1PHRA

The crystal structure of a low molecular phosphotyrosine protein phosphatase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
154
structure length
154
Chain Sequence
VTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LOW MOLECULAR WEIGHT PHOSPHOTYROSINE PROTEIN PHOSPHATASE
publication title The crystal structure of a low-molecular-weight phosphotyrosine protein phosphatase.
pubmed doi rcsb
molecule tags Phosphotyrosine protein phosphatase
total genus 61
structure length 154
sequence length 154
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1994-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1phrA00
4MS4A 2QZJA 4IMIB 3UKJA 3VNAA 5IEJA 3BREA 1USIA 3OO0A 5EWLB 1K66A 1YVUA 5EWMB 3A0RB 3GYBA 3HO1A 3DGFC 1C4WA 3E61A 4W5TA 2HQBA 3MM4A 4Z9AA 3GRCA 1PEAA 3EDCA 4RK7A 4YO7A 3ILHA 4Z4FA 4RXMA 2F8SA 1VLZA 4H3HB 2MYUA 4JB0A 1RZRD 4YP9A 4ZYLA 2LPMA 3OM1A 4WXMA 2R47A 2ZWMA 5CNKA 4F11A 3H5OA 2R4QA 1M2FA 4EVRA 3HK2A 4LDAA 5EWMA 3KHTA 3LUDA 3JPYA 1ZGZA 4Q6BA 1ZHHA 2E4UA 4QYMA 5DGCA 3CTPA 1ZH4A 1MIHA 5TQ2B 2J48A 2A9RA 4OG2A 5KWSA 3CZ5A 1I3CA 1E6LA 1ISSA 3CRNA 4HNRA 5DTEA 3BRSA 3DBIA 3H6HA 2H0AA 2FXIA 3LOPA 4GPAA 4MR9A 3OQOA 4WZZA 2JK1A 3ROFA 1VKRA 4O5AA 2FQYA 2E4XA 3F7NA 1DG9A 3HDGA 4YV7A 2FLWA 2LP4Y 1PUXA 4IGAA 4Z4CA 5TQ2A 1AB5A 2YHAA 1YK1A 1KMIY 5IC5A 1Z2EA 3H75A 1RZRA 5DCLA 1D2AA 1JX6A 4PEVA 4NCBA 4QICA 1ZH2A 1DBQA 3CS3A 4PYRA 5C5EA 3QX8A 1Z16A 2PKXA 1YK0A 4S04A 2MSKA 1RNLA 3GWGA 3S99A 1QQBA 1C0EA 3GL9A 3GBVA 2NT4A 4MS1A 5PNTA 3SY8A 3H1FA 3KJXA 3A10A 2JCGA 3JPWA 2NZUG 4RK0A 4KZKA 1ABFA 3IPCA 3LUFA 4OLAA 4KMRA 4TMYA 4Z9BA 3H6GA 5B3JA 1NXSA 3H5TA 3HXMA 1SD5A 2QVCA 4LE0A 1JH9A 2XDYA 5I4CA 3H1GA 4RK1A 4Z4GA 3CFYA 3OO1A 1MVOA 2A9QA 2FMFA 1Z13A 1M5TA 1J56A 2FQXA 2FMHA 1QPZA 4G0QA 5EWJB 2FVYA 1IIBA 4MS3B 2PUEA 1D1PA 2I6FA 3HV2A 2AYZA 3HM9A 4UHKA 2PUBA 4N03A 1NXTA 3CNBA 3N53A 3TB6A 3N8IA 1JBEA 1M5UA 3FFTA 8ABPA 2PE5A 1QNLA 4KK3A 4JA2A 1DZ3A 1VPWA 4MQEB 4RY9A 2RGYA 3G1WA 2QVGA 3HUTA 1NXXA 2JVIA 3HJFA 1R8JA 1UDRA 1VRVA 4MS3A 5JNTA 4P1ZA 2OQRA 4HNSA 3QK7A 1P2FA 3G85A 1DC8A 4E7OA 5BR1A 3MF4A 4HYEA 4RK6A 5F64A 3JS5A 6ABPA 4Z99A 1U0SY 1TJYA 2PAFA 4MQEA 2PUFA 4LE2A 1CYEA 1HEYA 4D74A 3N0RA 2Q5CA 5FWYB 3CHYA 3KLNA 3N0XA 1BDIA 3RVJA 4G0OA 4PZ0A 3D8UA 4G0ZA 4YGXB 5KQLA 3RVOA 2NUBA 2ID7A 2A9PA 2MYTA 5T7BA 5TQJA 5T3YA 3BILA 3MIZA 4YLEA 2P4UA 1YTUA 3UUGA 1QP7A 3LKBA 4B09A 1TLFA 3RVPA 1QKKA 2RDMA 5IUJC 1BVHA 1L5ZA 4RSMA 5TQ0A 5FWYA 4KFCA 3JY6A 3I42A 4GNRA 1E6MA 4MRMA 3RVKA 3OMWA 3TD9A 1GLGA 3C97A 1U2QA 3QEMB 2GKGA 2E4YA 2FN8A 1PNTA 2FW0A 3EGCA 3KYJB 3T8YA 1A0OA 4G0YA 1NXVA 1MB0A 1ZGGA 1OXBB 1YIOA 2JBAB 3C3WA 5IEBA 3T6KA 5ABPA 1NXWA 1GUBA 1NY5A 4O1HA 1XWWA 2AYXA 4XXHA 3SAJA 5KI6A 4W5RA 7ABPA 5KQPA 5EWLA 2LUOA 1W9HA 2DRIA 1DBPA 4ZMRA 3LKVA 1TMYA 5FBKA 3LMKA 3SNKA 1BDHA 4RS3A 1DP4A 1ZAYA 4IRXA 4H3KB 5D2CA 3A0UA 3ROTA 3DGEC 1EWTA 4EUKA 1FFWA 3CKMA 3H5IA 3H5VA 1E6KA 2ZAYA 1QO0D 3O2SB 4JB2A 3KCNA 3KS9A 3HCWA 1F4VA 4Q7EA 3C3KA 1DC7A 2A9OA 3RVNA 3GBPA 4XARA 1JYEA 1DRKA 2FEWB 4RKQA 3OLVA 2IPAB 3Q15C 4LX8A 5IX8A 4OBBA 2WRZA 2CWDA 3RVSA 5JS1A 2V0NA 9ABPA 3O74A 3OQMA 2JRLA 5ED4A 2PL9A 1D5WA 3OM0A 3UK0A 3D02A 3HDVA 4MLCA 3QELB 3QLUC 5JNUA 2NT3A 2PLNA 3LUGA 3MA0A 1EFAA 1BDJA 2FEKA 1F51E 3RH0A 4WXEA 1CHNA 1LK0A 2HSGA 1JDNA 3I5AA 4W5QA 3GV0A 1Z18A 1KGSA 1TVMA 4YWHA 3HSYA 2PUAA 4MR7B 1KRWA 4ZJPA 4ETNA 1Z15A 5DLEA 3SG0A 4PE5B 3M6MD 3QELA 3EAFA 3L49A 3DLHA 3CG4A 4KRFA 1PHRA 5JNSA 2R25B 3O1HB 2N9UA 1U8TA 4M88A 4NV3A 4TLLB 2IYNA 3K4HA 4KK4A 4YRZA 2WJWA 4LE1A 3QLVC 4S05A 2MYPA 4RV5A 3O21A 3F73A 1DCKA 3EULA 2L18A 3KTOA 3KG2A 4HNQA 1LJUA 2WWVD 2QW1A 3EQ2A 4RDCA 1M2EA 4W5NA 2GBPA 3NHZA 2ID9A 2M1ZA 4Z4EA 1ISRA 1USGA 3Q7SA 3HVRA 4N0PA 4JP1A 5KC9A 2WY2D 3RVLA 2CHEA 5IBQA 4E7PA 4LZLA 3R0JA 4NCAA 1ZN2A 3NNSA 4MQFB 1PNRA 3DLBA 2FTKE 3Q41A 4TN5A 3NHMA 2RJNA 1JL3A 1Y1LA 1GUDA 3CZCA 5EWJA 3LUHA 5KC8A 1APBA 5GOTA 3LUJA 4F06A 1DBWA 4EYOA 3T38A 2WJAA 4IMJB 3FDFA 3Q9SA 4EYGA 4MGEA 3IP5A 5CNMA 5GQSA 4JOQA 2B4AA 3E3MA 5TPWB 4MQFA 2QV0A 3B2NA 1OXKB 4QYWA 5HM6A 5KQMA 1QQAA 4Z4HA 3M9XA 1LBIA 1AB6A 4KPYA 4RY8A 3FMVA 1SXIA 2QR3A 2JB9A 3OLYA 5HSGA 4N41A 4DQDA 3KYIB 2HJ9A 5TPZD 1U2PA 2VUIB 4ZPJA 4EYKA 2IOYA 5IUKC 4MPTA 5CNJA 4KVFA 4L4UA 1MAVA 1BAPA 1EHCA 3NNNA 3JTEA 3LTEA 2VUHB 4MRMB 4MAAA 3RVQA 2GI4A 4MS4B 4MR8B 1NXOA 2QSJA 1GCAA 1LBHA 5JNRA 3H1EA 4ETMA 1P6UA 1XHFA 2O20A 4IF4A 4OATA 2QXYA 1ABEA 1B00A 4EVSA 1ZESA 2FMIA 1K68A 4TLMB 4RU1A 3O75A 4WUTA 4DADA 4RK5A 3GA5A 1ZITA 3LFTA 3CLKA 2FSPA 3MYYA 2FN9A 2H3HA 3P9YA 4QPJC 4RZSA 3JVDA 4MR8A 3KSMA 4MYRA 4XASA 3EQZA 1Z26A 4XAQA 3RQIA 5TPZA 5JS2A 1EWKA 3FFWA 2L19A 3OMXA 2GWRA 3QEMA 4JASB 2QU7A 4KQ9A 3HS3A 4O1IA 3I09A 4G0PA 1FFGA 3BRQA 1S8NA 4ZMSA 1RPJA 2JBAA 1D1QA 1W25A 3N6VA 1DJMA 1L5YA 4FE4A 1Z25A 1FSPA 4N47A 1QMPA 5B3JC 5C5CA 3RVMA 1JHZA 2E4ZA 2PUCA 4MR9B 3C3MA 4EY3A 4EVQA 5DKFA 1JFTA 4JAVC 5BRJA 3MQ4A 2R48A 2IPLA 2CHFA 2P9HA 5BQ3A 1USKA 5FWXB 3RVRA 4YS6A 4RKRA 1JF8A 1TM2A 3Q7RA 1JLKA 1JFVA 3EODA 2HQOA 2YHBA 5JNWA 3H5LA 3QEKA 3O2JA 2FMKA 1EWVA 4Z0NA 3O1IC 1YS6A 2FLKA 1DCMA 3URMA 2MSWA 1SRRA 1YS7A 2WB4A 3FGZA 3IP6A 3KLOA 3MMNA 4XLTA 5E3JA 3TX6A 1YMUA 3K9CA 3QLTA 4OTZA 5CHYA 3VNBA 5FWXA 3TO5A 3DZDA 1WETA 2MSLA 1QO0A 4MS1B 3OLXA 2VK2A 3FFXA 4LDZA 3A3KA 4Q6WA 1U04A 4CBVA 3IP9A 3N75A 3F6CA 2IKSA 2CD7A 1QP4A 5IULC 2LBPA 2E4VA 4G0MA 3IDOA 1NATA 2PMCA 1ZDMA 2RJOA 3EJWA 5HKOA 4RXUA 3F6PA 2PUGA 3CU5A 2IPNA 3O2QB 4UHJA 2WMYA 4G97A 3TMYA 4DN6A 2FQWA 4MR7A 5HQJA 1XHEA 2B1JA 4LRQA 3OLZA 1Z2DA 1P6QA 4G86A 4L85A 5BRAA 1MB3A 2HPHA 4OLBA 1FQWA 3HZHA 2M98A 1FFSA 1QP0A 3IP7A 3HUUA 1A04A 2OENG 3SM9A 4EYQA 1BA2A 3BBLA 5TE9A 3OLWA 4F8JA 4NICA 4EGSA 2FKAA 3IPAA 2TMYA 2IDMA 4RK4A 1H9CA 1JFSA 3L6UA 3Q7TA 3NNDA 4H60A 1JDPA 3CG0A 4IILA 1KRXA 1DRJA 1NXPA 3LUAA 4Y9TA 4YR7A 3GT7A 1ZY2A 3QLUA 3QX9A 2E4WA 1CEYA 4YCSA 3NBMA 3I45A 1EAYA 2W42A 2IPMA 3M9WA 3N0WA 1YMVA 2GX6A 2NZVG 2PJUA 4RWEA 4P98A 5FBHA 4WWHA 1RXIA 1LJLA 3JVIA 4RY0A 4F12A 1NTRA 5IUNC 4W5OA 4KNYA 2X7XA 3ILYA 3HEBA 2JVJA 4KQCA 2L17A 2KYRA 3T95A 4G0XA 5JNVA 3C6QA 4N76A 1GCGA 4Z4IA 4XFKA 3KKEA 2JVKA 1Z12A 1SXGA 4FB4A 3O1JC 5KQGA 1DCFA 5TPWA 2F8TA 3QLVA 3SQNA 4ETIA 3W9SA 6CHYA 1P8AA 1Z17A 2PUDA 1D4ZA 5CNIA 4D6YA 1SXHA 3LUKA 4ML3A 2FEPA 1URPA 4MLDA 5TQ0B 4RXTA 4D6XA 4F3TA 2PL1A 4NQRA 2BGGA 1ZVVA 4PICA 4WT7A 3LUCA 1JWLA 1RXEA 1E2BA 2LIVA 2HQRA 2VYCA 1T34A 4KV7A 1A2OA 3H5WA 4N0QA 4KREA 4FE7A 2L2QA 3OQNA 1PEYA 2MYNA 1JYFA
chains in the Genus database with same CATH superfamily
2WWFA 4MS4A 1E5TA 3WGNA 3IX7A 4NBKA 2W71A 4Z8YA 3WGGA 4ARZB 4RCZA 3PL1A 1U81A 1PT5A 4JELA 3GRUA 1W87A 4DBVO 3BERA 4RS4A 3JZMA 1M6WA 2AXNA 2B8JA 3MM4A 3ILSA 3DJYA 4RK7A 1TAHA 2WFMA 1DX6A 2PR2A 1DIBA 2PDAA 3N07A 4XM1A 1Z4OA 4YO7A 2WJYA 2ZZMA 4DLSA 1WS6A 3VVMA 2Z6VA 2P5UA 4IIFA 1UBEA 1KK3A 1YASA 3DMRA 1XDUA 1TCUA 3FSRA 5A62A 1O4WA 1F8FA 2QUZA 1EUDA 4OU5A 1N2IA 1QGYA 1ZNWA 4U2KA 1JHUA 2MR5A 4GO1A 4WGFA 3RYHA 4CLEA 2W2TA 4QYMA 1ZJZA 3DLCA 3SX0A 3V4SA 4BX9A 4I1PA 4DDMA 1H2XA 1KJ8A 2EFEB 4JVLA 2C94A 2VBGA 4UHFA 4ZAZA 4ZIRA 1GNQA 1RJFA 1P3DA 3PDCA 821PA 1EEXB 4HAVA 3TZHA 1QCCA 5D1HA 3SDSA 4XWAA 1TRHA 3AONB 2ZJ4A 1XP5A 5EZYA 1RYYA 2CXTA 1T8WA 2EKPA 1CJCA 2OT3B 3I37X 1ODJA 4JBIA 4IIGA 4LBVA 1V95A 3KWFA 3T5CA 4DCGA 5LBUA 1P9WA 3GAZA 2I0FA 3S0JA 1NSTA 4LOLA 4MUMA 2QU8A 4IXMA 4G5XA 4PLGA 5T4HA 4YRRA 4ENQA 3F74A 1DTEA 3PDUA 4Q7MB 1MAHA 2ZIEA 2IU3A 1PQ4A 1NBEA 2PUHA 1KFKB 2AQ8A 4G26A 3UMGA 3FAZA 2ACEA 3IPYA 5FWAA 2O19A 2FRXA 5LDDC 3LCRA 4YRQA 1GRQA 1L5RA 3FZNA 4RELA 4D6PA 1N77A 2KB0A 2WHQA 3HB7A 1N6OA 1YK0A 3O4IA 3VTKA 2CCGA 3ROEA 4B87A 3ROZA 4ZRNA 4Q7KA 1OR8A 5FP0A 5BV1A 1V7ZA 4PYNA 3OQBA 1ODLA 4H35A 1VDMA 2XPCA 1XDDA 1EFRA 5T8KA 4RIFA 2B5WA 1XZFA 3WMRA 4US2R 3BBPA 1UQRA 3L0IB 1IN5A 3BJIC 3GCZA 1VC2A 3IQDB 3KEOA 4OQEA 1UKVY 4MZDA 2QORA 2E0IA 2E1RA 1TNDA 4TMYA 4TQGA 4CKBB 2Q6IA 2QZ4A 4JQSA 3RHTA 1DIOB 5CCXA 5I4CA 5H82A 3IE0A 3IIJA 4RK1A 1I6WA 1KI3A 2PCJA 3TCXB 3GZNB 4K3VA 1MVOA 2ZT5A 3M2TA 4H7JA 4EGFA 3KSAC 4Q48A 3ZHYA 3I28A 4KTTE 2EKDA 1WCIB 1GZSA 1LVUA 2O5EA 1NLZA 3OVMA 1I2DA 3O95A 2KX7A 1QPZA 1KOJA 2EWWA 1BQEA 2ZS8A 4MW1A 4U6SA 2EBFX 3SMQA 1K6MA 3PC8C 2JFQA 4HNGA 4OI2A 2IUUA 3IAUA 1SOWA 3SQDA 2PUBA 1XYVA 1U0BB 3FNFA 2PZLA 3ZLTA 4KK3A 1SA0A 5K3EA 5LP6A 1DZ3A 1YHNA 4OQLA 3L8HA 4CZ2A 3HUTA 2ZBDA 2N0SA 4CMAA 1D6MA 4UJ5A 1PYGA 1XT6A 2QSYA 2D7CA 3PGXA 3EPRA 1DKQA 4GLOA 4B2IA 5AHKA 4E94A 1JB9A 3K0CA 2HJGA 4G5OA 4HDSB 4PLTA 4D9IA 1U2TA 2PXXA 1EAMA 3AUSA 3H17A 2DQ4A 2QTAA 4FCVA 1D0VA 1ZM4A 2PKEA 4O4LA 3STHA 3ZTTA 3ZCUA 2B8NA 4PG6A 1N1EA 3KTFA 2JDID 3KZOA 3G85A 2IOQA 4OO3A 1DC8A 2D1QA 4E7OA 4EL5A 2FMTA 3MF4A 4TKMA 2NXWA 1XCPA 2AJDA 4ALNA 2VKQA 4BBAA 1P5JA 2WAOA 4MQEA 1TO6A 3CE9A 2GPSA 1K7SN 2HMTA 1V11B 3LYLA 3OWOA 2WIJA 3EWNA 4GE0A 4P3KA 4X6YA 1PKXA 4QSHA 5D6OA 5A2QA 2CV0A 4WVFA 1PN3A 4OXXA 3IL2A 1KPHA 2OV1A 3BE8A 1PR2A 3G2PA 1PV2A 2NQ2C 1T5SA 3ID6C 5BN5B 1P81A 3BXEA 4LXYA 3P9ZA 2PMDA 4XEUA 2JKZA 2I78A 3K31A 3OJFA 4I1RA 4YJ3A 2H1LA 2ZSFA 3P4XA 5AJVB 1CLEA 3K9FC 3QJGA 4LJAA 4WMLA 2Y1DA 1KYZA 4YDHB 5CX4A 5HJ2A 4CRWB 1M1YE 3AXTA 3GFBA 2WUDA 2OYRA 1Q83A 1QP8A 4IFIA 5EQDA 2HNKA 2PX0A 1OV4A 2I67A 1Z0JA 4TUYF 3TPFA 4FPXA 4AVYA 1KR2A 3EXHC 2FPIB 1USVA 1EM8B 2GKGA 4PIMA 2EIHA 4HO1X 2AJTA 2R62A 2P9GA 3OM9A 2ZANA 4N8SA 3O31A 1JIIA 4EGAA 1E1QA 1BE0A 1T2VA 1SCAA 2OXFA 1NP3A 4FWTA 1MAUA 3JSAA 4O1HA 1Z5WA 1WF3A 2BM1A 1UMBA 5IAAA 1B0PA 2YMQA 5AICA 4ARZA 1QHFA 4D3DA 1LTQA 4P53A 4XA8A 2P5TB 1ZBQA 2J6HA 2QJOA 5CLGA 1GM5A 3DEAA 4HVLA 4OGKA 3CC8A 3MJEA 3MTEA 3NONA 5IVHA 2Q3HA 3FVVA 3TH5A 2QW8A 2X86A 2NSHA 1UEIA 1RDFA 1UDAA 3JYQA 4I9GA 3BAFA 4LSZA 1AIPA 4RS3A 2YJ6A 3SNKA 4Q4JA 4XCVA 5KYUA 4XCQA 2JEOA 1ECGA 1N2SA 2ZTHA 3DGEC 4J94A 3IJ5A 1JPVA 3CKMA 2VP5A 3ND5A 3AMVA 3CUSA 3DEYX 2HSEA 2V59A 1O6ZA 3IDSA 1SFRA 2FZCA 3E58A 3M1AA 4N01A 2E21A 2FFRA 3L8EA 1I7LA 4B3MB 4REMA 3GBPA 2X7HA 3GCDA 4X8MA 1YR2A 4P33A 1GRNA 4LJ9A 4D9MA 1QB7A 3PHCA 1XZJA 2OV3A 3G13A 3C48A 4DLPA 5J5CA 3T7RA 2ZT7A 3LFUA 3OBBA 3FIUA 4BE7B 3NDPA 2R1TB 1FP6A 3V1TC 1XZHA 3D02A 4K9DA 1Z83A 4CMBA 2VCHA 4FI3C 3AHCA 4MKXA 4ZVNA 4Y2XA 3T3OA 3BMOB 1HE4A 3HYRA 3OZCA 4X84A 2JFNA 2VRCA 3KDPA 4EO9A 4IV5A 1VMIA 2AFVA 2H08A 2QZZA 3E9CA 5AVWA 3RH0A 1SUIA 4HN9A 4IZOA 2REXB 2X22A 1YQEA 1EVIA 2I1VB 1E2NA 2QSUA 2IL1A 3GV0A 3D8HA 4NC9A 5AP9A 5HKKA 2FE4A 2Z08A 3O84A 5DXFA 5FBRB 4BXOA 4CDGA 1U2DA 4UU8A 2YIJA 1UM9B 2JCYA 2RGDA 4AJHA 2SNIE 4JXZA 2O4CA 1CUIA 1I32A 1SURA 2XDWA 4MMXB 4ZODA 4R8RA 1QR2A 4JC0A 4JMPA 1CJMA 2A9FA 2HBZA 1B0AA 1PVDA 1XO1A 2PWZA 1BD3A 1F48A 2QUHA 3P7MA 4J75A 1B4DA 4XLZA 5AXCA 4YHHB 1IRXA 4KK4A 2J4DA 3IOMA 1IN7A 4S05A 2QVBA 4ZQHA 4PLFA 1Z37A 1PT6A 3M6IA 1A71A 4B74A 4CM1A 1NRWA 2I3ZA 2M1XA 4RWZA 5IBRA 3DMNA 2DFVA 3AKEA 3IVRA 3NHZA 5AK3A 3R24A 1P0CA 5BYJA 3SXPA 2HEGA 4B45A 1VSQA 2AK2A 1Z0IA 1BX1A 4PTZA 5CFNA 1H23A 1V9SA 2ZROA 3I8OA 1SCQA 4HYTA 3O38A 4LTDA 2BJWA 5KVQA 2ECKA 2CKMA 1MP0A 5C46F 3ZDZB 1QGUB 1US8B 1TCCA 3FKSD 4JWTA 5K09A 2FTKE 1U2GA 5SYAA 1XVUA 4DSOA 4OHUA 1P0QA 4DLWA 1OFUX 1BEZA 2I4TA 1RVV1 3N5CA 3NT4A 3OG9A 2X0FA 1MO3A 3T7JA 3ZBUA 2DCUA 1GTG1 5IZ4A 1XNQB 4F97A 2LRHA 3O90A 4HWRA 4KACA 2B4QA 2ZDHA 1GGKA 1JQDA 4I9HA 4I4TF 2BW0A 1CR4A 5K20A 4JLUA 2VJAA 1Z2NX 4LY9A 1KYVA 5KAPA 1NN5A 4L9RA 3CXUA 5DN6A 5TV2A 1Q1QA 3GGOA 4D4KA 4O4JA 2OB2A 1AB6A 3KR0A 2HUPA 3EIQA 1T9GS 2HAEA 1T3LA 3FMPB 3QXSA 4HDSA 4R1MA 5ECWA 1EE2A 4KN8A 1A82A 1QYIA 4NU8X 4X5OA 4JJEA 3SJBA 2OFFA 1Q2XA 5EOVA 1JIQA 4BNZA 1HE8B 4G8JA 3DM9B 1J2RA 1H6BA 2H9IA 3H1PA 3PWZA 3K1YA 3QWFA 1I4LD 1N34B 2VSQA 4W82A 3VTFA 4F4CA 4F84A 2PL5A 3ORRA 2GAJA 3GLIB 3IVCA 4KN9S 1UK8A 5G0VA 1V11A 2ZCVA 1GOTA 3EPPA 2RGWA 3MCVA 3OIFA 1HY3A 3SYTA 4DSAA 4BOYA 4KE6A 4QQRA 4BU0A 3ZD6A 2OCAA 3IBSA 1TQ8A 4GC5A 1QJCA 1Z8DA 4KMMA 3T9EA 2WYUA 1ABBA 1CULC 3AC0A 3T5DA 3DHNA 3HDHA 1VSUA 5BN5A 4JR0A 1UK9A 5JAUA 4Z2AA 1JA9A 3EA0A 4WXPA 4WUTA 1FUEA 2PX2A 1JG3A 4E1BA 3MERA 1KJZA 2FPOA 1FJHA 3JVDA 5A5VA 4MR8A 4HDMB 3W4KA 5K8VA 2XZLA 5COAA 3U26A 4NPAA 5LU8A 3Q11A 3TZLA 1ZHOA 2ISSD 2EL7A 2FPIA 3N8GA 4LJ4A 1JNYA 2GD1O 2ZJAA 1R1DA 5H81A 4KB5A 1V2HE 4XDZA 4WPGA 3LQ2A 4GQBA 5B6JA 3TG8A 2YQ4A 3B6IA 1HYEA 2I76A 2QX4A 2C95A 1L5KA 4EHAA 3N6VA 2X8BA 4D3YA 4ZO4A 2IYRA 2LTAA 4R1NA 3W8FA 1MABB 4RTNA 1Z25A 1DJMA 4HCJA 5E1BA 4JGIA 4B7XA 5TVGA 1ULTA 2GF0A 4ARIA 1WCWA 5C5CA 5F12A 2PSJA 3TOZA 1E6WA 4DEYA 2OWDA 2O8FB 4I5IA 3RWMB 3U4DA 4EY4A 2VTBA 3D4BA 3FI0A 3FHTA 2R48A 4CKYA 2KMLA 3H4IA 4WCDA 2FPKA 4E5PA 2PFKA 5AKIA 3FRIA 4MVJH 4Q3AA 2FPSA 4PG4A 1C9JA 3QKRB 5BXYA 3CH4B 5JO9A 3OCCA 1XX6A 5DHQA 4YXFA 1FP4B 1WPGA 3AFMA 3PNYA 2WE8A 2CZCA 4HLQB 4UDXX 5IRCD 2NXEA 1SBNE 1CFZA 1IHUA 3AEYA 5LQJA 3FUVA 1RI5A 1GPWB 5D3ZA 4OGGA 4PNPA 4NBRA 3LBIA 2BDUA 2F1KA 2V7WA 3CLSC 2G4LA 3MFQA 4N9WA 1KP9A 1UJ4A 4JQYA 2J46A 2YY7A 4XSGA 3R75A 3IJRA 4OI1A 3A3KA 4GMHA 3HU2A 4WFKA 3NHFA 4YB8A 1XTRA 5AI5A 3BMOA 4MDHA 3EPLA 2H1VA 2N1BA 4TSRA 1GQFA 1DAEA 4LHWA 4OHFA 3P9NA 4ISBA 1H85A 3R74A 3EIHA 4HLDA 5KVCA 4BQOA 2A0YA 4K6OA 1S3IA 3VU8A 5A4JA 2YUIA 4W9RA 1J70A 3NETA 5AJYA 4EFNA 4EY7A 1I4WA 2WT8A 2MOKA 3EA5A 2VZ9A 2COEA 4IEEA 4HRAA 3WV4A 1JG7A 2Z4SA 3FPLA 1A7JA 2A2ZA 1LVHA 1UM9A 4TVOA 1W19A 5ECDA 5H83A 4JT8A 1I4OA 2CDAA 3KQWA 4QFBA 3W9BA 3STYA 3JR3A 1HH4A 3WDLA 1JR3E 4RZHA 2QMUA 3RDPA 5GJVC 3WRYC 3HXQA 3C4JA 3M4NA 3CM0A 3AVPA 2EFCB 4PYOA 4R0VA 3L4BC 1TAUA 3ELUA 4F8JA 3TPCA 4E32A 3ZOKA 3N3BC 1ZRHA 1DKNA 5FUWA 3TDNA 1TLLA 1JYSA 1ZH0A 5D85A 1T2DA 2WU0A 1JP7A 2ZJ7A 3H9QA 4TLEA 3ZG6A 4MXDA 4DHWA 3VPDA 4OHBA 4Y9TA 3RSCA 3VKHA 4LF7B 2JZOA 3B6JA 5KVVA 1KWKA 1NSYA 2CHQA 4YLYA 2G06A 4KR2A 2ZRPA 5EPOA 2P2YA 1LNSA 3HJHA 1ZVJA 4BAGA 2Y6VA 3K30A 4GQIA 1H2RS 2X3FA 1QGUA 1US8A 3AEZA 5DRYA 4BNYA 3KLPX 1KIAA 2KPOA 4F12A 4HT3B 3GRFA 3ILYA 2VP6A 3IB6A 3W5DA 2V6GA 1G41A 4I9UA 4JR2A 4U0KA 3T7CA 2ZT8A 2ZZKA 4I4CA 1R0WA 1JEAA 1CUGA 3KHSA 5AVKA 3I9KA 2R8ZA 3WWPA 3ETEA 4L1KA 3C6QA 1U0JA 5AOCA 4FCWA 2GN1A 4IR7A 1T4DA 1FTNA 3TNJA 1NPTO 5U1PA 1W75A 2JVKA 3IFSA 1P7PA 1RLUA 5A7GA 3SBDA 1FSFA 1GGJA 2XNHA 1D6NA 1D07A 4PANA 1CJSA 4ALJA 3R6GA 1U1CA 1N0UA 1K08A 3JWEA 3MWGA 2QI9F 1IM5A 3DBRA 1TU3A 4QUGA 2GA8A 4F71A 2VHJA 3C3YA 4YCDA 2BKAA 1LS6A 4BLTA 3LWDA 2R65A 3ONVA 1E2BA 1LBSA 1JRLA 4GDMA 1SXJB 1H1LB 3OJXA 2FR0A 3C45A 3G8CA 4EJ2A 2VXCA 5FRDA 1U9JA 2ZDQA 3UJNA 3KC2A 3V1LA 4J0JA 2WB2A 3QEOA 1LPBB 1XDSA 3VNAA 1Y3BE 4CKEB 3NUZA 2HFJA 5A2GA 2B5OA 4P4GA 4RHYA 1Z5ZA 5JH7B 1X7ZB 4OKNA 1OFIA 4PF1A 1YTLA 2NQ8A 1LDYA 2OMEA 1RI2A 2HRRA 2KLHA 2PGLA 4QEDA 2VS1A 4M60A 5FPTA 5I48A 1U6KA 2DT5A 2FSHA 4EPWA 2ZB4A 1Z0SA 5DHTA 3ILVA 5DYWA 1R6VA 4OMUA 1SUEA 1V7QA 4DG8A 5LWQA 3GLTA 4IHAA 1ZMBA 3SIPA 4JB0A 4YP9A 1Y63A 1VJDA 2SKCA 4HDMA 4B5KA 1HQDA 3DC2A 2PS9A 2WDPA 3I6ZA 1T4CB 1QYWA 3UCXA 5KOIA 5H7XA 3THWB 2O8DB 2BGRA 1OXVA 3BFJA 2VF5X 3EEYA 3O92A 4IYJA 3IKTA 1R8YA 4EY5A 1HEIA 3LDHA 2ZWPA 4AG6A 4ZHQF 2G25A 1XUOA 4Q82A 5K3DA 4UZFA 5TQ2B 1MABA 4V0KA 4DDVA 3QWHA 5HJEA 5ENZA 1FXWF 1UDXA 1C3OB 2EF0A 3E7PA 3LWZA 1TJPB 2F8LA 2ZYHA 3BIFA 3LLUA 5DXJA 3TPZA 4EIWA 4FKBA 1Y8QB 3GLVA 2WJ4A 2FJPA 4JI1B 2QNBA 2O8FA 4TKVB 1PCXA 3EVCA 3B82A 5DW0A 4CEHA 3ISJA 1KKUA 5JD5A 3BM5A 1NT4A 5MN5A 2YJNA 4GMDA 2H2FA 2HREA 4G9GA 4JOCA 4KKXB 2FLWA 2UAGA 2ZJ0A 3AIIA 4D3ZA 1IM8A 2PMBA 3QKRA 4Q1FA 3TJZA 5DYYA 3ZDYB 2C7PA 3NI2A 4RF5A 2OFWA 1P0IA 1GSAA 4ZCLA 5HA5A 3YASA 1FP4A 4IXWA 1L5QA 3ZU3A 2RGXA 1ZH2A 1YSCA 2RH5A 1IOVA 4J2TA 2ZPAA 4KE8A 5A4KA 2MSKA 3IEXA 2BMFA 1WCYA 3PNPA 3PNBA 1M2WA 4R1PA 4ONEA 2BAGA 4M7RA 1XXHB 2JCGA 4QVGA 5BWCA 1EJ0A 2MMCA 3JD3A 2FP3A 2EKBA 1J5XA 2ZYTX 5I9IA 1XPUA 1AZLA 1RC1A 3EVFA 3LUFA 4XUDA 3U56A 4QBKA 2VHUA 5HIMA 1NXSA 4LE0A 3WVNA 2PZJA 5G41A 2QY6A 3UCEA 3E5HA 3VFDA 2VH5R 2OKGA 1V4NA 1U28C 3IURA 3S40A 5CTAA 5C5IA 1FRFS 3NG1A 3DCNA 3EOBI 4WEOA 2V4MA 1J56A 2BGWA 3TIIA 2VRBA 1EUCB 2FQXA 2JD1A 8GPBA 4FHCA 2P4SA 2VF4X 3OZUA 2QD3A 4DZRA 5BUCA 4KMOA 4LWPA 5EEHA 1YJQA 1W34A 2FVYA 1UXOA 1RWPA 2IYYA 2OCXA 4IQ4A 2JCSA 1D1PA 2Y1EA 3G23A 4QQ8A 5ELMA 1JKIA 4H08A 3UYKA 1E4VA 2CT8A 1UUFA 3ZE6A 3I83A 4H0CA 2BFFB 2ZS7A 2NW6A 4IOLA 4NDAA 5CXXA 3U1BA 5IYZB 3ZGVA 1VLHA 2BEVB 5T67A 1EP2B 1LLFA 2VA9A 4B4WA 4L28A 1N5MA 3W8NA 4LXIA 2OV6A 3INTA 4Q3DA 1QTQA 1NXXA 3LI2A 4QOGA 2EHDA 3RS7A 3O8OB 2Q3LA 3FJYA 1NNLA 1O0SA 3KEQA 2VYVA 5I5GA 5JROA 1R8JA 4ZO7A 4N8EA 1YBAA 4X41A 1BWRA 1DBIA 3IR5A 1LF5A 3F7MA 2F67A 2XWBF 2X2OA 3LDAA 3NFRA 3N2EA 3ZD9A 1XMVA 4C6RA 2I33A 1R0XA 2HTEA 3CHYA 3UAXA 3PUIA 2OZEA 2GH1A 3DUFB 4L4RA 1QIKA 3GLGE 3O1LA 3K72B 4E5UA 1JXOA 2VNHA 1WG8A 3BCRA 3DEFA 1EVLA 4OQMA 5C7LO 2ZIXB 2O6LA 4IGIA 1ZZGA 3VNQA 5LMNB 2M9MA 2ZI9A 3B1XA 1D1TA 4P82A 4CE6A 1ZUIA 2OHGA 1AGYA 4BGEA 2DEUA 3IBCA 3L8GA 2E6UX 3TZBA 4PO1A 4PTLA 4Y9RA 1G3MA 2ZYRA 5DBFA 3VQTA 1SBHA 1RMYA 5L7TA 3PGA1 4FHGA 2ZEJA 3I42A 4GNRA 3VX4A 5I7OA 5KSWB 1PX0A 3AJ9A 1V35A 3F8WA 3ND6A 2R5FA 1NHGA 4F4HA 4E5SA 1BJRE 2RAVA 2NPOA 1SXJA 3T8YA 4CFZA 1H1LA 2HCRA 5ALIA 3RI3A 1RJWA 1GUBA 4BUZA 3BPSA 3TX2A 3HWX1 4PPFA 4I1IA 1H2AS 2MDTA 3AF2A 2YWEA 3EXFB 2JFVA 3GFQA 3L7IA 3OZTA 4OAPA 3WLJA 3TRFA 4BMOB 2R3SA 1M8KA 3F6YA 3NUQA 3OZEA 1UJNA 5KVSA 5JH7A 4M22A 3FKQA 2BMAA 5EXPA 1X7ZA 1W36D 4UMDA 2CVZA 4ZVKA 3EVEA 1Y3IA 4BV3A 3ZI4A 1T0HB 2FRDA 3TLMA 3AUUA 2O2JA 3VVLA 5BUQA 1KXJA 4PCAA 4TV9B 3NB0A 4D0GA 3UJHA 5HKBA 4JB2A 2P90A 2A35A 3ONWA 3VU9B 3WX0A 2UZIR 1QWSA 4Q7EA 4YAGA 2IS6A 4IMPA 3RVNA 1L0BA 3CNQS 4D3XA 1T4CA 4W9MC 2GAAA 5LD2C 2F43B 1D4OA 5CT9A 3THWA 1SD1A 2O8DA 5IX8A 2X42A 1KTVA 3F2IA 2CF6A 3SIRA 4WFIA 1P77A 9ABPA 4DANA 4G89A 1ZJWA 3BTUA 1KJYA 2A84A 2B99A 4LRUA 5K8CA 1GNPA 3GVIA 4QYIB 1EBBA 2X1HA 4HYQA 5I7RA 1E2IA 2ZYWX 1C3OA 1FFCA 3HKCA 3QLUC 3QIVA 2ZTLA 3W6OA 1IBKB 5JYBA 4HQLA 4YQEA 2O1XA 3SSAA 3OCXA 2FEKA 4TKVA 5K3FB 2ZXFA 1RAHA 4EHFA 2OC4A 2JIZD 2XB4A 2FZWA 2Y1OA 3BHMA 3MT0A 3OD1A 1PSWA 2O8VA 3O5AA 4OXQA 4BASA 2OPBA 1II8A 1X7YB 1B0ZA 2GZSA 2YRXA 2GZHA 3VYSB 4PE5B 1EUZA 2D0OB 2IVZA 4HNUA 2ZJ3A 3BKXA 3WBKA 1C1XB 3GROA 1LY1A 4MAFA 1LDEA 3ASVA 1D04A 3BB3A 4KQ2A 5THXA 4M88A 4IRMA 1OFGA 1C8LA 5J5VA 1JJVA 1H1DA 3HZRA 4CMKA 1YZVA 3H9EO 2B5VA 2ZWAA 1KBOA 1UXGA 4YRZA 3GX1A 2R00C 3IRUA 4Z4QA 2QLMA 4MUXA 3N2NA 4RV5A 4LHXA 4B3DA 3V6LA 1R0RE 2HJRA 2W2QA 3DZGA 4BO4A 2FOXA 4GXQA 3R9KA 1RP7A 1VG0B 4XSHA 3AHFA 4QOSA 4CQJA 1WDKA 3QOFA 3A6ZA 3I9NA 3JQ7B 2G9RA 3TXXA 5JSHA 3JRNA 3L06A 2OSVA 4U8HA 4IJUA 1I0LA 4LZLA 4BBJA 4U3JA 4W6ZA 4V0LA 1Z3IX 1KEWA 3AV3A 1NUPA 2GF9A 1LC0A 2P62A 3PVZA 4H7KA 5JAHA 1MJNA 4DM3A 4KDFA 3FPKA 4BTLA 1Y1LA 2BTQA 3B3AA 1C7RA 3LUHA 3LY5A 2XCIA 1J24A 3W34A 4B17A 3RRNA 1S0UA 4Q4DA 1QG0A 3G1UA 1R6XA 3JZDA 2D5AA 3KWLA 3R5FA 5LUBA 2BFFA 3J81A 1DEAA 1HTTA 5E7QA 2X58A 5IYZA 3IP5A 2BEVA 4GKJB 4AFNA 2JAOA 2AF3C 5GQSA 2VK8A 3ANLA 4A03A 1H05A 1RYBA 2XLBA 3S29A 3FNBA 1X42A 3DDZX 2FN7A 3E9YA 3RUFA 3STTA 2AXQA 5TXGA 3R9WA 3RS4A 1SG9A 4I1OA 3ZIDA 2P2CA 1NBME 1NLMA 2FKNA 3L5OA 1LI7A 3O8OA 3QYPA 4OIFA 2ZYAA 2IELA 3KYIB 3QGMA 5KKAA 1Y7HA 4MVCA 2IWRA 1JU3A 5DTJA 3PFBA 3KVNA 5TPZD 3PEWA 2OZLB 4KAJA 4F4DA 4UMEA 4KXQA 4LF8B 1K6IA 3EJ6A 3H9BA 3NHWA 3PHBE 4TS4A 1Z35A 3OC6A 4YJFB 3TTTA 3QF7A 1YJCA 3QOYA 4W8OA 3BMNB 2WJIA 3ANMA 1GZ4A 3DUFA 1NR7A 1W5SA 1IWBB 3PLRA 2OXTA 3SQMA 2JDIA 4YRTA 3A11A 3B85A 2ZIXA 4Y1GA 4OATA 4QQFA 2PMFA 1HQYE 1PV1A 4QPNA 3GT4A 4ZVLA 4F6LA 1QTRA 3ICVA 5DIZA 2MSDB 3VBCA 3D8NA 1GPH1 4FT2A 5A4FS 4GI1A 4Q4HA 5FI3A 2P7HA 2NU8A 3SC6A 1CS0B 3TLJA 2E5FA 3UA3A 4YCMA 1R64A 4PY2A 4Y0NA 2OFPA 1IOZA 2WWRA 4I9NA 4S1VA 4PFKA 2DGDA 2FX3A 5J5AA 4WLFA 3UWDA 4EI7A 5GJWC 4QXMA 4O1IA 5SYNA 3L18A 4G8BA 5CXQA 4R3NA 4ZT3A 5FNVF 4B40A 4CL8A 4ENTA 1IIRA 3UYLA 4CMEA 2AR0A 3REGA 2D5IA 1PGJA 2FSVA 2Q4EA 2UYCA 3H13A 4FDTA 4CUZA 2GO7A 2NUAB 3TL3A 4BNIA 1OB2A 4C7XA 1L5HA 4BU1A 4GM0A 5ITZB 2E4ZA 3I9OA 1LFDB 2HHJA 1IH8A 3RG8A 1M0WA 4I08A 1PWXA 2CNNA 2Q49A 4JWKA 2VZ0A 4QU8A 4CGZA 2DP4E 4TUYB 2ZRGA 1KO1A 4TV9A 4WBNF 3EW7A 4TTSA 4L8GA 3Q7RA 3UMBA 3VHRA 1NDHA 4NYMQ 4L5IA 5J59A 3RS5A 2I6XA 2K4MA 5IKOA 1GQOA 2K87A 2JAUA 3AM3A 2F43A 3MMZA 4ZCMA 2W6JD 3F8TA 1CQPA 2ORYA 2OZPA 4D9FA 2XCRB 5E3JA 1JB1A 1W88B 2J0UB 3GI1A 2P41A 4HXGA 5EMHA 2Q2OA 1LWOA 5FWXA 3VH3A 5AVZA 4IOJA 4OP3A 1R10A 3V4PB 1P7VA 2WT9A 3BJEA 1G1AA 3PWTA 4QYIA 4BNWA 1YKGA 5K05A 1P80A 1AQYA 4UULA 3QA9A 4QNMA 3PYXA 2VQFB 2CD7A 1F2VA 2V6FA 2YVLA 4I2NA 2ZB3A 1XELA 2AVNA 4G0MA 4DC9A 4ZDIA 2IXDA 2ECPA 3BMQB 2AG1A 3DB2A 1C0LA 1XEWY 4U6NA 1HV8A 1RE0A 1VG1A 2FFQA 4XRRA 3ZNQA 2PUGA 4IQ0A 2UZ1B 5JOQA 4PAQA 4UHJA 3O2QB 3FM9A 4TRNA 4K28A 1C7QA 1ESNA 2QTFA 2V3VA 3DZIA 4F04A 1HOTA 4KPUB 1XHEA 2I7DA 1BVUA 1L1RA 5TRTA 3AB3A 3R2JA 3M83A 4RX1A 1Q92A 4WQMA 4F2PA 1QYXA 5BRAA 5T4EA 4EPXA 1T5DX 1PLKA 2HC9A 3HBFA 4UU0A 4EBBA 1IVYA 4F2GA 1LBQA 3IP7A 3R5SA 3W6ZA 1X1DA 2HA7A 3FH0A 5KQRA 2BP7B 4I55B 4J0QA 4BFVA 4DQ0A 3E7DA 3DV2A 1M76A 2BGUA 3PGVA 4LZPA 1EE1A 2F90A 4WK6A 1Y8CA 3TD6A 4BNXA 4TRMA 4CFYA 1H0HA 1N92A 3L6UA 5EYPA 2ZUSA 1NW3A 5DM4A 1XJ5A 5EHXA 2P67A 2ZBPA 2JA2A 1TU4A 2HV9A 1S4MA 5KNBD 3EGXB 3CX4A 4MRVA 4YR7A 3DDCA 4INZA 5FQOA 2VJMB 5HUQA 1ORHA 2CDNA 4GEKA 1H6AA 2EFGA 4L08A 4BC1A 1XYGA 2XZOA 2XAUA 4UVEA 3RRZA 3V8VA 3JTMA 4IJVA 2VDVE 4K6GA 2VA8A 4KQXA 4Y30A 4QT4A 2EC5A 1EFVB 1PZFA 4X3CA 4K7JA 3DSRA 2F9FA 1WUJS 5IAJA 3KFLA 4BO6A 3T9CA 5B58C 3HJTA 4UQPA 3H6KA 1K89A 5FAKA 2IP4A 1OWMA 1Z36A 5CJPA 4CWAA 3CE6A 1ZOPA 4GKAA 4DB2A 1BU8A 1Q0SA 2GHTA 1VLMA 4CTKA 2IC5A 5EUCA 4K03A 2PT9A 3PFHA 3D31A 3ZC3A 2ZI4A 1W4RA 5F2EA 5HE8A 1L5SA 3WL5A 3CMCO 3ICCA 1GTRA 1TYCA 2QE7A 4N12A 4NBWA 1DADA 4YQYA 3RC2A 4BNLA 1VL1A 2YYYA 4EJSB 5KNBH 1XD2B 3PRKE 4JQOA 2JA1A 1I7NA 1Y4SA 2OZLA 5H9WA 5JR3A 1R6TA 5B7GA 5CXSA 1XPJA 3T94A 1EGAA 2Z56A 5DNEA 4TKUB 5ELLA 1OAKA 2A86A 4FE7A 2RHWA 2E49A 3BMNA 4B8ZA 1JYFA 1UPCA 4I4TB 2WVHA 3K6JA 4GP9A 4RFVA 1ONPA 2QN3A 4IH1A 1K2WA 3OO0A 1Z29A 2GPTA 1IZ0A 1R9JA 1ICEA 1THZA 1ZIDA 3EHDA 5IDQA 2GAIA 1P17A 2MIIA 2CW5A 4AI6A 2IYOA 3JCZA 3TQIA 2HMSA 2ZRDA 4ZRDA 4M38A 4H1VA 5AUPB 3JQRA 3C8DA 3UY4A 5KO2A 4B3BA 4KE7A 3A6FA 1H8HD 3P9RA 4Y6SA 1CBUA 5EZQA 3WAJA 2E18A 3O9ZA 1FX0B 1CS0A 2JI8A 3NORA 1EP3B 1YDFA 2ETVA 1GARA 2DTXA 2ERYA 3OM1A 3H5OA 5CNKA 2IW3A 4MW6A 1GITA 2PKQP 3VR2D 3GGJA 1U1IA 1KMHB 2XKBA 1CPYA 3IC5A 3MT7A 4WNCA 1SHUX 2I03A 5DHFA 2E4UA 3QKSB 4OKSA 3VZRA 2UYYA 2ORED 2C0PA 2XUJA 4O0MA 4MVJA 1SUSA 3CTPA 4YA6A 1ESMA 1I6LA 5LQNA 1H4TA 2NUAA 1V6SA 4YJKA 3V3KA 4OVKA 2GLUA 5IT4A 4IDCA 1DUSA 4PFQA 4XX1A 3O8QB 3WS7A 4JLPA 1UFVA 4MI1A 4MRAA 1Y8ZA 1B8PA 1RWVA 4OK5A 1C9DB 3SC2B 1JFRA 4U39A 3HDGA 3QF4A 3ESRA 4A0GA 2O8CA 1IPFA 2WUEA 2DWCA 4AJNA 3DMHA 4KLCA 5BN3B 3OTGA 3A6PC 3S2YA 4QHTA 1ZA2A 1PFVA 4TTPA 2YDXA 4KGVA 4OF4A 1RZRA 3PI6A 2Z1NA 3WKCA 1YU6A 2QY9A 2EJBA 2XJ4A 3BK7A 3FCAA 3KZMA 4FK8A 1GG5A 4HAWA 5IMSA 1Z28A 4EG4A 5DULA 4RTOA 2J0UA 4UDNA 3GWGA 5EQTA 1X1AA 3L7LA 3B5IA 3UAYA 3K94A 6NULA 4DF3A 3R6TA 1R9MA 3DP9A 1U4OA 5CVJA 4TV8F 1KH3A 3LK7A 3QPWA 2XOEA 4PO3X 3QEBZ 4IDDA 4EENA 1EXNA 5JC8A 3IPCA 1FJ2A 1OBVA 2EP5A 4OM7A 1RADA 3H6GA 1P1RA 2XMDA 5DNDA 2AUNA 4XI9A 1B93A 4ARSA 2UUBB 3VJRA 4JYBA 2XMZA 5L40A 2UZ1A 4UTNA 3ZQ6A 1Z6ZA 2FMFA 2YVUA 4WA8A 3TQCA 3RAPR 1Z22A 3F7TA 1WSAA 2H85A 4KPUA 5EVCA 1MC1A 1IC6A 4EB3A 2I9KA 1IY2A 4Q1VA 4WINA 3F9CA 5ITVA 2X9QA 2XHZA 4J0DA 1MPTA 1KPIA 1KY3A 1TYZA 3RGWS 1IIBA 3Q0IA 4NFSA 2WF7A 4FGLA 3CEMA 1YWGO 3EXG2 3W1EA 1Z2PX 1N6RA 3MVEA 1PRYA 1Q7EA 2BP7A 2C7VA 1KEUA 4I55A 1Z4JA 2B7CA 1PR0A 3AKYA 4HDRB 5IAKA 5AM5A 3OY2A 2YBEA 1YQDA 3QMWA 1F7UA 4CQMA 3DH0A 2CXHA 2F3UA 2C98A 3HN6A 4HGYA 4L0DA 4UAGA 3UQYS 1V6CA 1SIWA 3UB3A 1U0TA 4BYGA 5ALVA 1E1MA 5COQA 2JGNA 2MSEB 3PQDA 4GAEA 1M66A 3FKJA 2VJMA 3RTEA 1XEFA 4K0KB 3OZIA 1NYTA 2Y76A 3PXEA 4I50F 4DLRA 1NVBA 4N82A 1NJFA 4JP8A 4LTMA 1Q20A 1U0SY 2P9ZA 3E22B 3GDOA 4NL4H 1EFVA 5E3HA 3JD0A 2X9GA 2G9ZA 1NASA 4PVCA 4DJTA 3N0XA 2JJ1D 3KWMA 3NVMB 4PIVA 3ESCA 1YDGA 3QHQA 2OVBA 4MV0A 2QF7A 4X1YB 1VE3A 2BR5A 4KL8S 2BI4A 4ZV9A 3AM5A 4D9HA 1DO8A 3MWDB 1XN1A 4K5QA 4FYYA 1M8FA 2QM7A 3UOAB 5HF9A 2A0WA 2C9YA 1RFGE 3OFND 4YAFA 5DI9A 2XMSA 1Z4NA 4K9MA 1BKDR 3HI4A 2J41A 1E2UA 3MIZA 2C7RA 5CVVA 1SVKA 1GUAA 1Z88A 3OPVA 2PH5A 4AG5A 1W2HA 1G5FA 2QUJA 5C3UA 4I3FA 4C7KA 1TLFA 2DUJA 1QKKA 2P3SA 4P7FA 4ZQIA 4MV8A 1L5ZA 3OA0A 4JROA 2VHVA 1EXWA 3PNSA 5DM1A 4BBZA 4QODA 4DFDA 5AKLA 4CT5A 5CX1A 721PA 1ORWA 1PZMA 1SELA 3QW2A 2IIBA 1K7XB 4N5IX 4Q9JA 3A6KA 3RD5A 4EKDA 1FFXB 5GV8A 2CLDX 4DCMA 2P79A 1WDLA 1C3LA 4GKKB 2Z8YM 4JJ6A 1AGXA 1Y9ZA 3CRMA 4GIBA 4XOUA 3B1ZA 2PK3A 4YXWA 3B3GA 5ABPA 2CLHB 3NATA 2Z8XA 1CY2A 1RKVA 4DLAA 1NBHA 1UDWA 4BJ3A 3K70D 1RU3A 1UR5A 1YFJA 2Z9BA 2I54A 4I4TA 2G5PA 4W5RA 4A36A 1KNXA 1ZISA 1MFZA 4R8KA 2W00A 3PBKA 1COZA 4BPBA 2D8MA 4YMIA 4DNQA 3SVZA 2NTYC 1ANKA 3HKEB 4LQDA 1YZQA 2YFQA 3ZDDA 1EGQA 1JDUA 2C61A 1T1RA 1JDZA 5B4UA 3UV7A 1FFWA 3GEPA 4L74A 2DUNA 4YT8A 3H5VA 4HSEA 2AE2A 1F3LA 3BXGA 3O2SB 2AS0A 2EKZA 3MHTA 3IEPA 3SNHA 2N75A 3MTGA 1F4VA 5DV9A 3RK4A 5A0TA 1DC7A 1QVWA 3FYSA 3I3OA 1AS2A 2EF1A 2PXHA 3WK5A 3CVOA 4QU5A 1JYEA 5JG7A 4E6PA 2ZM6B 2BKXA 3C8UA 2XIQA 2HIGA 1W36B 1KZHA 2QRQA 1BEUB 3DNMA 1HFKA 3I23A 4OBBA 4YP7A 1NF9A 3MWEA 3M5DA 1V8ZA 3SOZA 5FBQB 2YINC 1IL0A 3DTVA 1UXJA 5EE3A 1YQWA 3ZU2A 2ZBEA 1I10A 1V1RB 1X13A 2DPXA 2N47A 4MLCA 2OCIA 1IJFA 5AVQA 4ACBA 3LGAA 1UK7A 4YRCA 1E1CA 4YV0A 1V47A 2I8LA 2GYYA 3C0KA 1Z5UA 1EMDA 3LHKA 4M7WA 4YMHA 4A82A 4HS9A 2JFWA 1RW4A 1T36B 1M1NB 1Q5PA 2FE1A 2HSGA 2PRIA 3AI3A 1XK6A 4NYJQ 4Y2QA 4CM6A 4GMGA 5ICEA 3ACBA 5CM8B 4M1KA 1O3YA 4TTAA 4JUAA 4ND8B 4WOPA 5TSDA 5BN3A 1KRWA 1ZJ5A 5AOAA 4B33A 4BFXA 1BHSA 1W5AA 2CXQA 3NBXX 3R09A 5T6BA 1V8DA 3PTLA 4E31A 3QELA 1N9KA 2ADMA 3TW8A 1ADFA 5DNAA 2C57A 5JSKA 4ZHQB 2QTHA 3J7AC 3X1WA 3K6SB 3H8JA 4NHOA 4LGYA 2ZKLA 4GU5A 4R0NA 4YPFA 3HUEA 1P61B 3O82A 3QVUA 4PONA 3U17A 3VBEA 1EZZA 2VFAA 1GRCA 4LGCA 1V26A 3PNVA 5KREA 2YHIB 3EULA 3L5KA 3VX3A 2DB3A 1DRVA 4WLOA 1VHQA 2WHEA 1M2EA 4GYKA 2I34A 4IIVA 1XDZA 4Z4EA 4RJIA 3MYRA 4Q01A 2I80A 1S3FA 1WTAA 3F8SA 3II6X 1OGJA 2HBYA 2WIKA 1GZ7A 3TMKA 2F3PA 1KA9H 3KJIA 1JZSA 2FWJA 3L1HA 4BRWA 4E22A 4E7PA 3DV0B 1MOQA 1DHTA 1HZZA 4IHKA 2GR9A 1O96B 3WKBA 1ZUNB 4R2XA 2NM0A 2VHWA 1SBQA 3JRWA 3VNSA 3IELA 1II9A 1SCJA 4IZHA 1S9DA 5KJEA 3A05A 1CXZA 3TUZC 3U4AA 2HADA 1XCGB 1VGRA 2J31A 3IVAA 1RKXA 5FUMA 2J9YB 2RIRA 2W6OA 5C7IO 1KHTA 2CNLA 2ZUUA 2AR9A 2FEOA 1F12A 3FWPA 2V74B 4QIHA 4BLVA 4FWIB 3T4UA 4RFSB 4LDQA 3D8SA 1NMXA 1RRPA 4J1SA 5U4XA 5ERYA 2BPOA 3CR8A 3Q3VA 4PBRA 3K73O 3W6NA 2SHKA 3BL5A 4M89A 2QR3A 3I32A 2HHHB 7MDHA 1JBKA 1E89A 1CQZA 2VDLB 4L95C 5WRFA 4DQDA 4KBYA 2DKNA 1XHLA 1EFHA 1HK7A 1N5OX 3ORSA 1WOMA 2G67A 5EKUA 2VUIB 3R7DA 4ZPJA 2YN0A 5B1EA 4CG1A 1PAUA 3EWSA 4D4MA 1D03A 1ZI9A 2RI1A 3E22A 5CLQA 3RUIA 4KODA 4DBZA 5KB3A 2A1UA 3ACDA 2W4MA 1TRKA 4MAAA 1TQ6A 2NO4A 4X24A 1VCIA 2VC2B 2UUCB 1UP4A 2FJ0A 4FW9A 4X1YA 3WP0A 2H7XA 3AVOA 4BMPB 3WI7A 5K0BA 1RXVA 4FT4A 2FX2A 4ALLA 3MWDA 4GC9A 4XIIA 4EJ0A 2O20A 1E96A 3KFXA 5L8VA 4JLSA 4JJIA 1N2HA 1FRVA 2ID8A 4O63O 1Y6FA 3N28A 1U31A 2NVBA 2X2EA 3K2BA 2IV2X 4RULA 4XUCA 4DADA 5BYKA 2ZE5A 1CIVA 4ZAYA 1JJ7A 1OC4A 2A8YA 2H3HA 1JHQA 2V8OA 3P9YA 4KYTA 3WLLA 4DNPA 1G59A 3UAGA 2B0JA 2WU3A 3FRHA 2HYIC 1M5RA 1XAGA 4H1TA 4L73A 1LNQA 5HOQA 4XAQA 4A9AA 1QX4A 1T1JA 3AEUA 1BFUA 3EE6A 2ZSJA 5I3ZA 1U9ZA 1RPJA 1Z06A 3PD7A 1UKZA 1HOXA 1PWHA 4H15A 1IONA 5ALKA 3RB8A 1WVMA 2H2AA 3STWA 4DG9A 1IEQA 4GUAA 4HWGA 1KMNA 5C1OA 2DBRA 3ANYB 4I99A 2PS3A 4QU9A 3FD8A 3K1JA 4IZ6A 3EC1A 4YI5A 4MR9B 3EY9A 3C3MA 5FHRA 3H2YA 4EVQA 2VRNA 2XZPA 5G1OA 1X1TA 3HCDA 4ENUA 2V55B 2WTBA 1E1RD 3PQ3A 4IPTA 1UMDB 1G20B 4HP8A 2HBQA 4JJGA 4Z0TA 1J90A 4JI2B 3W8DA 3WG9A 2YZNA 2Z04A 3AJEA 3CSSA 3GUHA 4O2RA 4V0ME 2PV0A 4DQLA 4HWSA 4MB2A 1A5SB 3CBQA 3LM8A 4HJRA 1Q22A 4D5GA 1LI5A 1Y4DE 2DHEA 4KYIB 2ZUFA 3O1IC 2CK3D 2FPLA 3HKDB 3N76A 2LZ0A 1GTSA 2HU5A 4XWOA 2Y6UA 3GUUA 4TYQA 3L8ZA 1RJEA 1A9RA 1YR7A 4LC1A 1MD9A 3G88A 4WK0B 1W1IA 1YMUA 5CJ2A 3P2IA 1E98A 5CHYA 1DC4A 2IXBA 2IUSA 1Z5NA 3QH4A 2XR1A 3MBOA 2G8NA 2D0DA 4K9NA 4P3YA 4Z1MD 5F2NA 5E7MA 3OQHA 2GK6A 2PRJA 4MOWA 3B36A 3R3JA 1B73A 1JJAA 1GKYA 2WSYB 3B9RA 3Q3IA 3IPLA 3AV0B 1HR0B 1KHHA 2YTZA 1T36A 3FAKA 1M1NA 4MWSA 2R7LA 4MQBA 2IPNA 3FCEA 5FFFA 1HT2E 2O59A 1EHYA 1OGYA 3SLRA 2HDOA 3IMEA 4ND8A 1GPAA 5TLSA 2A88A 1EYZA 3IRVA 4KQ6A 5CH3A 3SYNA 2ZBUA 3AOEC 3LRTA 2D6FA 3OLZA 3EXG1 1S3GA 3FMGA 2AJ8A 4L85A 4UTPA 2J33A 4BNHA 1H2WA 3F4KA 3VOTA 3O26A 2WM2A 2IWHA 3NAMA 4DDHA 2CHVA 3K6SA 4L16A 5FTKA 3HMKA 2J3LA 4B3RB 2O2GA 2O7QA 1FXWA 3RYFA 2JIZA 3OCJA 3CF2A 5CIQA 1EWRA 4LISA 3K35A 5DLPA 4CT0A 3E7FA 1BGWA 5TEVA 5FLEX 4WKPA 1TEXA 2YHIA 3HG7A 1HT1E 3FDIA 4RTRA 3KU1A 4R83A 1DOHA 1LW6E 3QBEA 4HB4A 4TMZA 4KDRA 2IYTA 5AMXA 2PO7A 3W5UA 3BGIA 3CVJA 3D3NA 1UBMS 3DFMA 4IDAA 3RVDA 2YWBA 3AHJA 1CEYA 1OB5A 2E4WA 1NVAA 5EJEA 3NHAA 2XBLA 5E9JA 2IPMA 1M8PA 4E3ZA 3M8KA 2SECE 3DV0A 2WZDA 3GELA 3TRKA 3TSWA 3UOGA 3B3QA 1O96A 4JXKA 3HB0A 1ZUNA 1EQUA 3FTFA 4YRAA 3AUKA 5CB4A 1EVEA 1KQOA 3D5EA 4PLZA 2BBTA 4L5AA 1LEHA 5DBHX 1VJCA 1S2GA 2IEDA 4ER3A 1OJLA 1KMQA 1QDLB 3KHKA 5A5GA 2JAHA 1SEPA 1PHPA 4BMSA 1LUAA 3GIDA 2OC9A 3WMXA 1KYXA 5REQB 2J8ZA 1SQFA 4TXMA 4Z2YA 3RWBA 1SC4A 4BRZA 1MV8A 3EC7A 2RE8A 2B83A 3DD5A 4DJEC 3OQIA 3DKRA 1I0ZA 3D3JA 1RRVA 1Q1AA 3G6WA 4FB4A 5AQEA 4YRGA 5IWCA 4KQJA 4PSVA 3NT5A 3QLVA 4RIIA 4I19A 1K7FB 1ZD1A 4ZI5A 3HV0A 5BSHA 1KF0A 3HVUA 3KELA 3ROPA 1M6YA 1QIEA 2GKOA 2RI0A 5ETJA 3GJSA 4OL0A 3PITA 1M73E 1WDWB 4H0NA 4N5NA 5HBGA 3H7IA 1UWLA 3QE2A 1LPSA 1SCBA 1X7XB 2I1WA 3PEVA 2H7CA 3HFGA 2YCLA 5JXWA 3IR7A 2L2QA 1KIMA 3IXLA 4G01B 4WDQA 3OQVA 4F3RA 2H0RA 3T7AA 2QZJA 4ZOEA 1NNUA 1GL3A 3GQVA 2MCFA 3SBOA 4DCVA 5IEJA 3AERB 2V97A 4Q1BA 4YC7A 2Y05A 4XIYA 1IN8A 1JR3D 2X1MA 4I8DA 1KSGA 3V5NA 3ZLUA 1ZM9A 3GYBA 3DLAA 1C4WA 2JGLA 1UJ2A 3L04A 1JHPA 5M04A 1E3JA 1FRZA 1AHHA 3VZDA 2PUJA 1JJIA 2CE7A 1SVOA 3A25A 4UUQA 3I1JA 3SHOA 1TT5A 3DZCA 3NHKA 3ZQUA 4UEQA 5D3MB 5FA8A 2O2EA 4QXOA 4YP0A 1R0ZA 3FMIA 2R4QA 2V6BA 2HOQA 2BYTA 3FPAA 2X0KA 5CCDA 4CV3A 3LUDA 1HMPA 2JFUA 4Q6BA 1UADA 1L4HA 3WXBA 4C06A 2VVTA 1C5KA 4U5QA 1ENOA 4Y6QA 5KWSA 2OO7A 1I24A 2PTHA 2DERA 2V7VA 2DHCA 4ZQFA 5GGXA 1U3UA 2DTEA 1MG5A 3PX2A 4MR9A 1I4TD 4MDYA 5HKAA 5KDOA 3OQOA 1TXGA 1VKRA 1YDHA 2IBTA 5K0GA 2FMXA 1XI2A 3U3JA 2PHZA 3M6AA 3AJ8A 1G20A 1YBMA 2IH4A 4NCNA 1DG9A 1QHHA 2FK7A 1JG4A 1O6BA 4GBED 5ER6A 3U5TA 4G5YA 2AEJA 3IQFA 1T9GR 4OB6A 4X3OA 3HJRA 5EJAA 4AJJA 1Z2EA 2FETA 3IB3A 4R8LA 3MSXA 5FNVB 1G16A 4JLNA 3BD9A 5BMVF 2QN9A 4GKBA 2B82A 1V0JA 2GRJA 3WO1A 3TLXA 1RCTE 4K8RB 3PA6A 1NW4A 1RNLA 2E4AA 5TGTA 2OFOA 1U99A 2VHQA 4GSLA 2BCEA 4QUBA 5A5EA 3DR5A 3FOBA 3GBVA 4RD0A 4HNVA 1KS9A 3C3JA 2CJFA 4E2XA 1FMLA 3UXHA 3ZK9A 1ONNA 4C0WA 3KSDO 3MQ2A 1N9ZA 1T10A 2AKAB 2IDJA 3SXUB 1QXSA 3TEMA 1S2IA 4Y2GA 4EGCB 3A1DA 2BDEA 3P9QA 4ZU1X 3VMMA 1L5OA 3WL6A 5BSKA 1MC8A 1A9TA 2FPGB 2G0TA 2P78A 2W6PA 2W6JA 3FUWA 4OM8A 5AJXA 4WBNB 1W29A 4ILEA 3SBEA 5A4IS 1N7JA 3C5VA 4AN0A 2XDYA 1S2DA 2OHIA 4QBTA 2YWXA 3CFYA 3R9XA 1NBOA 2JIRA 2Z1MA 2V7UA 3JYHA 2UVPB 4WFQA 5FX2A 2FF7A 4DY4A 4D43A 2AI3A 5C4IA 3BTSA 4JP3A 4HEHA 4FR5A 3WB2A 5DN9A 2E55A 2YNMA 5IK2D 3P5BA 3UC9A 3T5PA 1K98A 2IHBA 2XXBA 1CB0A 3FB4A 4KVGA 3V9PA 3UHAA 3CNBA 2YL2A 4RMHA 2OL4A 4DTCA 4KI0A 1GNTA 4LBZA 4BQNA 1ZCJA 2HCFA 1FS4A 2VRWA 3OPXA 4L3WA 2IE0A 4QEZA 4IIBA 4DA9A 2RGYA 5C1IA 3U39A 4CI0B 1U11A 3P32A 4TLBA 2FWRA 2JVIA 2G1KA 2NSYA 3W05A 3SYKA 4LIPD 2LD4A 2BFOA 3TLCA 5FCDA 4IIHA 3G9QA 4CR8A 1YB2A 4C2AA 4LV6A 1A96A 3H84A 3I9V6 1UP7A 3TLGB 4QSMA 3BH7A 5AQ1A 1OBFO 4PCLA 5C4MA 6ABPA 1CEQA 3QPBA 4MI3A 3GGSA 2WBLC 3HP1A 1HLGA 2OCGA 5T6MA 2VJKA 3P97A 2ZAGA 4URZR 5KNBA 2JASA 1DJOA 2ATEA 3CUWA 2HMWA 3K15A 4M6WB 4CN8A 1AZWA 1V1MA 4LMAA 1P2BA 2INGX 1IDOA 1CV2A 1NLYA 2GBCA 4AKTA 1UDCA 3RVOA 4HY3A 3V97A 1TUBA 2ID7A 4QDJA 2PZGA 5IJ9B 1JT2A 1KSJA 3R7BA 4HB2A 2A1IA 3C1OA 3O7MA 3LLMA 3LKBA 1MXHA 5B2ZA 1VHJA 4R71A 2VQEB 3QUAA 1CQJB 4JI5B 1ZD2P 1PJAA 4I1YA 4L8WB 4BO7A 3RFVA 4C4YA 1QE3A 1ST2A 3C7DB 3A58B 2B61A 2W9XA 5C8ZA 1Q12A 2ZIFA 3JQEA 1RLJA 1FL9A 1QVVA 4RFLA 4M1YA 3T6KA 3A8TA 5ALMA 3MMXA 3VKFA 5BV7A 3RC3A 1ODIA 2PX4A 1K4KA 4R8MA 3I9JA 4EK9A 1TEZA 4B0PA 1W52X 1FVOA 2BFAA 2PD6A 3BXZA 5E6SB 5A0FA 1TW3A 5KI6A 1ADCA 5GV7A 2B25A 3A6LA 3R5HA 4BYMA 3LP8A 1G4UR 1RPNA 1LSJA 2AVDA 3H2ZA 3IKJA 2LUOA 4LK2A 3TS1A 4FE3A 4FYMA 16PKA 1PFKA 2V8BA 4ODIA 4H7EA 5FBKA 5IDVA 3KBBA 2C0QA 3X2EA 3ZW8A 2PMWB 4TT3D 4V3BA 4GRDA 2V1UA 3RTDA 1XNRB 3JYPA 4MUKA 5EIBC 3RUEA 1YFZA 5G0TA 3LL7A 2JJQA 3K70B 4AXBA 2RGCA 1XQXA 2F6RA 3HRKA 4RKYA 2IEAA 3PICA 4RZ3A 6ADHA 4ZOAA 3NC1C 3HM2A 3JD2A 2BZSA 1L8LA 5D3MA 3U1VA 1QH8B 4XPIA 4QA9A 5EVJA 4YT4A 4HVCA 3I34X 1L4YA 1FZQA 3H3XA 5DTMA 2HO5A 3WIVA 3RKRA 1SVWA 2I1LA 4BCBA 1UODA 2BDTA 4LQ4A 1H8HA 3WB1A 5DLYA 3LS2A 3DTYA 1ZI6A 2EJVA 4C29A 4MTCA 3PEUA 2YXDA 2ZK7A 3WQSB 2V58A 3FGOA 3ZGOA 2A5YB 3QXXA 4EEXA 4CETA 1XN4A 3BMCB 3LT1A 4F86A 2OHVA 2XUFA 1NR1A 3ZK7A 3NV7A 4R9UC 1BDJA 2QRLA 2WU4A 3NBYC 4M1QA 3VDRA 3G2MA 5CW1A 3WLPA 3ZCVA 3ABZA 3AI7A 1J6UA 1AQIA 2VO1A 2W6NA 2H1SA 1Q0HA 3T52A 1PSDA 4X00A 2A67A 3PZBA 5E1OA 2JCVA 3BIOA 3MBKA 5DLEA 3T3EA 3TR5A 1ATZA 3ZKWB 3S1SA 4JQCA 1T9BA 4GMKA 4G67A 1UT6A 2OVFA 4G24A 3UJ6A 3M70A 2CY0A 3G0BA 3O47A 4KH1A 2J6CA 5CVUA 3UJDA 1N5KA 2NO1A 2QLTA 3E1GA 4AURA 1TMKA 4MMZB 1JDBC 4MJLA 4UPDA 1H8ED 1XQ6A 5LL6P 5GONA 4BFLA 2PZBA 2PBLA 4QPDA 3EZFA 3F73A 1M1YB 4MWEA 1YDEA 1QE5A 3SXUA 4B81A 1OX5A 5JWHA 5SYMA 4MTLA 2ZB2A 3QLJA 3VPHA 4R7GA 1G9XA 4JEHA 4KBGA 4OKIA 5BWNA 3GNLA 1Z6QA 1XWFA 4N0PA 1N57A 4RKEA 4WY8A 3JQBA 4WBNA 1XLTC 4HV4A 3KUDA 2B1RA 2I2AA 4ZVOA 1NUQA 1K9VF 1MN6A 3AY3A 2R4UA 3ADCA 3REQA 2XT9A 3AL0C 4GUDA 1T8PA 4EHNA 3I2KA 5KCMA 2UVPA 4NG5A 3WTCA 2P4QA 3A4MA 1JGTA 1H42A 3RRXA 1Q77A 4FYPA 5HZKA 5K3OA 2A78A 1K2VN 2AIRA 2GK7A 3LE8A 4UE3S 2ZR0A 4IUBS 1EGVB 1JL3A 1M2VA 3CZCA 4OK3A 3EFOA 4M1ZA 1IOWA 1B8VA 1E0SA 1V96A 3KAQA 3RFUA 4YCJA 3AW9A 1T9ZA 2BLLA 2ZJFA 3F78A 1NVVR 4HH4A 4NJEA 5FBLB 2ORIA 3AY6A 3GG2A 1SWWA 1XQVA 4TV8B 3TL6A 5IPFA 4X0EA 2AOVA 4G1BA 1BSVA 2ZUBA 1JAXA 4J0HA 4EGQA 2O5VA 1Y7IA 1WZIA 4JLAA 4U7PB 2ISQA 5TVKA 4MULA 1K1EA 4LSMA 1MGOA 3FMVA 2ONZA 4Q12A 1BKYA 4MA4A 3OLYA 1GAWA 1I5RA 5HSGA 2YQ5A 4XLLA 3MJRA 3NH9A 2DH5A 4KCGA 4MRRA 3SKYA 1KI9A 1XNGA 4LCEA 5KTPA 2ISCA 5TT1A 3NU1A 1J8VA 2IOYA 3KVOA 4NE2A 1DWOA 1HDCA 3Q4GA 4OIMA 4CN9A 4ZCSA 2PUVA 3O0DA 3V2UA 5FI5A 2B9EA 2VUHB 3QUCA 2CLEB 3U4CA 2GI4A 3G2HA 4M0LA 4PPGA 1G0NA 1ZC3A 2OORC 3C7KA 4YJHA 5BORA 4NK4A 1VBFA 2ODNA 2NU6B 1F0KA 2Q4DA 1CC1S 1P7YA 3EGDA 1TQHA 5IJ9A 3C41J 1TVCA 4F5EA 4CV0A 1E92A 1Y8RA 3A14A 3ZKAA 3HJNA 4A7PA 2IY9A 1GQSA 3KQSA 5FAXA 3K09C 3SHTA 3NTOA 2JJ1A 4TSKA 4WFJA 5FA5A 1CQJA 1KS2A 3F71A 2VJNA 4I50B 3WQQA 3ZVNA 3T9BA 1ECLA 4W1SA 1L5GB 3EQZA 1FSGA 4A8JB 3DVAA 2OPHA 3Q6NA 3B6EA 1ZAKA 1T9AA 3HLYA 2WZCA 3IHKA 2GWRA 2JFXA 4YV2A 2FWBA 3GAMA 3HS3A 1KU6A 4G0PA 1Y98A 4YMWA 4ZVPA 4UPVA 1ZCZA 2JC3A 4PC2A 4H4EA 1UWVA 3GNTA 2OO5C 4ID3A 4X20B 4M9SA 4RBNA 3LQ4A 3PDIB 3ZHQA 1F0YA 3AYXB 4J7AA 1RABA 2NTEA 4KWTA 5AKXA 5E6SA 3RTCA 2IOHA 121PA 1OLXB 1PQYA 1TU0A 3DC7A 2R97A 2H2IA 3ESXA 2GAOA 4FEGA 1U0RA 4IV0A 4NQZA 5BW6B 1TCBA 1L4NA 1QFXA 1Z5VA 3EIWA 2PUCA 1QJ4A 3TNDA 4HDOB 4D8YA 2QUAA 1JLRA 1FTWA 4WCFA 1Z07A 2V7BA 3T4XA 4AK9A 2DVMA 4ZCQA 3RVRA 4S2UA 2W0SA 3KOZA 2VH1A 3QXHA 4YH1A 3OWXA 4XW2A 2YR0A 4BRUA 3E5NA 5CEJA 1JLKA 1NBMD 3H65A 3JATB 4LHSA 1NVGA 2G36A 5FLXA 3CLUD 4D82A 1QH8A 4XDHA 5EQFA 1FDOA 1YULA 3DZJA 1Y1PA 3NOQA 3WA6A 2XA2A 1SRRA 4H18A 4U0JA 5MN6A 2ZI5A 4X91A 5DEOA 1W0JD 4PLCA 2HFKA 2J7PD 3HCCA 4WLVA 1PJTA 2QX9A 5IARA 4EKNB 3X44A 1ODTC 3O8NA 2MSLA 1JSLA 4L76A 4WY2A 3V32A 3KQKA 3GPLA 4GPBA 4I0WB 1AKQA 3S7TA 3KDAA 5M29A 1U04A 1ZGCA 1JLLB 3BMCA 4RGQA 5FYDA 5EEGA 3OOSA 4P22A 2X4LA 1S2LA 4FHZA 3ZYZA 1YH3A 4AP6A 1IQPA 4UEKA 5FD8A 1KVSA 3IMCA 5FPYA 2C2YA 5E6UB 2I91A 1QCZA 5A06A 2DX7A 4RF2A 1Y1KE 3N58A 1PYOA 4D9KA 1ENZA 3QENA 2V0CA 1KYYA 1PZNA 1R16A 4LRQA 2YCBA 3CLSD 4BB9A 1KBQA 2AQHA 1JG1A 4WERA 1DIAA 4NMHA 1HE1C 2I55A 3D6JA 3FOWA 3HA2A 3PTAA 3GT3A 4LY0A 2ZIVB 5ALTA 1JW9B 3PXUA 2PRZA 1EHIA 4N6NA 1N3BA 1BE6A 3SM9A 4J7XA 4DCUA 2VTKA 2ZREA 3N8KA 2OUIA 2VJDA 3IT1A 3NM6B 3FCYA 2TMYA 2YZ7A 3IBYA 4EUSA 3OH8A 1JFSA 1S3SA 4KH0A 5CGZA 3WLIA 1CETA 1QHGA 2IH5A 4DYDA 1Y89A 3AEKB 3AFNA 5E2IA 2Y0PA 1RHJA 4NZYA 5T57A 1J2EA 2JFFA 3G0CA 4D5EA 4RWEA 3WL4A 3GRAA 4RH0A 3RC7A 4JI8B 1JEQA 2P5SA 5IUNC 2ZKIA 1NOJA 3K9BA 4DEXA 4X6LA 1FBTA 2BMDA 3EZ6A 3GMTA 4HGPA 4BX3A 1WHTB 4XJVA 1H94A 1NURA 2I9PA 5CFMA 1A95A 1I2BA 5EJ9A 3QUQA 2WG2A 1G64A 3X2SA 4AJPA 2AG8A 1G3QA 1RHKA 2HUNA 2NYRA 3P9IA 4LW8A 4XR4A 4CMGA 1KP2A 4M0PA 3L6DA 2XMQA 3TZ6A 1N7IA 1DCFA 1XDWA 3BJZA 4TQUS 1E69A 2KS6A 5HQ3B 1OBOA 4LJLA 1JIXA 1QHSA 2HI0A 5E38A 4XGKA 2HK6A 2H16A 2FEPA 3T7TA 3JD1A 1KO8A 1C8VB 1HE2A 1R4MB 2BKVA 1GN9A 1G5PA 3U7RA 3O8CA 2BGGA 1DEHA 3V33A 4I6EA 4JMLA 1RQPA 4OX9B 4GMFA 4EKEA 5FI1B 1QLHA 1R2QA 2JAWA 2FG7C 1UKAA 2V45A 3GARA 1QGAA 3S2UA 2ODBA 1Y0BA 3UUFA 1EIWA 1YA8A 1T2NA 2HNBA 4QGBA 1UC5B 2GRUA 1AV6A 2G76A 4YYEA 3ZOZA 1CQWA 2Y1KA 2P1ZA 5EFOA 6REQB 2VQSA 1HLDA 3UIEA 1Y3AA 1USIA 2ON6A 3L79A 1K8ZB 1SU4A 1TPYA 1HNZB 9ATCA 1QFMA 2EBHX 2HQBA 4BNTA 4BN4A 4DQKA 3GRCA 5SZKB 4N0EA 4EFDA 3EDCA 5IP5A 4XWWA 1INLA 2G1PA 3OIGA 4J49A 4N54A 2O0LA 3NM5A 1WJGA 2MYUA 4TZ0A 4I50A 2H18A 3HSKA 4PV7A 2X23A 4ZYLA 3VPFA 2HPZA 3UWSA 3R23A 3WK4A 7AT1A 3HXOA 1Z7EA 3N2GB 3OQJA 2QDXA 1L8AA 4OJKA 1K92A 3MW8A 2Q1TA 3IUEA 4ZQGA 4I4NA 3UT5B 1E0AA 4X20A 3UQZA 4ZJUA 4LRXA 2VWPA 4LXQA 4RD2A 4EQ6B 2EJCA 1ZP6A 5JSFA 4NCHA 2WFLA 1XD9A 1ISSA 1K27A 1RYEA 3DOJA 2WD7B 4HDKB 4HZIA 3CISA 1DRUA 2LCQA 3VPXA 3S2GA 3T15A 4LXUA 3TRIA 4Y6GB 1ZSNA 5TS3A 5EPEA 1GT6A 1GVNB 1ZK2A 2ALJA 1F4LA 4P5PA 4WUVA 2FQYA 2E4XA 2ZLBA 1FPQA 3HY6A 5PGMA 4F3CA 2XRYA 2Q3JA 3QY9A 2J4FA 1DLIA 3GFGA 2POQX 3RSQA 2QAJA 3JATA 2Z43A 1CY4A 1WD7A 3WR5A 3PHHA 4CLOA 4KUGA 4HUJA 3ENWA 3KQYA 3L1UA 3R20A 1XEWX 1FS6A 2AWNA 2VWGA 3CS3A 1E1RA 1ZRSA 5ES3A 1U4SA 4NMWA 4S04A 2CEAA 3M6VA 1YR1A 3KAKA 2XMGA 3NAZA 4D0SA 5JMWA 1O58A 1EGMB 2C20A 2NMVA 2QRUA 4Y0VA 4GPEA 3N9IA 4ABTA 1N4DA 2AN4A 1FDIA 5AHRA 1QOQB 2QTGA 2HN9A 3KD3A 4TMKA 1JLLA 5KYWB 2CK3A 4WE3A 4MGIR 4DLUA 5JY6A 2VOJA 3MJTA 5HUJA 3A3YA 3HXMA 4RVOA 2ZI6A 4INOA 3H1GA 3D7NA 3KYDB 3KKMA 3OZSA 1D0SA 1JR2A 4GM4A 1SD2A 5F1KA 4FGKA 4MCJA 4DR2B 4GECA 1RXWA 3EQ7A 4AMVA 2ADFA 3C5WP 3LX5A 4YFYA 3UV3A 3O4FA 3B52X 2JLVA 2C03A 3P52A 6PFKA 5J4KA 2PUEA 4S1NA 3DWFA 1Z47A 2G9NA 2AC7A 1B26A 2C5BA 1VIYA 3QFCA 2R8RA 1GU7A 4Y2SA 4PGMA 5TY0A 3ZHVA 1VBKA 3N8IA 5DOVA 3QPVA 5BXQC 5H4HA 1G6OA 8ABPA 5LNK6 1CEXA 3AF6A 1MTZA 1V16A 4WLNA 2C1XA 4AD8A 3W04A 1QC5A 1LWNA 2R6DA 2WSLA 3INGA 2QRPA 2GLXA 5AKGA 2P65A 2GXSA 2HU2A 1VZ2A 1ZN8A 3V00A 3WQHA 1U9YA 3O8LA 1K0FA 3IE2A 3PDHA 3AEKA 3EISA 1ZLXA 2LCIA 5JNTA 3AK4A 1U6IA 2OQRA 4O25A 3QK7A 2IZ5A 4GGOA 5CG1A 1ZJ4A 3ITDA 3GJRA 2ASEA 3O2NA 5JD3A 1CDZA 1X3SA 3DL7A 4N5HX 4O4HF 3GUZA 5FB3A 4B6GA 1QHXA 5CK5A 2EATA 1TJYA 4FYHA 3V46A 1TB4A 3JQ8B 4JHXA 4Q4LA 1VKNA 3RM3A 4XD7A 1N75A 5CP8A 2OD7A 3HYLA 1BNCA 4C0SA 4DRYA 1BDIA 2ZRIA 3LO5A 5ENVA 2ZUEA 1AGRA 3OP1A 4I81A 2VUSA 4HMPA 2YKGA 3BRWD 3HY3A 2GTIA 3BXOA 4TWRA 4UUPA 1SKAA 3TZKA 3EEFA 3OCZA 1R8QA 2Z5VA 4A15A 2GXUA 4DCJA 5TQJA 1UPAA 5T3YA 2YIDA 2XYRA 3BXPA 5HQ3A 2P91A 1C8KA 1R15A 2MHCA 3EQ9A 3IO5A 3Q9LA 3IAAA 1CUDA 3PVCA 3B9BA 4DMUB 1BVHA 3RV3A 5EP2A 1R4MA 1CF4A 4R81A 2FI1A 3A9WA 4N8DA 5L3VA 1U98A 4TMWA 3ZD7A 5B55A 2R6GA 3KOUA 2WM9B 4UE2A 4MIEA 4CCWA 2BMWA 2PZFA 1I30A 1SPBS 1T9DA 2FW0A 3BRCA 4M0EA 1FVFA 4U6QA 2OGSA 1IYZA 4Z9FA 1MB0A 5IEBA 3RS8A 4HVAA 3IOCA 2YWJA 4WVLA 4BEBA 5AM2A 3BQNB 5IM4F 2JEYA 3S4YA 5DLQC 2BSQA 3HGQA 4ZI2A 1X2EA 1EDOA 1NVVQ 4D8VA 2OZVA 2B0CA 3AIOA 1QYVA 1K3FA 3QNWA 5K99A 2XRZA 3B7WA 4IHJF 2X5XA 4ITVA 5K3AA 4TTVA 4DV0B 1GL7A 2EARA 1RM3A 1IE3A 3LKVA 5IKPA 1IUKA 5LMUB 3VH4A 4Y2VA 1CX9B 5B3KA 1OQAA 4GP6A 3ZZ1A 1PJ3A 2DR3A 4H3KB 5D2CA 1T3HA 3K8YA 3OT4A 2VTBB 1XRLA 4XRGA 1SWVA 3D7SA 3UXYA 1TX4B 1QYRA 1UQUA 4PZPA 4MVXA 3CZQA 4P9NA 4D44A 5KKNB 3UENA 1BS1A 3EGVA 5CT8A 3K5PA 2VDQB 1VG8A 2EFYA 3FDZB 3MNFA 1JR3A 1DAPA 2G1JA 2IRWA 2WIAA 1EJ2A 4D8XA 2B69A 5CHEA 4ZWNA 2XCLA 3N2GA 1CY6A 4QBGB 1I5EA 3VTZA 5A9SB 2R1VB 4YAIA 3EC2A 3H19A 2A5FA 2BSAA 3EXHB 1D7OA 4FHFA 4OYLA 5EE5B 1H2ZA 2YFKA 5AKKA 3UT5A 3V34A 4DMHA 1HX7A 2X8JB 4EQ6A 4M49A 2RMKA 5F7JA 4UOZA 1EM6A 2PY6A 3Q3EA 4G56A 4US0R 5G4KA 3KJHA 2IVFA 1RZUA 3Q2IA 3DULA 1A98A 2GJ4A 3D4IA 5T3UA 1S2NA 2N42A 2WD7A 4TGLA 3PJEA 2OK7A 2XNJA 4FCTA 4XQCA 4YONB 1SQ5A 2O7NA 3VHLB 1HDZA 4UHCA 2OCKA 3RV4A 2FSIA 1JDNA 5LB4A 2Z2JA 4BNUA 1H6CA 1PT7A 2DY1A 2QRVA 4RD1A 5GGYA 3AF1A 1CZUA 4JV5B 5KTMA 3NVAA 1JQ3A 4JVMA 2RBEA 1BCRB 2YJTD 3ET4A 1J8MF 1V71A 3GEHA 4OPMA 4EPYA 5A4MS 1H2BA 1LTHR 4J0EA 5GZ3A 3PJRA 4KRFA 3SHFA 3PX7A 3BA1A 2AA3A 1W30A 4D4GA 1SVSA 4D0RA 1RQXA 2IY8A 2PM8A 4FJ1A 4NCIA 3QVWA 4TLLB 1EI9A 4RGYA 1G5QA 4CM4B 4E5YA 5DBGA 6Q21A 2AMFA 2CJYA 2HB6A 3OOYA 4QDTA 4H0FA 1IK6A 4LZOA 1XPRA 2IGTA 4G9BA 5TR9A 4AB1A 1H3EA 1TM5E 2VSNA 5K9ZA 1G8JA 2JH3A 4W5NA 3M3DA 1Q50A 3GUYA 2ID9A 1WPXA 1D7AA 2CXSA<