1PHRA

The crystal structure of a low molecular phosphotyrosine protein phosphatase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
154
structure length
154
Chain Sequence
VTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotyrosine protein phosphatase
molecule keywords LOW MOLECULAR WEIGHT PHOSPHOTYROSINE PROTEIN PHOSPHATASE
publication title The crystal structure of a low-molecular-weight phosphotyrosine protein phosphatase.
pubmed doi rcsb
total genus 61
structure length 154
sequence length 154
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1994-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1phrA00
1M5UA 4ZJPA 4LX8A 2NT3A 4RDCA 3QLUA 1JFTA 3Q41A 3OMXA 4KV7A 2VUHB 1ZVVA 1PEAA 4KPYA 2IPLA 3M6MD 1K66A 3M9XA 3OLXA 3TD9A 1JLKA 3H5WA 5DGCA 3ROFA 3HVRA 4RSMA 5TPWA 1QP4A 4JB0A 5TQ0B 1D2AA 3JPYA 1QPZA 1BDJA 5DTEA 5HM6A 4Z4FA 3QELA 1DBWA 3CRNA 4Q6BA 3OO0A 4QYMA 2JVKA 3T8YA 3QLUC 4G0OA 1SD5A 5TPZD 2FQWA 4LE2A 5F64A 2B1JA 4G0PA 4TMYA 4RK7A 1MIHA 3K4HA 4MPTA 1OXBB 4XASA 1NXVA 2FEPA 3KLOA 3IPAA 3EODA 2QVGA 4W5RA 3DGFC 3RVQA 4F11A 4YR7A 1L5YA 1YVUA 1EFAA 4G0XA 4PE5B 2PL1A 2JBAB 3GV0A 1PHRA 3GT7A 1LBIA 2WMYA 4NICA 5TE9A 3QX9A 5IBQA 1USGA 2FXIA 5DCLA 5ED4A 4F06A 8ABPA 3A3KA 5IC5A 3NNNA 2YHBA 2IKSA 2NUBA 4G0ZA 4RXMA 2R47A 5ABPA 4NQRA 4D74A 3MIZA 2PJUA 2ZAYA 1SXHA 4W5OA 1JL3A 4NCAA 1YK0A 3FFXA 3KS9A 1RPJA 2M1ZA 2MYNA 2QV0A 4N0QA 5EWMB 1UDRA 3RVRA 5JNTA 2H0AA 4RS3A 1I3CA 4ETNA 4MRMB 3ILYA 1ZY2A 3H1FA 3RH0A 1WETA 1NXPA 1D1QA 2V0NA 4LZLA 1ABEA 4RKQA 4F12A 1TJYA 2X7XA 2PUCA 3HS3A 2HSGA 3E61A 4DN6A 1NY5A 5JNVA 4RXTA 3C3MA 4MR8B 4IILA 3GYBA 5GOTA 1JH9A 3HO1A 3HV2A 4M88A 3FDFA 3HCWA 3RVJA 3F6CA 3H75A 3SY8A 1DP4A 3IP5A 2WY2D 2ID7A 1ISSA 3FMVA 5IUNC 4LE0A 2FW0A 2OENG 4UHKA 4EGSA 3Q9SA 4RZSA 3LTEA 4MS1B 2P4UA 3N0RA 4ZMRA 2OQRA 3LUHA 2I6FA 3QK7A 4MS1A 3ROTA 2W42A 1GLGA 4MQFA 2IPNA 2O20A 3I09A 1EWVA 3RVKA 3KHTA 3OM1A 2WWVD 4OLAA 2IOYA 3IP7A 1MB3A 5JNWA 1GUBA 2FMHA 2FMIA 5IULC 2VYCA 3IP6A 4RU1A 2JVIA 1JDPA 4G97A 4KMRA 2LUOA 5JNRA 4MR9A 1EAYA 1NXWA 3HJFA 1ZN2A 3T38A 2NT4A 5FWYA 1QQAA 4H60A 3NHZA 2CHEA 4PEVA 1SXIA 3T6KA 1YS6A 4N03A 3IDOA 3A10A 3M9WA 4HYEA 3E3MA 4L85A 2LP4Y 4EYQA 1PUXA 2WB4A 3JTEA 2AYZA 2GI4A 4XAQA 3RVLA 1Z17A 2JRLA 5B3JC 3SM9A 1H9CA 5HSGA 4Z99A 5HKOA 3C3WA 1KRXA 2QXYA 3MM4A 3UK0A 2L17A 1Z2DA 5KQMA 1R8JA 5DKFA 3RVSA 2FKAA 4JA2A 4Z0NA 1MB0A 4MR7B 4MGEA 3JY6A 3QEMB 1BDHA 1YTUA 4W5NA 2E4ZA 2WRZA 2F8SA 1B00A 4WUTA 1DCKA 1K68A 5TQ2A 3MMNA 3EQZA 5IUKC 3LKBA 5KQPA 1TM2A 4KVFA 3OQNA 4YV7A 1DC8A 5CHYA 2AYXA 1C4WA 4Z4IA 4OTZA 4FE4A 1A0OA 2GBPA 1Z2EA 5TPWB 1JFSA 4EYOA 1ZHHA 2PMCA 4ETIA 2A9RA 1JBEA 2FSPA 3HDVA 3MQ4A 4WT7A 5E3JA 2ID9A 3Q7SA 3QELB 4KNYA 4OATA 2KYRA 1SRRA 2L18A 4E7OA 3SNKA 3W9SA 1IIBA 1Z12A 4IMJB 3O74A 1EWKA 2WJAA 3NBMA 4KK4A 1RNLA 1LK0A 1FQWA 1PNTA 3A0RB 3H6HA 1XWWA 2LIVA 2R4QA 3O1IC 3QLVC 4IMIB 5JS2A 4D6XA 3UUGA 1XHFA 3HDGA 4UHJA 3OM0A 1JX6A 4XFKA 3H6GA 4PYRA 1PEYA 2PE5A 3OLWA 1E2BA 2IPMA 4EUKA 2FEWB 4KK3A 5CNKA 4RK0A 1S8NA 1P2FA 4KFCA 3F7NA 2P9HA 4YWHA 2FMFA 4EVRA 4OBBA 4FB4A 4F8JA 5JNSA 5FWXA 4LRQA 2JK1A 3EULA 3F6PA 4JASB 4G86A 4Q6WA 3GBVA 2LBPA 3BBLA 4TLMB 2PUEA 3O2QB 1VPWA 3DZDA 2A9QA 2QSJA 1Z25A 1JWLA 4O5AA 3O21A 3KTOA 4LDZA 1VLZA 3R0JA 1KMIY 3LUJA 4G0MA 2JCGA 3FGZA 1AB5A 3H5VA 4LE1A 1XHEA 3O2JA 4O1HA 3OLZA 2VUIB 2CWDA 2E4XA 2L19A 2E4UA 4MQEA 5T3YA 1NXXA 2IYNA 2H3HA 2QVCA 3KYJB 1RXIA 3EDCA 4OLBA 1GCAA 3L6UA 4L4UA 1VKRA 1GCGA 1MAVA 1ZITA 2FLWA 3N8IA 1JFVA 4YS6A 1QP0A 1YK1A 2NZUG 4KZKA 3HM9A 3OQOA 1DBPA 2NZVG 2HQRA 1JYFA 1BAPA 1ZGZA 3H5TA 3JVDA 4RWEA 4MQFB 4WWHA 4RK5A 3O2SB 4EY3A 5EWJA 1NXTA 4GNRA 1QMPA 1QP7A 1JHZA 3LOPA 1W9HA 1P6UA 2PUBA 2PKXA 4NV3A 4S04A 1FFSA 3DLHA 5TQJA 2FQXA 1QO0A 2Q5CA 4MR9B 1Y1LA 5EWLA 3B2NA 4N41A 2A9PA 3HUTA 2DRIA 1USKA 5FWYB 1FFGA 5B3JA 1RXEA 1QQBA 4D6YA 4MLCA 3CU5A 4W5TA 3LUAA 4MAAA 3CZCA 3CHYA 3EJWA 4MS3A 5BRJA 3KG2A 5T7BA 5C5CA 1ZAYA 5CNIA 1A2OA 3OQMA 2TMYA 1YMVA 9ABPA 4TLLB 3KCNA 3G85A 3BRSA 3D8UA 2FLKA 2A9OA 1D1PA 1EWTA 2FEKA 3IPCA 1BDIA 1Z16A 2PAFA 5IEBA 5BR1A 3TO5A 3N53A 4MS4A 1JF8A 1FSPA 3MA0A 1SXGA 5KQLA 1DZ3A 1HEYA 4OG2A 4G0YA 3MF4A 4W5QA 1M2FA 3F73A 3HK2A 1YS7A 4EYKA 2HJ9A 4IF4A 5PNTA 3TMYA 3URMA 3BILA 5KQGA 3CLKA 3EAFA 5FBHA 4KQ9A 2J48A 2FTKE 5TQ2B 1QNLA 4E7PA 4YCSA 1U04A 1NXSA 3OO1A 2QR3A 1U2QA 1Z15A 1ZH2A 3Q7TA 2QW1A 3N75A 3ILHA 3O75A 3QX8A 1DC7A 1P8AA 4Y9TA 1DBQA 4XXHA 1APBA 3OLYA 3HEBA 4H3KB 4EYGA 4P98A 1PNRA 3RQIA 2MYUA 3RVOA 2PL9A 3GRCA 1DCFA 2F8TA 2E4WA 2FN9A 3K9CA 3SQNA 3QLVA 2CHFA 2MYPA 4KRFA 2ZWMA 5IEJA 2L2QA 7ABPA 4HNRA 3P9YA 1E6KA 1U8TA 3UKJA 4NCBA 5I4CA 1EHCA 3DBIA 4H3HB 3LUFA 3QLTA 1LBHA 3EGCA 1KRWA 2GX6A 5KI6A 1C0EA 4JB2A 2LPMA 3HZHA 3NHMA 3QEKA 3TX6A 1OXKB 2RGYA 1TMYA 1NXOA 4RY9A 3T95A 4RK4A 3RVPA 5C5EA 2YHAA 3S99A 3HSYA 3NNDA 2IPAB 2MSKA 4HNQA 1DRKA 5TQ0A 1LJUA 4RY0A 3LUDA 5JS1A 1CYEA 3HUUA 3I45A 3L49A 3I5AA 4WXMA 2FN8A 1TLFA 1YIOA 3OMWA 4MYRA 4P1ZA 5FWXB 2PUAA 4MLDA 5BQ3A 4IGAA 3JS5A 2IDMA 1USIA 1F4VA 3KLNA 3RVNA 1TVMA 2PUDA 2RJOA 3FFWA 4RK6A 3H5LA 5IUJC 3CZ5A 4EVQA 1F51E 3VNBA 2GKGA 1RZRA 4S05A 4N76A 1QO0D 3H1EA 2GWRA 3MYYA 2PUFA 4FE7A 3SAJA 4ML3A 4XLTA 4RY8A 3CKMA 3KYIB 3C3KA 3H5OA 2JB9A 1NATA 2XDYA 4MQEB 2JBAA 3IP9A 4N47A 4Z4CA 2WJWA 1U2PA 1U0SY 3I42A 3KSMA 2CD7A 3NNSA 2BGGA 3CG0A 2HQOA 5IX8A 3N6VA 4PICA 2HQBA 1YMUA 4QICA 1DJMA 1QKKA 3O1JC 5JNUA 3GA5A 5DLEA 4N0PA 1NTRA 4JAVC 3VNAA 3HXMA 3TB6A 4RV5A 5EWMA 1ABFA 2QU7A 1AB6A 2VK2A 3CFYA 4YP9A 2PUGA 3CNBA 5EWJB 4MRMA 5TPZA 2R25B 3JVIA 3LFTA 2R48A 4IRXA 1JYEA 3H5IA 4GPAA 3SG0A 4PZ0A 1VRVA 2MSLA 3GWGA 3LMKA 1ZDMA 5FBKA 4Z4HA 2E4YA 3BRQA 3CS3A 3N0WA 4Z9AA 2FVYA 4DADA 5D2CA 3A0UA 5CNJA 4MR8A 4QPJC 5EWLB 1GUDA 3DGEC 3RVMA 3LUKA 3Q7RA 1W25A 4WXEA 4XARA 1ZH4A 3DLBA 2FQYA 4Z4GA 1DG9A 1ISRA 3CG4A 3FFTA 4MS3B 1KGSA 1Z26A 1CEYA 4LDAA 3LKVA 3O1HB 4KREA 4F3TA 2FMKA 1J56A 4B09A 3BREA 5KWSA 1Z13A 2QZJA 4KQCA 1URPA 4RK1A 3GL9A 3LUCA 4ZMSA 5GQSA 2JVJA 4TN5A 4ETMA 3JPWA 1E6MA 4YRZA 1FFWA 4MS4B 1L5ZA 4JOQA 1M5TA 5BRAA 4G0QA 4Z4EA 1M2EA 2N9UA 4CBVA 4ZYLA 5KC9A 4YO7A 1A04A 1CHNA 3OLVA 4O1IA 4HNSA 3KJXA 6CHYA 3H1GA 1MVOA 3GBPA 4Z9BA 3LUGA 4Q7EA 1E6LA 3CTPA 4YGXB 3Q15C 2PLNA 3C6QA 1JDNA 1LJLA 3C97A 3EQ2A 4RXUA 1BA2A 1Z18A 1T34A 2HPHA 3N0XA 3D02A 6ABPA 1D4ZA 5HQJA 4RKRA 1P6QA 4QYWA 5CNMA 2M98A 1ZGGA 4YLEA 2MSWA 4ZPJA 3KKEA 1BVHA 4EVSA 2RDMA 1DRJA 1RZRD 1DCMA 2B4AA 2MYTA 5KC8A 2RJNA 2E4VA 4DQDA 4MR7A 4WZZA 3QEMA 4JP1A 1ZESA 1D5WA 3G1WA
chains in the Genus database with same CATH superfamily
2FDCA 2PGXA 3MSXA 4KZPA 5DBEX 4B5KA 2FZEA 2FZGA 3VR6H 2WIBA 4DGQA 5LA6B 1ZVVA 4X20B 1W0KA 2XZDA 5TB5A 1PRYA 2MSNA 1TC1A 2Q2QA 3M9XA 4GOND 3OLXA 5CIWA 1Q20A 4M37A 3WFJA 5CXUA 4QODA 3OAAA 1XZBA 2H2HA 3RFXA 2CMFA 4WBNB 1G21E 3AEQB 3ORFA 1BDJA 1N0UA 2HQ1A 1LS1A 2O48X 3TLGB 3ZHSA 3KOOA 4JUBA 1MMFB 3G5AA 3FI0A 5CEFA 5D7BA 3S2ZA 4HFNA 1OAOA 5FTWA 3OZDA 5C1DA 3BF7A 2QY9A 4UATA 1A9XA 2HN9A 5ISMA 4MPTA 4Z53A 1NF3A 2LWIA 4GYJA 3GLTA 3BFKA 5U9CA 1ZM3A 4U7TB 3QKUA 4RMNA 3D1JA 3DGFC 3EIQA 1S1MA 2YS6A 3KD3A 1KE2A 4ARVA 4W5RA 1WPQA 1KAGA 2IYXA 4YQEA 3AMVA 3NIGB 1A7UA 3WVNA 1KSJA 3DT9A 1V26A 3I2GA 4PX2A 5ADUS 2IHNA 3DVLA 4QXQA 1OLUB 2AJLI 4GR4A 1G5IA 3RS0A 4KN9S 3UYKA 2LW7A 1WMDA 3A4VA 4ALIA 3QOWA 3PR2B 1RAHA 2J5XA 4KDFA 1G7TA 1PJ4A 3CIOA 2CFRA 4K7JA 4X1KA 3KELA 3T4PA 2F4NA 2HU8A 3AJ8A 3VU3A 1JL3A 1VL8A 3O4HA 4JUIA 5C51B 2CBGA 5CLJA 5ED0A 4LOLA 5THQA 4AJNA 2VG8A 3NVAA 4BFLA 5LDHA 4TV8A 5JZBA 1UJ2A 1ZMTA 1LPAB 3QBTA 4MRMB 5F51A 3ITDA 1ZJYA 1M34E 4NENA 2XW6A 1OGJA 3U3MA 3NANA 4F12A 5A4AA 2WG2A 1OI3A 1NRXA 3BGIA 2F7SA 1PFYA 3L8MA 4EMSA 1C2TA 1CKEA 1EE2A 1P61B 4KN6A 4BGUA 4MULA 4L3WA 3WWZA 4X71A 4IILA 2GXQA 2RHWA 3FMPB 3NKFA 4PWYA 5FBZA 3W79A 3GLGB 3WGGA 4B6QA 1QYXA 4F85A 1NG1A 2GPTA 4UMDA 4W99A 5LU8A 4REMA 4RWZA 3IP5A 3VU9A 3C43A 1ISSA 3W5VA 4KTVE 3COWA 3NTVA 5C4IA 3DYVA 3M5CA 5JLAA 1LF5A 1E9BA 2GGSA 2Y27A 4Q66C 3DMGA 4RZSA 4PZ9A 2H9IA 4X6XA 5AJXA 3ROZA 3VR2D 4BATA 4BVJA 1XALA 4PSUA 4DCSA 1JFFB 3PTZA 5EJ6A 3CLHA 2VYFA 2WKQA 4PC6A 2Y68A 2ZAMA 3WWPA 4YT2A 2J0SA 3UBTA 2ZTHA 3WLIA 3LNTA 2PY6A 4LGVA 3F78A 3WGZA 4AZVA 2P3SA 1JA9A 4N18A 5FO1A 2G5TA 5ELMA 4G4IA 2WSBA 3C1UA 4FOOA 5EIEA 3VKFA 4ER3A 4HJXA 4KIJA 4B7AA 4JGGA 4RNDB 2BR4A 3ZLVA 1D8TA 2JFGA 1H8EA 2C31A 1IN7A 2BMFA 2XKBA 1ZA2A 4OQQA 2OO3A 4G1MB 3D3WB 3LPAA 3ON5A 3OKPA 4WW0A 5EZYF 2ZZKA 4MCJA 2CLLB 5CX1A 4FB5A 2H5JA 3NHZA 2ZCVA 2REOA 3NOXA 3VSCA 5BSHA 1RLMA 3TNDA 2WJVA 2PUVA 1EX1A 3KKPA 4IDHA 2OHIA 1NP6A 1U0JA 4QGFA 1P7PA 5EHZA 3OE7A 3BGOS 4OU4A 3ZZTA 1KQOA 2NPIA 1G5FA 4JJ7A 5CCDA 1T4GA 2GI4A 2PMKA 1QQ7A 2ZJ2A 2WQZA 3GEPA 1SA0A 4QPCA 4NMLA 2IP1A 2VXOA 3KZNA 3A6DA 5EUMA 3BTOA 1K3TA 2NQTA 3WAJA 5HSGA 3L6DA 2W8BB 3PNBA 2A5JA 2C95A 3H9UA 3BG5A 4QHTA 1PTKA 4FOTA 3UK0A 1KRXA 1XEFA 2PV0A 4OREX 4R51A 5AJHA 1QYVA 3FB1A 1RQ7A 3EGEA 1E18A 2VO1A 3JY6A 5LXTB 1Y9ZA 2TS1A 1DZIA 1ZR2A 4OX9Y 1I4DD 2F8SA 1IVYA 1BEEA 1LQUA 1XOIA 1NZDA 1ZCZA 4MGZR 1DCKA 5BYJA 1M0SA 3IAHA 5K0SA 3GPCA 1G42A 4TTRA 2HAEA 2QM8A 4ZO9A 2CCGA 1C7JA 1DC8A 1QDUA 1W88B 2JGRA 5FL3A 2AOUB 2X1LA 1XVAA 5K0CA 3ETEA 2QPLA 2V74B 3VNUA 2A3RA 2IIQA 3DT6A 1JLLB 1LPNA 4G5FA 2H0RA 1O3YA 5CAEA 1F8GA 1P1HA 2Z5GA 1RCFA 3OVMA 3E3NA 3TCKA 2RHOA 2FOIA 1JBEA 2FSPA 3I2KA 3PRJA 4KYVA 4P3XA 3R7WA 3C3XA 4B6RA 2D1RA 3LXXA 1E2UA 2ZUFA 4MINA 4NNPA 4OKIA 5CT9A 3NDPA 5DHRA 5DYIA 5CGZA 4BP9A 5IJ9B 1QRUA 4BTLA 4NU8X 2B3TA 3TM5A 1GHTA 1K5GA 3BWXA 1SC3A 4LY6A 5H80A 5JSZA 3KZVA 1FTWA 4L7QA 2WLTA 3IKVA 4RIFA 5M04A 3HVHA 1DOZA 4JLAA 2XPCA 2Q3EA 3DS8A 5K0FA 4GOLD 5K20A 4Y6PA 3W7AA 4D4LA 3S70A 4G1EB 2LIVA 4G84A 2RGEA 1IWPB 2DJIA 3LFUA 3AVPA 1J33A 4M0KA 4UQOA 5F9FA 4C7OA 5HF9A 4CDNA 2X6RA 1EGQA 2QK4A 2PE5A 2C0QA 4X60A 3C3JA 1MQSA 3LFHA 2FOLA 4EUKA 2GKSA 2VPIA 4TUYB 4KK3A 5FB3A 1JDZA 3IQXA 4ZOLA 3AW9A 1T26A 2H18A 3B89A 1OXXK 3S3TA 5B2ZA 3UBMA 4WJLA 2QE7A 2V9CA 3FOAA 4KYUA 1KI6B 5DT9A 4EQ6A 1E96A 4KC0A 5FI0B 3W5AA 5L3RA 3A2LA 4DG9A 3BK2A 4DANA 5IKEA 2PG3A 4FHEA 4OY3A 1KY5A 1JEYB 3WGNA 1ORRA 4B83A 4C01A 3AF5A 1JUDA 2XF8A 4YQYA 1EU1A 3GRYA 1J00A 3EY4A 4XOUA 4HATA 3K72B 1AB5A 4EWLA 2F3SA 4V0LA 4LE1A 2JIRA 3DPIA 1B93A 2E0IA 1Y3HA 2EAUA 1NX6A 4HADA 4KWHA 4ANFA 1AA9A 4YAFA 2IYNA 1FPQA 4LDRA 1QHXA 4OLBA 4FJ1A 1GQSA 1V7ZA 2O7NA 3UYLA 1R0LA 2FUKA 4LXQA 2C83A 1RPTA 3HXPA 1MAVA 2V1XA 3D9QX 3K0KA 4DR4B 3LIPA 2GD2A 2GN0A 1CQXA 4AKTA 3ND8A 3U81A 3SNHA 3U9TA 4CIAA 4B35A 4HGRA 3JAMA 1QH8A 4J03A 2IUYA 2BF7A 3WYNA 5DHQA 1RJDA 1FSSA 1XVLA 1NNI1 1SELA 1TTHA 1O95A 1C4XA 1UK9A 1ZXXA 1QJ4A 3QLJA 1HDCA 3SC2B 1EE9A 1UFKA 4FN5A 4KYIB 2QTVA 3IHTA 5EWJA 3D59A 2XYGA 1SHLA 5AD1A 2VAXA 5LL6P 3D5EA 4BO8A 4AMVA 2CYCA 3U1TA 1O03A 3PQ4A 4K9DA 4B7CA 1MDBA 4KX3A 5JMOA 3KC2A 1W9HA 3EW7A 5WRFA 3WL6A 4EO9A 5HP4A 4IX9A 2BDEA 1CWUA 3IEKA 4P3KA 4RMJA 3DZJA 1JZQA 1SKYE 2ACWA 2RHGB 2R8YA 2WUWE 3A4MA 5DBGA 5IFKA 5F9HA 3EDRA 3HUTA 2JGAA 3UK7A 1ZL2A 1O95C 3ZJ5A 2A86A 3LX8A 4GDFA 4EMTA 2XYPA 1WPGA 2JAHA 4WD3A 3TR0A 5GV7A 3ZXXA 2C2OA 4H7EA 3IB3A 4OB7A 4Y1RA 3JD4A 3FPEA 2C4HA 1A2OA 4BMXA 2HH9A 4I2NA 1OFHA 4QU5A 4I6JA 4EHJA 4NG4A 2UKDA 3D7KA 1IK4A 1PZHA 4AYXA 1D1PA 4HAIA 4JU9A 3KZOA 3ENNA 4GPEA 4Q7JB 3ZZUA 4HNTA 3N2GA 2C8JA 1UXGA 4CKEB 3H1AA 2BBSA 3LC0A 3X1MA 2FSHA 4FU0A 1MX9A 1KDZA 1HLDA 3VPFA 1IK6A 4Z9FA 2RHHA 3MVEA 4ZIRB 2JI4A 1JEEA 3LRTA 3MGCA 4A8HA 3PR3A 4L74A 1YB7A 5DGHA 1FXWA 2P4SA 1WBDA 3AG5A 1C1DB 3DTVB 4MIEA 5REQA 5BSKA 2HJ9A 4TLEA 1ADJA 4YJ2A 4MQLA 4E12A 3LQYA 4GL2A 1XTUA 5DGTA 3CVWA 9ATCA 1Z62A 1XP5A 3B1ZA 4GVPA 3CRMA 5E7MA 3X43A 3DBHB 3R20A 4JNCA 3KB2A 4L50A 4PGFA 3A6FA 3B6EA 4I4TA 3R7BA 3P96A 1G3MA 4Y9TA 1Y5MA 2BFPA 3DL4A 2ZWVA 4O4IA 5EN4A 1PS0A 4P98A 2VDVE 4INJA 3AL2A 5TV2A 4H08A 1QZUA 3PX2A 4ZVTA 1SUEA 2NV6A 2ZWMA 1ZH8A 1IONA 5C37A 3VGJA 1ZINA 1RQXA 3N9IA 4ME6A 3FNHA 1U8TA 3MJVA 1ENPA 3DBRA 4JH0A 4XSGA 4O2BA 2A0YA 1TKAA 1WOYA 1DC4A 2DBRA 3FBTA 4XSHA 4H18A 1Z06A 2AFVA 1JBQA 1HDRA 1RQGA 1GQQA 4L0DA 4M22A 5JRDS 2CC2A 3EGCA 4B6PA 2ONJA 2GESA 3ZHBA 4BZPA 1G291 3O47A 1SIOA 3OWOA 7AT1A 4HK4A 3PDCA 3UKOA 4MXDA 4W1RA 2GLUA 4RK4A 1SHUX 2F8LA 1REQB 2QJTA 5TARA 3TOVA 1WUHS 2W58A 1QF7A 1QIFA 1ST3A 1L9KA 1NVWQ 2I8AA 3BZUA 3LUPA 1SNYA 4DLTA 4DV4B 4LZPA 2F3QA 2KI5A 1QG2A 2P9YA 3VR6D 4E5PA 4BEWA 2B5OA 4KB5A 1JLHA 3Q2IA 2H1RA 2PUHA 4G0VA 2WOOA 2FN8A 3AM5A 3LVQE 1W73A 2P1ZA 4A5SA 5IANA 3FLMA 3M4ZA 1N7HA 4HNAA 5B1EA 2VYND 3AX6A 2AG5A 3G23A 3MS7A 4M83A 5SZHB 5HS4A 3C70A 4ZV7A 1BVYF 2YY6A 1RIFA 1SCUA 5K0NA 3ESRA 4DLBA 1ZWKA 3BWVA 3CKYA 3EXEB 4X0EA 4PLCA 1XEWX 1MV5A 2P9CA 4GC9A 1AHNA 1AKMA 2HA5A 2VHZA 3R4VA 1T2EA 3OZWA 5FBQB 3THYA 4LJSA 4B3XA 3KYIB 4W6ZA 2JIOA 1XNGA 4Z4CA 2ZJOA 5DWDA 3SMVA 1XMIA 2ASVA 2G6TA 1Z4IA 2VWQA 5JBNA 3TIFA 1OFUA 4PLZA 2PU7A 3NGXA 4YMVA 2GZ2A 1QKKA 1RR6A 3CMCO 4O6VA 5AI0A 1DKOA 1JJAA 1UMCA 2VXCA 2Y4OA 5T57A 3LV8A 5EL0A 4EW6A 1N6HA 2C7OA 1DINA 3L7IA 1N0IA 1WDMA 4GOOD 3S0JA 2JLUA 3S1SA 4K9NA 4E31A 3D3QA 2HIGA 3TQFA 2VK2A 3VTFA 3D7SA 3EB9A 4YCNA 3WLPA 1T36B 2PO5A 1FNSA 2NXWA 2P11A 3HPRA 3JQ8A 5JZSA 5TC4A 3VU0A 3PNVA 1S7CA 2QXTA 3AILA 2PXHA 5KSYA 1DL5A 1A9YA 1GYPA 1FU7A 1PVDA 1W49A 3AR7A 1XMXA 2QQEA 1HF3A 4M7RA 2OFWA 1OA0A 1N2SA 1P7WA 3KPYA 3QY9A 2ZVQX 3EGWA 5D2CA 1B16A 1JJVA 4MR8A 3DTNA 3T5TA 3GT4A 3I12A 4Y1EA 4X8HA 2BR5A 5HM8A 2QG6A 3C87A 1Q1GA 2IVFA 2TSYB 3JX9A 4KHPB 1VJ5A 2ZLBA 3A9CA 4Z4GA 2ZB7A 5DN6A 8ADHA 4X6UA 1DSSG 2CL7X 4RMIA 5BUSA 1Z26A 5LQMA 1CEYA 4HGQA 3RU3A 3O1HB 5AVVA 4F3TA 2OM6A 2DETA 3IO5A 2JFQA 3ISJA 1KYZA 2QZJA 4KQCA 5F23A 1U0OC 1AXGA 4ZMSA 5BORA 2ODPA 2NSYA 3ESQA 3BRCA 5F1OA 1D2MA 1YC5A 4L9RA 3ZCPA 4FPXA 4WK0B 1VMAA 1RLOA 1V43A 5A9RA 3TXAA 4DARA 1XCPA 1S8AA 4G0QA 1TLLA 1P9OA 2YR0A 2VPPA 5C2JB 5JYBA 2PWBA 4Z4EA 3F8WA 1B76A 4NPHA 1BKSB 1NMZA 3UMYA 2V9PA 1W29A 2XZPA 2ANCA 4LV5B 3VPDA 2LCFA 4ENRA 2VOJA 2I03A 1MVOA 4GIBA 5GONA 3UFXA 2QMUA 1RACA 3H11B 3T0FA 4I9FA 3OCWA 3FR7A 4ZANA 2VRNA 4Z3KA 2HO5A 2GCOB 4BGDA 1AU9A 4EHHA 2BFDB 4H27A 3RI3A 4YUAA 5KHAA 1Z8DA 2QUJA 1G8SA 1ZUD1 2FFJA 4KAXA 2QSZA 3CWQA 3P9IA 2YOFA 2CNDA 3C4VA 3WXMA 2VHUA 4NONA 3WSTA 5K45A 4IGEA 1XTRA 4DV1B 1LPMA 4NU0A 3PRYA 4H7JA 1US8A 4FBMA 3EG9B 4DA4A 3BULA 3KKEA 4R01A 2CUTA 1U0BB 3OZEA 4IM7A 2RJNA 3H9JA 4DQDA 1AQYA 3NAGA 5COQA 1B6GA 1MVNA 1Y1TA 3O83A 4UUQA 4AJ4A 1V48A 1CZNA 1N5KA 2I7VA 1KK0A 2ZSHA 2YIDA 1P0CA 3BB3A 1D7OA 4FIDA 4FSXA 2NT3A 4BMYA 3Q41A 2J59A 5DXAA 1B8PA 3TOZA 5BQFA 3FB4A 1MO2A 3HDYA 3JR7A 1GZVA 4N3CA 1UK7A 1UC8A 3X1ZA 2K5UA 5C8YB 1TVEA 3GA0A 1PT7A 3CEAA 2XX3A 4LJ8A 4TTQA 3P1JA 5CU7A 3UJHA 1QP4A 3EA4A 3SD7A 4GO1A 1D2AA 1U7TA 3X1DA 4QGBA 4O8ZA 4UHCA 2BM9A 1XLTA 2Y67A 3DLCA 1N8NA 3ZNPA 3DC7A 1KI1A 5FNVB 3AM1A 3OEEA 2XZOA 2XJ4A 3L0BA 3L2OB 4IOKA 4M9ZA 4BUCA 1VLVA 4DRZA 4ITVA 3P2OA 3EIHA 2H2DA 4XTCS 3CZQA 5JROA 1Z75A 5BN4A 2Q4BA 5L3QB 2H51A 5IJ0A 3FOCA 4W63A 4XWAA 4EKYA 1K86A 1Z2AA 1ZZGA 1HG0A 3HSKA 2W48A 2WT9A 5HMMA 2OFFA 3ESZA 4AFNA 1UBOS 1HDEA 2WUVA 1OIWA 4KITB 1CNEA 1RI2A 4UEJA 1MOSA 2X0FA 3BIFA 1QNFA 1RI1A 4U1RA 4UDXX 6ADHA 3FKQA 4IGFA 3DCIA 4FXOA 1MTOA 1NJFA 4NMMA 4F4CA 3IUNA 2QTZA 4JYAB 1Y42X 4K6MA 3TLMA 4KXUA 1E4VA 1R8XA 1GIAA 4DGSA 3LQFA 3E58A 2B61A 2R47A 1QTIA 3NG1A 3KT3A 4AP9A 3QUTA 3PTAA 3PL5A 1PG0A 3ELBA 3NTRA 4OGFA 4BQRA 2VSFA 4LHEA 4LHXA 1W1IA 2ORWA 1NOJA 1ZUHA 3GFRA 3JAWA 4BVGA 1OZGA 1QK3A 521PA 4UNPA 3E8MA 3PJFA 4CM8B 3AKZA 2A5LA 2C4NA 3ABOB 2PUCA 4MWDA 1PFGA 4AU1A 4CL3A 4X7MA 1QRSA 3HCBA 3ZE8A 1V5IA 1Q0QA 2PMWB 4Q4JB 1K5HA 1M2OA 5KX5F 3GP5A 1N0HA 3LWNA 1CJSA 4DTIA 3R5HA 3KQQA 3MJTA 1JJBA 1MC1A 3GZ4A 1X1RA 1CJCA 2EBFX 4X84A 4ZAXA 4BVLA 3H2BA 4OK6A 2WY2D 3KVVA 1X3SA 3GQVA 1YBMA 3KSAC 5G3ZA 4AP6A 2X42A 2ZU0C 4GXTA 3TOSA 4DJEC 1V37A 2Z04A 3W5CA 2ZJ8A 4FYHA 4RENA 5EVCA 2B8EA 2G9VA 2BGKA 3CKLA 3OM1A 1NQXA 4JT8A 2FCRA 3F3MA 5AKZA 2VZ0A 4ZT5A 4PQFA 4L95C 4LSWA 5JNWA 1DV2A 4R2JA 2FMIA 1D1SA 3M83A 4H7FA 3CTMA 3NOOA 3U3DA 5G0VA 4TWRA 2O0KA 1KVTA 2GZAA 2ZPTX 4FINA 1OKKD 4JFRA 4OGWA 4P53A 1BCSB 2A0XA 2VK4A 3EG5A 3QVMA 1ES9A 1Y5LA 1M7GA 4JLBA 4MGYR 2NT4A 4JVNA 3ZU6A 1OZAA 3EGIA 2ZJ7A 1YZKA 2O3SA 3O90A 3IKLA 4HB3A 1OWNA 3MRXA 1NVEA 4H3VA 4K0RA 3HHEA 4RETA 4XX0B 4N03A 2FWNA 2H1IA 2JAOA 4OHFA 3VX3A 3M33A 3A3YA 4WECA 2OCGA 4B6FA 2PO7A 1VHWA 3L43A 3VTZA 1XLWA 2HLNA 5JPCA 2A88A 1WXQA 2H4WA 1IB0A 1U0EA 4EGFA 1Y1PA 3V2HA 4FUQA 3ZH9B 4ZQBA 4TTPA 2W7TA 1JDBB 4IW3B 5HBGA 4JI2B 4NE7A 1NC1A 5FWDA 2V97A 3BJMA 4N5NA 4P2BA 5CTJA 1NM5A 4BQOA 5JCZA 8OHMA 5KINB 1IUPA 3FPGA 1IJFA 1E79A 4ZD6A 3VPCA 1N8SA 2GSWA 2ZS9A 1F7VA 1LPBB 2JRCA 2WRZA 4UOQA 3CV3A 3KXKA 2ODAA 3MMNA 3MS4A 1J2EA 3RHTA 3RRXA 1SUIA 5EE9A 2O0LA 1TM2A 2GEJA 3UJAA 1K3FA 1TPYA 2OFOA 1A0OA 4BLTA 1PV2A 4X1IA 2CSXA 4BP1A 1NM5C 1AY0A 1WY5A 1OAAA 2WSSA 2CB0A 2XTZA 2XYRA 2C1EA 2XUQA 1IOVA 2Z6VA 2HU7A 3KZKA 3P19A 4QUEA 3UWKA 1CY4A 3RS5A 4EHBA 4MUEA 3IIMA 5BR4A 4CCYA 4ZTZB 3B82A 2R6HA 4LZOA 4DQVA 2O5CA 4L8FA 4HB0A 1C3EA 4ZCRA 4C29A 1KYQA 1SU4A 1J8DA 2DPYA 4RESA 4X1YB 5CB4A 3MAAC 4P58A 3TW6A 3ZGLA 5H02A 1JBKA 3M8KA 3ROKA 3A0RB 4DL9A 1OXVA 3ZE0B 1NI4B 2G1JA 3S7TA 1JEDA 2YUIA 3D4LA 1I32A 2QUZA 3R74A 4PHGA 4Z8XA 1J9EA 1BFDA 2Q07A 5ENDA 1QWOA 2QRZA 3UUGA 2GZHA 3PWKA 1N0VC 4XWTA 2NACA 2YC2C 3NTLA 3ONVA 4XFDA 1ESMA 1M3SA 4NL4H 1L8OA 4X00A 4ZMBA 3TMKA 5B64A 3HJNA 2QRGA 3OIVA 2QVBA 3D6AA 3NIDB 1G5RA 2X0JA 3O8OA 4GI1A 4US2R 1IQPA 2XXBA 4BO1A 4OQYA 4GS5A 2P9HA 4KPFC 3W5IA 3LP8A 4I3FA 3JATA 1RZUA 1X7HA 1OZHA 4KFUA 2XUHA 3AY3A 5HJ2A 1E1RA 4N0DA 2I6SA 2FP4A 2ZITA 3V8NA 2ISSD 1DAOA 3RIEA 3DKKA 2WVGA 2P5SA 2RI0A 2CXOA 2NAFA 3Q85A 3D8HA 3LK6A 3VO8A 3I76A 2WYVA 4KSCA 1Y7TA 3T5CA 3A1EA 3Q11A 3IULA 4KVGA 4O5AA 2SICE 4HEHA 1KZ1A 4J43A 5CFPA 1KMIY 4UUMA 5BVHB 1AA6A 1NVKA 4EL0A 2DY1A 2IZ7A 2WHYA 2F1OA 3B6KA 3EY9A 3I4FA 1POXA 2PFGA 3O2JA 2QP3A 4G24A 4C0BA 4EG3A 1J2YA 3HN7A 1TD9A 5CG2A 1L5RA 2NAPA 1Q3HA 1H6DA 2WF6A 5DLDA 2M6LA 4M1SA 5KIAA 4X44A 2HF9A 3LC2O 2GAFA 1A4XA 5I9NA 2MINA 2VZLA 3IO3A 4PO8A 3V4RA 1OILA 2REBA 2XZLA 1GPMA 2VWHA 2W6JA 1WU7A 4KZKA 4QGGA 5D6OA 5DCYA 2OVBA 4AZWA 1YZFA 5EVJA 5BN5A 1WXDA 2GNOA 4JLPA 3R9XB 1GQYA 1P8JA 1QIDA 1UM9B 4J76A 1L5HB 3DF9A 1TEXA 4KX5A 3SBXA 1BCRA 5E0OA 2EW8A 1QBGA 5AW9A 3RTEA 5C80A 5JUWA 3F1LA 4OQDA 1C8BA 4WWHA 1DBRA 4C6TB 3TNYA 2DXIA 2CCJA 4GNRA 1NW4A 1TGVA 1X1CA 1GRVA 4PGHA 3E70C 4A3SA 1IG3A 2GXSA 1L4NA 3CUVA 1QGOA 2V7UA 3GP3A 3HL4A 2I1LA 3D3EA 4AJIA 2PUBA 1IBSA 1LVUA 2Q6LA 1L5QA 2V4ZA 3LIIA 4MR9B 1FXUA 1KY3A 2JLQA 5ADHA 5KVCA 1YR8A 1V1MA 1Z6TA 2G07A 2PYIA 2DRIA 3IRUA 5B3JA 5EUQB 4CQNA 3AOEC 2QWXA 2R84A 1TAUA 2Z4SA 2H52A 1WHTB 2BCGY 1YT5A 1RRGA 1I13A 5DULA 3D6MA 4DEVA 4BFYA 5ITWA 2I54A 2NTYC 5I01A 4D92A 1OBCA 3AM3A 5JR3A 2NPOA 3CPJB 3FA2A 3W3AA 1PIWA 2IPOA 1BMFA 1VHDA 4TZ6A 2C3PA 4B4KA 3PZRA 2FEKA 3OG9A 5EJ5A 2TECE 2WJIA 3KWFA 2RJ3A 3LTNC 3WA7A 4CL2A 3GLGE 1G21A 1H1LB 2OAQ1 2R5FA 1N6PA 3PNKA 2A7XA 4ARIA 3ZWNA 1B0PA 4BB6A 4QGAA 2Z5VA 3OIDA 3VKWA 3WL3A 5A4MS 1Q16A 1CEXA 2BC9A 2WWWA 3IAXA 4JI7B 3NHKA 4IIVA 1GKIA 2Q4TA 1VIYA 1P1FA 3CNQS 5HK9A 2XB8A 1J5PA 3L40A 2FWRA 1PCXA 1J5XA 3M6WA 1KJ8A 4WNCA 1K2WA 1CFJA 1GVNB 1JQAA 5I7WA 2C9MA 1O96A 2ANBA 4PX5A 3EGVA 4EYGA 4WEOA 4C04A 3EGDB 1KH2A 3NW9A 4BECA 1TCCA 1Y8CA 4F4IA 4KQ2A 4JXKA 5CDUA 1RLUA 3AO0B 1ECFA 1CEEA 3THOA 1XNHA 2E1PA 1FFXB 4RTNA 3QW4B 2HFJA 3IBGA 1J0DA 2GCGA 1CY7A 1JAYA 2V4UA 2ZUCA 3UKJA 1Z45A 1FMJA 5GJWC 1BVUA 1RXVA 2UVDA 3F6SA 4GEGA 1G6KA 3WS7A 4HC4A 1TECE 3QLTA 2FEOA 3EEBA 2VAWA 3ZZ1A 4JI8B 1ZMRA 4V0QA 4Q03A 4OA5A 5CM8B 3FPBA 1F4LA 5BSGA 3Q7IA 3MJSA 4R1SA 1YQDA 1O94D 3HN2A 4GOJA 3S8EA 1IOLA 3K6KA 1LRKA 5E1BA 3ZZMA 4CUJA 1B42A 1P4AA 4CXMA 5DLQC 4MHSA 3NNDA 1M34A 2C5BA 1RBZA 4FI3C 4M8KA 1BQ4A 4PTLA 1DRKA 3ETDA 1R50A 2RFLA 4KBYA 4L2IA 4QGHA 4RY0A 4EH1A 4L8YA 1L5MA 1R6VA 4KXMA 5E8JA 3TKAA 2ZT5A 1X19A 4OXKA 1AKQA 2AI1A 2G5PA 3K16A 3L49A 3QVUA 4XIFA 3SX0A 5IYZB 4F38A 4A1FA 3IVAA 3IQHX 4H6PA 3SFVA 1QCDA 4ZAVA 1NW8A 4Q4HA 3KLNA 3Q0TA 1KETA 1KS2A 2RJOA 1VGQA 3QBJA 4MV9A 5JAUA 3GCGA 2NVWA 5ALIA 2JAWA 4HB4A 3HCFA 2D4HA 4S05A 1WV1A 2JKVA 3AF6A 1MJ5A 2F3UA 4QUJA 2YICA 2YQZA 1KQ3A 4DLVA 1ZK0A 1D5CA 2GF0A 2TMKA 4TXHA 1TYZA 2C7VA 2ERCA 4OXYA 1EFCA 2PZ8A 5K4HA 1CHDA 3BXFA 4X8MA 1XCMA 1MO6A 1V96A 4DC1A 5KYKA 5C5IA 3L7JA 1QQ6A 3OOYA 2BGGA 3TIXB 3A2MA 3L18A 3CN7A 2G6BA 4QICA 4R3WA 5KSZA 2RHDA 4QG7A 4YUYA 4EF5A 1OD6A 4CFSA 3PGXA 3DOIA 4QUDA 2VJCA 1VC2A 5F73A 5H3CA 3DBLA 4WH0A 4CMCA 4Q7QA 3DCNA 3PV0A 3C8UA 4JEIA 1CJMA 4P5DA 2QTWB 1NE2A 2Y1FA 2R1ZA 4GSLA 5BNZA 1YB5A 4C3UA 2X58A 1K4KA 4U2CA 1ZM2A 2FHPA 3UHPA 3ZOKA 4A2CA 4EGAA 4XIIA 1Q15A 4MIOA 5FIUA 3R2JA 3STYA 4ZGWA 5LQKA 3O26A 1M1YA 3BMCB 2P1RA 3AUXA 4KR9A 3USCS 2AT1A 3N0WA 5JO0A 3HY6A 1HT1E 4H7HA 1RU3A 5CT6A 1H1TA 1FJHA 3CZRA 2C20A 3P32A 1K7CA 3OTIA 5GV8A 4XARA 4B3FX 3U17A 1WKBA 3GUUA 3Q10A 4X91A 4XJXA 4BASA 4F72A 5CTAA 4NOKA 4TYWA 4FFMA 4DMFA 3FD8A 3PQ2A 3EJ6A 5C7YA 5KMGA 4WAUA 4OFWA 1KDTA 4QDKA 4KMOA 2Q6KA 3IJ5A 1Q92A 2FMKA 4MUIA 4P3NA 3NBYC 4MUBA 2QLLA 3RRYA 4MW6A 5IJZA 5JDIC 3NTQA 5BR7A 1TMOA 4QYIB 3WMWA 4FEEA 2Y2VA 3HL0A 4LXIA 4CDMA 4UE3S 3ZE2B 2H8GA 4JZKA 4U02A 3TTYA 1E9EA 1L5ZA 4O3MA 4BE9A 2O14A 1JKIA 3KDPA 1P3Y1 2GZ1A 2HDHA 4HH1A 4I50B 5K6TA 4JLMA 1IM8A 3BJZA 3EZYA 3TSOA 5EE3A 3BGWA 4Q7KA 4Y9SA 1C3JA 3CLSC 3ZJ4A 1U5BB 4UU7A 4QQNA 4CV3A 2RHCA 3T1VA 5ALLA 5HCIA 3I6BA 4MRAA 1FS6A 2QL9A 4IXTA 1DIOB 1KKLA 4Q9JA 3ZZ0A 3TX2A 1NVDA 2CNNA 4YDQA 1MT3A 2YQ5A 2I2BA 4O29A 2PLNA 4UQPA 3WOVA 4MQBA 2GK7A 1FVOA 1WNFA 4M9SA 4CNBA 5IVDA 2GN2A 2QRKA 3L0OA 2JJYA 4U7HA 3C97A 2IUFA 3P9XA 3ZXIA 1MN6A 2KX7A 4M6WB 1G5TA 4ZI5A 2V7VA 3K4QA 3T5PA 2APJA 1GNSA 3H0EA 3P27A 1AQUA 3O03A 1OROA 2V7GA 2NU7A 3NPMA 2G0TA 3BHMA 3HE3A 3IDSA 2D2FA 5KOHB 2XVYA 3J80A 3FMOB 2C4TA 4G2TA 1P72A 2D8MA 2VHQA 4ALNA 1PK9A 3IUJA 5TXGA 1WMEA 2MYTA 4IV8A 5B5SA 5G40A 4JMPA 1OW3B 3W2TA 2OTCA 3WLNA 5IU6A 1L2TA 5CMLA 2GBCA 3QEMA 4FFVA 2ZIVB 5KNBH 3U60B 4OP1A 3AVUA 1XZKA 1NVVR 4D2IA 3O0DA 1U0LA 1P0IA 2D5IA 4KV7A 4JROA 2IOFA 2VUHB 2MSCB 4IJWA 3V8BA 4IIDA 3WTCA 2ZTMA 3RAFC 1XZGA 3QVOA 4JU8A 1HLPA 2W4IA 1PYGA 2QTMA 4RJ2A 2WM9B 3L07A 5I7HA 1K6XA 1R00A 1MC4A 3DFIA 1DTSA 3M9LA 4HFRA 5AVTA 3RS9A 3U3OA 3HVUA 1PWEA 2EJTA 1UKBA 4EY7A 4TKVB 4BU0A 1AOXA 3UPTA 3KQWA 4LYYA 2XMSA 1T6ZA 2CLCX 3WLKX 2JVKA 3IS3A 4E5UA 4BUZA 1CYDA 3U13A 2NN3C 1QPGA 4YALA 4DLLA 1NMEA 2DQSA 4EG4A 2C3MA 3ITKA 1Z8FA 1HDOA 4GLBA 4ISCA 5MGBA 4FFBB 1F3LA 2OLEA 4LQ4A 1OBHA 2FEPA 1UEXC 4G9BA 1QIMA 4A36A 2QNBA 1FQKA 2VJQA 2COUA 4P92A 1MXFA 1I24A 4GF5A 2J6IA 3AEKA 1G7SA 2VTKA 2WHPA 1LBIA 1E2JA 4J3FA 4X93A 1E2KA 3BSSA 2Q21A 4NC9A 4F06A 1QFZA 5P8WA 1SCQA 1L9XA 1TF5A 3R3ZA 1IN1A 4PC2A 5G53C 1O9HA 3S5JA 5LM3A 3TE7A 1QPBA 2YOGA 3O8CA 1XZQA 2ZAYA 2BMWA 4P6VF 3WYAA 3QV2A 3A2KA 1QR2A 4DJJA 1U3TA 4K8RB 1X1SA 1X6VA 3SDZA 3AJDA 3ZW8A 1Q12A 1XAHA 2B92A 3PF9A 4FR2A 4KNWA 4OOFA 4BX9A 2GILA 1NXPA 3KPJA 5KYXA 1YNOA 2CXUA 4ZQGA 3S2SA 4BZZA 4UMVA 3UPDA 4MGIR 4ENPA 4R8KA 4MUKA 3E7XA 1NW3A 3E3AA 1O6GA 4L5AA 4ZCSA 1LUAA 2VQ6A 3AIMA 2AN9A 4RXTA 1D8AA 4ZCLA 2VRCD 1H23A 5J63A 4TYMA 2XYVA 4YRMA 1SXJE 3TCXB 2F9FA 2OGWA 3F6CA 3QNUA 5K3EA 2G0NA 3KYCB 4V1CB 1UOEA 1KZ9A 1DQYA 4IGKA 3L8HA 8AT1A 3FNIA 3FPJA 2O2EA 4BQIA 5BOVA 3LTEA 3R0ZA 1WJGA 3F97A 3GJYA 4OLHA 3TQSA 3VFDA 2P4UA 4CQMB 3DE6X 1HBJA 3JQ7B 3KZCA 1Z5ZA 3BFPA 4U7GA 5L3SB 1LF0A 1LLQA 4I5EA 1DUIA 1RPAA 4HZGA 5BMVB 4UUOA 4KR0A 5HRAA 2VPYA 4O4JB 2R2GA 3KEOA 5E9AA 2ZUWA 2AGVA 3GBSA 2FMHA 1VZ2A 3SS9X 1V7PC 2X2PA 4NPAA 2W2MA 5KTRA 1WXHA 3PVCA 4TMVA 1CR0A 2P90A 2YIMA 2LUOA 3GAAA 2FUNB 4XCXA 4D3ZA 1NBME 1QHIA 2PBLA 4XWYA 4K86A 2FSVA 5DSTA 2JKZA 2DWOA 3P2JA 4HGNA 4NZOA 4YK7A 5K9ZA 1SXIA 4M8LA 4ACBA 3EFHA 4C4ZA 3PE4A 1AKRA 3M9WA 3L05A 2HRBA 1JR2A 4L85A 3N8DA 1YZTA 4MQ6A 4OSOA 2EFJA 1K8XB 4LISA 2WF8A 4B84A 4YTEA 4Y2XA 4XAQA 1P81A 2FSIA 1YQXA 5G1PA 1W2GA 4MWZA 3D0QA 3I1YA 5KTPA 3JRXA 1S89A 4LF6B 4LDJA 4J1TA 3TMAA 2P0AA 5EKDA 5ESWA 4XVUA 5A2GA 4URVR 3OX3A 2OZPA 1W4LA 2JFUA 5F3RA 4CMBA 5DWVA 3NAQA 3ASZA 4RA9B 4YBZA 3UEOA 4D43A 2YV5A 4I8XA 1ZUNA 1RYYA 1ULTA 2D7JA 4WUTA 5A5DA 2AD1A 3AUAA 1IHXA 1C8VB 1UDAA 1XXHB 1ANKA 3G89A 1JE0A 2BUBA 3B53X 1IZ8A 2Q49A 4Y0VA 2QM7A 3COJA 2ZM5A 3GGCA 2E4AA 4MKZA 3G9UA 2IXEA 5HRUA 2IXAA 3SR4A 1OXUA 1YDGA 3HR7A 2X0KA 1C9KA 2A9RA 1OY1A 2I80A 3NRCA 3UJ7A 4ETIA 1AH2A 1U1GA 2GN1A 3OPNA 3OJOA 1R6DA 3KTAA 2CZCA 3Q98A 4L9SA 1ML3A 1XRRA 2R44A 4FJ2A 4AY6A 1O4VA 4LJ9A 3MYRA 3QX3A 1XKTA 5F3DA 4YXWA 2C99A 2IEBA 1EXMA 3O74A 4JY7A 4KK4A 1OTYA 4DC9A 1DIGA 1S5PA 3RTGA 1GPH1 5IXYA 2JGLA 3BN3A 2VDOB 4MIKA 1RP1A 2P67A 2VEOA 3LHDA 1XZAA 1B8VA 1UKYA 3O1IC 2FPOA 3PUXA 1Q0SA 3BC1A 4D6XA 5AM3A 4H1UA 3WO1A 6NULA 3K31A 4H3SA 1POWA 4ZYTA 4ESHA 3FSRA 1LDEA 4DY4A 4E15A 2ACKA 3H6GA 4L9WA 5DDIP 3TEFA 4GL4A 3V55A 2C8LA 3ORSA 3ZV3A 2CXNA 4E5SA 1I3MA 3VZDA 5HQTA 2IPMA 2V7QD 3V6MA 2FEWB 4O4HB 5ALNA 3WK7A 4AYWA 2PDAA 1R37A 1FS5A 2J7KA 4L5BA 5LUAA 4RH0A 1W48A 2OCBA 3ADDA 4F8JA 3PNLA 2F1IA 1FP1D 3VQTA 2ZIXB 4I3HA 1T0UA 1QKJA 2BFCB 1R2QA 3KQSA 4ZN6A 2R6CA 5CLIA 3GB9A 3D7MA 3QGMA 4LV8B 4ZQHA 3DZDA 3VSAA 5JD5A 5JIBA 4BNZA 4GBGA 2BPOA 2K2WA 1N2BA 4RO0A 1JWLA 3PJGA 5GZ6A 5B1SA 1VLZA 1FC0A 3LUJA 3WQSB 4OI1A 2X2EA 2X9NA 2W2LD 3DJYA 1RBMA 4YRGA 4QREA 2L19A 1HSOA 2YCLA 4IEEA 5D1NA 3O8LA 1NXXA 2YZ7A 1NF8A 3NS7A 1E1MA 4JJ8A 2G1AA 2L82A 5EJ7A 1NVUQ 2WFMA 2WD8A 1FW6A 3MFYA 1UL1X 4NU6A 4PAQA 5EXEA 3W1WA 1GCGA 3K6SB 1IQ0A 1QHEA 2CFCA 4X7PA 1YK1A 3U5TA 3VR4A 1DT5A 2WTMA 3DHEA 1FEZA 2JW5A 4YJKA 1J99A 4F0JA 1M33A 4IVQA 4Q1VA 4L3OA 1XEAA 3N6XA 3R5FA 2RGNA 4XPZA 4ETWA 3HKCB 3JQAD 1U4NA 2EQBA 3BICA 2YZ2A 3QZUA 2DHDA 1XU4A 4IHJA 4X85A 5HILA 3VJRA 1R16A 1R9MA 4J0HA 4E88A 3T35A 2PNFA 1TFRA 1E4EB 4HX9A 4NV0A 1UXKA 4BX2A 1I0IA 3VI4B 3B5EA 3OTQA 3SICE 2WG1A 2Z57A 4YMUA 5MN4A 1MZPA 1CY8A 2IOFK 4QPNA 2UZIR 1W6RA 1S2MA 1YQQA 5GGXA 3W04A 4HI0E 1SB9A 3U16A 4DDMA 4DV2B 4LYGA 3QWFA 5EWLA 4ZWNA 1P5ZB 2O3RA 4TTIA 1RMYA 3EWAA 3CU5A 4CM6A 2ZVJA 1G8AA 2JCSA 1TYEB 3DPSA 4EB6A 2QJRA 1PQPA 1ZK4A 1ZAYA 4WXPA 1P4SA 1SD2A 3RBXA 5C5DA 2AV6A 3JASA 3AV0B 2IBSA 2GYUA 3QEAZ 3GAMA 3D8UA 1RAEA 4C4AA 4L28A 4OYLA 3P0IA 3ZQKA 5F35A 1RZVA 3FCSB 1T2NA 2DE0X 2Q0XA 3NC0C 3VYVA 4HB2A 2R65A 1SC9A 1FSPA 1T5IA 2X8JB 3QVLA 1IZ0A 4A9AA 1KAQA 4JB3A 3A1UA 1EVZA 1E64A 4RADA 4LCJA 1IHUA 3KQPA 1LFDB 1TCAA 3MRVA 2C4UA 2O2CA 3N5KA 1TYBE 4F8EA 2NXJA 1CJTC 5TQ2B 4OXNA 1GU1A 3TWOA 2VQFB 1XQ6A 2AK3A 3CZPA 1VB5A 1ZH2A 3DF7A 4ALJA 1EUZA 3W1VA 4Y2HA 1DC7A 4EOGA 1TKCA 4X63A 4ZAZA 1APBA 4H3KB 4D46A 4M76B 5DBIA 4LBYA 1HTWA 2OOSA 1QIJA 1HQYE 4HVTA 2E4WA 4MITA 1CLUA 3CF4G 1U3DA 1YHNA 3QX7A 1T1JA 2BE9A 1GN8A 3C8ZA 3QG1A 4DV6B 1KI3A 1GEEA 7ABPA 3LE8A 5CB0A 3AGQA 1BG6A 1E6KA 1TVCA 1R0KA 5JCJD 2H08A 5LZ5A 1BU8A 1RHKA 3DE1X 1W85B 1VE1A 2EYQA 3WL8A 4AKEA 1EHCA 2O5RA 4DJAA 3LUFA 1JPVA 4UM9D 3CVXA 4IHKA 3ZV7A 1EESA 3OIGA 2KW5A 3QSYA 2XGOA 5EQFA 1OXSC 2H9AA 3NRJA 1I4TD 3IAM6 4I5FA 3T9FA 1M1UA 2Q2NA 1KY4A 3GDFA 2GAIA 1IPHA 3PWZA 2ZBQA 4H16A 4JL8A 2X0EA 4CQLB 1NVMB 5KNDH 3W6NA 1GSOA 5F7OA 5HZGA 1E5DA 3WI7A 5KNBD 4E5YA 4N39A 4B85A 1R6UA 2F9MA 3K5PA 3AB8A 4HNQA 3ZCSA 1LRLA 3L8ZA 5LCXA 3UMGA 1ZSVA 3A37A 1Y8QB 4BNGA 1J8QA 2WSIA 1CYEA 1P0MA 5ICEA 1HKUA 1WPRA 2I6GA 4HWGA 2GKOA 4EAAA 2YWEA 5DEOA 2BIFA 4TYNA 3GRPA 1HT0A 5FWXB 4JUFA 1V1RB 3IXMA 3L0SA 1RKVA 4V1CI 3G0OA 2XT0A 1USIA 4O4LB 1TCUA 1WABA 2GN8A 3RVNA 4EL5A 4PCAA 3FFWA 1W34A 1NVFA 3H5LA 4EJSB 3UCXA 3NKVA 4A03A 1B41A 3H1EA 2IY7A 3IT0A 4N49A 2ILVA 2ATXA 4JX8A 3T3OA 4FGSA 2ZTUA 4RABA 2BI7A 3C3KA 2I6TA 1KR2A 1PZEA 1QIEA 5GZ1A 4MUFA 3FYSA 1U2PA 3E9ZA 2WVAA 1I7PA 3GT3A 1N8TA 3M5WA 4Q1CA 4N5LA 1J4AA 4KODA 4EA8A 5K6AC 3T0IA 1IWOA 3RUPA 3U0VA 2FG6C 3V1KA 2DHEA 2AA3A 3KKQA 1P1BA 3GXBA 1R0CA 3NP9A 2ZVDA 2CFTA 2DT5A 2G08A 3B13B 1I7SB 1V3QE 2XSZD 3IR5A 1WSDA 2C2BA 4HXEB 2VNSA 1ULZA 4W6QA 4EPYA 3VO2A 2M32A 2ZAOA 1DIBA 1JAIA 4PPQA 5ALEA 2HFKA 1XD9A 4DR7B 3L7LA 5HGXA 2WMDA 2EWMA 3WYEA 1BWPA 2IYTA 3EVCA 3EZFA 3UMBA 1WEHA 4DW8A 3L4BA 3E8SA 4FYMA 1EX9A 1A3CA 1U7OA 3OFND 2FG7C 2E7ZA 3RJMA 4JFAA 5J2TA 4FQ5A 4F1JA 2GDZA 3AUYA 4MYSA 4Q3LA 1M2JA 1U2GA 1QGZA 2A5FA 3DT8A 3KJGA 4OJMX 3PUHA 4M2LA 3O95A 2WTUA 1CDOA 2ETXA 5AJTA 1E2DA 3LI2A 3R6GA 1J0AA 4TROA 1XZEA 3C6YA 4WXHA 5CVEA 5JCOA 1UKCA 4AJ9A 3AEYA 2JFVA 3FUCA 2IYFA 2HBRA 1W87A 1BWQA 1I2AA 4OFBA 3L4BC 3LKVA 4GX1A 1A9PA 4ZI3A 5K8UA 5EKTA 2ZCJA 1YVPA 1DJOA 5A62A 1DRWA 3QPDA 5A9SA 1EVKA 3RC7A 3GL9A 4QIHA 1OMOA 1U2GC 3DYIA 3G8YA 1HYQA 4N12A 2JHGA 1HDZA 1QX4A 2PVCA 1KL7A 2QGZA 3B6IA 4NE9A 4P4NA 3TW8B 3U4AA 3CE6A 4MS4B 3KSBC 2CVQA 3B8EA 5IN5A 4C1NA 1U80A 4TQAA 4ZYLA 1NVBA 4EF4A 5ECDA 5JBIA 1EKXA 2BBTA 2I2WA 3ZHQA 4WZAE 3JYLA 5E2IA 3U31A 1G2PA 2SCUB 2J9YB 3R5SA 1RYEA 3GLFA 2P8SA 1XA0A 3C74A 2P62A 3LYLA 3NALA 1KJJA 1E6LA 3Q12A 4OEHA 2OAGA 4FOSA 3DAFA 3RKRA 4D0RA 2B8WA 3N3AC 3LCCA 2HI0A 3PIDA 3PD0A 3WJ2A 1A72A 5AHRA 3HQ4O 4FGLA 3Q9UA 2JJ1D 3EQ2A 3LBHA 4BCCA 3ILVA 5A0VA 3FWYA 3OC6A 3SIWA 3AP3A 3T34A 3TNJA 4EG0A 3TF5A 4G1BA 2YWGA 2A0KA 2VPZA 4LYJA 2I55A 4PIVA 5K51A 2BHLA 3DDZX 1XYGA 3A3NA 3BX1A 3OX2A 3QPBA 5G3YA 3DL2A 4ZEWA 3EOAI 3W8DA 3FRHA 3M6XA 3CPSA 1L8LA 1QZZA 1WTAA 2FN3A 2QYOA 1PJ8A 3QHPA 4F6RB 4V3CA 1CDDA 3NHFA 4MV4A 5JFTA 1DAPA 1USVA 2IYQA 4WZZA 4UFNA 1DOAA 3RU7A 2PZFA 4BQPA 1GSIA 3AINA 1JPJA 4RDCA 3GJTA 1ZK1A 3WK4A 1GCIA 3DXFA 4YRAA 3MWKA 3NEYA 1U7UA 4IJMA 1OHHA 5JS6A 1RYBA 4KTTE 1Z4MA 4WERA 4IJVA 1A98A 1V4BA 4Q21A 5EC8A 1F1BA 1CP3A 1CUDA 1K66A 1NW6A 1PJ2A 1Y3AA 1MNQA 1JLKA 2P4HX 2XVMA 1YL7A 3ENVA 4LWOA 5EP2A 4ENVA 5JQGA 1RHJA 1P80A 3WLMA 2IYYA 1LZKA 4PFSA 3MPOA 1F2UA 3REQA 1DG3A 1P18A 3Q87B 4D9FA 2XUJA 4WBNA 5IKXA 3QELA 1ONPA 3F98A 4RPIA 4JWKA 4LMAA 3ENQA 2ZRNA 1U9IA 2IIBA 4HHEA 1EUDB 1Z0DA 3EQ7A 1SEVA 1MPXA 2EIHA 4FFRA 4IJUA 4JL6A 4XSVA 5IVIA 5T64A 4FMDF 3LG2A 2XQGA 2ZB4A 2C1ZA 2GEKA 1LI5A 1JNYA 1G17A 3TG2A 4WFQA 4AUMA 1IQRA 4KO4S 1JFRA 4CW7A 1B1CA 1NXVA 5CJPA 3ZV6A 4HQ0A 1IYZA 1OASA 2UYYA 5FUYA 5IYZF 4EFLA 4ZZ3A 4S24A 3D5TA 2RI6A 2H1HA 3F90A 2NADA 1KEEB 3PHJA 3PWTA 2OV6A 4P82A 4MRPA 2J8ZA 3NYIA 5A04A 5BN3A 4YP7A 1EFUA 2QTBA 2Z9CA 4LTNA 4P32A 4QU0A 1IEQA 2GCNA 3P5BA 4RD1A 3VHQA 4RJTA 5HKBA 5IXJA 1KXJA 3FOWA 1XRLA 2GD6A 4X6YA 2ISQA 1HMPA 4P7GA 3VBCA 3EPHA 4S1NA 1J0EA 3CW2A 2BRUC 4TVOA 1QF6A 2IWRA 2M1XA 3A3OA 2HMUA 3AIKA 2CE2X 1U6KA 3G5TA 4QEZA 1TMKA 3UAOA 2YHIA 1O58A 4LZWA 4W5OA 4BXOB 1E3MA 2ZSAA 1K4YA 3KS9A 1L7QA 2EKPA 2M1ZA 3KQYA 1XMQB 2Q5QA 5IJWA 2GERA 4GP9A 1ISHA 5AVJA 3THXB 2A84A 2EU8A 4QEDA 4DLKA 1CRQA 1WXEA 4MUJA 1JEAA 5CYOA 3A6GA 3T9DA 3SWWA 1GDDA 3NGMA 4AN4A 1Z4LA 4IO1A 5EUCA 4C5AA 2ZE6A 3ZDYB 3VVCA 4EW1A 2J30A 4PLPA 1BE6A 3DNMA 2ZDGA 4JZYA 2YJ4A 3UWPA 3MWGA 1PGNA 3HO1A 4YJFA 2FJPA 3KYDA 4LYDA 4D4MA 2XVZA 2VUSA 4UTOA 2O1XA 5IABA 1P5HA 3GT0A 3MJDA 4MW7A 1BFUA 2AXPA 2ZI6A 4JT4A 3TSAA 3WLRA 3WLTA 4FNMA 1N75A 1AE1A 4G8JA 3SXJA 3V4FA 2OV4A 4C4XA 1JHDA 4J9UE 1SN7A 4LOJA 4X90A 4CV0A 1W0JD 1TZCA 3QK7A 3F7MA 5CLLA 5KNCA 2IPXA 3I09A 4QLBA 1QO9A 1D3AA 1MFZA 3P9QA 3PXDA 4IYJA 1QP8A 2WKRA 4DG8A 1P2TA 3C6KA 4CDGA 4B2IA 4KDRA 3I2IA 3WO0A 4MWEA 1STOA 2CN1A 4XX1A 1JHVA 2Z58A 4MQ4A 4K6GA 2X9GA 4RPKA 2R00C 3VOAA 3JD2A 4KQHA 4CEHB 1B23P 5A6VA 3MIIA 2HXYA 2UYOA 4UXHA 4ND1A 4PO3X 1A8PA 1DBSA 4XTRA 4YMHA 2RKOA 2YXEA 3O7WA 2ZRKA 3T9EA 1DO2A 1WU8A 1DDGA 1L4BA 4RD6A 3L0CA 4OHVA 3ZHOA 2P9ZA 3OPXA 2HRRA 5EJAA 4L0QA 5BOSA 5DW0A 1G41A 1Q57A 1XQ9A 2IY9A 3SF0A 4FJ0A 4GD3Q 3S8MA 2R7KA 5SYAA 2IXFA 4B81A 2B82A 4OQFA 3RVLA 3FW1A 2C2YA 3H4IA 3OF5A 1YL5A 1YU6A 4A91A 1KDVA 3R3JA 1O97C 1A1SA 5DN9A 5AYVA 3PXUA 7REQA 2BWJA 2FPLA 3JCZA 2W6PA 3TQOA 1ZJ4A 3MCWA 8MHTA 4HTFB 3K9HA 1U3FA 2QXYA 4BBJA 3F0TA 5FP0A 1GKLA 2C59A 1F60A 1C7ZA 1GZ5A 3HXKA 4YT4A 4UTVA 4AXBA 2E4ZA 5ABPA 4R1MA 1AV7A 3TZLA 1ADBA 2H59A 2YIVX 1H42A 3RRMA 3RIGA 3D3NA 2OD9A 2HCTA 4L0CA 3EQZA 3RS2A 4DCOA 4F2WA 1KPHA 3PCXA 1PQWA 3HGMA 3OIYA 4JLVA 2ZSFA 3D0KA 4BLQA 1XYYA 3FF1A 3HUDA 2DWQA 2V8BA 2RI1A 2P3LA 1IQUA 1Z37A 1UM8A 4IVRA 1D09A 1JIJA 3NZEA 3UB4A 4N8DA 2PMCA 5B4TA 4FHDA 2UUOA 3FM9A 2ID9A 1HO3A 1DKUA 3OCXA 2PL5A 4IAOA 1M74A 1KOFA 1R8YA 3H04A 3R5XA 1IIBA 2PMDA 1BOFA 4N5DA 1E69A 2G17A 2VNIA 1Z7GA 3IE0A 1R5OA 2JI9A 1PNTA 3DHNA 1C1YA 5EZSA 4B4UA 5J47A 4FGWA 4OQLA 3VNSA 5LMUB 3LGSA 4WZBE 3K70D 2J7PA 3E5HA 3ZG6A 1OH8A 2VSNA 3UY4A 3MB5A 3TB4A 2B1QA 4F1WA 1SHTX 4ND4A 3M6FA 4G07A 5DYWA 4QDOA 4G5GA 4UUPA 3RREA 1JX6A 2DSNA 3CZAA 2BMEA 1VRCA 2QHXA 4UCFA 5U4XA 1IBLB 5FWAA 5JAPA 3QKTA 4DJDC 2V96A 1PN3A 1DJNA 3UOGA 4DBLC 2JG3A 2B8JA 3KOZA 4UAUA 1VXOA 1NL3A 2V5UA 1G8FA 1P45A 1P2FA 2ZIWB 3EZ6A 5AVRA 4Z0TA 5I4KA 3HTXA 3CINA 4MLPA 4EVRA 1T4CA 5KNDD 3SXPA 2BHSA 2P6RA 3VSEA 2XEXA 1XTBA 1T9DA 2D5CA 3H05A 5J1TB 4CCAA 1J21A 1JAXA 1N3BA 3BBLA 3HO8A 4AJ2A 1AKEA 1T0JB 3I9OA 1W36D 2NMVA 2Z9BA 1QVVA 4MUMA 5AHKA 1DWPA 3EH1A 3WIEA 1KO1A 2HEIA 4U5QA 1NBEA 1S2LA 2XQJA 4Y8VA 2JCGA 2ONCA 2ZG6A 1EVJA 4S2UA 1IN4A 3V1LA 4BFUA 621PA 4ND5A 2GRJA 1JTEA 4BO3A 3EIWA 1C0LA 4J0IA 2CDBA 3QXCA 4D79A 5CA0A 1TFUA 1C81A 5H70A 3CEPB 1I4EB 5FTMA 2CBZA 1U9CA 2D0DA 2OK8A 3WLHA 3FCUB 4PPGA 5FULA 3IHKA 4JT2A 4QNMA 4R1OA 5KAMA 1WUKS 3UA4A 2A7QA 2FLWA 3JD0A 1SZJG 4YS6A 1W4AA 3OHSX 4R05A 4RDHA 4YMGA 3HM9A 3T5MA 5FDFA 3AGPA 3PEWA 3IEUA 5TMEA 1ESCA 3T41A 3K4PA 4UBNA 3BXGA 3L4EA 3QP9A 4P5EA 5FPHA 4F7WA 4D8TA 1NWCA 1X70A 3SF8A 3TQCA 4AICA 5LD2C 3P0EA 3TEJA 1ADFA 1BWRA 1F8YA 4EKGA 1G8YA 4FKBA 4EY3A 3QE0A 3SZLA 4KR7A 3LX4A 4IIHA 1ZH0A 3NP7A 5K4AA 2R62A 3RPEA 2G09A 1EVQA 1FF9A 4HEA6 1Z6AA 4F91B 1JH8A 3JXEA 4KVZA 3HFSA 3EC7A 3QIAA 4HRXA 5LA6F 1JKXA 4PSAA 3DNPA 2H0QA 5AK6A 4K9PA 2FPIA 4NR0A 2GAOA 4A0SA 1B8NA 2R8PA 3LQ1A 2CNBA 5ALPA 4URHA 2N47A 4JI1B 4DB2A 1RM4A 3OPYA 3D8NA 4KSBA 5HS6A 4IRUB 3BPSA 1GSHA 4U2GA 4E03A 3PUVA 4F9TA 4WBNF 2CVZA 2D62A 4OYRA 5GJBA 3KKOA 4MI6A 3IMKA 4JYPA 4PNEA 3FTDA 2OP1A 4ZAWA 2WJ4A 3ZHZA 1B0UA 2DKNA 2FB9A 2ZPUA 2OORC 3QBVA 4EI9A 1HDXA 1Z56C 3BFVA 5B58T 1XRNA 1YBHA 3WHIA 4M9XA 4B74A 4NY1A 4D9JA 3N53A 4GP7A 1TL7C 3H5AA 2GXAA 3KUUA 3MA0A 2CJYA 4BDSA 3PUZA 3RJZA 4FT2A 1C1XA 1YDHA 4G8CA 1WXGA 1SIWA 1IY0A 3QVJA 3HU2A 4B3SB 3NVKI 4D0LB 3TMYA 3NDIA 4AUKA 3TBHA 1SC1A 4MVJG 1UJ4A 1QV7A 4KQ9A 4PZDA 2YWFA 1YJCA 4FS3A 1J8YF 2JD0A 1H85A 3LYHA 4TTTS 3HKBB 3H83A 1NXSA 2PR2A 1Y8RB 3ZIUA 4E94A 1ZQ9A 1MB2A 2SNIE 3IXQA 2IV7A 4M0UA 3TTTA 2E49A 2FSGA 1SVWA 2W93A 3MPUA 4QXAA 5C8DA 4KE6A 3NWJA 1DBQA 1U8CB 1Q5PA 1RYMA 1XTSA 1JXQA 1ZOSA 3AHHA 2DR3A 3DM5A 3K15A 3OLYA 5IZ4A 1QX3A 4FSHA 4YYZA 1FPMA 3OH8A 3QLVA 4DNXA 1WUTA 2MYPA 2QT0A 2D2EA 5IMBA 2BFFB 4YT8A 5GVSA 3OIWA 2ACVA 4A4DA 2HA4A 2BLNA 3F5MA 3BCHA 2JA2A 4DA6A 5K0GA 2XCTB 3AHGA 1EA5A 4BWYA 4UAJA 2COKA 1CIVA 1DB3A 1FMTA 3UT5A 2H1VA 2N42A 4ZA2A 5BQOA 4DDKA 2GX6A 1W5SA 4OK5A 1YKSA 4G4SO 5E6UA 5TX7A 4I4IA 1I5EA 5I9IA 1SM4A 2C4MA 2ZW9A 4HYQA 3ZCVA 3OURA 4R8RA 4YCBA 3AEUB 5ICGA 2O5EA 1IPEA 4R2WA 3INNA 4YFYA 4IV0A 3NTXA 1U8XX 4RVGA 1CY6A 3TGPA 2Z1NA 4INPA 3CVUA 3D4NA 3P9SA 1LWOA 3CF6R 1V8PA 3K09A 1WNTA 3GMDA 2YV2A 5CT4A 1R5JA 3ZS8A 5BUCA 1WMFA 2C0CA 3E03A 3S29A 2H6EA 2PTGA 1YR6A 1AGYA 1SXJA 1UP6A 2BKUA 2GA9A 4XM1A 5E3HA 2HIMA 3PGMA 5JVDA 4JODA 2HF8A 3CJTA 2G4VA 3JR3A 4MKIA 1L7DA 4JB8A 3CZ5A 4TPKA 4BS9A 1M0EA 3GLHA 3VNBA 2H4JA 4RJKA 5ALKA 4N76A 3EXEA 1CQJA 2GD0A 4FE7A 5A7HA 3E22B 3KVOA 3U4QA 2BJWA 4AO6A 3MTIA 2CXQA 5BNFA 1YZHA 2ERXA 2JB9A 2XB6A 5G4KB 4TT3A 1UK8A 5FCDA 3WMGA 4P0TA 1JHMA 4IIBA 2VATA 1X0VA 3N2EA 4J2HA 2P41A 3N58A 4ZVKA 1VYVA 5DF1A 2HQBA 2IODA 1OT5A 1NMXA 2X4LA 1BE0A 4ZHQA 3FOFC 1NBMA 1T0BA 4FCWA 4EX6A 4F56A 3DKVA 2YWXA 2DERA 4MEJA 1DVRA 2B25A 1SUDA 3ACCA 3S28A 5IHPA 3H3XA 4ZJYA 1QYWA 1ZMBA 3E3LA 3LX6A 3R1IA 4GOXA 4MKHA 3ZWCA 1Z36A 1DQPA 2QLNA 4GLFA 4LBVA 4LRUA 1XCOA 3WDMA 1XZNA 5LXTF 3TZKA 5BPHA 5BWCA 4LVNA 2AEEA 2H92A 2Q62A 3K0AB 5FD8A 1SRQA 2Q2OA 4YVFA 4QDUA 3VMFA 2GOYA 1QDLB 1KVSA 1ZDMA 2R60A 4QOJA 1PWZA 3F9IA 3CS3A 2KS6A 2YN2A 4PIPA 2ZZMA 2XMRA 4EARA 1QG6A 3G2JA 2PSHA 1AVTA 4ND6A 4DQXA 2HEGA 2BH2A 2ORIA 2VT7A 3Q7RA 4EF6A 4EA9A 1PD0A 1ZH4A 2W2PA 3L7NA 3GJSA 4ND8A 1DG9A 5AMXA 2E9SA 3TNFA 1WWKA 3BXEA 3I53A 4YROA 1KGSA 3W9UA 4LNAA 3ZWPA 4NAUA 3KZMA 4G26A 2Q4EA 2ENWA 4KL8S 3F4LA 3L92A 3WQQA 1PFKA 1EFVA 2G7MC 1XT6A 4KAJA 1QYDA 1XG5A 2ZRGA 3HCDA 3UOWA 4J16A 3AG6A 2XI4A 5KDDA 3C7TA 3W90A 4NYJR 4A7PA 1E6MA 1PNVA 4UW9A 4FYJA 4PBRA 1S3GA 2UVQA 1NSTA 3CSSA 2WPDD 1PVOA 1VMDA 2FUG1 3V46A 1EFPA 1THZA 1XL0A 4OL9A 4LW8A 4QFCA 2ORYA 1JHXA 4J1SA 1VXRA 4K87A 4YCJA 4TUYF 3TRIA 3L8YA 3FVVA 1Y4SA 3CTPA 4BJ1A 3M6UA 2HMWA 5CD1A 4ZZ0A 1Z29A 2XWQA 1I3OA 1N1GA 3HVKA 3ODGA 2O8NA 3V1MA 2Q9BA 2XDAA 4NBWA 2WT4A 4K6OA 1BA2A 2H4HA 5LJIA 1JU3A 1T34A 2WU0A 1AKNA 3N0XA 4HZIA 4JEMA 2Z8ZA 3IIJA 4DMRA 4E5NA 1C9NA 4PWZA 4OB8A 2MT9A 1JKFA 2NPFA 1M7BA 3K8OE 4F5ZA 3VHXB 1I3KA 4OQPA 1GPUA 1U0NA 2IBMA 4RF3A 2Q3FA 4GYYA 1GPDG 4MGHA 4Y18A 1A27A 2CXXA 4R9UC 1R7RA 5A2QA 1JNXX 2HQSA 3VO1A 5ELXA 4NBLA 1UIMA 3FLBA 2FXVA 4H31A 1PBNA 3I32A 4PHCA 3GVIA 1NMQA 5B58C 3W6ZA 1H2WA 2QIOA 2JANA 3OSZA 1C3OB 1Q6ZA 1XQWA 3DBVO 3OMXA 4WOJA 1CRLA 1EFDN 5IT0A 1BDMA 3LD9A 3N2KA 4ZTBA 3B7PA 1ORDA 3PUKA 4E6PA 1I7DA 5DIZA 3UJDA 1X80B 3JARB 4YRKA 2VJMA 4L8WB 4PYLA 4DM7A 4JB0A 5TQ0B 2IS6A 2AK2A 2RBEA 1LQ2A 1PWYE 2IZ0A 1ENZA 2FV8A 3EZ2A 3UHOA 5L95A 2AZMA 4F9GA 3P9KA 3BTVA 4Z4QA 1VLHA 1Y7HA 1Z88A 3P20A 4H77A 3T7EA 3UJNA 2ISCA 1V5EA 4G0OA 1XTVA 4HUJA 3KP1A 3H1PA 1BXRB 4HDOB 1CF9A 2FRXA 3KOWA 3RK4A 2VBGA 3WNBA 4AX8A 4B48A 3ZJVA 3UAZA 2GETA 1OREA 5FA6A 3T61A 1K06A 4WA8A 1UZAA 2FG5A 1C8KA 1JEQB 3DTYA 2YDYA 2NSLA 3JAKB 4OAPA 3A04A 3DLTA 4AJ1A 2AFHE 2C2HA 4ID9A 4LDNA 1XCJA 3C7DB 2J32A 3D3JA 1PJRA 4MW4A 4EP1A 4DSOA 3KJFA 4NXNB 5JH7A 1PWXA 3PFHA 2ZRQA 5HR5A 4Q1DA 1ZWLA 2PD4A 4PPYA 5TMPA 1A1VA 1BJRE 3D8TA 2NU6B 1A77A 2GYVA 3RD5A 2FPPA 3BIOA 4UM7A 2A5DA 2GO1A 1TW3A 3RABA 2C7GA 2R79A 5JADA 1OLSA 4GPZA 1BYIA 1KH1A 1KP9A 2R1TB 4M3NA 5CG1A 2QV0A 1ULSA 1OIVA 5G0UA 3T7SA 2ONYA 2FPXA 1NW7A 4YAJA 4HWKA 1EWYA 1Y9DA 5KWJA 2V8OA 4HUQA 2AKYA 4IBOA 3ZNNA 3OCVA 3S1AA 3F8SA 2X8LA 1DLIA 1I4OA 2F17A 3I2YX 3PHBE 1AZTA 3NAMA 4NEQA 4PLYA 2HSGA 5AT1A 5B7GA 2VA9A 2QTAA 4RVOA 5E0KB 1TIKA 1YOVB 1J20A 3O82A 2O4CA 4IDPA 3VPHA 4M49A 1E8MA 3GYBA 1MJGA 4HNUA 3MWFA 4LHVA 2YXPX 1JH9A 3AV3A 1CUHA 1YJ8A 4OUDA 4EPTA 2XGJA 2EGUA 3N6RA 4RPCA 3S7ZA 2ID7A 4E1VA 4AYTA 4BMSA 4AZ3A 1T6BY 2A1TS 2HA6A 2R3SA 1U7WA 3DEIA 1N3IA 3HDTA 3LA6A 1CUVA 3ABIA 3OETA 4XWKA 3L01A 3ECCA 3NIWA 5EMNA 1C29B 1OBOA 1RMTA 4N8EA 4CMGA 5L7YA 5AIBA 3RVKA 3EA5A 4CLEA 1JAHA 4PCVA 5LBIA 4MIYA 3RADC 1MIOB 1N5JA 5J4HA 4DSTA 4OMUA 2SECE 3A1DA 5HMLA 4QE3A 1MABA 3DVSX 4U0JA 2VZ8A 4B75A 2JVIA 3JQFC 2XQKA 1AUPA 3SI7A 1YKGA 2Y9MB 1N2ZA 3SEAA 1SBYA 4OB6A 4A16A 2REXB 1PQ4A 4BVEA 3CUYA 4IDQA 4ZZ2A 2BFBA 3NORA 4QTXA 1ZOIA 4H60A 5HZKA 3BB1A 1AJEA 1ODKA 2XTJA 3ASYA 3R09A 3NDRA 2YVQA 3B1KA 4IQ0A 2FR1A 2JIPA 4XX0A 1DE0A 1UZNA 5DP2A 3ZZNA 1FUKA 1VJGA 2NV2B 3M4YA 1GZSA 4AZ0A 4EDHA 4EO7A 5LMNB 1JLRA 1PTJA 1T91A 2HSZA 3GFBA 3O2NA 4V0SA 1PK7A 1Z4JA 5COAA 5KYYB 4GPBA 5JZVA 2GN9A 2P91A 2WT8A 3NH6A 1PJQA 4WEQA 4WBXC 2DWPA 2PT9A 2D5BA 4I1UA 4YRPA 1H9CA 5HKOA 1SHZA 4TXLA 2PZMA 3RU2A 3MJ4A 4KUEA 2L17A 1N9GA 4FKZA 3RVSA 1FLVA 1UZUA 1EIWA 3KT8A 1MB0A 1WUYA 4MR7B 4MGEA 4HDNA 4QOSA 1Q1NA 3AKEA 3PNMA 3N39C 2DQYA 3RSGA 1NSFA 1YDFA 1I6MA 2YNMA 4OD0A 4P84A 1SWVA 4WZ6A 1M83A 4F4UA 2E6UX 2NTVA 1OLXB 1Z2NX 2JDIA 1RWXA 3CH4B 3NB0A 3KOMA 5CJJA 5CHYA 4FMCB 1JTFA 2YASA 4OTZA 4FE4A 3JQ9C 1AGPA 2EX0A 3ZGNA 5K09A 1IZ7A 2ZR0A 1WXFA 2O7SA 3KEQA 3FWHA 4DLUA 5HG0A 5HUHA 4RORA 1E99A 4ZOAA 4DOMA 2FZLA 4EYOA 5FI3A 2SBTA 1KXZA 3MQ4A 2QGFA 2XUOA 2VPQA 3EDYA 1TUBA 3NXSA 5EIBC 4HMQA 5LQSA 2UUAB 1QC5A 1ZM4A 2QNIA 2YNMC 2Y71A 3DEFA 5K3FB 1IN6A 3ABRB 1N5LA 4P83A 4MW5A 5TGZA 2W6NA 5FF9A 5DB4A 3LKDA 4QAJA 4WL0A 3KJQA 2Q27A 2Q4OA 2Z4TA 1VCMA 1A2QA 3GFQA 1KR5A 2WJAA 3CBGA 4K5QA 3GQBA 3N28A 1XX6A 2BEVA 4BFXA 4HWRA 4LSGA 4HF7A 3U9SA 2Q3JA 4RZXA 1WOMA 1W35A 2C29D 4B8ZA 2QQ5A 4O2AB 1NI4A 1UWKA 2EZTA 4H7IA 2PRYA 4DDVA 4GMHA 4B7XA 1G1MA 2C9BA 2XA2A 1V11B 1WDLA 1KI9A 4EJ6A 2JLAA 4U5XA 1BXGA 2INGX 3LW7A 3QHAA 1MHPA 4NCKA 4C05A 4XCQA 4R2MA 2WR8A 2QS9A 1FNBA 2W11A 3V8EA 5CP8A 4KWTA 3ZDZB 1NQOA 3SYLA 4ZCPA 2JD1A 1RAIA 3P2MA 1E8NA 4HDKA 3W2EA 4G65A 5ARCA 4QO7A 4ARZA 3TZ6A 1BFKA 1V95A 2J33A 1U8FO 3C3DA 3F7NA 4FBLA 1B73A 2W71A 2VNJA 4GBJA 4J7CA 1YQGA 1VP9A 2BY4A 2JJ8A 5B7NA 1MJFA 4FNOA 5JFOA 5IRCD 3GBVA 4NABA 1KSGA 4LRYA 4JI6B 5IM5A 3EA0A 5CVTA 4PC1A 4B7UA 3M89A 2P6MA 3NBFA 4FYIA 5EXXA 2DLNA 4OGLA 3ZHUA 4LZZA 1FU8A 1LBSA 4JLWA 4MA5A 4ZOEA 5JAMA 3L1UA 5CCXA 3MC1A 1Y1QA 4Q9NA 4F4DA 4CIBA 1NHGA 1H4QA 2QRQA 3U7QB 1EINA 3F7TA 4O1HA 1T2DA 5D00A 2WIKA 1L7MA 1R66A 5FYDA 3ZWVA 3A6PC 4XR9A 2J0UB 1D07A 5KYNA 1JECA 5FLXA 4X45A 1KO4A 1EJ6A 1NNUA 4GX5A 4L4UA 3PPVA 5ALMA 1PFWA 3M70A 1XA3A 2O1EA 3AW8A 3HEMA 3G6KA 4IQGA 1G4UR 1SD1A 3PFIA 4WZAA 2WI8A 3NHWA 1SKQA 3CWZA 4HBZA 4OXXA 3KB6A 5M7EA 2A1UA 2N46A 2VXYA 4MQFB 3FMFA 2FWJA 2EJVA 1DQSA 4FHGA 4RPLA 3ZDXB 3IDAA 5ICSA 1QRRA 3MGAA 3WOHA 3FJYA 2BI4A 2R6DA 3VZPA 1X1QA 1A4IA 1JHZA 4C6TA 2DUJA 4ILEA 2PWPA 4OM7A 4C4PA 4EQZA 1JQEA 1NKSA 1ZI8A 4R3NA 3BMOB 3M1IA 4DLRA 4Q4CA 3AV