1UJBA

Structure of the protein histidine phosphatase sixa
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
156
structure length
156
Chain Sequence
MQVFIMRHGDAALDAASDSVRPLTTNGCDESRLMANWLKGQKVEIERVLVSPFLRAEQTLEEVGDCLNLPSSAEVLPELTPCGDVGLVSAYLQALTNEGVASVLVISHLPLVGYLVAELCPGETPPMFTTSAIASVTLDESGNGTFNWQMSPCNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Phosphohistidine phosphatase sixA
publication title Crystal structure of the protein histidine phosphatase SixA in the multistep His-Asp phosphorelay.
pubmed doi rcsb
source organism Escherichia coli
total genus 54
structure length 156
sequence length 156
ec nomenclature ec 3.1.3.-:
pdb deposition date 2003-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1ujbA00
1E58A 2P30A 1V7QA 5CX4A 5HR5A 2WNIA 3R7AA 4PZ9A 1RPAA 1QFXA 1DKQA 1T8PA 4GPZA 1BIFA 1ND6A 4GPIB 2DWOA 4FDUA 1DKPA 2P78A 2HIAA 1E59A 3GW8A 4JOCA 2QNIA 4D4MA 3FDZB 4HBZA 2A9JA 3QPVA 3E9CA 3C7TA 1SKAA 2OWEA 3DB1A 5CU7A 4D4LA 4E3WA 1DKNA 2P9YA 2RFLA 3K4QA 3LG2A 4ODIA 3IT0A 1C7ZA 1UJBA 4TSRA 5AJXA 2IKQA 1UJCA 2A6PA 5AJYA 1EBBA 4IJ6A 1QWOA 3LNTA 2F90A 5AJWA 2P77A 1DKOA 2GFIA 5AJZA 1FBTA 3KKKA 2H4ZA 3GP5A 2ENWA 1H2FA 4PGMA 2P75A 3D6AA 3IT2A 3FDZA 4FDTA 3DCYA 2P79A 3ZHCA 2ENUA 1SK8A 4EMBA 1ND5A 3QPUA 2P6OA 3D4IA 2HHJA 2P9FA 5AJVB 2WU0A 4ARSA 2YN0A 2BIFA 3IT1A 2EOAA 3MXOA 1BQ3A 3EZNA 3FJYA 5CDHA 4JOBA 1C80A 1TIPA 4D4KA 1DKMA 2PA0A 2YN2A 3K4PA 3LL4A 1IHPA 3BIFA 2P2YA 2I1VB 2EKZA 3NTLA 4ARVA 2WNHA 4EO9A 2H4XA 1QHFA 1H2EA 3HJGA 1RPTA 1BQ4A 3PGMA 1YJXA 2OWDA 2AXNA 1K6MA 3IT3A 1RIIA 3EOZA 4AROA 3D8HA 4PZAA 2H52A 2P9ZA 2P6MA 3F2IA 3O0TA 5PGMA 2EKBA 1CVIA 3E9EA 3E9DA 3MBKA 4JODA 4D4JA 1DKLA 1C81A 5HTKA 2H0QA 1SK9A 2DWPA 1V37A 5AK0A 3QPWA 4QIHA 2HPAA 3GP3A 1FZTA 1SKBA 1NT4A 3NFYA 2P2ZA 3F3KA 3OI7A 1YFKA 4ARUA 1XQ9A 4MA4A 4IJ5A
chains in the Genus database with same CATH superfamily
3M9XA 4HADA 3RRZA 3VH2A 1TECE 2FDXA 2FN8A 3SHTA 5F9FA 4KVGA 3P5BA 4NJMB 4OP2A 2C2YA 2ZE5A 1DL5A 5FBRB 3UGQA 3DEFA 3GNSA 1MJ5A 4M98A 2FDCA 2QLFA 2X2OA 3KYJB 5MHTA 4WT7A 3UV3A 2WE8A 5IVHA 5BWMA 3EXIB 3MQ2A 4J1NA 1T4BA 4N7RA 1ZW6A 4EI2A 2AXQA 2PRSA 3FD8A 1SCJA 1W5AA 3ZZUA 3G17A 3NEYA 1O5IA 1PR4A 2X4DA 4UKDA 3KLOA 5HMMA 4V3CA 3EEOA 2HYIC 4NYMR 2BL4A 1N8KA 4UZFA 3UK0A 2HJ9A 1IC6A 4C0KA 3KSDO 3QM1A 5J2UB 2QRPA 3WB9A 2Q9AA 1R3UA 1NXQA 3LUBA 5IG2A 2Y1LA 3O92A 1DJNA 4HL6A 2FQYA 4J1TC 1E3WA 1ACMA 5LNK6 3REFA 1HBJA 1W4RA 2ZRQA 1KYIA 4EMTA 2XECA 3FJOA 4JMPA 1R5NA 4ONEA 1HEIA 4BGVA 1GGFA 1WG8A 4OSEA 4Y0VA 3CINA 2QZ9A 3GLFA 2H7XA 3WAGA 2F8LA 2CLOB 1HX7A 4EG8A 3QUQA 2O0KA 2WWVD 3CRW1 4B2LA 1R9GA 1HE4A 1CYEA 1ZMOA 1B8VA 2D5AA 4OQQA 4UM9D 5EIOA 5HF8A 3AR7A 1E5DA 5K8JB 1I5OA 1LBTA 2GF9A 2VVTA 1OB2A 4TVOA 4EY5A 3QX8A 1XNQB 3IOEA 3ML1A 1Z2EA 3O1IC 4M0UA 3A6PC 2CLIB 4HQ6A 2AJLI 2ZB7A 4I4IA 3AERB 5TV2A 1L2TA 1ZLXA 5JU6A 3N0XA 2VF8A 1T5TA 4PLVA 1Q74A 2ACEA 1DINA 3FYUB 2QD3A 4PRYA 1FVXA 1AQNA 2OOKA 1PZEA 4ZTZB 5BQ3A 3H4TA 2E7ZA 3QE3A 1FQWA 4YV2A 3JRNA 5H70A 5FWNA 4COOA 3JD2A 5C18A 5K0LA 1EHYA 4P7BA 4B3HA 5KQGA 2MMCA 4LOLA 5K0NA 3PC6A 1R1DA 4HWKA 4IZIA 1QLJA 4O29A 3WIVA 1KDVA 1K8QA 4RY8A 1JYFA 3B6JA 4G89A 2C42A 1NQ5A 2MSDB 1EFLA 3GIDA 3ILVA 3RKUA 4YO7A 1M0SA 4NVRA 4WJKB 4YH1A 1G19A 2W98A 3QFHA 2ERCA 4BAGA 3TLEA 3KYDA 1Q16A 2ORYA 2P69A 3CLTC 4GYYA 4RH3A 3U37A 1E4EB 3JD4A 3V7UA 1D2MA 2OBFA 3IHLA 4KUHA 4Z8XA 4ENQA 2Q1SA 2WTAA 4W9RA 3KJEA 2NOAA 8ATCA 2ODTX 1E3WB 3PJRA 2XGJA 5JADA 1GQ2A 1J00A 1N9KA 2E82A 3Q1KA 4L8GA 3RWOA 1EX6A 2DT8A 4FLMA 4HWSA 1QU2A 1ZWLA 4M3NA 3MD9A 2DFTA 5IS2A 4PSVA 3FY4A 3E8MA 4P3PA 2J67A 3NC1C 2BPOA 3TZLA 1QV6A 4TVKA 3UB2A 1EA5A 4HATA 2PL5A 1B8NA 3KAKA 3WX0A 5TY0A 1CR1A 4CU2A 4ZYYA 3AB7A 4IRMA 1E6UA 1DKUA 2FDRA 1YHZA 3NDRA 5ALDA 2RHTA 4DQVA 5F21A 3FTDA 4Z3OA 2JZCA 3GCDA 5HTOA 3BQ9A 4EKEA 4BFZA 1HQDA 4QE3A 3IUBA 5LJIA 5B57C 3UCEA 1JU9A 5B55A 1YZKA 1ZCAA 1ZXLA 2G7ZA 2G1PA 4HQOA 1C4OA 2Y76A 5ALFA 4YJFA 2XQGA 3MWYW 3AHHA 4X7BA 2R6AA 3VR4H 3DKIA 4ZGBA 1G3UA 1XMSA 4M89A 4H1WA 1QPZA 3AF2A 3B7PA 3JAKA 1P0PA 4GGOA 4R1UA 1CJBA 4LJYA 3AIKA 1W4BA 4YT5A 3QWIA 5DXAA 4EB8A 1YE3A 4LMPA 2P78A 3PUVA 4TTAA 4DA8A 4LJ8A 3JX9A 1L7VC 4K86A 3GJ4A 4X94A 4DCJA 3E5HA 3LMKA 5DP1A 3ITKA 1UPBA 1NF9A 4IDGA 2Z2XA 3TRDA 4C4XA 5EERA 1ZU4A 2R00A 4RJLA 4F85A 2O4CA 2F9FA 4IIBA 4AECA 1E2LA 1ZH4A 3PHLA 2WJ3A 1MB9A 4DIFA 1UBOS 1XZFA 4PPNA 2ZRFA 2QJRA 3EXHC 1RZVA 3M8KA 2X1HA 4YUXA 3V8VA 2B3DA 2HLDA 5AKYA 1NR7A 3KEQA 4M8LA 4RCZA 5SV2A 4O5OA 2FPLA 4A6DA 5BNZA 1W36B 3C7KA 3L43A 5EQTA 2PMDA 1ULHA 3RKSA 1L7EA 2AFRA 2NVUA 1AKVA 1DIBA 1ZCBA 2JH3A 3EG5A 3FTQA 3UVEA 2G0TA 1WBDA 2G9RA 4KFRA 1KVQA 3FVQA 4L0QA 3RYIA 3WDMA 5BUZA 1S3GA 2EV9A 4PGMA 3PUJA 1GVHA 1WCIB 5TEVA 4NPAA 4MUEA 1UEXC 4JP3A 3S70A 2NO4A 2YWEA 1Z0IA 4IH9A 4G84A 421PA 2E5FA 1YDFA 4ZI3A 1GZ7A 2XCOA 5DLPA 1O77A 4R51A 3ZU5A 4CEHA 1AQLA 1M1YA 2B8WA 5IKPA 2R5NA 3G5LA 1MZPA 1YRLA 2YQ5A 1XTSA 4KHZA 1IAQA 4D44A 2NG1A 1HNXB 2WAAA 2OQVA 1JLRA 3GAMA 3F6SA 3M6IA 1PS8A 2QN6A 4RBNA 1NBEA 2CE2X 1C4XA 2DY0A 5EJ2A 1FC0A 4Z2AA 3EUAA 3KQTA 4PXAA 3WRYC 2XR1A 2C31A 2PSHA 1GGMA 1ZD9A 1HE5A 1NRJB 3ETNA 2ZDGA 3S2IA 1EUZA 5JMWA 1P0IA 3IIIA 2AF3C 3IB3A 4BEBA 1SAYA 4ZU3A 3COWA 5LMCA 4RNDB 1DQSA 4OY3A 4TUYB 3PEYA 1HUQA 3H5WA 4MGYR 3REQB 1CR4A 3BM5A 3OZAA 2K5UA 2FWBA 2I2DA 4BX8A 1QG2A 1Q0TA 2LW7A 3DDZX 3LCMA 1QX3A 2HMTA 4P4GA 5BN5A 4E14A 2W6JA 2H8KA 1L7QA 2GSDA 2HWUA 1FTSA 2P2LA 2ZULA 4C7KA 4L22A 3ASZA 3I8XA 4J9VA 5TGDA 3P9YA 3RYIB 4HPXB 1CQWA 2H9YA 1AUQA 2W2TA 5FJJA 8ADHA 3U9TA 2JAUA 1B26A 1RCFA 4FXPA 2ERXA 4QFBA 2ZAOA 1Z82A 3L93A 1X77A 4ZC8A 3QA9A 2BFDB 3UFXB 4YCSA 4OGGA 3RM3A 4QT4A 4I0WB 3B89A 2ZE7A 1E3QA 4HXFB 4QREA 1ZVQA 2IY9A 3CYFA 4NATA 2AW5A 3PCTA 4IQFA 3W6ZA 5LZ2A 3V6LA 2J0VA 4DJJA 2QQ0A 2XZLA 1XYGA 4JDUA 1KAEA 1M1YB 3BIJA 3O1JC 2GTHA 2WW8A 3H5IA 3HB9A 3JQBA 3L6UA 5T4HA 3RFXA 1ZUNB 3AV0B 4PVCA 1LDEA 3GZNB 2OSBA 3VC1A 3BORA 1JJVA 1G20E 2B2XA 1JA1A 5T5QA 2PNFA 3JALB 1AURA 3HDTA 1ZM9A 1GT91 2PXAA 2AG6A 2YV2A 2XY4A 1YHYA 3J7TA 3I73A 5AM4A 4HGRA 5L7WA 5LQAA 4D25A 1ZK4A 4Q1EA 3UJHA 1PFQA 1Y1SA 4BO2A 4WNAA 3INTA 4DWVA 4MYCA 1YDHA 1YZGA 3F7NA 5JMTA 1H2ZA 2D5BA 4FP9A 1SCDA 3HXPA 4QLBA 3ZE1B 5JXWA 4G0NA 4ZYTA 2Q99A 2G70A 4EHDA 5BYKA 2XVAA 2WKQA 3PQFA 1DU4A 5AICA 4LBYA 3BCUA 3DC7A 1FFAA 5IDYA 5KNDH 3DLBA 2XMQA 3JZDA 4RQAA 3AHDA 4GC5A 4WKNA 4EHLA 4GI5A 4TTRA 1JE0A 3FRIA 3E1KA 3IBYA 4D6YA 1U2TA 4PG4A 2ZS9A 3OZVA 1Q6YA 1UK8A 2GDZA 4NBRA 4DBVO 5JZVA 1NNEA 3F6EX 1DKOA 3P4XA 1WKBA 4N82A 3W1WA 4YJ3F 1LJLA 3IAM1 1JSZA 2AE1A 4BPBA 3NW9A 4GKKB 1LI7A 1OFVA 2PIDA 2P6UA 1DO8A 3GRKA 4LY6A 1LNSA 1TQ6A 3VZBA 3HSSA 3AR8A 1PGOA 4P84A 2WF9A 1Q0ZA 1T15A 4UUMA 2OD9A 4H6VA 3WDLA 4AD8A 2CE7A 4HY3A 2ZUFA 1MGPA 2ZZNA 4F60A 4HYTA 5DWQA 5JSHA 4BNKA 2NPOA 3U17A 1L7DA 3C87A 1S96A 2OC9A 1SR8A 1VMAA 2RHRA 2GEBA 3NYIA 2ALJA 2QE6A 4MPRA 3LQFA 3EPRA 1MN6A 5JAMA 4PZCA 3MXOA 1IQPA 1TRKA 4OQNA 3JPWA 3KT8A 2HXYA 3V4FA 1RWQA 2IEIA 2Q29A 4XPIB 1C1HA 2EKZA 3PQ3A 4P33A 3LP6A 4ETNA 1N2CB 2AEMA 3WGIA 3W6NA 2AI2A 3ANXA 2ZBDA 4D96A 4EIWA 5DTRA 1G8GA 1ZGHA 2XHEA 4PZPA 1GO2A 4ZXPA 3GJ7A 2EU8A 1XROA 1OYVA 3H0EA 4A8PA 2YMPA 4KOEC 5F9HA 3VU9A 1FDTA 1RRGA 3B13B 4JXXA 5IYZF 4I4TF 5I8ZA 3W9YA 4P4NA 3THRA 5B1IA 4RS4A 1CEEA 1VG9B 5DWVA 1KQNA 4J91A 1FW8A 1U7PA 1W44A 2LCIA 4LDRA 1TGYA 5B3JC 1PO7A 3L8EA 2DZDA 2GRAA 2O0MA 1OWLA 5FD8A 2WJ6A 1LQUA 3K73O 3OQ1A 4GKVA 1RHJA 4DHEA 5BRAA 1SCBA 4D3SA 1J8VA 4CG1A 1VYTA 4HFNA 2DULA 2JLSA 1WQ1R 2O4UX 2C98A 2Q3HA 3S29A 3TE7A 4WZAA 3ZS9A 5C3MA 2H4FA 1JHUA 4R1NA 2ZUCA 3R75A 4YV0A 3QMMA 1RWMA 4FDAA 2QB5A 4DR2B 5E6UA 2PL1A 1Z8DA 3I4FA 1Y4UA 4CFYA 5JFTA 2XUOA 3DDCA 3NHSA 1NV8A 2FN9A 5HOQA 4WOKA 3PV0A 1NC3A 3D02A 2LBPA 2QRLA 1AHNA 4HDQB 4IIHA 1PG0A 1S89A 1SEVA 1BNCA 1U0HC 2SKDA 4RHFA 4ESVA 4EFNA 4J7AA 1NE2A 3W3ZB 4LWQA 2DVMA 1EHIA 1M1XB 1B73A 5E9JA 4N47A 3RBXA 4AIIA 4EGAA 1KXZA 4XH9B 2CKMA 1LTHR 3IIKA 1TZJA 1C1XA 2WYUA 4TV8B 5CB6A 4HNHA 6CHYA 5ICEA 4US2R 3BGOS 3L7IA 1AF4A 1RZ3A 3GT4A 1X39A 1G18A 1QSGA 3PYLA 4IHQA 3QX7A 4GNRA 1OASA 1X1AA 1PLLA 2ZJAA 3IKJA 2FOIA 4RFSA 1TJ5A 1TMOA 3KR1A 3DZGA 1OZFA 1XFDA 2MWMA 4FGWA 3GGOA 4IUDS 3A4LA 4D4LA 4B44A 4MQ6A 5CFNA 5D84A 5JDCC 1BEZA 3VAZA 2UYOA 1WXWA 1TU4A 3M3HA 4QXMA 2VSYA 3GVHA 4YCDA 2BEJA 3EMKA 4WZ6A 3DMRA 1R0CA 4W8GA 3U7JA 1NZJA 5DGTA 1G9XA 3BAFA 3E7PA 3FPAA 4N7BA 4QGBA 3K30A 1L5RA 5AKGA 3BXPA 1JZSA 4XW2A 4KFSA 3K1AA 1HKUA 4LJ4A 4CXMA 3F71A 4DIKA 4YMTA 5A5VA 4H1VA 1B76A 2HRZA 3TD6A 4ZPXA 2J9YB 1IBMB 1IUOA 1XKLA 5JJBA 1Z5NA 1J4AA 3D7KA 4EB0A 2HEIA 2NXEA 3L4BA 2NPIA 3EBLA 4BLWA 4HK4A 2J33A 3W06A 2PFGA 3TZEA 1OIVA 3WNDA 3WLNA 4AP5A 2HV8A 4Q7LA 4XYEA 1U9ZA 3ET4A 1TYZA 4OK6A 3VR5D 1NP3A 4CQLA 1D4OA 3C97A 2UZ3A 4U7FA 3THYA 4ZEXA 1C1XB 4I1SA 4NCAA 1LRJA 1Z08A 3HG7A 1OXBB 1U90A 2VAVA 4LW8A 4QTYA 1BQ3A 3LWDA 4KR3A 3TIVA 1WBJB 4U8GA 4YY3B 5BR4A 4R7GA 2RGBA 3HN6A 1GR0A 3WIBA 1YDMA 2DOKA 2VRBA 2SECE 1WKCA 2Q50A 4R1TA 4X8OA 1GN8A 5EKTA 2DUNA 2Z8ZA 2R6GA 3QY9A 3CB2A 3JQ6A 2ICAA 4RZHA 3Q8KA 4FXOA 2B0JA 3DOCA 4X64B 3FDIA 1TYDE 4F4HA 2E55A 4OYYA 4MKHA 3BWYA 4D45A 2C4HA 2GWHA 4EZBA 4LQ4A 5J1SB 3OTQA 2ZBFA 1DJOA 4HGYA 5IWCA 4CM7A 2XMDA 2RHBA 1I2DA 5ENZA 4ESHA 3MQ4A 4HEHA 4LBZA 2MYUA 3TBFA 3A6ZA 2XMSA 2AUTA 3JQFC 4MMYB 3IE1A 1SELA 4NOJA 4IJWA 4D4JA 2VP9A 1ZGAA 2ANBA 2XE6A 3ZJ5A 1IMJA 5ALLA 1SCQA 3O82A 2GO1A 4EENA 1QIEA 1DBRA 4UQPA 2AK2A 3UKJA 1OU4A 1SCUA 1SUIA 2DH5A 2F3TA 2XITA 3C98A 2O2JA 2O1XA 3DBIA 5D01A 1D4FA 1FNDA 1JAIA 3ZQJA 2H48A 3FLMA 3MCVA 2C1ZA 5IF3A 1URPA 5M7EA 3M83A 1WSWA 4PPQA 4CVNA 5DYYA 2WI8A 5BWNA 1H9AA 3UYKA 4D9BA 4W5JA 1I4DD 1GEEA 3WYNA 4LFAB 3X2SA 5C1PA 2BH2A 1C0LA 1KI9A 1RP1A 4HR7A 1H9CA 4IQ0A 1BDBA 1V6SA 3U1VA 4N3AA 1AGPA 4C1BA 1VDZA 2DSTA 1YB4A 2JJ2D 3R8XA 3S8EA 3L4EA 2VJYA 3I5AA 3SI7A 4PRZA 3TOZA 4FOSA 2JEOA 2ZG6A 4Y2RA 5KJEA 3L8CA 4GOOD 1NQAO 1PUJA 4WESA 3UK1A 1XTUA 3BXFA 1ABFA 2UYGA 1PGPA 5GM2A 2CN1A 2FEXA 2IZ0A 4RGQA 2V97A 2IGBA 4MGEA 4RETA 4W7HA 3RH0A 1Z4PX 2XYRA 5DNDA 4C4OA 1E77A 3G2QA 1P1IA 1VZ2A 2ID7A 2J9XB 2PFSA 1OZGA 2X0KA 5IN4A 1UPCA 4JGGA 4NSNA 1OLUA 1WXQA 1FNBA 1PJLA 2KWIA 4OAPA 5ETJA 4BRSA 5MFZA 3IV9A 3C5HA 2ZXEA 4AF7A 1CUUA 4TKVB 3KU4A 2BFCA 3P0HA 4YMVA 4X45A 1TK9A 2JFWA 2HJGA 1KSFX 1K5HA 1KGSA 1N3LA 2B7BA 3CKYA 3KKZA 4PAWA 3TSOA 1RXWA 4RIFA 1TTHA 3P9KA 4WV3A 3AUFA 1NW4A 1JJ7A 4E31A 1WCXA 3B2NA 3KLNA 2BM0A 3L1UA 1HTBA 3NHPA 2PBLA 1Z8NA 1W19A 2HCTA 4MVJE 1VMEA 3O2SB 4DC1A 3OKCA 3D7NA 1RAEA 5FTKA 7ADHA 5LL6P 3V8RA 2WA1A 3TG2A 4EI8A 3B5JA 4YI3A 4LECA 2DYKA 3EVTA 2G9VA 3DKPA 1YS1X 3GUUA 2DKOA 1CT9A 4KO8A 4QUDA 4R6XA 5AK4A 1DAPA 4FMCB 4IQ4A 4Y1FA 1QNLA 1DFHA 2UZ1A 1OFTA 5M3BA 3BH6A 3RWMB 4YRGA 1RLJA 2XWQA 4WH0A 1USGA 2I8CA 1MW8X 1ZZEA 4EWLA 4A91A 4J0CA 1TYCA 5A9RA 1QYCA 4HGNA 1W48A 2IZ1A 2R9VA 1ZD4A 5FF9A 1NW7A 3SX2A 3PI6A 1V5FA 4WNCA 1Z4IA 2IBMA 3L1KA 3CGWA 5LC1A 2V74B 3IIMA 4QBIA 3WLLA 1GL9B 1WB4A 2WTUA 4N12A 4DLBA 4EHBA 3AM4A 2WNHA 1WO8A 4HUJA 4XR9A 3ZU4A 2GILA 4BVHA 4GR5A 3O5AA 4ILKA 1PI3A 1CIVA 2PANA 1OLUB 2J9ZB 2QPTA 5D5HA 3PICA 1TVMA 2E0IA 1GGNA 3UMCA 3TM5A 3WGKA 1AZWA 1GLNA 3C4JA 1B43A 2Q2WA 2FYTA 2VZEA 3AF4A 1L8AA 2BFCB 1FFXA 3STXA 1Z7GA 2QT1A 4C6HA 1JILA 3DD1A 3FTEA 1NBOA 4IIJF 4TGLA 4BWVA 5EJEA 1I9GA 5B2FA 1FCJA 3EFHA 1JJAA 2Y1WA 1EG7A 5CNKA 4WFJA 1KERA 3EIOA 5JSFA 1IN6A 4M7PA 1EIZA 4Q1FA 3RUAA 1ISSA 1DKLA 4BIMA 3IP5A 1WUYA 1V39A 3L5KA 2ONZA 3LH5A 1RFGE 3JSXA 3OQIA 5FO0A 4BQOA 2CFCA 1Y9AA 4U6SA 4CKYA 1L5NA 5HRCA 1WV1A 2IF2A 1QC5A 3K0BA 4R31A 2XVZA 2E4XA 4ZMSA 5KSWB 2OCLA 2JJ8A 2A1TS 1EFUA 4U3JA 2H29A 2VJLA 3EYAA 1I6WA 1P77A 3EDQA 3O91A 1NVXQ 3PE4A 1YV9A 3A3NA 4LK3A 5TEWA 3ZBUA 1CLUA 4LGCA 3TL3A 2FA9A 3DVRX 2IYQA 4FGLA 2Z09A 4PONA 4ER7A 1EAYA 4NARA 1E4YA 3MYRA 3ZV6A 4EO7A 5SYNA 3JASA 3EIHA 3PE3A 4RXUA 3EGCA 1A95A 3QOYA 4DV7B 4CV1A 2PAAA 3JVVA 4B1FA 4DLWA 5GZ6A 1US8A 2GXUA 2Q5OA 4GWGA 3AJEA 3KR2A 3LUJA 1X92A 2HO5A 1X1RA 2HL6A 1G4AE 2H5EA 1T1EA 3D5QA 1F1JA 3DTVB 2QN3A 3GI1A 3V7NA 3BD9A 1C3JA 4O2AF 3UAGA 1NHGA 1TK3A 1J5EB 1N9ZA 1TA4A 3X1DA 4YHHB 1NUHA 3CO0S 4IZHA 4PZZA 1FFXB 1T5HX 2M32A 1T29A 3MFYA 3R0ZA 4RO0A 5FTLA 1YRBA 3JZAA 5TARA 4G9EA 1PSZA 3VQTA 3D4OA 3JWHA 1Y5MA 2XQKA 4WK0B 5AK6A 3B1KA 2R11A 1JLSA 1V5WA 5KVQA 4LXHA 3W5DA 4ZAYA 2EFDB 4BO8A 1KQOA 1ZH2A 2MTBA 2HFKA 1EVZA 4DUGD 1QYIA 3G2IA 1KRWA 4BFXA 1MABB 2X2FA 3KWLA 1Z22A 4PBRA 4F6RA 4DDVA 4Q19A 1QC5B 1YMQA 3W9UA 2EEPA 4K3UA 5DHTA 4A36A 2J45A 2X9LA 3OPYI 5DM1A 1ZY2A 3B3AA 3PDIB 1QB7A 1QPGA 2R66A 4DM4A 3QLEA 4BVEA 2YHAA 2Z3VA 1AB5A 4L15A 5KO2A 2QDXA 1PP4A 1WDMA 3FWKA 3NGLA 2B0CA 4BQEA 4I9NA 1Z26A 2VP6A 5IKEA 1XTIA 2CUKA 1BD4A 3L0SA 1E2JA 5K8VA 2A0KA 2JC3A 2X0JA 1Y9JA 1XP5A 2YJNA 4HLCA 2ZVQX 4IVRA 1F0PA 4E2ZA 4PSDA 5B37A 2W6JD 3IEPA 1ESNA 4HSGA 2IWHA 3GEMA 3NT4A 2Q5CA 2XMPA 5ESDA 2PUWA 1GARA 3D8SA 3ZR4B 3MWGA 5AK5A 3ONEA 2N3ZA 4RM2A 4A16A 2GZ3A 4FZJA 4PPGA 4PLZA 1C9DB 4MS3B 3SFVA 1HYGA 1IXRC 1OSNA 1T2CA 2WWRA 4E70A 1M10A 3ESBA 4KAXA 1AZSC 1XHLA 1TADA 3FSGD 4GR4A 2JH8A 2H4XA 3RUIA 1QHFA 1WDLA 3HWWA 3QF4A 3KZMA 5H4GA 3P8ZA 1G7RA 1UQTA 2C5GA 2QRHA 4AWAA 4Y2PA 5JCOC 3LLCA 1DBWA 1XDZA 1HFEL 4MV1A 3ECSA 2AZDA 1FFBA 2R751 3DR5A 3FVTA 4FR2A 3CUUA 3IA7A 3UMMA 2X0IA 2XJ4A 3JQ8A 1XEWY 4KYVA 4C7JA 1KKUA 1QR6A 2QG6A 3GJ6A 3MOSA 3NBYC 3IEVA 1KDTA 5FV4A 4S1WA 4F6RB 2K87A 3I64A 3CNNA 4JT9A 4AMBA 4F56A 1PW5A 5JCPA 1WR8A 1ZOLA 1P1KA 3DLTA 3ND6A 1DLJA 1KJ9A 3FZGA 5EP1A 4NCBA 1MVOA 2AHOA 1NF3A 2BELA 5K8TA 4O4IA 3S44A 5I51A 4MVJD 2AYYA 4YAIA 1GILA 4NBSA 4OH7A 3F8TA 1ZCJA 1X42A 2ZCJA 2D1YA 2YY5A 4BNUA 5IASA 5HCUA 3C6BA 4MB6A 3HA2A 3UPDA 3GIWA 3ILSA 1Q11A 3U6KA 1OROA 3GJ3A 1P6XA 2SKEA 4JLDA 1PUIA 1NI4A 3F4KA 1L5KA 5IAOA 3IL2A 1XSEA 1VJ5A 5HBRA 3MYYA 4AY4A 1GTG1 2IXDA 1XEXB 1JQ3A 1QFXA 1UJ4A 2REXB 3E9NA 4J0IA 3KSAC 1B1CA 4LYDA 3ZWNA 4DC0A 1D1PA 1SC3A 2QJWA 3TQFA 3G2HA 2B9VA 3QF4B 4GQBA 3QMVA 3C3JA 1V6CA 3ER6A 3IX7A 4FYPA 4MKRA 4YRFA 1I0IA 2X8WA 1N77A 4L85A 4OB6A 2W70A 3E3LA 1Q0QA 1SKAA 4BMSA 3U6BA 5F51A 3UPTA 3AG5A 3NUQA 4J3FA 1L3IA 1XAJA 5E6RB 3EQ7A 3JQ8B 4QJ5A 3E8XA 4ZAXA 1Z63A 2AQIA 1N2ZA 3C4VA 4QO8A 3PX2A 1IU9A 4I8XA 4LZWA 1F2UA 3DJYA 5TXGA 3TX6A 1JN0A 2AFIB 3GGPA 1JLLB 1X7YB 4JBLA 2NX2A 1UK6A 4GGMX 1WB9A 3K20A 3UM9A 4HDMA 1XEAA 3P9SA 2GN6A 4ARCA 3SEAA 3CVWA 3QWAA 3NAQA 3KKLA 4O4IB 2W2LD 4IDHA 2PQ6A 4B4KA 2OV3A 3TTYA 5K9ZA 2ZITA 1N2JA 3KALA 4CLDA 3VGPA 4CT4B 3OOSA 4LAFA 2G83A 4DNXA 1CZUA 4PICA 4QVKA 3VHLB 2JDID 4EL5A 3IEXA 5BUQA 4NAHA 4QM7A 1R74A 4JJKA 4Q7MB 1U5AA 4GF5A 1GNQA 3U4AA 4MLDA 5C7IO 4ZZ1A 4MI6A 4R01A 1GTL1 1CUYA 3PQ7A 4QDKA 4UVDA 3NNNA 2ZR8A 3OEED 1Y81A 1CP3A 3GVIA 5K8IA 4GM0A 3ENWA 1R9NA 1SRQA 3JRXA 3SKXA 2ZSUA 4YVFA 1Q19A 3E05A 3PXUA 5AP9A 2WVGA 4YQZA 4IX9A 2ZIWB 2ZIGA 4I4TA 3MWFA 4IUBS 3BMQA 5TQ2A 4G81A 3U7QB 4DIDA 5AVTA 2BGIA 3QVWA 4AG5A 4JJ4A 3BIFA 5BPHA 4RF5A 4C78A 4GEKA 5ALQA 4AYXA 1IUKA 3MCAA 3DFUA 1VMIA 4HQFA 2GQ0A 4UVIA 3PQCA 3AOEA 1NGSA 4LMAA 3BGWA 3CR7A 2G9ZA 2Q9UA 3N5KA 4DPMA 2JIBA 1N1EA 5JZOA 4KWEA 2CJWA 2OZKA 3PXCX 3M6XA 3T1NA 1JWLA 1XZPA 3V9AA 3FROA 2LCQA 1UFRA 1BFKA 4FFDA 1QVVA 4NF2A 4F1WA 1W88B 2XUPA 1ENOA 3GJXC 4AL4A 5C31A 1XF1A 1FNMA 1E1KA 3C70A 1IQRA 1NRXA 3SZMA 3NBUA 2R8ZA 3OPNA 1E9AA 1PT9A 3FUTA 3UIEA 3OLCX 4HNSA 3ESZA 2IZ5A 1VLLA 1SHKA 1YCFA 1QGED 2GR9A 3DOOA 4N18A 4AI6A 4HXEB 3F3KA 2ECQA 3H2BA 3R1IA 4WY5A 4HAUA 4G36A 1YVPA 2FRXA 2QPOA 1I6LA 5DGXA 2BEUB 3DPSA 2XB4A 1BHO1 3ASVA 4R6WA 3SBXA 4QVGA 1ZC3A 4EQ6A 2PL9A 1ZK1A 1NG1A 3CF4A 3EXFB 3BB1A 4X9XA 1STOA 2PE5A 2JI7A 4H15A 2NN3C 1JALA 1XRLA 3LT4A 3X1WA 1DRUA 3I45A 1QH9A 2BMEA 5TQ2B 1T8PA 1UFQA 2GK6A 2TECE 3D0KA 3LPDA 4NL4H 1QHHB 4U6NA 1FU8A 2GFQA 3HBNA 2ZJFA 4JT4A 3LUHA 2DWOA 4OSOA 5EVCA 2O8EA 1GZ5A 1YB5A 3DZFA 3VPGA 4F92B 5K0JA 2GLTA 3EC2A 3IO3A 1JMVA 3UK6A 4DYVA 1ESZA 1J1UA 4HPJB 1A4RA 4HGZA 1QJ4A 5CH5A 1RI4A 5FBHA 5I4BA 4I08A 4YCJA 5BVHB 1A9XB 1YSCA 1QCCA 2W2KA 2UZ0A 3LD9A 4QGAA 1RI5A 2AZTA 3DXXA 3IDSA 4FOOA 4ZDKA 3WLPA 5DEOA 1P44A 2CJWB 4UDOA 4EPWA 4MTCA 4DCTA 3RU2A 2GZ1A 1BROA 5C8DA 1ZN8A 4KVFA 4NOMA 2ZYWX 3I9V6 3D6JA 4OIMA 4Z0NA 3SC3A 1WZIA 4QAQA 2YJGA 5ERXA 4A0QA 1ZSVA 1A7JA 2WYOA 1NPYA 2I3BA 3AC0A 5JBQA 1FSSA 1TVKB 1GV0A 2OPBA 2W0MA 5FI0B 4MCHA 1R0SA 1T13A 2EAUA 2I6TA 4RL6A 1CTQA 2IIQA 2GD1O 1JECA 2PGAA 5LP6F 1U9CA 1HDRA 5AMXA 2ZR9A 2XTMA 2FQXA 1CQXA 2OQRA 4UHDA 4E51A 2FW7A 2WDPA 3DEKA 3LKZA 3MTBA 4EFDA 2YVUA 3D1VA 3DXYA 4JN6B 4Z4IA 2HX1A 4DVGA 2EFJA 3KJNA 3FPHA 1RJEA 2XVYA 2GARA 4BO7A 4GI2A 3WYDA 3OO1A 1JV2B 4FUQA 2AJCA 1P5HA 1U1CA 1U80A 3FH0A 3ND8A 4LK2A 4XB1A 4A23A 5K8LA 4D8YA 3ZVLA 1KL7A 2AOTB 3CPJB 1PHPA 4PG8A 5JAPA 1JPVA 5JNSA 2O8EB 3SS7X 5I4IA 2QMZA 3HUTA 4ESOA 5AH0A 5BR8B 3E70C 3FWYA 4BU0A 4NBUA 1M6HA 2NYRA 2MOKA 4AO6A 4DILA 2WOOA 2I4RA 3C39A 2ZJOA 3RC9A 4NH0A 2VQEB 3EIEA 3OFSA 1D2NA 2Y1FA 3M34A 1X8KA 4JWTA 4WWHA 2ECOA 4RMJA 4XUCA 1C7RA 3CURA 3G1WA 5CDGA 2R65A 3ZHOA 2XBUA 4YLGA 3UJAA 2E49A 1P9WA 2P0YA 2ZVJA 1KMIY 3GCGA 4LJ9A 5C34B 1U28C 1KVRA 3TNJA 3B6MA 2M6KA 3LVFO 1WSDA 2BFMA 2H52A 3Q9LA 1BC5A 4W1SA 4HRYA 4CIWA 4H17A 3QQPA 1CY7A 1LNQA 3PJFA 1Z35A 3ADOA 1CKEA 1R8SA 2QTHA 4GD3Q 4W8OA 3PQ6A 3R44A 2MSEB 4IEEA 3GEPA 1MX3A 4MULA 4RHXA 1X3SA 1N2SA 4KV9A 4IDAA 1O94C 2AOUB 2I33A 2XCUA 1MOPA 3K6JA 4RMHA 2WM9B 5IXYA 5G2OA 2ETVA 3WWPA 3WL8A 3L6RA 3OD5A 3KHSA 5ALHA 3OUUA 4JS0A 4KH1A 2QORA 3MVEA 4GP7A 4DUZB 1GPUA 5IEJA 3SJZA 2X1VA 2HK7A 4ARUA 5KCZA 2YW9A 4UTRA 1U63A 4QT0A 1KU6A 2II6A 3FOBA 1HDIA 3T0FA 1PGNA 2MJLA 1X19A 2G9QA 5TS3A 4DANA 1JIKA 2Z6QA 2V0GA 4L9AA 1G9SA 4BNLA 3FYHA 4V0SA 4C3OB 2ZI9A 2PM8A 4R71A 3SQOA 1P8JA 3RC1A 1CZHA 4NNOA 3NHZA 1D2RA 3FNFA 3ROFA 5I5GA 4LTDA 3TOSA 1EK6A 3JQEA 3NS7A 5IC6A 3G2OA 4ND7A 3WMGA 4PTZA 1PL7A 3NIWA 3KTFA 4UBLA 3NOOA 2YWGA 1YS6A 1XMJA 1HG1A 1J49A 1NXTA 1ZSNA 2R5WA 1Y1KE 3CONA 5BSMA 1Z68A 2QM3A 3JQ7A 5A4MS 5AHOA 5CNJA 3HLKA 3UB4A 2D5CA 3IT0A 4Z9FA 4RTKA 4U02A 3HRKA 4LOAA 1HDEA 4CUJA 3HEBA 4E5NA 3ZQ6A 1HDCA 3IAUA 2QROA 4GPAA 2CNKA 3DKKA 4GI3A 1ZW1A 1A5TA 2HTEA 1MQSA 1JRLA 1YRAA 5FNVF 2XCLA 2JARA 3F5DA 1RU3A 4Q1DA 1QV7A 1ZJYA 2B5VA 3AHGA 3KT3A 3L8ZA 2I71A 4ZAVA 3QKSA 5DW3A 4RYLA 2X76A 4DUPA 3G8DA 3BUSA 1K6JA 2JJYA 2R79A 4HMQA 4ARZB 3CNOA 3RC8A 5JLAA 2EJVA 5D87A 2NSLA 1KDPA 3DEHA 3H6GA 2X4LA 4NAUA 4BTEA 3DAHA 2PLNA 1XU9A 4NBKA 1MEOA 1Y4DE 4M1OA 3VTZA 3N2EA 3OM9A 5HFAA 3WY9A 3VJMA 3G68A 1Y1LA 1ZISA 2QRNA 4WCFC 1CRLA 1I6MA 2PD6A 2YYYA 2D5IA 1DE0A 2WFMA 4UCXA 4M1WA 5L3QB 2ZXFA 5T4FA 2UYCA 3V8PA 3M6AA 4IIJA 4RLHA 3NVKI 1UM9B 1C80A 1DXOA 4YPFA 4LCBA 3K4PA 4N48A 2RHGB 3AZOA 3DKRA 4W1PA 5FIUA 3TQTA 2P5TB 2EC5A 3LRPA 4LE1A 3I9MA 3FGOA 1NRIA 4I6EA 3VHRA 1ZUD1 3JQ7B 2GCNA 3LRXA 1V3TA 3M1LA 3MERA 3JQAA 2QX8A 4MUBA 1GKLA 3RS0A 5JI3E 4QDZA 2B8TA 2EG9A 1AM4D 1TMGE 1VE1A 2XWJI 4MX8A 4ZCQA 3WOHA 1NU8A 2JBAA 3I52A 2H85A 3PNVA 2V7UA 5AFSA 3IESA 4KO4S 1I7QB 4E2WA 3LFUA 1OY1A 5AUOB 3B2EA 5H80A 1MDFA 4GXTA 3S2SA 1JQ5A 3ZLVA 2YWBA 3Q5DA 3THWA 2A4MA 4QDOA 2CLSA 4B2PA 2AXPA 1DXQA 5KNBH 1FK8A 5DM0A 2QLTA 2RGXA 3A6DA 3CMMA 1V8ZA 2V8OA 4LJSA 4BKRA 5CYPA 5AIBA 4INPA 4JWKA 1UJMA 1JG4A 4RVUA 1DSSG 4MS4A 1OXKB 2H2WA 3BK2A 1IJFA 3Q6NA 3N7AA 4MGZR 4R3WA 1Y5RA 1HOTA 4XJVA 1CDZA 4Q18A 2VUIB 4TTQA 2YTZA 3ANMA 4O2AA 4MCIA 4EY8A 4HVCA 5EIBD 3M6FA 3TRIA 3BTSA 1R50A 2WPNA 4L9WA 1P5JA 4HV4A 5HCIA 1KORA 2Y77A 2Z2KA 1V7QA 3DPUA 4HOYA 1N1GA 3A1EA 1RJDA 5DHPA 4BNVA 1MB3A 5CEEA 1EK0A 1GG9A 2NUPB 1MPTA 3DYIA 1M1ZA 2PL3A 3VZDA 3WLMA 2NZVG 3AJ8A 4U1RA 1BX1A 4QQKA 1K8XB 3O38A 4RJKA 4YR7A 5BUCA 3KUUA 1RWPA 4XGQA 3KNZA 3EGWA 2EFEB 3PC4A 3IE2A 1J2RA 4G5HA 3U40A 1RPNA 1JBKA 3OKPA 4W9NC 4D9IA 2OGWA 1X1DA 3JQAB 4KK3A 1GGEA 4K6HA 4WOCA 1T2NA 2R8EA 4PG6A 1LRLA 5HA5A 3VH3A 1J06A 4AKSA 1T5IA 1AV7A 4RC9A 5H3HA 4C07A 4DJFC 1FP2A 2J08A 3A36A 5DNCA 2ODEA 1KDOA 1ZXXA 5IU6A 4H3VA 4DEYA 3AU9A 3LQ1A 3PRKE 2PZAA 4QYWA 2HJSA 1Z0UA 4KGXA 3TB4A 4Y3UA 5BWLA 1L4LA 3DBVO 3RLFA 4R9VA 1NQXA 3FRJA 3RHTA 3THWB 1AX9A 1HZZC 2O06A 3ETCA 4KIGA 2DR2A 2ZLBA 2UVQA 4OIFA 3NTUA 1PDOA 1WAMA 3R3JA 1X7XA 3BIWA 4BJ1A 4EYOA 1N4DA 5DLYA 2QMEA 3SMVA 5JHHB 1KJWA 3DZKA 2OYCA 3UY4A 3AEQB 4HNAB 4IJVA 3KKKA 3NHFA 1Z06A 3WLKX 4EW3A 4RABA 2YL2A 1T6NA 1L7MA 2ZM5A 3LLMA 3D4LA 1PFVA 3EMVA 4KO1S 3ZZ1A 2H0RA 3KXKA 1W94A 2VBIA 3A11A 2ENUA 5DOVA 9ABPA 3RVOA 4DR4B 4PWYA 3EARA 3Q3EA 4BYMA 1R15A 4YJGA 3F96A 1NKSA 2C03A 5JZ9A 4QDXA 4F91B 4RJIA 3O3NB 2DTDA 4JJZA 1NZDA 4OUDB 1IVYA 1OT5A 5ER9A 3GV0A 3WBBA 3ZV3A 4F2DA 2VBFA 3OUZA 1UDWA 5C1BA 3LF1A 1BE0A 2WAYA 2FEAA 1W2HA 3C8ZA 1JXQA 4FIZA 3CKLA 1LPOA 3RS3A 3CG0A 4S2UA 1FLAA 4CN8A 3H04A 4PHFA 3ZVMA 3UWKA 4Q3CA 2B30A 2XUDA 1KRXA 2IGTA 3KKQA 4HO1X 4ILEA 2OFXA 6Q21A 1G6Q1 3GD5A 3L7KA 4ZWNA 2IHTA 1K7FB 2IHVA 3WZ2A 1W93A 3L0YA 3N74A 1YJXA 4RKFA 4ID9A 4G2NA 5HE8A 2ZYIA 4FW9A 1S2IA 2C5AA 2VC2B 1E2KA 3FJ1A 2A0WA 3FUXA 3ODPA 3D2AA 1HO3A 1YONA 4NK5A 2W6NA 2ORIA 4MUFA 1HDZA 1TCVA 3MUEA 4G86A 3FIJA 1TZKA 4N1AA 2IP2A 4NK4A 4F4JA 2PX8A 4C1NA 1Q3KA 3WSVA 1SXQA 4R4JA 3DOIA 2MYTA 1TL7C 1G8SA 3HYSA 4P98A 1Q57A 5EZSA 3TK1A 4DADA 3LGXA 1ZM4A 4EJSC 4CIDA 1E0JA 3WZMA 1UOQA 4ERXA 5AVRA 4MEJA 2TMGA 3AETA 4C2AA 3QHQA 4ZOLB 1HT2E 4JA2A 2PUFA 2IOQA 4L27A 3OY7A 2NVWA 1GQYA 2R5FA 1E2DA 3WMWA 1H2HA 1JA0A 3NI2A 2FY8A 4UD2A 3SIPA 1DPGA 1DQRA 4BEVA 3DB2A 5KX5F 3CLRD 3N7UA 1UOOA 2YWFA 1Z6TA 4PSUA 3RF7A 2ODNA 4I7EA 4RVFA 4YT4A 4N6NA 3B20A 3GU3A 5IUJC 4MUIA 4K6OA 4DA0A 3ABOB 1A2KC 3FETA 2H92A 5CAEA 1M7HA 3EVBA 4QYSA 4R41A 3UHFA 3DTYA 3N86A 4Q3DA 1QGZA 1YR2A 2ET6A 1NT2A 4QNNA 2CNDA 2FSVA 4G0ZA 3L79A 2IZ6A 1UOEA 1R4MA 4PGAA 3U3KA 5CVTA 3MT8A 1Y37A 1NNLA 1Y1PA 1KSJA 2QW1A 2I5PO 3FWNA 3OCCA 1PNVA 4RKQA 1EPUA 1OYOA 1USVA 5FBZA 3MWKA 4FN5A 4OXKA 3SBEA 1NOKA 3ZIAA 4Z54A 2XYQA 1M6YA 5CDYA 1VMDA 4RKEA 2FZWA 2PGNA 3FHCB 3H6HA 2ZJ4A 2VWHA 1GDHA 2G1AA 3PDWA 5BV8A 5ALMA 4DQLA 2OUIA 4L1KA 4GG1A 3B60A 4ZCIA 3HWRA 2LP4Y 4I6GA 5FBKA 1J6UA 1RQ7A 2H5LA 3PITA 2IKQA 4A8JC 4N5MA 1HM5A 1NFRA 3GAZA 2WC1A 2HA5A 1IUNA 4WXYB 5AM3A 2A9KA 2Q6LA 1OXUA 3SD7A 2E4WA 4US1R 5HQTA 3CXRA 3KZKA 3PXBA 4QTTB 5UKDA 5LUAA 1E9FA 3ZD9A 2XB9A 3BAZA 2DLCX 1GZSA 2PBRA 1GPWB 3UT6A 3OCWA 5KSYA 4EHFA 5BP7A 2JATA 4D46A 4QXAA 1CUEA 2QGNA 5CG2A 2X40A 4D98A 1GLVA 1A04A 4BZQA 1XJ0A 1S02A 2OK8A 2JEYA 3ZW8A 2O59A 3H5VA 4MAMA 1GA6A 4MKFA 1ND5A 1ML4A 1SXJE 3OFVA 4LE0A 4TN1A 4UEQA 3IIEA 3SQMA 2O8FA 3L4KA 1JFFB 1MTOA 2R3SA 3KUCA 3OZDA 5FQOA 4DFDA 4O3MA 2R6R1 4A0SA 1N0VC 2LVBA 1FZQA 4Q0MA 4MKZA 2D54A 4TSFD 2B9EA 4YUZA 1I4OA 4ZAZA 2EZ4A 1JKXA 5T4BA 3RBZA 1AJEA 1QLHA 2AG1A 1IY2A 1U7UA 4NC9A 2A35A 1E2EA 4G1EB 3ILYA 1EQ2A 4WBNB 2NM0A 2ZT8A 4FINA 2L17A 3AJ9A 3JQGA 10MHA 2O2SA 3B12A 1ISHA 3CX8A 5DX1A 1ZONA 2XIJA 3IELA 4EJMA 3U60B 3N0RA 4OBEA 5KQRA 3HVUA 1D5WA 1YC2A 2NXCA 3B70A 4UZSA 4BYGA 4PYIA 4E30A 4MUNA 1DRKA 2DH6A 2Q7XA 5EE9A 2EX4A 2V1UA 2VT3A 4I50F 3JQ9C 1J21A 1K3TA 1CEQA 1G20B 3FCYA 4EARA 1R0RE 2W8BB 2J07A 2YX1A 4EF4A 1XKXA 5BT8A 1ST3A 3BWEA 4GBED 2Q0QA 1J23A 1IFXA 2YMMA 3IALA 1EE9A 3MJTA 4JODA 2PTGA 1L4YA 5J43A 2H2DA 3I72A 3O03A 4GYJA 3ABSB 5I3ZA 1CHDA 4KQCA 3X2FA 4RSGA 1Z4MA 3N8NA 4M1KA 4G8JA 5DGCA 2ZTSA 3CO5A 3AEUB 3ZDRA 1HR0B 4S05A 2UZAA 4JQOA 2OMEA 3K35A 3NU1A 2GZDA 3EXAA 1J24A 3KFVA 4MCJA 4YMSA 1Y82A 1D9XA 1GSHA 1NW3A 2FLWA 4M8SA 5HDBB 3TLZA 1XCBA 4TVBA 5EWJB 2RJOA 1ZHHA 1BX3A 2BLLA 4NJOA 4XOIA 1U81A 2AB0A 2OZVA 3V2HA 1PV1A 3T35A 2K7ZA 2FE1A 3E22A 3GOHA 3WI7A 4C03A 4UVEA 4E15A 2A5YB 5JXGA 2FLKA 2Q62A 2XA1A 2YJZA 4ZRNA 3QVUA 1NQTA 4ZQIA 4GPIB 3J81k 3PQ5A 4ROSA 5FWYA 2X5XA 3L6DA 1M76A 3OU6A 4L3WA 1DIGA 5IK2A 3SDSA 3VKFA 2PZLA 2RK4A 4A15A 3F74A 4UULA 4X93A 5F4BA 4JYZA 1G8AA 4AZ0B 4TL7A 5FFFA 3ZHXA 3CSUA 2FSHA 3NG1A 4MUJA 4QQNA 1GQQA 1TIBA 2A0XA 4J0JA 4UE6A 1BWQA 3TRKA 1IRXA 5LP6A 3Q72A 1VJRA 3LUKA 1Y0BA 3T3IA 1E5LA 3E7WA 1JQAA 2M9MA 1NMXA 3DYBA 3GBSA 3I2HA 3SHQA 5IBQA 2QZ4A 1JDZA 1YZFA 3ROXA 5LDGA 2OUKA 2QZJA 2YH2A 3F67A 4J75A 1X87A 4TL6A 2UZ4A 1JR2A 2WK1A 5IZ4A 1G8FA 4BRZA 3VKVA 3FFTA 2XZDA 4UNNA 1W4CA 4A6PA 3ZXSA 3ZE6A 3MIIA 3DUWA 5E0KB 2P3LA 4JQYA 1B0ZA 1T4CA 3ITNA 4ND8A 4C7OA 4WDQA 1SD2A 4A4DA 5C9ZA 4JSTA 3FYUC 1CS0B 2BKLA 5JCJD 1F4PA 2C29D 1ODLA 1DC5A 1R5BA 3KQQA 2PWAA 5EESA 1MIOA 4F46A 1RBYA 2VH2A 4QOGA 3B8EA 5DYNA 3OJOA 4EHKA 3QOFA 4M49A 2N46A 5D1HA 3TMKA 3ZZ0A 3CT4A 3WGYA 2HUNA 1XJ5A 2ONKA 3EJWA 2A0FA 4L4XA 4YFYA 2ZQYA 1UMBA 3WK4A 4ZVUA 3UANA 3KHTA 2BBWA 4PLWA 4HSEA 5FWYB 3SXUA 5EE1A 1XR3A 1V3VA 4M86A 2VRCA 4CG0A 1JWAB 4IINA 4ZQGA 2N0SA 1B74A 1NJ6A 1XELA 2PA0A 2ZSHA 3ACCA 5JH7F 3T3NA 1A7UA 4Z0HO 2P2YA 4LISA 3B53X 1FYXA 1PUXA 3E0QA 3L92A 3JTMA 4MUKA 2AN1A 4X63A 4FWBA 2FV8A 1BU5A 2QNBA 3BX1A 4EW2A 1MA3A 4MUGA 1LFDB 3Q9SA 3PVZA 4Q6WA 2R7LA 4EA8A 3E53A 3M6MD 3Q5EA 3U56A 1OBOA 1MDBA 1MT3A 2CUZA 3WL3A 1NTRA 1PKXA 1Y5LA 1JU4A 5HE9A 1SC1A 1EVLA 5JVDB 3ZGLA 3A1UA 4Q4CA 1RLMA 4YACA 2I91A 1JDBB 1F5SA 1M7BA 2XDQA 1PR9A 2J9GA 1LPBB 1M8GA 1RYHA 1WXXA 1Y8ZA 1KEUA 1U3FA 1NFQA 2PKRA 1WCWA 3BEOA 4ZYVA 4G5RA 4KZPA 4C7OB 2X7HA 2XUKA 5CH3A 3MBKA 1PQUA 4N0QA 4CI9A 1AIPA 1HY3A 3RRMA 2OD2A 3W5CA 4FZ3A 5TQ0A 2DWPA 1V96A 5ALUA 2D1RA 2Z5LA 4ES6A 3PIIA 4KHPB 1V25A 1QTRA 2RJNA 5DYGA 5IJXA 1LPPA 1U2QA 3NFYA 2P2ZA 5ERYA 1HGXA 1XNRB 1FJGB 2C7VA 4RFLA 1UMBB 3NT2A 4ZVOA 5GJCA 1XQ9A 5C4MA 1EWYA 1LLDA 1R8YA 4NCJA 2W43A 2RK3A 1F17A 4HG2A 3N2ZB 5A2QA 5CX4A 3OETA 7YASA 4JXZA 2C5BA 2ROQA 4EEKA 4MV8A 2MU1A 4WXPA 1F8GA 1K4YA 4CNQA 3GD7A 2PYDA 1NWHA 4RD4A 2NADA 3AILA 1PGQA 1QLWA 4K81B 2EL9A 3KOMA 4M4SA 3D1LA 3ZN2A 2BZGA 1ZUIA 1H0SA 3RU7A 1IXZA 4MA0A 3SJ7A 5FNVA 3ZI7A 1ZJJA 2G6BA 2WZQA 3D1JA 2YN4A 2SNIE 3HA5A 2CFOA 1W36C 4FYHA 4LC1A 1HH4A 3E03A 1SZJG 3QMWA 3C1UA 1YAHA 4K6KA 2XDQB 2C9DA 1XDBA 1BOFA 1FS4A 1RHRA 4WY8A 4MGHA 1AUVA 3ZJYA 4AZSA 1QWSA 2P9QA 1XZ8A 5G0TA 4FFWA 2C0CA 5DTEA 5T8KA 5BVGB 1B8OA 4URFA 4U5QA 3S55A 4PCUA 3ED1A 4FZ5A 4NI5A 5CTJA 2YIMA 1M3SA 1U2PA 1S01A 4RPIA 4AWBA 2YZGA 4M22A 2X0FA 4NV1A 5CFPA 4HVAA 4MKGA 1LI5A 2B69A 3I05A 1H2FA 1L4HA 1YL6A 2CYBA 2XYPA 5BQFA 4Z53A 2D2EA 1TMKA 3FKSA 1JEAA 1NF8A 4K46A 3BT7A 4TLDA 1U7ZA 3IR7A 5A04A 4Q4HA 5D3MA 2YUIA 2QLMA 2CDBA 3A06A 2Y1CA 2R00C 1JJFA 2H57A 3AFGA 5JYDA 1DTSA 1W2GA 2IA5A 2P7HA 4M9QA 4N9WA 5DNEA 5K3FA 5LFAA 1NVUQ 1JE1A 2X22A 4R8VA 5FUWA 1NM5A 2C92A 3KZNA 3R5JA 4R0MA 2QAJA 3DZ8A 3TLKA 5IANA 2B37A 5JALA 1JG2A 5K0CA 1ZK3A 4YMWA 3VGJA 5EJMA 2XX3A 2AN5A 4RTNA 2O3QA 4D3XA 3DTNA 1V9LA 1UXGA 3IYLW 4AMVA 5I7WA 5J4VA 3GLGE 2UUBB 1VYUA 2J0UA 2CLMB 1R8QA 3KHUA 1AT1A 5DTIA 4BKPA 1T1JA 4MWTA 5I7UA 3U4CA 4EJ6A 5C5DA 3GAAA 3I42A 4RJTA 2J4FA 3KB6A 1R10A 4GICA 3ZOKA 3SS9X 5HJ7A 2JFPA 3EOZA 1U0RA 2DLDA 1ACLA 1IWPB 2JW5A 2IHBA 4PHCA 1ZVKA 1P91A 3U9LA 1KEZA 3DDHA 2IX9A 2WHYA 3JVUA 3LY8A 4KV7A 3V7WA 5HRUA 2O57A 2KLHA 4A6EA 4EEZA 5CCEA 4I2NA 2B2NA 3TI7A 5BMVB 3MGBA 2EFYA 2DBZA 4NCNA 1G0NA 3LPMA 4JLUA 5BV1A 3T8YA 2NZ8A 1PJZA 1E1QA 2D62A 2DHRA 4J16C 1WZUA 2ASVA 2QD2A 3CF0A 2G3YA 3GZTB 4X7PA 2OO3A 1T3TA 3HCBA 2QE7A 3H1AA 5D3MB 3OA2A 4TKLA 4DQUA 4YHBA 4OHMA 4LJRA 2H00A 5CXUA 1PE0A 4HNQA 5CCDA 2DGDA 3KJHA 1DG3A 2VSNA 1O8BA 4L8LA 2BR4A 4MNTA 4EUEA 1NXVA 4KXLA 5J2TF 2GERA 4BQNA 4MR8B 3I23A 3L0CA 3G9XA 2HLPA 3KVNA 3JPYA 4J1SA 2C4MA 4C04A 1LDNA 2IIVA 2A9FA 2DHDA 3GJ0A 2I99A 3VU8A 1XJWA 2WMOB 5CJJA 2QTAA 5BQXA 1QO9A 2GD0A 1XZNA 4YV1A 2GAJA 4NJEA 3ZE7A 1X7WB 4XASA 1L7BA 3OIWA 3L9WA 5IBPA 5KNCD 4AJHA 4IMJB 1N3YA 3WLFA 4AMYA 2JGDB 1XN1A 1RXVA 2V03A 4O8ZA 1EP9A 2GWRA 3DW3X 1LU9A 3ZUGA 2PS9A 2ODBA 4NPHA 5KSZA 3AHFA 4KR6A 3JYOA 4GX0A 2ZRCA 1B3RA 1Y33E 3G82C 5HKKA 2CZQA 4R83A 3O4VA 3ZWOA 5ISMA 3FNQA 1U8AA 1L5SA 1KA9H 1QP8A 3PIDA 3Q12A 3U1TA 2WVAA 2ZUDA 4JEIA 2WFLA 2Z3ZA 5LKRA 3AKEA 4MVYA 4X1KB 2ZTVA 4R05A 2WABA 1JLHA 2MYNA 3T9DA 2HAEA 2V98A 3VFDA 3WGMA 2NVBA 3B2QA 3L8HA 4F7WA 2JFXA 1IOLA 1PT8A 1ZBDA 2VHVA 2Z8XA 3RS7A 1XZJA 5EQDA 4DYHA 4K0KB 2FWNA 3II6X 4YAGA 1T9ZA 2CT8A 5EZYB 1S4MA 3PIRA 3B5EA 4QECA 2Q6TA 4ZEWA 4CTNA 4ZCSA 4P5PA 5CM9C 4DR6B 4G3XA 3ZHCA 3ZK9A 5CHYA 2HZ7A 1N6PA 1RZRA 3HKCA 3E3MA 4GR9A 3ZYZA 5TSDA 3PB3A 2FWIA 3O75A 1QGUB 4WK4B 1E99A 1V1MB 1RYMA 4FYJA 2EBWA 5KAMA 2FG7C 3EX7C 1V16A 3K9FC 3VU0A 3WQBA 2ASEA 3HHEA 1W59A 3AUKA 3ADBA 1H4QA 5LYJF 1JHMA 2OY0A 5DCWA 3A1WA 1CUIA 1IG0A 1WM1A 4E32A 4KE7A 3RABA 1VCIA 1U0GA 3DKVA 4YMGA 5H9VA 2D7CA 4GOMD 1VIDA 4FYIA 1RE0A 3LHKA 3IUPA 3VU3A 3ZIUA 3U7HB 4O02B 1NG9A 5BOSA 4MR9B 2CNOA 1KR5A 4O0LA 4EA6A 5ERGB 1U0EA 5CA0B 4PIPA 1GFWA 2BE7A 2HSWA 2W9XA 3COSA 4QELA 2UZIR 3B78A 3JYLA 4UU0A 4XWOA 1DJMA 5GTDA 4N65A 2WP0A 4UM8B 2IEDA 1VSUA 2IPXA 1GPMA 3H86A 1Q21A 3TGPA 3H4VA 3VI4B 2P9GA 4J3JA 3DWEX 5HUJA 2Z58A 1A9RA 4ZYZA 4C6RA 1M6EX 3L1HA 4UHEA 1QG0A 3H11A 2C4NA 4IV5A 4JEUA 3V8QA 3BMOB 2FF7A 5HKAA 1EGMB 3H8JA 2J5BA 1T9BA 1IXKA 1GL3A 5AUPB 4BMOB 5CVJA 5E6SB 4B3BA 1YIOA 3KOOA 4ZO9A 1BX0A 1JDJA 1IIBA 2HV9A 2W2NA 3WYGA 4AMZA 5EP2A 4IJ5A 2RH8A 2VDOB 1FTYA 3HV0A 2XNDA 4KXMA 3T95A 4RNCA 1BE6A 3UKOA 4HUQA 1QOQB 3RVNA 4CM9A 5HM8A 2NQ8A 1J2YA 2OECA 3ZY2A 1A9PA 1PU2A 3NAZA 1UK7A 2ZDQA 2CHQA 1AQYA 1QE5A 4TLAA 3K1JA 1OCEA 1K75A 3P71T 1PZNA 1BDJA 5FQNA 3T54A 1C30A 5BSVA 3KQOA 4LHWA 4Y2TA 4BQSA 2J8ZA 5FOXA 2B82A 1TQ2A 1XRMA 1UPTA 1TKBA 2UVPA 4L7QA 4ZARA 1SOAA 3OSZA 1QQ6A 2IU0A 3A1NA 4V1CI 1HDOA 1MVNA 2WSIA 4RTRA 1YQGA 2FN7A 3LC7O 4I19A 3ICQB 3OJWA 5A9TA 4EMUA 2XNHA 2P2GA 3BE4A 4H3KB 2YC2C 1FMLA 1SCKA 4PC2A 4ZXFA 1B0PA 3PNMA 2VXBA 3CUWA 5LU8A 4GMKA 4C4AA 3LYUA 4UOQA 4M7WA 1DAFA 3C3CA 2WUWE 3S2UA 4DJDC 1XU7A 4EW6A 5IKMA 3VHXB 3QKRB 2ZYRA 2RMKA 2EP7A 2KS6A 3H11B 4KUGA 4UATA 4Q4DA 2R8XA 2WF6A 1QFZA 2QTVA 3TLMA 4UAJA 1R27A 4UMVA 4BTVA 3PYMA 3ZI4A 3E61A 2WU1A 1TJYA 1F8XA 1DVRA 1W581 1UFOA 1Z39A 2B6NA 3EVEA 5AI9A 4YMLA 3MTAA 4NS4A 4S3MA 4AG3A 3QEMB 2GBCA 1CNFA 1DLIA 4QBGB 3CCBA 3N8HA 4Q3LA 2JFOA 3J81A 1SHJA 1F9AA 2P9FA 4MCAA 5GJBA 4KQMA 4IW3B 3O4GA 1LQTA 4A5SA 1IY9A 2NO9A 4M9ZA 5CLIA 3VYWA 2XDAA 5AKHA 4W6ZA 4ZYWA 4EB6B 2JAXA 3F7TA 4I50A 4U7GA 4MITA 3F9IA 4OQPA 4BFYA 2UUAB 2Q5HA 3LXUX 1V5GA 1UMDA 4KODA 1VYVA 5JUWA 3A31A 2G5CA 4Q9IA 1OTYA 3FHOA 4ARVA 1BW9A 3I9V1 4HMOA 1TGVA 4JH0A 1BVHA 4K5QA 3HCEA 1BOOA 1LNZA 4RHTA 3B3QA 3GLHA 2OLEA 4LJLA 4DHWA 3IERA 1JYEA 4JYBA 1SIUA 1UJ5A 3RLIA 5ER6A 2QMOA 3SVLA 4R9UC 4CFZA 1GRNA 4RDCA 2XODA 3QMPA 4LDPA 1LQ2A 1WUIS 3BSYA 4PANA 3L4BC 4ZT2A 5LSAA 3X1MA 4M83A 4YGYA 4QZVA 3NVAA 1R0KA 2DBRA 1V41E 2SCUB 4IS3A 4FFMA 3EGXA 1SQ6A 3LI2A 5JAQA 1BS2A 4EFLA 1SCNE 2CXNA 2QTVB 4M9RA 3D3EA 1S2OA 3IRUA 4RHYA 1NVAA 4H6WA 3HNPA 4I9FA 1DAKA 1SNYA 4M9UA 5EKUA 1IULA 1QRDA 2ARKA 3JYHA 3R7NA 1IIRA 4UNRA 1FE8A 1P3Y1 3GDGA 2IHUA 1DP4A 1DT3A 2W4QA 3O2QB 4R54A 5AD1A 1J0CA 3LQ4A 1XTBA 4FW8A 4U2BA 2FW0A 2PHZA 1Z5PA 2HQBA 2CMGA 5CVUA 5JPIA 4OQXA 3IQXA 5JJLA 2IHYA 1DC3A 4BNWA 1AV6A 1T6XA 4O4LA 3UWPA 1ULBA 3NYWA 2VTVA 3JAWA 3KTOA 5ENDA 3IKVA 5CYGA 1LBEA 1MENA 3TI9A 3UEOA 1BHQ1 2PZEA 2W8ZA 2CHEA 3E2MA 4G0WA 4ITUA 4JFAA 4UBJA 4FJ1A 2C2KA 2E6UX 3KAPA 1BW9B 2POQX 4GLOA 3D6FA 3W34A 1G7CA 3H1BA 2A67A 3KIPA 4BO5A 3CVJA 1PS0A 2LDBA 4HDCA 2XRZA 1RXCA 9GPBA 3LIPA 3F6PA 3OQOA 1RWKA 5E4FA 2AUMA 3TTWA 3BBPA 2NZ2A 3OLVA 2WIDA 3DNFA 2CNNA 3A1DA 4WJZA 5FAKA 4JKYA 2NAFA 1ZGBA 3MTJA 1H22A 3GJ5A 1OI3A 2NUBA 4FHEA 3QX3A 1SU6A 1WB6A 3GPBA 1OFGA 3BHMA 1G4HA 4EJSB 4BEJA 5BR1A 4N0PA 4X7MA 1H05A 4JX8A 3A4TA 3FFXA 5F2EA 5TF4A 5JANA 1PR6A 2G28A 2IY7A 3IODA 1E1YA 4XYGA 4DCNA 2IU4A 1C14A 1HYEA 4LNUA 1NYTA 4XGKA 5L4SA 3W9BA 5EEHA 3D4PA 1E1RA 1O9BA 2VRCD 2XTJA 5CNIA 1XU4A 5CLFA 2GH1A 5IABA 3KYIB 1TB4A 4MDHA 1TCAA 1YR7A 4NBNA 3T0IA 2FG5A 4XZ3A 3A26A 2WG1A 3CFYA 4UTOA 3H5NA 1FX0A 4IG9A 5J5AA 1SKUA 2SICE 2X1LA 3N75A 2ZIXA 4EKGA 3MHPA 1JIJA 1KFBB 1WQ4A 2PEZA 2R62A 4O4LB 2A8YA 4JLNA 3TEFA 4NP6A 1GNRA 2CLKB 4JK3A 3V6MA 3VSBA 3L7AA 3LYHA 4DMGA 3VBCA 4E5DA 4Z4FA 3WQSB 5ITSA 3UH0A 3A1TA 1GNTA 2PKQO 2AJ8A 3HC7A 4F4IA 4QFDA 2JANA 3FUUA 1J9ZA 1OILA 1KY5A 1USKA 3LCJA 5BQPA 1PFKA 4QBHA 4ZOQI 2QA5A 3EB9A 3AX6A 3EVZA 1FL9A 4ISBA 4JLAA 2WD7B 4P6VF 4R8RA 1S3FA 4V2IA 4EUFA 3J80A 2WICA 4CFSA 4EY4A 3ZCRA 4GXNA 2YQ4A 2PUGA 3F2VA 1RC0A 2AMYA 2H17A 4GRDA 1K3UB 3EDYA 5LCXA 4G85A 1EJ6A 2YJ6A 1ZJ4A 5EMHA 2I3ZA 3SSAA 4AN0A 3IBGA 1ISGA 4LVOA 4OVKA 4PNHA 2LKCA 3L01A 1ZH0A 1ZS9A 2VYVA 1Q7EA 3QEKA 4C88A 1WIWA 3QWHA 2J7KA 2JLQA 3GFOA 1ZI6A 4FKBA 4J1TA 5IDWA 1M74A 1O0BA 1YULA 2H1FA 3RG8A 4C21A 2OAGA 3LHFA 4KX3A 3T3MB 5TPZD 3ORSA 3ROEA 4ZDIA 1BMQA 1CUVA 2GEVA 2HO4A 2NSHA 4BV2A 4IZOA 1CHNA 4G0QA 4Q4AA 4D0RA 3T15A 1WULS 2D6FA 1ZM7A 6REQA 2IS2A 1R16A 1I24A 4X8MA 5I4CA 4WOBA 3LKDA 2GVDC 1NXWA 3KT6A 3M4YA 1J0AA 3TB6A 3KZXA 4MS1B 5DI3A 3FMPB 3GHYA 4G23A 3E35A 5KMGA 3P2OA 4KPUA 4V0OA 2ZUEA 4GO1A 3TFQA 3OT1A 3B3GA 4KYIB 3ULKA 3IBSA 3EGDA 2R8PA 2EX1A 5BN1A 2IS6A 2O6LA 4NULA 1K8YB 3BF8A 4MW6A 4JC8A 1G8MA 3FMGA 3BN3A 5EIHA 1FTGA 4Z7OB 2K2QB 4IXWA 3E7DA 1TCCA 2J5KA 1A8QA 1XDUA 3GGSA 5L6MB 2I6FA 5C7YA 3FPCA 2QUBA 3KC2A 4ITRC 5DTQA 2HCFA 3RASA 1H3FA 1E18A 3SDZA 2ZT5A 1VI6A 3QNMA 2PSEA 4DWOA 5T4EA 4X62B 2F67A 1M6VA 1E3EA 2VT2A 2Q9BA 5AW5A 3ZCXA 5JTTA 4I4CA 4HVTA 4BLSA 1E2GA 1CF4A 2JJQA 3AXSA 2WKWA 1QAMA 3UWMA 3ROMA 3KQNA 4Z3DA 2C9BA 4Q15A 4Q4JA 1P2BA 4FSHA 3VDMA 4K6GA 3SC2A 1SN7A 3LTNC 3JR3A 5IEBA 1CUZA 4Q4AB 4LSWA 2DKFA 4JSRA 1KIAA 1EFPA 2BTOA 4D9HA 4Q12A 2J3LA 2FG6C 3CSDA 3ETGA 1J99A 3CEJA 1CUHA 4J4BA 3D4BA 1LZKA 1I2ZA 3BHJA 2I80A 4DE5A 4EI7A 4X66B 4PQGA 1O97C 2IP4A 4IFEA 3BRWA 3M4NA 4K6FA 4QYTA 3OPQA 5DI3B 4LHEA 5AXDA 4HAXA 4MP8A 5JNTA 5AJZA 5KMGB 3D7LA 4CWAA 3VR0A 2A5DA 2NU9A 2X42A 4U2EA 2IBSA 1EDBA 4UEKA 3R6GA 1IPHA 2VAWA 2X2EA 5CB4F 4AQ7A 3F4BA 4PCVA 3FOAA 1DBQA 4KBFA 5CNMA 1M5UA 2CBZA 3ZLTA 4D3ZA 4FI3C 3MBIA 4PC3A 7REQB 1AS2A 2C0QA 2RHOA 4MP6A 4OXRA 2WU3A 5LQKA 4F2PA 2HHJA 1TYAE 3L46A 4BDSA 5SZIA 3I32A 5BSFA 1OUMA 2DPGA 4O4JB 2E6KA 1WCV1 3HKEA 1C8LA 3WWYA 1UBJS 2E1RA 3A10A 3BPSA 1M33A 3CJQA 2OHHA 4BX3A 3D2CA 4JOBA 2PT9A 3V55A 4XIFA 1B6RA 3USES 4P4LA 4IUYA 2D0PB 2TSYB 3V2IA 3E9QA 3VZPA 1EJ0A 3STVA 3TIXB 3D6MA 2W42A 4LJ6A 1ZL0A 4Q47A 3FOFC 1GZVA 4II3A 4OGFA 1S1CA 4AXXA 2IQIA 5LDHA 4Q4JB 3V42A 4B6RA 5KYWA 1Z8HA 1K5GA 3KB8A 3NHWA 1Y6GA 3MLBA 1BMDA 1K89A 3WISA 5WRFA 3DLAA 1AGRA 4V0LA 5NLLA 5JYEA 4NOKA 3BXEA 4JA0A 4M54A 1I1HA 1CQJB 3R0JA 4ZI5A 2P9TA 5KYUA 2V59A 3K05A 2ZJ7A 3Q8XB 1AKTA 2GYVA 1ZNXA 2AFHE 2GN9A 3G23A 4ZGWA 1TPYA 4MQFA 4QOJA 4OHYA 1Z3IX 4CCYA 2DPYA 5I7SA 2XV1A 1DJLA 1MRSA 3I6ZA 4JB0A 3KSZO 3DOJA 5L45A 5J2TA 3GP8A 2NT3A 1UDRA 2VYND 1KEVA 2P62A 3KYBA 3FGZA 6PFKA 1FNCA 1GUYA 1FTQA 4GOKA 5ELLA 2CBXA 3TLGB 3MS2A 4JUBA 1FYDA 1XK6A 3D7MA 1T25A 5EQFA 3ESXA 2HNKA 4LJ7A 4D9CA 1ZNQO 4K2HA 4EAQA 4U9IS 3U49A 1NLYA 3D3WA 3NVDA 1C8VB 1OR8A 4CM8A 5LQMA 5A9SB 4CKZA 3ZE8A 5HKKD 4I8DA 4D8WA 1GU1A 1TT5A 3VR4A 1USUA 3EWIA 1ZGJA 2HBZA 3QE0A 1DWQA 2BRUC 3LX4A 3NHBA 4HRAA 2Y8EA 1EUQA 1H6AA 1T35A 2EW8A 4CMKA 4EHHA 3EDRA 2EFHB 2ZRPA 3KOUA 3O7MA 3O8DA 4FCCA 5ESWA 4C20A 3PDHA 2AL7A 1SBTA 4JHLA 3PQDA 2Q21A 1E5XA 2Z5FA 2HIAA 5EWLB 2A1TR 5FEMA 1N25A 2XB8A 3S99A 2OTCA 2N1MA 3B9BA 5EKXA 5A7HA 3SF8A 4X65B 5KYWB 5DYWA 2VEOA 5AI5A 5E9QA 3QPVA 4BGUA 4EK9A 1GYPA 4DV1B 2QR5A 2PSSA 4LQCA 1F0KA 2FJUA 5EUCA 5KYUB 3K6KA 2YBEA 2H7VA 1ISFA 4P36A 4YEDA 3FHJA 2GM9A 2EARA 1UKVY 4EF5A 4MQFB 1EVIA 5LA6B 4M1YA 3RS4A 1U7WA 2C2WA 3BIOA 1VPVA 3EA0A 4WLVA 4CCYB 5KYXB 3R3WA 4KDCA 4D9FA 1XCGB 1DAMA 4W7SA 3EGVA 2V8BA 1JGTA 5TQVA 9LDBA 1RCTE 4A5OA 2QZZA 3RUFA 1T8YA 1WNFA 1WTAA 3H2KA 1DTWA 1WSAA 5BURA 3D59A 1MAHA 5TGTA 1YASA 2AKEA 3CY6A 1GFIA 2AR9A 1OWOA 2TS1A 1H5QA 1EXWA 1INLA 2AN3A 2OVFA 3L7NA 3R3XA 4ZOAA 4W5OA 3D3WB 1ZK0A 4RCYA 1T3GA 5B1DA 1FYEA 4XYLA 2DQZA 3LYLA 4WLEA 2P5SA 1BEUB 3KQVA 2NTEA 4N5NA 2YXEA 3YASA 2VKQA 3S27A 5EUQB 1C3OB 4CU5A 1JEOA 4LWPA 5FPSA 1Q3TA 3LZCA 4ND3A 3QTLA 1QE3A 3V3TA 4KFCA 2RCNA 4UTZA 1JDNA 4FCVA 3UMGA 3UO8B 1T1GA 2JRLA 3DE4X 4FHFA 5EKSA 2GCIA 1KJNA 1RAFA 3OJCA 1YE8A 3TZKA 2Y4OA 1GTZA 3Q3HA 5IJ0A 1JUDA 3KXLA 3JY6A 1FMFA 3MTQA 3OP1A 4QYXA 2Z9CA 1NN3A 1EB8A 3F4LA 1UKBA 3GFGA 3NALA 2G8LA 4P54A 4MVJG 2JRCA 1PRYA 5I9TA 4PCLA 1GGJA 4OMFG 4AICA 1CJUC 2W2PA 1BWSA 5LYYA 1JDVA 1W73A 2HF9A 5K09A 1HDXA 2HMWA 4AJ4A 4IHJF 4LY0A 2OV4A 5ADUS 3MINB 5JR3A 1JSXA 2X0NA 2FMXA 4A27A 1U99A 4A1FA 4BNMA 1KHTA 4ENRA 3STWA 2C97A 5JYBA 1ZFNA 2GZ2A 3EW7A 2IYOA 5AW6A 3AY3A 5JTUA 2G40A 2G80A 4XVCA 3FCSB 4E0BA 3DVQX 1T5DX 1Z16A 3K32A 3SMQA 2FQQA 3ER8A 3ZQUA 1JEDA 2GNAA 3KTDA 3RIGA 2CFRA 3PENA 4JROA 4NE2A 3W1VA 1UT5A 2ZIAA 5EINA 4FOLA 8ABPA 4OLAA 4Z2YA 2ZYVX 2HNBA 1PJ2A 3FBWA 3NP7A 4XIJA 3ZWDA 4DLPA 4IF4A 1Y48E 1SKBA 3FVWA 1Q0HA 2PLWA 5BYJA 1UBUS 4AO7A 1MTZA 4BTLA 4WKPA 1XO1A 1MO2A 2XF2A 4BNIA 5JV5A 4K1LA 4TTSA 3AOEC 3WK9A 1UBNA 3JVEA 2XCTB 2FPKA 3A6GA 1UZUA 2OBLA 2OGSA 1A2QA 4IMIB 4OYRA 4QWWA 4RLFA 4B75A 3HGQA 3FIUA 1Y7PA 3ZHVA 4D57A 1N75A 5EY5B 3VU1A 2PUCA 2ECPA 1KEPA 2ZRMA 3B1WA 2BC9A 1ULSA 4JVNA 3RAFC 2DUMA 2D2XA 3VNBA 1TF5A 3KLPX 2YW2A 4EYEA 2OSVA 3H3JA 1N4AA 2IV3A 2PBFA 1IJKA 3CLSC 3QV1A 4G1MB 2HMSA 3OHSX 2F3PA 2H2GA 4I14A 3NWBA 5HXAA 4EUSA 2PYZA 4QUHA 1QO0A 4FEAA 4PF1A 3S1AB 4EPYA 4GKAA 4F3CA 5JNUA 3ISVA 2HLNA 1E9DA 4NABA 1QBKC 1BE8A 2WM2A 2Q0XA 1YDEA 2AE2A 1QHEA 3TYXA 4JC0A 4XLZA 3AVPA 3NASA 1L4GA 2JCGA 5FOSA 5KNDA 5B3JA 2WV9A 4TZ0A 1W96A 4FGUA 2ZW9A 4M99A 1ADFA 2FSGA 2VHZA 4S1TA 5H16A 2Z2ZA 4QNRA 1H4TA 3PNKA 2BHRA 1B16A 2NSJA 3ABRB 1DOHA 2RGEA 4E09A 3A6EA 1Z4NA 2W37A 2IWRA 3AUSA 4DBLE 4HVLA 3RYCA 1OHHA 1WEHA 3DQPA 3QLVA 4GDFA 1W0JD 1ZL2A 2WWWA 3DQQA 4QVIA 1BXRB 1FX1A 2HF2A 4NU0A 3WZLA 2BV3A 3L4SO 4DLAA 3WLAA 3IJ5A 4CUKA 3UGJA 3H2YA 1ADCA 3AQ4A 4OFZA 4Z1MA 1DUIA 3AMVA 5ES3A 5KTSA 1T5OA 3ROZA 1I4TD 1Z75A 2MHCA 4MGIR 4X3PA 1X9HA 4IX1A 1WW8A 3M82A 3JQDA 5H02A 4GNKA 2C84A 3H13A 3TLBA 1COZA 1GZDA 2UKDA 2ZB4A 3NRCA 3QE4A 4KRFA 4UHKA 3B1FA 5GQSA 4JD5A 1LJUA 3VYTB 3P0JA 3U44A 3IUYA 3FI9A 3BK1A 3ZE0B 2J7PD 5CDHA 4DLNA 2JGNA 4XSGA 5DGIA 5A7GA 2H18A 3HR4A 3MG9A 1UAYA 1K66A 4UUBA 1OGYA 2UAGA 3RHSA 1FSFA 1N0UA 1XXHA 5C0OE 4BP8A 3DBHA 5BR7A 1DC7A 3E1GA 1VKHA 3EZ2A 4F84A 1L1EA 4KB5A 5JS7A 3I3OA 1XTKA 3ITEA 1C3VA 4UOZA 5A5FA 3SC6A 5JDCA 1HMYA 4I1OA 1N7IA 1G3RA 4ER5A 4RDXA 3MUFA 4X8LA 2OHOA 5CYOA 1H3NA 3EISA 1RI2A 1JR3E 1E9EA 1KZ6A 2EJUA 2FN4A 2WLSA 2ZANA 2ZJZA 3C5WP 3SG0A 2IDKA 4Q37A 2Q4RA 1SXJA 4B31A 3KWMA 1E9VA 3GMTA 1G42A 2IHZA 4OMDA 4RY9A 1KYYA 2BHLA 2ZB8A 4I4LA 2IV2X 2VPZA 1H2RS 3HZOA 3PD7A 2JK0A 4HS9A 5LB4A 1QANA 2PCLA 1ESMA 3WBJA 3RYCB 1Z3CA 2AEJA 1T10A 1YQXA 3IOCA 3OZRA 2HU5A 1L8LA 3EBPA 5ENVA 1U0JA 3HABA 4RJJA 5F73A 1HNZB 4G67A 2GOYA 3CT6A 4YK7A 1LD3A 4W1RA 4IF6A 4ARBA 2YY6A 5KNLA 1NYLA 3TZCA 1ISIA 1H66A 1IAVA 1P60A 3INNA 3L0DA 4Q9LA 3ZWMA 4B17A 1YS9A 1RYDA 2D4HA 4NCKA 3HCDA 1E6KA 4WOPA 2IVZA 1YK0A 1M54A 5THKA 3ZCQA 4E46A 1E63A 3UHAA 3FNGA 1U3DA 5L7TA 2ZI7A 3QU9A 4ZICA 3GNTA 3OQ6A 1IRIA 3LVRE 3R7AA 4P81A 3MBOA 1QF6A 4V03A 5L3VA 4F45A 5L4LA 2Z57A 4OYLA 1HWYA 4FGSA 2H4JA 4K3VA 3RE1A 1QRSA 3GH3A 4JJAA 1BH2A 1N8SA 1E1RD 3BZBA 4BWYA 3CX7A 3UW3A 2OCDA 2HMVA 3HJAA 5FT9A 3ZD6A 4RZIA 4LI0A 1XWWA 1IN1A 3R4CA 4HNUA 5BT9A 2NLOA 4YREA 1OE0A 2E4AA 1R6BX 2Y4NA 5JO0A 2GYWA 2JFFA 3BXXA 1G38A 2Q1XA 1SXJB 1YQTA 1VL0A 2PVSA 3KZCA 3MRTA 3UCFA 2BYTA 3HY3A 1G21E 3CRQA 2DQYA 2R87A 2X15A 3JQFA 3B6ZA 3CUKA 1A9ZA 4IFIA 1NFFA 4UJ3A 4US0R 4ON9A 2FMTA 4C89A 1PQ4A 2RBKA 1XAIA 1YE5A 2ZI5A 3A1FA 4ADSG 3T9EA 4QM6A 3QWBA 2Q2NA 1XAGA 5CEFA 3W90A 1N33B 3CUVA 4YBRA 3WADA 4W5QA 2AC4A 1EJ2A 2JFBA 3AR2A 3KCQA 3PWTA 1AN0A 2GBIA 4G8CA 3MLAA 4ID3A 4QHSA 4YV7A 3FOZA 4RU1A 4C3VA 4QEDA 2J3QA 4XDHA 1VLZA 2IXTA 2N1BA 4FBGA 2X77A 5HF5A 4XD2A 1Z83A 2Q1UA 2QTFA 1PNTA 4TZTA 1QZUA 4BZPA 5FX2A 5ICGA 4QYMA 2KYRA 1CZLA 2NTVA 5D86A 1JB1A 2QG9A 3I09A 1UQRA 2GESA 3ZGZA 4EMBA 2PZBA 1TKRA 2JCBA 3AUJB 4UNSA 1ENYA 4JR2A 1ML3A 1KWGA 1P9NA 2VKTA 3NEPX 1I4WA 2IEAA 4P5DA 3K5WA 3BB3A 1XTZA 5DK4A 2Y9PB 1K6EA 2IZOA 1F8FA 2JLZA 1ADJA 1VDMA 5C8YF 1A8UA 1QK4A 4L75A 3VSAA 1L5QA 3VMFA 2N75A 3WNCA 1HURA 1GZUA 5HKOA 2VJAA 2H11A 2YN2A 3WLSA 1HEUA 2NV2B 3EWNA 1TF7A 4NFYA 2WG2A 3IPRA 1CX9B 1E3DA 3G8CA 2ATCA 2PBZA 3OIUA 4J90A 4BNYA 1BKYA 1KOJA 2QNRA 4KMMA 4WK6A 4EJ0A 2W93A 4CZ2A 1TUBB 2V7QA 5IF9A 5ECWA 4CM4A 3GVPA 5KCMA 3G5MA 4FLEA 1O7JA 4KGDA 1ODKA 2PXHA 1U5BB 4J0EA 3TTUA 3Q0EA 2AZMA 2W2VA 3C3EA 4AU1A 1QRAA 1D2HA 4MDEA 3G7NA 4AROA 5K4AA 2QF7A 3F2IA 4OGWA 1CDOA 1L7OA 3A9CA 1OAOC 1JHVA 4YIKA 4JBGA 5BO5A 4BMDA 3ESYA 2I54A 1HK7A 5IJ9A 1L5GB 4GL4A 2H2FA 3G3EA 5FTNA 3KUKA 2P3OA 4RENA 4B2IA 4AUMA 3IKTA 1FRVA 1FEZA 5HFJA 2HCRA 1SB8A 3CLTD 2P67A 5C35A 1RI1A 3OTWA 2NUAB 4GXQA 4E3ZA 1ORHA 1BGVA 1PVVA 2Q49A 2ZSKA 1JKIA 5B12A 4D3DA 4C6TA 1MB4A 1Z73A 2VWPA 5EP4A 1VPDA 2G9UA 4KQ1A 3E8SA 4HRVA 3EAQA 3JATB 1Z2NX 3ND9A 4RPCA 4XUGB 5FBLB 2B6HA 3CKMA 5FL7A 1N78A 2ZUUA 3CVUA 4R2MA 5K3BA 4R7TA 4NMMA 1S2NA 4HI0E 3GDFA 5TRTA 4XVUA 1C3XA 4WXMA 3T5TA 5C46F 1CK4A 1SVIA 2NZJA 4RS3A 5JSZA 1C3EA 1UC5B 1U11A 2XZTA 4K1XA 2J9RA 3KK0A 2X5KO 2I4NA 3DC2A 5CA1B 1ULTA 2C3OA 4YBZA 3ESCA 3NHUA 3OJEA 4JP8A 1Z7BA 1J2JA 3MMZA 5B6PA 5JZBA 2V5VA 4KWIA 3V34A 4BRUA 2G7MC 5HS4A 1PL8A 3DPIA 3Q7IA 1GNLA 4TMZA 2JD1A 4XAQA 2V5UA 4FHDA 1HQCA 1JR3D 4MW7A 3P2MA 4NNJA 2QTGA 2VCYA 2Y71A 3KOZA 5CB4A 1LBIA 2B20A 2C7GA 4YAKA 3PFHA 2HJHA 2LRHA 3FDFA 4FJ2A 1WW2A 4QX6A 3U9SA 2AD1A 2EEZA 5LZ8A 4HQKA 3WK8A 3DVAA 1YKSA 1MQ8B 2Q0HA 3L07A 4PRLA 3IXQA 3R76A 2JLXA 3X1JA