5CG1A

Crystal structure of e. coli fabi bound to the carbamoylated benzodiazaborine inhibitor 14b.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
247
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
publication title Crystallographic insights into the structure-activity relationships of diazaborine enoyl-ACP reductase inhibitors.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 91
structure length 247
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5cg1A00
3DBLB 3RFTA 4AJ4A 5T57A 1AXEA 3GK3A 1IE3A 3JQDA 5JDCA 1ZUD1 1WDKA 3PJGA 1EVJA 2P9EA 2ZK7A 3HQ4O 4LVUA 2FY8A 4B3HA 2HMWA 2YFQA 1PWZA 5LC1A 1QLJA 1SNYA 1ISMA 3SEFA 3H9GA 4IXWA 1L7EA 4N7RA 1MXFA 5KKCA 4C7KA 3ANMA 1XCBA 1BXGA 3E03A 3BMOB 1UUFA 1R15A 3HDHA 1E3JA 1HDRA 1PZGA 5MGBA 2NACA 2AHRA 3DOOA 1R4NA 1H2BA 1UR5A 1VM6A 1HSOA 4JJIA 4YT5A 4PLVA 4XZ3A 1Z75A 1PQUA 3DAFA 2HLPA 3BTUA 1ULUA 4HADA 3PXXA 2WTBA 1M6WA 3ZNQA 2AMFA 4XWYA 3ROQA 1B0AA 3KOUA 1ZSVA 2GO1A 4W82A 3FNEA 2GN8A 4JROA 1F06A 1PGNA 4MOWA 3CZMA 4DVJA 3ANLA 4U0KA 3C7AA 2WMDA 4QTZA 1KEVA 1KVTA 5F3RA 4IIVA 4CM3A 4YRBA 3RUEA 2IEBA 3UVEA 1P1FA 1T1RA 5L51A 1E7YA 4OOEA 3H9EO 4ITUA 3BIOA 2Y0DA 3GUCA 3RBVA 1R4MA 1Q7GA 4X54A 4DGSA 4PIVA 5FI5A 4F6LA 4JCOA 4PLHA 1E7QA 4II3A 2NWQA 5LCXA 4B4WA 1QYDA 5L7YA 3RVDA 3INTA 3I9MA 1X14A 3DOCA 3D3WB 4PN3A 4OL9A 2B0JA 4NBVA 4WOJA 3FNFA 1K5HA 4PCVA 4Z0HO 3JD0A 4AJNA 1FDUA 1HDXA 3DMYA 3OMLA 4HNHA 4ZQBA 1JTVA 4JLWA 4CV3A 4CM4B 4ROSA 1EVZA 2PFGA 2ZB7A 3I9LA 3IKVA 1VLLA 2W4QA 3O8QA 2JFFA 2JCXA 1BTOA 1EFLA 4QECA 4NPCA 2CVOA 1DIGA 2A94A 3QQPA 3WQQA 4GSLA 3OETA 3WQSB 4Z3KA 1GUYA 3A9WA 1JWAB 1NAHA 1PX0A 3B1KA 2X0IA 2GASA 3C1AA 4HXYA 1PGQA 2X58A 3W8FA 3EMKA 1QXSA 3PGXA 4XGKA 2H6EA 4AJIA 1E7SA 2VTEA 1PJ3A 1LDNA 3GRPA 3V8BA 2BFAA 3BA1A 5L53A 3QVXA 2YDXA 4UVIA 2X0RA 4LMRA 1E6WA 4CMJA 3ZN2A 2C7VA 1P31A 2ZB3A 3GAFA 5EIOA 4YAKA 4J9VA 4IDDA 4DXHA 3V2GA 1EZ4A 1ZEMA 2EP7A 2J3JA 3VH3A 2BELA 1P1KA 4CLRB 4NR0A 3QY9A 4Q3EA 3Q0EA 1LU9A 2DVMA 2EGHA 5COQA 5EESA 5TSDA 1SOWA 1P0CA 1Y5RA 1A72A 5A3JA 1P74A 4BO9A 4CM8B 3PFWO 2VWHA 1LSSA 3GGGA 3JV7A 1GQQA 1ZK2A 3VTFA 5JY1A 4A26A 3L4SO 2DQ4A 3BMOA 5JCXA 1GYRA 4IQGA 2AW5A 1HE4A 3JYPA 4EUHA 3C85A 4XQCA 3JYNA 1E1NA 3KTDA 3GNTA 2HKIA 2VYND 3ZW9A 4YDRA 2IE0A 4XCVA 5JYEA 4ALIA 3AI3A 2HMVA 4F3YA 2EV9A 2NU7A 3MZ0A 1GZ6A 1KY4A 4M54A 5F5NA 5JLAA 1Y5MA 4ZVVA 4ZQEA 3W4IA 1E3WA 3L9XA 2GN9A 3QWBA 3CE6A 4J1QA 3VZRA 4K1LA 5LDGA 4Z9FA 3W8EA 3WGZA 5TNXA 4LW8A 5L3ZA 5GZ1A 1R66A 1NXQA 4I1IA 1CWUA 1Q2XA 1T4BA 1X1EA 1E5LA 4WEOA 3BMNA 3GA0A 3PK0A 2NQ8A 3WDSA 3VOSA 4JNKA 5GZ6A 5DCUA 1ZO8A 2ZCVA 3QHAA 1DB3A 4RJTA 2AE1A 1Z73A 1KIFA 4UVEA 5EL0A 1HKUA 3H7AA 3JD2A 4YACA 2OL4A 4DMMA 5C7LO 3WTBA 3GNSA 2O7QA 4ND1A 1B8UA 1ZMTA 1XKQA 3QWHA 3FD8A 1SB8A 2UUOA 4XX0A 3JQEA 3D3WA 3I23A 2EF1A 2ILTA 4AJKA 3JQBC 4EDFA 2QG4A 4DBZA 1HSZA 2DBZA 3INRA 2PTGA 3UCEA 3I83A 2IZZA 4W9NC 1WNTA 5EPOA 4RF3A 1B8VA 3ETDA 5IDQA 4J7XA 1PJCA 3WYBA 2I65A 4GGOA 1FK8A 3FR8A 3HSKA 1TLTA 2IEDA 2YV2A 1NR1A 4B79A 4CMCA 5FWNA 3TFOA 1HRDA 1L1FA 3IOYA 3AM5A 1XHLA 1HYGA 2VHZA 4I5EA 4RZIA 3RROA 4YVFA 1EQ2A 2H1SA 3DB2A 5B37A 4GBJA 1T2FA 4OMUA 1HXHA 2NLOA 4M87A 3GY0A 4YJHB 2WE8A 4KUHA 4KUEA 2IODA 2HMSA 4P4GA 1Q0QA 2A92A 4B4VA 1ENPA 3GF4A 2O3TA 2ZKLA 1NPTO 2FR8A 3RUIA 3S8MA 3JYLA 4RLSA 4P8RA 1S6YA 1KY5A 1EDZA 1YKFA 3GVIA 4OQZA 4WGGA 5COBA 3S2FA 4TZTA 1RM3A 4BNMA 1UZMA 1R6DA 1JQBA 4Q3CA 1W8DA 3VDRA 2BD0A 1ISGA 1V0JA 3AY7A 1I2CA 4FC7A 4CV0A 3DHYA 3JYOA 4LGVA 4JBHA 4CM8A 1DIRA 1O9BA 1X0XA 3GEMA 3LK7A 1B3RA 2OMEA 3L07A 4ESOA 4CM9A 5AVOA 5IDXA 4ILKA 3PWSA 1ZXBA 3R3JA 1QYXA 2CMDA 4J43A 4E6PA 5A9RA 2VZ8A 4O59O 2RH8A 5KVCA 5CHEA 1NAIA 3LVFO 4O63O 2Q2QA 2BHLA 3NJ8A 5JAMA 3HHPA 4XDYA 1SO8A 1XR3A 1JDJA 1ZZEA 3OIFA 1Y7TA 1TT5B 4O0LA 1TT7A 3IUPA 1ADCA 1XG5A 2Y1FA 2QRLA 2TMGA 1ADBA 1DFIA 2Y1CA 4GWKA 2B4RO 4UREA 3QVTA 1AUPA 1CQIA 3EZLA 3L6DA 3PHJA 3VZQA 2NNLD 2G5CA 3R6DA 4A2CA 5TT1A 4R01A 1M76A 2VNAA 4BV8A 1EK6A 3R0IA 2VWQA 2D5AA 5DN9A 5TX7A 2PLAA 2XXBA 3VPGA 4BNLA 2IZ0A 4DREA 3FTNA 1NHGA 1LLCA 3O4RA 2X5KO 1YVEI 2E48A 5H82A 1B14A 1DOHA 5F1KA 1N7HA 1FDSA 1HDGO 3FPCA 4KWIA 4ZRMA 1U28A 4XB1A 1Y8QB 1DDOA 3VKVA 3WMXA 5JBIA 2GSDA 1HETA 2Q50A 1DBVO 5CDYA 1FDTA 3OHSX 3HDJA 1QMGA 6ADHA 3U49A 1ORRA 2EHDA 1RWBA 2G0TA 4TRRA 4XDZA 1I5RA 5COAA 2IYOA 4GH5A 4A03A 5TLSA 2PZJA 4CQLB 4BOYA 4Y98A 4OSPA 1WP4A 3D4OA 2RIRA 1E77A 3OEYA 3T4EA 3O26A 1KBZA 1C1DB 2PV7A 5TF4A 3QJ5A 2J6IA 5KVQA 1K2WA 1J6UA 2B5WA 2FN7A 1QSGA 4DA9A 3WSVA 1GD1O 4HFRA 4PLWA 4AJOA 2CUKA 3HFSA 4BKQA 2BRUA 4LCJA 1IHXA 4YJHA 3ETGA 4I9UA 3DOJA 4P22A 4E5KA 5AQ1A 3PFFA 1WDMA 1O94A 4J4TA 4NH4A 5C7OO 1DRWA 2O4CA 3WX0A 3I4CA 1MLDA 3MWEB 3PJDA 4UUNA 4DUPA 1V9LA 1UXIA 3C8MA 3GDFA 3RUCA 3MWDB 5FF9A 3GN2A 5F21A 2JKVA 5JPIA 1NVTA 4J4BA 1GQYA 2BF7A 2ZYAA 2O48X 4JBGA 1G0NA 3PHIA 3A06A 5DF1A 3HB4X 1DLJA 2VYVA 1GAEO 3BZUA 4GMGA 2AEJA 3ZI0A 5JAZA 2HJSA 2PR2A 1JVSA 3HUDA 4GLLA 4OXNA 5A9SB 4MVJG 1IZ9A 4BNTA 1EE2A 5JS6A 5AYVA 3BYZA 4IDCA 3NAQA 4D41A 2E82A 3VPXA 2UVDA 3ABIA 4XYLA 5ER6A 2EIHA 2WYVA 5JO9A 1C0PA 1K0UA 1YBAA 4BB5A 3QLJA 4XRRA 4J3FA 4L74A 2NM0A 1K89A 2C07A 1I01A 3EAGA 3OQ1A 3PDJA 2C5EA 3WMWA 1KERA 4FFMA 4LN1A 5A05A 3WTCA 1HL3A 4R9RA 4IDBA 1TT5A 2J3HA 3OA0A 4R69A 1UDCA 2HAEA 3VAZA 3TOZA 4I5GA 4EEXA 4UVDA 1B2LA 1Z7BA 2UDPA 1J0XO 4IM7A 3SXPA 2V6FA 1PL6A 5G4LA 3DONA 3GZ4A 3WGTA 3PDUA 2X0JA 3JQ8B 2AG8A 2DU8A 1N92A 1ZJZA 3OECA 2WSBA 3FI9A 2Y1EA 3D64A 3QP9A 5T64A 1NX6A 1I10A 5GY7A 1QYWA 4R54A 3NTOA 5A04A 4HFNA 5TIIA 4YA6A 3H5AA 4NJMB 3HG7A 3PGJA 4DTIA 5FEUA 2O2SA 4PLCA 1T26A 3DZHA 1Y8QA 3G1UA 3K6JA 5K6AC 1H6CA 2OO5A 3G0OA 4QQRA 5JFOA 4BNJA 4EITA 1X1TA 1ENYA 3PQEA 4NFSA 5JAQA 1U4SA 1LRKA 4DQUA 3MJTA 3PWZA 2JCYA 4GVXA 2NVUB 4MVJF 1X7DA 4WLNA 3VHRA 3ONEA 1YL6A 3MJEA 3WIEA 4BVAA 1NFRA 2IXAA 2UYYA 1AGNA 3F4LA 5MDHA 3ZHZA 4J0FA 4IDEA 1FDVA 1H2HA 3EC7A 3NTQA 4QFCA 1DPGA 2FPPA 2W8ZA 4BNGA 4D43A 5U9CA 2DUWA 3FWNA 3V5NA 5FFFA 2WD7A 1RYEA 1KVQA 1SOVA 5BSEA 5A9TA 1NBOA 1ID1A 4FJ0A 2CFCA 4AJPA 2D0IA 4U7WA 1UXJA 3GGPA 2FRDA 2DBQA 1ZK1A 3IL2A 3TZHA 4PVCA 1NPDA 3HB5X 3EZYA 4OOFA 3U09A 3KETA 1LDGA 4FBGA 3G17A 1T1SA 4NK4A 4E5PA 3SVTA 4EBFA 3PJFA 2G17A 2ZYGA 1WPQA 3CINA 1OFGA 3KYDB 3OM9A 4YAGA 1IPFA 4FDAA 3ZV5A 5B4TA 5K6AA 3VH4A 5IAAA 1X15A 4MPDA 4DQXA 1R0KA 1QYVA 1XELA 2X23A 4CQMA 4HKTA 4D3FA 5A03A 4E0BA 3JD4A 3LSYA 1MA0A 3JQFC 4IDGA 1UH5A 5IF3A 5DNAA 2XAAA 4F45A 1HZZA 3ITDA 1A7KA 4JJFA 1P0FA 4CLHA 5IZCC 1UXHA 1O8CA 4AVYA 2IDZA 3A28A 4BNFA 1E3LA 1C0LA 3A4VA 4CLDA 3RQSA 1K6XA 4RVUA 2IXBA 1DJQA 3H9QA 3NT5A 3GQVA 1YJQA 3Q2IA 5EJ2A 2J3IA 4A27A 2VNSA 5JY6A 4KP7A 4YPOA 2POQX 1JW9B 2DBRA 4G65A 1PQWA 4GI2A 3FNGA 1F14A 1RPNA 1CIVA 3HNPA 5F5LA 3M6IA 3OQBA 1ENZA 3QE3A 5DT9A 1RM4A 2BFPA 2Q4BA 3ZV3A 5TRTA 1HLDA 1F8FA 3DZIA 1N9GB 1I32A 4FB5A 4FOSA 5EERA 1LC0A 4TWRA 5JE8A 4JP3A 1VKOA 4OGWA 4DC1A 2RHRA 4NBRA 3HZZA 4S1VA 1RYDA 1HDYA 4CR6A 2EW2A 2RHCA 1BMDA 1MC5A 2VUTA 3IAHA 3PYMA 4ND4A 4JBIA 1JAYA 4YT2A 2V65A 5CPBA 2OP1A 4RLHA 4TZKA 3AK4A 4A7PA 1UP6A 3C7CB 4PGFA 4EYEA 1AN9A 4RDIA 1I30A 1XU7A 2J5RA 3I9KA 3JQFA 3U4DA 1J4AA 2UUPA 4LRTB 4R16A 1M67A 4TRJA 2D3TA 5IZCA 2IYPA 1P9LA 4XD2A 4BO1A 1QKIA 3K96A 4RPJA 2BLLA 5IN4A 1ZNQO 1NWHA 4JP2A 4DL9A 3TQHA 4OHUA 3ONDA 4NBUA 1G6KA 1NYTA 1O89A 3N58A 4IIUA 1ZK3A 3LF1A 1DC5A 2NTJA 2I3GA 4O1MA 1I3NA 4BO5A 1OAAA 4DIBA 3I6IA 3WOHA 3NKLA 3C24A 3N7UA 3OJ0A 3CMCO 3BHMA 1UDAA 4P4LA 1XQ1A 1YWGO 3TPCA 2PD3A 4WLOA 3RKRA 2BH9A 1NPYA 4UAGA 3ZWBA 3H4VA 1PL7A 4BO0A 1Z82A 3ZNNA 3QWIA 3DWFA 1LSUA 1ZVMA 1HDOA 3ZV4A 3WG9A 4M89A 2VRCA 1J5PA 4NI5A 2NTVA 1F8GA 1C1XB 3GNQA 2H5LA 4M1QA 4FGWA 4GVLA 3KVOA 3MJSA 3W6ZA 4R1NA 3ON5A 4CUJA 4RORA 1P1IA 4ALJA 3ZU5A 2VWPA 2X7HA 4D44A 1N1GA 1MGOA 3P2OA 5DOVA 5T67A 5ITVA 3TZKA 1PQPA 4BKUA 5B1YA 1KC3A 3VC7A 2JL1A 2ZB8A 1Y8RB 2FSSA 1JU9A 3VZPA 3AW9A 3LC2O 3FCOA 4Z3DA 3K8ZA 4LSMA 1R0LA 4CMIA 4KTTE 4GWGA 3W1VA 1JKFA 1YE3A 3MJVA 4HX5A 5KKAA 2EXXA 3TZQA 3DDNA 1B3BA 3QWFA 1FMCA 4DRYA 3VKUA 4JIGA 5BT9A 1VL8A 4LRSB 3TL2A 1LRLA 5LDHA 3PHGA 1PJ2A 5G4KB 1GUFA 3BHJA 3T4XA 4D3SA 4OKNA 2CDBA 2J5QA 4RV9A 1ZK4A 1RM0A 3SC4A 3KHUA 3ST7A 1H9BA 1V3UA 4S3MA 5ADHA 5ER9A 3CSDA 4FCCA 5F1PA 1KVSA 3IIEA 3WS7A 1O5IA 3EHEA 1IPEA 1PJLA 2JHGA 2XPCA 4W6ZA 2BGLA 5KJEA 1PJ4A 4G81A 4ZU3A 3SC6A 5EMHA 3U3XA 2EP5A 2OBYA 4NJOA 4ZQGA 3MCVA 4R3NA 3EYWA 1X13A 4B7UA 3H2SA 3PI7A 3OFSA 3GMSA 4YJGB 4ZQFA 3OICA 1EDOA 1ADFA 3K5PA 4OAQA 1IZ0A 1O6ZA 5G2OA 3UKOA 1M75A 5L7WA 2NU8A 4E5MA 4NIMA 3QA9A 3MTJA 2I76A 3I1JA 4TVOA 1KC1A 2OXIA 1OMOA 2RAFA 3LC1O 1H0KA 2Q2WA 4K6FA 1ZK0A 2HMUA 1XWFA 4K9DA 1MX3A 5IJZA 1Z74A 1RKXA 4I9HA 2W2LA 5KWEA 4L75A 4FGSA 4YRAA 3B1FA 1ISHA 3NYWA 3WGHA 5DCYA 1GCUA 3DBLA 3RWBA 1HE5A 3KSDO 3K30A 4M86A 4MVJM 4RPGA 2GF2A 5EINA 4AG3A 2VOEA 1BVRA 2PD6A 1YH3A 1XIVA 1SAYA 4TROA 5G0WA 3NX4A 4XYBA 3AM3A 3H65A 3KV3O 4BGUA 1ZFNA 3FTPA 5CG2A 3P5SA 4CL3A 2D1YA 1U7TA 2B36A 4QT0A 2DUUA 1UP4A 2NTNA 1YB5A 4WLUA 2W98A 1WMAA 4HWKA 4Z0TA 1SPXA 1C1XA 4YJFB 1I3LA 3AOGA 1DAOA 3OA2A 1R37A 1AHHA 1DC6A 4IY1A 4BO7A 1GR0A 3FSRA 4N18A 1U2GA 1IULA 3DBHB 4YR9A 1D1SA 1CDOA 4PRKA 4R3WA 3E1KA 3RUHA 4EUEA 3TWOA 5C37A 1YOVB 3NDRA 3SLKA 2NADA 2ZYDA 3I9NA 1R0SA 4KWHA 3KLMX 3CIFA 3EY4A 1YDEA 4MIOA 3VPFA 3ZHXA 5G0UA 1E3EA 4MIEA 4E32A 1UAGA 3OIGA 5TT0A 1MP0A 2PGJA 3ANNA 3M1LA 4GX1A 1A4IA 1ML3A 4JQCA 4DQVA 3BTOA 1T25A 2FPGA 3P7MA 3I9JA 1I2ZA 1CYDA 1GEEA 2X1HA 5G4KA 3RC7A 5JMWA 1LXCA 3OF2A 3I5MA 3WSWA 4D45A 1PR9A 3E9QA 1T2CA 2PKRA 2VWGA 1NM5A 2YQ4A 4E2WA 3WFIA 1XA0A 2AE2A 2JFGA 5HBRA 3JQGB 1PZHA 2YYYA 3ZNOA 1TEHA 3OJOA 3RUAA 3PHHA 3GFGA 4JN6B 4TQGA 8ADHA 3TN7A 1LX6A 4J1TA 3WYCA 4A5OA 5JYDA 1M6HA 2DFDA 4ALLA 4ZHSA 4E21A 2C2YA 1EMDA 4FN4A 2CF6A 1DJNA 3TJRA 4IMRA 4Y8VA 3QV1A 4H7PA 1U5AA 1DFHA 4CM4A 1EUZA 4YJGA 3S1LA 2X6TA 5KJCA 4BKOA 4WUVA 2A9FA 2O3UA 3DZJA 1BXKA 4XJSA 3DHNA 3ROPA 1OI7A 2NUAA 2Y0CA 4FQ8A 3DFZA 4I8XA 4D46A 1TI7A 3RD5A 2VHXA 4IZIA 4J7CA 2V6MA 2ZJ0A 4PLZA 1R12A 3V1TC 2VCYA 5I7VA 5BNIA 1U8FO 1B7GO 2G1UA 3DO5A 4RPKA 2J8ZA 3ENKA 4FFLA 4XKJA 3UCFA 3PYLA 1A71A 2B35A 3L6EA 1O0SA 4MP6A 1G1AA 1A27A 2GCGA 1T2DA 3NGXA 2VHYA 3ONFA 5A3VA 3AU9A 4NFHA 2ZATA 5CFZA 4CLRA 1DFGA 2VZ0A 4I9NA 4BNXA 1XLTA 3KSZO 1CJCA 4IDAA 3ZH2A 6LDHA 3JQBA 4FOOA 3GOHA 4GGPA 3NV9A 3PLRA 3WB9A 5I9MA 5TS3A 4MVJH 4WLFA 5HWSA 4UUOA 4YT4A 1SZJG 4RVFA 4TVBA 3JQ6A 3F1LA 4W9NA 4PZCA 2QQ5A 2VYNA 3AU8A 5G0SA 4AJLA 2E37A 4YJFA 1GFSA 3D5TA 3WGOA 2GD1O 1QV6A 4ZQHA 1LQUA 2VYVD 2FWMX 4OQYA 2NU6A 4YWJA 5EQFA 3DBHA 4KMSA 3UFXA 3PRJA 3BMCB 5T8KC 1NVGA 2O7SA 3D0OA 4NDNE 3ADPA 3ENNA 4DPKA 5HTOA 2FZWA 2UV8A 4J16A 1T4DA 3DAGA 4Y6PA 2DBVO 3TL3A 4LSWA 3TF5A 4GPD1 2HRBA 1Y81A 1Z7EA 4YAEA 4G2NA 2PH3A 3JQCA 3TFQA 2DLDA 2HO5A 4PG7A 1UZLA 5BSFA 1KVUA 1WZIA 2GERA 3HADA 4WCFB 1QP8A 4TKLA 2ZB4A 3KRTA 4PZEA 3ROMA 1VC2A 5K0ZA 3AUUA 2I9PA 4J91A 1GADO 4Q3DA 3CEAA 5BNFA 2CF5A 4BNVA 4DIFA 2G82A 2D2IA 4WECA 1NVMB 4ZICA 5DP2A 1U4OA 2Y1OA 1ULSA 4BO3A 1YRLA 1WAMA 1F12A 4BNNA 1SEPA 1CETA 2PA3A 1ISIA 5ENDA 3IJRA 3LT1A 3LT0A 1WDLA 1CERA 5H81A 5L9AA 4EW6A 1M66A 4NU6A 4WJZA 4FW8A 4XYEA 4BHTA 5T8KA 4DWVA 4Z6KA 5CDGA 4UULA 2X9VA 1FF9A 1GUZA 2EKQA 3QVOA 1DRUA 4HNGA 5KNLA 2V6GA 3JSAA 2QHXA 3TRIA 3AFNA 4DPLA 1HTBA 2R6JA 1U9JA 2VHWA 1E1LA 3LT2A 4CMAA 4D0RA 1GQ2A 1NQ5A 4CM7A 3EVNA 3DXFA 3AY6A 4UUMA 3PWKA 5JDIC 1NP3A 5AXBA 1K3TA 3JYQA 1I8TA 4A73A 3GZNB 3EUWA 5ITWA 4II2A 3N74A 3ZCXA 4FC6A 2I67A 2C2XA 3GG9A 3GEGA 3DAPA 1GPDG 2HK7A 4FIZA 2W2KB 4ZA2A 4A10A 2Q2VA 1GCOA 2TMDA 4BMSA 1OC4A 1EUCA 1VL6A 4B7XA 3X2FA 4LVCA 2GPTA 1B8PA 1VJ0A 3RSHA 2PWZA 4HP8A 4J0EA 3BAZA 1UP7A 4TMFA 2I6TA 3NTRA 4L8VA 1DRVA 1VI2A 3DEYX 1Z45A 3ZWVA 5I8ZA 1PJTA 3OJEA 3I6QA 1NFQA 3QVWA 5A06A 4C7JA 2HUNA 3RASA 5THQA 4DYVA 3D4NA 2FPIA 2C29D 1NWCA 4ALNA 1KETA 4J1NA 4F46A 4CLEA 3OP4A 3PZBA 4BO6A 2EG9A 2DTEA 2CVZA 1ZIDA 3PZRA 3SJ7A 1GY8A 1LUAA 2P9CA 2VQ3A 2Z1NA 3ASVA 3GMDA 3HDYA 3M1AA 4E5NA 3DFUA 5T5QA 4CV2A 2CY0A 3Q9UA 1R16A 3IJPA 2G76A 5JDIA 1YGYA 3RJ5A 3ZHYA 3E6AA 4BGVA 4E13A 5L95A 1LEHA 4CJXA 9LDTA 1ONNA 2NVWA 1AE1A 3FR7A 4L76A 4EZBA 4CLOB 2ZTUA 3B1JA 1IOLA 1EFKA 4UEOA 3UICA 2D5CA 1HYEA 2Y0EA 4MINA 4JJGA 3ROKA 3RC1A 4WE3A 2E49A 3JQAD 1SEVA 2QIOA 2E4AA 3PQFA 3ORFA 4RF4A 5L7TA 3WNQA 5HA5A 3FRJA 3GVCA 3KZVA 2I66A 4XQ9A 4J2HA 3GAZA 4HY3A 5ICSA 3A1NA 4PZDA 1LC3A 2DPGA 3GPDG 4MO2A 1DC4A 4J49A 3UF0A 1CF2O 3GG2A 2D8AA 5BSGA 2FR1A 4RQTA 3TDKA 4CQLA 4PG8A 2VN8A 1PS9A 3LU1A 5ICMA 2YQ5A 4N54A 3ZWNA 1C1DA 4NBWA 4DC0A 5A5FA 4XR9A 3VH1A 1NASA 3C3XA 1YQGA 2ZTMA 5B4UA 1DIHA 5DOZA 2Q99A 1SB9A 5CPFA 2QZZA 4FFRA 5JCJD 3QSGA 1GZ3A 3DHEA 2Q1TA 3E18A 2YV1A 3ZWAA 4DYDA 2P5YA 2HSDA 3ZWXA 4BMVA 4RL6A 4IMPA 4R51A 4M49A 4EGFA 4H16A 4JXKA 3S2EA 1W73A 1MB4A 4ND5A 3VPHA 2OGUA 4WK6A 3AM4A 4CM1A 5T6BA 4P38A 3WLEA 3MEQA 2HMTA 1A4UA 4YEDA 2HCTA 2GLXA 2O50A 3L0DA 4Q3BA 3GZNA 1P77A 3EVTA 3K31A 3H8VA 2PGDA 4CPDA 4BO8A 2OHXA 4ALKA 3JTMA 5HRUA 2W2KA 3Q11A 1E1KA 2HJRA 2YHIB 3PEFA 1HE3A 5BSHA 1P33A 1BXGB 1JVBA 2X8LA 3WBBA 4PRLA 5A9SA 3QW2A 4MVJA 1BW9B 1V8BA 3M2PA 4J9UE 4L4RA 1VJTA 4TRNA 4E2YA 1D4FA 4EJ0A 4NG5A 2Y66A 4LMPA 4YT8A 4BO4A 2DKNA 1ONPA 2X4GA 1DHRA 2WE7A 4FS3A 3DBRB 1EBUA 3PPIA 4WNIA 3W8DA 2AQKA 4ONEA 1F0YA 3GLQA 2ZQZA 4NZ9A 1NFFA 2V7PA 3WR5A 7ADHA 3JQ9C 2H63A 4GQAA 5JC1A 4L4SA 5JO0A 1EQUA 4OIMA 2C82A 1H5QA 3ICPA 4J2OA 5FI3A 3VZSA 2DC1A 4MJLA 3WLFA 2AEMA 3LDHA 4IINA 5IN5A 4F6CA 1NNUA 3K92A 1GV0A 3DL2A 4NNJA 4MKXA 3TSCA 1TVEA 1HT0A 3UUWA 3JQ8A 1HZJA 2PY6A 2BI7A 5IDYA 1LJ8A 1YQDA 1JKIA 3PQDA 4IXTA 3IDSA 3QIVA 4GL4A 2AXQA 4BUCA 1A5ZA 1N1EA 4NJMA 5CEFA 4NU5A 1FXSA 3ULKA 1GDHA 3WIDA 3F6YA 2GN6A 3TZ6A 4O6VA 4BMNA 1IYZA 4IDFA 1VPDA 3U62A 2EWMA 1N5DA 5IXSA 3KUXA 1WWKA 4BO2A 2D4AA 1DHTA 3OQ6A 2Q4EA 5C5IA 2PZMA 4RZHA 4BL5A 2HDHA 2OFPA 2B4QA 4B4OA 1ZW1A 2NVUA 2WYUA 2PH5A 3AI2A 4CMKA 3NJ4A 3NT4A 2O2YA 2RBEA 3NEPX 2ZQYA 1H9AA 3JQ9A 3DZFA 3SX2A 1TXGA 1BRMA 2GGSA 3O8QB 5ES3A 3NRCA 3H6KA 1N8KA 1EK5A 2FZEA 2EERA 4MVJI 4OXYA 2HRZA 4QX6A 1IY8A 5DBGA 1P3DA 5TJ9A 4AJHA 3KEQA 1YJ8A 1I33A 4CL8A 3P2YA 4FFOA 4AL4A 4KOAA 1AXGA 2P68A 3D7LA 1KVRA 1GPJA 1QR6A 3HWRA 1HWYA 2YDYA 1PGOA 1PZFA 1HEUA 2LDXA 3D3EA 4W7HA 4E5YA 4RF2A 4GX0A 3WJAA 1V35A 4FD3A 3MJ4A 1YB4A 1OBFO 1X0VA 1FJHA 4NMHA 4KZPA 2C54A 4MIYA 1U3VA 2P4QA 1E7MA 1WW8A 3W4JA 2CDAA 2VUSA 1YDWA 3E8XA 2WJPA 2GUGA 1IB6A 3KYDA 5I9LA 3COSA 1HE2A 4HV4A 1Q7CA 2CSUA 2B69A 4OXKA 1ZSYA 1DSSG 2P4HX 3VH2A 4E30A 3NDIA 2E6UX 4CR8A 2QYSA 3IP3A 4N5MA 3FPLA 5HS4A 3FBGA 3ICCA 2JFHA 2YHIA 3JQ7B 4ZD6A 1PJBA 1MXHA 4BQRA 4RPHA 5I7EA 3H5NA 1GU7A 1BW9A 4DMLA 1C14A 4EJMA 3ZWCA 1LNQA 1A9YA 3LF2A 3V1YA 3UGKA 4KDFA 4M55A 4IS2A 5I8WA 2AEFA 1KEWA 2AQHA 3P19A 3AUSA 2Y99A 4B8ZA 3DBRA 4HFMA 4NK5A 2CD9A 4U0JA 4CMBA 5B4VA 5KVVA 3ADOA 5A4DA 4OJNA 4L73A 5CEEA 4XJTA 3W4KA 2V6BA 3PP8A 1E3WB 1UXGA 3I3OA 3INGA 1E92A 1P44A 1P1RA 4YAIA 4R1SA 4HBGA 2JJYA 3WYEA 3H9UA 4XEHA 4PG6A 1GEGA 1N9GA 1HYHA 5IDWA 3GVHA 5CDUA 3HJAA 3OJFA 3Q2KA 4PLTA 3ZNPA 4XQEA 3BMNB 5A5EA 2Y05A 1E6UA 2H9IA 4NQZA 3Q3CA 1ADGA 1UAYA 4CUZA 1ZKMA 4R1UA 1PJSA 1KS9A 3FF4A 3OBBA 3FN4A 4PFJA 2RCYA 1C3VA 3HFGA 3ZWMA 2Y1GA 2EJVA 5CDTA 1L7DA 2VTDA 3WBFA 4ALMA 3AOEC 1PGPA 3DTYA 3M2TA 4YCAA 3CUKA 4CMGA 2WEKA 1UZNA 1RJWA 4UEKA 3H3FA 1YXMA 2FMUA 3V1UA 3F9IA 1NHWA 3O9ZA 4BKRA 1WVGA 3SBOA 5TQVA 2OORA 2VRBA 5CDSA 1YS4A 3VVBA 3KSUA 4R4JA 1LQTA 1U5CA 1E1MA 3GEDA 4E2XA 5KCZA 4AJ1A 4BNZA 2OOSA 4H15A 4Z9YA 3IUSA 3WGYA 2PNFA 5IXYA 3HE3A 5L4SA 2EGGA 2JAHA 4AJJA 2F1KA 4R68A 4N5LA 4TKMA 3AWDA 2YV3A 4XRGA 1PJQA 4GMFA 4QFDA 5KOIA 1NQAO 3HDQA 2GNAA 4TRMA 2FP4A 1ZMOA 4OSOA 2C7GA 3V2UA 4CODB 3ZWPA 4ND3A 1LLUA 4UVGA 3S2GA 4BNKA 4YAJA 5C3MA 3D4PA 3E82A 3F4BA 3GHYA 2VUUA 4NHEA 2I99A 4QEDA 3ZW8A 1PEDA 4I5FA 4XB2A 2XOXA 3ITKA 3S2IA 4B3IA 1N2SA 3AJRA 1TA4A 2Y93A 2JCVA 3AOEA 2BFOA 3L9WA 3CKYA 4P4NA 2DM6A 4OYRA 1E6EA 3FHLA 3ZV6A 3WQRA 2O3RA 3EGOA 4WASA 3BMQB 4Y6RA 8LDHA 2X86A 4E12A 4RVGA 1LSOA 2DT5A 3VVCA 1AHIA 1ZBQA 1ONOA 2X9NA 4FSHA 4GSKA 4MVJP 3RFXA 3JQ7A 2RH4A 4J90A 3K9QO 4H3VA 1OOEA 2IZ1A 1Y8RA 4Z0PA 1Q0HA 3A14A 4Y67A 2X5OA 2WM3A 4XA8A 3MJCA 4DLAA 1S7CA 4DIOA 1JWBB 3UN1A 4CM9D 4K6CA 4OM8A 3U9LA 3K73O 3MOIA 1PIWA 2CVQA 3JD1A 5JMPA 1NQTA 1WZEA 1T24A 3GN1A 5IG2A 1H93A 2P2SA 1NR7A 2YFHA 4GKBA 5HM8A 3KB6A 4BB6A 3WWZA 4IJWA 4RVSA 4YRDA 1RM5A 5L40A 1Q7BA 5JW6A 3DMTC 3T7EA 1GYPA 3G1TA 3V2HA 3GUYA 4GKVA 1XGKA 1X7GA 4MDHA 4PLYA 3UW3A 4J1SA 3W6UA 3ZWYA 2O3SA 3WNVA 1LRJA 1P1HA 2VZ9A 2HU2A 1I36A 4ZN6A 4U6SA 1U7HA 4C4OA 3IQDB 2B37A 3GVXA 3KBOA 4I08A 1VL0A 4AJ2A 2WDZA 3BTVA 3DC2A 3GFBA 3UAGA 4E2ZA 1V3TA 1I3KA 2OP0A 1E0DA 1XEAA 5G0VA 2YJZA 2EEZA 3F5SA 3KYCB 2C59A 3QVSA 2WYWA 3IS3A 4IUYA 4D3DA 4CLXA 2O3QA 3MOGA 4YXFA 4E33A 2P91A 2PD4A 2ZTLA 1LLQA 2Q1SA 1KEPA 4E4YA 5KJ1A 4WLVA 4BQPA 4FJ1A 1ISFA 3TNLA 5I9NA 5AOVA 2IRWA 1MV8A 1C0IA 2ZIZA 3ZDFA 2QX7A 3RU7A 3RUFA 3VDQA 4Q3AA 3RI3A 5KJ6A 4ZRNA 5I7FA 3O38A 1BGVA 4IJVA 4U8GA 1EVYA 5CG1A 1PR3A 1MG5A 1W6UA 4K28A 3E48A 1HDZA 4L9RA 2PZKA 2VOJA 1ARZA 3PIIA 4YTEA 3ZHBA 3DMTA 2X22A 4DLBA 4XIJA 1Q1NA 2GRAA 3FNHA 3QRWA 2Q46A 4E31A 2Z5LA 7MDHA 2Q3EA 3DZBA 1N7GA 1V6AA 4R9SA 1PZEA 1BXZA 3O03A 5G0TA 3U4CA 3CTMA 4RVDA 3OEWA 3OSUA 4JGBA 1HF3A 3NUGA 1SCUA 5DBIA 2Y68A 1I24A 3LQFA 3NT2A 4PVDA 5ENVA 1IHYA 4DLLA 4D7AA 3I9OA 5DCWA 3CMMA 2YZ7A 3JCZA 4MP8A 4Q39A 4BNYA 5TGDA 1D3AA 1ZSNA 3BMQA 1PTJA 3RU9A 4YBZA 2BFMA 1JA9A 5AXDA 2Z1MA 1CQJA 1ZCJA 4TSKA 4MKZA 1YOVA 3GH3A 3RBXA 3KLPX 4XYMA 3G3EA 3TOXA 2Z95A 4YYZA 3KO8A 2HK9A 2VT2A 2BGKA 4IBOA 4AFNA 3OIDA 5EQDA 2FHSA 5L4LA 5J23A 3I52A 4CV1A 1BSVA 4J4HA 1LA2A 4OKIA 2O3JA 3H2ZA 3NDJA 2W90A 3PLNA 4FFPA 1PS8A 3UH1A 1ZXLA 1KOLA 4YQYA 4G5HA 3NGLA 5FYDA 4DBVO 1EE9A 3EW7A 4O5OA 5HS6A 3F5QA 3BXXA 3JQGA 1V3VA 3DZGA 4HUJA 1W4ZA 1YBMA 2EKPA 4RPLA 2O23A 1YO6A 4YB8A 1LDMA 1X7HA 2JHFA 3B20A 3RUDA 3I4FA 1DEHA 2P9GA 2J5KA 1T2EA 2PKQP 4ND2A 2AA3A 3OJLA 4B4UA 4CM6A 1Y6JA 4XGIA 3L77A 4K26A 5TJHA 3RKUA 1DIAA 2FR0A 2ZJ1A 1YB1A 3GHHA 5DZSA 1JN0A 1KEUA 3CH6A 4CMHA 2C20A 4KUGA 4EJ6A 4W99A 4W7IA 1QORA 4JK3A 1KYQA 2VHVA 3KYCA 5DDIP 3DQPA 2HQ1A 4M8SA 3E5MA 1IL0A 1BWSA 2X9GA 1LTHR 3PVZA 2FSVA 5JAIA 5THKA 3BHIA 1XQ6A 5AXAA 2B5VA 4YQZA 1F17A 1CRWG 2JD0A 4CUKA 2GZ1A 3S55A 2AQIA 5U4QA 4J6FA 3ZGYA 4ZJUA 4JX8A 5GMOA 3LYLA 1GYQA 3RCBA 3PTZA 4WPGA 2DPHA 1EUDA 1FDWA 4W4TA 2WD7B 4RGBA 3L6OO 4PG4A 1DC3A 1IUKA 2C5AA 3WXBA 4CMEC 3WJ7A 5L45A 3G79A 1B26A 2OUIA 1H6AA 1XU9A 3RJ9A 1SBYA 1DIBA 3WWYA 2EKLA 4PLGA 2B83A 2GYYA 4R5HA 1VKNA 1DLIA 3SLGA 4GX2A 4GLOA 3K2EA 1GZ4A 1DO8A 2A4KA 4XR4A 1B16A 4WCFC 4YJDA 1ZJYA 2QYTA 2DFVA 4BGEA 4IZHA 4L4XA 3GC6A 3HN7A 2NSDA 4QSMA 2I3AA 3LLSA 3UHAA 4WEQA 4E3ZA 2I5PO 1MG0A 2EJWA 4Q9NA 2ET6A 1OC2A 4Y9DA 2YHUA 3U5TA 1EEHA 1O95A 2AG5A 1VRWA 2HK8A 3E5RA 4IQ0A 4IGEA 2BGMA 1LSJA 1Q0LA 4NFYA 2XF8A 1JLLA 1OZAA 3FBTA 3GT0A 5JNLA 2QRKA 4CQMB 4IQ8A 1YQXA 4A0SA 4QO7A 1JKJA 4CQMD 3FWZA 4B7CA 4DPMA 5I7SA 4XIYA 4KQXA 2VT3A 3BMCA 3DBVO 4ID9A 4ZGWA 3PYXA 1WMBA 2X5JO 2YY7A 4MVJD 3RIHA 2Q1UA 4WNCA 1ISJA 2Y67A 1M2WA 2BMAA 5BR7A 1C0KA 1E7WA 3B6ZA 1E3IA 2X0NA 1GV1A 5L4NA 4RF5A 3K2BA 4CMEA 4URFA 4BNIA 2R00C 3STHA 2UAGA 1DAPA 3WFJA 2YW9A 4IJUA 3GGOA 2P5UA 1XYGA 1VSUA 3JD3A 3R3SA 5ILGA 4B8WA 2JD1A 3JQAB 2Q45A 3RFVA 5DP1A 3UOGA 1NTOA 4WCFA 4N5NA 4CR7A 5KIAA 4BNUA 1I0ZA 3LT4A 3Q1LA 1U8XX 3BTSA 3HN2A 1JAXA 1P45A 3VPSA 1D8AA 1U3UA 1BVUA 1MFZA 5A02A 4U5QA 1W0CA 3GDOA 1I3MA 5KJFA 1BDMA 2GN4A 4Z9XA 5KVSA 1Y9EA 1U3TA 4LK3A 1U1IA 3D5QA 1E3SA 1BHSA 4GX5A 5ILOA 4XGNA 2EW8A 1T2AA 1GL3A 3F3SA 3IC5A 3Q6IA 2GZ3A 2CDCA 3ZU4A 1EVIA 2CNBA 4XQGA 4BV9A 1PSDA 2A35A 5CP8A 2GZ2A 3PHLA 3ZZNA 3RAJA 2NV6A 5C7IO 4OH1A 1LBEA 5H83A 3G49A 1Z6ZA 4UEJA 3E9MA 4AJEA 3IKTA 4I5DA 2DAPA 3CZRA 4KDEA 3LLVA 2OZPA 2FOIA 5DULA 3D1LA 2R00A 1PGJA 2O4UX 4BGIA 1G0OA 4RO0A 2QZ9A 1LDYA 2C0CA 4R1TA 4KQWA 3RC9A 2QRJA 3UXYA 3U4IA 4BKPA 1PWXA 2CZCA 4R41A 3GPIA 4EI2A 3IP1A 2AQ8A 1QRRA 2LDBA 1I2BA 4L0QA 2NVBA 5U1PA 2PK3A 2NU9A 1EBFA 1ZEJA 1TB4A 1H6DA 1LLDA 4INAA 1VE9A 2Q49A 3LZ6A 2BKAA 2JD2A 1LDBA 2PZLA 2WWRA 1U3WA 1WLYA 3GDGA 4D79A 4PG5A 2NQTA 4UUPA 4WOKA 1MFPA 3H3JA 3DR3A 4IPTA 3L4BC 2GDZA 4U6QA 3B70A 1QYCA 3F46A 3U0BA 4AICA 3WGQA 2VRCD 3OH8A 4PLPA 3R1IA 4QUKA 3WGIA 4D42A 5IZ4A 1SC6A 3CXRA 1R4NB 5EN4A 4PLFA 4CM5A 1LI4A 3ETEA 4D0SA 1Y1PA 1VSVA 3GVPA 3LC7O 4FJ2A 5BNTA 5AXCA 1ENOA 3VTZA 1K6JA 1MC4A 1E5QA 1U2DA 2D59A 4EUFA 1YBVA 4OO3A 1QG6A 1CEQA 1QLHA 3H5RA 4GAEA 4LISA 1GTMA 4WLEA 4IGFA 4CMIB 4IJKA 1BDBA 5A1TA 3WGGA 1XSEA 4MVJE 5GZ3A 4UVHA 3E9NA 3ZU2A 2SCUA 5DBFA 1P1JA 3H9JA 3SJUA 4BNWA 4KTVE 1UDBA 2DTDA 4XYGA 1MUUA 3DZKA 5JSFA 1D7OA 2Q1WA 4NBTA 3T7CA 1E7RA 2BI8A 2Y1DA 3EK2A 2QW8A 4CLOA 1R4MB 4B3JA 5K9ZA 3KXDA 3GRKA 3KYBA 3JQAA 4J7UA 4RVHA 3WICA 5IFLA 4RCVA 3AI1A 4EEZA 3L4BA 2ZCUA 4R5MA 4RDHA 1UXKA 1H6BA 5CAEA 4BS9A 4QXMA 4RQUA 4BNHA 5B12A 1HLPA 5JDCC 3UCXA 1VJ1A 1PS0A 3ASUA 3EDMA 5JC8A 4MP3A 1H94A 1LDEA 3C7DB 1YONA 1D1TA 2F00A 5KTKA 1PL8A 3C1TA 1PU2A 1XDWA 3TZCA 3PJEA 1DXYA 1WXDA 1BG6A 1YL7A 3RBZA 2PKQO 1A9ZA 3QWAA 4FR5A 4IS3A 3RC2A 3AFMA 4LCEA 3PIDA 2DTXA 3U4HA 1UJMA 1A7AA 2B4TO 3AUAA 4QO8A 2PGLA 1Y9AA 2XXJA 3CPSA 3MTGA 4WKGA 5JXWA 1SMKA 5F1OA 5JCJA 3Q9NA 1K6IA 3F1KA 4BIIA 2YUTA 1NQOA 1HDCA 2WD8A 3ZU3A 1YL5A 1QV7A 3GR6A 2ZTVA 5BQFA 2GR9A 4FPXA 4Q3NA 3ZWWA 3F47A 5TC4A 3IMFA 2J3KA 3DTTA 4WCDA 5CEJA 1ZH8A 3ZWOA 3AUTA 4HFJA 9LDBA 3C1OA 4Y6SA 4FFNA 2R2GA 3AY3A 4MKRA 2JAPA 1J49A 1B15A 2OBNA 3KM0A 2W2LD 3X2EA 3KEOA
chains in the Genus database with same CATH superfamily
4CKWA 3GJZA 1QCZA 2D1TA 1BOFA 5KQMA 3V3KA 1AXEA 4ADSG 3JQDA 3D7RA 1RZUA 3WL6A 1EVJA 2P9EA 2W2MA 2ZK7A 4B3HA 5IASA 1C7ZA 2YFQA 2IPNA 3O83A 3VMMA 4E5VA 4FHGA 1PWZA 3MS7A 1FU8A 4WY5A 5DFAA 5LC1A 3R7WB 1QLJA 1SNYA 3H9GA 2ZIAA 1RC8A 1MXFA 3MT8A 4BRWA 2XZDA 1DKPA 3U13A 1BXGA 3T5DA 3BMOB 3DNPA 1GQFA 1R15A 3GFQA 4OHPA 2WICA 1V5FA 2HOQA 3CURA 3PRYA 5DW0A 4B0PA 1OH7A 1E3JA 4KPYA 4Q1VA 3D2CA 1HDRA 4RJLA 2COEA 4ZCIA 5BV8A 4DV7B 2O7VA 1PQYA 4AXXA 5SZJA 3O94A 3CB2A 3U60B 1P72A 3CS3A 3KYIB 1JHOA 1NW4A 1EHIA 2O5RA 3A25A 2X2OA 3OT4A 3UGQA 3LWZA 4XX1A 1UR5A 4L9WA 3WGKA 3IULA 3ZVNA 4LWZA 2Q3CA 4BTVA 3H9CA 3WIUA 1Z7WA 4KRXA 1Z75A 3VSDA 4HVLA 1PQUA 5EI5A 4G0WA 2HLPA 1T1IA 3BTUA 4D80A 1Z13A 3GEIA 2BUBA 5JVDF 3KJXA 1OHHD 3W9SA 2WTBA 1IPHA 1FX1A 2OZKA 3HKEA 3ZNQA 4BMDA 3RYIB 1B0AA 3HSSA 3SN6A 1HTWA 1ZSVA 4W82A 4RC9A 1RPZA 3DB1A 3FNEA 2GN8A 4OMCA 1UK9A 4KNYA 3CVUA 1O57A 5ISMA 1YVRA 4L7VA 3CZMA 2PVCA 3ANLA 5CURA 3KJGA 3D6FA 1KEVA 2FPGB 2P1DA 4IIVA 4FEEA 4BP9A 2E9SA 2IEBA 5H16A 3RUEA 2R3SA 1T1RA 2PJUA 3DV0B 4BZPA 5L51A 1MX1A 4QVIA 4P9NA 4DILA 1XRSB 4QYWA 1JTFA 4LHZA 2KI5A 1ZZGA 2Y0DA 1R4MA 4YMIA 3EA5A 2IV2X 3V42A 3R75A 1PP4A 1L4NA 2M1XA 3EGWA 4PIVA 4YASA 5CA0F 4WKOA 3NXKA 4XW2A 1OX4B 2NWQA 2QX4A 1QYDA 1YVDA 2V7EA 4B8YA 2R5FA 5D87A 1XNGA 4FGUA 4UASA 4HNTA 1QHHA 1JFFB 1KNXA 4JI7B 4PN3A 2GNOA 3KG2A 1NF3A 5AW9A 4NBVA 3GWZA 1CUXA 3J81A 1ACLA 1Y3AA 2ZBPA 4Z0HO 1GGNA 3ICOA 1X74A 3JVEA 1VDMA 4H2DA 3H86A 2QT0A 1HDXA 1OKKD 4Y2SA 1F51E 4AMZA 2IYVA 3K0KA 1YD7A 1JTVA 4MLZA 2PSHA 3AEXA 2GK4A 1Y4AE 3FFBA 1J07A 2C7RA 3KKZA 3O8QA 4BJHB 1QTRA 4YFYA 2OGTA 2G1PA 1TIKA 3KHKA 4BMCA 1JKMA 3U9SA 3QJYA 2GAIA 5DISB 1K97A 1WF6A 4JWKA 3VVMA 1VI6A 3WE7A 3LHIA 1JWAB 1PX0A 3B1KA 4IYRA 5FTKA 5KC9A 2AGVA 3DQZA 2X8JA 1KOGA 1KI7A 1AKUA 5FX2A 1Z2OX 1ZC4A 3UA4A 4AG5A 2VTEA 1OA0A 1JDVA 1KEEB 1NE2A 3GRPA 4K8OA 3CKKA 4NYIQ 4R2HA 5GJCA 3VNAA 4LZAA 3VISA 1EX9A 4L9AA 2YDXA 4UVIA 3N0XA 2X0RA 1E6WA 3USCS 3O2QB 2XVMA 5JANA 1MO4A 2QPOA 3QE4A 5EIOA 4EK9A 4DXHA 1EZ4A 2CJXA 1ZEMA 1T6ZA 2EP7A 2J3JA 3BCUA 3WFZA 4CLRB 5JI3E 2IZ5A 3QY9A 4Q3EA 4FD2A 1LU9A 4UBIA 4EARA 3O1JC 1O77A 3C98A 5AM3A 5ESRA 1KQ3A 1N9KA 2I8LA 4MGHA 5A3JA 4N41A 3VUEA 3Q87B 1M1NB 3PFWO 4FGLA 4XASA 1T9GR 4W9MC 3GGGA 3JV7A 3USES 4YRIA 2YZ2A 3S2SA 1XFDA 1E6MA 1DKMA 2XB8A 1NZFA 5AKZA 4CEJA 1NN5A 4IQGA 1UK6A 2AW5A 2SKDA 3PNPA 3CVOA 4M53A 3K09C 3KVNA 4XQCA 4BV3A 5A7HA 2HKIA 3IOBA 3RR2A 5ALNA 2IE0A 4M0CA 4JODA 5EWJA 3EARA 5JYEA 2ZWVA 3MRXA 4ALIA 1H9CA 2J48A 2EV9A 1C7EA 1T8UA 1G21E 3MGAA 1E1CB 1GPLA 4HS4A 1QP4A 5AESA 3H2YA 1GZ6A 1KY4A 1BROA 1KXJA 2PANA 5F5NA 4B32A 4ZVVA 4DV6B 2QVZX 3L4EA 4L5BA 1HEYA 3DL0A 4PO8A 1JBEA 2GEKA 2PBLA 1E3WA 4G56A 3W4IA 2WWWA 4F4DA 4ISBA 4QLBA 5JS7A 1T35A 3AGPA 4WZBB 1ESEA 1C9YA 2PX8A 1N57A 4ZDKA 3RRMA 4MHSA 4UHHA 5L3ZA 4JLNA 3Q7PA 1UODA 3NBUA 2CB0A 3BD7A 2QJRA 1XVVA 4YV0A 4L7QA 4HK4A 1HG0A 1X1QA 3QXCA 3HJUA 4YJ3B 3L8YA 1U7WA 3OZTA 2ZJYA 1M0SA 3VOSA 5GTDA 1WPXA 2PAAA 5DCUA 1EDEA 3N7TA 3N2EA 1M83A 4RYDA 1ISPA 4MW7A 4H7EA 3NHZA 4UVEA 3X0DA 4RJTA 1OB2A 3H7AA 1KWKA 1XRJA 3NDBB 2NNWB 4GNKA 2WF5A 3RG2A 4RHTA 1R6TA 4Y6GB 1LK0A 3QWHA 3ZK8A 1ODFA 5E9JA 3BB1A 1FNMA 1FYDA 1BX0A 3D3WA 3FNBA 4C89A 4F91B 3JQPA 2IY7A 5EIHA 4TL7A 2HLDD 1FU7A 4L28A 5DWDA 3TIGA 2YVQA 4BTLA 3WMGA 2AFIB 4H7FA 1Y48E 3K1ZA 1IBSA 3CSUA 4OI4A 3ZKAA 2XA1A 2ZP1A 4OIFA 4AMVA 5JI2E 2PO7A 4W9NC 3U26A 3PE3A 4RF3A 4OLAA 2CUZA 4MMYB 1SIOA 4OK5A 1IDN1 4I5IA 5HCUA 2I65A 4GGOA 1FK8A 4QBIA 2IEDA 4V2UA 3KNZA 2O9JA 4CMCA 2FOLA 3QPDA 3O6VA 4B79A 2B8WA 1P2TA 1W88A 2L17A 4KAAA 5I9BA 1H2FA 4OHFA 2PX0A 2V98A 5EP3A 1CD5A 1ECGA 1V47A 3SI7A 4I5EA 1W46A 1N25A 4YVFA 1UDXA 3CRNA 4LIPD 4BP8A 2GEBA 4C76A 1YFJA 4TTPA 2ZUEA 4K1XA 1KFJB 5J58A 4HDQB 3YASA 1CUZA 4RPIA 4JOBA 2JLCA 3A6DA 5ADWA 4LG1A 4HYTA 3I5XA 3NOQA 3UYLA 2A92A 3QVGA 2K6GA 4GM1A 2FAXA 1GAQA 2O3TA 3K9WA 4Y0AA 1QTNA 4ON9A 3ZE9A 1NPTO 2O06A 4JDUA 4FWTA 5IC6A 2H29A 1S6YA 2WSSA 3PQ5A 5K09A 3GVIA 4OQZA 5COBA 4AF7A 1G2IA 3RVKA 4TZTA 2RGWA 4BNMA 1AIPA 3OCCA 1JQBA 2N1BA 2VK8A 1FMJA 1W8DA 4Q3CA 9MHTA 1U8ZA 4JJ4A 2YRWA 2BD0A 1FA9A 4RD6A 1YGPA 1JR3A 4N48A 1I2CA 5KC8A 4FC7A 4CV0A 3DHYA 4BLVA 4JBHA 1WKVA 4R7ZA 4CM8A 1DIRA 5IJAA 4YMUA 1Q0UA 1O9BA 2C9CA 2WAYA 3BWCA 3LK7A 2QRHA 1B3RA 4LYHA 3S2UA 2OMEA 1QJ4A 3DOHA 3L07A 4BBJA 3GGSA 4ESOA 5M7EA 3QKIA 4UBLA 1U9CA 4XLLA 2XT9A 2ZB2A 3ADKA 2YY6A 4P83A 4S1NA 1C0EA 1IC6A 2RHHA 4IIJB 4QUBA 2ECOA 4ILKA 3J81k 2OXFA 2W6MA 1LS1A 3R5JA 1E9RA 4S1TA 3A4MA 5KDLA 3F98A 3JALB 5E7IA 2L18A 3Q3VA 2VKQA 4FDUA 5CHEA 1QG2A 3NI2A 2TMYA 2JFXA 4KCGA 4U00A 3D2BA 1J22A 5TMEA 5KX5B 5E38A 3VYUB 2Q2QA 2BHLA 3DCJA 3NJ8A 3THRA 3UC9A 5JAMA 5CBPA 2GJ4A 1WMFA 4TKUB 4XDYA 3T5PA 2IW3A 1JDJA 4Q24A 3LQ2A 1Y7TA 4O0LA 1G8AA 5EJ5A 3HR4A 4X71A 2QRLA 3OZWA 2V96A 4YP7A 1ZL0A 2VUHB 5EY5B 5EIBC 2HT1A 3TE6A 2B4RO 4C78A 1AUPA 3L6DA 4WXYB 4PSDA 1E6CA 2QW1A 3R6DA 5AJWA 3RU3A 1M5TA 1QFYA 1PX2A 2PXHA 1YK0A 2C1XA 2Q9UA 3C5HA 4XD7D 3A10A 3RVOA 5EHZA 1M76A 2UVPA 2R8BA 3DD1A 1EK6A 1N2BA 2O07A 2VWQA 2ZYTX 4K40A 2D5AA 4PW0A 1OLSB 4ZV4A 4IUDS 3NBFA 5CX4A 5TX7A 3RJMA 2YWGA 3O7MA 4Y9SA 4UNPA 2IZ0A 4BNLA 3FTNA 5B3KA 3N2YA 2QLMA 1NHGA 1T9GS 1RAHA 2GPSA 4OK6A 4TLLB 5E9QA 4Y2TA 2EBFX 4OQEA 5B6PA 2Z98A 4UD2A 4BN0A 1N7HA 4EYKA 1VRCA 4KWIA 5SY4A 5FH9A 1K86A 3G8YA 2JJ8A 2WR8A 4XB1A 3RJTA 1S0UA 5ARDA 2X5NA 3WMXA 5FNVA 5L6LB 1HETA 3IKJA 1IHOA 3SDBA 1J7JA 2GXUA 4R2XA 2R8ZA 4UCFA 3Q15C 1V2GA 1BCSB 1NI5A 2BC9A 2I4RA 3O7WA 5HE8A 1ORRA 5HF8A 3U49A 2G0TA 1DZ3A 1QO0A 3O4HA 3LO5A 3TMAA 1O6FA 4ARUA 4DLSA 3Q3GE 1Y6FA 2I34A 2PFKA 4RLQA 1DCKA 1VLHA 4IIDA 3KKQA 5H9VA 1J8DA 2FG7C 3A1FA 3W3AD 1E63A 1K3FA 1HFEL 1IOZA 1QZUA 2R97A 3LHSA 4Y98A 2P4EA 1YZQA 4MV8A 3IOCA 4NL4H 4OSPA 4O4JF 1E77A 3NOVA 5EKUA 3A70A 2FPPB 3T4EA 2DQZA 3ZDQA 4EZEA 2J6IA 2WFMA 1BWQA 1K2WA 1RE1A 2RONA 1PDVA 1U7ZA 1QSGA 4BQSA 3WSVA 4NEGA 3OF5A 1Z2EA 4V0KA 1JQKA 4DV0B 1N3LA 1DQYA 1XN1A 1XNJA 2JGLA 4AJOA 1ZRNA 2O8DB 1E8MA 3JAKA 3DMRA 3KXPA 3EMDA 1GG5A 5K0GA 3HBAA 1NYRA 1EBBA 2X8WA 1AO0A 2ZYWX 2XB9A 3I6YA 2C95A 2JKYA 4GT1A 1QZZA 4HH3C 4I9UA 4L6AA 4JOCA 5FKJA 3MYYA 2C42A 3DDUA 5EE0A 3I4CA 3ZE6A 4R71A 4MRMA 1X38A 3CUUA 2EQBA 3PUVA 2OZVA 3ZXYA 4TSFA 3CR8A 1UXIA 3C8MA 4KLAA 4X65B 2LE0A 3MWDB 3GN2A 3BC1A 4UUAA 1NVTA 2XUDA 2BF7A 4N4AA 2ZYAA 4DQKA 4B81A 4QEKA 1P2BA 3E7DA 3SGLA 2IWHA 2C57A 5JBQA 2ERYA 4PAQA 2PVPA 4WA8A 1YTLA 3NHUA 3OM8A 3E22A 5FPPA 5DN6D 1Z6GA 5E1MA 1QGOA 1F5NA 5BSMA 1R74A 3P2JA 4GLLA 4OXNA 2O2JA 4MVJG 4R31A 4FGKA 3I42A 4Z7NB 1IM5A 5AYVA 2ZS8A 3FRIA 3NAQA 1Q74A 1ZNZA 3QFHA 4RSMA 1X92A 4MR7B 1P6QA 1SU8A 1M3SA 1P5ZB 2ZIGA 3O73A 4TWJA 1XXHE 2PLWA 1K0UA 2Q9BA 4BB5A 1GUBA 3HUUA 2DLCX 3GLRA 4XRRA 5A0FA 5IYZF 3ZY2A 4L74A 1FJ2A 1EFPA 4Z53A 1K89A 4Q5IA 1I01A 3FYHA 1UBFA 3OQ1A 4M4SA 3NWBA 1KERA 3BM5A 2OT3B 4X1KA 3SBEA 3BMXA 2VYCA 3BBPA 5AO9A 1J0CA 1DXQA 1KAEA 1U0JA 4I50F 2XVAA 4XIGS 2F90A 1IJBA 4QFMA 3ILHA 1AH2A 1SVSA 5E0OA 1F5SA 1U2RA 2C4WA 1JSXA 3G9ZA 4I2VA 4JB2A 4RVOA 2I6XA 1J0XO 2UDPA 3KD3A 3SXPA 5K3EA 4TL8A 1OIXA 3MN1A 1Z4LA 2N42A 1PL6A 2RGEA 2ZJ6A 3DONA 2ZRFA 3GZ4A 4Q7MB 5G4LA 3WGTA 3HWX1 3JQ8B 2AG8A 1N92A 3FWKA 1NXVA 3OECA 4DV5B 4TN1A 1GSHA 5ALMA 2Y1EA 3QP9A 4LJAA 2DETA 2QGZA 1T4MA 2YJ5A 1MX5A 4YECA 4US2R 4GE3A 2ZBVA 4R54A 3UK7A 1ZA2A 2ZWOA 4G1UC 4RWEA 3L01A 4EPVA 4PN7A 2C1ZA 4OGLA 4ZXPA 2FPRA 3H5AA 4NJMB 4TS3A 3PNMA 3THWB 4DTIA 4EYOA 5FEUA 4PLCA 4YRPA 3K6JA 4MJ7A 2P6UA 1H6CA 1V71A 3C6MA 5ECWA 3PPWA 2POCA 1KU0A 1T2NA 1DXHA 2DY0A 3NBXX 1KDPA 5EVCA 1UJ2A 2UKDA 1LV8A 4GVXA 4HMQA 10MHA 1QS0A 2ZW9A 5IABA 4JI8B 2EJBA 4ER7A 3C6XA 4WACA 2C94A 2WVHA 3VHRA 1V8OA 3QEOA 3FUUA 3KSBC 221PA 1AQYA 5C53B 3SIXA 2UYYA 3EVBA 1XCOA 3D7SA 4WJKB 3FUCA 2PMDA 1H2HA 2WVAA 4MR9B 2GQ0A 5FFNA 4N0MA 1UM9A 1NUAA 2YXPX 2FE1A 4D43A 5HJ5A 2R68A 2VS1A 3FWNA 4HDNB 2ZI4A 1QHGA 1KVQA 3P20A 4P84A 5B55A 2ETVA 3HXLA 5A9TA 3K4QA 3UZUA 3AEKA 1C29B 1NBOA 1SC1A 4D9GA 2CHGA 3U56A 5FI1B 1I14A 2CFCA 1AZSC 4AJPA 4GXQA 4K87A 5K8JB 1UXJA 5CGQB 3N9IA 2DBQA 4KV7A 4RTSA 1W5FA 4BCCA 3HABA 5FAKA 5E6RB 2YNMD 3KKMA 3TZHA 3QF7A 4RV5A 3U7GA 1NPDA 1TQHA 2XY4A 3EZYA 3L8CA 4OOFA 4PX2A 3EIQA 3BWMA 1HKHA 4FBGA 5AJTA 5REQA 3U09A 4K6MA 4LY9A 2VNHA 1X1BA 4G1FA 3LW7A 1WHSA 2ZSUA 1GFIA 2GYVA 3ZCUA 1Z4OA 3DVLA 4HYEA 2CD7A 2DFNA 2G17A 2WIFA 4W5RA 1FFDA 1WPQA 1OFGA 1YRQA 2NO1A 3KYDB 1IPFA 4O2BA 3ZV5A 4F72A 4QJ3A 5IX8A 2JHAA 3IUNA 1EFVA 1YS6A 4MPDA 1XVLA 4KU4A 4UM9B 1MX9A 2ZRGA 2ODNA 3ZV7A 2AZMA 2AYXA 1N2XA 1I7DA 4Q9JA 1DO2A 2G8NA 1TMGE 1DOAA 4JVOA 3BJEA 2REBA 2VDWA 3SZGA 4D26A 3JQFC 5KDOA 5DNAA 2XAAA 3M6FA 1HZZA 3BQNB 2CZQA 4HZGA 3SVZA 3MFYA 4JJFA 5IZCC 2EAUA 3C3JA 2I03A 4AVYA 3PS9A 3B3AA 1C0LA 3A4VA 4HUQB 4EATA 3PC4A 4CLDA 3S1AB 1K6XA 1S3SA 2IXBA 1DJQA 1FSGA 1TECE 1WHTB 5CU7A 5BURA 3S8YA 1U2QA 1YJQA 2RC5A 2YWCA 3Q2IA 3CRMA 5EJ2A 2VNSA 5JY6A 4KP7A 2D54A 3ANTA 4M21A 4MYTA 2QX8A 1PQWA 1XCLA 2WM9B 3BS4A 3LL4A 3NBYC 1EZZA 5CB4F 4BP3A 2FDCA 5HHTA 1JHVA 2ID9A 3CWZA 1ENZA 4TV8A 2BEVA 2XV1A 2DP4E 4RK4A 3ZV3A 4A6PA 3AMVA 1KZGB 1L5HB 3NRBA 3NPAA 4UATA 5TRTA 1THTA 4AKTA 4DCVA 1P7CA 4FOSA 1LC0A 5EEGA 1QH9A 5LOVF 3P2KA 1J8VA 4HNQA 2VATA 1HDYA 2H4ZA 2EFJA 3LCCA 3T4UA 1MC5A 2ZRIA 4ND4A 3W2IA 2AZXA 2GVNA 1JAYA 3LDAA 2W58A 1ZUIA 3PUWA 4J76A 3RS5A 4YT2A 2OP1A 1S3FA 3KEGA 1CCWA 4LHVA 5LYJB 1YZYA 1GXSB 4ZCQA 4A7PA 4UU7A 5G1NA 1AGRA 1OI2A 3W2HA 4OMDA 3C7CB 2CCJA 2EL7A 4PGFA 1AN9A 3HP4A 3QPBA 3UATA 1E9FA 1US8B 3U4DA 3EG9A 5EE5B 1J4AA 2BEJA 2UUPA 4LRTB 1HNNA 4TRJA 4ZU6X 5JVDB 4M0FA 5AR1A 3LUDA 4JVSB 4MSUA 4RPJA 4BMYA 4D97A 1PNRA 2XWSA 1PKXA 1P7PA 4UTOA 3L7IA 2QUBA 3V2IA 1NXWA 4JP2A 1W1IA 4JLUA 3KX2A 4GM4A 3IPCA 1P7YA 2OM2A 4OQNA 1K27A 1G6KA 3IUEA 4JUCA 1QGED 5LB2A 5TEWA 4R8LA 4REQA 4IIUA 3GX1A 3TTSA 4YMLA 2NTJA 1W0KD 2ZBRA 1SVWA 2I3GA 1HX7A 3BHNA 1U0NA 3I8XA 3I8SA 1V6SA 2PEZA 2VNIA 3NGMA 1FPQA 4K9MA 4O1MA 3SIPA 3AHFA 4CRWB 5HQ3B 5C8YB 1M8FA 4WY2A 5LIRA 4KO8A 2MR6A 3CZCA 1DQZA 1P18A 4GW3A 5ICCA 1DKOA 3C24A 1I94B 3IVRA 1NBME 3ECSA 4G9BA 1WVMA 5IDVA 3CMCO 1ORIA 3NIBA 4RY0A 2ERXA 2FP4B 3EODA 4S12A 1YWGO 3UMRA 1TGYA 2RHLA 1UDWA 3N86A 2V03A 4OHKA 4WLOA 1RXIA 3OT5A 1UFVA 5AOBA 5HKOA 1CJBA 3H4VA 4A9AA 3A6ZA 1PL7A 2OCPA 3KT6A 4BO0A 2XUPA 1UJ5A 1H23A 1QOZA 2JGEA 3ZNNA 3DWFA 4GRAA 1LSUA 3ZIUA 1T1JA 3N2GA 3T1TA 3VU1A 1XDDA 5DV9A 3WG9A 3B89A 3SKYA 2FETA 3QEJA 4M89A 3F5MA 4MEJA 3MINB 4CQLB 4CYMA 4F8EA 4NI5A 2NTVA 5FWXA 3GNQA 3KKEA 3CNBA 5HNKA 2C03A 5I5GA 3L7OA 1TQ2A 4MYHA 5DM4A 2C58A 4OY3A 4GMHA 3KE8A 4ALJA 4X8MA 3RWOA 3NC1C 4LXIA 3PC6A 3IH5A 1Y3FE 4ENUA 5FADA 5T67A 3TZKA 1PQPA 4BKUA 2B25A 5B1YA 4P7GA 3H8WA 1OLUA 3AKDA 4CG1A 2E1PA 3V33A 1E1RD 1I3OA 4QUEA 3KLOA 3F7NA 4OCZA 4U9IS 4GQIA 3WLAA 4BKPA 2XT6A 3A1WA 4ZVSA 4BB0A 4Z3DA 5CB0A 1H22A 3K8ZA 4V1CB 3HY3A 4MUFA 4CMIA 2QTBA 1TA9A 2JIDA 1HL7A 2PXCA 4Q7LA 3W1VA 2B30A 3MJVA 4X62B 2WYOA 1ZD2P 2EXXA 4LHSA 2PX4A 3QWFA 3TLJA 3V6LA 2XOKD 5DI3A 5BT9A 4UJ5A 3UAWA 4LRSB 5LDHA 1PJ2A 3LUCA 3M4ZA 4R2LA 5G4KB 1U2EA 3T4XA 3TK1A 4LTNA 3TR6A 3WVNA 4D3SA 1SA0B 3HRHA 4KKXB 5DYYA 1QX4A 4X92A 4ZVOA 4NJEB 4BZWA 2BTEA 3ADDA 4DCSA 1RM0A 1H0RA 3SC4A 5G3ZA 3ST7A 2IXDA 1H9BA 5IBCA 2IX9A 3D3KA 5ADHA 4MTCA 1YASA 5ER9A 4AIIA 2QMOA 5F1PA 1CZRA 1KVSA 4JI5B 3MUOA 1RRFA 3IIEA 3WS7A 5BVHA 1YZFA 4QPJC 1IPEA 1IAQA 1PJLA 1KRHA 1DG1G 2P3QA 4CDMA 1K63A 2VDJA 4NV1A 1OH5A 4EHBA 3IDZA 2Q6KA 2BGLA 2GWHA 4EOGA 2QQEA 1J7KA 3D8NA 3OU6A 2AUNA 2EQAA 4B3MB 5I9IA 2QN6A 1KYWA 1EFRD 2I1VB 4G1EB 3SC6A 1GTSA 2XMDA 3C41J 1Z7YA 4KQ1A 1LV7A 2EP5A 2OBYA 2I2BA 2F67A 4FKBA 4GR9A 4KXXA 5DLYA 3DP9A 5FBLB 2GJAA 1H66A 5BP7A 5AP9A 3UAZA 4MCJA 1ZM7A 1KO5A 2PKWA 4H7DA 1VHTA 1I4LD 1FRFS 1T5IA 2P65A 4GU5A 4I3GA 3EQ8A 3OICA 1EDOA 3K5PA 5D85A 1IZ0A 3WA6A 1DINA 1O6ZA 4E1AA 5JNWA 2Y9PB 3R20A 3V1KA 2O2XA 3F71A 5L7WA 1BS9A 1XF9A 2H00A 4H60A 4H1HA 4O2RA 3NTLA 3QA9A 4NIMA 3MTJA 2XQGA 5J1TB 3I1JA 2OXIA 1QQAA 1OMOA 1W4CA 4ENTA 4G07A 3LQ4A 3FPJA 3H87A 1MX3A 4K9DA 5DTJA 2XRZA 1QNFA 2J3QA 3GWGA 1T0BA 4JLKA 1X80A 4LXGA 2XWPA 4YV1A 5KEIA 1SFRA 4H35A 4I1YA 1M74A 2QY9A 4FKMA 5DCYA 1A8QA 3DBLA 4LHWA 3RWBA 3KSDO 4AS2A 1SULA 4YO8A 2GF2A 1BVRA 4O8CA 121PA 4TVSA 2Z9DA 3CCFA 3GAAA 5G0WA 1WLSA 1XCPA 2H4HA 4JHXA 3AM3A 3U3MA 3KV3O 2CB9A 5E7MA 2VDKB 2PNJA 3T3HA 4C01A 4BGUA 4FEYA 1NM5C 2XGOA 2OHOA 4P80A 1TM3E 3OE7A 1U7TA 4PBTA 3MTEA 5HR5A 3AP1A 4ZHQA 3RIXA 2HEIA 3TGWA 4DARA 4EFDA 1WMAA 3WK5A 3SHQA 4ENRA 1RHJA 5AVZA 4ZI2A 2Q2OA 1C1XA 1RP7A 3IPYA 4M2LA 5FUYA 5TDHA 4CGYA 1I3LA 3OFNA 3BGVA 3AOGA 3UKDA 3N2LA 5DT2A 2P6MA 5FOTA 4EM6A 4J1TC 5IVKA 3UYKA 2HSGA 1DKUA 1AHHA 2O8EB 1B8OA 1IB0A 1GR0A 3EWIA 4R6WA 3FSRA 1GCIA 4N18A 5DASA 4FILA 3A9VA 5I6DA 5HUJA 3FYUA 4NCAA 1D1SA 1O4WA 5AHOA 4FLEA 3NYIA 2JEOA 3CVJA 3QEMA 4RHCA 3RNOA 2YVUA 3SXJA 5BSKA 2DQKA 3GLFA 1ZGGA 2C7OA 2WU0A 4MDFA 1FUIA 3NDRA 3UJPA 5IBRA 3SLKA 5ESXA 4LFCB 1M2FA 3VRHA 1GITA 1Z2CA 2ZYDA 3IMEA 1UMKA 2Z3ZA 3PGA1 4UNRA 3CIFA 1NJFA 1YDEA 3QFSA 3W05A 2FQWA 1VE1A 5BY2A 1GHTA 4XM1A 5DMHA 4DANA 1ODJA 4E4RA 4UARA 2W2VA 3QLUA 2XMQA 1BCRB 5TT0A 3RS2A 2A9OA 1UKEA 6REQB 2H17A 4JQCA 1SCBA 1T25A 4WBNA 2JLUA 1XTVA 1I2ZA 1GEEA 4G1CA 3RC7A 3MSCA 5AOAA 2IFTA 2FPOA 1OILA 3I61A 2PQ2A 3LUPA 3ZGVA 1RACA 3OURA 4E2WA 3JAWA 2I2FA 4CKCA 1L5NA 3OG9A 1VPTA 2JFGA 2YC2C 1YR7A 5FJJA 1I5EA 1BE8A 3L0IB 4HYQA 5J2TF 3VNQA 3ZBQA 1GN8A 3SMVA 1J1ZA 3JQGB 2V9PA 1AQNA 4NCXA 4HQNA 1Q6ZA 4LJ5A 4GXNA 4B33A 3RSGA 3BK2A 3OJOA 2ZIXA 1P2VA 4TQGA 3T9BA 1OXVA 1NSYA 4H08A 3TN7A 2YIMA 1JHYA 1XLTC 3KQYA 4UU0A 1PG5A 1E8NA 1XMIA 2DFDA 5DHSA 4NSNA 1XXLA 5EIWA 3RRXA 4U3JB 2B98A 5F9MA 4ALLA 1D9XA 4E21A 1M8KA 4HL6A 3U7HB 1TO1E 1SUSA 3TJRA 4A0QA 3DE5X 2QN1A 4QBTA 4G4SP 1G8MA 1OI3A 3PR1A 4TOIA 1W76A 1U5AA 2ROQA 1ZC3A 1U0FA 5EHIA 4YJGA 2MTBA 3PB3A 2JK1A 2NG1A 1X19A 4HDKB 2FW7A 2X6TA 1BO6A 2A9FA 1GFZA 2AX4A 1BXKA 3HXOA 1O3YA 1OI7A 2EDAA 2NUAA 3OKAA 2R62A 2Y0CA 2JGIA 3D7MA 5EIAA 1EHYA 1BX3A 2WQZA 3N2IA 1N2HA 2W48A 4JUIA 4CEHB 4D46A 4QUAA 4J7CA 2YZKA 3M5PA 2V6MA 2ZJ0A 1IK4A 3CE9A 3IQGX 4DJDC 2CWWA 5EXDA 2J9FA 2J8ZA 3ENKA 4PGHA 3EUFA 3CLUD 1THZA 3I32A 3H6GA 1SD1A 4V3CA 1A71A 3L6EA 2Z57A 2GCGA 4QRDA 2XWJI 4ZVPA 3GJ8A 5F3WB 3AU9A 2QM8A 2GCIA 2KS6A 3QVVA 2PCJA 4I9NA 2VZ0A 3N2KA 1TJ5A 2EIXA 3KSZO 1CJCA 4IDAA 4E5SA 4URHA 3NG1A 4GGPA 2ZLBA 3GOHA 4BATA 2CNLA 3RRNA 3G5AA 3G9TA 4WLFA 4FE7A 2JFQA 4QATA 4YT4A 5BUSA 5CA1B 4RVFA 2FWNA 4YIHA 5HWSA 1M2NA 4Y30A 1Q1ZA 2QQ5A 3LUGA 2WPNA 4HJRA 4JQZA 5G0SA 3SOZA 1R1DA 3PQ8A 5C80A 2QE7D 1TPYA 2QNBA 3KBBA 4O4JB 5A7GA 3D5TA 2B7CA 3WIVA 1MQ8B 1P9OA 1PR0A 2GD1O 2JLVA 4WBXC 3I5AA 7GPBA 2IYUA 3EGIA 1MAAA 5DEIA 4PYNA 1TVMA 1KA9H 1VB3A 1E2GA 3MF4A 2OXTA 3FOZA 2TSYB 4WFQA 3C97A 2WF7A 2NU6A 3O2SB 5EQFA 2G7MC 1JPJA 1ZOSA 2OLJA 5LR6A 1T1EA 4KMSA 3Q72A 4JY7A 2I4TA 3BMCB 3PRJA 1T4CA 5CYOA 3G5TA 2O7SA 1OFUA 2HNBA 3BD8A 1KYTA 3FCXA 3RYTC 2AN9A 4C04A 4NDNE 1HNZB 4L1KA 3ENNA 4EUNA 1VG1A 2J32A 2ZIEA 4EI9A 4GZ5A 4J16A 1T4DA 3DAGA 4Y6PA 1DAKA 5EJMA 1SCAA 3EQ6A 3TL3A 5T3YA 1XKXA 8OHMA 5LMZA 4NBKA 1D1QA 4YAEA 2P2CA 3JQCA 2NO4A 3QPVA 4IFEA 3TFQA 4W5NA 3AEQA 3FPAA 4QOEA 2ODPA 3HMKA 3P9IA 1PJAA 3MAAC 2R1TA 4OYLA 5FUMA 1IXKA 1E0SA 2H1OA 1MAVA 2GERA 3R2JA 3GOQA 5L3SB 1RQNA 1RXUA 2RHOA 3COVA 3HJRA 3R24A 3W8RA 2WQ7A 3BAFA 2I9PA 4J91A 5BNFA 1GSIA 2O1EA 4BNVA 4DIFA 4EF6A 3HLYA 3LLCA 1N0VC 3ELUA 2QX9A 4HEQA 4I2NA 1AZLA 2D2IA 4BTEA 4DSNA 1NVMB 1U7UA 3E4CA 3H4TA 2QS9A 5BV2P 2Q07A 1F12A 1FBNA 3EEFA 5H68A 3TIIA 3UANA 2OESA 4DF3A 4ER0A 4B3SB 4CV2A 3I8OA 2R7NA 2W6NA 1B2RA 4UZFA 4A4DA 1ZBDA 5IMSA 5FWYB 3FPGA 1VE6A 8AT1A 2YXBA 3C3PA 3FI0A 2TECE 3N0TA 1UOEA 2JJ2D 5AKYA 3V8RA 2ZM5A 5DGCA 2FW0A 5T8KA 2VEDA 2QQFA 2EBWA 5CDGA 1VA5A 1QWSA 5DHPA 2CBZA 4C0JA 4I50B 3SF8B 3I1YA 4Z4IA 4HNGA 2N47A 3GJSA 3H6HA 1JA1A 2V6GA 4DLXA 5BMVB 4L4YA 4MS1B 4NE2A 2ZUSA 4DDHA 1EGHA 3TRIA 3WMEA 5JFTA 2GCEA 1R8QA 3EPKA 4MCIA 1JR4A 4B2IA 4L6CA 3QFTA 1GNPA 2HREA 2Q7DA 2VHWA 1E1LA 3OUUA 4H9GA 4YAUA 1SVIA 3MUNA 3MW8A 1NQ5A 2LKDA 2V45A 4DM4A 1YRAA 2M1ZA 4ZPXA 3IDOA 3WWEA 2JIPA 1BA3A 3AY6A 3KCNA 2ZCJA 1ZY2A 3KPJA 1M0EA 3V7WA 3IP9A 1TD9A 1HMPA 5DYIA 1NA5A 2OFOA 3M0EA 3H2IA 4RGYA 4A73A 3KZMA 4TKZA 5HRCA 4II2A 4FC6A 2ID4A 2NZVG 3GG9A 521PA 4CCAA 1C50A 4AY3A 4FW9A 4FIZA 2HK7A 3TRKA 1U2SA 3UFBA 4A10A 5JT1A 4ABTA 1TJPB 4J0HA 4W1RA 2Q2VA 4IYJA 1RHRA 2R8PA 3UMSA 1PK7A 1XZEA 1FNDA 2QV7A 1GCOA 1NU8A 2YMPA 5EP2A 4BMSA 2XTMA 3G2MA 5LZ2A 4L2IB 3DT9A 5K4HA 5FUBA 1UC8A 4IOLA 1KZHA 3X2FA 3QBEA 4E03A 4JUDX 3WGMA 1JPUA 2WUGA 2PWZA 1CY2A 3BAZA 1JG1A 1FXWF 4H77A 5DCLA 3BWBA 4F97A 2FW9A 3NTRA 2PZBA 3EVFA 4ZZ1A 2AJCA 4BKMA 4W5TA 3E5NA 5EZYA 5JS1A 4IKOA 2WHRA 4AZVA 2IUSA 1NFQA 4Q15A 2R44A 5CFOA 1PK9A 2AS0A 2R5NA 5LBTA 4KQHA 4YRZA 5K8CA 1RI5A 1ZAKA 1W2GA 3RGGA 1ABFA 4ALNA 3N59A 4DWWA 2QMEA 2I78A 5KYWB 2LR0A 2H7YA 4N82A 2H3EA 3UBMA 3PXGA 4PNEA 1M6VA 3IAM1 4NU8X 3F0TA 3SJ7A 4GOXA 4DAEA 5DNCA 3ASVA 1YCDA 3FPSA 1XAHA 1P8AA 1T3ZA 1T9HA 1CE8A 4ODIA 5CYFA 2WU8A 4AU1A 4EHLA 1R16A 4C6HA 2HA5A 4EDHA 4DMRA 1W47A 3IJPA 1B1CA 3A6JA 4EGJA 1E4EA 5D3KA 1EH5A 1X2EA 4RTKA 1Y98A 2H1HA 4Z99A 2BFBA 4BFVA 4CJXA 2CLDX 1WSAA 3BA6A 1YMQA 2GHQA 1QBKC 4ZEWA 3KJIA 3B1JA 1EJBA 1IOLA 4MCAA 2BE9A 4M37A 2B1RA 2AMYA 1YRYE 4V2IA 5AKEA 2Y0EA 3EZ9A 5DIZA 4XLTA 1OUMA 2CXUA 3ROKA 4PONA 1QP0A 4DXAA 2PUWA 1SEVA 3LP6A 3KQHA 2OD2A 1FFWA 3KWJA 13PKA 1E5TA 5D86A 5HG0A 1DEOA 3L40A 5DYTA 5KSPA 3UNXA 3WNQA 1K9VF 5L7TA 1PW5A 3ID6C 2OC9A 5A71A 4BN4A 2R9VA 3FRJA 1RRVA 1YZNA 3OCZA 3KZVA 3PL5A 4GPTA 3ZDXB 4J2HA 3GAZA 1PLLA 1YU6A 2FZ5A 2HRRA 5ICSA 2OK7A 3CFYA 1DC4A 4J49A 4BFYA 1CF2O 5AD1A 3GG2A 4QREA 3IRUA 2IK8A 1JAZA 5KYTA 2AIRA 2IUFA 2FR1A 4RQTA 4CQLA 4CE6A 5INTA 4B7AA 3T3DA 4KI0A 2R47A 2GVZC 5ICMA 3QX7A 5JG7A 4N54A 5DSXA 4C1NA 1X1DA 1R6UA 2VP0A 1E2DA 3HVIA 3OAAD 1CDZA 4G4SO 4XR9A 3TSOA 2IUYA 4LGMA 4MTLA 1RWPA 3JZAA 4KXYA 5DOZA 2XDQB 5D84A 4LX0A 5AK4A 2D2VA 3IPXA 3DMHA 4LWOA 5CPFA 3UK2A 1YFZA 5JCJD 1SQ6A 5KYXA 3QSGA 5LOVB 2B8NA 2Q1TA 4DYDA 2CMGA 4R2KA 3ZWXA 1T0HB 5JTUA 1DI0A 3P96A 3BKXA 2PWAA 5BT8A 4R51A 2YIVX 3NIWA 4JXKA 3W5DA 2WJ4A 5JADA 3QU2A 4ND5A 1A2QA 1QFZA 4QPDA 4EVSA 4LYAA 4U4AA 1VLVA 3HM9A 2O8CA 3CRRA 4WK6A 3JASA 2DPXA 2GYUA 4N12A 4P38A 2GXAA 3H17A 2B78A 1PVDA 1Z62A 3IQIX 2BGJA 2HCTA 4GI7A 4KC0A 4M88A 4CKWB 1GTG1 5IK2D 3T0FA 2HR1A 2NXJA 1U99A 4UXHA 1NN3A 1WUKS 3GZNA 1P77A 3BZWA 3EVTA 4H4DA 4PWZA 1OBVA 2CVPA 3LC0A 1VECA 3SQLA 4FXPA 5LWHA 2NZJA 4D56A 5DNEA 3KVVA 4CKZA 3TSZA 3IB6A 4CKEA 1JMYA 2XNKA 4BWFB 2JAUA 3ER8A 2W2KA 3ERCA 3E3LA 3Q11A 5FA6A 5BSHA 3VFDA 1BXGB 2X8LA 3KB2A 5ALGA 5GONA 1G55A 1QVRA 2O0LA 2CLKB 2WIGA 3QUQA 4L8LA 1BW9B 4J9UE 4PRLA 4BMXA 1ZPDA 1P4SA 1D4FA 1U65A 2OMKA 4NG5A 3FTCA 4DCCA 4F4HA 2PRIA 3K35A 3ELWA 2EF0A 4LE0A 3STYA 3C43A 4YT8A 4BO4A 1XWWA 1CXZA 3IIIA 3LH5A 4ZV7A 3KPVA 4NARA 5BWCA 3CVXA 1CJMA 3KUUA 4ZVTA 3SR4A 1Z33A 5H5JA 1IN7A 1RS0A 1C9KA 4LPKA 5HZMA 2CW5A 2O05A 5J4KA 1GCAA 1NFFA 1AUOA 5AMXA 3HH8A 3KJFA 1EAMA 3TQOA 3BK1A 4AWBA 4AKEA 4EVIA 4OIMA 4NMLA 3R9XA 3L41A 5EJ8A 1S2GA 3VZSA 2QZSA 4MJLA 3MXTA 1S4QA 4BCBA 2ZZMA 1QFXA 4F85A 4BPBA 5IN5A 3BH6A 1NNUA 3ZHCA 4F6CA 4Y2PA 3ORSA 1G6OA 2RMKA 5BQOA 5C31A 1XHFA 2YMQA 1MVOA 1WU8A 3LCJA 1FSPA 2GKGA 5K5EA 3CF4A 4KO2S 1VMAA 5CD1A 4HGQA 2JJMA 3RPEA 3SS8A 4FR0A 1HZJA 4NVRA 1CUFA 2BI7A 3BVPA 5DXFA 3VDNB 1JIKA 1YQDA 1ZOLA 2J0UB 1JSRA 1NNSA 3FUVA 3ONWA 5DH9A 4Z51A 4IXTA 3UJBA