1UJBA

Structure of the protein histidine phosphatase sixa
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
156
structure length
156
Chain Sequence
MQVFIMRHGDAALDAASDSVRPLTTNGCDESRLMANWLKGQKVEIERVLVSPFLRAEQTLEEVGDCLNLPSSAEVLPELTPCGDVGLVSAYLQALTNEGVASVLVISHLPLVGYLVAELCPGETPPMFTTSAIASVTLDESGNGTFNWQMSPCNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphohistidine phosphatase sixA
publication title Crystal structure of the protein histidine phosphatase SixA in the multistep His-Asp phosphorelay.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 54
structure length 156
sequence length 156
ec nomenclature ec 3.1.3.-:
pdb deposition date 2003-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1ujbA00
2OWEA 4AROA 5CU7A 1H2FA 1C81A 2HIAA 2AXNA 2P6MA 2WNIA 3FDZA 4HBZA 2P9YA 1DKQA 3O0TA 1T8PA 3EZNA 1DKNA 2P30A 2ENWA 2GFIA 4FDUA 3DB1A 3K4PA 3MXOA 5CDHA 4D4MA 3C7TA 2P77A 1SK9A 4PZ9A 2P2YA 3EOZA 3NFYA 4EO9A 2WNHA 4QIHA 1V37A 3GP3A 1BQ3A 4GPIB 4ARSA 2IKQA 2A9JA 2P75A 3IT1A 1CVIA 3FJYA 4ODIA 1H2EA 1DKMA 2YN0A 5AJXA 2ENUA 1DKOA 4JOCA 3LG2A 3FDZB 5AJZA 1QFXA 5PGMA 1YFKA 4D4LA 1TIPA 4E3WA 2EKBA 3F3KA 2BIFA 3MBKA 3E9DA 3F2IA 5HTKA 3KKKA 2WU0A 2EKZA 1BQ4A 2H0QA 4D4KA 3IT0A 3GP5A 2DWOA 3E9CA 3IT2A 3D8HA 3QPVA 4GPZA 4D4JA 2H4ZA 2P9ZA 2I1VB 4JODA 1EBBA 2P2ZA 4MA4A 1RPAA 2HPAA 1ND5A 3D6AA 2P9FA 1UJBA 1K6MA 2F90A 2HHJA 4ARVA 2OWDA 1UJCA 5CX4A 1FBTA 1IHPA 2H52A 2H4XA 4TSRA 4JOBA 2P78A 1E59A 4ARUA 1QHFA 5AJWA 1BIFA 2A6PA 1C7ZA 3R7AA 2DWPA 1SKAA 3LNTA 1DKLA 2RFLA 3QPUA 3QPWA 4PGMA 1RPTA 3ZHCA 4EMBA 5AK0A 1SK8A 4FDTA 3NTLA 1V7QA 3D4IA 3GW8A 5AJVB 2PA0A 3HJGA 2YN2A 5AJYA 2P79A 1RIIA 1YJXA 2EOAA 3OI7A 3K4QA 1XQ9A 2QNIA 3LL4A 3PGMA 3DCYA 4PZAA 1FZTA 1QWOA 1ND6A 3BIFA 1NT4A 2P6OA 1C80A 4IJ5A 1E58A 1DKPA 1SKBA 4IJ6A 3E9EA 3IT3A 5HR5A
chains in the Genus database with same CATH superfamily
4L27A 3H6GA 3JZFA 3G0CA 3VX4A 1BN7A 3ND7A 4YJFB 1MB3A 4DC9A 4U7DA 1MVLA 5GM2A 3ZI4A 1R6VA 5FAKA 2GTHA 1CE8A 4JNKA 3IP5A 4FFMA 4ZI7B 4IXMA 4EG3A 2HV8A 4CQNA 4TQ9A 2IY7A 4HB4A 3LV8A 2OO5A 5CA0B 2QUBA 1YJQA 1K7SN 3CUKA 1CPYA 1ESCA 1NMZA 3M3PA 5IDVA 1K7EB 1HEYA 4D5GA 1P39A 4CKBA 3X44A 4F8EA 2CMDA 5AK6A 1O89A 5EXTA 2WFMA 5GV7A 3FPFA 4BS9A 3TDKA 4D8XA 3R7LA 4KL8S 4HS9A 4E5UA 4KR6A 1KYIA 4KRYA 4W1QA 4DNFA 1C30A 4JBYA 2XMGA 3NHUA 4FE7A 3SF8B 4CU5A 4L28A 5IBRA 2YS7A 2ZATA 2N42A 4LOKA 3T7KA 1LZLA 1Q44A 2JCYA 3KR2A 3RT9A 4JLUA 4Y6SA 3HM9A 3KTFA 1YZVA 3D4OA 3OM1A 1WMEA 1DKMA 3NC0C 1N2SA 1XELA 4HEHA 3W9BA 1D1QA 4BLQA 3EXHA 4I4TB 3MB5A 1P5HA 4X61A 2NZVG 2BGKA 1NYQA 2A3NA 4GQAA 1RQNA 1ZN8A 4GM0A 4J76A 1HNNA 1NUAA 5DRYA 5DYGA 1PQPA 3F9CA 3WHIA 1X7DA 4MYUA 5B1DA 3BULA 4CUKA 4BVJA 3LY9A 4M83A 1BWSA 1TMOA 2VHJA 3MJFA 3QHAA 3GP5A 1UDRA 3F6BX 4G85A 2X40A 3GVCA 3BXPA 2J1LA 5CB8A 5HZHA 3VAZA 2I6UA 3QVXA 2DFLA 4DV7B 3EAQA 3OLZA 3V7UA 2PZAA 3M89A 4BKUA 5HKAA 3P4YA 1OKKD 4G56A 3PFBA 1L4UA 5DH9A 5FBZA 2ZANA 1DT5A 2PLNA 1Q19A 3MTBA 2RDMA 3R5KA 4RULA 4AY6A 5BVHB 4N7RA 3ODPA 3AFHA 4JT2A 5JXJA 4ALJA 2HIGA 1G8HA 2NO0A 1ZOPA 2AA3A 1Z8DA 2WJIA 2XA9A 1P5FA 3COWA 4LC9A 2L19A 1XHLA 1NRJB 2ZT7A 2PVSA 5B58T 1E2QA 1RI4A 3P9PA 5A4DA 3BWVA 3UMCA 2R4QA 4HVAA 3ZHUA 4E4TA 1PZGA 3NRBA 5TEWA 4H0NA 2JFVA 1QCZA 1U4OA 2AJBA 3CMMA 4RLHA 1W0KA 5AK0A 4AF7A 5B4TA 4KKVA 1RM3A 2C99A 3K20A 3NW9A 3TQTA 5BQFA 1DKUA 1QBKC 5C4IA 4D42A 2CZCA 1MZVA 4POOA 4JI8B 4IXWA 1EXNA 1MDFA 3OETA 3ZYZA 2DCUA 1LK5A 4X63A 3TOVA 1ZM9A 1W35A 2Q99A 4V0QA 4J0GA 3PNSA 1QP4A 5ELMA 1FQKA 3LWDA 2V7XA 3BXGA 1SU7A 2CB9A 3ZGLA 2VOJA 2XE7A 4I5DA 2XB9A 1PJQA 4LCBA 4QELA 3IE2A 3DTVA 4MOWA 3CT4A 4YUAA 4HRVA 4WXYB 3EGOA 3L1KA 4Y3UA 3KYDA 1QH9A 1Z2CA 5JPDA 1P1HA 4KIFA 3MBOA 4Y2RA 1ID8A 2P4EA 2R84A 4IXNA 1KYXA 5CYGA 2SKEA 3P2MA 1KYYA 3QMPA 3LC1O 4O1MA 1DKQA 5KSOA 2PXAA 1DARA 3OLXA 4JBXA 4MVJF 2WKSA 2ZR7A 4OHVA 5DT2A 4JKYA 4DJJA 2P30A 2OK8A 1ISPA 3LC0A 1YI1A 4UUMA 3TAXA 3K9BA 3W2TA 1QLJA 3D8UA 4J0IA 3QPCA 4L22A 2ONJA 1D2HA 3I9MA 4X24A 4K8RB 3W8DA 1T3ZA 1Q0RA 4JQZA 5KHAA 3FOEC 1L3BA 1HH4A 2X7JA 2HPZA 2BONA 4J7UA 4P58A 3GZ4A 1K6EA 2QPTA 1NQWA 2Y2UA 4ECEA 2YX1A 3O3NB 1TCCA 4G5XA 3PKJA 4W1SA 4UEQA 4QPDA 2AXEA 3WLHA 3IBFA 3S27A 4NCKA 4XWYA 3SE7A 3TNFA 1WABA 1Z38A 1XO1A 4D8UA 3C8MA 2YV2A 1XCGB 4OHBA 4ZQCB 2QAIA 1ZESA 3E6AA 5E6RA 4DEYA 5KIAA 1OB5A 1A2OA 3LLCA 1CC1S 1MQ8B 4I5GA 4N5MA 2YW9A 4QX6A 4R4JA 2Z56A 3SXUB 2GN9A 3RWOA 1YK1A 2O8FA 3DOJA 4YJDA 1FL9A 1IYZA 2Z58A 3ZV5A 4EJFA 5JC1A 5EP1A 4CV0A 1S3GA 2CDCA 3LX4A 3USCS 3VU9A 5M7EA 1PL7A 1L5OA 2ZJ6A 1RFGE 5C34B 1JDUA 2V8BA 3LOUA 2BELA 1P62B 3G2QA 3NHZA 4AIRA 1QKKA 3N28A 4ND5A 3G17A 5EJEA 1VYTA 1IK4A 4Q3OA 4Z3OA 3AHJA 5HJ5A 1Y34E 3CWQA 1UOPA 4H7KA 3HHPA 1Z68A 4I3GA 1KP2A 2QYOA 4LS3A 1MBZA 4JJGA 1TXGA 2VNHA 2L69A 5ITZA 1KXZA 5KDOA 2IV7A 4NIMA 4X6XA 3TNJA 2VWQA 2QRZA 1GG5A 1UKCA 2FJ0A 2XYRA 5SY6A 3SXPA 1S9DA 4AY5A 1RRPA 5CAEB 4JOBA 1U1IA 3SQWA 4LDZA 3A3NA 4X0EA 4Q48A 4JL6A 4H6PA 4KQIA 2ZULA 1J99A 1U1EA 5DCWA 3IO3A 4ASUD 1ST3A 1IXRC 2EF1A 1P9WA 4NCJA 4U5XA 1SPBS 5MGNA 3U44A 3TKAA 2GZ2A 5T41A 5I3ZA 3RC9A 1ZONA 5GZ6A 2H2DA 2N75A 4KPGA 1V47A 1XCLA 3VU3A 1DTWA 1W4AA 3T7JA 4OHXA 2JJ2D 3OZSA 2GAJA 1VBNA 1Z4JA 3TEFA 2YKGA 1IN1A 3HKEA 3EQ2A 3TPCA 3MMZA 3PVZA 2BFDA 3AR2A 4DHWA 2PQMA 1MNAA 2JF0A 2QTAA 4U3JA 2P5UA 5BP7A 4I50B 4N7JA 4BRSA 1VKHA 4GZ5A 2QT0A 3N8KA 3WDSA 1GGVA 1WMSA 4QQ8A 2OOSA 4HMPA 3PFIA 1SXJD 2HWYA 3O7WA 3EVBA 2YMPA 2GCIA 3NBFA 4CODB 3WTBA 3X0DA 3G9QA 5CDTA 3DO6A 2IZ1A 4A5SA 4UBJA 4ZDKA 3VZQA 3T38A 2W4QA 3V4VB 1E2NA 2OCPA 2VDMB 2J85A 5FUQA 1YIAA 3BHIA 1ZHOA 4IFTA 4DJ5X 1U7TA 4QUHA 4PYOA 3JQAD 2F62A 5FIUA 1OXBB 1ORWA 3OT5A 1SVLA 3DNFA 5J4VA 3ZR4B 4G97A 3BQ9A 1XRSB 3BFJA 3ECAA 2QVCA 4FSXA 1C7QA 4PPNA 4WZAA 1FP6A 1JXOA 1WXFA 5KYUA 1NR7A 2Z08A 2JJ8A 3SKVA 3WNCA 1PFYA 3FTEA 1EUZA 3GMSA 3RNLA 1Y8RB 3M5CA 4Y2UA 4JVNA 3G8CA 4E0BA 1I3OA 2FOLA 2F4NA 1GNQA 4H0FA 2NWQA 8ADHA 1KI4A 4YHHB 1ISRA 2J3EA 3L8MA 4GX1A 1C4KA 3NT5A 4XWTA 1P9RA 1DE0A 1ZPDA 1LRLA 2A1TS 3FVQA 2HDOA 4TMFA 2GBFA 1FDTA 4FP9A 5D5HA 5BRNA 3OBBA 5TS3A 3O82A 2PUGA 1WWKA 1GPLA 4NH0A 2C3OA 2ZGVA 4UBNA 4F2WA 1O8CA 3B3JA 4NMHA 2IPMA 4ZKDA 3DZDA 4HAIA 4WFIA 4BKQA 4DMMA 3GLFA 4KFRA 1SM4A 3ZDQA 1H0KA 1XJ5A 2ES4A 3FOBA 3P9XA 5FL7A 2GN6A 3UUEA 2VXCA 4YQFA 4NL4H 2X2FA 3DAPA 1UR5A 2F3PA 5U4QA 3QVTA 2A84A 1GSOA 3CF4G 3V80A 2Z3VA 1YRAA 1NUUA 1MO2A 2IP4A 3TTWA 2ZKIA 5ALSA 5GINE 1PK7A 3BL6A 2HRRA 1KOFA 3I6BA 1PK8A 2IU6A 1JRLA 1Q1BA 2PJUA 2H29A 4FEAA 1JIUA 4RA9A 2DLDA 3VZDA 5JAHA 1PL6A 4IAOA 3LUHA 5EP2A 4E6EA 1SO8A 2WQ7A 3CLRD 1X8XA 2EWWA 2XHZA 3PUHA 1B6SA 4G5FA 4OBBA 1J2YA 5G1PA 2HU7A 4ZEWA 3T35A 2VHVA 3SIRA 4G5HA 3TOSA 3L7NA 4BC0A 3GLHE 3AP2A 4JN6B 4MGKR 3LGXA 3GYBA 1SQ5A 4GYKA 1PNQA 4S2EA 4TKVA 3DFZA 1BIFA 4AMYA 4YLGA 5TARA 1GUZA 4FE4A 4LAFA 4AULA 3RTBA 4NU5A 1GDTA 3ZHQA 5COQA 1Y3FE 3G1WA 2QMUA 4GECA 1XMJA 4GOOD 4CCAA 4HPXB 1JB9A 3KSRA 3UTCA 1XMIA 4OQNA 3N5CA 3ZDFA 4Q3KA 4G8BA 1Y9EA 1Z83A 3EMVA 5T64A 4H3HB 4GXQA 3BWDD 4JP2A 3RUAA 1WD7A 3RODA 1UPAA 1OSNA 3OHSX 4XD7D 3T3DA 1M1NB 1N0UA 2AMFA 2Z8XA 5ALUA 4AQYB 1PT8A 2M6SA 1YS9A 2QTHA 1YR9A 2XTNA 2XGOA 1BYUA 1T3GA 5A9TA 2H4FA 3GJRA 3O1IC 3R5TA 2R25B 2RE8A 4UREA 4LF4B 1ZGAA 4EYQA 2MSCB 3OE5A 2VPXA 2BGTA 3GRCA 4QHSA 5K3CA 3OF5A 3KD2A 4EZEA 2BGNA 5JD3A 5HOEA 1H9CA 4XUDA 5B1EA 1E2PA 5AFSA 5CVUA 1TAUA 2RGNA 3FAKA 1GQSA 2UUOA 5EE9A 1Z8NA 2I22A 3O8NA 5ALIA 2IEBA 3GPCA 3SDSA 4JLSA 1RMQA 1XNGA 4PNEA 1JA0A 1XKTA 3PC7A 4MGEA 1D2CA 2IYSA 3H9JA 4ESEA 3CNNA 2YV1A 3H4IA 3OQNA 2BCJQ 3AWIA 4IOLA 1A4RA 5JBIA 3M1AA 4KH1A 3L46A 1CJKC 3EZNA 1IN6A 4JBLA 3VC2A 2I91A 1NN5A 1JAHA 3ZCXA 4KIWA 2IU3A 3UPUA 3E48A 4KQHA 3VR3A 4HLUA 5KKNB 2JFBA 3LHFA 4HQFA 3RS4A 3P94A 1H1DA 3DGFC 4AS2A 4F92B 3DR3A 1LPAB 1R10A 1Z2OX 3GELA 2PBFA 2P91A 4NQZA 2A8YA 3OT1B 3WWYA 4ZQGA 3H4VA 4YRTA 5E9JA 5L3QA 2GEKA 4MRPA 5LZ2A 1WW8A 4ARSA 1I36A 1MXHA 3GRYA 4Q1AA 2QY9A 2V7GA 3PLRA 2W90A 1CVIA 1UP7A 5DM0A 4C5CA 1TPYA 4DEXA 5KQPA 3DV9A 4ZDWA 2AWNA 1JJVA 1H2XA 4K9OA 1IQRA 1SVWA 3ETJA 4XGKA 4XM1A 3EPRA 2YWGA 3GXBA 3IQGX 2EFCB 4OQLA 3AU8A 4D9GA 2PLRA 3V4FA 2DUNA 3I0MA 3JY6A 3L43A 3W2GA 3WMXA 4BP1A 4EB6B 1EB8A 1QO7A 3TR5A 3W6UA 3KQLA 2ZIGA 3T3NA 3LYLA 2EKLA 1CJBA 3AB7A 2EJUA 2O7VA 2BF7A 3IBCA 4MUJA 5H0IA 2RHOA 4GLFA 4RFLA 3WJ7A 1JL3A 1E2IA 4JT4A 3DKIA 1VLZA 3GGOA 3NIFB 3ZDXB 5LMNB 4TS1A 3ZJ4A 2W2TA 4GP6A 5D00A 3O8CA 4L5AA 1Y80A 3B48A 1J4AA 1CZUA 1V6SA 5J2TA 3WRVA 2LXNA 2OMKA 2XPCA 4QPZA 4Z54A 3LIIA 3OFSA 3KFLA 1Y8AA 4JC0A 2AC2A 1I6MA 1UBUS 1JG2A 1FSFA 2A5GA 3HBLA 5DF1A 2NZYA 4KBGA 3ZLUA 2WM2A 3C43A 3DDCA 3WLTA 4YDSA 4F1KA 3I04A 4OMDA 5IK2A 3EXFA 4LI0A 4JLNA 1BC5A 2VUUA 1KHTA 4ZD6A 3ULKA 3D43A 3HUFA 4A92A 1X15A 3JR3A 3B20A 3NAMA 1UADA 2VYND 1RKBA 3TR6A 4X1YB 4BO3A 2JFFA 5C52B 4LGYA 4QWMA 3WQHA 3WWOA 1TT5B 1OCEA 2KB0A 3K0KA 4MQFA 1KQFA 2C03A 2CSUA 4R1LA 4MEAA 5JSZA 2A1UB 4HY3A 4RD6A 4ND1A 4PG8A 3UT6A 1T6BY 3AUYA 5K3FB 1R9JA 3HDTA 1X1DA 2GTPA 5LJLA 2XQGA 3TZKA 2J4CA 3L4SO 4NCXA 5LB2A 3ZV6A 1GPKA 5ARDA 2PUWA 3ZX4A 2OHVA 2ZBEA 3ML1A 1V7ZA 4IDNA 5I7VA 4DE5A 5IJZA 1E3EA 4WLNA 3EEBA 2QM0A 4O02B 3G1TA 4L8GA 1Q1NA 1GEEA 1U2GA 2ADFA 2WHRA 1KL7A 1NI4A 1P1IA 1Z2AA 2VRCD 4ZZ1A 3THYA 1EK5A 2REXB 3IAS6 2DCMA 4BRZA 2XZTA 3UPTA 4L8FA 3UPDA 5JH7F 2QM7A 3WAGA 1L7BA 1XZAA 3I58A 5JAUA 3Q8XB 5GONB 5FWNA 5LD2C 3NGLA 4L50A 1GARA 3G0OA 2KJQA 3K92A 4N8SA 4QDXA 3EIOA 3EFOB 5CNKA 3WO1A 3UAXA 3D02A 3OD5A 3RRNA 2WB4A 3ZU6A 1Y98A 1JDSA 5I8PA 2ZWOA 4EF4A 4D4MA 1HZJA 1FFXB 3LBFA 2ZPUA 5GGYA 4C4XA 1VP9A 5SZJA 1LX7A 3K9CA 2JLYA 1H69A 3ROZA 1W87A 2FMUA 1YJ5A 4HF7A 4JBNA 3QELB 5H59A 3SKXA 1AUXA 4RTQA 5CBKA 4EH1A 5JS2A 3JW8A 3KG2A 3LBNA 3MSCA 3K72B 2BHTA 2BM9A 4X8OA 1CV2A 2XRZA 4GP7A 2C8LA 2GF0A 1ECLA 2C2HA 5ALPA 1XEXB 1VXRA 2C5GA 1M72A 2N1MA 1C2TA 3JQ9C 3PFCA 2OAQ1 3SIXA 1FDIA 1A5TA 1U1DA 1ABEA 4C07A 4N54A 5KSZA 2FZVA 1T0UA 3V1MA 4PCLA 1J24A 4RVUA 1DRJA 1Y63A 2A4MA 2PGDA 2PX8A 2W37A 3A3YA 4QA9A 4YB8A 2IPAB 3N2YA 2E4VA 4UBLA 1OU0A 3K31A 4HADA 1ZYUA 2RHLA 2WJHA 3OJFA 4LVCA 3WLSA 4TUYA 4MLZA 1WXXA 1U9ZA 2D5BA 2IGBA 1UXHA 4UCXA 4JI0B 2J0SA 3NOOA 3A4LA 1BS9A 1R8YA 1I7SB 2QL9A 5AVRA 3NFRA 3UJ3X 4L6IA 3NDIA 4C03A 4CMAA 2DPGA 1T2NA 3FB4A 5C51B 4N8EA 3C4QA 4HR7A 3BXEA 4QBHA 1FJ2A 1O95C 2RC5A 5JDIA 1GR1A 2C5AA 3C6QA 5KKAA 3AM1A 2JLRA 5JTTA 2PYIA 2ZBQA 3NGMA 5IN5A 5HDQA 5DBGA 1IHPA 3A26A 2R97A 3RUIA 3CISA 1KH3A 3C0KA 2ERXA 5ALKA 2GCEA 4S1OA 4OQXA 1M34A 5G0TA 2O8DA 5M3BA 1RXYA 4MB6A 4AO7A 1R0BA 2Q46A 2XIQA 1C7ZA 3NXKA 2QF7A 3Q5EA 3RM3A 4CI0B 1M5RA 5KAMA 5K0TA 4XH9B 3LCRA 2Q07A 4IIFA 3CSUA 4TLDA 4XSVA 1CUCA 3S29A 4QYIA 2R8OA 4Y9TA 3EK2A 1CJMA 1YVDA 4NEGA 1BDMA 3H6HA 3TTYA 3VNAA 1I2MA 2PNFA 3HP7A 4X8MA 3OPMA 4GNKA 3FPLA 4IEIA 3WK4A 3AOEC 4Q02A 1WKVA 2XH8A 1E5TA 3W90A 1RWOA 1CLEA 4IRUB 2F55A 1JF8A 4HNGA 2J7KA 3G8DA 4IJUA 4WL0A 3NWBA 3WWPA 5EUBA 2I80A 2ZSAA 3K0CA 1USKA 3ADBA 3H87A 4JKIA 4G5QA 3K71B 4KRFA 4FFRA 3HA5A 1P2VA 1E1CA 1U0OC 1JAYA 3IDQA 4D9NA 5JCJA 1I2BA 2QI9F 4TS3A 2GBLC 1QYWA 3ROMA 1RYYA 2VUHB 5E6UA 4MVWA 4MVJP 3UNXA 3DMYA 4X7MA 1XYVA 5JO0A 3F7NA 4ZCTA 2IS2A 1GUBA 2CNBA 2E1PA 5ULLA 1Q0ZA 3VBCA 1LW6E 2VDRB 3RRYA 5HRUA 3H2ZA 4KREA 2WF8A 1GAXA 3WTCA 4G5RA 4FNMA 2FAXA 4WUVA 4CZ2A 3EIQA 4XI9A 1M6VA 3BXXA 1HXHA 2O23A 4JLPA 4M76B 1GNRA 4ZOLF 2GARA 3KPYA 5FUXA 3WYAA 4LV8B 4BC1A 4CIWA 3IE1A 1YCDA 2JIZA 1H1TA 3MWGA 5AM3A 3SQDA 1OH5A 1Q16A 3MOSA 2Z2KA 3PFFA 1ZHHA 4OJYA 2F43B 2ONYA 4RY2A 3N9IA 5DNVA 3T0IA 4HYTA 3FOAA 4KHZA 3X2EA 4ND4A 5LQKA 1X1TA 5JPIA 2GHRA 5BV8A 4PZ9A 3E4CA 3FBWA 3L41A 3RU3A 4QBFA 4H4EA 1D6MA 3P0FA 5HE8A 2HA4A 2QTLA 4WMLA 4RPGA 5P8WA 5LWHA 2OL4A 3IT1A 4POAA 2IXBA 4D8WA 1NPYA 2RGCA 4FCTA 4AN0A 3DBOB 4F7DA 2ISSD 2GN2A 3U7HB 4PY2A 2R66A 4OP2A 2PUTA 3ADCA 5AIAA 1W94A 3PJFA 5BRJA 3GRPA 1LI5A 1WTCA 4YGXB 1GU7A 4QVGA 1R4NA 3PFWO 2H8KA 4RENA 4TMWA 1PWXA 3TZBA 1COWA 2FCAA 1WXDA 4QOGA 4ZVNA 4O2LA 1J5EB 4DYHA 2B7BA 3QITA 1M2JA 3KAKA 4L07A 1Q83A 3U5TA 4DV2B 4B3RB 4ZXFA 3RVPA 3TRKA 1VFNA 4L73A 3B6MA 1NBHA 1SELA 1XKXA 2QU8A 4ZDIA 1V4BA 2WIDA 4ZO4A 1G8FA 5IJ0A 3AKDA 5LP1A 5LOVB 5ERXA 2JKVA 4OMUA 1H4VB 4HDMA 3O1HB 4NC9A 4JB2A 3VNBA 4X92A 3ZPXA 4HX9A 1DZIA 4IDBA 1I3NA 1OLSB 1SVOA 3ZD7A 1TJ5A 4NJEB 4XAQA 3SFTA 4B87A 2P8SA 3S1LA 4RCVA 4MDFA 1GZ3A 3Q7EA 3TZHA 2HDNB 4UPVA 1BDBA 1DWUA 1F9EA 1M6EX 1RJGA 2AEJA 1O0CA 1BCSB 1DAPA 4IF4A 1TFUA 3DWGA 4YMSA 1FMLA 1PKEA 2PFSA 2IH5A 3AHEA 5CB6A 1RI2A 2NU9A 3FGOA 4RGYA 4A8HA 3UGTA 2PGNA 5HKOA 4F46A 1NF8A 1G42A 3C3WA 1C9NA 2JJ1D 1SR8A 4AWBA 5JCOA 2Y0DA 3L79A 4R5MA 1C8KA 3ASVA 4CIVA 5KOIA 2RGXA 4F56A 3D0KA 5JD6A 5I9SA 1OF1A 3ISTA 2GSWA 2XWPA 2AKAB 3GRVA 4M21A 4OF4A 4XEHA 1J1UA 3LT4A 2AR9A 2B92A 2YJZA 3OWOA 2B82A 1M1YA 3UFXB 1XTUA 2Z9CA 4DIDA 2O19A 2D7CA 4QO8A 5IYZB 1AURA 4DEVA 4O4IF 1WSDA 2A92A 5EI5A 1JECA 2NO4A 3UJ6A 3VR5D 1BDJA 5KTMA 5JWOA 4IHAA 2IT1A 4H6XA 4NAVA 2BM0A 5MN4A 1FTYA 3FYSA 4RKWA 2BOVA 1SWWA 3PVCA 3GDFA 2JL1A 3ROQA 1E1RA 4OQ4A 5DK4A 1O5TA 4PN3A 4MQBA 5KNDA 3MYYA 4B8YA 4CV2A 5KNLA 4DCVA 4MRVA 1GNPA 2PBZA 2ZRCA 1B43A 3KOOA 3QKTA 4D6YA 2VBIA 1EX9A 2OAGA 4MYTA 4LTMA 2DSNA 4ZU6X 5LZ5A 3SZLA 4IHJF 2VT3A 3E84A 2RGGA 2ZJ8A 4PC3A 1ZOIA 3M0EA 1PO7A 3EW7A 1NJ2A 2AJCA 2VTDA 2JIQA 2VHEA 3H5NA 3C6YA 1I4EB 1EQAA 1QE5A 4GI3A 1TCAA 1FSPA 2FR8A 2HYIC 1D8TA 5FTJA 3VYSB 4LGMA 1GY8A 2B1QA 3T5PA 4JJZA 3UXEA 4FJ1A 4ETNA 5HUQA 1IL0A 2X2OA 4YJ2B 2QVBA 4RESA 1BNCA 4KQMA 5A62A 4DADA 2M98A 3DXXA 3AM3A 1M1UA 2C31A 3LCCA 3NBUA 4OO3A 1FC0A 2BD0A 2ZAGA 2A0WA 3I8OA 4P22A 3NBZC 1IEXA 2KLBA 4FMDB 3KPVA 4I55B 3PUWA 4FQ8A 2YQ4A 5TMDA 4D4IA 1PRYA 1NW6A 5KJ6A 3AUXA 1XQVA 4DLYA 3H5TA 2IHJA 3IRUA 4UATA 4AX4A 5C3MA 4GNRA 4AJKA 2WTXA 1XR3A 1KTIA 1EX7A 1RXVA 3AJRA 1IAVA 4QYXA 3ZV7A 4JHXA 2XMZA 4NPCA 4OBWA 5AT1A 4HV4A 4JODA 2NVUB 1CF2O 3SZUA 1O6ZA 4O08A 3PIDA 3JQGB 1MIOB 4C78A 1QHHB 3E53A 4TLBA 5JBQA 2QQ5A 5FWYB 4F84A 3PGVA 4YLEA 1X14A 3EZ6A 4QAQA 4Q3EA 4PHGA 4IICA 2H92A 1RU3A 3DZFA 4WTOA 5FUMA 2E49A 3AI2A 1S3FA 3LWNA 3SHVA 2DLCX 5HCUA 5K6RA 1P2TA 4MV5A 5EESA 3L0OA 1EQUA 5IJ9B 1VJ0A 2C3YA 3E35A 4R1MA 4E03A 5FNVB 3E5NA 2C9ZA 3RS3A 1MU0A 2G72A 2IHKA 2JFUA 4UMDA 2R6FA 3VPXA 4YCMA 2OXTA 4E21A 2I1WA 3BD6A 1I14A 1QYCA 3LCJA 4YCLA 2ZI7A 1X9HA 2P2NA 3G79A 3KSDO 2DFPA 3L1JA 3EPKA 3NTXA 4YBRA 3ZZTA 1L9KA 2PUAA 2BM8A 2C77A 1JTVA 1N5OX 1YULA 4NPAA 1R1DA 1PSDA 1R2QA 4BNLA 721PA 1NULA 4F97A 1N2OA 3I1JA 2E55A 3TJRA 2VF5X 4ZTUB 3NVKI 1JXAA 3JYPA 2BMWA 2OZPA 4ZC1A 1M2WA 2BEWA 1FMJA 1XLVA 2Q3MA 4CLOB 1QKIA 2YR0A 3AETA 2CNNA 4LUCA 1P4HA 2JGJA 5FULA 4ZVTA 3OSZA 3DXZA 2AFIB 3FHJA 1A88A 4FYVA 1UMKA 1AJEA 1ZINA 3FYTA 4GWLA 5DM60 5HR5A 3GFGA 3VKVA 2HF2A 1F6DA 4KDRA 3UCEA 1NU8A 3FAZA 1WV1A 3RVLA 4AW9A 2P1RA 1ATIA 1X7ZB 4AI6A 2W2OA 4BMCA 3E3OA 5T4BA 2MSNA 2X5XA 3AOGA 4UNPA 4AX8A 3MS4A 1TRHA 1VBMA 1VMAA 3FMFA 4QU8A 3MCTA 5K6AC 5C5DA 1GQYA 2HTFA 1I01A 2DU8A 2V6IA 2WJVA 4Q19A 3L06A 4CGYA 1PV2A 4U7FA 2EC5A 1B2RA 3KZXA 5CFMA 3KUUA 1EXMA 1U63A 3R74A 3WL3A 1GFZA 1Z25A 4LBZA 1OKKA 2VDLB 3H2JA 2MR6A 2ZWAA 1M0WA 2IEAA 2MINA 2WJPA 3FTPA 4GYWA 5DEOA 5JANA 1XQYA 2JPDA 3RYIB 1IK6A 3IHWA 1UBRS 1X1SA 3G5AA 4A0HA 1RLUA 2C8KA 5GVSA 2FN7A 4YDHB 1BXKA 1TMKA 2O0KA 3TQSA 5JJIA 4E5PA 5DSTA 5F7ZA 1ML3A 2ZYGA 4CM5A 2GB4A 3RFCA 4AMZA 5HILA 5ILQA 3OM9A 1W4ZA 2O7NA 3TCXB 5B57C 3BTOA 1IVYA 2ODTX 1EVEA 4HDOB 3NDBB 3MAGA 2QD4A 2ZTUA 4Q39A 3WLRA 1O6CA 4HMOA 1NU6A 4Z3KA 4Y6LA 3N6RA 5SY4A 3FGZA 2PLAA 1RYBA 1G5QA 2YY5A 3O8BA 4BNFA 3VOSA 2IL1A 1DG9A 2I4IA 3LDGA 4BB9A 2CDBA 1Z0DA 1A71A 2ZYDA 5I9NA 3JQFA 4ZALA 2RKWA 1R50A 1TZJA 1L5ZA 3ENVA 1YI0A 4DR2B 4PBRA 3K6SA 2WB2A 2GK6A 1AVTA 3TTTA 2WZQA 1IBKB 3PGKA 4YRFA 5BN5A 1MB9A 1VJDA 2IYUA 4L8LA 3SU8A 5D2CA 5IH3A 3UMMA 2IYAA 3ONNA 4M0LA 5JZVA 2VJBA 5JQGA 4RVCA 3BJEA 3NVMB 4IX9A 2GMWA 5UKDA 3WIOA 2DBVO 2OCBA 2P68A 3TLBA 4ZTZB 2WD7A 5ECYA 2B3DA 3ICWA 2I6QA 1V26A 2QX7A 5KMGB 2BFMA 3PJRA 1ZISA 2OBLA 2CL7X 2GRAA 2Q4TA 4ZPJA 4MX8A 4FFSA 4N5HX 2CLIB 3K0AA 4QUKA 5EWJA 5TJ9A 3UMVA 3VSBA 3WLIA 1ADYA 3A32A 5HCIA 3NLLA 4ARAA 3QNUA 2AOWA 2KHZA 2VJDA 4Z7JA 5IKPA 3DL0A 3L6CA 4LI3X 5FYDA 4OXYA 2GF2A 3MXTA 4G0NA 1KJZA 4CLRA 2VTBB 4HN9A 1YA6A 2ZE5A 3KB8A 3U81A 3BB3A 3QF4B 2YQ5A 3Q9UA 2VK8A 3GIWA 4I8IA 1RAAA 4ES6A 5KX5B 4C4PA 3ER9A 1T2EA 2OV1A 4YV1A 3ZDYB 2ORYA 1RPTA 1WJGA 2ZWPA 1A1VA 1GXSB 2M6LA 3UXHA 5BV7A 1JE0A 2GNOA 3MTDA 1RZVA 1U1CA 3LDAA 3RJMA 4N76A 1QG0A 2AG5A 4JI7B 1CWUA 1DQRA 1SZPA 1TCUA 4JVOA 4UQLA 1OXSC 4XDHA 4R2WA 1UXIA 1QRTA 3INGA 2WTAA 5A04A 3OZXA 3L4JA 1J9ZA 4LHWA 2QRVA 1M7GA 2J0QA 1IU9A 4LNHA 4C6RA 3JYQA 1NVXQ 3WK9A 5HW0A 3CMCO 3MPOA 4HDRA 1ITZA 2JARA 4NI5A 2BN4A 2W71A 3MWEB 3IA2A 1WKBA 4KN9S 4INAA 1IHDA 1KERA 1OVMA 3WLKX 4WT7A 3SYLA 5EWMB 4CM7A 1BKYA 2YRWA 2QYSA 3R4VA 3B8EA 4KPUB 3LWZA 4I81A 1VPVA 3RS5A 2I7XA 3HDYA 3VR6H 1HA3A 1E2MA 4RIIA 2CE2X 1L0BA 1ZR4A 4HBZA 4RHYA 2CXPA 4K6HA 1DQZA 4CLEA 5K20A 3PJEA 3CC8A 4NMLA 1KS9A 3KALA 3GNLA 4EGJA 2X4IA 3RIHA 3WA6A 2B3TA 1GOTA 1TW2A 3NVAA 1W8IA 1GV0A 2G4CA 1KI2A 1EJ6A 3R6GA 4IPTA 3CNBA 1J0DA 1WB4A 1N2GA 3A6GA 3DAYA 5LYJA 4PTZA 2HQOA 4DLPA 3ROGA 3ZS9A 4Z4GA 2JFGA 1DC4A 3GF4A 1ETHA 2QLLA 4OREX 1UJ6A 3QQ5A 1VLVA 4KXYA 2Q9CA 3KC2A 1QAQA 2DT8A 1XD2A 4QQFA 1Z2NX 3VDNB 4R7GA 3VUEA 1SUFA 1HNXB 1ZL2A 2VKQA 3QVMA 4HTFA 4B31A 3NS7A 2SHKA 2WUEA 5E1MA 1RXIA 2QZJA 3PHLA 1R6UA 3UN1A 4EMUA 4LYGA 2J3MA 3AERB 3H5OA 2IXAA 3WGVA 5HJ7A 5F77A 4UFNA 2OOKA 2IZ7A 2ZCVA 4ASUA 2NVBA 2P4HX 5A5GA 1TD1A 1TGYA 4ZGWA 1Y7TA 2FUNB 2XZOA 3K3PA 3S1AA 3UJ9A 5K0FA 3TNYA 4EGQA 4QXPA 2B25A 4HYEA 2AMLA 3NR2A 1FJHA 2JJ2A 3A6KA 3D3KA 3QRWA 3W4IA 3C15C 2JC3A 1E92A 3DP9A 4G1MB 3FHCB 3QEJA 4TTAA 1GRNA 4X00A 4BV2A 4DM7A 4DREA 5AICA 1CY0A 1YL7A 1BEEA 2D4HA 4MUFA 2ZETA 3WGKA 1SG9A 1ABFA 1K6JA 4HN2A 3GLGE 1BHJA 1KK1A 4I9FA 5FUWA 3ESXA 4MWDA 4QLAA 1H8ED 4M98A 1CDZA 4EUKA 3F3YA 3SSMA 1N36B 5JS7A 1OGIA 3AF2A 3TM5A 1VXOA 3L0BA 3TSZA 3KXDA 4E33A 1XXHE 6AT1A 5IDWA 1HDGO 1CY4A 2DJIA 2LRHA 3TH5A 2POCA 4IIJA 4BZXA 1RZRD 3I1IA 1FF9A 1QK4A 1HSZA 3ACBA 1ZGBA 4DC0A 3JD4A 4Y2GA 3LDHA 1T1IA 2XMBA 1DIRA 3WWCA 1RWNA 2B8NA 3V8PA 4E5DA 1MX3A 4JX9A 4ENWA 1NXSA 3KT3A 4KI0A 4JEMA 4XSHA 2PL3A 3B7WA 2CYBA 3L6DA 1XZMA 2VOEA 4G5YA 2I1LA 4LY0A 2RHDA 4N65A 4QJ5A 4CTKA 1R0CA 3NRCA 5LP6A 4DUZB 5DN6A 1J21A 1LTKA 3LGAA 2R6CA 5AJVB 5A2QA 3IAM1 4LYJA 4RWEA 4UVEA 1M7HA 3COVA 1DOAA 3T1YB 2OSVA 3VOTA 3QV1A 3O9ZA 1UQUA 1SKYB 2B99A 1XOIA 4JGIA 1BGVA 5EIAA 1Q1GA 4H77A 5I5GA 3TLAA 1SHLA 3B5IA 4N49A 3IDAA 4NBWA 5KO2A 3UKOA 3G2HA 1ODCA 1HFEL 2WE8A 3W9UA 2XE8A 1GT91 2K7ZA 5K2OA 4EG4A 2OWEA 4YV7A 1UM9B 2PRJA 2GQ0A 4FD2A 4PLPA 4JH0A 2AT1A 1J00A 1E4EB 1NBEA 3FGNA 5IT4A 2QQGA 3A4TA 4DV6B 1V1MB 4MH0R 5AHWA 5DTQA 2OV2A 4QZVA 1YBFA 5IC6A 1UDWA 2PUVA 2P2SA 3U62A 2V59A 4YREA 1NM5A 1GZ6A 2CDRA 4J91A 4KX5A 1ZO8A 4R2KA 4DSZA 2WJ6A 5F21A 1O2DA 1EBUA 2NZ2A 4E30A 1HMPA 1TJNA 1N34B 1U8EA 1C2YA 4OXKA 4PINA 3MTGA 4IHKA 2B5WA 3BC1A 3H9BA 3JR7A 5CT4A 2Y05A 3GYGA 3MXOA 1RAEA 2DR0A 3HVUA 1DT3A 3LK6A 1TU0A 2UVQA 4GKAA 3KPWA 4OKNA 4N82A 2XNJA 2BLLA 3PWZA 4YP7A 2POQX 1F0PA 1Z82A 1RQGA 1UPTA 521PA 1T1SA 1FTWA 2CMKA 3EGEA 5EHGA 1E3TA 2A35A 4XM0A 2O52A 2V6JA 1R00A 2J87A 3R7FA 2AEEA 3GROA 4QFCA 5CLHA 3OZWA 3QOXA 4X7PA 3S2YA 4D79A 4F8YA 4G4SO 4AM8A 4RTSA 3KD3A 3R75A 1YC5A 4MYSA 4JLBA 2RBGA 3F9RA 2GYYA 3G82C 4IXTA 2GM4A 5IU6A 4QFMA 2VJQA 1CUGA 1QOPB 1VYHA 4KWTA 3HR7A 3ZVMA 3PLNA 3QWHA 5DGHA 4F2PA 5JYEA 3CX4A 3GRZA 3K6RA 3JSAA 5JAQA 2DJ5A 2GS9A 3AQ4A 3UJCA 3VR0A 3IE0A 1JZTA 2DBYA 1G7RA 3MQ2A 5E4YA 3CKYA 3LLVA 1K3FA 2JCSA 1K97A 4HAUA 3VC7A 1MO5A 4XD7A 5HG0A 5EL0A 3ABIA 4N8DA 3JVEA 3PNMA 4NZPA 3FWPA 1OI3A 3H16A 3U4CA 4DA6A 3T7IA 3MS7A 3FZGA 2F1JA 1MVNA 4EI2A 2WJYA 4TYWA 1JPJA 1U2ZA 2VDJA 3WB0A 4G37A 4LQ4A 2JW5A 2ZI4A 4C7OA 5L7TA 1BGXT 4LJ6A 2YRXA 2DBZA 1P2DA 5TMBA 4MV4A 1N2CB 3ZNQA 3RKUA 2EX0A 3KELA 4D99A 4HG2A 2GJ9A 3GCXA 5CHYA 3R9WA 1SXJC 2NP6A 1YJAA 3DL7A 1KIFA 1VIAA 1ZC3A 2F9FA 1KPGA 1KEPA 3HTXA 3P2JA 4R8LA 4DCNA 3SDZA 4A6XA 5LN1A 4YXFA 3KQTA 2PWPA 1G20E 2QZPA 3QYJA 1ZG3A 3AHIA 3D3WA 1KARA 2FMXA 2FEAA 5BUCA 1MEOA 4NATA 4EEKA 4QU5A 5BNZA 4XM2A 3OFJA 1U98A 4OU5A 2J0EA 3ZYCA 2ZPAA 3B9PA 1MJGM 3ZU4A 3PLAE 3Q2KA 4JZYA 1O4VA 2WWWA 2JCBA 5DWQA 5IKOA 4F2HA 4OSOA 3ZJTA 5CG1A 1KOJA 2ZAMA 4XWOA 3OJWA 3UWDA 3GQBA 5HIIA 1WEHA 4U3JB 4G0UA 4D25A 2W9XA 1G5PA 3D2AA 3FYDA 3HACA 3T5MA 4BNGA 4G4JA 2Z57A 1Z56C 3EA5A 4TYNA 3QGMA 2TMYA 4L9RA 4OY3A 1K4YA 3G7UA 3QBVA 1U8YA 2X2EA 4N9WA 3E22A 4ITUA 4X20B 3R7NA 3VJLA 4MW1A 1RAIA 4LXTA 4MPPA 4QDUA 3RI3A 3FWKA 2RBEA 2IRWA 3H6KA 3HWRA 3OD1A 4IS2A 2CK3D 2FPSA 4OQYA 4Y9SA 2MYTA 4KXMA 2R7AA 1NASA 2ZWMA 1SVUA 3LUGA 4NNJA 1CB7A 1RSZA 2IDJA 3T54A 4JU9A 3HHEA 3WMRA 5EC8A 1AMNA 1MAHA 3JASA 1AQ6A 1II8A 1TAGA 4UM9B 2HCTA 2I76A 2OP0A 1CDEA 1M8KA 2G8LA 4N5NA 4E1VA 1A9ZA 1UKEA 2QTBA 4RIHA 4FCWA 3UO8B 1LFAA 5BN3A 4DV1B 2ZYAA 3I4LA 2ZRLA 3OPVA 3URMA 2C88A 1RVDA 1UP6A 4X7RA 1NVVQ 2JI8A 2R6R1 4WNAB 3L92A 1DLIA 2Z2IA 4G1FA 3HZRA 5JEDA 4I08A 5AVYA 1AD2A 1Y3DE 4M22A 3GGPA 3SIWA 5CCXA 1QTNA 4ERNA 1IM8A 3EWNA 3JAWB 4PG6A 4DABA 1XX6A 5A4IS 1YZYA 4A36A 2LCIA 2PX2A 3OHPA 1OX6A 5G4KA 2ZJ5A 4C5AA 2F4VB 3KXKA 5E2BA 4RVDA 2FFBA 2GN1A 3VTAA 4O6VA 1GADO 4HVCA 2C4VA 1B16A 1MF7A 2VYNA 2N1BA 2D8MA 3HSKA 3LK7A 4L16A 4Y2YA 1JYFA 2PGIA 3X1DA 4MS3B 2C9BA 1NDUA 1KFEB 1YMVA 4RPJA 3UAZA 4U8GA 4N39A 4HDSB 1R5BA 2FMTA 3BZUA 1KKMA 3V8RA 2Y0EA 1RLOA 3KQSA 3AG6A 4HH0A 4JL8A 3RDPA 4BBZA 3BSFA 3FPJA 3AHDA 4MB2A 4PBSA 4M1EA 3UOWA 3KXPA 4XYMA 1YT5A 1KMHA 2CF6A 4N6GA 1HBJA 1VE9A 2HAEA 1ODKA 5AI5A 4B6JA 3Q15C 3I28A 4LCEA 2KM1A 2Q21A 3I9JA 4OSEA 3I34X 2C4TA 3O4FA 2GA8A 3KR1A 3K7EA 1KI8A 2G40A 2JEYA 1NW8A 1U9YA 3C8DA 3I01A 2IV3A 4I8XA 5E7MA 1O3YA 4ZAZA 5L51A 3ZWDA 1EVZA 3SLKA 2AEMA 2O4UX 5TVGA 2VRCA 4B71A 2CUZA 1Y42X 3FSRA 5EUQB 1UKVY 4GHWA 2O2EA 1TT7A 2XTMA 3LQ4A 4RD2A 1A04A 2XJ9A 3CB2A 3PXBA 1E1LA 2WU4A 2XKBA 1V11B 4L02A 1U3TA 1US8A 2QRMA 2RMKA 1AUPA 2B4AA 3BWEA 5CVVA 3U6KA 4AKIA 4HWPA 4S1TA 3QPUA 1YD7A 5CURA 4WXEA 3U9LA 1W4BA 1WDMA 1NTRA 1YE3A 4R6XA 5TDHA 2WYVA 4JYPA 4AXBA 4YAOA 3RVNA 3WS7A 4XVUA 1T9ZA 3SJZA 1PJ2A 1U02A 2PPLA 3S2EA 1BHQ1 1X7WA 1B76A 2QLJA 3AJ8A 1AQJA 2RCYA 1CJVC 3BMXA 3QIAA 4O4HA 4XLZA 5DP1A 5C8VA 2GVNA 2ZQZA 3F8TA 1M73E 3LL4A 3TLZA 1BWRA 4KWEA 4BLPA 1PR2A 3LECA 1L5HA 1YZKA 4URHA 5FOXA 2L18A 3Q8LA 2O07A 2BI4A 1N3IA 3PFKA 4TRMA 2A0KA 5BNIA 1TUEA 3DMHA 1SKBA 2FEXA 4Y30A 3RWBA 1I10A 4MS4A 4UVIA 1PWYE 1IJKA 2C94A 2QXTA 3ONEA 4DARA 2IE0A 3UMRA 3P9YA 3AJEA 4IWYA 4G4IA 4IOKA 4Q37A 2P2GA 5FWXB 3L04A 1D1PA 3AUTA 4GD3Q 1BA2A 3NONA 3QVJA 3GRUA 1KQNA 1KDPA 4D6XA 4RMGA 3H84A 1E9DA 2PKXA 1IBRA 4ZQIA 5E0OA 1V1JA 3UV7A 1L9XA 1Q3TA 2O14A 4TSFA 4YPOA 1A8IA 5C8YB 1Y3CE 3QLVA 4Q03A 4Q01A 5FYQA 1IOZA 2CJWA 4UHEA 5AM0A 2Q62A 3L7LA 1U81A 4EX7A 4YCNA 4JYAB 2WT4A 1UDCA 3G6WA 3AF1A 4MARA 1TTHA 5I7WA 1BW9A 2QSYA 1T8WA 2AF3C 2EQ5A 2VBGA 1TC1A 3DF9A 1PX0A 3EXG2 1SD1A 1Y5NA 2PX4A 3HABA 1X87A 1Z4PX 3E7PA 2H1LA 4U7GA 4AYWA 2QLMA 3VTKA 1N2XA 3WADA 3UOAB 1LBIA 3ZC3A 4C43A 1V37A 1Z73A 1XQXA 5TQ2A 2HRQA 4F9TA 2IHYA 2GZSA 1BVYF 1I2AA 4P4NA 3TMKA 2DEUA 3UT5B 3RBVA 4BJ3A 3UY4A 4ZO8A 3R6TA 3FYUA 4DRYA 1DO0A 1L4GA 1P18A 1W2HA 4A91A 4N3BA 3WIEA 1PW7A 2EZUA 3QUQA 2HMSA 4OPMA 3WJAA 4J16A 3M49A 3VR1A 4DDKA 4ARCA 1IM5A 4RV4A 5FOTA 3R7SA 3CXRA 1B15A 4E3ZA 4RIEA 4EI9A 4X7BA 1E96A 4D45A 3PKZA 1SXIA 4GM1A 3ELYA 1NNUA 3PGXA 5AKLA 5IP5A 4ZOBA 4RZ2A 4DA0A 3ZY2A 2VAPA 1ECCA 4NWIA 4QRDA 1MO6A 1RRVA 4RD1A 1QCCA 3KTAB 3B89A 3DDNA 4WBNB 3TUZC 4Q9LA 4CQLA 1ND5A 5ENVA 1PYOA 2QAGA 2WKQA 1Z26A 2GPBA 3I76A 1P6UA 5JS1A 3EZYA 2F9LA 2OFXA 3GH3A 2WV9A 3AR4A 3QX9A 1GPJA 3W04A 4D82A 5JQWA 3EPHA 1BRMA 1BJTA 1JFLA 1LK7A 2OCGA 4HQ6A 4K1LA 4UDXX 3ESZA 5LYYA 3RIYA 2NNWB 2X0DA 5IH7A 1AT1A 4D4GA 5J2TB 3D4PA 2W6IA 4IZOA 2GZDA 1SUCA 3DE2X 3CR7A 3AILA 1KMCA 4BYGA 2GK3A 3MW8A 1XDUA 1E9RA 4RDIA 2FW1A 2BTQA 3ABRB 5C1OA 4WY5A 4WOJA 4CHGA 3B12A 2ATIA 3PNLA 1X8LA 4OYYA 2AB0A 3IX7A 1R0YA 5LUAA 3GBVA 1NI5A 4QTXA 3HJGA 5JECA 5KWSA 3Q41A 3L7YA 1T24A 1ZMOA 4N40A 1KH2A 1L7OA 1J90A 4P4LA 2HH9A 4MW0A 4M1MA 4EGAA 1E0JA 1YJ8A 2PL5A 2PCJA 1L5NA 4PNHA 2P69A 4U4AA 1NYLA 4MQFB 5FFNA 2B5OA 1LNSA 1GP2A 1RQRA 1ULBA 2B4QA 2F48A 4MYCA 1YJCA 3AU9A 4CQMD 3EEOA 4FNOA 1CUVA 1YB5A 2PKWA 2AN9A 5GOTA 3L6OO 1I0LA 3KSUA 1RPZA 4LYFA 1VCIA 5H1YA 3W2IA 3B1WA 1NGSA 3WGQA 3ZG6A 3IPXA 5JRJA 1I1HA 2PX6A 4DCGA 4RJKA 1FRZA 3B70A 2YZ2A 1PWHA 4HWGA 3PB3A 1EK1A 2LDXA 1Z74A 3ESBA 2WMOB 3N86A 1BXGB 1Z4MA 3ONFA 1Q50A 3H1BA 3KU1A 5IMSA 4BO2A 3N0VA 5BN1A 3ZLTA 3E0XA 5IZ4A 4DCCA 3AINA 3HXPA 3GOQA 5HGJA 4FDUA 1BE6A 3HLKA 1Z7EA 4L5IA 3VI3B 1POWA 4H2DA 4I8DA 4PHCA 4B48A 1U0FA 4C2BA 4CFSA 1N0HA 1N6RA 3UICA 4LVOA 2PE5A 3WGLA 5H80A 4Z51A 4V2IA 4KOEC 4CYMA 2FE4A 5CH3A 1NG1A 1UK6A 1ZVMA 2BLNA 3AI7A 3B1ZA 3CXUA 3QU9A 4LZWA 3GLIA 2WQZA 4BCBA 4B3TB 5IAEA 3T94A 1KZ6A 1NDHA 2EXXA 3RTEA 2WBLC 3JWEA 3L93A 4EPWA 3B1KA 4DZRA 3OIYA 4REMA 2E85A 2YHSA 2O2SA 4G0QA 4Y9RA 2IJGX 5ESWA 1JZQA 1J2EA 1UOEA 4F38A 5E6SB 1H2EA 1O9GA 1MTOA 4YRGA 1V96A 2Y92A 1DC3A 1FPQA 1NN1A 4KAXA 4UBMA 3KNZA 4W4TA 3BMQB 4ZAVA 1TZ2A 4CG0A 1LLCA 1QTRA 4G4GA 5DIFA 4COOA 2JAQA 1XNQB 4A2PA 1TIPA 2JJ1A 2V3CC 5AW4A 2WKRA 2WIJA 5J2UB 5KQGA 2FP4A 1RXCA 1RTKA 2FETA 1NJ8A 1S8NA 1VG0B 2FMKA 2QTTA 4N12A 4WKPA 5AVTA 4I14A 2AYZA 3IOCA 4L51A 1O77A 1YQQA 2KI5A 3ROXA 5TIIA 1XZEA 4PFSA 3ZXIA 4N3AA 3SR4A 3UWMA 2PWBA 3C85A 2QORA 3FFXA 4GSLA 3A1SA 4ZOEA 3G5UA 1VJ5A 1BFKA 2C7PA 2VUTA 3T4UA 2XYGA 1CU1A 4S12A 1A4IA 2G25A 3BWBA 1EM8B 3FSEA 3IQXA 3TLCA 4E70A 1SQGA 3JQBC 4FR2A 3VR5A 3AK4A 3ANSA 3T3IA 5B7QA 1CZLA 4K9QA 3KYCA 3DLTA 3HO8A 3QMVA 2EWVA 4NV0A 1S3IA 3VDXA 2YHUA 1U2TA 4TPKA 4DN6A 1Z75A 1QPBA 2V54A 3CLTC 5KJFA 1CEYA 5DI3B 2P4SA 5BWMA 1U2DA 3T7SA 4R84A 4YBZA 1CVLA 4BKMA 1JR3D 1EWKA 3OEEA 3IVMA 5JATA 4YVFA 1G6OA 2FOXA 1VFPA 4KJZA 4NF2A 3U26A 5B64A 1FJGB 2JGFA 5ALQA 1OASA 1JQDA 2OCKA 4JLAA 4LN1A 4HX5A 3GU3A 4HZIA 5AW5A 3OCJA 4PIVA 1DC6A 3QHQA 1BE1A 4RNDB 4GYJA 4TQGA 4N03A 1NMEA 2WEKA 4UCQA 2JLAA 2IDZA 4OXRA 2QJFA 4X1IA 3T9CA 4EDHA 1QONA 2P0EA 2QRNA 1FZTA 1XJCA 2QD2A 2OYRA 3MRXA 3NEPX 4Q9AA 2FN3A 2JAPA 1ZI9A 3TNLA 1QFSA 3GH1A 3HA3A 3RC1A 3CZRA 2YVAA 5AK3A 1KY5A 5FA5A 1HDEA 5BSGA 3SOPA 3UW1A 4LRXA 4B2PA 1ODIA 4LSZA 2DUUA 1W46A 3OFKA 1SPXA 4QGGA 3BB4A 1S89A 3AR9A 1LD3A 4B6QA 1ZOLA 2Y9PB 5HZMA 5JROA 4PZ0A 1G59A 2W6OA 4M8KA 4Q21A 2EIXA 5DFAA 1E9SA 2V4UA 3R3HA 2GBPA 4HB0A 5KOHA 4U6SA 3HUUA 2BEJA 3H0KA 2VNSA 3PJGA 4FZ3A 4DKJA 1L4LA 4P86A 4I99A 3ZW8A 3UGQA 4IX1A 5AW9A 3GEIA 5FXMA 2I54A 3AW8A 1QANA 1ZU4A 4P84A 4B6EA 4FMBB 3NEJA 1KMQA 5DLPA 3MINB 1H2ZA 1KORA 3L8DA 3V1UA 3N0XA 5AVSA 2BKEA 1MUUA 2W83A 4QDKA 4R5HA 4EJSA 2CUTA 4JV5B 1UDXA 4HWSA 2PFGA 4FS3A 5A4KA 4LPKA 4TXMA 3TFQA 4PC1A 3W8RA 4NBUA 1CNFA 3B3GA 4TN1A 1RZUA 1QU3A 1QP8A 1JALA 1BXRA 3H1FA 4FONA 4M9ZA 4IRMA 4F1JA 2XCQA 3ZDAA 3TCKA 3IHKA 2ZBDA 4F7WA 2GXSA 4WN9A 3D6VA 4PC2A 4NESA 3U13A 3O2QB 1TA0A 4K9MA 4BVFA 1OIXA 2QN8A 2W93A 3DOFA 2M1ZA 3BERA 1J25A 5LZ8A 3AHCA 2XJ4A 1CRWG 3EXEB 4HDNA 4WAUA 3ZE9A 1JDVA 2FW7A 1MA3A 4IKOA 4PAGA 5K0LA 5HHTA 4RDCA 2PTHA 1NVUQ 2R2AA 3A9VA 4KQCA 4IV0A 2IDMA 1Z2PX 1EVJA 3NP7A 4IWXA 2PY6A 4FMDF 5TNXA 4A2CA 4EZIA 1R4NB 4BMVA 4P36A 5F1PA 4CMBA 1X1QA 5A0VA 1UBLS 4NOMA 3ONVA 2JLUA 9LDTA 1LQ2A 1OREA 1T4CB 2RK4A 3Q87B 4I4IA 2B9EA 4HRAA 5EEGA 4YUYA 5LQJA 1U3UA 2H31A 1L5KA 1Q0HA 3THRA 1CX9B 3DJYA 5ALZA 4D74A 2NSLA 3CHYA 3WNQA 5CLGA 3GFVA 2ZM6B 4BATA 1GTJ1 1EE1A 2FHSA 5BN4A 2F1HA 1NVAA 5IBPA 1FTSA 4PZLA 2YW2A 3WLJA 5BORA 5LPNA 2ZS7A 1NE7A 5HKKD 5IJ0B 3OMWA 3A7DA 2HBZA 4RE5A 5CK5A 1KIMA 2H1WA 2HO4A 4KG7A 1Y3BE 5EP3A 1YQEA 1PR6A 4Z1OA 5HJEA 5EIWA 1OLXB 3N8GA 2JEZA 4MWTA 4TTPA 4XASA 5HFJA 2J08A 2Y71A 4XJXA 3WWEA 4YUZA 4RY9A 4C7BA 2D5LA 2JVKA 3S7TA 3TK1A 4C6TA 3ICCA 4OUKX 1SIOA 4XCXA 5CGQB 5IULC 3H1AA 3JZMA 4E31A 2NXEA 3D0OA 1ZJ6A 3CJQA 2KE5A 3LC7O 1BFDA 3Q98A 1N5MA 1I1NA 2EBFX 3NCHA 4EY3A 3HMKA 3EC1A 2YN2A 3IPRA 3R3ZA 4N4AA 3QXJA 2C7VA 1EP3B 4GPD1 3UXYA 2GM9A 4V02A 2QTWB 4ZI5A 3Q8KA 3TKYA 1Z5UA 3VKHA 2YV4A 4WX2B 5CFZA 2F9MA 4XGRA 1ZA1A 1E2UA 1G5RA 3GGGA 4O3MA 2DQSA 4MV1A 5ALHA 4L5YA 3SE0A 5U4XA 3P9NA 1XJ0A 2A0XA 4G0PA 4MUMA 1QG6A 1DAEA 1XZQA 2H1FA 3AY6A 3HCFA 3LJKA 5FB3A 4EHNA 3DLHA 1ZKDA 1TC2A 2ROQA 2P6MA 3SF0A 2B21A 4LQDA 2P5TB 2ZQYA 4EHLA 3FYHA 1I4TD 3RR2A 4N01A 3DE6X 3LVFO 5AXDA 5EJ6A 4XFJA 3FPBA 1YDEA 1CQIA 2JFWA 2VEDA 5HBGA 4GU5A 2MHCA 4JCCA 4YRRA 4CUZA 1V35A 4Q4CA 5A4MS 1QHGA 2JGMA 5GIOE 5KMGA 4R0NA 5CCDA 2VSYA 1KMNA 4QGAA 4M54A 1V95A 4ZCSA 4MYDA 3UAWA 1UQRA 1VDZA 4IDAA 1IZZA 1Z3CA 4C22A 1OROA 3EQ7A 4ESHA 4WK0B 4LOLA 1T8RA 3S1SA 3UATA 3K73O 3EUFA 4GICA 4PYMA 4TXNA 1S2LA 1UINA 3L7AA 5FR1A 4QTTB 4A0QA 1IAQA 2PGJA 4MMXB 5EIFA 4HT3B 3C24A 1WCYA 2I4TA 3VV3A 4AY3A 1FDSA 4QJIA 4YJ3F 1P0PA 2WG2A 2D06A 1D03A 2OCDA 4J07A 5CXXA 1BCRA 3AUKA 1Q7CA 2O1XA 5HRCA 4EFNA 4OQQA 1W96A 5JEEA 4BLWA 1OFTA 3GFBA 2A94A 1II0A 3COPA 3MBKA 4M1YA 2VRBA 1EIZA 3NIDB 5DOZA 2M6RA 1IJEA 3RFXA 2AJDA 2AG1A 1EDBA 3GDOA 3WWZA 4TTJA 1RYNA 1Z4QA 4DAEA 3DOUA 1XCJA 4FU0A 2KW5A 2TYSB 4L78A 1X7YA 2FPXA 2VATA 2DRIA 3EVEA 3H0CA 1FP7A 3K96A 3LBIA 3NHRA 3Q3CA 3QKUA 4XGNA 3WRWA 2BR3A 4NU8X 1SOMA 3DQZA 5KSYA 2UYHA 3O94A 5BVGA 4TTIA 3OO0A 3TE7A 2E4XA 2OAEA 3ZVLA 4A82A 1LS1A 3PC8A 4AO6A 1TLFA 4LRYA 1XMQB 3ICQB 2HADA 3IUJA 5CA1B 2NVWA 1HE5A 2WPDD 2E3JA 3ZBTA 3WNBA 3FI9A 3ASZA 3EYAA 3WGNA 2P3LA 4ZT3A 3PP8A 3DDZX 1ONSA 1Q22A 3NTUA 4L15A 1F48A 4A8JA 1JLMA 2QN9A 3QV2A 5DBOA 1B6GA 1OYWA 4Q4HB 3SY8A 3C1TA 1W7AA 3GFRA 1Q20A 4WOPA 4HJXA 1DIBA 3E5MA 1L3IA 3M9XA 4HGNA 3MAAC 2YCBA 5ALRA 1BDIA 3PT9A 1GCAA 2WJGA 2XAUA 1IJBA 3ITEA 1TK3A 1EWVA 5DBFA 5K0NA 1E18A 1NYRA 4PX3A 3IDOA 2PZ8A 4J43A 3BXZA 3N7AA 2EOAA 1G3IA 2YJTD 4MI3A 5KX5F 5JADA 3N2KA 5A02A 3KVYA 1P8AA 1RLIA 2Z1NA 1D6SA 2EKDA 4EO4A 4XDYA 2HWUA 1EXWA 2AOTB 5ED0A 3IAUA 5D7BA 2O1WA 3CUVA 1DKPA 4IDFA 5FDFA 3JPYA 4J1TA 3AW9A 4JROA 4DSTA 3K9GA 5K3BA 5HS4A 3ABZA 2CY0A 1GVHA 1GUAA 5IM4A 4BMPB 2P9GA 1Z39A 4BN0A 2UZAA 1JWAB 5JNUA 3WYFA 2BGWA 3BXHA 1C9YA 1Q6ZA 4BBPA 4B5KA 1RMYA 5K0JA 1QRUA 1QQ7A 1EG7A 1L1RA 4QRHA 1M0EA 3D3EA 5FEMA 4FYHA 3GLGA 4S04A 2IW1A 5KSWB 1EA7A 1QNLA 4L3VA 3RK1A 4YRKA 4JDUA 3A4YA 3FN4A 3FSJX 1UT6A 1H8EA 3CNOA 3DD1A 1FJXA 3O92A 4IQ4A 1HF3A 2EDCA 1OVGA 1DC7A 4XKJA 1XD8A 1IG3A 2P2YA 1N3LA 3P26A 2R00A 1HK7A 1XYYA 2GASA 3B6IA 3EJWA 3K2EA 5FKJA 1ZUNB 2MINB 3FTDA 1XU9A 4H27A 5AM4A 1YOVA 4JUCA 4MHOA 1RZRA 2W11A 4P53A 1U5BA 2X0EA 3BJZA 4V0ME 3SSNA 2Q3DA 2PRIA 2YYSA 4UE3S 3WLNA 4DSOA 3TSAA 1UC5B 2WV7A 3EULA 1Q77A 4DC1A 1Y1PA 3CKLA 3IVRA 4LJAA 4XDZA 3VO2A 4IDDA 4B3XA 4BOYA 1WVGA 4EPRA 1CZNA 5I5EA 4KR7A 1RRCA 1Y9JA 3Q7IA 4LBWA 3FWHA 4P35A 5E38A 4JI4B 2D5CA 4ISBA 1GNVA 3ZHOA 3VHRA 3NBYC 3RAJA 1G55A 1VPLA 2YICA 1ZRHA 3Q8WA 2DUWA 2VPPA 2GSDA 3K6SB 2PRZA 2ZRDA 4R40A 2DY0A 1BH6A 4P5EA 2IXFA 4EHBA 2XUPA 3GFFA 3UMBA 4RF5A 3LA8A 5IC4A 1JU3A 2ZRHA 4F4IA 1LSJA 1ADJA 3EG9B 3R24A 1BRTA 2HQ1A 1UZMA 2NX2A 3ESYA 4URXR 5JQGB 2IXEA 2PXHA 5JWHA 3W5AA 2TECE 3DEKA 2Y77A 5ECDA 3AIKA 4AZTA 5F12A 4GS5A 4EUFA 1UJ4A 4FW8A 1M0SA 2CLSA 5C81A 4HXGA 3K94A 2H11A 2VPZA 5EN4A 2ODPA 3AEZA 1ACLA 3BN3A 4JLDA 4DIOA 3EDRA 3R3WA 2AE2A 1M2VA 1Z5WA 4H3VA 3H9UA 2QQ0A 3SYTA 2NMVA 3STUA 3K0FA 1E3JA 4MPDA 1VPWA 2QSJA 5JY6A 4D81A 4TLCA 1WAMA 5F73A 4CI9A 6NULA 4F71A 1L7PA 4MWGA 1AA9A 1QIEA 2NPOA 3EGWA 1EXDA 3G89A 4CM9D 3W5DA 2CCKA 4KQ2A 6LDHA 1DLJA 2C9DA 1GPBA 1Z2DA 3KT6A 1M1ZA 1RWKA 2RHRA 3HCNA 1V39A 4Z0PA 1N7HA 2W6JA 3KQYA 1M75A 1T1JA 2Z8YM 2OENG 2WYWA 5BQ5A 2I03A 3B5JA 1F6WA 4DDVA 1XZCA 1XL0A 2AUTA 4FE3A 4J4BA 3VZRA 5JJKA 4EHAA 4EYEA 1VHLA 3KSBC 4R05A 4RJJA 2BL4A 3GDGA 3GVHA 5CVEA 3IDFA 3MUEA 5B37A 3BJRA 2LIPA 2OB2A 4Y9DA 1CY1A 5J59A 5BSVA 2ERYA 3O4HA 2UKDA 2QVYX 4J1NA 3BMNA 4AS1A 1M6HA 2ASVA 3H2KA 3H5LA 1FYVA 1FNBA 1X80B 3QWBA 1WTAA 3AY7A 4HNHA 1NJ5A 1H05A 2GUGA 2IUEA 4O2AA 5DGXA 3DOIA 5ESDA 4CV3A 1WBJB 3OKPA 3A1VA 3GJZA 1UIRA 1ZNQO 5ALFA 4AJ2A 1ZLYA 3B1VA 4P2BA 4GWKA 4CMGA 1EAMA 2RHJA 2NUTA 5HVNA 5CT9A 3TB6A 4V24A 3DAOA 1QTIA 1VE6A 5CM2Z 1A95A 1CYDA 4Q1EA 2PJRA 5IK2D 4UTXA 1E8NA 1JSZA 3EJ6A 3C87A 1BMTA 4UAGA 1KKLA 4Y2JA 2ZSEA 2C9YA 1FDOA 3L4KA 5JCZA 4C0BA 1PFKA 1WB5A 4M1QA 1E3DA 4TKUB 1P1KA 1BQ3A 1XD2B 3FLBA 4IKEA 4KUHA 3DVAB 1X7XA 1YUBA 2G09A 2P75A 4MHTA 4MJ3A 2IP1A 4PTLA 4X95A 4UXHA 4HTFB 1VRCA 3CBQA 4B0PA 2XITA 4Q7LA 1NXVA 2XXBA 5AJXA 4QGSA 5IKXA 3T3HA 2R00C 4HLNA 4P33A 4F2DA 3NHJA 1NI3A 4NAHA 1UCFA 1KC1A 2H08A 4F1WA 1ISHA 2Z98A 2IOQA 1C3EA 2VF7A 2WHQA 2O8NA 2YXLA 2Z95A 3V46A 1V1RA 2YZNA 3CKMA 5JE8A 3CR8A 1UT5A 3JZDA 2G1JA 3OCVA 1Q7EA 1RRGA 1AKQA 2NYVA 1CQJB 1P73A 1U5AA 3AZOA 1KZ7B 3L77A 1J23A 2CC2A 2GK4A 2H4ZA 3LHDA 1O54A 1KJJA 5FA6A 2DZDA 5A7GA 3PUKA 3W1WA 4A2QA 5FLXA 2GX6A 3KB1A 1JHRA 3TAHA 5CK4A 2A14A 5EIXA 1WB9A 1NVFA 2PPVA 3QXSA 4M8LA 1CRPA 1AKTA 3GUCA 3G9ZA 5AJUA 3K0SA 3WBKA 2AUMA 1HZZA 3S2ZA 5CW2A 3TQOA 3TIXB 3W0LB 2ACVA 1IN7A 5FT9A 5BYBA 4HSGA 2DC1A 5K3SA 1A8HA 3ER6A 3LO8A 4DBLC 5DYYA 1JHOA 3QJGA 4XYGA 2OLKA 3K6KA 2CK3A 3KRTA 4U2GA 2ZJ2A 4E08A 3W6ZA 2Y99A 3DBRA 4R8MA 4M46A 2O5CA 2X76A 1XC7A 1HRKA 2DWCA 4CKEB 4BRUA 2AFVA 5BR4A 2H7YA 1DOZA 4TV9A 3GEBA 2PMEA 3T1HB 5ECWA 3DBIA 1KETA 4OLHA 3SG0A 3UB4A 3IJPA 5DKFA 3PQ5A 2V7TA 5K3AA 3SS9X 4WHMA 4MP6A 5AVWA 3U4QA 1JKXA 1GKUB 4LE2A 4Q1DA 4DR3B 2G77B 2FSPA 4UD6A 5EZ5A 2JGEA 4A8PA 4RTRA 3CVYA 2C96A 3FGPA 2QN7A 7ABPA 1YJBA 1LEHA 1J6UA 3UUFA 2GBCA 1CFZA 1PJ4A 1T4GA 1X7GA 2C78A 2ORWA 3HSYA 5AUPB 4BQOA 1Q1EA 2EX4A 5LZ4A 2PZMA 2NT4A 2XRFA 1RLJA 2JBAB 1CW2B 3NASA 2J7PA 4KFUA 5D5QA 3WDLA 4P0QB 2VLIA 3KLBA 4BGDA 1Q11A 1DDOA 2ZE6A 4U6QA 5HZKA 2Q2VA 5KTNA 2GPTA 3RE1A 1E79D 1LK0A 5HQTA 2CN1A 3TZCA 1LV8A 2QUIA 5ELLA 4PQEA 4C4TA 4CLDA 3V8MA 1H65A 2R6HA 2MSWA 1NR1A 5I51A 2OYSA 1WV0A 4IR7A 5J1SB 1ULUA 4NV3A 4NNOA 1ID1A 3AF4A 3FM9A 5H5JA 1JH8A 2PEZA 4XLTA 4IJQA 4EK9A 3IKTA 2R8EA 1UJ2A 5BYKA 3PEYA 2D4AA 2ID7A 3HY3A 3PSHA 4ROSA 4UC0A 4UUPA 1Y6FA 1EEXB 2PTGA 1R27A 3SFZA 1NUTA 4G36A 1SOWA 1G6HA 1JT2A 3GT0A 5IAKA 2NADA 4ZO6A 3SR0A 4Z4FA 5B3JA 1XEFA 2ZTVA 4KN8A 4GWGA 4S3MA 2BTEA 2ZPTX 1PN3A 3G7NA 2NGRA 2D2FA 3PVSA 4OB6A 4YUXA 1PF7E 2ZCUA 4LHZA 2CJPA 1LLUA 1MJNA 2E5FA 4GVPA 1KVRA 4X3PA 3J7AC 3GB9A 3IVGA 5CDUA 5BR8B 5EIEA 1A4XA 1AF7A 1LI4A 2ID4A 3MCVA 2OBXA 4NLLA 3QEMA 4M0PA 4M8SA 4RF2A 2G5GX 3ZGZA 2JGDB 3USES 3SEQA 1VKZA 3RNOA 2JGLA 4D3FA 3JWGA 2YFKA 1N3BA 3L05A 1NY5A 3LGSA 3ND8A 1NQVA 2I9KA 3R9XA 4LMBA 1J7KA 4KV9A 4LOIA 3GLHB 1QV6A 2EBUA 1UAYA 3BT7A 4I3FA 3BH7A 3IAS1 1JEQB 4HNAB 4WACA 3SK0A 4UNRA 3WA7A 4OB7A 1JEEA 1M8JA 2JLVA 1EVIA 2M2IA 2XMCA 4FINA 5D3QA 4EL5A 4RA6A 1T1EA 1N8SA 1NDQA 2QXYA 1ZAYA 2YVLA 2QX4A 2C8JA 4OX9B 3D81A 2XCUA 2AEFA 2NTYC 3DTTA 4ALKA 2ZSDA 3TVYA 3RSGA 3HKDA 4I5FA 5G02A 4HBGA 1PKXA 2AE1A 4G26A 3AVVA 2QRHA 2MMGA 3A8TA 4DXAA 3Q3HA 1OMOA 3QBEA 4G1VA 4FYKA 1UBSB 1C9JA 5CB4B 1F5SA 1XP5A 4HDKA 1ULHA 4N1AA 1IZ9A 3V7FA 4MVJG 4BNXA 3UMFA 2ZIFA 1JQBA 4G8DA 3KOMA 4RTKA 4KMMA 1U3DA 4D97A 1NBME 5C46F 3ILHA 4PFQA 2ZJ4A 3X1XA 2JFOA 5CX4A 3ZX5A 4AJHA 1WQ4A 1M6YA 2QI9C 2VC2B 3F46A 2PAFA 2H4XA 4C7OB 1CYEA 3UG7A 3NKVA 3PEWA 1QHFA 4Z6KA 3VHQA 5NULA 4HL6A 1UAGA 2NPIA 5DM4A 1GNLA 4WI1A 4A16A 4UVHA 2VEOA 1V9CA 3CUWA 2DAPA 3L1HA 3LSTA 1QH8B 4YHBA 4B3GA 1C1DA 4XVQA 3PITA 4IHQA 4F5WA 5A6VA 2JFYA 1WZEA 5K0ZA 3DULA 1DCTA 4L7QA 3E9YA 5FI3A 5JMPA 3REOA 1F1JA 1LPPA 1GTL1 3U4HA 3O8RA 2IHZA 1HYEA 3KETA 1CJUC 3WICA 4O4JA 2EJBA 1R0RE 1T9KA 4U00A 3HFRA 4CDNA 3OQMA 5BSHA 4ZI3A 3QG5A 2COKA 3KOUA 3M7IA 1Q1QA 3MMPA 1LBTA 2EERA 4UPEA 5JHGB 3HEAA 4JP5A 1GZ4A 1JIXA 3EEFA 5LLDA 1CF4A 1G18A 5G3YA 1FX1A 2EW1A 2CFOA 2OD9A 1E60A 1JDTA 2ETXA 2NOAA 4MR9A 5JXWA 2IHBA 4ZVUA 2FY8A 1B8NA 1OAKA 4MRNA 5CFOA 2Z5FA 1L7AA 1EFVA 2WUWE 3GQBB 1JVNA 3ZGNA 1C14A 4M1ZA 4MRMA 5CJ2A 4TZ6A 1OY1A 2J3DA 3KJNA 1KHHA 1W44A 1VPEA 4DR6B 1JSRA 2YJNA 4DQDA 4KO4S 1FXSA 1C4XA 1DMRA 2QENA 3IFSA 4RC9A 2IIBA 5KNDH 2YTZA 4EKDA 1AY0A 2B34A 2FI1A 2H1IA 4XD2A 2QVXX 4QM7A 4PZPA 3IUBA 3ZZ1A 5TR9A 1DWOA 3E23A 1IM2A 5L6LB 4FI3F 4FKZA 1II8B 2WD9A 4FDMA 3SS8A 2PIAA 3EOZA 3GJ0A 1E6EA 1D2MA 1U11A 2Q0XA 1WVIA 3LVQE 3OWHA 4U0JA 1YU6A 2ZJZA 5DMHA 1KK3A 3SBXA 5BN3B 5C80A 4I6GA 1OZGA 5CP8A 3BSSA 2C0CA 2HQBA 1HM5A 3PPVA 3S8EA 2CCJA 3CIFA 4N41A 1Z0FA 1LH0A 1TZBA 1I5EA 2B61A 4KO8A 4IMPA 4YFYA 2BKLA 4ENQA 1DJLA 3ZY4A 3ZQ4A 1A9XA 2C4NA 1G16A 4PE5B 5IN4A 2QTMA 2XNCA 5I7OA 4F0JA 4WZBE 1QS0A 4BY9E 1C3VA 2FZ4A 3BTVA 3GVPA 3QEAZ 1NTOA 2I3BA 3QOFA 5AUNB 2IXGA 1X9IA 1XTKA 5CPFA 5HSGA 1SUPA 1Y6ZA 3BDIA 4YALA 3UZUA 5C5EA 1HV8A 1JA9A 1QUEA 5AM1A 4CPDA 5KYGA 3QVUA 1JWLA 3TSWA 5JSHA 1BDHA 3QVLA 2O7SA 3BFKA 2QGFA 4HMQA 4RHUA 3FPCA 4AUKA 4HEA6 4JBGA 1VSBA 1N5DA 2BEUB 4D4HA 2Q4OA 2FX5A 1RD4A 2B0JA 1J42A 2WM9B 4C0XA 1U6IA 3JQ7A 4QEDA 3VHXB 2IOYA 4MI1A 4O63O 5BV0A 1K0FA 2BF4A 1SCBA 2F90A 3LXUX 1DWPA 4FDAA 4U9UA 3HVHA 4B73A 4J7CA 5BPHA 1WUTA 1OH6A 3T8YA 4AS3A 2I7VA 4XGIA 4TMVA 2O54A 4KYUA 3SC6A 1EB9A 1X3SA 2HU8A 2JGAA 1SVIA 4J0FA 2CLMB 2Q5CA 2Q5FA 3PDUA 1X6VA 3UC5A 2RGDA 4MV3A 4R16A 3QFHA 4P32A 5DCUA 1XKLA 3MEQA 2WC1A 5G3ZA 3TJZA 3ZK8A 3QZUA 2QBYA 5E9QA 4TM7A 3D64A 4EW2A 2CVHA 1KZGB 4ZI7A 3G2IA 2AI3A 4BU0A 4RTNA 1YZLA 3W4KA 1HLPA 1HYQA 5CA0A 2VNJA 5KTOA 5J2TF 1VQ1A 2BZ0A 3P97A 4EQZA 1G8KA 1NN0A 3PUXA 5T4HA 2O4CA 2QLTA 4LKOA 3T3PB 4BJ1A 3NDRA 2CFIA 1XRPA 3ZXYA 1T26A 2AF4C 4UDNA 1DO8A 2H6EA 2C97A 2HXYA 1RLMA 2JH3A 5K8VA 2QNIA 3SJCA 3FKQA 5AXBA 1E3SA 1N1EA 1X7WB 2YJGA 3LMKA 3OTIA 1XZBA 2FEKA 1OI2A 1H2WA 3SF8A 4B3FX 4DXDA 3V7WA 3U3DA 4AJPA 5KU7A 1DEAA 1RYFA 2R8ZA 1WDLA 1P7YA 4PHTA 4QTUB 1SCUB 3T9FA 4EYKA 1SJ9A 2OXEA 3BXFA 3LUAA 2DXIA 2H06A 2W58A 4I4TA 2FJUA 2MYUA 4EECA 4AQDA 1BWPA 2QL6A 1DAKA 1BSVA 3AGPA 4AUEA 4C2TA 1P4GA 2YWCA 4GRAA 1JSLA 5J4HA 3OAAA 4P81A 3O6VA 1NNI1 4L9AA 3U48A 5C5IA 2HR1A 1YRQA 5AOVA 5ARCA 1WY5A 4B2LA 5DTJA 2GH1A 3ASUA 3W3AH 3N39C 1TUBA 2C61A 2GRJA 1Z6XA 3FZYA 3IQZA 3TI7A 1F4VA 1HDIA 4OHRA 3NYWA 4YMUA 4LF5B 3KT8A 3GD5A 3N3AC 4BO9A 4BQNA 3LPNA 2SCUA 2Y1EA 1U65A 2J4FA 4NYJQ 4CW7A 5ALWA 5DYWA 1NUQA 2F3TA 1E7WA 3OX1A 3MQ4A 1UBOS 1KAEA 1WNTA 2O6LA 3OLWA 4R69A 5BVHA 1G2QA 2PR2A 4B34A 4BECA 3WYCA 1W75A 3RS7A 3ELUA 5IWAB 2YVQA 3UW3A 2Q6VA 1K08A 2ZU6A 2R1TB 2IH2A 1JBQA 3DSRA 3BCUA 5TQ2B 5AESA 1YBVA 1YS7A 2WT8A 3V1YA 4HGZA 5D01A 3X1YA 2F8SA 2VK4A 5DWDA 5DX8A 1HWYA 1NZFA 2RGWA 2WQ6A 4YY3B 3U80A 3E3LA 3UHOA 1JW9B 4FYYA 4WUTA 1JT9A 3FYUB 1MD9A 1NZJA 2WSYB 4S05A 1WHSA 3G9TA 3I2YX 4MQ5A 4D3XA 3CF6R 4DBLE 3ETDA 4EG0A 1Y3HA 4YRBA 1KZ4A 1QRRA 1VSQA 2FKAA 1LNZA 5KTSA 2XWBF 4JVSB 1GT6A 3A6HA 1AXRA 1UBKS 2V45A 3R5XA 1LPSA 2ABWA 4L9SA 4ZZ2A 1IIBA 3WNDA 3KV1A 2W2LA 1PJAA 1VE1A 4P5DA 4W5RA 3PBKA 1K4MA 4OFWA 3T34A 4DMHA 4DV4B 1Q12A 2G5CA 5FBHA 1N5KA 1QM5A 2O3SA 2NYAA 1IXYA 1UBFA 2KQUA 2G76A 2Q6LA 3Q3IA 4LHEA 1W6RA 2Q1WA 1AK1A 1I6LA 1T3TA 4TUYF 1Q7GA 1RQ2A 5EKTA 1YZFA 1H2BA 4D3ZA 1P6XA 4QVIA 5LBUA 4V2UA 2VJMB 3VZBA 1YVUA 2R1UA 4R1QA 1AQIA 1HE4A 2R11A 2W5UA 1VC2A 2HFKA 3SJAA 2BHLA 2VTVA 4F6CA 3LPLA 1U2EA 2AYYA 2BP7A 4B7AA 3EBLA 2B6NA 4W9MC 3ZIUA 2KSQA 4J90A 4FBMA 1J1ZA 3DW1X 4PYNA 4F5YA 2RBKA 1HYHA 3CLHA 3GLQA 1RHUA 4P83A 3DDOA 4Q9HA 1ZCFA 3CTPA 1XZIA 4DLWA 2EARA 3ZCVA 1YR8A 1VJ1A 2ZRKA 3NP9A 5KWEA 2FUG6 2ZSJA 4JQYA 3WQRA 5DNEA 1XCMA 2DKFA 3LBAA 4HDAA 4GMGA 3DCJA 1U0HC 1QWOA 1ZAKA 3V97A 1NFFA 4YRAA 3WGZA 4FK8A 2IA5A 5AW1A 4EG1A 5GV8A 1AHNA 3FIJA 2J67A 1RYMA 4A26A 4QLOA 1R6DA 3JYOA 3KR0A 1C9DB 2Y6UA 3OZBA 4AJEA 2YASA 2OMEA 2ZRFA 3FSGD 4ZV4A 3MS2A 1RHRA 2HBRA 2Z6VA 3QKRB 4IYJA 3SXUA 4C3VA 3TD9A 1CVRA 2CEKA 1H42A 5AOBA 4RFSB 3L6RA 3C3MA 3UA4A 5ICEA 2IW3A 4FCVA 3IRVA 1M74A 4YA6A 4E5KA 1TZKA 3I01M 1I7NA 5LQAA 3PDCA 2ZYWX 1C3LA 5L3ZA 1WA5A 2O0JA 2YZGA 3EXG1 1UWVA 3KWJA 1GHTA 1IH8A 1VIYA 2QM8A 3ET5A 4QPJC 5A9SB 5HKKA 1XCPA 2FK7A 2G82A 4BUCA 4J4TA 1A8QA 1K75A 3ECCA 3GEDA 2JHPA 4E2FA 2CL6X 5AVOA 3Q40A 3K9WA 2BJHA 5E3JA 3K8QA 2NTJA 4HP8A 1BYIA 4I1RA 1SOAA 3T7DA 3CWZA 4UM8B 5CAEA 2C8VA 2QRUA 2NUPB 3UC9A 2HXSA 4B8ZA 4D57A 3R3YA 4W6QA 1EWTA 1ML4A 1VA4A 3K05A 3FWYA 4BQEA 1AMUA 4I1PA 3NIWA 1NIJA 2VAWA 4H59A 1YH3A 2Q3JA 3FNQA 2QD3A 3I5XA 3HO6A 4MWSA 2PZJA 5ETJA 1ORDA 1FQJA 2JI4A 2P3QA 3L8CA 3P45A 1AX9A 1A77A 5BRAA 3HJCA 3I1FA 3PC4A 1THMA 3LI2A 3SSAA 2BFWA 4F12A 1TIKA 2EBWA 1JFFB 4TV8B 1W9HA 2B94A 2ZG6A 4H4DA 1G6KA 2K87A 1ZSNA 4LA4A 1B00A 5KYXB 4DZTA 5TPWB 2JZCA 2ZJ1A 4U63A 1G3MA 2OP1A 2NU8B 5BOVA 1DJOA 4OHOA 1M0TA 2G1KA 4F96A 1U31A 2G1PA 1U8ZA 5F9MA 1HDXA 3TXYA 1Q7TA 1VHWA 2NU6A 3RAEC 1CLUA 2V0CA 3EA4A 3F78A 2OAP1 3C3YA 3WL6A 3UB3A 4CG1A 4C7VA 4CIAA 2B9VA 4ZZ3A 2X8JA 4JJ4A 2QTFA 3DL4A 1DELA 1RXSA 1QGAA 1IVNA 2R751 1ZSYA 4XR9A 3J7TA 1CUZA 3MUOA 4JUFA 3ZHZA 4S2UA 4HNVA 2VP6A 1VJGA 3PHCA 2VUIB 2AC4A 1GVNB 5DO9A 3I6QA 1L5WA 3VC1A 2M32A 3HZHA 1GILA 3HYCA 1F14A 4RQBA 1XK7A 3WE7A 4K2AA 3DD5A 1MFZA 2Z4TA 1KIAA 2W4MA 4IDEA 3K09C 3EPPA 2ZVDA 4LV6A 4MXDA 1ZSVA 4NYMQ 5GQSA 2ZIWB 2EZ8A 4OHKA 4PG4A 3RT7A 3HB5X 1Y8RA 4IIYA 3RO7A 2BYTA 1R16A 3V8NA 3G1UA 3NNDA 4KQWA 1FP4A 2O5VA 4OYHA 1W0KD 1NJ6A 1F0KA 1HFWA 1K2VN 1K5DA 4WLVA 4P4GA 4QAJA 5LXTB 2ZDHA 3EODA 1E0AA 1GL7A 1PJTA 2Z43A 1RDFA 2BPOA 4UEWA 4WBXC 4NXNB 121PA 1FUKA 1Y7HA 1YR6A 2XUKA 4BYMA 3SHTA 1E0KA 1RWWA 4RZIA 4UU0A 4EITA 4DR7B 5JMWA