OF5A 5C8YA 3CZAA 3DTNA 5DM70 1SHJA 1G1AA 1JG2A 1V11B 4J6FA 2H5LA 1RXCA 2AFHA 2CDAA 2WLSA 4CKBB 4QO8A 2CL5A 5LL6P 1OGYA 5DN9A 3AI3A 2BPOA 4UUQA 1BMDA 5TE9A 5CFLA 3O4IA 3PC8A 1W73A 3TL3A 5JBNA 2ODQA 4I9FA 2V7XA 4LSWA 4JIMA 4Y6SA 4QHTA 2NSJA 2YR0A 2E48A 2LWIA 2W37A 3H19A 3H5VA 3OD5A 4C1BA 1AMNA 2HJ9A 5ER6A 1G8YA 3EQ8A 5DK6A 1E9AA 2V8BA 1UWLA 2V0CA 3NP7A 2PLWA 4HZIA 4FP9A 4TZ0A 3QBDA 1ZDMA 4HZUB 1WZ2A 1LJ8A 2RKWA 4KRXA 1SCUB 3EAQA 4TXJA 5LU9A 3A9UA 2R6CA 3BD6A 5A7GA 4BX3A 3O8QA 3I6YA 3ZHYA 4X7RA 4DR5B 2XQJA 3DYVA 3JQ8A 3T94A 2X7XA 4FBGA 4MP3A 4KX3A 2ACVA 1YONA 2HRCA 1S2GA 3IQFA 3KAQA 3LW7A 1FVOA 1U1DA 4B31A 5DIZA 1LI4A 1D6SA 1Z3CA 2VRCA 4MQ5A 2FPLA 4KH0A 4ECEA 4Z7QB 4DR7B 3DCYA 4MOWA 1A0OA 5EMLA 2CZCA 1BO6A 2HSZA 3JQQA 3OC0A 2VBFA 3JPYA 3OE7D 4L5AA 5DEIA 4X66B 4UM5A 5GGYA 1XJQA 3OF2A 2AEFA 4ZVUA 2QLMA 2C00A 2WBLC 4OU4A 4RA6B 4W5HA 2E89A 1CEQA 2VF7A 2N3ZA 4N8SA 2YY5A 3HYCA 1VL0A 5AKXA 4MLDA 3ONWA 1Q2XA 1H9BA 3CZMA 4WNYA 3BFKA 3PD0A 2INGX 2VH5R 3LUHA 4HDNA 2O7VA 4A0SA 2GWRA 4ZDJA 3AILA 3I6IA 2NT4A 4M7RA 1XX6A 4QYXA 4UCQA 5A06A 2WF5A 3FF4A 4GI1A 2NO5A 3BSWA 1GGFA 4IGEA 4RFVA 5KNCA 3BH0A 3JWIA 1YK1A 4TKMA 1U80A 1E0AA 3PA8A 3AOEC 1UK7A 2YXBA 3IMGA 2PQ2A 3EIEA 3VSBA 2P27A 1C1XB 4UBOA 5EJGA 1O9GA 3C3YA 3C5CA 3HB9A 2FGKA 4WOKA 1YU6A 1W6RA 3UJ6A 1LFAA 5CXXA 1GCGA 4UHFA 1FK8A 4XYEA 5LQJA 3OMLA 3VYUB 3AJ9A 4EKGA 2AZXA 2YZNA 3BMQB 2VLIA 2Z6UA 3ZNQA 5K3BA 5JZOA 1V47A 2QE7D 4LC1A 1H4SA 5DTRA 3AF4A 4FX2A 1J0CA 5IJWA 4YUYA 1Z0JA 4EY7A 3RGGA 3I34X 2R5FA 1B8OA 3QGMA 4ZOLF 2Y27A 4QVIA 1H9CA 4LOIA 3T7AA 1XMQB 4LEIA 1Y1KE 4F11A 2JKZA 4JB8A 1BXKA 4FYHA 1UODA 4D8YA 2D7CA 1MZVA 1U0GA 4UOEA 4XUCA 3CH7A 1KFJB 1IIBA 1V3QE 1C0IA 2E87A 2G7MC 3DXZA 3GW8A 3H5OA 4QRIA 4DY4A 4E46A 1VLHA 1SO8A 5KDLA 4RQTA 4BO3A 1Z2EA 1MX5A 3G2KA 1YQWA 3ZG6A 3ROKA 1ZSYA 2V4ZA 1YMQA 1VI5A 4EO9A 1V45E 3OG9A 3NH9A 4LSZA 1NQXA 3LC0A 4A6XA 4CYMA 1U7XA 3NTRA 1W4BA 2Z95A 2KYRA 1BRTA 2DPMA 2VRBA 2ZUCA 5FCDA 1YZTA 2ZRJA 4Q3LA 3MJDA 3VBCA 3WTBA 4DLLA 4IUCS 3ZWVA 3ED5A 3F6BX 3FWHA 5AW6A 5CXQA 3K2IA 1QANA 4BNUA 1RVV1 1KIFA 1THGA 4HUQA 2GKSA 4F5DA 4RCVA 4DLSA 1EVJA 2ODBA 3GNSA 4KXFB 3L6UA 1MOPA 3DEYX 4X90A 2TMKA 3F73A 4UU8A 5JYBA 3OQMA 5DHPA 4LHEA 5LP6A 4JJ4A 3JQGA 1WW2A 2YHBA 1C9JA 1DT3A 1PLJA 2C8KA 4ROSA 2AW5A 3G13A 4KK4A 3H1FA 2VNSA 4JQCA 1BMQA 2YV2A 2F43A 3BTUA 3IBCA 4ARZA 4BCBA 3K70C 1JMYA 1VE9A 5AOBA 3NGLA 3HMQA 4PN3A 4D25A 4UNPA 1GA4A 1NU6A 4ZOBA 4EABA 1OBOA 4O4JA 4JB0A 1T9GR 1YZGA 2H00A 3X1ZA 5G41A 1XT6A 4KXYA 1C30B 2JFWA 1CY8A 4RQAA 3VR5D 4UMFA 3KSZO 3AVWA 2VJNA 1M1YA 4X6LA 1L5MA 2D0DA 3NTQA 1CZRA 5KKAA 3Q3CA 3WIVA 1RAFA 3KZKA 4IWNA 1KU0A 4LV8B 2WJYA 1GYRA 1B42A 1MO2A 1GNTA 1KR5A 3A2LA 2FZ5A 1DV2A 1NRJB 2X15A 4MYUA 2W4IA 2CHGA 4PYRA 3U3JA 5FLYA 1RJGA 1HH4A 1YJCA 2W6JA 2TECE 1N0WA 4MQ4A 4FKBA 4BVBA 3C3PA 4XAQA 5FTJA 3T7KA 1GPNA 2IY7A 4F4FA 2PH7A 4MJ7A 4CEJA 3DO8A 2J48A 2FCRA 2BTOA 3HCEA 3EC1A 3UHAA 1FFYA 2ZULA 4TLEA 3CNHA 5J2TF 3RG8A 1KZ4A 3R3SA 2B35A 1E2GA 1KNXA 1XDUA 3QI7A 2CMGA 1MGOA 3R7LA 5JWRA 5DYTA 1AQNA 2D59A 1IYZA 2Z9DA 3KVVA 1H4VB 3QUQA 2PN1A 4QRDA 4S2EA 3TAXA 1IHYA 3B9RA 5E2AA 1LSUA 2P69A 3GA7A 5F7ZA 3TIXB 2P6PA 5KINB 1T9AA 1GUYA 3T1NA 3GLIB 4ENTA 4FGWA 5HGJA 1R74A 1YZLA 4TLAA 2JLQA 1C4WA 2ODEA 2BTQA 1FXWF 1S1CA 1UWKA 2X8JB 2Z56A 5AOCA 2SCUA 3MCVA 3ZVRA 4X97A 3RS0A 4Y18A 3RVKA 5CT5A 1KYIA 1RQGA 2HNKA 1Y80A 2XD4A 3C7CB 1QZTA 3GGOA 3Q3EA 1LPPA 2YWDA 2DJIA 2G28A 3A27A 1E6WA 2WABA 3GEGA 3ON5A 2H2DA 4UJ3A 4OFZA 2DQ4A 3MYYA 1P2VA 2Q27A 5JMWA 2PRJA 2VJLA 4N6GA 1KMIY 1VG9B 1QLWA 4KXMA 1XMSA 2HK7A 4JEMA 4FUTA 5B12A 1W4LA 2Y05A 1VL6A 4PYLA 3GOQA 4QICA 1P5HA 2FWMX 2XAAA 4PLYA 1ESNA 3Q7RA 3UT5A 4A0RA 4YMVA 5HX7A 2JASA 5EIWA 3AJ8A 1QDUA 2B8JA 4BPBA 3T5CA 2O1SA 3M1YA 4RETA 4YIKA 1ECBA 4BX2A 1Z8HA 5AOVA 1QF7A 1YUMA 2YTZA 4L57A 4E30A 5HJEA 2D4HA 1Y0BA 4HWTA 2PUAA 1WVIA 4E1AA 3EJWA 4AK9A 1F12A 1FX1A 1FFAA 5TX7A 1PR5A 4YFVA 3TZEA 5HG0A 4RFSB 2WYIA 1FQKA 5ECDA 1Q16A 3H87A 3M9LA 2HXYA 2YXDA 3PDIB 3QWHA 4RAOA 3OWOA 2AJ8A 3A11A 2NPFA 5FH9A 3KR0A 3WYBA 1NBOA 1LW7A 2PTHA 2XMZA 4YO7A 1KQFA 3EISA 4M46A 3DHYA 1X1TA 2BI4A 4Q4HB 1LC0A 1XWIA 5EXEA 4BRWA 5LM3A 2PQ0A 5DASA 1L4YA 2RE8A 1Y1LA 1C8BA 3D6TB 1R0KA 2VPIA 3SBXA 1Q0HA 4DUZB 5AVWA 5KYXA 2R6R1 2BGJA 5BSVA 4P3NA 4CLEA 1PZGA 1FS6A 1V95A 3B9PA 3WWZA 3ANTA 4AG5A 5AVSA 1V39A 5TEWA 3W7VA 1N3YA 2BFDA 4U5XA 3ENNA 4FJ1A 3FBWA 4L1KA 3SE0A 4UQOA 3ZHVA 4JLDA 3KP1A 2A9OA 1EM6A 1EZ1A 3R74A 1JKMA 3ZZ1A 4CMAA 2Y76A 4NG4A 1GSOA 4KIWA 1EWRA 1QPGA 2G9QA 2JIOA 3PCXA 4XB2A 1ZGJA 2GA8A 4RK1A 1KARA 4BZXA 3FKSA 4RK6A 3Q9LA 4JB2A 3HA7A 3QA3E 3OESA 2D6FA 1MKYA 5I51A 4R7TA 2ZBRA 1NBMD 1A7KA 5BSMA 2QUIA 1R12A 4I4NA 1Q0PA 4IDGA 1I1OA 5TS3A 1LVHA 1QK5A 3CF4A 3V3KA 1M7BA 4QPJC 4EI2A 4G67A 4BDSA 3AW8A 4YRRA 4D8XA 2E4AA 1G16A 4UDNA 4A9AA 3WNBA 5AM5A 3N5CA 1P44A 2P2DA 1ZLXA 1C8KA 5IKPA 2CLMB 4GDFA 4G8JA 1UPFA 3K6KA 3WLHA 4QO7A 1NVWQ 3K2BA 4MTCA 1JIIA 3HWSA 4Q03A 4RKWA 3VNSA 2D5IA 2WNSA 1AO3A 1CG6A 4RVNA 5DJ5A 2JARA 2A7XA 2GVDC 2J9FB 1L6RA 1WU8A 3GFQA 3NCHA 4M22A 3UBMA 1FE8A 5IHPA 3HKBA 2QUAA 4UPVA 3WADA 4QPNA 5LUBA 3RYHA 4ZN6A 1CWUA 3RU3A 2OHHA 3HNOA 1Q44A 2IIBA 3AHJA 1D2MA 2CDBA 4J1TA 3LC7O 5IBCA 3DVAA 3ZJ5A 1TJ4A 3CKMA 3KJQA 3BKXA 1FTQA 4N54A 2OAGA 1QFXA 3HVUA 3CNLA 1JDTA 4Y6OA 3SYMA 3CFYA 4LNAA 1IXKA 4MPTA 4EGAA 3MOGA 3BL6A 1CY7A 4PPNA 1O97D 2V7WA 4LGVA 4CUZA 2IEGA 2GO1A 2H4YA 4KYVA 1IZ9A 3H7AA 4XVQA 4DMHA 4F5YA 3ZNOA 3VZCA 1E99A 3UJPA 3L06A 1E6UA 2BKVA 3NIDB 4E5KA 1XJ0A 4ZAXA 4TVSA 2RD2A 1V7CA 3WMWA 4BNWA 1X2EA 2P9JA 4J1TC 2XUAA 3JD2A 4R6XA 2DUJA 4O29A 2Y99A 2Y3IA 3L8FA 1E3IA 3G89A 1TFRA 1UBOS 3UUGA 3EGDA 1EHCA 4HN2A 4N3BA 4TPKA 2JL1A 3ZKAA 5KNCH 2YN2A 4OM7A 1RAIA 4RSHA 1GL6A 1NVVR 3KUUA 3ZX4A 5DE3A 4YT4A 5IWCA 1U1EA 2Q21A 4M1YA 3QA9A 2VP5A 3E0QA 2BHSA 3OAAD 1L5SA 4XDGA 3T7JA 2XCUA 1YZQA 2DG2A 5ALPA 1W1IA 3H2HA 2WWGA 3ZK8A 2H63A 1MC4A 4KQEA 3LY7A 1DS6A 4X60A 4UOZA 1A8IA 4E2WA 3EVDA 1Z33A 2Y1KA 4Q3BA 2OHXA 1RHJA 3IXLA 3W5CA 3OCJA 1M2JA 1UXHA 1VGQA 2F62A 4PC1A 4WOJA 1XEFA 2IEAA 5K0FA 4RMIA 2FW8A 3SFVA 1UT8A 5FD8A 4GI7A 4GEGA 2D5CA 2H85A 2OMKA 3ICPA 5FTLA 3EB9A 4W5QA 1ORIA 1GAWA 1FS4A 3NVKI 2BRUC 3OLXA 1SBHA 1T6YA 1SU6A 1TM7E 2PV7A 3CINA 3QRWA 4MRPA 5KTTA 5JJ5A 4OHPA 4EMUA 3QMVA 4IXWA 1GGVA 2CWDA 2DUMA 3L4BA 4WIAA 4JL5A 4ZOLA 3STXA 4MWSA 1XQWA 3FY4A 4LQ4A 4BVHA 1JIQA 2HFJA 3R5KA 5HW0A 1TYZA 1ZKMA 4MVJM 1FTYA 5CPBA 4B81A 4E94A 5T6MA 5EZSA 1Q1ZA 1KOGA 2XCSB 3PL1A 4A8JA 4TRJA 2DBVO 5LQRA 1NATA 1U2PA 4XIIA 1PK9A 1N8KA 2CKDA 3ZWWA 1T4CA 3L0YA 2ZIWB 4P3XA 2H92A 3ZUPA 1PZXA 1KJ8A 5IUNC 5KOYA 1A2BA 3LSTA 1JQKA 3S99A 5M5BA 2OO5A 3BZWA 2ZIUB 4CTMA 4RTRA 1EP9A 1E2HA 1E1CA 1JB9A 1XIVA 2Z8XA 4MUEA 1Q7RA 4PCVA 2P9CA 3P71T 2ZJ4A 1N6KA 4Y9RA 4LHZA 3DMTC 3QV2A 3DE6X 4PZLA 4GNKA 4QXPA 5ALXA 2C7RA 2AXQA 4A8JC 2Z5FA 3FGZA 5CA0B 5IT9A 1R9NA 1WOMA 3KOYA 3P0RA 4BRUA 5K4HA 2G6BA 2CBGA 3DV0A 4GEKA 1GFWA 4ML3A 3RSFA 1VE1A 1XD8A 2B4TO 3H1PA 5AIBA 5AKYA 2OO5C 3SDSA 3P9KA 2W7TA 4POAA 1CUGA 16PKA 4JITA 3TRFA 2MYPA 2DFPA 3COYA 2W70A 4ZJPA 3LBYA 4DSTA 5U9CA 2H5JA 3A6JA 1NXQA 1VSTA 2IPAB 3N70A 3P9SA 2V45A 3Q3IA 1B6TA 2PVCA 1ZISA 4MVYA 1SU8A 1U7WA 2PUJA 1IWPB 1FCJA 4IH1A 4IWYA 3VOAA 3VQTA 2PUHA 3MJ4A 2AUTA 3F5SA 4GPBA 3K9FC 3DL2A 1HNWB 1E6KA 1OIVA 3RYFA 3AFHA 2AKAB 2H5IA 1T8PA 3FNHA 4TXNA 4BQPA 1Z2PX 2WFLB 3AI2A 4K9QA 2QBYB 3PYLA 3O8OA 2J07A 1U8XX 4G01B 5KMGA 2UXCB 3FHJA 1LNQA 3ONVA 5AM3A 4W8GA 4C4ZA 4X1KA 1AURA 1K68A 3NC1C 7REQB 4YX9A 4IIBA 2VTBA 4DWOA 3KD3A 2QZJA 1SVMA 1YJBA 2H1CA 2YHSA 4MMYB 4AUKA 4W6ZA 1XZPA 1QHYA 4MUMA 3W1EA 3HNRA 4QHSA 5CFMA 4CR6A 3R8FA 2JAOA 1W76A 2XE8A 3ZV5A 4WA7A 1Q17A 2PNFA 3AHEA 5FWXA 1TVCA 3MGKA 4IG9A 5J2TA 3EG9A 3N3BC 1GAXA 3SLRA 4B75A 4DR3B 4P80A 4BJ5A 3OEWA 2HO4A 2DM6A 4EGQA 2IS1A 2HEIA 2EP5A 2YJ5A 1TUGA 2GZMA 1FFDA 1KEEA 1WBBA 4GI5A 2ZYAA 3AKCA 2WUFA 1V37A 2QM7A 5AVKA 2NG1A 4FCTA 1KDVA 1Y8QA 2VAVA 1FXWA 1F0PA 3V1UA 1RM5A 1B73A 4FC6A 1DAHA 4WBXC 3KAPA 3IPXA 1RKXA 4Y9DA 4NOKA 2WJHA 1ULUA 3CLSC 1T9CA 2C3UA 2R6ZA 4MYDA 3N2GB 4TV9F 5DGXA 3TMYA 2PE5A 3OCCA 3MWKA 3VKWA 1Z83A 2I3GA 4KFUA 1E7QA 4KRFA 3LOUA 1JFFB 2KBEA 4F2GA 1ZJYA 4LXUA 1ECFA 3MM4A 4IF4A 3RBAA 4IZ6A 4C7XA 5JADA 3JZIA 4H7JA 4HAZA 4HDMA 2XUIA 1AKMA 4M1ZA 4AVYA 4D9KA 3B1JA 4JT8A 1A76A 1ZJ4A 1G8PA 1WMAA 4AW9A 2WINI 1YDFA 1IULA 3BA1A 4OUDA 1WX1A 2NTJA 2REOA 4OJYA 3GLGA 2R47A 5KC8A 3KJHA 1H6DA 2YFKA 4FGZA 2OLKA 4EL0A 4A6DA 1O8BA 3AF5A 3BZBA 2N1BA 3HCBA 1VZ3A 2WWHA 3G0CA 2IQ5A 1TLFA 3AHHA 1QFSA 4BDTA 4DTCA 1U02A 3L02A 1JFLA 3FZEA 4JJGA 3V7FA 1TQ8A 4H08A 4H3VA 3BQ9A 3F47A 4C89A 1Y9JA 4ASUD 1U9IA 3OBIA 3C43A 3HUUA 2C3OA 1DIGA 4HDQB 2AI1A 1ITZA 2D3TA 3F6EX 4UZEA 4M0FA 3U80A 4PTLA 2ZYTX 4GAEA 1XKLA 2JJ2A 2PBZA 3DEZA 3A0RB 3OCVA 4KSBA 4LJ7A 4IINA 4F4DA 4QA9A 3FCOA 4W5WA 1BQ3A 1D3AA 1JHYA 3W5AA 2OCKA 3L8EA 5KNCD 3CLTC 2J45A 1E6LA 3DGEC 2GUWA 3EY9A 1KAOA