1UJBA

Structure of the protein histidine phosphatase sixa
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
156
structure length
156
Chain Sequence
MQVFIMRHGDAALDAASDSVRPLTTNGCDESRLMANWLKGQKVEIERVLVSPFLRAEQTLEEVGDCLNLPSSAEVLPELTPCGDVGLVSAYLQALTNEGVASVLVISHLPLVGYLVAELCPGETPPMFTTSAIASVTLDESGNGTFNWQMSPCNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the protein histidine phosphatase SixA in the multistep His-Asp phosphorelay.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Phosphohistidine phosphatase sixA
total genus 54
structure length 156
sequence length 156
ec nomenclature ec 3.1.3.-:
pdb deposition date 2003-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1ujbA00
2EKZA 2P75A 2HPAA 1E59A 2EOAA 2WNHA 2P78A 1RPTA 4PZAA 4ARSA 5AJZA 3QPVA 3OI7A 5PGMA 5AK0A 3BIFA 3QPUA 3ZHCA 2BIFA 2EKBA 1SKAA 3D8HA 3DCYA 2YN2A 1SK9A 4EMBA 3EOZA 1CVIA 2ENUA 1ND6A 4JODA 2P2ZA 3LNTA 4IJ5A 1TIPA 4GPZA 1DKNA 1QHFA 2GFIA 2H4ZA 3O0TA 1V37A 2AXNA 1RPAA 1DKQA 1RIIA 2H4XA 2H0QA 1FZTA 1T8PA 2RFLA 3GW8A 1YJXA 2DWPA 4AROA 4D4LA 2WU0A 2DWOA 3R7AA 3D4IA 2A6PA 4GPIB 1C7ZA 2PA0A 3NFYA 5CU7A 3IT3A 3E9DA 4TSRA 2I1VB 1K6MA 4D4KA 1IHPA 2F90A 1DKOA 4D4MA 1SKBA 5AJXA 4ARUA 3EZNA 4PZ9A 3NTLA 2A9JA 3F2IA 5AJWA 1NT4A 2HIAA 4EO9A 3D6AA 4E3WA 4IJ6A 1YFKA 1C80A 2OWEA 1SK8A 2P2YA 3QPWA 5CDHA 3FDZB 5HR5A 2P9YA 3E9CA 2P6OA 1BQ3A 3IT0A 3K4QA 3MXOA 1V7QA 2HHJA 3FJYA 1FBTA 1H2FA 3GP3A 1E58A 1H2EA 3C7TA 3GP5A 5CX4A 1QFXA 4FDUA 4HBZA 4QIHA 2WNIA 4MA4A 4ODIA 1EBBA 1ND5A 1BQ4A 3HJGA 2P79A 4FDTA 1DKMA 1UJCA 4PGMA 4ARVA 2QNIA 2P9FA 3LL4A 3LG2A 2YN0A 2ENWA 3K4PA 1QWOA 5HTKA 3MBKA 2P9ZA 1DKPA 3KKKA 2P6MA 4JOBA 1C81A 1XQ9A 1DKLA 2H52A 3IT1A 5AJYA 2P30A 2OWDA 3FDZA 2P77A 3PGMA 4JOCA 5AJVB 1UJBA 3IT2A 1BIFA 2IKQA 3DB1A 3F3KA 3E9EA 4D4JA
chains in the Genus database with same CATH superfamily
1ZK4A 2I8CA 5CPFA 2EBUA 1FUIA 2NPIA 4U9HS 3PFWO 4U4AA 3U3OA 2DB3A 5DNYB 4JWTA 2Q5CA 5JEDA 1T1IA 1Z29A 3EVZA 3CE6A 4P58A 2Z3WA 4G89A 4I5EA 4XVHA 4BNKA 4DCPA 2L82A 3RT1A 3DLBA 3LXUX 5CYGA 3HWWA 1T9KA 5L8VA 2UXBB 1JR3E 2OHIA 4RULA 1J0AA 1MRNA 1OZFA 1G8GA 2ST1A 4QQRA 5K3AA 1N5LA 1OFGA 3PFKA 4YPVA 1VHDA 1G8JA 3HHEA 1OWNA 3GMTA 3IDAA 3PIRA 4KXLA 1WSBA 2PJUA 2QORA 3ITNA 4W9RA 3ZS8A 3ZS9A 4JI0B 3TLJA 2WTBA 4CKCB 1GDDA 1VP3A 3F6BX 1IXYA 4BXOA 2GT1A 2HW8A 1H3FA 2Q1WA 5FORA 1WZCA 3GOQA 2WMDA 3ROPA 5EQDA 3MCTA 2CVQA 4GH5A 4YJGA 4ZT5A 3GFVA 5DBOA 3RFCA 3OA0A 3WLKX 4DEXA 1KIFA 4LWQA 5IFLA 4OHOA 2HPHA 3WYGA 2VEOA 3H3FA 3C5EA 3O8OA 2YH2A 3F3SA 4HGQA 1KY4A 3VHXA 3NWEA 1P74A 1FUEA 4PHCA 4UAVA 2Y6VA 5TQJA 4YCCA 3W1WA 1ULSA 3L84A 5ERGB 1PZMA 5KHLB 4GR9A 3CUVA 2EFYA 2QTVB 3GBVA 3QBJA 1N75A 3AYXB 2RHDA 4GRIA 4M53A 1T0UA 2XT0A 5CR9A 4GPTA 4M76B 4X71A 1QIGA 5G4LA 1KVUA 4Y30A 2YFKA 2G36A 2OO3A 3WGGA 2XE8A 5FV7A 2HO4A 4I1UA 5L7WA 4ZVVA 2VJPA 3DPUA 3N7AA 5LMZA 1XMVA 4CCYB 3L1IA 3L5KA 4Y1EA 1SOUA 1RP7A 4HJRA 1F4LA 4DRXB 2N46A 3TSOA 1MVLA 4QOSA 5E8RA 4ZXPA 1BN7A 3BKWA 3MWYW 5LP6F 4G41A 2JJ1A 4JBLA 3HNPA 4GIBA 2PS3A 4J9VA 1NNEA 2F2TA 3V9AA 3DXFA 3DWEX 4OQEA 2WOOA 3IHTA 3K3PA 4H1UA 3MT7A 3ER6A 1TMGE 3HUDA 5F7ZA 1U7XA 3OZRA 2G06A 2IOFA 3AIMA 2O7RA 3NB0A 4FKBA 4TKLA 2QQ5A 5L7TA 1NNUA 1IU9A 2I2DA 2P1DA 4IMIB 4F93B 3R75A 3JWEA 5TLSA 2P2CA 5FQNA 4YP9A 4IIBA 2IITA 5AKZA 4PO1A 1EHIA 4IICA 3PYXA 3QP9A 4J6EA 1PX2A 4E0BA 2RC6A 5GJVC 2WHRA 2BH2A 1YVUA 2VDRB 4MI3A 4QUJA 3TTUA 4MDEA 1PQWA 3OKFA 1ZC4A 2FCAA 3MMZA 4C2BA 1Z07A 5LCXA 2A33A 4ML3A 4QVGA 1FFXA 4B6FA 1W76A 1Z16A 2RG7A 4EJFA 1QIDA 3NUQA 2KHZA 4FQ8A 3RIXA 2ZEJA 1Q14A 5J58A 4IEIA 5MF6A 4BEVA 3UHOA 1QJCA 2ZDHA 3MPUA 4XGIA 4W1RA 3QPAA 1WXXA 4RNCA 1ZAYA 3N9IA 5B4TA 4ZO7A 5TQVA 4Q4DA 4WJKB 3BDAA 3WMEA 1USIA 3KJHA 2QRPA 2I7CA 4NFSA 3L4KA 2VKQA 3N8IA 4CKZA 1ZI8A 1MQAA 3NMUF 1FYFA 3DVAB 1AGRA 1QP7A 2GHIA 3DE1X 4NEGA 2FAXA 5EIBC 3UMCA 2LIPA 3ZZMA 4EYSA 5HRUA 3Q7TA 5HF5A 1QVWA 2WWFA 2PRKA 1FNSA 1ABEA 1SUAA 1WXDA 4KNVA 4Q3BA 1G18A 4BIIA 2UU9B 2RJ3A 3T7KA 5DCUA 3MELA 2H0AA 3BXZA 1B00A 5GOZA 3P5BA 4NZOA 1YR6A 2FVXA 1YB2A 1XCMA 2COEA 1FP4B 4YJGB 1J7KA 1ODSA 5IASA 1USWA 2GJAA 1HWYA 3DMPA 3AVWA 1BKYA 3FBWA 2C78A 2H2DA 4D81A 4PY2A 1ND6A 2RCYA 5UKDA 5HIJA 3DP7A 3BQ9A 1K3TA 1TUIA 4PLPA 4BJ3A 2TS1A 4DS3A 3ZJ4A 2GPYA 1DKQA 2TMGA 4E09A 4IIVA 4XDGA 2QBYB 2GCNA 2P7HA 3X2SA 1EFKA 4WXHA 3T3DA 2QUAA 4DEYA 2OAEA 2DWPA 3KB2A 2MCFA 1PJTA 4BQNA 3C3EA 4LV6A 1KEWA 1MU0A 1JWLA 4BX9A 3M6IA 4CV2A 4OP1A 1XWIA 1MA3A 3TNYA 1ONNA 1GPNA 5D5HA 3TFWA 1W49A 3OCYA 4MR7A 3OJEA 4D82A 2PAFA 3JAWB 1G66A 3FTDA 3L0CA 3U4HA 1LC3A 2VSYA 1E9EA 4JB2A 4HDCA 1NSTA 4PAGA 1NW3A 1NMEA 4H0CA 4NESA 4O3FA 3BICA 4M9QA 5DSXA 1YCHA 3BA6A 5TIIA 3FYUB 4GLJA 1CRLA 4HX2A 2RAPA 3LUPA 5TVKA 3ETJA 4N40A 1R12A 4LKRA 3I01A 5TRTA 2WHQA 4Y1RB 1PX0A 2Q62A 1EFRD 5D5PA 4MZXA 5I7UA 1AG9A 1P62B 2P6OA 3FBTA 5L4LA 3KJZA 4OHKA 4WNYA 1K5GA 3AW8A 1F17A 3F6RA 4Q6WA 2IYSA 4Z9AA 4J8PA 1DUIA 3NZEA 1S96A 1WVMA 3O5AA 1DAMA 5K3CA 1CCWA 3MSCA 4EGAA 2R8PA 1R5JA 2ZGVA 2Q6VA 3TOZA 3DQZA 3VAZA 4C6TA 4CFZA 2O7NA 3KYCA 5E7IA 1RYFA 5DYGA 2Z5FA 5CFRA 1WMFA 1JR3D 1TKBA 1A98A 4RK4A 1P80A 4GMFA 2LGJA 2I55A 1P3Y1 4INOA 4LK3A 1G2QA 2CVPA 3EVGA 3PQ8A 4LNUA 1YBAA 2R1VA 5AHOA 2QUBA 3MM4A 5LZ2A 5JCJD 2JGJA 3REGA 4V1CA 1OXXK 3LCMA 3HU3A 2GNOA 1P1CA 3NYRA 2VOJA 3KP1A 4G5OA 2OP0A 4AY2A 3R3VA 4E5YA 4PBSA 3SYMA 4CU2A 4MWGA 1UKAA 3T15A 1G9XA 1R6AA 4P92A 1JZQA 2NUAA 1V6CA 5E3IA 1C7RA 1GG9A 2GM3A 3VC7A 3OWHA 2VYVA 5IT5A 5HWSA 1NQUA 2E0IA 1M2VA 1VMKA 3RROA 3MT9A 5LUBA 1WE2A 3CH7A 4XGRA 4AZTA 3NHRA 4OUKX 1JVBA 2BGJA 1PL6A 4ZOBA 1USUA 2YVKA 3IELA 3TM5A 3ADDA 1FFYA 5B57C 5JE8A 3GT4A 1MT0A 3KK0A 4PRZA 5HIMA 3L8HA 1RI1A 5KQLA 3DFKA 1E3QA 1W7AA 4J7XA 1T9BA 1TGYA 3GMIA 1EK2A 2ZTLA 3ZHQA 3UGTA 2FQQA 4B4UA 1KA9H 5E95A 3GMSA 3WWEA 1ZWKA 3GLFB 3KVNA 3UW3A 4OB6A 3HKCB 4NFYA 2HBZA 3MOSA 4ZMSA 2IH5A 2C2ZA 3LHSA 1VSVA 3MQ2A 4EG6A 3AI2A 3EBPA 5EUBA 1KGDA 4Z4CA 5TDHA 4B32A 4ENWA 1RXVA 3TWOA 3TEFA 1YQEA 2FW6A 2GZSA 3L18A 2FUEA 2H7XA 3PU6A 1ZSYA 2IU6A 4FJ0A 4BXOB 3B3JA 3PGXA 4GE0A 4ZANA 2FR8A 1GTL1 1HBJA 4G0OA 4IO1A 4KFTA 4PX5A 5EPUA 2P67A 3W2HA 2VJNA 1DGQA 5CAEA 2EFGA 1W4RA 3OSZA 1XP5A 1W87A 3ZDYB 4ND8A 4ARBA 4LRYA 1V8PA 3KB1A 3MWGA 3R7AA 3E81A 4P0TA 1OXUA 4UE3S 2FF5A 2B4RO 2B1GA 2BYTA 4JMPA 5CBPB 1P17A 3VISA 3ZDXB 1A9OA 2C5BA 1EVEA 1VKHA 2EIHA 2Q3FA 2DEUA 2BRUA 3JAWA 3AGQA 3KFXA 2Q29A 4JENA 5DK4A 5CT9A 4MW6A 5F1KA 1DKOA 4RZQA 4ZVQA 2OD9A 3KUCA 4V2UA 3EGEA 4DZTA 4S2UA 1QE0A 2JHAA 5A03A 4J91A 2C42A 1M10A 2X9NA 5I7OA 1J2RA 4KQIA 3W5UA 1JLLA 1Z7GA 3SVZA 3NHAA 4ARAA 4FYVA 4HPJB 1IMOA 5M5BA 2YBDA 1LDGA 3JQFC 1E5DA 1V11A 2O2SA 2QPLA 2YC4C 3PA6A 4J3NA 2QRVA 3PRJA 1M34A 1YQXA 5FWNA 1T5IA 2WZCA 2ZCUA 4KGVA 4Y8VA 4GM0A 5IJXA 2BHTA 5AI9A 1X7GA 1KBOA 2GBIA 4RXTA 4H0FA 3CRNA 1L4GA 4C0XA 1BJRE 2D3TA 2H7VA 3KDAA 1OXVA 3MLAA 3QTLA 1XWWA 1Q2UA 4EEZA 4DMRA 2BMJA 1W0JA 1UBCA 1K7EB 3RR2A 1XE3A 7ADHA 1EPUA 4PIPA 4C7BA 4J90A 2C57A 4WTOA 2P79A 3NGMA 2F9LA 4JLPA 1AE1A 5AT1A 1CPYA 2JFXA 2H2GA 2Q1TA 3BXHA 3ED5A 2HZ7A 4F45A 5LNK6 1VP9A 5FO1A 4LTNA 1XVIA 2ZYUX 1L5YA 1TU3A 4IFBA 3GVXA 2MHCA 2ZRLA 3VNUA 3WKAA 3EVAA 4B44A 3IEKA 4EUKA 4NH0A 1CZLA 2OHVA 3OMLA 4TT3A 4BMVA 4H1HA 4PAMA 3ASZA 3Q12A 4PCLA 2PUVA 4AN4A 3NBFA 4Y7DA 2XUGA 1NXVA 1QS0B 1W8DA 4UBJA 6LDHA 1P1JA 4FOTA 3EQ7A 5HRAA 4P2GA 7REQA 4IKPA 3Q7EA 3DSRA 3SZLA 2ZSDA 1IPHA 2DQZA 1S3FA 2UZ1B 3HMQA 3FCOA 3MWEB 3N7UA 4RANA 3VC3A 4HR7A 1VI5A 1NBHA 1WPGA 2HIGA 3PBKA 3RIGA 3JAKA 4A10A 2FMFA 3WE7A 4IFIA 1EB8A 1JQBA 2GJSA 4JH0A 4ND8B 1AXGA 1IWBB 2W7TA 5IXSA 3EBOA 3DEYX 3GLTA 4G1VA 5DN6A 1VLZA 1N6LA 1Y5RA 1KI7A 3DMTC 5AVJA 3OPMA 1BJKA 3P9QA 1V3UA 1Z8DA 2FK7A 2WT4A 4MDYA 1Z12A 1ZNXA 2IV3A 5EMNA 2JLWA 4M9UA 3KPJA 1GTG1 3GAMA 1KE2A 1GP2A 4R0NA 4B84A 1JHDA 4YDSA 3OZWA 6YASA 4L51A 4EUHA 4PTZA 3V1TC 4CDGA 4FFBA 4AMVA 3K6KA 2D7DA 3NDIA 5G0WA 4YREA 1C3OB 4PPYA 1V7ZA 3PKIA 1IM2A 3LW7A 5E3JA 1DJMA 1D2MA 1QIKA 3CO5A 3OFSA 4IP0A 4RENA 5LLSA 3UHJA 4FPXA 2HU7A 2OM2A 5T67A 4DIMA 5HZMA 3JD4A 2VNHA 5HX7A 1FZTA 2AWOA 1EG7A 2F64A 2V4ZA 4UXJA 1SCJA 1YKGA 2CLCX 2XWBF 1BTOA 2PO7A 4JVNA 4HQKA 5GINE 1ISHA 1LTHR 1I2ZA 3WIBA 1J9GA 4IY1A 4U6QA 4KN6A 3LO5A 1ZJZA 4QUEA 2OCPA 3W05A 4BVKA 1COWD 3CLSD 4IYJA 1NOJA 1YQGA 3AUAA 3TNLA 2XZDA 3QOXA 4A8JA 3LFHA 1KMHA 5DN9A 2QE7A 5IBQA 4MVJA 5T64A 5AW0A 4JYZA 1PT8A 2EERA 4MS4A 3RYHA 1GFIA 4EHKA 2G40A 3K5IA 3SIWA 2DLCX 1ULBA 2NXEA 3LKBA 2XMBA 2YRFA 1SKBA 5EJ9A 1LI4A 2VH2A 2OY0A 3BH6A 4TTJA 1NJ2A 3HFSA 1GZ3A 2EZ9A 3DXXA 3MA0A 2AE1A 5DV9A 5BYJA 1XZGA 3IEMA 2QRZA 3VHQA 2FPRA 4DR2B 2PKCA 1U9IC 3IIJA 2B61A 4KMSA 5HQ3A 4GKKB 4DR4B 3AHEA 3AFHA 3LC2O 4G5SA 1HUQA 3ANXA 1XCLA 4Q3EA 3T4UA 3PDIB 1WUTA 3IBGA 4QG3A 4X7MA 3F90A 1DG9A 3F47A 5E0OA 5CT8A 1UJNA 1X8XA 3AKZA 3G7UA 2R7MA 4Q0MA 4W5QA 1Q3HA 1TT7A 4KAFA 1RZRA 1T2VA 3PC7A 1SH7A 5TNXA 3SIPA 5D3KA 1UFRA 1QMGA 1PHPA 3KXDA 1DXQA 4FGKA 2FWMX 4MKGA 4N0QA 3BHIA 1ILEA 3CNQS 3C39A 1YR2A 1OVMA 2H51A 3SNKA 2CXOA 3F46A 2I99A 1XEWX 3PCXA 4B2IA 2QX8A 5F7OA 2Z2KA 5KU1A 3FNEA 3WGMA 2F3UA 2J4CA 3V55A 4B7CA 4BGVA 4DDVA 3ZKWB 3A1VA 2PM8A 3CIOA 1QR2A 1TK9A 3FDIA 3K5WA 4FGLA 4J1QA 3VDRA 4WLNA 4B5KA 5JC8A 2NO6A 1EG2A 3FPGA 3GRUA 3Q2OA 2OHGA 4Y2QA 5SY9A 1IIBA 4YNBA 4QULA 1CRPA 2HZBA 2EZUA 2F3RA 3WADA 4BO3A 1G3MA 1GLGA 3FVTA 4BNLA 2I2XB 2G70A 4JC8A 3LHDA 2O8BB 1HT1E 3E7WA 1TJ4A 1YZGA 3NVMB 4MCJA 4ZZ2A 3ZXIA 4TXNA 1GNTA 2IZOA 5AR1A 3BX1A 4RMGA 4UDOA 5EIEA 3QSGA 4G1EB 4F60A 2WU4A 1NN1A 4DW8A 1LTKA 4F71A 4PBTA 4JK3A 1HYQA 2RBEA 3EH2A 5AD1A 3Q8MA 1EP3B 2Q5EA 4GU5A 3H04A 1LK7A 1Y33E 4RS3A 1SEVA 1DFGA 3EFHA 3MEQA 2XB6A 3V1YA 1A8QA 4OHPA 3KT8A 3D7KA 1N5JA 4M0KA 3I8SA 1CNFA 1JQKA 3C6BA 4U7TB 4B33A 3Q8XB 4KMOA 5JAHA 2XT9A 1JTFA 3GNQA 3KPVA 5F3DA 2XOKA 1GAJA 3BEDA 4WACA 1C4XA 3ZH9B 5JS1A 2PN1A 2YN2A 1C0EA 1QYXA 1YDGA 1DX9A 1R16A 3EIUA 1MZVA 4KQHA 1DXOA 1QB7A 5L45A 4F85A 4RZ3A 1JIIA 1KDPA 1V6SA 2R6ZA 3EFOB 2LDBA 1YIDA 4WX2B 1CJCA 2WSIA 2AFIB 3DNFA 4BFVA 3QBTA 4JLUA 3LZCA 1LPPA 2RHMA 5LXTF 3JQQA 5GVRA 4HN9A 4B87A 2JBHA 3L1KA 1TO2E 1VM6A 1B26A 2PBZA 3DG9A 4YCBA 4WZ6A 1TT5A 5CDYA 1HNWB 1GOTA 5KVAA 1FLNA 1JRLA 1NI4A 1R4ZA 3DTYA 5AIBA 4CIWA 2JA1A 3OEHA 3UCEA 4S1OA 5GONB 5CVDA 4AJ4A 3RADC 3IT3A 3KYBA 1AURA 3EA4A 2X1VA 4TS9A 3ZK9A 4H1WA 3SE7A 3AI1A 2QE6A 1AUVA 2VQEB 3W34A 4NYIQ 1E9FA 3IO3A 2ECPA 4HB3A 2PZFA 2Y4NA 1AKNA 5IC6A 3SZ3A 3THYB 1KMMA 4C29A 4OB8A 4C4AA 5FI3A 4JYCA 3NOVA 1K4KA 2P2NA 4KWEA 1Z5WA 2K6GA 4E88A 1N1MA 3QW4B 1D2NA 4JJ4A 3WS7A 4ESEA 1RKVA 3L7IA 1QLWA 2NZ8A 4QYTA 2A92A 4OKSA 2ZI4A 5DP1A 1A2BA 1Y8QB 5ALWA 5D51S 3TZLA 4BB0A 3HB5X 2P9YA 4ZKEA 2QG4A 4M99A 3SYTA 4INPA 5HXAA 3WSVA 5JRZA 1V7QA 2UUBB 4CF3A 1M3SA 3GCZA 3QVGA 4YWHA 3ZKWA 3GY0A 3ILSA 2EYUA 2XNJA 1E9SA 1VKJA 1YAHA 5JMTA 1GY8A 4MV8A 5T5QA 3SBXA 3WP0A 1GCGA 1W47A 1YJQA 3PI6A 5KUTA 3INGA 3SC4A 4R01A 1JHQA 5K8LA 1DRUA 2ZAOA 3WTBA 2FSVC 3A9CA 5KQGA 1NONA 2LWIA 3DEFA 1XVLA 3ZC3A 2YJ4A 3AU9A 1KC1A 4LRXA 3O95A 5JT1A 4NOMA 3PCRB 4X62B 5DM70 1OIXA 2FFAA 5FFMA 3H84A 3QEMB 4X63A 2GBFA 1QRDA 2NZJA 1OPXA 2FQXA 1JLRA 3ENZA 3SK0A 2AFHA 1O3YA 2FEMA 4A1OA 3PDIA 4HAIA 4HD8A 3RV3A 4EHJA 4IDNA 4DUYB 4RTKA 4UW9A 4YBZA 4IZHA 4NOJA 3ZVRA 5IH7A 1E0KA 4M0FA 2C5FA 4LDQA 2H7YA 2HY7A 1C1DB 1BMTA 1CU1A 1E6KA 1FE8A 2KW5A 4E1BA 4YVFA 1GVNB 2QTRA 4CF5A 2RGDA 1IZ7A 3ONWA 3I8XA 2J6IA 2ZIGA 4I8IA 3TAUA 1N34B 2OL4A 3HCCA 4QUAA 2H5IA 1KK2A 1JU3A 1QGED 2P40A 2P78A 1DJOA 1RPTA 3Q5EA 1VG9B 4KODA 1NBOA 1UM9B 4ARSA 5GTDA 4R1MA 1QHSA 1Y4DE 4TWBA 3AW9A 2FW9A 3ZGXA 2FKAA 1RDFA 2QN6A 4YRKA 3H8WA 2GCOA 3EUAA 3PPIA 4PZ0A 5C8YF 4C14A 3Q6MA 4TWIA 4CKXA 1E4YA 3CZ9A 3BL5A 4LJLA 1D2EA 2DKOA 3GPBA 3MQ4A 3P9CA 4MR9A 1YQQA 4UMEA 3ZH2A 1U0GA 1NFRA 1HI9A 2I8AA 1V48A 1PR2A 2FN3A 2RKOA 4KE6A 2DBVO 3OU2A 1UDXA 3EISA 2WYVA 5HF9A 3FLBA 3GRAA 2PT5A 4N39A 2H4ZA 5KYUB 1PU2A 1V4VA 4OHBA 3WFIA 4BGDA 2Y1CA 5LP6B 1MBZA 4F5YA 4EJMA 4DRYA 1AK2A 1CY4A 2XBMA 1T5TA 5JVDF 1GUZA 1SNYA 4CI0B 1PFUA 3FTPA 5IDYA 5KYXB 4GAEA 5L3SB 1Q7EA 3GAFA 1FTSA 4I14A 3T1VA 1G20E 2GM5A 4D4LA 1YZLA 4EUSA 5AH0A 1MPTA 5A62A 3MCUA 1FBNA 2HLNA 3LLVA 2PA0A 3L5OA 3UJPA 4DJDC 1JEQA 1XRQA 3WQSB 4EHNA 1GPKA 1QGYA 4C6RA 1GA6A 5KQPA 1PL8A 4U2FA 2I34A 5JQWA 1P2UA 3L77A 3K6SA 3PC8A 4KR3A 1G7CA 2IP1A 4US0R 1HLFA 1Y4AE 4CMAA 2YJGA 4DABA 4D96A 5E2BA 3ZQ6A 3SR0A 2ECKA 2Z04A 2EHJA 4KYVA 1DAEA 4RWEA 3TIVA 1KH2A 1LPSA 2CLEB 3P0FA 3DTVD 4L6CA 4R7TA 5DM4A 5ECYA 3EEIA 4IDDA 3UMSA 4W82A 3KCNA 3JVDA 1QS0A 3C8MA 3D0RA 3BGIA 3FSEA 4Z8YA 2WUDA 3TXYA 4PGAA 3MCZA 1XTRA 4MDFA 4OXXA 3JWHA 5ER9A 13PKA 2VVTA 2ZVJA 3DBRA 1T3SA 3ESYA 2FWNA 5JISA 5JAPA 4WFJA 3LUKA 1GFZA 1UWLA 3KPUA 1J8FA 5TPZA 4N47A 4EZIA 3UTDA 3J81k 2VTKA 4WFIA 1VC2A 1WXEA 2JJMA 2XYQA 1SXQA 3RRZA 3I6BA 1VHLA 3LA8A 5C4IA 1B4DA 2LKDA 3BB1A 2EU8A 4L5CA 2HRBA 2HXGA 5CK5A 1OU0A 3REOA 4BLRA 3AJRA 2FOXA 4I55B 4IIJB 1Q1NA 2GD6A 4CUZA 1VL8A 3MAJA 4UMFA 1OV4A 3CPSA 1IBMB 4H3HB 5BQXA 2EBHX 2FZ4A 1XN4A 3GPLA 2WHYA 1XROA 3VH2A 2SKDA 4BU0A 5I4IA 1Q2XA 4CMCA 3ZKAA 2OT3B 4BUJA 4F46A 1P6XA 5DBFA 3ACCA 1AKTA 2HUNA 2P0YA 1BVUA 3B9BA 3HCBA 4MICA 4F0JA 2P4EA 1KAGA 4GP6A 1B2RA 2QRVB 4OVKA 4PIMA 1GNVA 4P22A 4DLTA 1RWXA 2FW0A 4GXRA 2WM8A 5AHXA 2A9VA 4F3KA 4ZYVA 3LY8A 2F00A 3MTBA 3R3SA 4RXUA 1EVKA 2JI9A 2LNDA 3GXBA 4IS2A 5KX5A 3GLGA 3I01M 1GEEA 4KG7A 5BN3B 4DM7A 5LIPA 1TK2A 3L8FA 1X7DA 1K06A 4HGRA 5KI6A 2FMTA 2QV0A 2Y0BA 1XQ1A 3LXRA 2I33A 4IRMA 5FKJA 1EGHA 2IWHA 1RM5A 1D04A 2GPTA 2Z56A 2IHTA 3OPYB 4M7RA 1K9VF 4NHEA 4HNQA 5KQRA 2B94A 2R66A 3KR9A 1XEXA 3BM5A 4NBWA 5CX1A 1PZNA 3RKRA 3VR6H 4PHTA 4OX9Y 1P19A 4GKJB 4YAIA 1OD6A 2VP3A 3HL0A 4GVXA 1RRGA 4FYIA 2QU7A 5E9WA 4BNYA 2HD4A 3IE1A 1DT5A 1Y8AA 4QPZA 1GNQA 1XLVA 2GKSA 4V39A 5CBPA 1VCNA 4EPXA 1Y7HA 2HA0A 2QVYX 2DE0X 5AYVA 3R9IA 3ECAA 3WQHA 5KSOA 3QY0A 2CXTA 4K9KA 3RSQA 5JW6A 1RM0A 5F5LA 4NP6A 4FFMA 5TX7A 3OO0A 3KQWA 3QUCA 4B09A 3VH1A 4TTAA 2PFGA 2GO7A 1U0OC 1DAOA 1GFSA 2GRJA 4JKYA 5M3BA 5BPHA 4G8DA 3Q72A 5ECWA 4EFNA 1GXSB 3G8DA 4CN8A 4QBIA 2QYTA 1EWKA 3D64A 1AB5A 1BDJA 1D4AA 3FF1A 1Z0IA 4UQOA 1G55A 2QDKA 4D4KA 3TOSA 5ALSA 4BHTA 3QA3E 5C7YA 1V16A 2BGKA 3GNSA 1CUFA 4HUQA 4AL4A 2GZMA 2ID4A 2V5AA 1SG6A 5KYTA 2G4CA 3VZRA 1O9GA 5KEIA 1TJPB 1PWXA 3G2KA 3WA6A 4R2XA 1IOVA 1H1LA 2QTAA 4GOND 4MIEA 3EXAA 3U4GA 1NT4A 3OE1A 3WGTA 1MV8A 2AYYA 2AEEA 3RUCA 2O52A 4Q03A 3SXUB 1CK4A 3PQEA 2IUYA 3M2TA 4UVGA 2F4VB 3OZXA 4GLFA 6GPBA 4NJMA 3GZ4A 3OLXA 4BMDA 3USZA 4M3NA 1Z25A 3DHEA 4D80A 4MLPA 3FCXA 3C4QA 5CTJA 3TIXB 2QYHA 2X5NA 1C2YA 2AQ8A 3QLUA 3MXOA 1RTTA 3KQKA 2HFKA 1CULC 3Q3GE 1N5KA 1Z74A 4HLQB 4BNHA 2YYSA 3A9VA 1J6UA 3G8CA 1W59A 4I2NA 4MPPA 1S8AA 1QHGA 4QQKA 4RACA 1DELA 2FFQA 3D59A 2AYXA 1ZIXA 3SKXA 4F2DA 4COKA 3CEMA 3RSHA 1P3JA 4AM8A 3DUWA 2ZUTA 4QYMA 2YFYA 4B80A 4CL2A 3AB8A 4UU0A 2VPTA 1NSYA 1RM4A 3KKOA 3QOWA 2GR9A 3CLUD 4KRXA 2QRGA 3FZNA 2MYUA 4YV1A 3CVXA 5HW0A 5BSVA 2FQYA 3BIJA 4U39A 2UUCB 5IFKA 1Z5NA 3S99A 1SGWA 3ICWA 3OO1A 3EVTA 1Y8CA 3ED1A 3MRXA 1T5OA 3SFTA 2AMYA 1CIPA 4JGIA 3LX6A 4B7XA 2APJA 5AJYA 1X8LA 3FWKA 1E1RA 3IEXA 1SKYB 4K6CA 5GGXA 4ENRA 1I5OA 2H48A 1A5SB 4FQ5A 5JJBA 3PJFA 4Q1DA 4P53A 4FCTA 3H4VA 3B9QA 4EKEA 1F60A 2ADFA 3H2JA 1NR5A 5JV5A 4FHGA 5J4YA 2VTEA 3TZBA 2CKMA 3RC3A 4YAOA 4BGEA 5FUMA 3E7FA 3JALB 4O2LA 3C3MA 3PQ2A 1X92A 5A71A 2WINI 3H5VA 5HILA 3M82A 3GJXC 5PGMA 2XJ4A 3KHUA 4OFXA 5A4KA 2LIVA 2WVJA 3LF1A 4I50F 4Z4GA 2PR7A 5LP6C 1Z6PA 3AT1A 2V45A 3G17A 2UAGA 3AEUB 4PS1A 4QG7A 3H3XA 4S24A 4RKYA 3RRMA 1BYIA 2BHRA 2C99A 1RKQA 2YZ7A 4XX0B 2V7XA 1OY1A 5AW8A 2ZWVA 1K7YA 3W79A 4R84A 1UBOS 1MRSA 4JP8A 3LPMA 1G5HA 3ND5A 2MSNA 4FYJA 4LVCA 1RAEA 4G3XA 1XLTC 3L4SO 3O47A 2EKQA 2BE9A 3OU7A 2PV7A 4LBZA 3IB6A 1ESDA 4LHWA 4YBRA 5EKTA 3I04A 1GYPA 2DBQA 4GQBA 4JLVA 4AD8A 4DC1A 1RQPA 3QU7A 4FFOA 2I7DA 4BCDA 2NU7A 2JK0A 1DP4A 4ER3A 4TLBA 1JZTA 5SZHB 1MB0A 2GF2A 2FUG6 3DZIA 4UM8B 4D3DA 1U2TA 4KPUA 1UH5A 5LYJA 3T7SA 1CJUC 2YZNA 3FNRA 3R3UA 4NS1A 1H1LB 4OQXA 2BGMA 4Z0PA 2O2JA 3OJ0A 1BCRB 4B47A 1TF7A 5C80A 4IH4A 1M34B 4YUVA 3V1LA 3B3FA 4FOPA 4NMWA 4CTNA 4BV8A 1MHTA 3OQVA 3GT0A 4CHGA 2WJAA 5CM8B 3UHFA 4JL6A 4UTOA 2CV0A 4QOFA 1FRQA 2JGEA 2O0KA 3X3HA 3QELA 4RF5A 5AJXA 1J56A 1JEOA 1SCQA 2R8BA 1K5PA 1KZ7B 5SV2A 4CM4A 4NICA 4IWXA 1SPXA 1QQ7A 4FMDF 2GTHA 1GT6A 1GKLA 2K2WA 4EL0A 4YONB 4U7FA 2BSXA 5IKEA 4JXKA 4DFDA 4ZGGA 3G8AA 1U2SA 3RS7A 3H1GA 2PSDA 1PDVA 1XPRA 2Y68A 3G2NA 1HT3A 3RS4A 2LD4A 1Z63A 2QR2A 3TSWA 4AF8A 1E4VA 5ALKA 4H08A 3TH5A 2ATXA 2O8DA 1XJ0A 3FHLA 4MW0A 4HT3B 1BVHA 3WAKA 1GZVA 1OI3A 3M9WA 2P5UA 4DLYA 5IVHA 3HVUA 1GKUB 1LPMA 3Q9NA 5EHNA 1ZL0A 2A4MA 4L7QA 2BKUA 1M1YE 1KDYA 3IMCA 5FL7A 1Q1GA 3ZQ4A 3H9UA 4DXDA 3K09C 2MYTA 3F49S 1QH1A 5BWOA 3DCJA 1OWMA 4B8YA 1I3LA 2DTDA 3GUCA 4UBNA 4URYR 1NIPA 1EWTA 4YMGA 1ULZA 4M2LA 5L40A 3AO0B 3ZCPA 2VXCA 1BQEA 3VTKA 1DOZA 5C7IO 2VTBA 2X4DA 4GYYA 4XB6B 1C81A 1LRJA 3TJRA 2GA8A 4JASB 1MLDA 4D8UA 2AW5A 5DO9A 3HI4A 4LXUA 2HNAA 3C3JA 5IW8A 3PUWA 2WUFA 4M38A 3TTSA 2YY5A 4MV5A 2GYWA 4F04A 1F7VA 2DOKA 2EZ8A 5SY4A 2PD6A 4CIDA 1WHSA 1E7MA 3F6EX 1HEYA 1P39A 4Q4AA 3DZBA 4X6LA 5BSTA 3VVBA 3KKEA 2NU8B 4II7A 4X41A 3D8NA 5A1TA 3WJ2A 3RAFC 3FYCA 3GEIA 3PQ4A 3LY7A 1DUVG 3P9XA 4I2VA 5LQJA 5F3WB 4FEAA 1W4AA 3WWPA 1H2XA 5HVNA 1CEQA 1EIZA 4E30A 1ORDA 2ZUSA 3ZZUA 4CIYA 1AJEA 2WWXA 4OXYA 2O5VA 4WVFA 2X5XA 2CWDA 3MTEA 2CYCA 3IP6A 4G5FA 5JYEA 1EJBA 2V55B 3GPDG 3HDJA 4XPZA 5AUPB 1O95C 1M76A 3GO4A 3QU5A 2H5EA 2H65A 3LUFA 3E3LA 5LP1A 5BRNA 4Z7JA 1XTUA 2OESA 5JD4A 2P9TA 3CHYA 4GLLA 4DUGD 5C9ZA 1TRHA 3VM6A 1SCDA 3CA8A 3AZPA 4RCZA 3ZDZB 4CKCA 4EEKA 1X9HA 1DWQA 1E7SA 4C88A 1U98A 2YRWA 3WL7A 4LRTB 3N2LA 4QREA 1VYTA 2PL3A 2W70A 2NO9A 2O9JA 3KL2A 5BWLA 3UK6A 3UMBA 5EC8A 3O75A 3A10A 3IMGA 1N2BA 4X92A 4AS1A 3TZKA 2P3QA 3QFHA 1VQ1A 1NW4A 1I4TD 2I78A 2PSFA 3EIEA 3BG5A 4JHXA 3K5PA 3AQIA 2J3KA 1T13A 4YP0A 4D42A 2NV6A 2RGBA 3CX6A 2IIVA 4IDPA 4WNCA 4ESVA 5B36A 1WPXA 3W9BA 2UV8A 2FI1A 4XLLA 4AKIA 4BVHA 4Y9TA 3MT0A 3FAZA 5AVKA 2IXDA 4KFCA 4X7RA 4K6HA 3DS8A 3TD2A 4MTLA 2W4IA 4MWDA 2A67A 4P31A 3TD6A 4E2YA 1Z73A 3B5EA 1OYOA 4UBKA 3TB6A 4MCHA 3OP1A 4MVJH 1JYSA 3I62A 1W4CA 1UINA 3HKDB 2TMDA 4KH0A 4ZC1A 4JLBA 1Q16A 2UYQA 3TQCA 3RUAA 1TD1A 2PWPA 3CW9A 3LRTA 4ZWNA 3UAZA 2NTNA 1KDTA 1Y89A 4QQNA 3IVMA 4B3BA 4DZZA 4DSAA 1UPTA 3LYAA 4GMHA 4MLCA 2WFAA 1V5EA 2VQDA 3GRZA 4TL7A 3UEOA 1YBMA 2ASEA 1L4BA 2W2LA 3Q5DA 5ARBA 4AKGA 3H1TA 4KV9A 5B7QA 1FXSA 3A05A 1Z34A 4C0HA 1KVSA 4Q16A 4E5KA 4KK3A 5TV2A 2JIQA 1Y80A 2P9FA 3IAFA 4ZYXA 1Y4SA 2HJVA 5ISMA 4DDMA 2BFNA 4M1EA 4WFKA 1LZLA 4PTYA 1R3UA 4WZBA 1PR9A 3HJFA 2R5NA 4DARA 5INTA 1ATIA 4WNAA 3T7CA 1IJFA 4LGCA 1XQXA 2GB4A 3ZU2A 5EXPA 1XZKA 1UR5A 3EC2A 1ZN8A 3QA9A 1I2AA 4ZQGA 2COKA 1G0NA 3HYNA 4MVJM 4LQDA 4TVBA 3O2NA 1TVCA 3WX0A 2XYHA 4BGUA 3MTGA 4GI3A 2VOEA 1W93A 1KRHA 1JSLA 2CL7X 2XQVA 1N2CE 2FDXA 1CRQA 4O2RA 1VL5A 2X23A 2JGDA 4HWRA 4LJSA 1P8AA 1NJ8A 2IYFA 5FLYA 1DIRA 2G0NA 3JWGA 4PZAA 2O7SA 3PX3A 4Q9AA 4W5WA 1CDEA 4ZEXA 3ZZNA 2JGAA 1RIFA 2C3MA 4PGFA 3FBGA 2XCRB 1T3HA 2VNKA 3GFPA 4TSKA 3W7AA 4KIJA 4C87A 2O20A 3D7RA 3E3AA 4CXMA 1LTQA 2X19A 5G1OA 5EJ6A 4Y2XA 4JIGA 1Q7BA 4TKMA 1X77A 3WGOA 2OK8A 5JS6A 1JQEA 4KRGA 4DV4B 4C5AA 1WB4A 4RVNA 3WYFA 1KI6B 1VE3A 4RWZA 2J7PA 3DWIA 3KLMX 3DE7X 3R0XA 4S1NA 4UDNA 4X1YA 2GPSA 3LNTA 1YUMA 3TLXA 4B6EA 4Y2HA 4GKBA 3A1CA 2IUUA 2GK4A 3C6KA 3PJRA 3OTIA 4OFBA 4Q19A 3NKFA 4X7BA 1L5HA 3OE7A 1BXGB 2Q99A 1XJQA 4G5HA 1WBBA 3R09A 4R9UC 2GN8A 2V03A 4RIHA 3KBOA 3GRKA 2HMAA 1RCTE 5FBZA 4YB8A 2C9OA 3UK0A 1PR0A 2XEXA 4IUBS 4W7IA 3DMGA 1NBIA 4W8OA 1O4WA 3F2VA 5FJJA 4UQPA 3TECE 3PJDA 2JL1A 1R5OA 3F96A 3L43A 4P93A 5E6UA 1ECBA 4DANA 1NMYA 3C8ZA 5IVKA 4OK3A 3H9CA 5BYKA 1RYMA 3OJXA 3NXKA 2M6SA 1F2TB 2OC4A 5EXDA 3UJ8A 3DPIA 1Q57A 3UKOA 2I8LA 3P0IA 3EZ2A 4ZT2A 3H87A 4BASA 1QX4A 3KHTA 4G8CA 3WIVA 4LG1A 1S4MA 2WYHA 1HE8B 1LK5A 3AKEA 3FUCA 3ZLVA 1JGTA 1OQAA 4UHEA 5KS2A 4HWGA 4O4LF 5M7EA 4Y2JA 4QJBA 2W58A 3HXPA 4LZLA 4FNGA 4XQ9A 5JD6A 2JLYA 7MHTA 1WUJS 2ABWA 2QM7A 3LBNA 3U1BA 4EQ6B 5J2UA 3TXAA 1CD5A 3MJEA 4IQ0A 3A9WA 2KPOA 1NVWQ 5K0NA 3NUGA 4PLGA 5A4MS 3IMFA 4W5NA 3F8WA 4CKWB 4M87A 4PXSA 1WXQA 3VR5D 2FLVA 2VC2B 5AK4A 3KAPA 3SE0A 1PNVA 4MAFA 4FDLA 4J94A 2F3TA 4N65A 2RONA 2H1CA 1THTA 2BZGA 3DZ8A 2RAVA 4OXIA 1B6SA 4Y0VA 5B53A 4CIBA 1L4KA 1YS1X 5G4KB 5HE9A 4HLCA 1KEEB 2JLVA 4IMPA 2DR2A 4Q66C 1TW3A 5CEJA 1I1QB 5HMLA 3PC6A 2FVYA 2WWTA 1A9XA 3UF0A 5EAIA 3QVVA 5CLHA 3CLTC 1FOEB 4BN4A 5D85A 2QNRA 3GGCA 4PXAA 1V8BA 3LL7A 5DTMA 2MSWA 3TRIA 2W2TA 4OYYA 3GFBA 3CX3A 3HBMA 3GEDA 3IX7A 1CUJA 4BPRA 1FA9A 2CLLB 4Z4FA 4WOBA 1E6UA 2ZLBA 4ID9A 3GLHE 1F48A 2ILVA 1DIBA 5EEGA 2WFLB 4PPGA 2DTEA 3L79A 3MAAC 1OILA 5I8ZA 4PWYA 1ZMBA 3IC5A 2WIDA 3F71A 1YE3A 2BEUB 2WC1A 3GAZA 3CUTA 1LWOA 4BX3A 3EVBA 4Z0NA 3QKSB 2BKVA 2ZIEA 1QGUA 2QIPA 1VI6A 4G24A 1VTKA 4QZVA 4ZRNA 1YJ5A 4JDUA 4E7PA 1FUKA 1L4MA 2H9YA 1TZ2A 1MGOA 3I52A 1ZLXA 2XYRA 3RRXA 1HA3A 3DDHA 1OFTA 2D2FA 4UD6A 4ER0A 1E0SA 4JP5A 3PVZA 3I23A 4E4RA 3DE6X 3QVJA 3KEFA 1NTRA 4JI5B 3DOOA 4DE5A 3HEAA 3I83A 5JY1A 5EGSA 3VX3A 1I7DA 1P9NA 1K2VN 4IAOA 3FTQA 3GR6A 1QHNA 3N39C 4A15A 4P81A 2AG5A 1NBMD 4XE5A 3L7DA 4CQLB 2H4FA 5EIHA 2HEIA 2FZVA 4MMZB 4RH1A 4FW9A 3S1LA 3I2KA 1KYXA 4XSGA 1N2OA 1AHIA 2P7IA 3CVVA 1F2UB 1FDWA 1UXGA 4DREA 1DQZA 1I1NA 3GLKA 2ETXA 4EPWA 4HP8A 4JQCA 4PQGA 3DP9A 1KDRA 4XXHA 1Z8HA 3R7LA 1XZBA 5TQ2B 4PNEA 5IXJA 1GTZA 1X9IA 2VYCA 4R8MA 4K9MA 5IULC 5CDTA 5KNCH 3HDVA 3QKTA 4Q3AA 4R69A 3D4IA 1EA5A 2YZGA 1H94A 2E1PA 1O0BA 4XKJA 3GT7A 1EX7A 1NUUA 4CF7A 1PQYA 4MUGA 4XR4A 3K35A 1QZXA 5BQOA 3DZDA 4DXHA 2AG1A 2BDEA 4KI0A 3W5CA 1TLTA 3C5HA 2VDQB 3MN1A 5ADWA 2QF7A 5CP8A 4IFTA 4P3OA 5BR1A 4RSHA 1E1QD 3W6ZA 1SULA 3F7NA 5TGDA 3W9UA 3WLPA 1XLWA 3ETCA 1DXHA 1CJKC 1GL7A 3S28A 3WK4A 4C78A 4O2AA 2FUG1 5C7OO 1UMKA 4U7WA 3NTLA 1E9VA 1GZ5A 4OQQA 4P6VF 3C4JA 3LKZA 1T5HX 5JSKA 3VOBA 2ZULA 1B0AA 2IPOA 1L5FA 3JW8A 3E8SA 4UD2A 5ARDA 4EATA 2D7CA 2QD3A 3HGMA 4M9ZA 3N8DA 4DIKA 2B6NA 4QUIA 5EJ8A 5KQMA 4DMFA 3LSYA 4JVOA 1VBFA 3I30X 4AJ1A 3UV3A 3FYTA 1W5FA 3ER9A 4MVYA 3KAKA 2AW3A 1A7AA 4JA2A 3M4ZA 4CG1A 2OGWA 1XXHB 3OOSA 4YJ3F 2HT6A 6ABPA 3P9IA 5GJBA 3S70A 4YECA 1PJCA 1E1YA 4KSBA 4RA9B 1L5GB 5JMOA 5DYNA 4KTVE 3BD6A 2YICA 4YHBA 5JO9A 2BKEA 2G9ZA 2EKLA 1UPBA 1J33A 2PNJA 5F23A 2IHUA 4BFLA 1QH8B 5AI8A 4KB5A 4YASA 4G0WA 4BNNA 1ECLA 1V8FA 2HJGA 3O2SB 1SXPA 3ETHA 3I9V6 3EDMA 1TU4A 1QU2A 1XQ9A 2VHEA 5BWMA 4ZOCA 2UZ1A 2F3PA 4MNTA 3WYEA 5HSGA 4FN4A 2V5UA 3T3OA 5CEFA 3OUTA 4HGYA 3V6MA 3WNBA 3NR2A 5COQA 4EA8A 1FX0B 3GUYA 4IZIA 2FR1A 4GWGA 5TB5A 3G68A 2X0IA 3WKCA 5KYWA 3GWGA 4KQCA 4N7MA 1M7GA 1Q1BA 3S6JA 1T15A 3NDRA 3G1UA 4F5DA 5IDQA 3N0WA 2XWPA 4I9FA 1TFRA 4MB6A 5E3HA 2ZRNA 3D81A 3GEBA 2GJKA 3KEQA 3UC5A 4GP9A 4E03A 1FW6A 1AUQA 1QORA 3EDOA 3LV8A 4HVCA 3NANA 3I8OA 4OQNA 3FRJA 4LF5B 4EF5A 2C0QA 1P4HA 3WB1A 2WSSA 1A4RA 2QNBA 3VSCA 3GG2A 4HGPA 4HX9A 2Q8NA 3NGXA 4R1LA 4E3ZA 2IWRA 4NV1A 3Q7SA 2AGVA 1QPBA 2IXTA 2ZI3A 2WKWA 1JFLA 1NW7A 5H82A 2JBAB 2C4VA 2P2ZA 1XZHA 2J1LA 2IYNA 2X8LA 2C59A 1DRKA 1TIPA 4HNGA 3IIMA 1ZONA 2ACKA 4OAPA 4TWJA 5CT4A 4B82A 1N1DA 2POQX 1Q0ZA 1U7OA 4DJJA 4I1PA 5B1YA 2IYYA 2H0QA 4UXHA 4Z9YA 4DCMA 4JJIA 4HXEB 2EP7A 3U7GA 1JPVA 1XCPA 2YV5A 5TEVA 3RHTA 2C9MA 3ONVA 2AE2A 4X85A 3TOVA 2WWHA 1CQWA 1CE8A 5I7WA 3KNZA 4CM3A 1M1NA 4URWR 1X39A 1TLLA 3HLKA 3TAHA 4LJYA 3GHHA 1FVOA 1H05A 1LDNA 3AUSA 4QHTA 2AN9A 1JBEA 2DPYA 1UDWA 3U49A 3RYCA 4QNMA 1GRNA 4DVGA 2C5HA 3P2YA 2IDMA 3ZI4A 4AKSA 2ZROA 4EG1A 2JFYA 1YQDA 2PMDA 2JJYA 1Z88A 3BORA 4ZJZA 2HWWA 4FSHA 4QARA 4CM8B 1IN8A 4PGHA 4B4WA 1ODJA 2D5AA 2ZQ5A 5FTWA 2HKIA 1GPAA 3ABOB 3KWLA 4B34A 2AKEA 5U9CA 3RS0A 1WLYA 2HCBA 4HADA 4P9NA 1CS0B 4QXOA 4KVFA 4YQYA 4BE4A 5EGNA 3IFSA 4X1KB 3B5JA 3ZD8A 5A05A 3EXHA 2XUOA 1R0KA 3BERA 4TV8B 1RHRA 1S2IA 3KVVA 3SS7X 3MS7A 3AUFA 4NMMA 3SN6A 3TMAA 2VZ8A 4TMFA 4NOLA 4EVSA 1BHQ1 4N5IX 3FPHA 2I9KA 2QUZA 1EX1A 1UQRA 5FWAA 4QTYA 4DR6B 4DV0B 1C30B 1UMBB 1T3GA 2QL9A 1B0ZA 4O4HA 4TUYB 4ZEVA 1VRCA 2DBYA 2JFNA 3E5MA 4TYMA 5JS7A 3JQBC 3U7QB 4DNOA 4PO3X 4OLJA 1ZVJA 3T5CA 2A5LA 3ORYA 4YJDA 2J8ZA 2XE4A 3A04A 3FGNA 1KXZA 3R0IA 2A2ZA 1U2GC 3P2KA 2Q7DA 4QFBA 5B3LA 2ZJZA 1Z18A 4R1PA 1CIVA 2ZUWA 3S2UA 3WOHA 2WKQA 3MGBA 3ZX5A 5A5VA 3VHLB 3O2QB 4LDJA 3DOCA 1FY2A 2DFDA 2B30A 2GETA 4FSXA 2XMZA 4RV4A 3RIEA 4F3YA 2DHDA 3BWDD 3F3KA 3OMXA 3M5PA 2AG8A 2PLWA 2A7QA 2BR5A 2JAWA 5KZMB 1P44A 1SCAA 1DUSA 4U63A 1P5ZB 3ANYB 1LNQA 2VHZA 3EIQA 4R5HA 4BTVA 4EY4A 1WX1A 5K0ZA 1XBTA 3LT0A 2VH1A 4AK9A 4AZ3B 1TTQB 2O0LA 2P8SA 4DPKA 1H4SA 3G2PA 4HF7A 3ROFA 3NHFA 3AM5A 3IQDB 4D0RA 1XRRA 3W6OA 4E2WA 3CU5A 1B93A 4LRSB 4NV0A 4RGQA 3LSTA 2H1OA 2QZ4A 1RZVA 3CV3A 1EJ0A 3IODA 3NATA 2CV2A 4CLOB 1ZUHA 4IRUB 5D1HA 2HHLA 4BNZA 4K1LA 4RFLA 3K6JA 5A3QA 2J6CA 3H17A 4UC0A 1YS2X 3WY9A 2EVWX 4DIDA 5I3ZA 2Y1EA 3B1JA 4PSUA 4Z7OB 4HDRA 2FLWA 5IYZA 1JXQA 5D1NA 4P1ZA 5IBCA 4LF9B 2JJQA 3PX2A 2BPOA 1V3VA 2X7JA 4NENB 2XAAA 9LDBA 2LPMA 4FKZA 4HCJA 4IDHA 3QPDA 2IOQA 4UFOA 1YRAA 4XFKA 4DQLA 4F91B 5LOVB 3CT4A 4GQAA 3DA8A 1WCIB 2BEWA 2JLSA 4J07A 1HYGA 4KO2S 3EOBI 4EJ0A 5JBQA 3TGLA 5ILQA 2CC2A 4X0EA 5G3ZA 5CB4B 3I6IA 2O7VA 4DL9A 1UXIA 5LZ9A 3EUEA 3U7IA 2VXOA 1YU9A 2I6TA 3UGJA 1JYEA 1BDMA 1E96A 1MOQA 4UHFA 3UFXB 5JJIA 2EJTA 2JH9A 2DBZA 2H0RA 1J20A 4MR7B 2M6RA 1W73A 5BR7A 1ZH6A 2J5KA 1PJQA 2Y4OA 3EZYA 2HF9A 5EP4A 4BN0A 2BGGA 4PYNA 1Q1ZA 3QEJA 4XQGA 1TLFA 2VDMB 3DOIA 5MDHA 1QR6A 4XWTA 3T7DA 2AYZA 1SHKA 4M8SA 1R88A 1JA1A 2VLIA 4M86A 1Q6YA 1SK8A 1U99A 2CXXA 2P11A 1DAHA 2G5PA 4KX3A 5F78A 1JPJA 3SYRA 3TS1A 1XTTA 2P6PA 1G6HA 3E9CA 1QRUA 1H69A 4JLDA 3ICEA 2Y05A 3I9LA 1UQUA 4I50A 1T0PA 3K70B 2BEVA 4RE6A 4AY5A 1E3TA 4J0EA 2F1IA 2JFBA 3MJCA 3ZHZA 4QYWA 4XFDA 3VR1A 4TUYA 5JIBA 1Z4QA 2F59A 3P9PA 1MQ9A 4EY7A 1OB2A 5JFTA 1QVRA 5HJ5A 1SRRA 4GI7A 4DTCA 5KTYA 1NVUQ 4JCOA 3SM9A 2QG6A 1W2GA 4I4NA 4NXNB 1XTBA 4GZLA 3F8TA 1UK6A 2G72A 2QKYA 5E2AA 1JFVA 4KTTE 4CR7A 3WNQA 3UAVA 5IU6A 1TM2A 3F4BA 1Z2AA 3JALA 1FDVA 1Y3BE 2QN1A 3LKVA 3MS2A 1JG6A 3NT2A 4WLOA 3RAEC 3QMMA 2PUGA 3FCYA 3KV3O 1P7PA 4UTRA 3DPSA 1EA7A 2CDCA 4Z8XA 2FY8A 4IS3A 3GN2A 2EDAA 2WM3A 2ZB4A 6Q21A 1UDCA 2OECA 4W9NC 4CKBA 1M5TA 1VG1A 4ZN6A 3K31A 4QXMA 1W36C 1QO0A 2ZIFA 3K0EA 3TPFA 1K9SA 3V5NA 5I01A 1SC6A 3C3CA 1K68A 2IKQA 1COWA 1KS9A 3EY9A 3OJCA 4EA6A 1HQYE 1PWZA 1G20B 5IJ0A 5CFLA 4A91A 5FFNA 4BVLA 2RE8A 1IH8A 3N2KA 2ZITA 5FWXA 3P9KA 4L8LA 3LLSA 1S02A 1SR8A 3QX7A 4I1SA 5CNIA 1XCOA 4FINA 3MGKA 4JUIA 4XIJA 4L3WA 5ALPA 3ILVA 5JDIA 2ZPTX 5MFZA 1MB4A 5CVJA 4IF6A 4IIGA 3F5MA 1FJHA 4L5BA 3DBHA 4Y7CA 2CB0A 2WSMA 1AUOA 4PONA 3WIOA 4EX7A 5K0BA 4YUZA 1PJ3A 3R7DA 3GC6A 4TL9A 4F4DA 2XXAB 4CWAA 1FTWA 3MYYA 3JRNA 1N2IA 1U9JA 4DR1B 1JQLB 3AHGA 3PSAA 2W6JD 4C04A 5KKAA 1Q20A 4JROA 3S5JA 1QVAA 4KYIB 1Q91A 4CGYA 1U3WA 2VJBA 1OLSA 1P5FA 4RFSA 4NJMB 1ZOOA 2FUNB 4CEJA 5DNUA 4TGLA 1YS6A 2JLAA 3HCRA 2K2QB 3NEJA 1LB1B 4LOJA 1QMPA 1T24A 1VXRA 1WBDA 2QR5A 2G09A 3SEZA 5T3UA 4D4GA 3FFBA 4B73A 1GITA 4JXZA 4PC6A 4IIUA 3DD5A 3EZ9A 2E6KA 5EJ4A 4YLEA 3ET5A 4RQUA 3MC1A 3OKPA 4MXDA 4W8HA 1EFCA 2CL5A 4ZT3A 2PT9A 3TRKA 1NMXA 3K15A 4X66B 3PQCA 2FZCA 2ZYIA 4C06A 1L7NA 1NVTA 1OAAA 2VNAA 2PVSA 1AS2A 5AKXA 2QTVA 4DNFA 1WG8A 3UUGA 2G1AA 2IZZA 1CUBA 3OCCA 4NZYA 4O33A 4MYCA 2GD0A 4D44A 5IJAA 2NVWA 1O0SA 4ENVA 4EVRA 2DAPA 2PKXA 4OJMX 2YNMC 1BOOA 2C97A 1N2SA 4LC9A 3U5TA 4OFZA 1BH6A 5EWMA 4BAUA 4DVJA 3NAZA 5D3QA 1OXTA 1WDLA 3T35A 4C4PA 4P54A 1U2QA 2AFHB 3SHFA 4PYRA 1GGJA 3U3RA 1GYRA 3TR5A 3RSCA 4U5XA 3FCAA 5SZKB 421PA 3AK4A 1LDBA 2ZRDA 4NH4A 2J7KA 2P2LA 2ZJYA 3S2YA 1A8UA 2RG1A 2P9EA 2HA7A 2PH1A 3HU1A 2R1UA 2QT9A 5ERXA 1CY2A 2FEOA 1HF3A 5K1ZA 1RFGE 1P33A 1X86B 5DNAA 3RODA 3Q1KA 2Z2YA 3UAYA 1VBNA 1XEAA 1LCIA 2AOUA 2H5LA 1II0A 2PLFA 3PYMA 4M8NE 4FWBA 5IEBA 5JNLA 2NV2B 2QY9A 1J2UA 5REQB 1P7WA 2ERYA 1XQVA 2XUJA 2ZPUA 4ARCA 1M33A 3FUWA 1A3CA 4KXVA 3V32A 1MX1A 1F6BA 2DUWA 5CVEA 3ZUGA 1Y6FA 1E2UA 2LUOA 4UEKA 2NVUA 4BLTA 2B0CA 2CKDA 2N0SA 1JS1X 3F67A 1PE0A 1M6EX 4RIIA 1GGFA 3GLGB 1ZRHA 3BGVA 4BO9A 1B16A 1KAQA 5L4SA 3ZJTA 1O7JA 1E64A 2DFPA 2QY6A 4FC6A 4ENPA 1WD5A 2AOWA 2DXIA 2XBLA 3THXA 4EKDA 2ZYAA 1BGWA 4UVDA 4UBLA 3WK9A 4D41A 4E5PA 3AERB 1TJYA 1CDOA 4IFEA 1P9OA 4YMIA 4URZR 3NWPA 3CNNA 1CIJA 1ECCA 1W85B 1ZSNA 5IMBA 2GAJA 1Q15A 5C3MA 2CCKA 4GYWA 1U0BB 4MLDA 2QYOA 4WZAA 5AVXA 1CEYA 3AUJB 4IG4A 4BS9A 2HUPA 3C48A 5GVSA 2OBBA 2R4TA 5M04A 1FDOA 3OCZA 1NZDA 2PT6A 1HMYA 3SS8A 1OWLA 3SQMA 4FHZA 3EA0A 4Q3LA 4A8TA 3ZW9A 3R41A 4Q7MB 4JBXA 4BKQA 3T1YB 1XD2A 4MUMA 1AXRA 3GFFA 1UJ2A 1XKQA 4MCAA 4RYDA 3RC7A 2YFQA 3GDFA 3DYVA 4A0FA 4BVFA 4MSUA 3A58B 1TU0A 4DM4A 1O0CA 3PHIA 1OFVA 1JMYA 3BMCA 3HNOA 1F8UA 2PSEA 3KLOA 4PLHA 4YT2A 2QMQA 1WETA 5EE5B 2JKZA 4ZZ3A 1EGMB 1FDUA 1MH1A 2BFCA 2GARA 3OZCA 5TMEA 3LMKA 3WRVA 2HB6A 2JANA 1SBZA 2YY6A 3F6PA 1NP7A 4JI2B 3AFOA 1V8OA 2XD4A 3ZCTA 1AMNA 4DCNA 1ZMRA 2F1JA 3I4FA 2QW0X 3DEZA 1YR9A 3KU4A 2EX4A 2YWRA 1N3IA 1VI2A 4IX9A 5TF0A 4DA6A 1JMKC 1Z15A 3HYSA 5B7PA 1MFZA 3DMRA 1A1SA 3LC7O 4LSWA 3ZZTA 2GRUA 4BATA 4XD7A 4D9CA 2H4WA 1F0NA 5ADVA 4RV5A 2DMRA 3W5VA 4CT5A 1WNFA 1E6WA 1D1SA 1ISSA 1L8AA 4KMMA 4WQMA 3B6IA 1PFYA 4C0AC 1PQPA 1VHTA 2W2XA 1RZUA 4KGZA 3IAEA 3RLIA 1LJLA 3BL8A 5BOSB 3RSZA 3QLEA 3BSSA 5FCDA 5CFQA 5LL6P 3W2TA 1OLUB 2YQZA 2DRIA 3NT4A 3TI7A 1PRYA 2HMSA 3KL4A 4BZXA 3AFMA 3BCRA 4LY3A 1TYAE 2CNOA 3ZCXA 5DI3B 2WFZA 2AQKA 4XQEA 3L6UA 2RGWA 1B8NA 1GPYA 1RQXA 2QS9A 2Y9PB 3Q4GA 4YHHB 5JWRA 4ZJPA 4DMKA 5KOJB 1O94A 2VJMB 3GDGA 3QTTA 1J8MF 4H18A 5J1TB 1BCSB 4RESA 4AICA 1ECGA 3A1WA 4QIHA 2O50A 2UKDA 4BRWA 2UYOA 4DT1B 3I04M 4Q9DA 4EBBA 1GLVA 2FFBA 3KU1A 4GNRA 4JMLA 2C9BA 4FEYA 4GF5A 4V1CI 2B3DA 1G3QA 1VE5A 4LOIA 5C4GB 4EP1A 1B3BA 4HXFB 4R8LA 3LPCA 3Q85A 3SNHA 4Q4CA 5JOQA 1EXDA 5EIAA 1IQ0A 3EVEA 3QU2A 4WK2B 2GZDA 4RLSA 3PEVA 3ZEIA 4UZSA 1J00A 4UTPA 4KFSA 3GFQA 2QUJA 2FZKA 3NASA 1TCVA 3ZTYA 1T8UA 5KC9A 1X1EA 3LLMA 2QM3A 1QB8A 3D5TA 3W2IA 1YRLA 1HTWA 5FTJA 4HAYA 5LQKA 3WMXA 4CCSA 2QXUA 4EMUA 1ESEA 4FS3A 5BMVF 2R9VA 3GFOA 2B99A 1YZTA 2FCRA 3RSLA 4WXRA 2C84A 3WL6A 4B3DA 3O91A 1AVTA 2PANA 3DJFA 5L3RA 1H0RA 3ON5A 2QQFA 3BH7A 1R9MA 4EY8A 4AIRA 2Y6UA 4YT4A 1G4AE 2WHEA 1D03A 3FM9A 2GRAA 2Q6TA 2Y9MB 4PC2A 5EKSA 3JQ8B 5AP9A 4E2XA 4QASA 4HKTA 1KWKA 4JJAA 4NY1A 4BQOA 4X8MA 1KK3A 1MOZA 1WZNA 1MX5A 3FMPB 5HIKA 1NV9A 4KO4S 3K2IA 4CKYA 2PO5A 3U3DA 1T4BA 1H65A 3L4BA 2J07A 2VWPA 4XM1A 3KJNA 1U7ZA 2H1RA 1XQ6A 3WWDA 3U4MA 3M4JA 3M1YA 3D3WA 2L17A 3WAGA 3W4JA 1UZUA 1VBKA 2I1LA 1G19A 2IUEA 1G4HA 2QJRA 1DJQA 2V96A 1Q7TA 1P73A 4GLOA 2XB4A 1IM5A 1DBWA 1L5MA 3G2OA 3IALA 2BFPA 1SQGA 4WBNA 3GLIA 1SBQA 3BXXA 3CY6A 2Z8YA 4LECA 1X1QA 4OQDA 1BXRB 1YRHA 2H06A 3EIOA 4EFMA 3K0CA 5C32A 1RPJA 2WHPB 3I92A 3BCSA 3BTUA 4QQ8A 3KOXA 4U5QA 3V42A 3ETEA 1QQ5A 2ODWA 3HACA 5H16A 4HEHA 3ZQKA 3WG9A 3G9QA 1O94D 1FTYA 2V7BA 4M22A 2II6A 1AUXA 5EWJB 5FB3A 3SC2A 1VBMA 3KEOA 3QVXA 1VJ0A 3IAM6 1N0HA 3D4NA 4IG9A 2WAOA 2BFFA 3O73A 3WJ7A 1TQ2A 1NUQA 2XNDA 1TC2A 1J8VA 2QJWA 3DMNA 2VJLA 1P2SA 2ACWA 4DDKA 3DAOA 3NTOA 1CF2O 5D3ZA 4B4VA 2RJOA 4PEVA 4PQYA 3TLCA 8AT1A 2Y1LA 1PI3A 1PL0A 1RRKA 4C2UA 1Z6YA 2PGLA 4H31A 2HHAA 1K08A 3AESA 4RELA 1S2MA 4U7PB 1MIOA 2BFBB 2Q3HA 3AJEA 1SXJB 1P1KA 3BRQA 5TQ0B 4JJKA 1T2DA 5BUQA 1NC1A 1YDHA 1ZA1A 2JFUA 1ZK3A 1AF7A 4LJ8A 3D3EA 2PGOA 4U00A 1O9BA 5HUQA 2WG0A 3CF4A 1ZESA 3GEGA 4EKNB 3OM1A 3S1SA 2QT1A 5ICSA 3JR7A 4UNPA 3R7FA 5JYCA 4ZYTA 1Z17A 1UM8A 1FP1D 2C5LA 3DD1A 3T3EA 1OA1A 2WIBA 4WNAB 2XDWA 3WISA 1JE1A 2V9CA 3WAJA 4RJJA 2LCFA 2R96A 2RARA 3HU5A 2WPNA 3T3GA 4EJSC 4DCJA 4MGYR 5LBTA 1EP1B 1PZHA 1C2TA 2IYLD 3GP5A 2FWRA 3OPQA 3OQIA 4JLSA 1U2DC 3BH0A 5FA8A 3TKLA 1K98A 3O8BA 2YDYA 4L4XA 2WUGA 2FPKA 3B2EA 3ANNA 1BYUA 4ER7A 5J23A 1YAJA 2OLKA 3OJFA 2HBYA 4F6LA 4R9SA 5KVQA 1QG2A 2QNIA 4D9KA 4IQ4A 1KGSA 3I28A 4OBEA 1T6NA 1C29B 1PTJA 2NXJA 3EZ7A 4QJIA 5GAJA 5GADl 1GQSA 5FWYA 1WDWB 1LNSA 2GPJA 2N75A 4LHZA 5E6SB 3NHPA 1L9KA 3B1ZA 4MUFA 5GGYA 2H08A 5BN5B 1TXGA 3X1DA 3V4PB 1GTRA 1K63A 4II3A 3RYIA 2R3SA 4IHJA 3RM3A 3O2JA 4Q12A 4O29A 1O5IA 2ZRQA 5GJWC 1M5RA 4E1AA 1RYYA 4OQFA 3FFWA 2Q3LA 3ZW7A 2ATVA 1C9EA 4O2BA 3OX3A 1JJFA 1C7FA 1ZN2A 2Z1MA 2CNLA 3HCDA 2CXNA 2D06A 2ZRAA 4IIDA 2GK7A 2P8JA 3H9JA 3LPAA 1NE2A 3PFIA 4D3YA 5JY6A 3K9HA 3N8NA 4O5OA 2JGFA 2QV7A 2XNDD 3VYTB 4HG2A 2GPNA 3BHMA 4DJFC 2C5AA 1FJXA 3G7SA 5BMVB 1YVPA 1K5HA 4AJPA 4RJLA 2GHRA 5A2GA 2W4QA 4H4EA 1MT3A 2HOQA 1GL9B 4OH7A 3WNDA 4B3GA 1QWSA 3ZCUA 3NBUA 1MA0A 5FUBA 5I8WA 1E6EA 4HUJA 5BYAA 1LS6A 1BROA 2LV8A 3DE2X 2I54A 3FNBA 4KDFA 4ALJA 4KN9S 5J4VA 1I7SB 4RF3A 2G5TA 3NBZC 3RUIA 1ZCAA 4G4SP 1ZGHA 2G08A 1NXQA 2G9VA 2WAXA 3PK0A 2PK3A 3O6VA 4KCGA 5JATA 5CH5A 2HK9A 2YS7A 4BZPA 2GXQA 3HSYA 4BFUA 3KQUA 4I6EA 1H8HD 3VPBA 3DKPA 4IOLA 4NMXB 4KRYA 1SOVA 4KR9A 1IVNA 2O2YA 1TK3A 3BB4A 4P5EA 3CWQA 2VWQA 3QNWA 2JCBA 1CQJA 1JR6A 1Y4UA 2O05A 5KWJA 3BAFA 4B9EA 1CZHA 3H1PA 5I9BA 5IK2A 4X44A 5CG2A 4MAMA 4KQGA 2R8XA 1C7ZA 2ZAIA 4WOKA 3RT9A 2Q2QA 2Q07A 1D9XA 1PCXA 2Y1FA 3EBLA 5ALLA 5T7BA 1OH6A 1RE0A 2D1QA 2NIPA 4QUKA 4CCWA 2PGJA 1L6IA 1JEAA 3GWZA 3AEQA 1ILWA 5KOHA 3NKLA 4Q82A 1KFCB 2UUPA 3OIWA 5K0TA 1EFVB 3A1NA 2IIBA 3H2BA 4ZOLB 1X19A 3OJLA 1VIAA 4HDNA 2F4NA 2FU5C 1A69A 1JLKA 1ZUWA 2ZIUB 5LDDC 1N6HA 2WUEA 3I72A 4R0VA 4B46A 1FYDA 1XKTA 2ZBFA 2EDCA 1MW8X 1AQNA 2IKSA 3U3MA 3T1TA 3IEIA 3WGHA 3KSBC 2VL7A 1X7WB 3ESZA 2HIHA 4FMCB 1Z5OA 3ZI0A 1OFIA 4NPCA 2PQMA 1QGZA 3DKKA 4FT4A 4MHOA 3TRJA 1XXHE 3WIDA 3WBKA 2BLLA 3B2QA 3WYNA 1NI5A 1FVHA 1UWKA 2Y1GA 1IHOA 1E1DA 1KQ3A 1C3OA 1H2FA 1EEHA 1RACA 2QAJA 2NOAA 3GLUA 3P4UA 4UATA 4X64B 2XZLA 4QODA 1IXZA 3QV2A 1TEZA 4G1BA 2AKYA 2FSFA 2HDOA 3O03A 4PO8A 5H9VA 2R8YA 4P3XA 2ZIWB 1MTOA 4GMKA 5EP3A 4FEGA 3TRFA 4GVLA 1UAAA 1EAMA 1Q0QA 3O9ZA 3C4VA 1X1DA 3JATA 3MTQA 2D62A 3PQ3A 4J16A 4PVDA 3VR3D 5TMPA 2IXBA 3LI2A 4OXQA 2BR4A 1R10A 1AQLA 5A0VA 2Q5FA 1XSEA 2CJWB 4ANFA 4A23A 2I1WA 2LCIA 4GS5A 1IM8A 1F0PA 2B6HA 2FMXA 1I3MA 2ZBQA 3AR3A 3A7DA 3MBKA 3TJMA 1QTQA 3FVWA 1ID1A 3K0SA 1RWKA 1QIIA 2Y92A 1XKXA 5HMMA 2XNKA 2QRJA 1UJMA 3EPRA 1OW3B 4GUDA 1KK0A 3G82C 3HYTA 4NJEA 2CLFB 2VWHA 4MUEA 2P77A 1ZM2A 1GU0A 2ZT5A 3JQ9A 4AYXA 1M34E 1HDRA 4GR5A 1JYFA 4WINA 4YLYA 2YFHA 2QP4A 5CLJA 1DTWA 3IQFA 4NV3A 3TLGB 3VPDA 5IHPA 3CUWA 3H11B 1DXYA 2ZWMA 3H9BA 5DI9A 3MF4A 1XZMA 3KE9A 4L50A 4RDIA 3SXPA 4ECEA 2HYDA 4CL0A 3CR8A 1VZ3A 4RMHA 4G4SO 4AX4A 1OC2A 2OCBA 4IVPA 4JT2A 2A3RA 3SMQA 2HJ9A 2FPMA 1QF7A 3BGSA 2XUZA 3RS2A 1QZ3A 1E69A 2BHSA 1GPDG 1UKYA 3E2MA 3BMQA 1E5TA 2OGTA 3WLHA 1F8GA 1J7JA 4OX9B 3H6GA 2REOA 1PG2A 4FYXA 1T4GA 4AJKA 2Y1WA 2WK1A 1E3JA 3MINB 4C4ZA 4ZT6A 3V4RA 4TMYA 1FQJA 2VHJA 3V1KA 2I4NA 4C7JA 3U31A 1FP4A 4F3RA 4PFQA 1RT9A 1TCUA 3N5KA 4K40A 3JVIA 4R8RA 2O1SA 5CDUA 1U6JA 4J4TA 3WC4A 4OATA 2PU7A 3DF9A 1ZM7A 3E35A 4OHMA 5HGXA 5JPCA 3NONA 1DV1A 3GOHA 4N0MA 2WD7A 5F3RA 4COOA 3QE9Y 1QYVA 2R00A 3WHKA 1Z13A 2V9ZA 1AXEA 5EPOA 1YNSA 4E1VA 3RK1A 1H2YA 3V9PA 5B64A 4O4LB 4LVOA 1CZUA 1XRLA 4HH1A 1VPWA 3HFGA 1TW2A 3WQQA 3LBHA 1XIVA 1UPFA 2ZSUA 3NHLA 2A9PA 2OFFA 4DWJA 4E46A 1WZ2A 4UDYX 5JDCC 2XMGA 4N03A 2HN9A 3QYPA 3W6UA 3AF1A 3E7PA 3WIEA 3HNRA 3ZWYA 2ATCA 1CE8B 1XRPA 5H02A 2JASA 5CIWA 3IOBA 4G4IA 5EIOA 1RC8A 2IUFA 4ETWA 3P94A 4YDQA 1N8TA 4MPJA 4B4KA 3IAAA 3SY8A 4I9HA 2GEBA 2SCUB 3E1GA 1G5TA 2CFIA 3L8YA 4R3UC 5C53B 1WUIS 3FJYA 2ORIA 2YYYA 2PGIA 1DT3A 3ACDA 4YO7A 1ULAA 4BJ5A 4NAVA 3TIGA 4EFLA 1IUPA 5A0FA 4L4ZA 1VA5A 4M21A 3REQA 4EGFA 2F43B 2KBEA 3OZDA 1M2JA 1U8ZA 1Z37A 3L49A 4EOGA 2IGTA 3ST7A 3IJRA 1Z3CA 2F6RA 4XD7D 4D46A 4G65A 4D43A 4W5OA 1YRQA 4RSGA 3FRHA 3HA3A 4YRBA 1TCAA 2ZR7A 2B2CA 3LG2A 5J63A 2PEZA 1E6MA 1WV0A 3K8ZA 3OIYA 4ZYLA 2UYCA 4X97A 3PHGA 3QMWA 2A78A 4R16A 1RBZA 1H5QA 3UJDA 1E2HA 2CVFA 4QEKA 4CLRA 1MHPA 4Q93A 2E4VA 1Q0TA 1O95D 2G7ZA 1U90A 4ND2A 2C95A 2DT8A 4FZJA 5AXCA 4DC9A 5A5GA 1QP0A 3HHPA 4F3TA 4QELA 1S8OA 3FDZA 3HV2A 1LPNA 4ZREA 4MGIR 4D3SA 2IH4A 3UXHA 2PJRA 1IZ9A 5GM2A 4BJHB 5BSKA 1A7JA 1GTSA 3ZDBA 4MLZA 4OV6B 1SD1A 3ZIAD 1YONA 2G9QA 2QTNA 3ZWWA 2FXIA 1RXWA 4FZ3A 4M98A 4CNQA 4EO4A 1YDWA 3ZCSA 5I7EA 4W5HA 4NCXA 3G1TA 2X40A 2DTXA 3DEIA 4ON9A 4OU4A 2ZJ3A 4KGXA 4DMCA 3FOAA 4RD3A 5BOVA 2NZYA 3RJMA 1PAUA 1ZNZA 3N59A 4KDEA 2ZVPX 3ZHCA 3EXEB 4KMRA 1VMAA 1KEZA 3VSDA 4A9AA 3CLHA 2RMKA 2HA4A 1QXSA 4NBKA 5ALHA 4C6TB 3EW7A 3GFSA 2G17A 3HCFA 2XB9A 1FTGA 3B3QA 1D2HA 1QO7A 2BMVA 2BF7A 2WYIA 3C74A 2EKDA 1KSHA 1D1QA 4B45A 2Y1KA 3EW9A 1XXHA 1C3LA 2W6ID 3F1LA 2KYRA 1NF9A 2AXNA 4MVWA 5DGCA 1M67A 3K73O 3QK7A 4KR0A 1RIIA 1SWWA 3C2QA 3DFUA 3OHPA 3ANTA 4AZVA 3GGDA 3CUSA 3COJA 4ZCTA 3IL2A 2XUQA 3VDMA 2DUJA 2Z6VA 2FWBA 4E33A 4F7WA 4ZZIA 1FFEA 1EXMA 4UTVA 5JDCA 1ISJA 5IJ9A 3O8CA 4ILEA 1XFAA 3UWMA 1ZZEA 4C0QC 1U0JA 3D3WB 3DTNA 5COBA 4NCBA 1EK6A 4QGGA 1NBWB 1N9KA 4RPGA 1GADO 2PKWA 3P2EA 1DBSA 2Q5JA 3I05A 1T1EA 4D0NA 3KZXA 1RLMA 1VCOA 2FEWB 2WJ6A 3AM3A 3TQHA 1P1HA 5JUWA 1LGYA 1RJFA 3NI2A 1Z6AA 2O1XA 4OQYA 4CQMD 4WADA 4C4OA 5CDSA 3GL9A 4NX2A 4NK5A 4Z9BA 3EDRA 3C6QA 3FR8A 5DSTA 3K2EA 5HJEA 1O95A 4QU0A 3I5UA 2PIDA 621PA 2AVNA 3PFBA 1Y3FE 4JR0A 4OMDA 1AK9A 1IULA 1V41E 2AF4C 3GRYA 4Y2VA 5G40A 3STVA 2IHZA 4DRZA 2Z6UA 4EG0A 1KQGA 4IIHA 2ZUVA 3I6YA 4BV3A 5HK9A 1PDOA 2JATA 2GN9A 3DVSX 3CJTA 4BKOA 1C0PA 1P0CA 1IG3A 1Z0ZA 3EODA 2VATA 3ZG6A 4QBKA 2AN4A 4EUFA 4L76A 4M60A 1QG0A 5K2MA 3NRCA 2A5DA 1AKVA 1RJ9B 1NN3A 3EEYA 1VDMA 3AXTA 4J75A 3UA3A 5LNK1 4OGLA 2NO0A 5LMUB 2CK3A 4WEOA 4DMUB 4AC9A 4AFNA 5BQFA 5JS8A 1X15A 4N3CA 2GEDA 4FCVA 4C22A 2J0UB 3V97A 4Z4HA 4NZNA 4A6PA 3JVUA 4B5LA 4ZV9A 2VT2A 1JNYA 1GDTA 5LYYA 4JR1A 2RHGB 3ZE2B 5F5NA 4MKFA 3ULKA 4EA9A 5IWCA 1IMJA 1EDEA 1HT0A 2Q1SA 4TN5A 3VJMA 4JOBA 2ICAA 4RVHA 4UOEA 5LDHA 3W90A 4BNGA 1NUHA 2ODTX 2WM2A 2BEUA 3X2EA 5AVRA 5EMHA 1NVDA 2H92A 2PS0A 2Q49A 3QX8A 4ZEWA 4DMLA 4U7DA 221PA 1NQTA 2KX7A 2EJUA 1KR2A 1STOA 2JHPA 1QJ4A 2VI5A 2VF7A 2ZJ2A 5TMDA 5THKA 1N9ZA 3DHWC 2C7PA 2P3LA 5BSHA 4UMVA 2JIMA 1NL3A 1Y7LA 4NLLA 4Q7JB 4IX1A 5BSUA 2HJRA 4WUTA 3A9UA 4IVQA 3E8XA 1RRMA 1HV8A 3CH6A 5KHAA 4GP7A 3WR5A 3KC2A 4B6RA 4CM1A 5K0GA 3LAWA 1JDJA 2WNHA 4JL5A 1YULA 2YUTA 3QWIA 4BFSA 1W36B 2BKLA 4ZQBA 2PZJA 4GI1A 3E5NA 3TUJC 2OLJA 4JI7B 4DCVA 1UKBA 1U3CA 4DQDA 1JIQA 1V43A 4YYEA 5KWIA 1IG0A 5IH3A 2XR1A 1DAFA 3UB2A 2YKGA 1EYZA 3VNBA 1J1UA 2R6CA 2ZR8A 3DE5X 3N8HA 2IXEA 1T25A 2DCUA 4JVSB 4RVSA 1R66A 3ZDFA 4ZQEA 3R5XA 4AECA 3OMWA 4ALMA 1FFHA 1XVVA 3DXYA 1H2RS 1N4AA 4ZU1X 5LJIA 4DSOA 1XDUA 3KXIA 3FHJA 1DIHA 2NQTA 3Q8WA 4DLVA 1CV2A 3BMCB 2Z2XA 2PPLA 5TJHA 3Q88A 4WCFA 1DBRA 2VHTA 4E11A 3H4MA 2O8VA 1BWRA 4KZPA 5BSRA 3X1YA 4U7JA 1B74A 5H7XA 4HJXA 4BY9E 3ZU5A 3WRXC 1NJFA 2R5WA 1XZDA 3OQHA 4BX2A 5J5CA 4ETNA 2BGRA 5B6PA 1BEZA 2I76A 1RP1A 4HZUA 4R6WA 4MWZA 9GPBA 1TTTA 1VL0A 2IEGA 3BQMB 1KQOA 4IL5A 2ZS7A 4HVTA 5AI4A 4PO9A 1WDMA 1VZ2A 2ZKIA 2AOTA 3RASA 3C70A 3EG9A 4GC9A 5FLEX 3ROTA 4AMUA 3AVYA 3H9QA 2VHCA 1Y8ZA 3PQFA 2X58A 3LCVB 1T0BA 4RMJA 2CXQA 3TPZA 1J9ZA 4EW1A 4UHDA 4Q4JA 3Q7RA 1EUCA 3ONFA 4PPQA 3IURA 2OEPA 3WKEA 1W6RA 2BFFB 3KAJA 3C0KA 1RTKA 3NWJA 3I76A 3PLRA 4DG8A 1ESNA 1NN0A 3ME5A 3V33A 4P4UA 3SC2B 2F1HA 1Q0UA 2XQJA 2GJ9A 4GX0A 3NVKI 5CDHA 3KYIB 1S1CA 4B3MB 1W19A 4RMIA 1KP2A 4FWIB 1NR7A 2O0JA 1BQ3A 4MUXA 1IOLA 2XZPA 5AI5A 3VNRA 2F8SA 3C3AA 3FSGD 4AZSA 3I61A 1ZGGA 1RS0A 1H8ED 3NXSA 2AC4A 3HQ4O 3AY7A 1E2BA 3GZNA 1UXHA 2OAGA 3Q3JB 2EFDB 2PDAA 1W0CA 2JDID 5KPDA 2VRCD 2BM1A 2C04A 4I9UA 2GKOA 4RJTA 4KAAA 1HLGA 2P9CA 1WB6A 2NXCA 2C82A 3DLTA 1ACJA 1ORHA 1QCDA 1QKJA 3F1KA 3FH0A 3NO4A 4TKZA 5KCMA 3NUZA 5TS2A 1QDUA 1XRJA 2G0TA 4YJHA 5EXXA 2IIQA 4DGSA 1HLDA 3RYFA 4PINA 3O94A 1TZJA 1YZUA 1A1VA 3OTHA 1LQ2A 2AR0A 1P2GA 3C7KA 5HTKA 4JUDX 1FVFA 4QGFA 4S2EA 4YO8A 1KQFA 3SKYA 1RXYA 2P62A 4JFAA 4V2IA 4JBHA 4M0CA 4BNIA 2V0GA 3I9KA 1E3LA 4LOAA 2J48A 4M37A 4IR7A 5GOTA 4KO8A 5DN6D 5FH9A 5ITZA 4A0RA 4DA0A 3OQMA 2KE5A 3ZY6A 3CISA 1KP9A 2G88A 3AUUA 1XUOA 2X0NA 3M34A 1MJGA 1IAQA 1ZINA 2NGRA 3KT3A 3N5CA 3L0BA 4QT0A 4TROA 4UU1A 5B6JA 4GXNA 4N12A 4PVCA 4F12A 1I4DD 4WN9B 4D8WA 4L9AA 3BOSA 1L1QA 4JJFA 4JBIA 1QO9A 5K3DA 4Z4IA 3HGQA 1V3TA 4O2BF 2F1KA 3AR7A 3SR4A 4X5OA 1JHUA 2NTEA 5FNZA 5BN4A 1ZXLA 1ZMTA 4UUAA 2SECE 4X8HA 3CX4A 3H65A 1XYVA 1RWBA 2OB2A 5KSPA 1T5DX 2DQ4A 1XTJA 1VG0B 1KQNA 1GGEA 1P2VA 4IPTA 1N0VC 3HFRA 5K3FA 1VB5A 2UVPA 3R3ZA 1FPQA 4JXJA 4WJLA 4ZI7F 1ZJYA 2BGTA 4Q39A 2L42A 4FIZA 3V6LA 4L4SA 4CE6A 4N49A 1X80A 5JXWA 5ICFA 3VA7A 1Y3AA 4UVIA 4OBXA 1SK9A 4EMBA 4AN0A 4QGBA 1ETUA 2H3EA 5JASA 1C41A 2OBFA 4KC0A 3OFNA 1LV8A 5CYPA 3II6X 4GT1A 3GGSA 3PNBA 3TBHA 4ADSG 1A9PA 1OTXA 2VAWA 3LK6A 2BJWA 4ZV4A 3UJAA 1M2HA 1SA0A 3I2GA 1V9SA 3FVVA 5AKKA 5LWHA 1OH5A 3FY4A 4L22A 1T8PA 3TUZC 2AVDA 2R86A 3ILHA 5CVTA 3SHOA 1JECA 3IDZA 4KVAA 4Z54A 1ZD3A 4YDHB 5EZ6B 2Z8ZA 2CMGA 2O3TA 3VR2A 1NKVA 2RKWA 2JDIA 1MEJA 3W9SA 4QJ3A 1DCKA 3TGWA 2X0JA 5SZIA 3FOFC 4Q34A 4Z4EA 2XX3A 4TSRA 1T6XA 1SUSA 5FI5A 4Q9KA 4GOKA 4AJOA 2A8YA 1YL5A 3W5SA 4W5JA 1E2GA 4WKBA 3TAXA 1SCBA 2CVOA 1JKFA 3EPJA 1KBZA 4U02A 2VJDA 1NFQA 4TLDA 4R8KA 4YRAA 3IJEB 3TPCA 4JL8A 4Y6SA 1N7IA 3ZE6A 1E5LA 5K7SA 5ALJA 4KYUA 5J40A 2C5GA 4QWMA 3T7IA 3HVJA 2RK3A 1XDGA 4XVQA 1M66A 3WMFA 5BSEA 5IBRA 3DKRA 1KJNA 1PL7A 4F2GA 4A2PA 1I1OA 3RAGA 3WQBA 5E38A 2FG5<