1UJBA

Structure of the protein histidine phosphatase sixa
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
156
structure length
156
Chain Sequence
MQVFIMRHGDAALDAASDSVRPLTTNGCDESRLMANWLKGQKVEIERVLVSPFLRAEQTLEEVGDCLNLPSSAEVLPELTPCGDVGLVSAYLQALTNEGVASVLVISHLPLVGYLVAELCPGETPPMFTTSAIASVTLDESGNGTFNWQMSPCNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphohistidine phosphatase sixA
publication title Crystal structure of the protein histidine phosphatase SixA in the multistep His-Asp phosphorelay.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 54
structure length 156
sequence length 156
ec nomenclature ec 3.1.3.-:
pdb deposition date 2003-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1ujbA00
3FDZA 1YFKA 4ODIA 2OWDA 1EBBA 3E9DA 1XQ9A 4PZAA 2WU0A 5HTKA 1DKQA 1QFXA 4JODA 1C80A 4JOBA 2OWEA 1BIFA 2P30A 3BIFA 4EO9A 3MBKA 3IT0A 1FZTA 4ARVA 2P75A 1C7ZA 1FBTA 4MA4A 3PGMA 3QPWA 1V37A 3KKKA 3EZNA 1UJCA 4GPIB 5AJVB 4EMBA 1SKBA 4JOCA 2A9JA 5AK0A 1RPAA 4E3WA 5CDHA 2WNHA 3D8HA 2H0QA 2I1VB 3OI7A 1RIIA 1CVIA 3LG2A 2RFLA 3QPVA 3E9CA 2P78A 4PGMA 2GFIA 1V7QA 2PA0A 3K4PA 3LL4A 4FDTA 2DWOA 3NFYA 2WNIA 5PGMA 1QHFA 2P6OA 4D4LA 3O0TA 5AJYA 3FDZB 1SKAA 1BQ3A 2HHJA 2P2ZA 2A6PA 4IJ5A 1QWOA 3EOZA 1RPTA 1K6MA 4HBZA 1DKOA 3DCYA 1SK8A 2AXNA 2QNIA 1NT4A 4IJ6A 3D4IA 3R7AA 1C81A 2YN0A 2P9FA 2BIFA 5AJWA 4PZ9A 1H2FA 2P77A 1E58A 4ARUA 2DWPA 3LNTA 1BQ4A 1DKNA 4AROA 3ZHCA 1YJXA 3D6AA 3IT3A 2H52A 2EKZA 2HIAA 3K4QA 3FJYA 4TSRA 4ARSA 2H4XA 1DKMA 3GW8A 3IT1A 5CU7A 5AJXA 4D4KA 1DKLA 1UJBA 3C7TA 5HR5A 2H4ZA 4D4JA 2F90A 2EOAA 3HJGA 3IT2A 2HPAA 2ENWA 3MXOA 2EKBA 5CX4A 3E9EA 2ENUA 2P2YA 2IKQA 2P79A 2YN2A 3QPUA 1E59A 3F3KA 2P6MA 3GP5A 4QIHA 3F2IA 1ND6A 1SK9A 1H2EA 1TIPA 3DB1A 3NTLA 5AJZA 4GPZA 1IHPA 4FDUA 1T8PA 1DKPA 2P9ZA 2P9YA 4D4MA 1ND5A 3GP3A
chains in the Genus database with same CATH superfamily
1W34A 1YBAA 3W8DA 5LZ8A 5AYVA 1GARA 5HFAA 2Y3IA 2JGNA 1G291 1ZRSA 3BXGA 3COZA 3L7LA 2OBXA 3K1ZA 1VPEA 1S2GA 4PLHA 4TYPA 4KACA 4EKNB 1XELA 1KI6B 1T9KA 2IT1A 3BE8A 1W2GA 2O14A 1QFXA 3GMIA 3HY3A 3NH6A 4HLQB 4W1PA 5D1NA 4MWSA 3TLCA 4Z0PA 4JLDA 4F71A 3SWWA 1EEXB 3NHMA 4EGAA 3SQWA 5B2ZA 3PQEA 4DY4A 2A58A 1RAAA 3FVRA 1KMIY 1HDZA 2IODA 2GKOA 3L8MA 3WGHA 2O2XA 1BYUA 1JVSA 2BKEA 2JA1A 2IHBA 1U3GA 1GTVA 2PBLA 2NZJA 2QP9X 1Y4SA 3SHOA 4MUYA 1JR3A 2CLSA 2D5LA 1LV8A 3RYTC 1DEAA 3WSWA 4CU2A 3GPLA 3LUJA 1N33B 4FHFA 2VUUA 2BEWB 4H7JA 4RVOA 1NQVA 4XQCA 1SD2A 4AURA 4L3VA 2PUCA 1HFJA 5B3AA 3BRWD 4IH4A 4XZ3A 4LZJA 1R5OA 2Y0PA 3GY0A 1XT6A 4DSOA 3HCEA 3JV7A 5C3MA 3PKIA 2HWUA 4PYIA 4UHDA 4Q9KA 4ZOLB 3GUHA 2ANCA 3IALA 2BZGA 1DAGA 1AV7A 1EJ6A 1NVUQ 2P4EA 3F9CA 3NWBA 1FTQA 2ADFA 2ISCA 3M83A 3PCXA 3BL6A 2HJGA 4KO4S 3R0IA 2P5SA 4J0QA 1CVLA 1F9EA 2JCGA 1J7JA 2YFHA 2Y68A 4HGZA 4QDUA 5AKZA 2LTAA 1QLJA 1EWYA 1P62B 1QANA 5WRFA 4BLRA 3OU2A 2R47A 3WSTA 3BN3A 3DR5A 5FJIA 4E2XA 1EB9A 1CX9B 1P0IA 3E2MA 3FD8A 4N4AA 4LDPA 2JK0A 4Q1AA 5FWYB 1UJ2A 2BGRA 2JFUA 1BWSA 1COWD 1XZLA 3ROTA 4KFSA 2PS9A 3ENKA 3V1LA 5JSZA 5DVZA 2BHNA 4RC9A 5AICA 1US8B 5HIJA 5CDGA 5KDDA 4AVYA 1DUVG 3JQ9A 4ZALA 3WICA 2Q5CA 2Z9DA 5HNKA 2Q0XA 5CNJA 3DFZA 4KXNA 3F5FA 3BRCA 3BFKA 3RRFA 3HY4A 1T2NA 3HRHA 1U63A 3L6UA 3H8SA 3ZU4A 4FBMA 3ONVA 3YASA 1J0BA 4NBKA 2WB2A 4V3CA 3VH3A 3RCBA 1KI8A 4LQ4A 1PHRA 2CSUA 3QBTA 4MICA 3QKSA 1QYXA 4GAEA 4IJVA 3Q11A 4BCCA 3D8RA 1RABA 1VIMA 5DHQA 3GIWA 2IY9A 4NCHA 3U0BA 4BAUA 3K2BA 2BUCA 4PZLA 2PKCA 4MS3B 3SYRA 4QU9A 4B6JA 1BA3A 1GU7A 1QX4A 2ZJ3A 3FCSB 4AZ3B 2EJBA 2AD1A 3Q2KA 4B0OA 2RCNA 4L8FA 2DOKA 1DRJA 1OTXA 3IAUA 1E1CA 1P2UA 1WCYA 4IJMA 1XFAA 4JJ7A 1NVVR 2DSNA 3WA6A 4RKRA 1YUBA 3DLHA 1Y8ZA 3FHJA 3PQFA 4OMDA 1QYWA 2SECE 3SYNA 4EA7A 1EK0A 2ZUWA 5THXA 3IAXA 3ML1A 4GECA 3BM5A 1XEWX 2GARA 1Z36A 1A9OA 3E8XA 3EQ7A 3GP5A 4WXYB 4QIHA 1GQYA 1ND6A 2ID7A 4WZZA 4RXUA 5D5PA 2OK7A 1JQ3A 1V25A 3QVJA 3BDAA 3X2EA 3IO3A 1GPWB 1TJYA 3INYA 4G0QA 2HLDA 2Q46A 2ZU0C 4Z99A 3TLYA 3EVFA 4H1HA 1IMOA 3ELDA 3D6VA 1J0EA 2EFDB 1UWCA 2IXEA 1KSFX 2ZANA 3O2NA 3G0IA 1VKRA 2B37A 4IG9A 4K9QA 4OI0A 1Q0LA 5GVRA 3OA2A 1MB4A 1Y9ZA 3A3PA 5LNK1 1VE9A 3WAJA 3C8ZA 5D7NA 2I1QA 1JJAA 2Q99A 4WMLA 1IZ8A 1M10A 3BIWA 5AH0A 3ZYCA 4E21A 5JQGF 2BF4A 3U7JA 1JEQA 2P30A 3GEPA 3HCNA 4DBZA 1IHUA 1ZI6A 2C92A 2JK1A 4DIMA 1F0NA 1MC4A 1M34A 2BEUB 1QQAA 4GXRA 1BEEA 1O5TA 1ZCFA 1MAHA 1Y6RA 2WKPA 5SV2A 5TQ0B 4WTOA 1U8ZA 1UEJA 3KKKA 1P3Y1 2OEPA 3ENQA 5D5HA 1TK9A 4CLEA 1DAHA 4Q1DA 1SC6A 3RVMA 3PFCA 5HKKA 2DR3A 2PMFA 4RHYA 5F23A 1JXOA 4NNJA 2BMEA 2H57A 1T2DA 3MD0A 3N2NA 2HTFA 5TJHA 2ETVA 5HRAA 2YC4C 4ITRC 2LV8A 5GPBA 3H6HA 3I0MA 3OF5A 4JFAA 4OKNA 4ZKEA 1X39A 2I9PA 3AIKA 1MB0A 1T9AA 2ORYA 3L1HA 4FDTA 8OHMA 1O96A 2QR5A 3PR3A 4GP7A 4MUEA 3S1AB 1G8SA 2A5LA 2VPXA 1ZI8A 3LUBA 4PO8A 5FXMA 1OD6A 2EX1A 1DDOA 3FPKA 3KV1A 1AKMA 4ZTZB 3IAEA 1K97A 2WTEA 5KEIA 4L2IB 4BEBA 5ELLA 1E0KA 2FSFA 2J46A 3IMEA 4BJHB 4QEZA 1VE3A 1YV9A 4LHEA 3AM4A 1T8UA 1NPTO 1KPIA 1YAJA 4RGBA 3V1UA 1ULBA 2V3CC 4BX8A 1ODTC 4LXQA 3QU2A 2XE7A 4DNPA 3AB3A 1WXWA 1KEUA 1W9MA 4NK4A 4TT3D 4CKXA 4BFZA 2QS9A 1YASA 3JVEA 1GKKA 5ICFA 2VH5R 3JQ7B 3PXGA 3UTCA 1LC3A 2XUOA 1ONPA 4PYMA 4C4RA 3ZBTA 3A6GA 1MC1A 5HHTA 5DIZA 2WWVD 4BQEA 5BURA 3AESA 1IRXA 1JIIA 2IL1A 3AJ8A 4QULA 5DCWA 7YASA 4K5QA 4YS6A 4YRGA 4AJEA 3GROA 4QOJA 2IF2A 3KXDA 3PXUA 1NXQA 4LNUB 4EI9A 2F7SA 4ZAWA 4D79A 1FNCA 3ZE8A 3LSYA 3TAUA 4MRRA 2HHCA 3RAFC 1QTNA 2HCBA 3DC7A 3TW8B 2WWGA 3MJ4A 3T0IA 5J59A 1AHNA 4CG2A 3H3JA 1DRKA 2OGUA 5ARCA 2ZDHA 1RPZA 2IYPA 2ORIA 3LUPA 5DI3B 3QVOA 5E4TA 5U1PA 3UMRA 1QVWA 1Y7IA 2YWGA 4DA9A 4WXHA 3HU3A 5GIOE 4QPDA 1DFHA 3CKMA 4D0SA 1ENZA 1DIAA 3ODPA 1PD0A 2JJ1A 4ASUA 1XHLA 3GV0A 3PA6A 3PGKA 4R8MA 4JGBA 1E7WA 3RYFB 2QTFA 4WXPA 1U0TA 4PG5A 2ZYAA 4CDMA 2GRJA 2NUPA 5B1DA 3F5QA 1XZFA 1ZBQA 5GJBA 4ZYUA 1C4OA 4DADA 3QLUA 1YA6A 2RKOA 4EUFA 4KDRA 5DEOA 3KTOA 5AVTA 1ZH4A 1FNSA 1XLWA 2VBFA 3EMDA 4FXOA 2WW8A 4CODB 4DQ0A 1RADA 3G2LA 4MXDA 1CQWA 4RKQA 3MOGA 4U3JB 2O3TA 4DDTA 2GNPA 4B83A 1WDWB 1XQ9A 3KOMA 1RQPA 3I01A 1KVUA 2Z1DA 3FB1A 3DAOA 3A4IA 3E53A 2GZAA 3NPAA 1MOZA 2IOYA 2W43A 4MJLA 2A1TS 2I3BA 3K6SA 4HQNA 1YQDA 3G0BA 1WRBA 4LOKA 3T1YB 4B32A 5IKPA 1YQGA 3BTOA 4OJNA 2WF8A 4KR2A 1RBZA 4GVXA 1XDSA 2W6JD 3FI0A 1JYEA 4HUTA 1O03A 3A3YA 3O83A 5AKXA 2XB6A 4BNWA 5JR3A 2OZLA 3GFVA 1AG9A 1YCGA 2C04A 1O8BA 4BRSA 1SHJA 4DCNA 4FFOA 5JXGA 4B48A 4JP8A 1U3CA 3HDGA 4ENPA 3K2EA 5D3KA 1IJFA 3DYBA 2YYSA 1U7UA 3E6AA 3LWDA 5EINA 5D3MB 4ZAFA 3PQ6A 3UXEA 5BV1A 2VF7A 3VR5D 1I4EB 4M8IA 2O1EA 3K70D 3LY8A 1PK7A 4U2BA 4V3BA 1JR4A 1VBMA 2K7ZA 4WLVA 5JVDB 2J45A 2P6OA 3PD1A 2D0DA 3ZZUA 4AXXA 5IFKA 3AI2A 2EIHA 1V48A 5JSYA 3P26A 1YSCA 1TEHA 3TD2A 5C81A 2J4FA 1DL5A 1E60A 3A37A 1G60A 4NFLA 3N0VA 2IRWA 1S3FA 1W5SA 2PX8A 1RKBA 1QOZA 3JQFC 2FLVA 3GDFA 3JALB 1BVHA 2RGEA 1K4YA 1EGMB 1Q1BA 1YZHA 2OD2A 4MW2A 4U9IS 5E9WA 3WFIA 3P9KA 4YBZA 3AJDA 3WGGA 1YXMA 1F2TA 3RRXA 4WBNB 2X9LA 4A5SA 1WW3A 4CCAA 2GILA 1K7YA 4Z9BA 1FB5A 4DTCA 1KMMA 1T29A 1ZL2A 2WHPB 4C2UA 1A72A 1KYXA 4MS1A 1XI2A 1SFRA 3CRMA 4PANA 4A23A 4RCVA 3H8WA 2QTTA 3KSDO 4BRUA 5HRUA 4X7BA 1OX4A 1IN7A 1P2BA 3A14A 4C78A 1OXTA 1E61A 4QDTA 1Z5NA 5I4KA 2BEJA 3PIIA 3WIUA 4MULA 3K4QA 2W2MA 1L2TA 3A6HA 5GJWC 1R15A 3DVSX 3RAPR 2QUZA 3G7NA 5EJ7A 2ZXEA 3BFXA 3BIOA 2VBIA 1I3CA 4UVIA 3IYLW 1DJMA 1YZUA 5BYJA 5E9JA 1WPRA 2BISA 4KPYA 5ALTA 2J3JA 5E8JA 1WF6A 4G0NA 2J8ZA 2OHJA 4A0GA 3P2EA 4FWTA 1CJKC 3WGJA 1SXPA 3CRRA 2PUJA 1S9HA 4HG2A 1J25A 5DM1A 4WV3A 3MC1A 1P33A 3OOHA 4UAVA 3GWGA 1N5KA 1K27A 5FUMA 3KYBA 3HZHA 4AG3A 3M9WA 1P0FA 3PNVA 4G89A 5TQ2B 4OQYA 4U7PB 1U8FO 2FW9A 1EGVB 4WESA 4TYYA 3AUKA 4H6VA 4FKZA 3RTCA 4JP3A 1YS4A 2H48A 4L8VA 4UBKA 5CR9A 4B4VA 5HM8A 3N8KA 4M99A 1CZNA 5JU6A 1SKYB 1XMQB 1UJMA 1YK1A 5T6BA 4UM7A 2X9NA 3V7WA 4D4MA 5FBRB 1G38A 1IDN1 4NH0A 2QSZA 2Y9PB 1YGPA 1ENPA 2COKA 4DWJA 1KNQA 1RI1A 1UMKA 3K6JA 3QFTA 1WMBA 3VU1A 5BN4A 2DCUA 4MKXA 1KTVA 3AJRA 2XXJA 4AM8A 2EC5A 1RIFA 1Q0QA 1JECA 4REQA 5CCDA 4URXR 1QRRA 5T8KA 2JG3A 4UXJA 2XYPA 3PI6A 5FI0B 4BQOA 3FGOA 4LRQA 5F4ZA 2IUTA 1G8GA 2CUZA 3L6BA 1YVPA 3K6SB 2RAPA 2WFLA 2BF7A 4JT9A 4NFHA 1H2WA 1TTPB 4KN8A 3PGMA 3T15A 2WFMA 3OZDA 2VDPB 4MV1A 5FL7A 2GH1A 1BDHA 3ZVLA 2MCFA 3ILSA 1H3FA 5DBOA 4NVRA 3SX0A 3HYLA 2ZE7A 1Z56C 3JZAA 2JI7A 2HQ1A 3ANTA 4F4UA 3PD0A 4N76A 2E9SA 1ZHOA 4EVQA 3I9FA 1X8JA 5COQA 1FDOA 3U2QA 1TCBA 5CLFA 3JQGA 3GJ5A 4G5YA 1QDUA 4PQEA 4BFVA 2C78A 1KC3A 1PYDA 1OFHA 2H7VA 3I4FA 4PHCA 4EPWA 4DR7B 1UBKS 2ZPUA 3HI6A 3LO8A 3I6ZA 3ELWA 4EX7A 3MK31 2IS2A 4BO2A 1C9DB 4BNUA 2DBQA 5F77A 5DHUA 1XCOA 3DEFA 3IMKA 4O4IF 5LNK6 3ER9A 4WA8A 5A71A 3SSAA 4BY9E 2GPWA 4JNCA 1GGJA 2MYPA 4YP6A 3RUDA 2GBGA 2HDWA 3IKLA 3PVSA 4P7GA 3R3YA 5G53C 4HVCA 4QM7A 4X45A 3V80A 3BAZA 4I8XA 4M1KA 1USUA 1RD4A 3AIIA 3C3MA 1K7SN 3N1UA 4ZIRA 1JHAA 3O73A 1CEXA 2I6TA 4I0WB 2WHYA 1BMTA 4MVCA 4NR0A 4RHUA 3G0HA 1Z74A 4O59O 3UJHA 3RFVA 5AUOB 2XYGA 1JNXX 5JPIA 4M9SA 5EMNA 2YRWA 4PHHA 5G1PA 1DBRA 2GN6A 2R2GA 1UDXA 4OHUA 3OCXA 1C50A 4I66A 4Q0MA 1QBKC 2HXGA 1I2CA 3DMYA 4P3KA 5FPKA 5EZQA 4EH1A 3UG7A 2NO9A 3U4QB 3Q8MA 2Q5FA 4QQNA 1W94A 2GTIA 3OKFA 3N74A 4MQ6A 2XTMA 2HFJA 521PA 4GRDA 8GPBA 1ESDA 1W30A 1UWLA 1PV1A 4CV3A 4YAKA 1DEOA 1AZLA 5F1KA 1GZSA 5AOVA 1XTUA 5LLSA 4AICA 2OP0A 2VCHA 2NTEA 5F2NA 2YOGA 4L5IA 1XVLA 1CYDA 3G5AA 4M83A 4FYXA 4Y2HA 4P36A 2GF9A 4C7JA 4WN9A 1LY1A 2PEZA 1IEXA 1N6RA 1U90A 1Z8NA 2OCLA 5GONA 3TVDA 1LS1A 3MQFA 1CUIA 1D3AA 3V8QA 1EWQA 3RF7A 1CV2A 2H2FA 1Q17A 4MRPA 5AKHA 1H85A 4PSVA 1SVMA 3U9LA 2PLFA 1YR7A 3WXMA 4POOA 5HW0A 5CLGA 2BBSA 4MDHA 5GM1A 1PEAA 1UZUA 3OPMA 2LUOA 2IYYA 1NF9A 2JI6A 2W2QA 3CSDA 4OA8A 3THRA 4EIWA 5FAKA 1EFCA 5CPBA 1EE2A 1JWBB 3HVRA 2GEVA 4O4JF 1GPDG 4UBJA 1WDTA 3M6XA 4NMWA 4KPUA 3DB2A 3JWGA 5FA8A 5K3FB 5B1YA 2Q1SA 5H80A 1IG0A 3R3ZA 2QMHA 3WWYA 3RYCB 5EZ6B 5IS2A 5FBLB 1MGPA 2DTDA 1T6XA 1JUDA 2FW6A 3C87A 3FB4A 3L6OO 1C3OB 3MTDA 4OM8A 4BLVA 5F9HA 3OOWA 3BSFA 2V6JA 4P5EA 4LY3A 1G3MA 4BMZA 4QPPA 4WIAA 3EH2A 1SUEA 3C8DA 2LGJA 4S12A 4W7IA 4XYGA 5ALZA 2A0UA 4INJA 4N5HX 1XNRB 1P8JA 1WR8A 1I24A 2FFJA 2J4CA 4IDHA 3HA2A 1FVOA 4PVCA 4TRNA 3S7TA 2FCAA 3A9CA 3NM6B 1Y8QA 3D9QX 1M8JA 4NONA 1YDEA 2O9JA 1C4WA 4HAXA 3V7YA 4CXMA 3QVXA 4RD6A 1YCDA 1C3VA 2P35A 4L5CA 1VE1A 1X7GA 3OJ0A 3HM9A 3OPYB 4FYVA 4G1EB 4Q82A 2OQIA 3AEXA 1W4CA 4JI7B 2H6EA 1RSZA 1LTQA 2PWYA 4JLAA 2XCQA 1QM5A 3L5KA 1AGXA 4MWCA 4B6RA 5JS8A 3GUYA 4K28A 4IAOA 4TL6A 4F06A 4RWEA 4R9NA 1XTZA 1KY3A 3I73A 3ZWMA 1BJKA 1LLQA 3AKDA 2RGRA 4DFDA 4RHEA 1OI2A 4Z9FA 2CLHB 4ONEA 2QJFA 4AJPA 3RVOA 4G4JA 1VPWA 4HNSA 1Z6PA 2VP6A 3H6GA 4KVZA 2ZIFA 1ZN8A 1OBHA 2PQ0A 3I9LA 5LYYA 5EIBD 3SI7A 4MMYB 3AUTA 2ATCA 4INPA 3IH5A 3R0JA 4JLPA 5DBFA 4D44A 3T3DA 4TLMB 1RXWA 2H4WA 3RAJA 3DVLA 1NWHA 1BSVA 1X1RA 2ZRPA 4EHDA 4YJ2A 4OHCA 4X71A 5BW6B 2FQWA 1SUCA 3K6RA 2OFFA 3CE9A 4YJKA 3ZEAA 4X20B 3HNPA 3O1LA 1ZJWA 4EA8A 3QFSA 3AZOA 2A1UB 3HSYA 2QF7A 1QUFA 2BTQA 1J1IA 1F8FA 1NE2A 2B2CA 4U7GA 1NBHA 1C1DA 3OUUA 4CQNA 3OECA 1JHMA 1GQQA 4FI3F 4LDRA 5TR9A 2C99A 3QE2A 3ZE7A 3B8HA 1H8HA 2EWWA 3NT4A 4YDRA 3IDZA 4ZEWA 1P2GA 3F73A 1KQOA 1XUOA 1YRWA 2YC2C 4G1VA 1PK9A 1GQFA 4RDCA 4YJDA 4BNYA 3HXOA 4RKWA 1J1UA 4N0EA 4RUKA 4TLEA 1H4VB 1QIGA 3GOQA 2X77A 3ONWA 1FUIA 1XALA 4C2AA 3SJAA 5M3BA 3M9LA 2J5BA 4PTZA 1PS9A 2B5OA 3MTEA 3UXHA 3OPNA 4M9RA 4GICA 3X44A 4DUGA 4ZPJA 3R6LA 4KIFA 5FPYA 3TZHA 2A1IA 2NO7A 3ZUPA 1J2TA 1TI7A 4OFZA 1VCNA 2C98A 1EA5A 1XRMA 2IEZA 4QEKA 1QYRA 1H5QA 4WBNF 5JAQA 2HX1A 4PG7A 1DT5A 4PC2A 5CLIA 2A5GA 1WXDA 2IYRA 4EG7A 5ALMA 1WXFA 1ECPA 1ORVA 1JE1A 2VF8A 2WT9A 1KDPA 1FSFA 1QK4A 2E6KA 4YCDA 2R8YA 4O02B 2C7QA 4GX0A 3ZY3A 2Q45A 2PL3A 2ZRJA 3DP9A 1G8FA 4OGLA 4G0MA 1NVGA 3W2TA 1BXRB 1O6FA 5DEIA 3LT5A 1CRLA 2FP4A 2QTBA 4L0QA 5LYJA 2QJRA 1OYOA 1JR6A 3D1LA 3I8OA 2HH9A 1V3VA 2OSBA 3VOAA 3NOVA 2UYYA 4RORA 1MA3A 2HA0A 3ISJA 1H3EA 4DMGA 2DU8A 1ABBA 2D1TA 3ISTA 3G3EA 4KQFA 4MVYA 2EGHA 3T3IA 4CM4B 2PH7A 3QEBZ 1G66A 1OLXB 1K0FA 2XW6A 3OT4A 3Q98A 4MZXA 3WYEA 3X1WA 3AR5A 3U56A 4XDYA 1ML3A 2FY8A 2ST1A 5BNIA 3QXCA 1DEKA 2CF5A 3RKUA 1QPBA 1P74A 1UH5A 4BU0A 4QICA 3IMGA 1V7CA 1VIVA 2CEKA 1GUYA 3B38A 3GARA 1UM9B 4AUMA 2RSLA 4LZZA 4Q7MB 5E4YA 1EUDA 2J6CA 1KK3A 5A3SA 2DLDA 3QLJA 1JXQA 1NM5C 2PXHA 1E3WB 4QXMA 4UXIA 4WOCA 4YRMA 3PHCA 3K1TA 2AQKA 1FP6A 1USGA 1W5BA 2YOHA 3CB2A 3I61A 4YPFA 3NT2A 3R75A 4CEHB 2N1BA 1JRLA 3EMVA 4HF7A 4J3FA 4Q9HA 3E1SA 4X24A 4CL0A 4W9NC 4HB4A 3HVKA 4AP9A 4EO7A 4W99A 4XVUA 5BMVF 1ZMOA 5JSHA 1OR8A 4JJKA 2HIGA 3C6KA 5JXJA 1T5IA 3SF8B 5DHTA 1CR1A 2FXIA 4EGSA 1Y9EA 4KI7A 2QWXA 4Y3UA 4XRGA 3T99A 2VWHA 3M6WA 1QE0A 1M8PA 2D1YA 1SVKA 1SUIA 4JS0A 2PZGA 3HRKA 3CF4G 3ZJYA 4CCYA 4D8UA 4I1UA 4OJTA 1R00A 2G07A 3EYWA 2GQ0A 2HHJA 3GDGA 4TKUA 1NPYA 2B25A 2NTJA 4L75A 4EDHA 5BQXA 1FQWA 3I23A 4MS4A 2Q2QA 4BBJA 1ZVMA 2V1XA 2YY5A 4L85A 4Q66C 4D9FA 3A10A 2RGWA 5I4BA 1L5MA 4MI9A 3U7EB 2DMRA 1FA9A 3AKYA 2DUNA 1UWKA 3X1YA 3EEOA 3AR2A 2LKCA 1NVKA 5CX1B 5CM2Z 2HK8A 1FS5A 1XQ6A 4QAQA 2J0SA 3AUUA 1CD5A 4EABA 2F00A 2W8BA 3T4UA 4YP1A 4MI1A 3LW7A 3AFNA 3R9WA 7MHTA 1E3DA 4Z4EA 2V7UA 4IYJA 3NKFA 4QUGA 4MOWA 4MVJH 4IOJA 3KAKA 4I5DA 1NY5A 3ZDQA 1EVEA 2CXHA 4D9GA 3L8YA 1V95A 1L5HA 4B7CA 5CURA 4DANA 5C4MA 3W6UA 4ARSA 2DRIA 4ZO9A 4D3XA 2EG9A 3HO8A 4Z1MD 5J47A 4RE6A 4A36A 2YDYA 1UFVA 3FPGA 4PN3A 4QM6A 2KX7A 2H1VA 4I55B 3EOBI 3F6EX 3CMCO 1NMSA 1Z2PX 4AKTA 5I6DA 1C9YA 2ZT8A 4AYXA 2WHXA 2VK1A 2HO5A 5JH7F 2A9QA 1EH5A 2A5FA 2CVQA 4PLFA 1P7CA 1THZA 3DL0A 3K3PA 2ZUCA 4JLVA 1D4AA 2V6BA 1HQKA 1GKIA 1PHPA 2X19A 1L8XA 1NR5A 2QK4A 4O2LA 3VKGA 3JQ8A 2HTEA 1YJQA 3PICA 3OEEA 4ZN6A 3QWHA 1SZDA 3X1MA 3R1IA 5D00A 4D9BA 4P98A 4EQ6B 2A9OA 2GOYA 1GLGA 3WGZA 4P80A 3PPWA 5HSGA 2XYVA 3ZDRA 3F8TA 2GPYA 2CLMB 4TM8A 4OXKA 5JD4A 2H54A 3LT4A 3M6MD 3GEEA 4RBNA 2GBPA 3AQ4A 3O90A 4DIOA 3NV7A 4QJ5A 1PWEA 2EJVA 2FUG1 3MPUA 1P2TA 5C37A 1ODSA 3LBIA 3LXMA 1JQEA 4O2AF 3AO0B 3IAM1 1J22A 1UT8A 3ACCA 3C7DB 3OLXA 2KBFA 3HPRA 1AKQA 1A7JA 3TLKA 4EYGA 5DFAA 3HJFA 1S3IA 2EX4A 2IZ7A 1G3RA 3ONNA 2WDPA 1RQLA 1UKYA 3D81A 2C88A 1FDIA 2VP2A 2QRKA 2WTAA 2WWFA 3D43A 3DTTA 4IH1A 3NI2A 3R3WA 5AVZA 2AZTA 3REQB 2CWWA 3Q7IA 1R0KA 4PG4A 4TKLA 2XAAA 3RGGA 3S29A 2C2OA 1NR7A 2YX1A 5J2TB 1D7AA 3O8LA 2R62A 1D07A 4JYZA 3OJFA 3B1WA 4QG7A 1F48A 1I4LD 4IXDA 3TIGA 1C0IA 3HGMA 3Q8WA 1M2EA 1PU2A 3HB5X 4KN5A 4KUEA 3MCVA 2YDXA 3ZIDA 2I6XA 1QH8A 2R6FA 1J8FA 4LWPA 2PV0A 1GPKA 4G56A 4WE3A 4KJZA 5KTMA 5IARA 2R86A 2B4KA 2FXVA 3IJPA 6PFKA 1QZZA 1RXUA 1QK5A 3TVYA 1N2GA 4DE5A 10MHA 1V7QA 4XR4A 2P1DA 5CIQA 3C3XA 4TMZA 1YQEA 2HY7A 1KU0A 2ZSHA 2WNIA 4CR6A 2XOXA 2ODWA 3EJWA 3UV6A 2P5TB 4GL2A 2YXDA 5HILA 4BVHA 5JEEA 1OVMA 2E6UX 3OD5A 4Q4JA 4P35A 3K9LA 4L95C 3ZHRA 2NQTA 1H2BA 1A98A 2CHGA 3RVNA 1TU0A 1DC3A 3CXUA 3F4LA 4WT7A 1XROA 3RUIA 4D97A 2QA5A 3DV0A 1GXSA 1TAQA 5K09A 5KYTA 1EGQA 4Q3EA 3CXRA 2PO7A 1EG7A 1TM7E 3A05A 3T4XA 5EZSA 2QE7A 2CXUA 3EGWA 2V8BA 3D5TA 3D3WA 3DVAB 1CSEE 1D2CA 2LIPA 2R9VA 1T2AA 4LZNA 4E31A 5I47A 2CDRA 3HN2A 1UKVY 2EDAA 1HT3A 2KQUA 3OX4A 1E1DA 3Q3VA 1U7HA 4FKMA 4MTLA 4BQQA 4BX0A 5L4SA 1KEEB 2OQ2A 2JGKA 5IHXA 1GP2A 3P9YA 1QHSA 4TZTA 3ZKWB 2D2VA 4XVHA 3GUUA 3ZHOA 4NECA 2PSDA 1J4AA 1GG5A 3B82A 4YRIA 2IYAA 3NHWA 2V0GA 3SEAA 4P34A 4CQLB 5ALYA 4ZDIA 5DNYB 1YI8A 3F8WA 1IIRA 4AL4A 2P65A 5AJHA 4R1TA 3TNFA 3PFKA 3QKRA 3NWOA 1HGXA 1Z2EA 2FWMX 2DWUA 5GWXA 2XLBA 3CH4B 3BJRA 3GMTA 2FEKA 3QXSA 1PNVA 1UDAA 2W93A 3FKSD 4JB3A 3QXJA 4RY8A 421PA 4BE4A 5J58A 3R5SA 4PIVA 2L19A 5KQGA 3I42A 4JYMA 4KRFA 1DJQA 3SC6A 4LQDA 3CY6A 3N6XA 4BP9A 1XTVA 1VB5A 1NXSA 1N3LA 3EGXA 4DLUA 1RJEA 5MN5A 3FZNA 4G0YA 1U2EA 1AB5A 4M22A 3K96A 4DC1A 2YN2A 1B26A 4MJ7A 1GL9B 4MQBA 5EKSA 1J42A 2RBKA 2FG6C 3OQNA 1LRJA 1Z5UA 3T7IA 2G7ZA 3EWNA 3ZK8A 3BEDA 1VJ5A 5K7SA 2FPPB 1FSSA 1F3LA 3M6UA 5F35A 1B14A 4DRXB 2ZSKA 2CXQA 2NXNA 1XAGA 5B1IA 1KH3A 3L77A 1GWNA 2CLIB 4GBED 2X0RA 4GP9A 2V0CA 4RTSA 1FJHA 1B1AA 2VJLA 3VDMA 3CLRC 4HH1A 5DSZA 1CUDA 3SIRA 5A7GA 5LXTB 1XKTA 3RBAA 3FCCA 5FFFA 3FTEA 1SULA 1GG8A 3MGGA 1CZUA 1MP0A 3SD7A 3SIXA 5IX8A 1D1QA 1V6AA 2C1ZA 5HZGA 5G4KB 3GJZA 1PR5A 5JLJA 5L45A 1YDWA 4QO7A 2YQ5A 5C32A 2OAGA 3EXHC 4KMMA 3IDFA 3TOSA 1OLSA 3GF4A 3B1YA 3OIFA 4QUDA 1ORWA 4UHKA 3ST7A 1W0CA 2JFXA 5D87A 2D5CA 4B4UA 1VCIA 1H42A 2XUQA 1BD3A 3IKVA 3KXLA 4GL4A 5JASA 2ZIZA 2IX9A 3HB4X 4WEOA 3T7EA 1U7PA 3DT8A 3PX3A 5G4LA 2XGGA 4FD2A 5FQOA 4J1TA 4MUGA 3W78A 4D43A 4JX9A 5AM5A 5CXQA 1EIWA 3GRFA 5HQ3A 1WAMA 3RR2A 1ZBDA 1WSBA 4RA6B 3MERA 4JYPA 3SP1A 5I7FA 4ZVRA 5IJWA 2ZUFA 2ZJ4A 1UR5A 2A33A 4LCBA 2VDWB 5BN3A 3W9YA 3CJQA 2HN9A 2BKAA 4PHGA 4KR7A 2JPDA 3Q7TA 3KZXA 2J09A 4LUCA 2VQ3A 5FEMA 5GJVC 3PCTA 1D5CA 3EIXA 5DZSA 1XEXB 1AS3A 4NBNA 4NTZA 3FIUA 3N7AA 1OB2A 2NTNA 2WSYB 1V7PC 1IWPB 2AUTA 4IUCS 4I3HA 2HYIC 1RLIA 2HJRA 4JVSB 2VHVA 3QRWA 2F55A 4LF4B 1DBPA 4N3GA 4XX1A 1R6VA 2JHFA 1NQWA 5AXAA 3C1AA 1G8AA 1OT5A 1U2GA 3OVMA 3BMQB 3IQFA 4RNCA 5TIIA 1B8UA 3QPCA 3RYHA 2ZBEA 4YN3A 5B3LA 2PD4A 1OZFA 5G0UA 4DIKA 1EFRA 2AFRA 2WU8A 1UBFA 3FVVA 4WDRA 1QCDA 2BEKA 2UYOA 4LE2A 3VFDA 2VUSA 2WE7A 2YN0A 2Q9UA 5E9AA 2W6PA 5FUBA 1Y6JA 4BQFA 5SZIA 1XJQA 3OQPA 2J6HA 3HADA 1ULSA 3KOYA 4LXYA 4PS0A 1MEEA 5CGQB 1FW6A 3TNYA 3OMWA 5CDYA 2IVZA 2LXNA 1TCAA 1RCUA 4PRZA 1YIAA 2P9EA 1DKNA 4BV9A 4OD0A 1MKYA 1NVTA 4LDJA 4Y6GB 1U1FA 1XXHE 3VOSA 4CKEB 4KGDA 3HUEA 3HXLA 4XTCS 2W6ZA 3ECSA 4K9RA 2G83A 1SVLA 3L41A 4UE3S 5F98A 3QKTA 5C1BA 3T94A 3U7HB 3LNCA 1KDOA 5UKDA 3BVPA 4MIYA 1TQ4A 1QG2A 3G0CA 1YKSA 4Y2VA 4OL0A 4RDIA 4C03A 2Z0MA 1G5PA 2QRMA 4BO5A 5JPCA 2WV7A 1S9DA 3CX6A 3FWPA 3DKVA 2FZVA 1QG0A 2QOEA 4KKXB 3IPYA 2WAOA 4BFSA 4HDAA 1C8KA 1BE1A 4N7RA 5ITWA 5HM6A 2HRZA 4RLSA 1E7QA 4MUIA 1NDQA 2X1VA 2JLYA 1ZCJA 1RFGE 3R6DA 5BW5A 1NFQA 3GC6A 6REQB 1F5SA 2C8KA 2VT6A 1TMKA 2D3TA 2OO5C 3JX9A 4HEQA 4LJLA 4M76B 5AJTA 1C7JA 4XWTA 2HM7A 3S40A 3VVCA 3EPJA 3A9WA 4MW9A 1OZGA 3N0WA 3BRSA 4HDNA 3U4GA 1MVNA 1Z37A 3NTRA 3B9RA 2AJLI 4UUAA 1GZ4A 3I72A 3UJAA 3M2PA 2WA1A 1XHFA 4KI0A 2Y1FA 1OQAA 5EE9A 1W5TA 1LZLA 2G6TA 2R8RA 4BLPA 1OAOC 3PQ4A 3WE7A 1X14A 4PZAA 4PRYA 2Y0BA 1EK1A 3EQ9A 4KDFA 1WUHS 2FU5C 4DKJA 1IN1A 4ZJZA 4HAVA 1UMCA 1T4BA 4DGQA 5LQAA 1QQ7A 3WWEA 2C2BA 1FMTA 2IXFA 3D02A 5ED4A 4YVFA 4A5OA 5LBIA 1PP4A 3MMNA 3PFWO 1G41A 2PH5A 5CA1B 5L7WA 4BWGA 2D7JA 2ZI9A 3KU1A 4DQKA 5A0FA 3W06A 3I1IA 5JDCC 4KYUA 4B3IA 1FUKA 3S44A 1KEPA 7MDHA 4HQLA 4OUKX 3ROGA 3ADOA 1J21A 3CUTA 1IEVA 4PNHA 3LVQE 3PC7A 4RGQA 4XA8A 4BYGA 2W2LD 3PXBA 2PBZA 5AOCA 2B20A 5EIOA 1DC8A 2GPBA 4YXWD 2P78A 4G8DA 1BEUB 4TXLA 2H1LA 1O87A 4ZMSA 5KTPA 1RRKA 3QYAA 5LD2B 3O91A 5JRDS 4E1AA 1U28C 4H4EA 3QX3A 1NQUA 1Z8HA 3IAM6 2P2DA 5EE5B 1T0HB 1DV2A 1X1QA 4G63A 3ETHA 4MP3A 3VO8A 4FZJA 1D4FA 2RMKA 3EVNA 4TMXA 1GFIA 3ZJ5A 3H8VA 1F7UA 1QSGA 4GPAA 2R7AA 2ZTHA 3COPA 5HK8A 3FLEA 1RDFA 1CY1A 2GJ9A 2MU1A 1PQUA 1GNSA 1KFEB 3QVGA 5IH3A 4EKYA 2ZR0A 3KWLA 4C6TB 4HX9A 4RV9A 1VZ3A 1PJZA 4C7BA 4CGYA 5ADWA 1A9XA 1JSCA 1VCOA 2H3HA 4EKGA 3MLAA 3BMOA 3W77A 4PAGA 2FMFA 3F6CA 2O50A 2D5AA 2ZOSA 1TM3E 4Y98A 3FN4A 1QIJA 3OZVA 3HO6A 5L7TA 4QUHA 5CFQA 2H8GA 2FPWA 4O4LB 4IFBA 4D3SA 3FOFC 4C3ZA 1PFKA 4BFXA 4C4SA 4FHEA 2FF5A 4LDZA 3MQ4A 1SBNE 2Y27A 3DAGA 3FOEC 2VFAA 1Q6YA 2A7XA 3ZV4A 4LJ6A 5JAZA 3RW9A 2JC3A 1JA0A 1WTAA 2PG3A 3ZCSA 2F1HA 5LIRA 3EBLA 3L4BC 1C7RA 1MZVA 3OZBA 5FO0A 4EPVA 4PLVA 1GRNA 2Z5LA 5E6RA 5CVVA 4IIFA 3TLEA 1U31A 1GFSA 1X42A 2MYTA 3ENWA 3VYWA 1PK8A 2RK4A 2ZBDA 3KQHA 3NBXX 4FR5A 4PQGA 721PA 3DG9A 5LZ7A 5JFTA 4ALKA 3BWYA 1U5AA 4DA0A 1CZLA 4C4TA 5CX4A 5ALWA 1HOXA 1WO8A 1YB4A 5DHRA 2AB0A 5CFNA 3W90A 3C4VA 1M1UA 4RDHA 1M2FA 3AERB 3C7KA 1YC2A 1PGJA 3KWMA 2W8ZA 4UPVA 4ENTA 3THWB 1Y81A 4I4LA 4OYRA 4ZHQB 1ORRA 2MJLA 1A5SB 1I4OA 2LZ0A 1F4PA 4DMRA 3EGDA 2RC5A 4MX8A 2M9MA 4MQEA 5L4NA 4O3MA 3ASVA 4CR7A 1QTQA 5BWCA 1Y7LA 4LY0A 5IYZB 2AZMA 5DO9A 4UBMA 4ZZ2A 1O89A 1P45A 2ESRA 1VBFA 3OE7D 4C4OA 4EHFA 4F7DA 5LZ9A 3THXB 2ZPTX 3CPEA 4QFMA 2I91A 3EZ2A 2PWAA 4UFOA 2AZ4A 4FNGA 1CF4A 1MVOA 2ODAA 2NU9B 1Z5ZA 4GSKA 3FPAA 3PKZA 4F5EA 3N2LA 3PG5A 2CV0A 1LRLA 1PLLA 5JAIA 4B5LA 3Q3JB 3F5MA 3NVDA 4L74A 4OBWA 3WBKA 3B2EA 3F67A 3HCBA 4MIEA 4OJYA 4PFJA 4BEJA 4CMCA 4NXMB 1QO7A 3V4VB 3LQYA 1GCUA 3T1OA 4MNTA 1MJGM 3W2EA 2H29A 3CUKA 3QHAA 4I4TA 3CR8A 1K08A 1ULZA 3LXRA 5CGZA 2ZSAA 3VR6D 4XVCA 4TUYB 4W5RA 4FOSA 1M2NA 4Q1BA 3UJ9A 3OY7A 3EVDA 4EJSB 2IS4A 1IM2A 4XJSA 2TMDA 3PEUA 2VPZA 1T91A 2OVBA 2AEFA 5AUNB 3RU7A 3ROEA 4Y9UA 3ORQA 4N0QA 3KJGA 1II8B 4GQBA 4LSGA 3QHPA 1PGPA 1W8IA 3TKAA 4B3RB 2D8MA 1RC0A 1HNZB 4ZJPA 1WDKA 4H6WA 2NSDA 1YB5A 3OURA 1W5EA 3B48A 3JTMA 4E32A 3LIPA 2G5PA 3LGXA 3E3AA 1Q0ZA 3CEJA 4JUDX 4UCFA 4WZBE 2HBZA 3Q8LA 4UXHA 3ZNOA 1H23A 3MYRA 4EG5A 4YONB 4OBXA 2E49A 2JGJA 1FPMA 1QKJA 4YLGA 1QHXA 5FWXB 1P1KA 1VBNA 1CIVA 2FZCA 1UFQA 2I22A 2PN1A 5DU2A 2XWPA 3HLYA 4QODA 4Q4AB 3V8NA 5B64A 3T7AA 5I4CA 1Y8AA 2VPTA 3E7DA 4WK0B 5BWBA 1RJ9B 4X1YB 5L40A 2HI0A 2X0NA 4D0GA 1W2WB 3CZCA 3FFAA 3PPIA 4TM7A 1W88A 1P0CA 1ZN7A 1TNDA 5K3BA 2GN9A 3PCRB 3OE4A 4JC4A 4D0LB 3KQWA 3RHSA 5JBIA 4UAUA 1FEZA 2BWJA 3WWPA 5BSWA 3A11A 2LE0A 1BE0A 2AR9A 3EDCA 3MYYA 1WHTA 3MSCA 5AHRA 1U3UA 4J0JA 1GITA 4MKIA 2ZIVB 1EVLA 4GXQA 3ZVKA 2C7GA 1ECFA 1Z0JA 1Y33E 4UZFA 2CLLB 5C8YA 1H66A 1T25A 4FQ8A 4BMXA 4ZYWA 1KORA 1IB0A 3TQSA 4E4YA 1TA0A 1SUDA 4OI2A 4KK3A 1XZKA 2EFJA 2J0QA 1FTGA 1Y3DE 4Y2PA 2XKAA 2E21A 4D98A 5JCOC 5BXQC 2ZM6B 2CNWA 3E03A 3G9XA 2OO7A 4YIHA 3AETB 1X7YB 2BFOA 1XSEA 2HQRA 2ZQZA 3AZQA 3PHJA 4R0NA 1KO5A 5IMBA 3VNSA 1V5GA 2POQX 3DVRX 2R3SA 4B6SA 2O0LA 1WXGA 3KEGA 3AJEA 4HWKA 1KO4A 2Q5JA 4IUDS 5AHXA 1PEYA 1PZGA 1ZONA 1KDTA 1PNTA 2GCEA 2Q1XA 1ECLA 2VPQA 2ZSIA 3DQPA 1PR6A 1LDEA 4FW8A 4MWZA 5CJPA 4Z9AA 2NV0A 1IJEA 4Z5XA 5EXTA 4HN2A 3HCWA 1R5NA 3NBUA 1Q0HA 1N7JA 2B35A 4V1CI 4YDSA 4H1WA 1UT5A 4DAOA 4B09A 2V4MA 4DYVA 3ZY5A 2HUNA 3JARB 4XUEA 3A6KA 3RFCA 4YC7A 1BDBA 3UNXA 3KU4A 2A14A 1HNXB 1U5CA 4JI6B 1DBVO 3BDIA 3P9CA 2AHOA 3VDXA 5K8IA 1TM1E 5KYUB 1E2JA 3A1WA 3HHEA 1CLEA 1OFUX 2YV4A 3BB3A 3ETLA 4GQIA 4C6HA 1S8FA 4HS9A 4O6VA 5ERXA 1ISMA 4Y2UA 2ONKA 1Z4MA 3QBJA 1Q57A 3BZWA 2IS6A 2ZE5A 1YQWA 1EQ2A 5IZCC 1PW5A 4OO3A 3OM8A 1YGYA 2LIVA 2COUA 2GR9A 2VAMA 3FNQA 4RACA 5BNWA 4N6OA 5JAUA 4LYJA 5L9AA 4AF7A 2BZ1A 2Y92A 4D9MA 2B34A 4J2OA 3OMLA 1G7RA 1Z2DA 4QHYA 2C5EA 5D85A 2D5BA 3T9AA 1QVVA 1A9SA 1HT2E 1Q3KA 5PGMA 2WYUA 3ENVA 1ZW6A 3QP9A 1T8RA 4RE5A 5AI8A 3QA9A 4XLLA 1X74A 4YRTA 3WLQA 4B31A 4JU9A 3WDKA 3DFKA 1C2TA 1U3DA 1V5EA 4HB3A 4HSGA 4EZEA 5BPHA 5JAPA 3ZWPA 4QYSA 2XQIA 1OT3A 2VTDA 3O7MA 5EY5B 1G2OA 1U8AA 3GPDG 4N12A 4XEHA 4ZQGA 2PTHA 1NLZA 4Q16A 4X54A 4OV6B 3WLTA 3TL2A 2G80A 1D6SA 1BVUA 3B12A 1V2HE 2X9QA 3UHAA 5M7EA 5ICCA 4TYNA 3VR3A 2E4WA 2WE8A 2HPZA 2G5GX 3WYAA 3BXPA 3LKDA 5JJBA 1M6NA 4PSAA 3FMFA 3N8IA 3IA2A 1WHSB 1DC5A 3GPBA 5A03A 3BE5A 4XLTA 1KR2A 1VI6A 2E55A 2GDZA 1JDBB 3HDJA 4UEOA 2CDNA 2WUFA 3GD7A 1G18A 2Z5GA 4WH0A 5C4GB 5JXIA 1Y3HA 4XSVA 3TXXA 5SYAA 2VAXA 4KAJA 1NFRA 3K73O 2E85A 1GKUB 1YTLA 4B6OA 1ZNXA 1QZUA 5EWMA 5TGZA 2XVAA 1GT91 4ZZ3A 2Q2NA 3MQ2A 4GLLA 4TLLB 4B3HA 3MHTA 4AKIA 5CK5A 1I6MA 1WABA 1N5JA 1YVEI 5K3SA 4XOIA 1A04A 3EBPA 1JU9A 1P4SA 1VCHA 2JAPA 4UE6A 3P2YA 3VI3B 1JQBA 2JAWA 4NK5A 1C9JA 4YJHA 5E7QA 3TFWA 5LP6F 2CD9A 1ZJJA 3Q5GA 1Z39A 4QO8A 4BL5A 5C2JB 4O4HB 1LS6A 4HWTA 1BRMA 1NF8A 2JZNA 1IXZA 3SY8A 4YLYA 2ILVA 4X62B 2QZPA 4K05A 2ZAOA 3KAJA 1CF9A 1DG3A 1SBQA 2ZTSA 3N2IA 3RODA 1P19A 1RXEA 4O8CA 5KVQA 1PW7A 1EX9A 4CEJB 3VH2A 2NVUA 3NGXA 1PT6A 3DDUA 2OQRA 4ZVTA 1AHIA 1N5LA 4CIWA 4QDXA 3IP9A 1JN0A 1N78A 1K06A 4X91A 4IGEA 1RWBA 3F5SA 1OTHA 4QOSA 1N9ZA 1NBAA 2H7CA 3C3PA 4HXYA 4X85A 3M82A 3R76A 5G3YA 3RK4A 5IXSA 4YGYA 2PJZA 2QR3A 1DG9A 3KQVA 3U7QA 2VP3A 3QEAZ 3C5CA 2QXTA 3O9VA 1I94B 1LU9A 1BOOA 3PNQA 2Q27A 4GI2A 4UDOA 1FRVA 5ALFA 5FTJA 4CMEA 4K6MA 4N01A 2YVLA 2ZCUA 3M4ZA 4LXUA 3JY6A 1RXIA 3TD6A 1EBFA 4TTSA 3ZD8A 1YMQA 2R8PA 3E5MA 4ZVLA 2X2PA 1FZTA 3KHSA 3MJHA 4S1PA 1WKCA 1JBQA 2W9XA 4MKHA 1FDSA 3UV3A 2XEDA 4MA4A 4XIYA 1YI1A 2JCBA 4EPTA 1YE5A 2W4IA 5CFZA 3E7PA 1O58A 1F8UA 1P17A 1OBOA 2GPNA 3L06A 3SOZA 3HVIA 4RENA 3AW9A 4K9PA 3LVRE 3WZLA 2B4RO 1GEGA 3ZGVA 4MGYR 3B6IA 3OSZA 4RPKA 2FJ0A 3UYKA 1M66A 4UBNA 4JI2B 1FY2A 1YDHA 3MTGA 4RYDA 3VZSA 3KOOA 3OM0A 3NHAA 2A8YA 3R3UA 3GDWA 4N7BA 1VGQA 1T1SA 1XU7A 3QMMA 2RGAA 2HDNB 1TAUA 2MSWA 2GF2A 2OZKA 1RWQA 1SKAA 2I4IA 3GQBA 3M4JA 1YS7A 1XZCA 2NU7B 3TXAA 4I1VA 2QN8A 3QOWA 2AC4A 3K15A 5JISA 1EKXA 4YQZA 3HBJA 4R5HA 4WACA 3DUFB 2YVQA 4LTMA 3DW1X 4C3VA 5JC8A 1MENA 4IILA 3PDCA 4O8ZA 4YJFB 5IW8A 4DWOA 4TZ6A 3JQAA 1O9BA 3KG2A 3T3MB 5G1NA 1EFKA 3LI2A 4PO1A 1C81A 5ELXA 5C1PA 1XRJA 2CXPA 1BROA 4N6GA 2REXB 3FPSA 3O8QB 3O8OA 3QFHA 2QYTA 4JMLA 1Q1NA 2ZUBA 3CFYA 1BG6A 1Q1EA 1YRAA 3CZ9A 1KMCA 3L7IA 3MBOA 3OEHA 4UARA 5P21A 4COOA 2ISQA 1G7CA 2CNLA 4AROA 3TIXB 2O8DB 5FBQB 2XNDD 1FMLA 3CLTC 3I6BA 4BAGA 3ZNQA 5KDOA 2A9RA 5GY7A 4P53A 3TG2A 1QCCA 3OZFA 4IDOA 1D6JA 2Z56A 5FFNA 3DEYX 4NLLA 2OE2A 1PL8A 2O8VA 4PPQA 3PXCX 4H1VA 4A8TA 2GEFA 3BULA 1I8TA 2Q1UA 3THOA 5BUSA 1F8YA 3MUFA 5KMGA 3F1KA 5EKUA 1A7KA 1N34B 4YYZA 2JFQA 3F9RA 3H5OA 5TVGA 2PIDA 1H69A 2BFAA 5BWNA 4MRSA 1UBLS 1WOMA 3T7SA 1CP3A 1XCJA 2FWNA 1G4AE 1ZA1A 1DZIA 3REFA 2H06A 3U7IA 3V8RA 4Z8YA 1KJNA 4BE9A 2P79A 1RW4A 1W19A 3NEPX 2YJNA 3WRWA 4BO0A 4Z7QB 2C7OA 3TM4A 2J08A 2I67A 5DW3A 4UD6A 2CUTA 2Z1NA 4IPTA 4KSCA 4MRVA 4OYHA 3UHJA 1DCFA 3MMSA 3BSWA 3OIYA 4LG1A 2DHEA 1EJ0A 4J75A 3IXMA 3UMGA 1QFZA 1CE8A 2ZYUX 2QAIA 3TLGB 4GZLA 4XR9A 5HKBA 4XWWA 5LU8A 1M0SA 3A9TA 2XIQA 5A1JA 4DPMA 5DX0A 1LTKA 1OF1A 3N8HA 3CEHA 1M33A 4NNPA 2RAFA 4B4DA 4MEAA 3V1NA 4ESVA 3V3TA 2G88A 3TFOA 1E3SA 1XTTA 4HNAB 2P9GA 3LQRA 1T0IA 3MUEA 1DAOA 4IV0A 3C14C 4NBRA 4CLHA 1H3NA 4FMCF 2X5OA 1XA4A 2X4DA 5AHOA 1RHRA 2GBIA 1LPMA 1IQUA 2ZJOA 3OAAA 1YL6A 4H4DA 3ZDYB 3ZXYA 4DIDA 1OW3B 1P2FA 1OB5A 3E9ZA 4R83A 1NSYA 1E79D 2P4HX 4FGLA 4IJWA 3WJ2A 1U5BB 1OREA 2XCLA 3GYGA 2V7TA 3KD2A 4H59A 3UC5A 2GPJA 1SXQA 5DSTA 4JSTA 4P3XA 5TPZD 1EQAA 2PMWB 1VSUA 3BWBA 4UUPA 4GR4A 1ILEA 1XXHB 1HH4A 3LHIA 1N1DA 1T9GS 4RNDB 5LJIA 1CT9A 1Q7CA 2J9FB 3PQ5A 3CX8A 5JI3E 1UK7A 2EQBA 2YXPX 3GRAA 4OHRA 4G26A 4IJQA 1T6YA 3FXAA 5BV7A 3AI3A 2PUVA 3G17A 2VK2A 4ZVOA 2WOJA 4Y6OA 1ISSA 5HK9A 3EHEA 1V1JA 2PGDA 3DMHA 1SA0B 2HA3A 2WP0A 1XYYA 1XZNA 4TWRA 4XWGA 3ABSB 4MYHA 2BT4A 3LVFO 3F7NA 2FOXA 4MQ4A 2M32A 3I30X 1FP4B 2W42A 3I8XA 5LLDA 1KYIA 2G76A 1UDRA 2JFGA 3O1IC 3SIWA 4R1SA 5A4AA 4OSEA 4E5NA 4UTNA 5EZYF 5DN9A 4I2NA 3WADA 3WHKA 3GK3A 2BMWA 4BLTA 3LV8A 2W2PA 1RLUA 3EEQA 1ESNA 1ZRHA 1D2AA 3BFJA 5DPMA 5FHRA 3IP7A 3R7AA 4BB0A 2WD9A 2A5DA 1KAEA 4NV1A 4J0EA 2H1SA 5JQGB 2AE1A 3HCOA 3PNYA 4DEVA 3DTVD 2NGRA 2PCLA 2Z6VA 4PZDA 1S96A 3B6MA 4UNIA 2ORED 3OT1A 4G9BA 4XEUA 1I1OA 5FPPA 1E9AA 1CY7A 3I1FA 4FFLA 4QUIA 3A32A 2IH2A 3STTA 1K3TA 3PB3A 1Z4PX 1JDVA 1OXXK 4R54A 5ALPA 2X1HA 3QSGA 3U1TA 1LF0A 1ORHA 1ZM7A 3EXFB 4M37A 2H63A 4TTQA 4EI2A 5K45A 3LWNA 1I7PA 2IS1A 3ER6A 2HYDA 3FFWA 4JCOA 1UKBA 4NYIQ 6AT1A 3L0CA 4ZEXA 5LA6A 3RU3A 2XMCA 2YWHA 1SXHA 2F1RA 4BZWA 1J2YA 2VWQA 5SY6A 2ZJBA 3AOEC 1WCIA 5JO0A 1TYZA 3SJ7A 5I7RA 3JYHA 1T2CA 4QXRA 4U02A 5EP4A 2ZIXB 3I04A 1ZM9A 4CETA 5FBWB 4F1KA 1AH2A 2J0UA 3HXQA 2Q6VA 1GAXA 1MF7A 4B3CA 2I4NA 4BC1A 1E7SA 3AOGA 4NOJA 1BRTA 5F76A 5BRAA 1E1KA 1Y6ZA 4QTXA 4A2PA 1GGVA 2A94A 4MGIR 5DGXA 3ZBUA 3BFVA 3VU9A 4B46A 3FKJA 4B8YA 5CVTA 2J7PD 2XWBF 1I3NA 4QQFA 2YNMC 3HABA 2F64A 4EUNA 5C1OA 5HKAA 4DR2B 2NP6A 1W6UA 3IRUA 2Q4OA 1FTSA 1ZWKA 1L5ZA 1W8DA 2YFQA 4EY7A 2Q1WA 4FZ5A 3PYMA 5K0NA 1EFPB 2EFCB 3WIVA 1GLNA 3JD1A 3ROZA 4HDRA 3PTAA 5FFMA 2Z3WA 2HCFA 4I99A 5LQSA 3GLVA 3I5UA 1AK2A 3GCGA 1T0JB 1N1EA 1WY7A 3T3HA 2OSVA 3BK7A 4Q4DA 4WCDA 5HFNA 3OZWA 5AKKA 2CJPA 1UFKA 1VLLA 2BFFA 2ISSD 3H1GA 3O03A 1JEEA 5DTRA 2YVKA 3AEKA 3KSRA 1NW3A 2QJOA 4BASA 4CF6A 5BYBA 1UJCA 3KHTA 3P0JA 2BGLA 4FGSA 5B1SA 3LH5A 5E4JA 1SHKA 3I0ZA 3VPCA 2BSAA 3H19A 4C89A 1QE3A 1S2NA 2ZBQA 4RY0A 4EJMA 3SKYA 3OOEA 4ENQA 5CXUA 1UWVA 1ZLYA 4FFBA 3MJTA 2FHPA 5K4AA 3D8HA 3U44B 3BEOA 3DH0A 5CJJA 5HRCA 1LWOA 3UJ6A 1RIIA 1T15A 3A1TA 5KJCA 3W8EA 4F92B 4L0CA 3IHWA 1AMNA 3ZX4A 2ZVJA 3H3XA 3PVZA 1XMXA 2QM8A 1GTSA 4GRAA 2FWRA 3AC0A 1ANKA 2A30A 3U9TA 1U8EA 2VYFA 2CFSA 3NETA 4LOLA 4NENA 4M53A 3S70A 4BNFA 1T4GA 3CF2A 2V9ZA 3NB0A 4XRRA 1Y9JA 3K9BA 4HKTA 3ETCA 3QZUA 2O54A 4GKAA 3FNFA 4FOLA 3UFBA 3U0VA 1EUCB 3E0XA 4LEIA 3GNSA 1F0PA 3GEMA 3U09A 1ILWA 1AC5A 2R00A 1ZLXA 2D4AA 2C3UA 5DGDA 2PBFA 3AFGA 4EY5A 4CIYA 1NBMA 3WQQA 3FOZA 4OLJA 4BUJA 1VI2A 1QIMA 4AK9A 1LXCA 1X0XA 2AXNA 4ZK2A 4RULA 3HLTA 2XA1A 4GXTA 3RS2A 2ZAGA 1DWQA 1YOVB 3OP1A 3NRBA 3I5XA 4NZMA 3WL6A 3RK0A 3HYTA 3RVJA 1L7PA 3E18A 5EESA 4M7WA 5T4EA 1KAQA 1T5HX 2Y6UA 2R751 1P1CA 4ER3A 2B98A 1E77A 4A8JB 3DV9A 4HGNA 1OILA 5B57C 5LJLA 2TMGA 3KSMA 4JVOA 3T06B 4OHZA 1DQNA 1LCIA 3BHNA 4NBWA 3HU2A 4MI6A 4ZT3A 2D2EA 5JECA 5EC8A 5EKTA 4C2BA 4P82A 5IHPA 4HAIA 1OYYA 3VPHA 3L7DA 3IT1A 4HDMB 5ECWA 1ENYA 5ESWA 4IQ8A 5IT5A 1EZ1A 3WWDA 3WGYA 1NOKA 4B74A 2QRQA 3LUCA 4D4JA 1L7VC 1X2BA 4GX1A 1TUEA 5BV8A 4CDNA 5HGXA 2MSDB 1JA1A 3EFBA 1DAPA 4Z86A 1ZWLA 4KFCA 5HF6A 1M6HA 4COKA 5DYWA 2HSDA 3RKSA 1ZK2A 1MRNA 1XMSA 5B1EA 1X1DA 3P2KA 3W5AA 4K6FA 2HF7A 2P2NA 1XFDA 1F6BA 1XVUA 1GZ7A 1PTJC 2W2KB 1AM4D 3HKDA 5IDVA 3SSMA 4CG3A 1EX1A 2B8NA 1H5NA 1X80A 2GGSA 3N7UA 4B79A 1P9LA 3BSSA 4KX5A 4MV4A 5CXSA 1KRHA 1CUYA 3DMDA 1SHUX 3KLPX 1U8XX 1DTWA 4MO9A 3CG0A 3RI3A 1UBEA 3B1ZA 3FTPA 4AJHA 4C6SA 4NZNA 3OZXA 4WZBB 3VGJA 2O23A 1CNEA 3U5ZB 1V16A 5DGHA 2XTZA 3CCBA 3MIIA 3UXYA 5J2UA 2AIRA 3DBLA 3R6GA 5CDUA 5EJ2A 1R2QA 1GKYA 5DX8A 1HFEL 1Y6QA 4UCWA 4IEIA 2PWZA 3B2QA 4D02A 2F4NA 2HRBA 1BE6A 3K0EA 2DUJA 5BSVA 1G9XA 1AQYA 3TAXA 1EM6A 2CKMA 2QN6A 3ZGOA 1UPXA 4CMEC 1N7IA 4AS1A 1KMHA 3VPDA 5JWRA 2FQYA 2ATIA 4DCUA 1THGA 1EDEA 2IEYA 3AJ9A 3OEYA 1DX4A 4LV5B 5EJ4A 4TTAA 1KKMA 1K98A 1V4VA 1ZHFA 2JLBA 3LLUA 3PDIA 3GGGA 2YRFA 5KWJA 2H1RA 4IO0A 2IK8A 2Y76A 3OZIA 1Q20A 1O9GA 3KO8A 2JFPA 4HATA 3RFXA 3WMGA 1YTUA 4NESA 4RZIA 3FFBA 1JIUA 3NDRA 4Q3KA 1D0SA 3AX6A 3LOQA 1EEHA 5K3OA 3WMWA 4O2RA 2QDKA 4E09A 2RFLA 4HEHA 4BZZA 1JHVA 1VKHA 1CQIA 2Z4TA 3O92A 2PFGA 1VJTA 1OWLA 3COYA 1NVWQ 4L4RA 1NZDA 4F8EA 3A4TA 3WYCA 1SU8A 4EYQA 1E7YA 1XMVA 3HN7A 4RZXA 2VK4A 4IMIB 5CEFA 2VDLB 3OLVA 3MWDB 4F56A 5JNUA 3PS9A 3C6MA 1FTYA 3JAKA 1VKZA 4HTFB 4KRYA 4LHSA 4YJ3F 4EFLA 5FNVA 2V6IA 5FA6A 5K3AA 2Q2VA 1X94A 1TTHA 4DM3A 2I3ZA 2C5BA 3PUWA 3UW3A 3ZLVA 2FPXA 3PJRA 3A70A 1YC5A 3B2NA 1QKIA 3AQIA 4TWZA 3W1EA 4UU8A 3NC1C 2RGGA 2GK7A 2PZAA 3EAGA 2Z6QA 3JVVA 4AS2A 1Z15A 1V11A 4QU0A 2IKSA 1BXKA 2HEGA 2JI4A 5LQCA 1ZHHA 4M9ZA 3RH0A 3MFQA 4F3CA 4R41A 2C3OA 2QD5A 4LHXA 4UHEA 3T3EA 1Q22A 2G4LA 1MXFA 4Q3OA 2OPBA 4YHHB 2I6GA 4BP3A 4BNXA 3H5LA 4X44A 4N41A 4GZ5A 4UHJA 5GONF 1W1IA 1PT9A 3MIZA 3B6KA 3KUKA 4R9RA 1SG6A 3X3HA 3CIFA 4BV2A 4D8XA 1E98A 1PV4A 4IFTA 2PPVA 4S1NA 2B1RA 3PPVA 5JJ5A 1DZ3A 4LWOA 3HJGA 2A4KA 2ARKA 2ENWA 2CJWB 2JGLA 2XGOA 3DBRB 3I64A 3ADCA 1TO6A 5AM3A 1OLOA 3CHYA 1NW8A 2Q49A 4CW7A 3RBVA 1Q16A 2XVZA 3JATB 4RF5A 4AJLA 2VP4A 3UMYA 3SC2A 3P0FA 3WKAA 3JQQA 5GOZA 1I7SB 3I1JA 1IVSA 2CKDA 4J0GA 4WK6A 2W5UA 3JXEA 3GIDA 4ZANA 4O4IB 4GMDA 5H9WA 1WXIA 4RJ2A 3IQIX 1ID1A 1MH9A 3CLHA 1UBRS 4HX2A 4J3JA 2GD2A 3HG7A 4G65A 1JTEA 2AW5A 2IA5A 2G1JA 4I19A 3FAKA 4FZVA 1K89A 2ECKA 4OKSA 1Z38A 3TCKA 5K0JA 4G1UC 1ENOA 2IW3A 4JBLA 5GGYA 4DSAA 1NJSA 1Z25A 1TT7A 1MORA 3QU7A 4H16A 3NG1A 3O3CA 4L57A 4LJAA 5CT8A 3NRJA 3U3DA 1TU3A 1OWNA 4FOOA 4K9NA 1AMUA 3AM5A 3RSLA 4AJIA 2JVIA 2BEVB 4D99A 1DADA 2F9MA 3A6EA 1ISIA 2PRJA 4RPHA 4S35A 1NP3A 1OV6A 2YH2A 4YUXA 2RB5A 3E9MA 1SXJA 1HE8B 3PFFA 4D4HA 1QG4A 2XIJA 3O2SB 4JUBA 1DLIA 3IEKA 5EPEA 4A2QA 2JD0A 4B73A 4EPRA 5DE3A 1DO2A 2H18A 4ZOLA 3H9CA 4X97A 1KI4A 3ZWVA 5DBIA 4ZA2A 1T0UA 1JG7A 5EUQB 5IVIA 2WFZA 2HMUA 4BNHA 5KHOC 3DWGA 5EQDA 4GEKA 4HAWA 3AI7A 1TDJA 1RCTE 4LF8B 3IDSA 4RJTA 4KNWA 1K9VF 3PWKA 2C2GA 3VR4A 3L7JA 1T1JA 3O4RA 5D3ZA 1M1NB 3FI9A 3TZ6A 3ZIAA 4OBEA 2RHBA 3N3BC 1A9TA 3L1UA 1IB6A 4HH0A 5FWYA 2Z4SA 1H2RS 3KZ1E 1PEDA 1O94A 1PS0A 2VXOA 2YJ4A 3A4YA 4JLBA 4LDQA 4QPZA 1PSWA 4QE3A 4RQAA 1W96A 3KR0A 5MFZA 5CCXA 1WXHA 4NU8X 2BR4A 1P1RA 2IYNA 1Z5GA 3E7FA 3KKLA 3PA8A 3V9AA 2HT1A 1BW9A 3H5RA 3CX3A 3BGOS 3TLBA 5KNCD 5CXXA 4NU6A 3VNRA 1ISJA 2E2WA 1JQAA 4AIRA 1K7FB 2NSYA 5DLPA 4LK2A 1WPQA 3K09C 1ZOPA 3F7MA 3AGPA 4OGWA 2ATXA 2ZJFA 1RRFA 2R6HA 3AHHA 4FYYA 4ZOCA 4CMJA 3TBFA 3VR4H 3PQ8A 1KEKA 3NHYA 4F2DA 4GC9A 1E9VA 4KE6A 3VPAA 3ZYZA 5TLSA 1DARA 3BREA 1BQ4A 2KE5A 1T4DA 2WVJA 2RH9B 3EWSA 5H7XA 2G9QA 2CHEA 5EZ5A 4KL8S 3UAOA 1FU7A 1W1UA 2C4VA 5AKLA 2BFCA 5JANA 1FMFA 4LTDA 2GCPA 4CJXA 3T7JA 3BK2A 1E7MA 3N0RA 3EDMA 3TZLA 1CETA 2IV2X 3L8EA 3W4JA 4I1IA 3MEQA 2X8JB 2TRSB 2OB1A 2Z43A 3DTNA 1U4NA 3U62A 4N1AA 2BFEB 3LY5A 4MA0A 1SQ6A 3UA3A 1G9SA 4QJBA 2GETA 1TJ3A 1X77A 4EHNA 4C05A 3AHCA 3GGCA 1HK7A 2IHKA 4BFWA 2G9NA 1P5JA 1CY6A 2ODBA 4RPLA 3EA4A 2AR7A 1XU4A 2I4RA 1XZBA 4XJTA 2ZWOA 4DQVA 1WUYA 3H13A 4HB2A 5CB4A 3FUTA 2FSSA 1M6VA 2WJVA 1LA2A 3QE9Y 2X0KA 4W8OA 4HP8A 4KLRA 2PKQO 2WUEA 5KNBD 1CKEA 1A3CA 5AVSA 1WVGA 4R7TA 5IASA 1HTTA 2CMGA 3JWHA 2YMMA 2XUDA 3MRXA 4KFTA 4UM9D 5BSRA 3RSCA 3MLBA 1QIEA 2YXEA 2O0KA 3EZXA 1JEJA 1FYXA 4FEGA 4P4GA 2NSLA 3EFOA 3ZXXA 4H2DA 1SUAA 4X1OA 5TQ0A 1GA1A 3T9FA 4EX6A 4AO8A 1PI3A 1JMKC 2A0XA 2CE2X 3N5KA 3KSAC 2ZT5A 2IEDA 2ZI3A 1J2EA 1Z83A 4QTZA 4AG6A 4D4GA 2IHJA 3IB6A 3W8FA 2BI7A 3UGTA 4WVLA 4CLXA 3C1UA 2J7KA 5ICEA 1ACLA 3KELA 3MWEA 3O21A 2N0SA 4KZPA 4QVKA 2QX9A 1V4NA 2ZTVA 4A92A 5I7OA 2O20A 4V2UA 2LCFA 2NYAA 2AG8A 4DXDA 2DEUA 4XW2A 4Q1FA 4ENUA 4HMOA 3C1TA 3KKEA 4MVJF 1YBFA 4X64B 4GC5A 4EHLA 1JYFA 2OCGA 4GDMA 1HE2A 3EE6A 4XASA 5CVEA 4BMNA 4F2WA 4BMSA 2C2ZA 3TJMA 16PKA 1WUTA 3MGAA 1BCRA 2NXCA 1CG6A 1P91A 1X9GA 1JEAA 3L84A 3I1YA 4IHJA 4IQ0A 4QARA 4AJ2A 4P3PA 4DYHA 1LEHA 1L9XA 1WP9A 3LDUA 4DMHA 5C8XA 8ADHA 3NGMA 2RHTA 3OTIA 4ALMA 8AT1A 4I46A 5AT1A 3F6RA 4D8TA 2C2MA 5F4BA 2KLHA 3BZUA 5AM1A 4CMGA 1VLMA 1ONSA 3AF0A 4JGGA 2IYXA 1I10A 4KMRA 3ZY4A 5JEDA 5KSOA 1KP2A 5KO2A 3PZRA 4DHEA 2HA6A 1UQUA 3PWZA 2O1XA 5D2CA 2GFQA 2XZTA 1TRHA 4GU5A 2Y99A 4G5OA 3TWOA 4MV3A 1BZYA 5FP0A 5JIBA 1J1ZA 1ZIPA 1R6AA 1ZSNA 3FCEA 3KIPA 3BYZA 4IJ6A 1XTPA 4PEVA 5AJWA 1HKHA 2GUWA 1TT5B 2VS1A 3I0NA 4OB6A 3UB2A 1YACA 3GGDA 4KQEA 1ZEJA 2SKEA 1SBCA 2WWHA 4DTIA 2W90A 3WLFA 4LQCA 4HNVA 3QF7A 4K9SA 4DIUA 3A4NA 3IO5A 4OATA 3TW8A 1TK3A 1QP7A 5EP2A 3P5BA 3E0QA 3HH8A 1Z0IA 3Q40A 2E5WA 2IGTA 2QBYA 4FE4A 3FWHA 1XVAA 2CWDA 3DMTA 3PT5A 1OYWA 5DI3A 4DNFA 2DQ4A 5JAMA 1WWKA 4YV0A 5H3CA 4FX2A 5JJLA 1ULTA 2D0OB 2G0TA 2ZE6A 2VHQA 3AEYA 4PLZA 4Y30A 4AMYA 3L02A 1Z3CA 4HLCA 1OUMA 4OAOA 3V42A 3GVHA 1NDUA 3TTUA 5KNDA 1SIWA 5BMVB 3DKIA 4UEKA 3E70C 2ODPA 2IOFK 3CPHA 2WG0A 1TUGA 1IY2A 3AVUA 4LBZA 3IGFA 2RJNA 3AKEA 2PFKA 3LUFA 4ITVA 4P5DA 1P2DA 3T1QA 1DXHA 1P7PA 2ZJ8A 2EKPA 1Y5LA 3AVTA 4YRNA 3BQ9A 3T6KA 3UF0A 3IUPA 5DM60 2IIPA 2SKCA 1FQKA 3HMQA 3NQ41 3PLNA 3TDKA 5M34A 2MMGA 2QVZX 2C58A 2G72A 1H2EA 3IPCA 1TIPA 3NUZA 4L9SA 5CDTA 1DDIA 4BKMA 4BO9A 5BSMA 3Q9SA 1QH0A 4U5QA 1DKPA 1AGNA 1M2WA 1OXMA 1YUMA 3DP7A 3ORHA 2P7HA 4WA7A 2I3GA 1I3KA 5FRDA 3CG4A 3PQ3A 3LT1A 4UU1A 3FHOA 1WE2A 2GZ1A 2VZEA 4KO3S 4F3KA 2GHRA 1MU0A 1SPBS 3VNBA 4HBGA 1L4EA 2PMKA 3K70C 3OC0A 4D80A 4EG8A 3X1DA 1CDOA 3KQTA 3AVWA 2FX5A 5T7BA 2RIPA 1J9GA 1SQ5A 4PZ0A 4Q34A 2P6UA 1IWOA 4MR7B 3AF6A 3K0AB 3IT0A 1AURA 5KSZA 4JQOA 1WW8A 2M98A 1VPLA 1UC8A 1YHYA 5KCZA 1R0WA 4K0KB 1PR4A 4OAPA 1A69A 4W5OA 1KH2A 3PBKA 1NX6A 4O25A 4YJGB 5DJ5A 2H00A 3A4VA 4RM2A 2MYUA 4J4BA 2IBSA 3NCHA 4E1BA 4RJLA 5AK4A 2GYWA 4TXNA 2ZR8A 1JI3A 1R9NA 2FG7C 5DXJA 4JSYA 2P91A 4P38A 4IDQA 3PDJA 3I9JA 3W34A 5F51A 4EKIA 3Q1KA 3URMA 2FWJA 5CFOA 1B0AA 2ZETA 2OFXA 1Y1PA 2SBTA 3CR3C 3WIOA 4DLAA 1JQKA 4P4SA 1N0IA 4DR3B 2UUCB 4IDAA 1C30B 2WD7A 3D4OA 2DBRA 4HS4A 1KAGA 4RSRA 2D06A 4W7SA 1MGOA 2HOQA 3BD6A 4LCEA 3LUHA 2C20A 4WN3A 3HB9A 4NPAA 1IONA 4FFNA 3R7WB 3D2AA 1WD5A 2C0QA 3RASA 1KSHA 1AGRA 2QAGB 3ZJUA 1V8BA 3DCYA 5IVHA 2UVPB 2H1CA 3RU2A 4DGSA 1ZYUA 4TKVA 2BONA 2ZITA 2WMOB 4E12A 4O2AB 1H93A 3KHKA 3PC8C 4OM7A 4OLHA 3FLAA 3EARA 3PGXA 4EF4A 5JNWA 2IUUA 1OMOA 3B52X 4LJ7A 3TSOA 1S4QA 3N2KA 3NRCA 2D1RA 2GD1O 4Q47A 3EY4A 1WMAA 2II6A 3UMMA 3ILHA 4TQAA 3C3BA 4CHTA 5KJFA 1CWUA 1W52X 1E1QA 1PZEA 2AGVA 2P0EA 2PUWA 1YJ5A 2O1SA 3GEHA 4XQ0A 5FV7A 3CLSC 2O6LA 4P4NA 2B83A 3IURA 4EJFA 5BSUA 3FJYA 2HWKA 1O9HA 1VLQA 4JROA 1T4MA 3A27A 3BILA 5DHAA 4GZ6A 2H4XA 1UXKA 2CXXA 4ERXA 1E1LA 4QVGA 4D92A 5F1OA 4G1BA 4GMKA 3IKTA 1WKVA 2JS7A 3KAQA 2F90A 3DLBA 4BNZA 1LDNA 3RBZA 1IM8A 2A84A 2PJDA 4M0LA 2CHUA 2ICAA 2V98A 2JIZD 3LF2A 1IK4A 1KJIA 3DKRA 4QBFA 4EG0A 4EK9A 5IF3A 4M0KA 4Q48A 3STYA 4TT8A 4MHTA 2W22A 1JIQA 2C1EA 5ETJA 2G28A 1DC4A 1G5HA 1HZJA 1EA7A 2AI1A 4DEXA 2JD2A 3GFPA 3GVXA 2LD4A 1PYOA 1RYBA 1TK2A 1UJ5A 2DFVA 3CO0S 3HDYA 3MS4A 3VTZA 1UPBA 4DT1A 1H0RA 4ZK6A 4DLXA 1SHLA 3FSJX 4K6CA 2BJHA 3BRWA 3QFFA 1JB1A 2TMYA 3Q12A 5BQPA 2C2WA 3A1UA 4D8VA 4ETNA 2VQSA 5EYPA 3A2LA 2DG2A 4OIMA 1NXPA 4HYYA 5IVKA 1AKYA 4L9WA 1PVVA 3T5DA 1IBRA 1JR3E 5EJ9A 1V6CA 1QVRA 5FIUA 3TOXA 4P92A 4F3TA 1H6CA 4FVTA 2H5JA 3D7RA 1XB2A 4CKBA 1TW3A 3LD9A 1GGKA 2GEUA 4GOJA 4HLUC 4R98A 5TB5A 4KOEC 4M0CA 3U6KA 4UM8B 4EI7A 2PM8A 1MN6A 1Z0KA 1FP7A 1JR2A 4X00A 2QMZA 3RHTA 1UC4B 4X84A 3V7NA 1Y6GA 1KMQA 1TF2A 1XMIA 1Z0FA 4CG0A 1I51A 1U8TA 2Q9CA 2QUHA 2QVXX 3KXPA 3V32A 4IIVA 2O52A 4I1RA 1ZGCA 2SNIE 5DP1A 3R5HA 1OFUA 1PZNA 4FBGA 4GS5A 1MAUA 4YMGA 4TQ9A 3ETNA 1COWA 3F4KA 3FMVA 4XWKA 3SXUB 3X1JA 4ZCQA 4CTMA 3CNLA 3ZE9A 2BH2A 3PE4A 5ICSA 1V39A 3GLFA 5CDHA 3SHFA 2MSLA 1NOIA 1MNAA 1W35A 3WJ1A 3I53A 3O1JC 3QY9A 1IY9A 3L92A 4KCGA 3RIMA 1U0OC 4JUAA 5EE3A 4PGHA 3GT3A 2WTBA 1A27A 1J2RA 3KTAA 5L3RA 5A1TA 2AQIA 3ZHBA 2GXQA 1I2BA 1U1CA 3U19A 4GOOD 4UQOA 1S2OA 4HDCA 4O33A 3CUEF 2ZS7A 4F9EA 1M7HA 3LY9A 2BGNA 4ER6A 2GKSA 1NZFA 1UF9A 1C9NA 1FLAA 1R3UA 2FN3A 3MW8A 4HPWA 5IEJA 1KSJA 4B1FA 3G8YA 1HQDA 1JH8A 2PGOA 4IJUA 1GL6A 2FQQA 2H92A 3DE7X 4R9SA 3IERA 2GCOA 3KKMA 1YVUA 3H2SA 2WTMA 4TLDA 1GCOA 2E18A 4RABA 3BWMA 3S0JA 5KVSA 5KNCA 5LQMA 1XLTC 2HK9A 4BX9A 4DJFC 1P2SA 1G63A 2IFTA 2R4UA 3SPXA 4UOEA 3KVRA 1P44A 4AJ9A 1PRYA 4EGQA 3MRTA 4J2HA 1NAIA 1EJBA 1V8OA 2RAUA 3EW7A 1A5AB 1RBYA 1RYEA 5LLTA 2GAOA 1AUVA 2QZJA 1AKRA 1AXGA 1GAQA 5P8WA 3OCJA 4OXQA 4GDFA 1HG0A 2DYKA 1JLLB 4XWAA 5TPWA 2B30A 4JJGA 5AJUA 2W6MA 3RVKA 2X2FA 4AKGA 1GVHA 2C4NA 4EW3A 5ALVA 3TSCA 2C5GA 4QA9A 3WNQA 3QUSA 4F9TA 4G01B 1YNSA 1Z73A 3L1KA 2PBRA 1ZC3A 4M9UA 1HDEA 3CEMA 3H2YA 1CR6A 2Y2UA 3HP1A 4DDWA 1AZTA 1SQ0A 2IELA 2NPIA 2OZPA 2HHLA 3FJOA 4IR7A 2HD4A 4YI5A 5K8CA 3SKVA 2IPOA 4MPJA 3L6RA 4PSDA 5G0TA 3W9BA 1U04A 5KNCH 1OYVA 1GNPA 1YU6A 2OC9A 3HR8A 4FFDA 3T7KA 3G85A 4H0FA 3ONDA 1QAMA 2JFVA 1HTBA 1ML4A 3WNBA 1L6IA 3TPZA 1M5TA 1D8AA 1T8WA 3ZGLA 3ZXSA 2QI9C 2JZOA 3QTBA 3RYCA 5EMMA 1QKKA 3V46A 4YAEA 2CVFA 2PLWA 2Y1CA 1C3OA 1UIRA 3AFHA 3KP1A 4QUKA 4HT3B 5ALHA 4K6HA 1YR3A 2H1HA 3TX6A 3VZRA 3HJAA 3PL5A 5TSDA 1DAKA 1TEXA 4A4DA 5KYWB 2O0MA 2EDCA 1M34E 4UVGA 1ZMXA 3RRNA 3QA3E 4IRUB 4EB8A 1XWIA 3FHLA 4ODIA 2V03A 3G5UA 1N0UA 1C4XA 5EJMA 1YS6A 3DMNA 4YAFA 2Q0QA 4HXGA 1GM5A 1MO4A 4DQDA 1M1ZA 4UOZA 5JCJD 3ZGZA 3ZNPA 3KWJA 3NOXA 2ZB4A 5L3ZA 2ZBVA 1WV1A 3Q41A 1MABB 2APJA 2JGDB 4QYMA 5CPFA 1WPGA 3KPUA 1LPNA 3NV9A 4TTTS 1QXSA 4Q3NA 4DW8A 1VYVA 1MO3A 1Y9AA 1ZD1A 1E0JA 1JHXA 1P3JA 4MPDA 2QUIA 1KZYC 2PYZA 5FF9A 1EK2A 2AFIA 2I2XB 1DEXA 1UMBA 2X0EA 4ALIA 2P3LA 4ZQBA 2VQEB 3G7SA 4DYDA 2WWXA 3AG5A 3ZQJA 1VJGA 4YRDA 4TT3A 2GBLC 3LQKA 1LPBB 3G5LA 3I62A 3AUXA 4KQJA 5KJ6A 4TRJA 2W2TA 4TRMA 1Z4NA 5HEKA 1RHKA 1E6EA 2PRYA 2AWNA 2Z83A 3AVOA 4NS1A 4ZVPA 3SJZA 3A1CA 5GVSA 4KPGA 4CTJA 1Q0SA 1BWPA 2QU7A 3DQQA 3L5OA 1X87A 2GF0A 2WHEA 1I1QB 1D4ZA 3UW1A 4R71A 5BXYA 4JUFA 5I48A 3AHJA 4JJAA 4DB4A 1Z13A 1NZJA 3RC7A 2I76A 4RMNA 4YPOA 4X20A 3WRVA 1B6RA 4W5TA 4ZC8A 1JBEA 2KJQA 1ISRA 4V1CA 5KQRA 1IZYA 4RV4A 3L8GA 3CX7A 3F74A 5HZHA 1VHDA 2G1AA 3DPSA 1ZXLA 3KYIB 4X1KA 3RFUA 5B4VA 3C6YA 4MWBA 1HC7A 5M5BA 1FW8A 4HNQA 1K5DA 5J1SB 3RC9A 4ND8B 1EXWA 1SUWA 3SZLA 3RHFA 3OLZA 1S02A 2ZUVA 3RV4A 3IHTA 1F9AA 1X7WB 4GBJA 1KXZA 2EFGA 4GUAA 3AWIA 1IFXA 2D2FA 3TQIA 4BQIA 4FEAA 4C7OB 3MINB 3R7LA 4KXMA 5H3LA 5F21A 3CSUA 5AIBA 1EP9A 1UINA 3KTDA 3V4SA 2WKWA 4IYRA 4L6CA 1MAWA 1X38A 3GELA 3BOSA 3PGLA 1P5FA 1U1IA 2P40A 4A2WA 1OHHD 4KTVE 5A6SA 1SG9A 3ORYA 2Q5HA 1FIUA 2O5EA 2KW5A 5TDHA 4CUKA 3OPXA 2QROA 1UT6A 4ZHSA 2YIMA 1RQXA 1B6SA 5IAKA 5EE0A 3FGPA 4WOPA 3ND9A 5E7IA 3QMVA 5A9SB 1N6KA 2OLKA 4L76A 1RRGA 1NVFA 3FNEA 1CUJA 3ZDAA 4PAQA 4MV9A 1GRVA 4RIGA 3VKVA 1NJ5A 2PKQP 1UDWA 3KJZA 3HYNA 4TV9A 4XM2A 3VMFA 4OFXA 4DV4B 4JJEA 2VBCA 4QNRA 1UFRA 2QM7A 3RQIA 2C9MA 2VWGA 4ZYYA 2CLDX 4FCTA 2W6JA 1QR2A 4LI0A 3V2HA 2W0MA 3R7BA 3G1UA 3OF3A 4G5FA 3P20A 3L7YA 5F9MA 2YFYA 1U1DA 4CM4A 2WG2A 1QGUA 2TS1A 1JF8A 4CKWA 1P39A 1OLXA 2ZATA 5AJZA 5C53B 3WRYA 4PHFA 1NQAO 3GJ7A 4YGXB 3A2NA 1H8ED 2ZUTA 2H9AA 4HQFA 1T5TA 5FOVA 2XZLA 1VMEA 4YR7A 1N4AA 2HL6A 3BDVA 3ANLA 4BNIA 4CCSA 1C7QA 4BXOB 3PUJA 3QIAA 1WEKA 3THSA 4ARCA 3IESA 4PRKA 3S2EA 4LHVA 3JASB 2JBWA 1ECGA 1DKQA 4HRXA 4DREA 4EWLA 3BB4A 4IWXA 3S2YA 1L4HA 1NU8A 3ZR4B 5K4GA 1BX3A 3FRHA 5K5EA 3NC0C 3L46A 1DINA 1M3SA 2ETXA 2R66A 3KSZO