1UJBA

Structure of the protein histidine phosphatase sixa
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
156
structure length
156
Chain Sequence
MQVFIMRHGDAALDAASDSVRPLTTNGCDESRLMANWLKGQKVEIERVLVSPFLRAEQTLEEVGDCLNLPSSAEVLPELTPCGDVGLVSAYLQALTNEGVASVLVISHLPLVGYLVAELCPGETPPMFTTSAIASVTLDESGNGTFNWQMSPCNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the protein histidine phosphatase SixA in the multistep His-Asp phosphorelay.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Phosphohistidine phosphatase sixA
total genus 54
structure length 156
sequence length 156
ec nomenclature ec 3.1.3.-:
pdb deposition date 2003-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1ujbA00
4ARVA 4JOCA 2IKQA 1ND6A 3FDZA 2P6MA 2H4ZA 4QIHA 3QPVA 4D4JA 2AXNA 3BIFA 3MBKA 4IJ6A 5AJWA 4EMBA 4AROA 5AJVB 1FBTA 4D4MA 5CDHA 1UJCA 1NT4A 1E58A 1V7QA 5CU7A 3D6AA 5PGMA 3MXOA 1V37A 3K4PA 3GP3A 2WNHA 1SKBA 2WU0A 1DKLA 2DWPA 3NFYA 3HJGA 3QPUA 2YN2A 1H2EA 2A6PA 1FZTA 3F2IA 2QNIA 2H0QA 1C80A 1CVIA 1TIPA 5CX4A 2OWEA 2YN0A 2H4XA 3IT0A 1EBBA 1YJXA 4JODA 2P9FA 1QWOA 4HBZA 5AJZA 3DCYA 4GPIB 4D4KA 1DKPA 1IHPA 3E9DA 1C7ZA 5AJYA 1BIFA 2BIFA 2P77A 3OI7A 1BQ4A 3D8HA 4MA4A 2P75A 5HTKA 2P9YA 1E59A 1C81A 3KKKA 1SK8A 3ZHCA 4GPZA 4E3WA 4EO9A 3FJYA 1BQ3A 5HR5A 3O0TA 1DKMA 2ENWA 2EOAA 3F3KA 1T8PA 3R7AA 3DB1A 1QFXA 2P2YA 3IT3A 2GFIA 1SK9A 3QPWA 3NTLA 1UJBA 1XQ9A 2A9JA 2P2ZA 2F90A 4PGMA 1H2FA 3GP5A 1DKNA 2P6OA 4D4LA 1RIIA 2RFLA 3LNTA 2DWOA 3GW8A 3PGMA 1DKOA 1ND5A 4PZ9A 5AK0A 2WNIA 1YFKA 3D4IA 2I1VB 4FDTA 4JOBA 2H52A 4FDUA 2HIAA 3FDZB 4ARUA 3K4QA 4TSRA 1K6MA 1DKQA 2OWDA 1RPAA 4ODIA 2HPAA 2ENUA 2EKBA 3EZNA 4IJ5A 2EKZA 3E9EA 2P79A 3EOZA 2P30A 2P78A 2P9ZA 1QHFA 3IT1A 1RPTA 2HHJA 3E9CA 4ARSA 1SKAA 5AJXA 3IT2A 4PZAA 3C7TA 3LG2A 3LL4A 2PA0A
chains in the Genus database with same CATH superfamily
3E2PA 3H86A 5B3LA 3TGPA 4K6MA 1IN5A 3ED5A 1EBFA 4FOSA 3O75A 1P60A 3AGPA 4YJ2B 4KQCA 4IIDA 4V0QA 2MYPA 3WNDA 4QQKA 4R40A 4ZFNA 4KRXA 1EVZA 2F17A 3ZCQA 4XEHA 1JEYA 3QTLA 1U0LA 4FT2A 2DRIA 4MVJE 4R1UA 5J4VA 5JQGB 4NXMB 1K6JA 5E1MA 3GFVA 1BHJA 2JHPA 4XQCA 4ZQBA 4AJ4A 4J3NA 4HXFB 3DF7A 4FUTA 3KTAA 5F51A 3ZV5A 3L8CA 1ZOLA 4X64B 4YRTA 3NPAA 1G98A 3VAAA 5T7BA 3B2QA 3M6MD 5CT5A 3OTHA 3UJ8A 2P6UA 1UWKA 2YFYA 1M34E 3CXUA 5MN6A 1W19A 3VZDA 2FG6C 4RLQA 2ZIAA 1XZCA 3HJTA 3L82B 3Q3JB 3IDQA 2HPVA 3MJCA 2AYYA 2BC9A 2Y93A 3F4BA 1VPLA 2XUZA 4HH0A 5FNZA 3VI4B 5A5FA 5IKXA 2C5SA 1YZTA 4KRGA 4BNMA 4LCEA 3FVTA 2XYQA 5EGSA 2B5VA 4ZZ3A 5HG0A 5ED4A 2R66A 2GEUA 3HI4A 3FJOA 2D00A 2CDBA 1B14A 2A14A 2HJGA 5EXDA 4D4GA 1SHZA 4CR6A 1T6NA 1H9AA 3TFQA 4DGSA 3E70C 4E5MA 3EQ9A 2FUG6 3DDCA 3OJLA 1RZUA 1V6AA 4ZOAA 2F64A 2PD3A 1WUJS 5AICA 3SHWA 4A4DA 5IT0A 1X1DA 1XZFA 1DT5A 4I9HA 2H92A 3M5DA 3K2QA 4GXNA 2VHWA 1U0EA 1YA8A 2GN9A 1ECGA 4I3HA 3U3ZA 3G82C 3ZI0A 1AGYA 2EDAA 2ZJ5A 3FJYA 1C3XA 4PPNA 1SVUA 4MKFA 2QQGA 1GD1O 1W29A 2QD2A 3C8ZA 2GO7A 2FQQA 1OXSC 1VFNA 3Q8LA 1DV2A 3WJ2A 3KHUA 3VSEA 2G40A 1IM5A 1P91A 2FFAA 2M1XA 2Y1KA 3UXYA 2QEQA 1NQWA 2UVDA 5KS2A 2CDRA 4POAA 1YS6A 3BMNB 3V1LA 1PZGA 1CS0A 4JP1A 4BJ1A 3GJYA 4LG1A 3T7TA 1B4DA 4MGEA 1IN8A 1CQJA 4PYLA 3KETA 4BJ6A 4CKEA 4L76A 4O4JF 5T67A 4XGNA 1X92A 3JVIA 2HMTA 6LDHA 3MWKA 1THMA 4HX5A 1A2BA 1HMYA 1QHSA 2OBFA 3HCCA 3EPRA 3OJEA 4QDKA 4D42A 5I01A 4YC7A 3T7SA 3I4LA 2A1TR 1O08A 1G4UR 2YDXA 1PUIA 2HYDA 4ZAVA 1KYTA 1OWPA 3NBQA 3VTFA 3HCBA 5MHTA 3LT1A 4YCAA 3MSCA 4B73A 1B3RA 2H8GA 1KJZA 5JD6A 1BHSA 4OHKA 4BV8A 2J59A 3NTVA 3OY7A 2Q1WA 4MS1B 1PGOA 4KMMA 1MVNA 4PTZA 4DCMA 4XGQA 3A9TA 1IUKA 3CLSD 3PC4A 1G19A 1HH4A 4BS9A 4C6SA 5E2BA 1FFAA 1CZUA 3RS3A 3ZC3A 4PU0A 5BT8A 1P3JA 2PANA 2RAVA 3NCTA 4JT9A 4U7WA 1EUZA 5SY9A 4UTXA 1E32A 4I1PA 2Y27A 1REQA 3SS8A 5GIOE 2WA2A 4FEAA 3F9CA 1JQBA 3FIJA 3GA5A 1F6WA 5AOAA 4Z49A 1G21E 4YJDA 2DQKA 3SBOA 4MYTA 3BQ9A 2AQKA 1SC6A 3LUHA 4YO7A 5FDFA 1ZDMA 2SCUA 2QUJA 4FSDA 4HB4A 1T2NA 3D3JA 5DO9A 3LUPA 2GPSA 3GLSA 1E3JA 3CKYA 4Z3OA 1YE8A 1U28C 3H7IA 2PL3A 2VAMA 4JLOA 5D3MA 2X8JA 2XF8A 4M38A 1ZH8A 1EG7A 3S3TA 3BFKA 3W6PA 5A4MS 5JYDA 4M1QA 1GRRA 1P29A 4F7DA 1J23A 1TUEA 1B15A 3D3KA 1WZNA 2E1RA 3HN2A 2CE7A 3IAM1 3OFJA 4NV1A 5BVHA 3HJGA 1E4EB 4BZZA 4N6OA 3WNCA 2GVZC 3OPQA 1P0QA 1MC5A 5DYTA 1GGNA 4LDRA 5BURA 3OEED 4HDAA 4LSGA 2OP1A 1L7NA 4DS3A 3TG2A 4E08A 4KNVA 4Q34A 4ND5A 4CG0A 1QB8A 3V32A 3BVPA 4PSUA 4FWTA 2Z4RA 4OCZA 1PQYA 2WLSA 2XKJE 2QMYA 1NUHA 3F98A 4X1YA 2D5LA 4D4HA 5KTMA 4FNAA 1N3IA 2RB4A 3E9YA 3JD2A 4WKBA 2XCLA 2HU2A 5C4GB 1ZIXA 4DLPA 3I61A 2VQSA 5FL3A 5KSYA 1J2EA 4FWBA 1QCZA 1FC0A 1E1YA 2VNAA 3HUUA 3LF1A 4HPXB 4IG4A 4ROTA 3AJRA 1J39A 3GMIA 4Z9YA 3EC1A 3I9JA 4OU4A 4WN9B 3SZUA 2BLLA 3EULA 3KDPA 4YUZA 1SULA 2BTQA 3L4BA 3ZI4A 4H7KA 4GD3Q 3MJSA 1F60A 4KO8A 1G5PA 1WCWA 1EAMA 1GDHA 1GYQA 1QCYA 3V7WA 2X42A 3RS7A 3RHSA 5KDLA 5JD3A 4UFPA 1K8XB 3C1AA 2Z56A 1PW5A 3GMDA 2H9AA 2RB5A 4FONA 1UBNA 3HKEA 4J16C 2OO7A 4PGGA 3QJGA 1RRKA 2XRMA 2W2MA 4X8OA 3AVQA 4ZCTA 2A3RA 4GP9A 1A9XB 1WZCA 4RXUA 4UXHA 4AB1A 5I4KA 3L06A 2N3ZA 4GLBA 4QVKA 4X91A 2PSFA 1WHTA 4AKEA 1OLUA 2OFOA 5EHZA 1QPGA 1XALA 3C7AA 2BPOA 4YHHB 4NZYA 2HLNA 3HJRA 1T0BA 5SV2A 2DWQA 3BA1A 4B9AA 2VT6A 4WNYA 4I6GA 3BQMB 1YFKA 3B52X 2JIOA 4AWAA 10MHA 2Z5LA 2ZSDA 3L2OB 1TD9A 5F21A 3PWZA 1YI1A 3TZBA 2GSWA 3SD7A 4Z51A 4U4AA 5ITSA 1ZM3A 1A7KA 1MEJA 4CDGA 4M1EA 1ECLA 2YYYA 1Y89A 4MP6A 1TAQA 2QMEA 2C7RA 1G8MA 4YLYA 3ECSA 1OLSA 1YH3A 4M9UA 1M8FA 3HL4A 2I8CA 1T4GA 1FVXA 2OE2A 3ZHOA 1ZNQO 4YT2A 4YDQA 5JADA 1CQJB 1UOEA 3LRPA 5CLIA 1I2BA 5SZIA 3A9CA 4GOLD 3UBMA 4CKEB 2I4TA 3NATA 4RV9A 1JKIA 1K0UA 2P69A 3NDPA 5JJ5A 4UAVA 3CNQS 4L2IA 2NNWB 1SIWA 2Y77A 2LIPA 1NXSA 1G0NA 5JXGA 3JQAA 5ES4B 4Q9AA 5HIAA 1X2EA 2OGSA 3NOXA 3EOBI 2J8ZA 3CS3A 4HLNA 4QTTB 5I8ZA 3OPXA 4KI7A 4BNGA 1NM5C 1P72A 1BN6A 3EVZA 1FDWA 1OYVA 3NEAA 4EKYA 2W6ID 5LXTA 1JS1X 2ZB7A 5EJMA 4IDAA 4EWLA 5AOCA 3RVDA 3SJZA 4ZZIA 4YASA 1R6XA 4ND7A 2YRWA 3MWEB 5CU7A 5ALRA 5ALXA 1AQLA 2A9QA 4AZ3B 1ORDA 3N59A 5KJ1A 1YQXA 4LNAA 1Z3IX 5HK9A 4LXYA 5IM4F 1CR0A 5ECYA 4AN0A 3FRHA 4PLCA 4TOIA 1E2EA 5BV7A 4AQYB 3S2EA 2P2LA 3LBFA 4M8NE 3R0QA 1JQJC 4MX8A 3MCTA 5KYXA 3ZVRA 1H2EA 1G8HA 4CKYA 1UK9A 2ESRA 3LLSA 1C50A 4I6JA 4J75A 4BFXA 4DTIA 3FFXA 5A04A 4XDGA 3HUEA 4DLXA 1EUDB 3GT3A 4PBTA 4CIYA 5JZOA 3IB3A 2I1QA 4HWRA 5BN5A 3ESDA 3I5YA 4YMTA 1HT1E 3RG8A 3BC1A 4MKGA 3FF1A 1RIFA 4BKMA 1SBNE 2FV8A 3V97A 4JYPA 5BSRA 2WI8A 4TT8A 4UQPA 3A0RB 1WE2A 1Z0UA 5D3MB 3TKAA 2DPHA 2UXDB 2IVZA 1NR1A 4M0CA 3RVSA 3WGKA 1VDZA 4Y6SA 1G42A 4Z0HO 4QNRA 4I6EA 3UJPA 4L7VA 1UC9A 2EXXA 3BWBA 2CXNA 3A1VA 3GC6A 3I9NA 4OHPA 5HMLA 3R6GA 4IZOA 1Y9JA 2XXAB 5A3SA 4Q24A 3C24A 1MO2A 2V9PA 2R7AA 4CL3A 2JGNA 4CF6A 1PNTA 2CV0A 4BQFA 1J8MF 3HTXA 1E5XA 3RG2A 5EUBA 1EFHA 4HZUB 2YCBA 5BR7A 1N2SA 3NPMA 4FINA 1IZ9A 4KXUA 3TLGB 2DPLA 3TQHA 3B36A 3WGQA 2CWDA 3GELA 2VBFA 4BGDA 2HA7A 4I4CA 2GB4A 2PGAA 2Q07A 4IMPA 1XQ9A 2Y1OA 4TTPA 1N1MA 4BUJA 1RYEA 4YK7A 3N3BC 3LPLA 3R8XA 4RK6A 3AP3A 3NASA 5KNCH 4MRAA 2H18A 3EEBA 4PFKA 4WN9A 2VZLA 1E2GA 3CTMA 4KQKA 5KTYA 3CLUD 3AILA 3C0KA 1ID1A 4KV7A 3AV0B 2HXSA 2GCNA 5EJAA 4K9QA 4P7BA 3IP1A 5DP1A 5FWYB 4KPFC 2FFJA 4A0FA 3KUXA 4XVQA 1H42A 2H52A 1FFDA 2Q5HA 4I1RA 4P2BA 1WL8A 4YCMA 2WF5A 1FTGA 2PUVA 4KEAA 4BVFA 4B32A 3SICE 1XO1A 3CM0A 3ADCA 5EWJA 4RIGA 2PZEA 1Q3HA 3DTYA 3GWGA 2AHRA 3ABRB 5ADUS 2YWRA 1OV4A 1NC3A 1E1LA 2BEUA 3I9KA 1J0CA 3SYKA 2QVLA 4UM7A 3VQTA 3VSAA 5IKPA 3RCBA 3TQIA 1B8UA 2FYTA 3LSYA 1QDUA 1Y9DA 3BCUA 3BWXA 1D2GA 2XSZA 2NVBA 1M5TA 2GAJA 2YIJA 3CEHA 1TW3A 4GEGA 1CD5A 1NL3A 1MO4A 3KOYA 4ARSA 1EX9A 2VUUA 4AM8A 3QXHA 5AJXA 1GU1A 2Z09A 4JOSA 1NRIA 4FC7A 4L8LA 2O52A 5EXSA 5L95A 1V9CA 5ALZA 2M6KA 5I7FA 3SKVA 2W4QA 1EXWA 4TZTA 4EPYA 3BDIA 3LHIA 2QJWA 2MINA 1ZICA 2GAIA 1XN1A 5FBLB 5JY6A 1X7GA 3QX7A 3KJQA 2FSUA 2I8LA 3AX6A 4BKQA 4D9IA 2BGRA 3A8TA 5CA1B 4IZHA 3JYHA 2ZJ0A 5HW0A 3I4FA 2V0GA 1ZK0A 1P2SA 3CPEA 1ZISA 2G5PA 3EXIA 1KHHA 1VGQA 2XXJA 1LQTA 3M6XA 3ON5A 2ZWOA 4FEYA 4M46A 1ZUNA 1KDYA 3N0TA 4E14A 2BFCA 3GZNA 3IXLA 4GGMX 1G8AA 2J30A 4CG2A 2E5LB 3IX7A 1VE5A 3ZDYB 4LKRA 3GGOA 4K0RA 4R84A 3ROXA 4TMFA 1YRAA 1LPSA 1VHDA 3IDFA 1PKXA 5DT9A 1H9CA 1RD4A 2EAUA 4O8ZA 3GCWA 1AJEA 4HYEA 4J1QA 2X13A 5F2EA 5AI8A 2GRAA 1PV1A 2GM9A 2C95A 3TIFA 3CLTD 4MVJG 2QL6A 1PJTA 4X20B 4L7QA 3RU7A 4IDEA 4MDFA 2HU7A 1K63A 3GFRA 4FUQA 4QBKA 4DRYA 5HRUA 3UTDA 1W2HA 2X5XA 1QH8A 2QD4A 3VH1A 4D9EA 1Z0KA 2PKQP 3FBGA 1GTL1 4Z9FA 4G56A 3CN7A 3MWEA 8OHMA 2NPFA 1XTSA 4NBTA 4I08A 4AZ3A 1BWQA 4JBLA 1WULS 2WHPB 1P31A 1SIOA 1QR6A 4CTKA 1U2EA 2OHJA 1V8DA 4KCGA 3EARA 4F1WA 2WM8A 1O94D 1TK9A 4G2NA 3H2HA 1W59A 3HU3A 2QAGA 5CXSA 3DAGA 4MB0A 4LMBA 4Y2JA 1XTTA 2ZYDA 3MAGA 3HB9A 4RHYA 3PNMA 1DIGA 3ZCXA 4WFJA 1ZU4A 1QFXA 3HCNA 5COAA 1JAYA 1SG9A 2W2XA 3WGMA 4DNQA 4UAUA 5HVNA 4Z86A 3B3AA 2WQ7A 1XMOB 3GUCA 4B0OA 4G67A 4D3SA 2CL0X 3Q5GA 1IN1A 2AOVA 3RU3A 1SXJE 1YZVA 2OCXA 1DL5A 3QKUA 5DZSA 1MBZA 1LI4A 1U0RA 4AC9A 1CRQA 3EEFA 1ZD9A 3TSZA 4ABYA 4MYRA 1JLKA 4V02A 5BY2A 4MYSA 3EQ7A 3D7NA 1JDBB 3V3TA 1KI3A 3O7WA 2OO3A 1NR5A 4ZD6A 3SHVA 5B64A 1L4NA 5BMVF 3EH2A 2FF5A 3BSFA 4ESHA 3AP1A 4WOKA 1IG0A 3VGPA 3M1LA 2AG0A 2I1VB 3NDIA 3RV4A 3NALA 1GAEO 3L7AA 4BV3A 2IH2A 5JJIA 3GRAA 2X0IA 4WZZA 3K31A 3WGTA 4M9CA 3PF9A 3IBYA 1Q1GA 1U3CA 2IW3A 3Q9NA 1TQ2A 2ENUA 3LBAA 4GAEA 4LYJA 2VPZA 4TQ9A 1MAAA 4A2CA 4CN9A 3FSGA 1K5PA 2IVFA 1VKOA 3N58A 2DYKA 4HRYA 5BRJA 5LR6A 2J85A 4EVRA 1NV9A 2ZE5A 2EZ9A 1Y8AA 1E79D 4UUAA 4PG8A 1Y5LA 1NMEA 1NVKA 1JFRA 5TF0A 1ORVA 3BD7A 4G1UC 4WUVA 2F8LA 1Y42X 2PYIA 1W34A 1L5WA 3IVCA 5GJWC 5JIBA 3UV7A 4NH4A 3WQHA 5AW9A 1XZJA 2C8KA 3L7LA 3Q7QA 2HMVA 4MKXA 2ACWA 5HUQA 3KAJA 4F6RA 1Z0ZA 1KO7A 3OCYA 2WYOA 3ZIDA 4BZXA 3KJNA 1S2GA 4D45A 1UBSB 4L5IA 2TMGA 1U9ZA 3X44A 1XTVA 3OJ0A 3AV3A 1Y8CA 5I5GA 2XBLA 1DUVG 1JDTA 3LTEA 3P45A 4PCAA 4RH1A 5F1PA 1EAYA 1LV7A 1MXHA 4YAOA 3X2SA 1Z4IA 5KPDA 1IL0A 2FAXA 1V43A 3VYTB 4KRFA 3GGDA 4FYMA 4TL7A 4TKUB 4LZZA 1W87A 4FFLA 2ADMA 1JFLA 2H0RA 3TTUA 2A67A 4D81A 2D4HA 4EPRA 2HRBA 4WCVA 4WZBB 3UJ3X 1LSSA 1O97C 4NHOA 1KNQA 3WLLA 1JHDA 5L7YA 3B78A 4RVOA 2EATA 2ZUBA 2GCEA 3EMBA 1ZUWA 1U4OA 2FW9A 1AZTA 3EPHA 2MOKA 3VOAA 4UM9D 4J1NA 3HNRA 3EIWA 5DTMA 5AW3A 3I0NA 5NULA 4LCBA 4F11A 2ACEA 3RAJA 1J9ZA 2DUMA 4XZ3A 1NWHA 3RBVA 5LQMA 4B76A 5JH7B 2O8FA 1NGSA 4F4JA 3C39A 5I9LA 4L95C 1R10A 1YJAA 2I0FA 1CZHA 2JH8A 2G80A 2DY1A 1TYDE 3OETA 1G6Q1 3SQMA 2C57A 1TKCA 1U2QA 2X5KO 3AY0A 3NLLA 3CZ9A 3PQ5A 5FBWB 5AW0A 3KT8A 4ZDIA 4WOPA 2GMWA 1NONA 2YHSA 3WLTA 2VTDA 4GBGA 4EW6A 2VH2A 3R7WA 1UIRA 4F4DA 5LZ9A 1IY8A 2JLBA 4B6JA 4EUNA 1JDBC 1NLFA 2YXEA 3AJAA 3OJWA 2G1JA 1VSVA 2HH9A 4MH0R 3SX2A 4C4YA 3D4PA 3LCCA 2AVNA 2OUKA 4QSMA 2JNWA 2ZR9A 3CZRA 4RHFA 3N7TA 2WSYB 5CFOA 2I2XB 3I04A 4G97A 2R5NA 3F7OA 3OUTA 2VO1A 5JE8A 1D5CA 3C3PA 4BTLA 5A05A 2G72A 3Q7EA 5FBQB 1HEUA 1JQ3A 2YIVX 1JR4A 3IPYA 4GQAA 3GDFA 2AZ4A 5E1DA 3UA3A 4JLWA 3HDHA 1HNNA 3OEHA 3M3DA 3PR1A 3AY7A 4HDRA 4WECA 1YA4A 4M76B 721PA 3F3YA 3M0EA 5A9RA 1S2MA 2A5YB 5EE0A 5ELLA 2J3MA 1YVPA 2AH5A 2HX1A 2WUGA 4PGMA 4RQAA 4EQZA 2WWYA 1L7DA 3IA7A 2GI4A 4R4JA 3G89A 4DDUA 3UY4A 3WL3A 1ZNXA 5I4IA 2PQ6A 3T9CA 1IVNA 2CDNA 1GLGA 2XNCA 2XNDD 3EAQA 1P0FA 1RLOA 1RRFA 3H6GA 2AV6A 2VRCA 1IXRC 3IHLA 4MKHA 1YRHA 1N5JA 3X1XA 3NHWA 4RFSA 2UUBB 2NSLA 3H2YA 3K7EA 5C8YF 2DETA 1TRKA 2GEFA 1CZNA 4HFRA 5KUTA 3OU2A 5L8VA 1N5LA 2ZATA 3W9BA 1LPNA 1DEKA 1C2YA 2NT3A 2XE6A 2HN9A 1PZNA 2HPAA 3WFIA 3LC0A 1QRSA 3AUFA 5B36A 2JL1A 1YVRA 4RFLA 2ZWIA 1E6WA 3OZSA 2WOOA 3TB4A 3GT4A 1MLDA 2PSEA 5SZKB 3FLBA 1GWNA 3OZCA 1QE5A 2HV9A 5H82A 3EZYA 2HRDA 3M4ZA 2HHJA 4FCWA 1ISSA 4WSOA 2GN2A 3C16C 3HDTA 5FTJA 4WLEA 3O4IA 4TT3A 1ZCZA 4W9RA 4YRAA 3BL8A 5T6MA 3HWSA 4C0JA 1K75A 4EFLA 2WKRA 1I4OA 4IIXA 4RUKA 4DBLC 1J5EB 1UBOS 2YMMA 3ZIAA 4OHBA 4B4VA 3OQNA 2TMDA 1K97A 3OOYA 3DYBA 2BY4A 4JI3B 1ZIPA 2DSNA 3GD7A 4H6PA 3W04A 4YCLA 1TMKA 2ZRHA 4U8GA 1KVRA 2ZDGA 4GKBA 5JDCA 4MW2A 1EUCB 2F43A 2JJMA 3TJZA 1SC3A 5H02A 2HQOA 5F7XA 1XTBA 1A95A 3CV3A 3T4EA 4YV0A 4UC0A 3MLBA 2FE1A 3UO8B 3WADA 3CIFA 2ALJA 1C8BA 4IW3B 2VJYA 4K40A 3RUCA 1FZTA 1L7VC 4MR8A 1K6XA 2OD2A 1QO7A 2XWSA 5A4IS 1O94C 3BGSA 5B1HA 5DW0A 1V1RA 2WYIA 5FP0A 2F4VB 3EF0A 4IHAA 3O8OA 4DGQA 5CT4A 3BIWA 1XL1A 3OUUA 3IR5A 5BOVA 2B9VA 1N2HA 1DJMA 1J97A 2P4HX 3DOJA 3HPQA 2PO7A 1E4OA 2ZGVA 3OY2A 3PX3A 3X43A 4E0BA 1XAHA 4WLOA 3F8TA 2Z6UA 2HBZA 5KNBD 4XAQA 2NXJA 3IC5A 1HXHA 1XAJA 1PP4A 1WQ1R 3L7BA 1PCXA 1BQ4A 5TVKA 3TINA 3MWFA 3NDJA 5C31A 1E61A 3IBCA 4NOKA 5I9MA 3NFRA 3IEVA 4DXDA 1TFUA 1XCBA 2K87A 2QTMA 3OO1A 3R74A 1KMNA 2QKYA 4NFSA 3NUQA 2AQ8A 1SVOA 2VSOA 3E1KA 3WGZA 4C4AA 1O96A 5GWXA 3ZLJA 2Z1MA 3L6BA 2C59A 3DB1A 4OXRA 2AOUA 4TRJA 2G25A 1CVLA 2IEAA 3MW8A 5E3JA 4NEHB 1NF8A 2Q6OA 1GVNB 4OXYA 2WIFA 2FEWB 3LK6A 3LY9A 2XZLA 1FSGA 3QXGA 5CH8A 1C1YA 2M9MA 4MMZB 5ALHA 1Q5PA 2R47A 2KBFA 4HBGA 5EE5B 1WHSB 5IJ9B 5BR4A 1OY1A 2CF6A 2EW8A 4Q9NA 3R7WB 4E4RA 4EP1A 1DKNA 2W5UA 3CE9A 5DNAA 2VJQA 2W70A 3CWZA 5F77A 3ANNA 2YJ5A 3H11A 2F59A 3W2FA 4B1FA 4C4ZA 5L3SA 4QVIA 4CMEA 5K2OA 3AF4A 1SGWA 4F4IA 5I7UA 2Q28A 2DFNA 4IUBS 3VU8A 4CU5A 1H23A 2OD9A 2FP3A 4O25A 1VKJA 3NORA 2NXCA 4MUIA 3I9MA 1X9GA 4LXIA 4I1IA 4TSRA 3ABIA 3UC5A 3FCXA 2XW6A 3VDNB 2I7VA 1N6KA 1YUBA 3L8EA 4QDTA 3N07A 3TM5A 3WK9A 5AD1A 4O4IF 2H2DA 2YJGA 3ZDRA 4NFHA 2AWOA 3BK7A 5DIFA 4HAUA 3AJDA 1TPZA 2HSEA 5AXCA 4ZVPA 2AKEA 2FPRA 5AVYA 4CXMA 1CP2A 1XTPA 2R6CA 4ZVOA 4HLCA 5JBNA 4CUZA 4H7IA 5EJ9A 2FN8A 3I05A 4H4CA 3G8AA 4RZXA 4JQZA 3VDXA 1IWOA 2I9PA 1YCHA 1H6AA 5TE9A 1N2GA 1NN5A 1IATA 2NYVA 3OFVA 2BI7A 4Y9DA 2I2AA 4DIKA 4EA8A 2G28A 1UPFA 4O1HA 4IFTA 1E3QA 4M7WA 4ZRNA 2IV7A 3O1HB 2CMDA 2OORA 1WY5A 4NJMB 5AK5A 3ER8A 3TX2A 3T5BA 4MYCA 3LPCA 4AZTA 4KO2S 2CB0A 3CNHA 4XB6B 4L28A 5DNYB 3THYA 4ZCMA 1W4RA 4LJKA 2PLAA 4HUJA 4YMLA 1U3GA 3FKSA 5IDWA 4ZCPA 2YR0A 3RRYA 2YTZA 4HI0E 3RIXA 2JFVA 2FZGA 1GPAA 3AHFA 3G7NA 3OHPA 2WWFA 4N7JA 3D6FA 4NDZA 3LGSA 4Q7EA 4OSOA 1EDOA 4II7A 3RRFA 2RBGA 4BCDA 4UOZA 3S2YA 3GXOA 4DZRA 4WZAB 3F97A 4N5LA 4RABA 4N40A 2C4MA 1HLDA 2QG4A 4ALKA 4C87A 3TAHA 2A78A 4KPYA 2PS9A 3AK4A 3EAGA 4M0DA 1PS9A 4OI2A 2JF0A 2ZSBA 3CF2A 3QI2A 5IAKA 1IBRA 1M2EA 1X19A 2AE2A 1FP4A 3AUUA 1NQOA 3BH0A 3EDYA 3DB2A 3IQXA 5I7AA 1XI2A 5JV5A 1VG9B 3BGWA 3JZFA 1CJTC 2OC4A 1H1DA 2PU7A 2R6DA 3DT6A 3Q2IA 4NCXA 5JSKA 2VRWA 3FTPA 2WG0A 3QOXA 1JFFB 1FP2A 2CLKB 2F43B 2UYOA 4REMA 4ZTBA 2GXUA 3X1DA 4LWPA 1M76A 3ITKA 4BEBA 1W4LA 1N5DA 1PFYA 3T1OA 3RM3A 5AVRA 5IHXA 3GGGA 3DW1X 4W7SA 2GAFA 4YDRA 5DHTA 4BV2A 2O3RA 4DA7A 4AY6A 1YQDA 1L9KA 2RMKA 3RTBA 4N3CA 4AYXA 4JJAA 1JZSA 4O4HA 4WZ6A 2EBWA 4O2BB 3ODGA 2CXUA 4D8TA 3K70D 2ERXA 3WSTA 5AJTA 3MUFA 2JD1A 4HUQA 4F5ZA 4K3UA 1G8SA 3BEDA 3DJYA 4FD2A 3ICEA 3L1UA 3E48A 1NSFA 3CBQA 4DWOA 2P9JA 4HLQB 5CVCA 1P45A 5EEHA 4ITRC 3B9RA 3F47A 3ZZNA 4EDFA 3WSVA 1M1UA 4B79A 4KAXA 4CKCA 1JLRA 3F6CA 2HPHA 2G07A 1DRUA 1RYDA 4JP3A 3FWHA 5U1PA 2B6NA 3BWEA 4FGWA 2PKCA 3VDQA 3MA0A 3QQ5A 3WB1A 3T0GA 3IBSA 3KDAA 5ALUA 5EWLB 3CNBA 3EC7A 4HQ0A 5BPFA 4P22A 2R1TA 4NCAA 5TPZA 1UADA 2IP4A 1FX1A 1HLGA 4DLUA 2R4QA 4HEQA 4BWYA 4YYEA 4DMCA 3PGMA 4PCUA 5L3ZA 1SWVA 4YCSA 5CJPA 1KYZA 4RKEA 3SSNA 2R8BA 4EYSA 4G65A 3PC3A 1NQVA 1TKAA 3PEFA 3EGXB 1QO9A 1Z4JA 3P2IA 4QHTA 5AO9A 2WYUA 4LSZA 2VJCA 1VCHA 1ZGCA 2WKWA 2XECA 4OREX 1LVUA 3WYGA 2C2OA 3KQKA 1V8BA 1H93A 1RAEA 2O2XA 2OPBA 5F2OA 3ONWA 4MAMA 1KEEA 3IE1A 1S8NA 5FTKA 3UEOA 4HMOA 1SM4A 1IPFA 2AG1A 1Y3CE 3DA8A 4PYRA 4RA9B 2M6LA 1EK1A 2IUYA 4HWSA 4C4XA 2YUTA 5FWXB 3B1VA 1UZNA 1SXGA 3MUEA 4UDOA 1DDOA 4L4UA 1KEPA 3QOWA 4RHTA 5I47A 4KI0A 1NTRA 3MS2A 3U3DA 4LF5B 1TA9A 3IT1A 5I7EA 4MJLA 4HVTA 5JLJA 2PVSA 2C5HA 3EYAA 4MZDA 2JAHA 1VDMA 1M6YA 1RWKA 1T8UA 4H4DA 5GONA 4QEZA 4P1ZA 3FIUA 5BNFA 4MUHA 4XUCA 3RWBA 4F0JA 2X4LA 1RXCA 4XWWA 1NLYA 5DOZA 4LIPD 4DWWA 4Q3OA 5AW5A 1AK2A 5JZSA 4TMXA 3PNYA 3FDZA 3WMGA 5CDFA 4HH4A 1O95A 2NZWA 2HA4A 3K2IA 1X7WA 3K1ZA 4K8RB 4CLEA 3NV9A 1V41E 2GZ2A 2XUFA 1NXOA 3IUSA 3MTAA 2PN1A 3MS7A 4GZ3A 3B1ZA 4RX1A 5G0VA 3SOPA 1GL9B 4C29A 5HXAA 1I3NA 1Z18A 3LKBA 3VYWA 5LMUB 1LJ8A 2H7XA 5C7OO 3TE7A 2RH8A 1FFWA 4PYKA 1U1EA 2FZWA 3AHCA 1M2FA 4EGSA 4P7FA 1JG4A 1O2DA 2O2DA 4QARA 4R3UC 4LXGA 2GJ8A 1IEVA 4M22A 5DIZA 3UJNA 1YR9A 2AEJA 1GADO 2G1AA 1Y5MA 4G0QA 4DF3A 3JRXA 1JE0A 4NZZA 3JPYA 4GH5A 5CVTA 3QKRA 4JODA 1QRDA 1KKLA 2V9CA 4XD7A 1YU6A 2H2FA 4EPTA 3REGA 2BMAA 3O5AA 4Y6QA 5EMHA 4BO1A 1KI6B 2RHLA 3FYHA 2JARA 4RETA 3BJMA 4KLRA 4PHGA 3R0XA 1Z2AA 2IE0A 3HWX1 1UXJA 1R8QA 3HUDA 1PR9A 5DKFA 1MQ9A 5KJCA 2VYCA 3GLGE 4FJ2A 4LJAA 1ZH2A 3DAOA 1CY6A 3L84A 4N03A 4D0NA 3U3JA 4HGOA 3ES9A 1TU0A 3E3NA 3QE3A 4N0MA 4NAUA 1E3WA 2X22A 1SG0A 1FFXB 2VHUA 5BV2P 2VLIA 2XCSB 2QV0A 2I34A 1U65A 4PWZA 3TNYA 4AKIA 4V39A 4MVJH 4JCOA 1NW5A 1W5SA 1Z6XA 4LJLA 4LV8B 4OI1A 4P5PA 1OCEA 4YBRA 3L8ZA 3V2GA 3QMVA 2M6SA 3W79A 4G5GA 2MWMA 4GKJB 2KS6A 2H1CA 4YAGA 2HMSA 2Q5FA 5KVCA 5FUMA 5BN4B 1L5MA 3CURA 4QGGA 5EY5B 4DV2B 1T3GA 2NV0A 3I2FA 4MV0A 1PW7A 1CEXA 1WEKA 7GPBA 2XMZA 1TMGE 2BW0A 2OKGA 4FHDA 4XSVA 5KOHB 1PR6A 3RUFA 5E6RB 3PRKE 2O1EA 3ZE9A 4CKBB 5ERXA 4OP1A 1N9GA 1JB1A 2G67A 1J9GA 2OCBA 4DG5A 4TVBA 1GV1A 4PN7A 4DSUA 2ZJFA 1RPNA 1GNPA 3KV3O 4FOLA 4O2BA 1IVYA 2WP8J 4GQIA 4HUQB 4U7TB 3NH9A 2B20A 4LBWA 2PH5A 1T1RA 4BNYA 1UM9B 3EVAA 3OZ7A 5G3YA 5KJ6A 1UBGA 4CFSA 1Q1AA 4ODIA 2RGGA 5TT0A 5ALFA 3EZ7A 1B6GA 1U04A 1WVGA 4PW0A 5H81A 4AS3A 4Q3KA 2PLFA 3IP3A 4IEIA 4LDNA 5FTMA 4Q16A 3GOQA 3IHKA 5CT6A 3W1EA 1JQDA 5AHOA 1YB5A 2WA1A 4JJ4A 2GS9A 4RIFA 1F1JA 1NVFA 5D3KA 3KBOA 3SWWA 4FGJA 4AF8A 3ODPA 4BQNA 1Z5WA 1Y7IA 3VC1A 1Z4OA 3AVPA 2EV9A 4IX1A 1KZ4A 3K05A 3ZQJA 2WOJA 1W96A 3DAFA 3GYGA 3LYLA 4ARVA 5TT1A 4FNGA 1KRXA 2G6BA 5F1KA 3QVLA 3VOSA 1VRCA 3SBDA 1K4KA 4LSWA 3I01M 5BSGA 1LVGA 2PRSA 2WTXA 3JYLA 3O6VA 5AJWA 1NVEA 1KOFA 3VA7A 5HDQA 2VG8A 4AYTA 3ZZTA 4IEEA 4DMMA 2VJBA 2A9FA 4WNIA 2O5EA 1OH8A 4QNMA 3T52A 4DARA 2Z5VA 3M3HA 1G6HA 4LA4A 2ONZA 3K1JA 3L6EA 1JI3A 2XCQA 2HQSA 4URFA 2PWYA 1WJGA 1H3FA 3OPMA 3AUYA 1A8IA 2GLTA 3QFTA 5DX1A 4Y9UA 1THZA 5T6BA 3SAJA 5HRAA 3C6BA 1RXUA 4IJKA 5BQ5A 2B3DA 4YB8A 1RLUA 2EGGA 3RFVA 3TLYA 4F9FA 2CBXA 5KWSA 1PWYE 1TO6A 4DUYB 1YACA 2UVPB 3HO6A 4AJPA 4TLEA 1EFRD 5T4BA 4XLLA 3B5EA 3URMA 3DMGA 1F3OA 4HBZA 1UK6A 3RIHA 2XTNA 3OD1A 5CVEA 5GADl 4DG8A 3DFZA 3RUDA 1G8JA 1NBWB 3T7KA 2DC1A 2ZPAA 3IR7A 4C3UA 3AM1A 4KHPB 4BJ5A 3TD6A 3KKZA 1Q3TA 4F2PA 2Z5GA 5C53B 3FG9A 3D8RA 4NABA 4X24A 4WW0A 4P6VF 3GDWA 4R5HA 5A4AA 4RLFA 3DOCA 3STVA 3T35A 3G5LA 5HZKA 2H48A 4CEIA 2PT9A 4FMBB 5J43A 1PE0A 1W44A 3OPYA 2C8VA 2WWXA 2H1FA 1PI3A 4MO9A 1TEZA 1MB9A 1O5TA 4QTXA 4Z3DA 2Y6UA 1QF9A 2EKDA 3QLUC 3UMSA 4MUYA 4BUCA 3ZD6A 4K86A 3M4XA 4N41A 2W2LA 4KSCA 1KZGB 3W77A 4B4OA 1RQ7A 3CGGA 1XZDA 4TSKA 4NEGA 4ENTA 5AUNB 4JDUA 4DCPA 5FH9A 3VKVA 1E2HA 2ZIXA 2X23A 3WISA 5KYKA 1ZMBA 3E8SA 3KCNA 4RTNA 2ID8A 3INRA 2ATCA 2Q5LA 4MKIA 4RD2A 5LQRA 2HLDA 3LUFA 3UAXA 1G2QA 1K6IA 1T9GR 2D5BA 3PNVA 4OB8A 4PR3A 3UA4A 2YQZA 5IYZF 3Q8MA 2PQMA 3K96A 2JBAA 4INAA 3THWB 1NV8A 1GT6A 3LQKA 4I5IA 3QVKA 4FYXA 4Q18A 3WBBA 2O2JA 3GFTA 1JKJB 3MTJA 4QOFA 1FFXA 1JJ7A 4JP2A 3H1BA 3D4BA 3PR2B 3T9EA 3WKBA 1WU8A 1I6WA 4UCFA 4IIUA 4A91A 1QZUA 4CIVA 4D5EA 1YB7A 4BEVA 1T1EA 2J46A 3WJ1A 3L40A 1JP7A 1C3JA 1NQUA 4FM9A 1FU4A 2J3DA 3G9TA 3EIOA 4BTEA 4B7AA 4FFMA 1Z36A 4S35A 4B74A 1FFEA 3RRZA 2ZLBA 1QNFA 2B2NA 1N4DA 3BMCB 3I4CA 3JWEA 3PGKA 1U63A 3EXEB 4EI9A 1JEJA 2Y68A 3ANXA 1U4NA 4RMJA 2PZMA 2ZZMA 5IM4A 1RU3A 1NE2A 1G16A 3IHTA 1ZC3A 2W7TA 5E6RA 4CKBA 5K6AC 2OCLA 2HIGA 2BJWA 2ZKIA 5C8VA 2BHSA 4LYGA 1BMFA 1W30A 3BHNA 1DQSA 4BLRA 1B0UA 3B2EA 1F2VA 1S8OA 1S9HA 3SJBA 4DM3A 5GTDA 2FPSA 5J47A 2R48A 3QEMB 3VKHA 1JIUA 4QIHA 4WL0A 4BP8A 2H08A 1PF7E 2YXDA 4NIMA 2QRUA 4ZJZA 1RMYA 4NWIA 4LHSA 3PA8A 3PQ2A 4MIKA 1R4NA 4WXPA 3V2IA 1BDHA 3GARA 3ZNPA 3GA7A 3RVNA 4NJEA 4D5GA 3VPFA 1V5FA 1XWWA 2BFOA 4GPTA 4AZ0B 2BBSA 2UKDA 3M34A 2QX8A 1N2JA 5DULA 1VJDA 3ASVA 3GP3A 3FN4A 4S1TA 1KQOA 2EZUA 2QYHA 5AWFC 2QVYX 4JP8A 4AY2A 2FJPA 1KDRA 1YA6A 4J1SA 4ND1A 4OKIA 5I9BA 1N36B 3C1OA 3BE6A 1YL5A 3BTSA 1GTMA 1EI9A 3EX7C 3H5TA 4AJJA 2HRRA 5JAZA 4B6GA 4CFZA 3VZRA 5IU6A 2ZJZA 2RGNA 3EA5A 1C7JA 1GT91 4FNMA 1PAUA 3VHQA 4BFSA 4F46A 3Q8WA 1IQRA 5KVVA 2BGKA 5JYCA 2FMKA 2VDPB 5IVKA 1UKZA 1JHZA 5C5IA 4RY0A 4B2IA 1DTWB 3VNRA 3EMDA 5FA6A 2P4UA 2AG6A 4AUNA 2CW5A 1BHO1 3O2QB 5CM2Z 4H4EA 1Y4UA 2K7FA 3MELA 1TEHA 4PC3A 4TKLA 4NNPA 2I99A 2IYLD 4GL4A 5K0FA 1T6YA 2WHXA 1Y3IA 1ZR4A 1C0EA 5ALEA 5CHEA 4Y6RA 3ROTA 3C3EA 4E07A 1GZ7A 3GUHA 5FOWA 2RH5A 1DBQA 4DQ0A 5AVZA 3HYTA 1TT5A 4CN8A 1LDYA 2BV3A 5TV2A 4UFNA 5ESRA 4OATA 5JVDA 1I5EA 1NX6A 1ZBQA 3ML1A 4UXIA 4CR8A 4X3CA 3W4KA 4N49A 1U7OA 4EGAA 1S1CA 3EVTA 3PQ4A 2O14A 3FR8A 1R16A 3KQVA 3HABA 3LDAA 4IPTA 3ZCSA 2GZDA 1E64A 2B1JA 3G5UA 2D2FA 3E0QA 1JHPA 3FCSB 3R7DA 3ZS8A 1OILA 2QTVB 1PFUA 2I5PO 1QH0A 3H4VA 4URYR 4D0SA 3FFAA 3WK5A 3FVRA 2VDJA 2RCNA 3RJZA 3AKZA 3LVBA 4Q4AA 4DCJA 1IULA 1Z2DA 3BTVA 3EZLA 1EWQA 3STYA 3AG6A 2C97A 2DZDA 1YHNA 3W05A 2F48A 4AY5A 5JJCA 1ZIYA 2XYVA 1NW9B 2B8JA 1E3IA 1OWMA 4GLJA 5JCPA 3R24A 2JKZA 5IJ0A 5KNBH 1N0WA 4JUCA 1K4MA 1N2CE 3IOYA 3JATA 3RWOA 3K3PA 4LF6B 2B4TO 3LSTA 2FPGB 5DB4A 3N39C 4HV4A 3UMMA 4PQGA 3TCXB 3BRSA 1C0PA 2BBOA 4WERA 5CK4A 3D5QA 9MHTA 1FDVA 2DHDA 2PXAA 1OYYA 1PL0A 1T6ZA 2H07A 3CZMA 3QNUA 1DIBA 3OZAA 3C6ZA 3EODA 4OFBA 1ZH0A 3LFTA 3RS4A 1CE8A 3ZXSA 4RGQA 1E2MA 5D87A 1PQUA 2CLHB 4CLOB 3OSZA 2D1FA 4L75A 1Q7TA 2HNKA 1R9NA 3EIFA 3V6MA 4ZAZA 2F3SA 3KEQA 5FV7A 4QJBA 4WASA 1XK6A 4MQ6A 3SVZA 3JZIA 1K3FA 3RRMA 3HP7A 4K0KB 5FX2A 4HAOA 1BW9A 2NUPB 3GX1A 2NYRA 3KLBA 4J6EA 4FFSA 5I7SA 3E03A 5ULLA 1RZRD 1L7MA 1LNSA 1LVHA 1M7GA 4X3PA 4BU0A 1HFEL 1JIKA 2PLNA 3H3FA 4MI6A 1E3MA 1CY0A 1QVVA 3JSAA 3I1IA 3GFSA 5HGXA 3ETEA 4KR9A 2BD0A 3IVRA 5IAOA 3FHCB 4IIVA 5DBFA 4G1EB 5FPTA 3D2BA 3PUWA 1QGZA 5ARBA 1K6EA 2OOKA 3KK0A 4UZFA 4KBYA 3W5HA 4XOIA 2X0FA 4A36A 2LE0A 2WFLA 2IH5A 3QUBA 5FCDA 2VSXA 1D4ZA 1KI4A 1WRBA 3GVHA 5DXJA 3TDNA 3TNJA 1Z6YA 1W47A 4CF3A 1L7EA 3JQFC 4P08A 4EG7A 1TIBA 2IPLA 3IESA 5FOSA 4BLVA 5HUJA 5JVDF 3BF8A 5FJJA 2AFIA 2Q1XA 2CUTA 3L1HA 4AZ0A 1OH5A 1VRVA 2WJ4A 2QK4A 2WTBA 3I5UA 3QUSA 2O0MA 4AMBA 4RDHA 1Z5NA 4YQEA 2B4KA 1DP4A 1JHOA 3FFTA 4X7RA 2ZYUX 3HB4X 2KI5A 1O6CA 3ZXYA 5DLDA 4DXHA 2E18A 1DT3A 1TVKB 1A77A 2ERCA 2ZIWB 4FPXA 4RJJA 1N6LA 4Y7DA 1ABEA 3PFNA 4ZV9A 1DWPA 1CY1A 1FYVA 1XZ8A 1Z7BA 1LJUA 2E7ZA 2QSYA 1YZHA 2QN3A 3B5IA 3ND7A 1FRNA 3O90A 3P9YA 3Q11A 4PYMA 2VHXA 1I8TA 1OSNA 3ESZA 3DHYA 2H2GA 4H3HB 5F7JA 4BFLA 1G4HA 2Z43A 4YUAA 4Y0VA 3KT0A 3D1LA 4Q3DA 5TDHA 4BWFB 2PBFA 4KYVA 3H0CA 1F5SA 2BSAA 4E22A 1H6DA 1XU9A 2QE6A 2QYSA 4KXXA 2P0EA 5ALGA 5HF5A 2X14A 1W0KA 3LO8A 2AXQA 5JU6A 1U0FA 1UMCB 4ATNA 4LS3A 5EFZA 1OXBB 1QYWA 4CZ2A 1HYHA 4JMLA 2QYTA 1H0KA 3BTUA 2GBCA 3A4VA 4IIJF 5E95A 1JJAA 1L5QA 1Z4MA 1N3LA 3N6XA 2AJBA 4EY3A 4WGGA 1U6IA 4PZPA 4Y6PA 2NU7A 4WKOA 4RTJA 1IHUA 2VJMA 4RD6A 4FMPA 5B30A 1TA4A 3TDMA 4OXIA 3GO4A 4M6WB 5D5PA 3WLFA 3LVFO 4WLVA 1H5QA 3DLBA 1HMPA 1NP6A 3OX4A 2YHAA 4QJ3A 3OJCA 2H1LA 2OM2A 4X93A 4JXXA 2YW2A 1HNZB 2C9DA 3MIIA 2JGRA 3CX4A 2QUZA 4RNCA 5IG2A 1TL7C 5H4GA 3F67A 3RABA 1FXSA 3BB4A 1XQ6A 5DSXA 2QUBA 3CSSA 3L6CA 3CKLA 1YZNA 3BRWD 4CUKA 2QG9A 4BKRA 2JVKA 4YJHB 4S12A 4YCNA 2PMCA 4LYEA 1C14A 3QU2A 4A6PA 2QXUA 2JI8A 1S2NA 1DKUA 3DMYA 1LX7A 4OQNA 4QFCA 1IZZA 4XM2A 7ADHA 2YOHA 5ICGA 2HNBA 4HVLA 4NS1A 2NVUB 4OJQA 4XUEA 3QBTA 1UKBA 2XVXA 3ABOB 1T9BA 1EIZA 1D2MA 4LZWA 5AKLA 4PQRA 4M0LA 4FYYA 1ESEA 3ZJ4A 4W5QA 1N1GA 2XHZA 1SD5A 2EGUA 2B6HA 4YJ3A 4EYQA 1EGQA 1YOVB 2TECE 3M5WA 4K81B 5C8YB 1UJCA 2XYGA 4ZVUA 2GBIA 5FF9A 4P58A 2VTEA 2R1VB 1NYLA 3N75A 1U7PA 3PITA 5CT9A 1M75A 2X1VA 1LLCA 2VKQA 5FB3A 1ZHFA 4MO2A 4WOCA 2AJ8A 3EDQA 3A6GA 3MS4A 4MWSA 1EB9A 4G26A 3EH1A 4UBNA 1T5DX 4ZOLA 3R75A 5B4TA 1XQVA 5TNXA 3IOMA 3AM3A 2H65A 1JRLA 1O6BA 1ZRNA 3F6SA 4DMKA 2J3KA 3DDSA 1KAOA 5FHQA 3WRXC 4A03A 3LRTA 1K7XB 1E99A 5H68A 5AW7A 2OGWA 1GSAA 4KQXA 2UZ0A 2XAAA 1DPFA 1J2YA 2X40A 4K6KA 4GEKA 3FBTA 1RWMA 3RAEC 4J90A 1GDDA 4LTNA 5TR9A 4EI2A 3QFCA 3FNBA 1ULSA 2Y1FA 5EIWA 1YMVA 4ZVVA 2FWPA 2IL1A 4K2AA 1T9DA 3VH3A 5B7NA 3LC1O 1Y4ZA 2WM9B 3RVBA 1QU3A 3A4TA 2UUOA 2ZUUA 3CBGA 4IDHA 1RBYA 1AN0A 3V7NA 1P39A 1ZVQA 4DDVA 1ZWKA 3EGWA 2VFAA 2BMEA 3L05A 4GPZA 4NQZA 1LPBB 1GRVA 5G4KA 1H5NA 3C14C 1XYVA 3KX2A 1HYBA 2XRFA 2V7EA 4HN4B 1GRQA 1ZMTA 1X2BA 3GEIA 2W2LD 3NJ8A 2PKWA 3ROFA 3F3KA 3JTMA 5IHPA 1L4KA 2R8OA 3ASYA 3KJHA 5LDHA 5HZHA 1UXHA 2HTFA 1KO8A 1SKYE 3KJIA 2GA9A 4NLLA 3UT5B 2QM8A 3O26A 3W5DA 1Q7GA 4G5RA 3BE5A 3Q87B 1FTQA 4N3BA 3T7RA 1O0SA 1QLHA 4IP0A 4QUEA 4FYVA 4YAJA 4S24A 4GOMD 4AG5A 5BV1A 2IDKA 2Z2JA 4PG5A 5BWNA 2JD2A 1Y48E 2L18A 4TXMA 2GXQA 2WJYA 3INYA 4FQ7A 4RY2A 5LA6A 3MBOA 5L4SA 3THXA 1NRWA 4O6VA 4B3CA 1FL9A 4LVNA 1CUBA 2ZYTX 1T5IA 3LUJA 4XR9A 3NOQA 3W3AA 4Z7NB 4DPMA 4NENA 3CFYA 3GZ4A 4HK4A 3GGCA 2QQFA 1BO6A 5IAGA 3N2EA 2N42A 3WV4A 4W1RA 1WVIA 1X3LA 2FTKE 2V6MA 4V0RA 4E32A 3PFBA 2BHLA 4QRDA 5JI2E 2QUKA 5F3WB 1PT8A 5CNMA 2FGJA 3SS9X 3DTVA 4HEA6 1GTG1 1R8XA 2BVNA 2VTVA 3G0DA 1ODLA 3BFJA 3PUZA 4OGGA 4RLSA 3SF8A 2PCLA 2TRSB 1CQWA 1XGKA 2PL1A 3HCPA 3D6MA 4B34A 2VCYA 5GJBA 2W93A 2CZQA 3QUAA 3RVLA 2GN4A 1WBJB 1DG1G 3DL0A 4DHWA 4F06A 1ZM2A 1EX1A 1C1XB 1I6KA 1WVMA 3GVPA 3M9XA 4BN0A 2IHVA 4JYAB 3Q98A 3EHDA 3C3XA 3HXLA 1QGAA 5LBTA 1DUIA 1P77A 1Q83A 3F0TA 5HGJA 2YJ6A 16PKA 1GZ5A 4BLWA 3NEJA 4AMVA 1JBQA 2ZTSA 5HCUA 1DJLA 4ZAXA 3TK1A 3NRCA 4WK6A 2XNJA 1RM3A 2JH9A 1IPHA 2EG9A 2ZI7A 5FNVB 2QBYA 2CLOB 2WE8A 4TTVA 5KQSA 1NKSA 1H65A 3OOWA 1WKBA 5J3JA 4DR3B 2RD2A 1RXYA 1RNLA 4NYMR 3BERA 5FOUA 4MEAA 4RVDA 5GP1A 2AOXA 5KTRA 2BMWA 1BFKA 4RXTA 4YRSA 2Z9DA 1M34B 4NMLA 1R0WA 3T3PB 1CQIA 9GPBA 3QPUA 1M33A 4BVHA 4FDLA 1DRVA 1ODFA 2WMOB 2RHHA 3B82A 5DSZA 3FOEC 1ZK4A 1D7AA 4KIJA 1JLHA 3UWMA 3VO2A 2NVUA 4LF4B 2FGKA 1XEXA 3PLNA 2W6JD 1LSOA 2FUCA 1Q77A 3GPIA 1OBOA 2HOQA 3LQ1A 4JLPA 3GJ6A 4MB6A 2OFFA 4UW9A 1AQ6A 1QWOA 4BYGA 2IZZA 2XUKA 3ZDDA 5F12A 3BCRA 3TOZA 4K88A 1ZIOA 3JQGB 3DVRX 2PH7A 3O31A 2PRIA 3NHRA 4YQZA 2OP0A 4DLYA 3MJTA 4K9OA 3OX2A 3JQ7B 4XWAA 3UIEA 4B2LA 2DXIA 5GY7A 3ZD9A 3IDZA 5BSWA 4MUMA 1T9AA 4Z4QA 2R8XA 4TS3A 1F2TB 2XA2A 1GZVA 3TO5A 3ZLBA 1L1RA 1QSGA 1YB6A 2DCUA 3E35A 3G8CA 4TYWA 1QYCA 1Z8NA 2Z04A 4PFQA 3I1YA 2V9ZA 1J0EA 1HE8B 1P7PA 2JIDA 1JHRA 3RIYA 5ER6A 2REQB 2B92A 1WP9A 2PS1A 1H22A 3PYMA 2VJPA 1F5NA 5ESDA 4EY6A 1T2FA 2O1SA 2PUEA 1VYVA 1F06A 1ZI6A 2H5LA 4EPVA 1XKTA 2FOXA 1GIAA 4ZCSA 1ANKA 3EW7A 4JUIA 1YVEI 5DU2A 4E5YA 3WRYA 4PCVA 1TD1A 5DJ5A 4UBIA 3G2OA 2EP5A 3LLVA 4INPA 1EVKA 1H0RA 5KJEA 2H31A 1NUTA 5G4KB 2OBNA 1W5TA 5K45A 2ABWA 5K7SA 1Q14A 2WSIA 4PZ9A 4Q7QA 5TF4A 2JLZA 1ZZGA 2PZJA 3G2PA 4JJKA 4PAGA 5JDCC 5HIMA 4XQEA 3SHFA 5CURA 5K01A 3U1VA 5E9WA 5BWCA 2CYCA 1IDOA 1EESA 3UT5A 2FWNA 4UULA 4F38A 4E11A 2W6MA 1XCJA 1XP5A 1SXJB 1UFKA 4I5DA 4LYFA 2HQ1A 1L4BA 5F5NA 1NMYA 4CCWA 4YAWA 2AX3A 2PD4A 4N3AA 5AI0A 4EF5A 2DQSA 2VRNA 2EC5A 4HXEB 2C94A 4EYGA 4C0WA 1FRQA 5J4KA 3ZHUA 3A7DA 2FCAA 3GY0A 3WK4A 5FBZA 1KEWA 1N2EA 1YI8A 5DM70 1KMIY 1ULZA 3N8IA 3SP1A 3KQLA 4E33A 3L41A 3RLFA 2WG2A 1D2NA 5F64A 4OQLA 3EDCA 3KPWA 1DQPA 3KOMA 4KV9A 5J2UB 3DWFA 1WPXA 1OXVA 4NZNA 4WUTA 1Q20A 1FVHA 4RKFA 1WB6A 1ZITA 3IE0A 4F1KA 1FUYB 3NB0A 4IDFA 3DS8A 5AOBA 1U9YA 4A8JC 5CG2A 5J1SB 5GIPE 4ZQIA 2UUAB 4JV5B 1Z39A 3KAPA 1FDSA 1GFWA 2ODWA 2EG5A 3D54D 3NIDB 3NXSA 4PVDA 1KQFA 4OLFA 1UFRA 1U3VA 2I62A 4IHJB 4OUDA 4EHKA 3ADPA 4JI8B 1EVYA 3UWOA 1E1CB 3SLKA 2WF6A 4YI3A 4YP6A 3N7UA 1CVIA 1V8OA 1ISIA 2GHTA 3HKBA 3QNWA 2X2OA 3DFKA 1O95D 4QPDA 3O21A 1AK1A 2BBTA 4JBNA 2OBLA 5D2CA 1EBBA 3PHLA 3U56A 3PDIB 1QAOA 3AB8A 1JFSA 3WMWA 1ZUIA 2GZSA 2HA3A 3EVDA 1MOZA 1MX9A 2X4IA 4HADA 4UE2A 1SWWA 1YUMA 2GZRA 5JTTA 4FEGA 2BH2A 4GMFA 1UL1X 1G7CA 1UOOA 2AFHE 2G17A 2X86A 1UP6A 3L0CA 3PNKA 2OCPA 2QLBA 3JQ9C 5GZ6A 1U0BB 3CVOA 2ET6A 5C34B 8LDHA 4HQFA 1W9MA 2AK2A 1RHRA 5H0IA 1G3IA 2LXNA 2P75A 3LQ4A 3EPLA 1RC0A 3CUEF 2JGDB 1J90A 4D8WA 1CQIB 3FZGA 3OLZA 5EZYF 2WG1A 1HG0A 2G0AA 1YAJA 1EQ2A 4J3FA 4AP6A 3DQPA 5K8TA 3DT9A 1HLFA 3IIIA 1W5FA 3T9DA 5IUJC 3EFOB 5HQJA 4L85A 4MRMB 3DOFA 2GK7A 3JYQA 1MT0A 3ZWDA 1I4TD 1NQAO 4HS9A 5K0CA 1DIOB 5EP4A 1RRGA 3NBXX 3FSEA 4P98A 2FZ4A 3COJA 3OM0A 2QA5A 4E7OA 3D7RA 1GM5A 1S3SA 4TV8B 1W7AA 2XA9A 1RTKA 3EQ8A 2WWVD 1U7XA 2P6OA 2XA1A 4X44A 4NQRA 1OT3A 2AFHB 4H17A 3O47A 1ONBA 2HJ9A 2XB9A 4LRWA 5LU8A 4P0QB 1XXLA 2Z8ZA 3H9UA 1GSOA 4Y18A 3JQ9A 2IU0A 4CF7A 1F2TA 2MR6A 2XUIA 4JLBA 4KE7A 3RE1A 5TGZA 4N5NA 2B83A 2CCKA 3D1JA 3LXRA 1AS3A 1KRHA 3LUBA 4XKJA 1U80A 3FTEA 1MO3A 3RH0A 1WOYA 3LLMA 4JUFA 5IKOA 2ZB3A 3ZBUA 4AICA 3LBYA 4G8BA 4BGEA 3B20A 5DK4A 4EZEA 3FNRA 4YREA 1U2GC 3IGFA 4XIGS 3K1TA 4U7HA 2XT9A 1Q21A 4MR9B 2EKZA 2J7KA 4R2JA 5IDQA 1I14A 2VT7A 5D3ZA 4R8MA 2O07A 5ENDA 1U8AA 3CW8X 3JAWA 3HGQA 1KDOA 2R79A 3NHUA 2GHIA 3V34A 3V4OA 4XIIA 1X1SA 4E5KA 1DWQA 3WC4A 3WFZA 3DZ8A 3IO5A 4II3A 4M0EA 2HHAA 3P32A 5JECA 4KXFB 3FUVA 2ZYWX 5DTIA 2J6HA 4PNHA 3FYUC 2OAGA 4GXTA 4QBIA 1BEUB 4LGCA 2OAEA 1F3LA 2H1IA 2Q5IA 2WJAA 1YRWA 3P5BA 1UT8A 2ROQA 3NHYA 2GETA 4PBRA 2WFZA 4ETWA 4EFNA 4MJXA 3E81A 3P96A 4C2TA 5F2KA 3PX2A 2FK7A 3QM1A 2YY6A 2A94A 1V37A 3FXAA 1Z83A 5EN4A 2F8MA 5ADWA 2G5GX 3NDBB 3D8BA 5KHAA 4ARBA 1N6OA 1H2WA 1CJCA 1P9OA 1XAGA 2OORC 2FRDC 2QROA 2MSDB 2R751 2OV1A 4NFYA 2CHGA 3QMMA 2BUCA 1ULHA 3DNFA 2A84A 1SHUX 3DKIA 3HHPA 4KOAA 4B6RA 1IZ8A 1XYGA 3M6IA 2ASEA 1KY5A 1LZKA 1VMIA 5KQMA 2VAXA 4M36A 3GLFA 3UMYA 2YWGA 3AMVA 3Q3CA 2FQYA 4EQ6B 4CTJA 1U7ZA 3GP8A 1T1GA 1WG8A 4KH0A 1TVMA 3SDBA 3SSMA 4ZHQA 1AQNA 1BU8A 1NM5A 4PO3X 3I45A 1MP0A 4DLWA 1BDIA 3G0HA 1E9VA 2VR1A 5TPWA 3HBMA 5J2TB 3LP5A 3S5UA 4H16A 1X8JA 1BROA 2O2HA 3F7NA 3N9IA 1AIPA 4A3SA 2QOEA 3NJRA 1A27A 1MB2A 1I7NA 3RVPA 1TPYA 4OQZA 1FFCA 5DYNA 3LYAA 3HKBB 4RZIA 4AIIA 1I2ZA 3CJTA 2JK0A 4HGZA 4F4HA 1XMXA 3NTOA 2BFBA 4G23A 4BECA 4GX5A 3E7PA 3CVWA 1F8GA 3WGJA 1OJLA 3PDIA 2X7XA 3PT9A 4QX6A 1QLWA 4G9BA 4UM8B 2ZIGA 1X9IA 2RGNC 3AF3A 2VVTA 2NIPA 3E5RA 4X1YB 4B8YA 4WESA 1YIAA 3BILA 3GVIA 3I23A 2Z2ZA 3NHLA 1IE3A 3LAWA 2NNLD 4IGEA 4LHYA 4TWZA 1QIDA 3T95A 5JJBA 2YKGA 3QX3A 2FZ5A 1M6WA 4U39A 4AI6A 1DNPA 3SCZA 3W90A 1H9BA 2D54A 4P3OA 1KDPA 4QA9A 4RGBA 1QTRA 3S28A 5KYUB 4TTQA 3BYZA 1O6FA 1P6XA 1NRJB 3SNHA 4H2DA 4W5NA 3WGHA 3V8EA 3KQYA 4GICA 1QBKC 2E87A 3LYHA 2WAYA 4I5EA 3HGTA 2WMNB 1NW7A 2XDYA 2ZRMA 3PB3A 2E37A 1AVTA 1ACMA 3GNQA 4FDTA 4QOHA 3FSGD 4D9GA 2FSGA 1E6LA 1VE3A 1Q1BA 1P4GA 1ZMOA 4JI4B 3ZH9B 1KRWA 3DEHA 3ADOA 2C54A 3JQQA 1IN4A 3TJMA 5EIOA 5DWQA 2AYXA 3D0OA 1SCUA 3OEYA 5DMXA 5C9ZA 5AHWA 2O06A 3U6BA 4J0JA 5AR1A 3FWNA 1ZRSA 1KJWA 2HK7A 2P4SA 3HRIA 3NBMA 3H42B 1TCUA 1KEUA 4YMWA 3ZOZA 3MCAA 1J1UA 1JDZA 1E77A 1PGPA 1OIVA 2RKWA 3SZOA 5A5GA 5KHOC 4J8PA 3KQHA 1KEVA 2JH3A 4FFBA 3IQZA 4ZMBA 2Q6IA 4FJ0A 2IQIA 5JS8A 2GA8A 3JQPA 4ZQEA 2G9VA 4Z4EA 2B4AA 3HLYA 4D7AA 4L5JA 2D0PB 3F6BX 1PS0A 2IDMA 3NGMA 1GQRA 1U9IA 5FPQA 2ORYA 5ALQA 5AESA 4UJ5A 3KKLA 4K6CA 3GJQA 3M83A 3QHQA 2OB2A 4D4MA 1E2IA 4RMGA 2VH1A 5AW4A 3D8SA 1OLSB 1YUNA 2WQ6A 2WUFA 3C4QA 3SIPA 2FG7C 2JLRA 1IBLB 3LA6A 3ONEA 2XPCA 1Y8QB 4BX9A 4JK3A 1GCIA 3TX6A 1JN0A 3C6XA 3KV1A 3R7SA 3TUIC 3VUEA 2DWPA 4B2YA 3KB6A 1GNRA 1D4FA 4QFDA 5H5JA 1DIHA 1W0JD 4JR0A 4YJGB 1HZZA 4ARAA 3ZW9A 2I4RA 4DEVA 4E09A 5LNK6 3GGPA 2Q2WA 5HOEA 3QE9Y 3R9XB 4OUKX 5BMOA 3IBGA 3KIPA 4DWJA 1E4YA 1HDEA 1Y63A 1BS2A 2XGJA 1II8B 1NVUQ 1Y1SA 2JAUA 4RD1A 4U9UA 5AI5A 4Z6KA 3M6LA 2GKGA 4CLHA 5LXTB 3ZIUA 1ZL0A 3DFUA 3NONA 4D4KA 5E4TA 1KZ6A 3UUFA 4E7PA 4WHMA 5CLJA 3DGEC 4KJXA 5IXSA 3EMVA 4C22A 1OFIA 4TMKA 3PFWO 4IXWA 4CT4B 1WETA 4FXOA 4IX9A 4A0HA 4UPDA 5ALVA 5B5SA 3LHKA 1HDXA 1KORA 3MJ4A 4EHHA 1JR2A 3TQFA 1NMZA 1RI1A 5L9AA 3D0QA 4OHZA 1G17A 4C4OA 4E1AA 3RADC 3U6KA 1H69A 4QG7A 1U81A 4YP0A 1Q0UA 4E12A 5EJ2A 1YDGA 1DQYA 3P9IA 4F2WA 1SVSA 1GG5A 1NW4A 1SBQA 3OQ6A 4JGIA 3VNQA 3EBOA 4UUMA 2JKVA 4QAJA 2JAQA 3VNAA 3VPBA 3IAFA 4B48A 3BF7A 4FSHA 2EWMA 3UB3A 4P92A 2PUDA 4TWAA 4WXEA 1E0SA 5JS6A 1U02A 2JI6A 3OZVA 4HDMB 4UAGA 5TPWB 1KP3A 1DUSA 2VH5R 4DV7B 3MINB 1WD7A 2O6HA 4AXXA 3DSRA 4Q6WA 5KYVA 1QF6A 5FUVA 1R0SA 3BS4A 4D9HA 2XXAA 3GUZA 4X8HA 1V25A 1RKQA 1Q2UA 3G85A 1J00A 3QH4A 2FETA 1L7BA 2Q50A 4O2AB 4Q9LA 4C0AC 5A1TA 3VNUA 4LHZA 3ONDA 3MWJA 3W6NA 3ZE0B 1YJ8A 4A82A 2JDID 4P81A 5MFPA 1U2DC 1SY7A 3L8YA 4FCVA 4CIXA 4L57A 5K1ZA 3CLRD 4AMZA 4BNNA 5C3MA 2OG2A 2ZIVB 3HEAA 4QDUA 3PC2A 3M8KA 4RH3A 4KK4A 2V98A 1JTFA 2WMYA 1BWRA 2L42A 3A31A 1V95A 3RS0A 5H8WA 4O4LA 4FGLA 2HNAA 1I3KA 5FI0B 1Q44A 5KYUA 1DZ3A 1IHOA 4DHEA 2P5SA 3LP8A 2H3EA 3BIJA 1KC1A 1QYVA 2QVCA 2XB4A 4G01B 1KVTA 4QUHA 4J9UE 4XJVA 3UHPA 5JQWA 2CY0A 1J2RA 4Q21A 1ZIDA 4RKYA 1T8WA 4FD3A 2GUGA 4L4RA 5FWYA 1NBIA 4AKSA 4QQRA 4FHFA 4CGYA 4Z4IA 3U1BA 2FCRA 2ARKA 2HFKA 3IL2A 4MV3A 4PX3A 1Z34A 3F5SA 4C0BA 3D64A 1TCVA 2P65A 3SN6A 3TN7A 1BXGB 2PGNA 3OIWA 1M8KA 3KALA 3PWTA 4K28A 1LDGA 4GVPA 3D6AA 1DQNA 2MMCA 3ELDA 4UTPA 1LW6E 2C5LA 3WIEA 3AF1A 1UP4A 2WC1A 1G60A 1L4MA 4JA0A 4PE5B 5AK3A 2Q3BA 2MTBA 3Q8XB 2HCTA 3MB5A 3R20A 3ZWOA 4LX8A 4NE2A 5JNLA 4RMIA 4KFRA 3DMHA 3IB6A 3HE3A 3ZDEA 2K6GA 4RELA 3VPDA 2O0LA 4LRUA 2R1ZA 1NVWQ 1P7VA 1GSIA 1RLMA 2AQHA 2Q3HA 2P68A 3Q6MA 5BYKA 1WSWA 1K2WA 3N76A 3CR8A 3IT0A 3STWA 1XTQA 4OK3A 4QU0A 4UUQA 4WACA 4NR0A 4E5VA 3AC0A 2IHTA 3PE4A 2B98A 1JECA 3MC1A 4JB0A 5HCNA 2DP4E 4TZ0A 1PO7A 2Y1EA 4OJNA 5DLYA 5I3ZA 5I7OA 1I94B 3GMTA 2Y66A 3A6FA 1Z12A 3A9UA 1Z13A 1KIMA 2QIOA 4G4SO 4EEZA 4TKMA 2BGNA 4WN3A 1F12A 3G9XA 3MGBA 4QGFA 4WLFA 4IIFA 2HXYA 4AS2A 4CM5A 4HDCA 4PSKA 3VJLA 3F3MA 4QEKA 4ZPXA 2AW5A 1IK6A 1SU6A 3F4LA 3FCUB 3W6OA 4ZYTA 3R9XA 3R7AA 4RL6A 3GVXA 3K6RA 4BRSA 1DOAA 2OFWA 4REQB 1W0CA 2D7JA 4NZOA 1UJMA 2W2PA 3Q1KA 5CVDA 2BFEA 4H0NA 1Y34E 2UYYA 4GKVA 4JC0A 1QHEA 5LDDC 4ES6A 2C7GA 2IHNA 3HHEA 5FR1A 3AWIA 3TSYA 1U5BA 5FORA 1VKHA 1T2UA 2WDPA 4HLDA 3Q4GA 5T4HA 4F3TA 1TJ3A 3VPHA 2IPOA 3DP7A 5SY4A 1Z07A 4D4LA 4UE6A 1GPUA 5JLAA 3R9WA 1ZD1A 2FY8A 2NO9A 2IELA 3CF4A 4JVSB 4QGHA 1YRQA 3W5SA 1SELA 1B00A 4JZYA 4B8ZA 4UTZA 3VI3B 3SXPA 1N3YA 1RXSA 3QY9A 1FXUA 2HSZA 2OGUA 1VBKA 4B7XA 1MABB 2QPAA 3LXUX 3MJVA 2UV8A 5LZ4A 1B16A 5THQA 4DNXA 1UFVA 2ZCUA 5FLEX 2AXEA 1WX1A 2OWDA 1JPVA 1KKUA 2IU3A 3OZWA 4NE9A 4QZVA 1XPUA 3CWCA 1CQPA 2QMUA 1PEAA 1QZZA 2VP6A 4JFAA 2A9PA 1E6MA 1OZAA 1DXQA 3RJTA 3V33A 4KH1A 1BGVA 4RLHA 1CUDA 2VBCA 3ECAA 1GCGA 4MW7A 1EFVB 5BVHB 1XXHE 4TQAA 2JB9A 3MINA 4JYBA 2IW1A 3BXGA 4WX2B 1TYZA 2UYHA 5K9ZA 3H9EO 1EVQA 2P27A 5CCDA 3QMWA 1ACLA 4EVQA 1SPBS 2XT0A 1DC4A 3MPOA 4UM9B 4XVUA 3NHKA 2F3TA 1MJNA 4LOIA 4MVWA 4TYNA 1FPMA 5LM3A 2JG3A 1YZFA 2IOFA 4GI7A 3WLPA 4B3IA 2FDRA 2NZ2A 2CFCA 3B9QA 4H3VA 4N7MA 1WB5A 1XJQA 2QGNA 2VIIA 3B8EA 5K8LA 4DV1B 3SVLA 4A7PA 3FJ1A 4N39A 3HB5X 2B8WA 2R25B 3IILA 4YRRA 3UN1A 4E51A 1BJTA 1OAOA 1A71A 3WQSB 1O0BA 2Q8QA 3BM5A 3FTNA 5LZ7A 3TTYA 5CB4F 5LQNA 3B1JA 2ZAYA 3RSLA 1G8YA 1XK7A 2NTJA 3QBJA 4DYHA 5C5DA 4LZPA 2ZJ6A 3T41A 1YS2X 3QKSB 2BTQB 2PUTA 2XQFA 2HXGA 5FD8A 3TXAA 3HNOA 3E7XA 4UAJA 2ZT6A 1KH3A 2E4YA 1S1MA 5ALNA 2QUHA 3X1WA 1Z33A 3HY3A 3UNXA 4ZYLA 4ABTA 2LZ0A 2ISSD 4C89A 1QOQB 2X5OA 1KWGA 4I8IA 1K68A 3L8GA 4B71A 2RGBA 3IPLA 4OHRA 1TZMA 4Y9TA 4BE7B 5AP9A 3PCTA 1SCBA 1MJGA 4KR0A 3A4LA 1NUPA 1A9XA 3CZ4A 5C7YA 1XJ0A 1XAIA 5LLSA 1V8PA 4TKUA 2A58A 3JR3A 3I09A 1KJNA 2FK8A 1J06A 2BZ0A 1K8ZB 2HJSA 1W2WB 3EGDB 4KFSA 1VJTA 2P8SA 4UCXA 5G40A 5IN4A 5LYJB 3VVBA 1W4CA 1NVVR 1U8FO 2CHVA 5BUQA 1U3UA 4QUDA 2IV2X 2JDIA 3RC7A 1GL6A 4RCVA 1T91A 1RP7A 1G8KA 1R5OA 2W2QA 5DI3A 1P73A 5EJEA 3K0BA 3HJFA 2QTNA 4G81A 2O8FB 5AVWA 4MVJP 5L7TA 1HURA 3MOSA 4UHFA 4BN5A 1L5FA 3QMPA 1QBGA 1Z6AA 4IOLA 1N92A 4OLJA 4XIFA 2JLVA 4A27A 3AHGA 1PDWA 1XCLA 2HKIA 3BKXA 1CRWG 3UTCA 1G5FA 2WV7A 5CB0A 4RESA 2ZTMA 3PV0A 1SQ0A 5AHRA 5EKTA 4C4RA 2XRZA 3LNTA 2JIQA 4L2IB 3E0XA 8GPBA 5F98A 5A2GA 5JWHA 3EGIA 3RQSA 1SOUA 4UM5A 1W6UA 3X3HA 3ZWPA 4BC1A 3P9NA 3HKCA 2W90A 3IVXA 4L0QA 4MVJM 5IZCA 2H2AA 2OD7A 3HBJA 2VATA 3DWGA 1TM4E 4H1WA 5CX1A 2AN3A 3W5VA 2ZXFA 4P32A 2EFJA 4WE3A 1PJ8A 2HSJA 4ZT2A 1IOWA 3P2MA 4HDRB 3AIKA 4IL5A 3DE1X 4K7JA 3NV7A 1FP1D 2CNNA 4UUBA 3RFFA 4E2YA 1ZUD1 5DISB 2PT5A 1JL3A 5SY6A 1U5BB 1ICEA 2IYUA 2VNHA 3S8EA 5AIBA 5E7JA 3FNGA 4BLUA 1HZZC 5JSZB 1WQ3A 1XD8A 4KXQA 4UKDA 2OV8A 1I5RA 2XOKD 2P30A 3WDMA 4GP6A 3KEFA 3LM8A 1UT5A 3NWBA 3DLIA 2PSJA 3FTQA 1WOMA 2RAFA 2IEYA 1EE9A 3ISVA 4I4NA 1QTIA 2J07A 3IPCA 3QX9A 3EXHC 1JG7A 1F1BA 2L17A 3EZXA 2IH4A 1WR8A 4A8TA 3QU7A 1JUDA 1ND6A 1E9CA 4Q9JA 1FLVA 2WKQA 3N5KA 3BMQB 3PHBE 5BN5B 1FQJA 1FMJA 2I87A 1ZN8A 2R1UA 4C7BA 1WUTA 1VYUA 4C0QC 4PRKA 1VP9A 2WU3A 2AHOA 4J7CA 1LI7A 1SHLA 1NOKA 1SKUA 3H9CA 4E2FA 2HWXA 1YRYE 3OE4A 5HUHA 5BP7A 2L2QA 3FDJA 5KWVA 1ISPA 2IYNA 1ADFA 1QIJA 4LKOA 3AR6A 2VOJA 3GJ7A 4U0JA 4RJTA 3QEAZ 1JG2A 3TRDA 1XMVA 2AKAB 2BDUA 2H4FA 5JI3E 3UOWA 2ZIEA 1NUAA 3KFLA 2OENG 5KYYB 1GZ4A 4Z0PA 1KZ1A 4IIHA 3DOHA 3UJ7A 1SU8A 1TYBE 4I46A 4F9EA 1IEXA 3GCXA 3FPBA 4EKNB 1NG1A 2VHVA 4GE0A 4HZUA 2CC2A 2FMIA 2J9ZB 1X8KA 5K4HA 1IMJA 4DSTA 1VP3A 1LDBA 4RHUA 5CDUA 3AYZB 4JOQA 2BFDA 2QZPA 2WPDA 1ZJZA 1EFPB 1WS6A 3WYCA 4MA4A 4MMXB 4B3TB 5JH7F 3VM6A 2V55B 5WRFA 3MMXA 5KVQA 1E59A 1EWTA 3DTNA 4MCAA 1GPLA 1C8KA 2Q3EA 4R9SA 3MRSA 1VHTA 3ITDA 3GUUA 1KAEA 2NU8A 3ZXIA 4GNKA 4D44A 3QIAA 1NUQA 4RJKA 4Z7OB 4NDNE 3AEKA 4GI2A 3I5MA 5JXHA 5KAPA 1M3SA 4GOOD 2LDBA 3BICA 3HV0A 4Q15A 3DZKA 2V3VA 1TADA 2GSDA 2ZRQA 2VYNA 3NCHA 3NU1A 4QOSA 2J7PD 1R3DA 2G77B 3INTA 4QUBA 2QB5A 5YASA 3CX6A 3WAGA 3SJUA 4HDSB 1R15A 1UWVA 2FWBA 1CYDA 1JFVA 3FPHA 1D2RA 2Q9CA 3E3AA 4KLNA 4PX2A 4Q4HB 4RPCA 4KGXA 1BHQ1 3WBJA 4P86A 4C06A 2BEUB 2A9JA 4OGFA 3ZJUA 5IEJA 1D1TA 4O8CA 1LV8A 1DIRA 1ZYUA 1OPRA 2J31A 3W4JA 1E9BA 1VL8A 2RK6A 2VPPA 3EGDA 3SEAA 4DM4A 3IIMA 2ACVA 4PX9A 5ALPA 2BGIA 1KH1A 1LQ2A 3T7DA 1WXHA 3VU3A 5KMGB 4MZXA 2PGJA 2CLCX 1A04A 3OCCA 2ZUFA 2WF8A 1JYEA 2YZMA 4NY1A 4FGUA 4IGKA 1I4WA 2DMRA 3ANTA 4KAFA 2LRHA 4ZN6A 2EEPA 2D6FA 3MWDB 4IF6A 421PA 3H6HA 4PRZA 4U2KA 4LX0A 1N2CA 3T3IA 2CNWD 1FFHA 2HEGA 1JWLA 3OEHD 5CA1A 1HL7A 1KK2A 2A1UB 2WTUA 3OQOA 3UZUA 3BHMA 4ID9A 3RVMA 3PCRB 4R8RA 2CLEB 1JQEA 1CRPA 2VK2A 5CFMA 1RPJA 5I7VA 4BNTA 3C3JA 4KGDA 3DM9B 4OX9Y 1PV4A 2MSLA 1VG0B 3QV2A 1X1AA 3WMRA 5CVUA 3ER6A 2X6QA 4PONA 5CYPA 3EXHA 1U6KA 2V3WA 3KR2A 2HMUA 3KVOA 3BT7A 1OE0A 2YX1A 1RZ3A 4QECA 1OKKA 4AG6A 1O7JA 3ZS9A 2AMVA 2IZ5A 2JHCA 1TC2A 3COPA 4JS0A 1FVFA 2ZULA 3KXDA 1IRXA 2MHCA 1U0HC 3VKGA 4W5JA 4M8IA 5EMNA 3Q6IA 1ORHA 3DULA 3SFVA 1G8FA 2B5WA 3IP6A 5G0UA 5ILOA 4JT8A 4Q9DA 1T1JA 2VUIB 5CTJA 3P2JA 5C7IO 4RNDB 4N9WA 1Q0SA 1U0GA 3BH6A 1ISGA 3UMFA 4S2UA 4P7GA 2PH1A 1COZA 2V6FA 4H59A 4MS3B 5JSZA 2HADA 2QRJA 4JNCA 1ABBA 2EJBA 1M54A 4BFWA 2FEAA 2WHPA 4E2ZA 2H2HA 2KPOA 4KXWA 3DF9A 2Y1XA 2CWWA 2R87A 4UE3S 4NCKA 4Z9BA 5I9IA 3IQGX 2IGTA 4ZK2A 3DE7X 3ZEIA 1FS6A 4UARA 4NV0A 3WZ2A 1WSBA 3IQDB 4LF7B 3QVUA 3HNPA 4N76A 1RLJA 2F9FA 2Q6TA 4RPHA 2ETXA 2IHJA 4CETA 1U2SA 2WP0A 5T4FA 2NZYA 4JJZA 3M70A 4N8EA 3WIBA 5AKXA 5KTPA 1FNBA 1NATA 2NZXA 1HC7A 2BSXA 3WYBA 5HJ7A 4EY4A 4WKCA 4LJ8A 4XEUA 1KZHA 1T5SA 5C4MA 5JNSA 2QT0A 1LJLA 1YKFA 4UTRA 5HTKA 2O2GA 1GCOA 1LUAA 2WRZA 1PJZA 1YR1A 2V6GA 3AQ4A 4LY3A 1JYSA 3KSDO 4QTUB 3T5MA 3W8DA 4MPTA 5JROA 5KKCA 1ADCA 1A9TA 1NVXQ 3CSDA 4H27A 4DLVA 4YQFA 4F92B 4ZV7A 1KGSA 1D0IA 3H8JA 1BDMA 1PX0A 3H84A 2AFVA 1FJHA 1GRNA 1ZESA 3N2IA 1BMDA 3REQB 1NVVQ 1PFGA 2Z08A 2PZAA 2QG6A 5LZ8A 1DBWA 3SZLA 4G5QA 4PLHA 1H8HD 5H1YA 1A8PA 5DCUA 3WWDA 4P54A 1TM3E 3KEGA 5GINE 4JWKA 5J58A 1Y3BE 1YC2A 2MMGA 4P8RA 5E6SB 1GHTA 3QLJA 3ILSA 2O05A 1OXTA 3L7KA 4KXLA 3DBIA 5DWVA 2JJ2A 4BLPA 3LDHA 5B4VA 2QMZA 4OFWA 1T5LA 1TGVA 1R0ZA 4G5OA 4IV8A 3I9V1 1R8SA 1M9NA 5KX5B 4OK5A 4C9BA 1RAAA 3VFDA 2NU8B 2X0JA 1L7AA 1XLWA 2WHRA 5JD4A 1YU9A 5K8IA 3A05A 5DNCA 1SJ9A 2UXBB 4D79A 4G5HA 5BSFA 3DKKA 1XU7A 5DBHX 5EZQA 1HT0A 4R8LA 2A5LA 2GN6A 1UZMA 2DTEA 2QRHA 3ESCA 3ZWKA 5IZCC 1F8XA 4C4TA 2EP7A 4ARUA 1JMVA 2EF0A 5IFLA 3M1IA 4RK5A 2RGYA 1U2PA 2ONCA 2XGGA 3FPLA 2Q2VA 1DJOA 1W5EA 1PL8A 4HCJA 5KCMA 3TI7A 3AU9A 4KR3A 1NUSA 4TN1A 3ZE6A 1GYPA 2OHVA 1YE5A 3HZRA 5C7LO 3G1TA 3ERCA 5EWLA 1O3YA 1I9CA 2O23A 1AE1A 3E15A 3L7MA 3GLGB 1FF9A 3WMEA 4XD2A 4B44A 2VYVA 2DERA 2A86A 3QVSA 5GPBA 4B40A 4JJ8A 5DBGA 4XFDA 1S5PA 5HF8A 1XDWA 1BRTA 4B2PA 2PBZA 1TDJA 3EGXA 3SM3A 2FEKA 4Y2XA 2R7NA 3OD5A 1PJBA 3AFMA 3CX8A 3KQNA 1RRCA 1XFAA 4QC2A 3BMXA 3A2LA 3NHSA 2N46A 3QELB 2QUAA 3DV0A 1ESMA 1F14A 4GVLA 2WZQA 2J9XB 1AKEA 1E58A 1I3MA 3R3JA 3U9TA 3TECE 3TRHA 3UFBA 2N9UA 4X1KB 1C1DA 1VJ5A 4Q4JA 2BFAA 2ZTLA 4GKAA 3OWOA 5JCJD 4NZPA 4R1LA 5LLDA 1A72A 3K1AA 4EK9A 3ZQ6A 3WNQA 4NMWA 2JATA 3A27A 3GH1A 4FMDB 3WICA 2AN5A 1DC3A 1OAKA 5GONB 3UB4A 4BLTA 4M9QA 4GPAA 4W5TA 4D9MA 4TWJA 4QULA 4YT4A 4G8CA 3TPCA 4JAVC 1EWYA 1DJNA 2V4MA 5C2JB 2YWDA 2EVWX 3L4KA 3CZCA 3PDJA 5THKA 3HMQA 1SA0B 2QVGA 2FHPA 4MUKA 1IBMB 4DMUB 2W2NA 3CKMA 3SK0A 1L1EA 4TUYB 1QAQA 1I2CA 1X7WB 3OE1A 1BZYA 1GKLA 1EVIA 3KOUA 3B9PA 3KYIB 3Q3GE 1W5BA 2PNJA 1QIGA 5GV8A 2OQRA 4FW9A 5IAAA 5HMMA 1TAUA 1GQFA 1ZX1A 3IAEA 4ACBA 2FR8A 3COZA 1KZ7B 1M2VB 2YZ7A 4G84A 4RE6A 4LWOA 3BJIC 3WQQA 3V8VA 4OSPA 3BA6A 5IXJA 4UUNA 4OLHA 3QRWA 2JANA 3B1KA 3ED1A 3UMCA 3HR7A 4HNHA 4YRPA 3VRHA 3CVUA 3E7W<