5CG1A

Crystal structure of e. coli fabi bound to the carbamoylated benzodiazaborine inhibitor 14b.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
247
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic insights into the structure-activity relationships of diazaborine enoyl-ACP reductase inhibitors.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
total genus 91
structure length 247
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5cg1A00
1E3EA 3C24A 2DTDA 4M49A 3DB2A 5A3JA 5CG1A 2EGGA 1PJQA 1YS4A 4J4HA 1IUKA 4FFMA 4YBZA 4TVBA 2DC1A 1XGKA 2WWRA 4E2XA 5IZCC 1MG5A 1VLLA 5JPIA 1EZ4A 5TGDA 3I5MA 2FR8A 4UEKA 3RBZA 1ZK2A 2PY6A 3OA0A 5T64A 2X5KO 2AQ8A 3ZNPA 1E7SA 2P91A 4YDRA 2EJVA 4YPOA 3A1NA 3FNFA 1UXJA 3CSDA 1E6EA 2Q99A 1YRLA 2NVWA 2W2KA 3RJ9A 3VH3A 5G0TA 2OMEA 4PFJA 4JBIA 3F3SA 4D79A 4BOYA 5A4DA 3D0OA 1GZ4A 2RIRA 3LF2A 3ICCA 1PU2A 1XHLA 2DM6A 3DAPA 4G2NA 4LCJA 4CUZA 1BXKA 4MVJI 1Q2XA 2EWMA 4OAQA 5A03A 5A1TA 3HNPA 1VRWA 3AU9A 2HK7A 2O50A 1NQ5A 1C0LA 3UH1A 1O6ZA 3EZYA 4R5HA 1JKIA 4WLEA 1R6DA 1MV8A 2VWQA 3WNQA 3JD1A 1KYQA 1ZSYA 2G5CA 4NI5A 4CQLA 5F1OA 3TPCA 2UAGA 3ROPA 3BMOB 3IAHA 4MVJA 3FRJA 1ISGA 2OP1A 3GNTA 9LDTA 1LLQA 1N92A 1U2GA 2E6UX 2YHUA 4IQ8A 3ENKA 2BF7A 4WCFA 2AA3A 3H7AA 4RV9A 3H4VA 3ORFA 4YAJA 3ROMA 2VUUA 1UP6A 2B35A 5ENVA 1GFSA 1Y7TA 4C7KA 1TT5A 2A35A 4JCOA 2DTEA 1ID1A 5T8KC 1LSUA 5I7VA 4MJLA 4ZICA 3L4BC 3LQFA 3E8XA 4XCVA 3W6ZA 4DIBA 3DBRB 4O6VA 5CPBA 2IRWA 2RCYA 3RKUA 3RQSA 1H94A 1P44A 2CDCA 2EXXA 2HRBA 3BMQB 3F4LA 3GUCA 3EC7A 4YAGA 2DBZA 3GR6A 4XZ3A 3NTQA 3QWBA 4BKQA 1PS8A 3VHRA 1VJ1A 2VRBA 3FBGA 3ZWVA 1M6WA 2Y1OA 5DCYA 5F5NA 1GTMA 4S1VA 3Q2KA 3PP8A 4MP3A 3UCEA 4EBFA 3K2EA 3DONA 3JD3A 1I8TA 2XXJA 3QWIA 1YQXA 3JQBA 3JTMA 5F1KA 3AWDA 4BNFA 1UP4A 1UXHA 2B4QA 4HADA 4WNCA 5JSFA 3MJ4A 1PS0A 1IZ9A 3S2GA 1X14A 4CLHA 3QP9A 4MVJG 3VZRA 1B14A 1E1KA 3DZHA 1Q1NA 2H63A 3AOGA 4L74A 2C59A 1H6CA 4GLLA 4Z9XA 1E3SA 1C3VA 4LISA 3BMCB 4MOWA 2B5VA 2NVBA 3PFWO 5BT9A 4J1QA 4R1UA 3ITDA 2PTGA 3LC2O 5B4TA 5BSGA 1LI4A 3F9IA 1DO8A 4WEQA 2PKQO 3AU8A 2BH9A 3DXFA 1MC5A 4BGEA 1BXGB 1IPEA 1Q0HA 4NJMB 2ILTA 1NVGA 2GZ3A 1GDHA 3B1KA 3DWFA 4YRAA 5K9ZA 2YW9A 1R15A 4NBRA 3ZWPA 4KUGA 4MVJP 2GSDA 3JYLA 1IL0A 1TT7A 4QO7A 1VL6A 4IZHA 1P33A 2GN8A 5AYVA 3DAFA 4XA8A 3WWZA 4BMNA 5B12A 1B16A 5HTOA 2PKRA 4GMFA 1NVTA 2QQ5A 4D3SA 3E5MA 2PD6A 3N58A 3EUWA 3GPIA 3C7DB 1NR1A 3U9LA 1WDKA 3ZWWA 4BNXA 1NAHA 2Z5LA 4IS3A 1DRVA 3GC6A 4RVGA 1W6UA 1PZEA 4RF4A 4OQYA 4OH1A 5K6AC 1I0ZA 5L40A 3PRJA 1AHIA 1HZZA 2HMTA 2BGKA 4J6FA 5AVOA 1HDYA 4IUYA 3MWDB 4MVJM 5KKCA 2FSVA 3PPIA 1IE3A 1WVGA 5KJFA 1DOHA 5L4LA 3EVNA 1X13A 2C82A 1G0NA 4ALJA 4BV9A 5JAMA 5JCJA 4OOFA 3KO8A 3WQQA 1SBYA 2I67A 3JD0A 1HE3A 4D3DA 1V3VA 3AW9A 4BNUA 1E3JA 2GCGA 4XYMA 1ISHA 1YB4A 2FWMX 2X6TA 2GPTA 2IEBA 3JD2A 1YBVA 4XB2A 1MGOA 3VH1A 7ADHA 1UAYA 3LT4A 2ZB3A 1K6JA 4XYEA 2ZKLA 1WMAA 4BNZA 4RDIA 4FD3A 4WCDA 5JAIA 1WZIA 3C7AA 3KV3O 4CM1A 3RUIA 3OA2A 4F6LA 4GGPA 3W4IA 5BQFA 2HLPA 2D5CA 3I9NA 1F12A 2EIHA 3DZKA 2CF6A 3VPFA 3GGOA 4CM4A 1DC3A 2B69A 3IIEA 1ZUD1 3BMNA 3GOHA 4BB6A 3PIIA 3PYXA 2O3RA 3NT4A 4JP3A 1K3TA 4BNIA 5JS6A 2Y99A 3DTYA 1CDOA 5COAA 2D5AA 5KWEA 7MDHA 4R41A 4XQGA 3LU1A 5JMPA 4U6SA 3L6DA 3GUYA 5L4SA 3TNLA 3VPXA 5B1YA 1R4NA 4QXMA 3PLNA 2GASA 2X58A 2ZQYA 3DL2A 3H5RA 2DLDA 2OXIA 2R00A 4CM3A 1XLTA 5EIOA 4R1TA 1F8GA 4PZCA 1PGPA 3SX2A 4PN3A 1NFQA 2GZ2A 4N5NA 3R3SA 4GPD1 5T8KA 2XAAA 3RAJA 3ADOA 1JAYA 4Z3DA 3IL2A 4N5MA 4PVCA 4RCVA 1T2FA 1NFRA 1FDSA 2OO5A 1UAGA 4R51A 5JY6A 3O8QB 2HKIA 1DIBA 3ONEA 4A0SA 4OXYA 5DBIA 4FQ8A 5I8ZA 2NU7A 3UOGA 4W9NA 4WPGA 4JGBA 1MFPA 4CQMA 1N2SA 1NTOA 5DF1A 1NWHA 3S2EA 3E18A 3H9EO 1ORRA 3BHMA 5IN4A 3JQ8A 3JQEA 1LSOA 4CL8A 3DHYA 5IDYA 5L7WA 4J43A 2UUPA 3JQGB 4CR7A 5L7YA 1VI2A 3FCOA 3KLPX 8LDHA 1W8DA 1U4OA 1X7HA 1CF2O 1VJTA 2UDPA 1QKIA 3PQEA 1P3DA 3U4CA 3PYLA 2VNAA 2GO1A 3K96A 4XRRA 3IP1A 2YDYA 1OAAA 4OM8A 4U6QA 3VOSA 4CR6A 3D64A 4JP2A 1MXHA 2C07A 4M1QA 2HJRA 3D4NA 4KP7A 1E7RA 3HB5X 1HE5A 2A92A 2EKQA 3OETA 1MP0A 2YJZA 4CV3A 1A9YA 4CLRA 2YQ5A 4CMGA 4DYDA 3R6DA 1YQDA 3ZV3A 1YL5A 2B83A 3H3FA 1K89A 4O59O 4CUKA 2UYYA 1A4UA 3PWKA 4RDHA 1OC2A 4L9RA 2PH5A 4BKRA 5CDTA 3AM3A 5B4VA 3K2BA 4P38A 3UAGA 2G0TA 1AUPA 5KVVA 4F45A 1U9JA 2FPPA 4XR9A 2C20A 4UUMA 2PGDA 2DAPA 4BNJA 1LDYA 3OJEA 3RBVA 1PTJA 2NVUB 1KIFA 4P4NA 1YVEI 2W90A 3RU9A 2H9IA 5I9MA 4CM8B 4E31A 1E7MA 4N54A 1QXSA 3TFQA 4WASA 1PZGA 1A7AA 4NBWA 1M76A 5ICMA 3ZHZA 4H7PA 3LT0A 3WIDA 1KC1A 2EG9A 2FSSA 1Z7BA 3GT0A 2NTVA 2I3AA 4PG6A 3ZW9A 2X5JO 5T5QA 1XELA 1JLLA 2XOXA 2AQKA 4DIFA 1LRJA 4A26A 4YJFA 4EYEA 5CPFA 3PHGA 1PQUA 4BNKA 1ZW1A 3V2HA 2PGLA 1QYCA 3ZZNA 4LMRA 2O7QA 2FPGA 4YJDA 1EDOA 2O4CA 5EQFA 5HS4A 5A9TA 5AXAA 4IDFA 4BL5A 3K73O 3LT1A 4IIUA 4HNHA 5L4NA 1GYQA 3DMYA 1GEGA 5KOIA 2Y1CA 4NPCA 2DPHA 1ENPA 2J5KA 3F47A 3GVXA 4IM7A 2PLAA 4CMIB 4O1MA 4DL9A 1Q0QA 5DP1A 4YAIA 2FPIA 3I9LA 3KSUA 4JN6B 2PWZA 3WB9A 3HDQA 3JYPA 2BFPA 2J3KA 5A9RA 3OQ6A 4E4YA 3AM4A 1I5RA 1PJCA 2GDZA 1HWYA 4FBGA 4IJUA 2BLLA 5DBFA 4XYGA 4R9RA 3K8ZA 3O26A 1YJQA 5J23A 2QRKA 3AK4A 2J3IA 4I9HA 1ZKMA 3DFUA 1RYEA 4IJWA 4AVYA 1C1XB 4PZEA 1IHXA 1LXCA 3AJRA 1H9AA 3EW7A 1KVQA 4IDAA 3DBLA 4GSKA 3EY4A 2VCYA 1E6UA 3R3JA 2VRCD 4J1TA 3WOHA 2R6JA 5EERA 1BVUA 1IPFA 1CIVA 2ZTVA 3ZWNA 3DZBA 2QYTA 1PEDA 1I3KA 1EK6A 4L0QA 1ZCJA 3C1OA 1LSJA 1FXSA 1Q7CA 1CQJA 4FR5A 2JD1A 4CMEC 5ITWA 3DDNA 3VZQA 4L4XA 4E2WA 5HRUA 4NG5A 4RGBA 1GCOA 4YTEA 1WLYA 3I83A 3WGTA 1UP7A 5A5EA 5I8WA 2WSBA 1BW9B 4A2CA 4EDFA 2C5EA 4J4TA 1EQUA 4R3NA 3H5NA 3QRWA 4WOKA 4HX5A 4YT2A 3JQCA 4ZQEA 4ZRMA 5JCJD 1NBOA 3FD8A 1PIWA 4ESOA 2HRZA 3I1JA 3NTOA 1GUZA 1YONA 3MEQA 1U3VA 3M1LA 3PIDA 4NH4A 1GY8A 4XQ9A 3WBBA 4U7WA 4XGIA 3FI9A 1R0SA 2YDXA 1QORA 4FJ2A 3ETEA 3HFGA 3O4RA 3JQ6A 4GVLA 4DMMA 3E03A 2RHRA 2QRJA 3VVCA 4IGFA 2WD8A 1G0OA 1ENOA 1PR9A 3SC6A 4BO0A 1X7GA 4XYLA 1PWZA 1PX0A 4MIOA 4XR4A 3WBFA 4HBGA 3WGQA 4DA9A 2GUGA 4AJ2A 3UICA 1K2WA 2FZWA 5LC1A 2BGMA 3ADPA 2J3HA 3JV7A 1PL7A 3TJRA 3WWYA 4WNIA 3HZZA 2O23A 2YV1A 1FK8A 2VRCA 3EDMA 1WDLA 4IDEA 1A4IA 2Z1MA 1JWBB 3D4OA 4YEDA 1HLPA 4AJ1A 4TVOA 3CXRA 1SB9A 1WPQA 5DOVA 1R37A 1L7EA 4PG8A 3NYWA 1QRRA 3LK7A 3ANLA 4B3JA 5KKAA 4RPJA 4B8ZA 5A05A 5F3RA 3EYWA 4BNWA 2CD9A 2H6EA 2Q1TA 3OIDA 4YCAA 5DCWA 3ASUA 2BGLA 4O63O 5EMHA 1OMOA 1DIRA 5K6AA 1GEEA 4A5OA 4NFHA 4D45A 4E3ZA 2DU8A 3B1FA 4RZIA 4RQTA 1Q7GA 2DBRA 4DTIA 1NAIA 2Y1FA 4ONEA 1B7GO 4CMKA 4DBZA 4DUPA 3PZRA 4TRNA 3U4IA 3UKOA 2W2KB 2JFGA 4QUKA 5BNFA 3AY3A 2Q45A 3Q6IA 5EPOA 1LDNA 1SOVA 4UVGA 4DQUA 1HSZA 2FN7A 1HDZA 2PZLA 3WYEA 3IJRA 4GKBA 4HWKA 2IYOA 3AI3A 1N8KA 2AEJA 2IDZA 3QY9A 2Q4BA 2X9VA 1S6YA 3GA0A 3G49A 1R0LA 2OFPA 2XPCA 3H2ZA 2RBEA 1A9ZA 2C2XA 4OGWA 1CJCA 1DAPA 3BXXA 1D7OA 3RC9A 1UXKA 5KVCA 3SJ7A 1XR3A 4BO3A 1LQTA 4GSLA 3DOOA 4OKNA 2AE2A 3KEOA 1GYPA 2B5WA 2P5YA 5B4UA 1SB8A 3DOCA 3RWBA 3A9WA 2HO5A 1UDAA 3H9QA 4EITA 1EUCA 1MG0A 1T2AA 1VL0A 4D43A 4RQUA 4PG5A 2G76A 2J6IA 3AFNA 1GU7A 1XQ1A 3I4FA 2JAPA 5KJCA 1B8UA 1YOVA 4DLAA 3GRKA 1GD1O 2HCTA 1DHRA 3G0OA 3CZRA 4MP8A 3PJDA 4WOJA 2Y0DA 4Y8VA 5I9LA 1SO8A 3RUFA 1P1KA 1WWKA 3DEYX 3K31A 5KVQA 1DFHA 1E1MA 1R4NB 3NDJA 2RH4A 1DAOA 4B8WA 1S7CA 4KTTE 5JBIA 1Y8RB 1HYHA 2A4KA 3GHYA 3TDKA 2G1UA 5U4QA 4CMAA 4DC0A 1J0XO 1DC4A 4PLFA 2X9NA 5AXBA 3E9MA 4IINA 4IXWA 2VWHA 3VAZA 1W73A 2E82A 4G81A 4YVFA 4NHEA 1U2DA 4J3FA 5KNLA 5IAAA 1M6HA 1DHTA 1Q0LA 3RC2A 3TF5A 5IG2A 3SC4A 2AW5A 3ZU5A 4BUCA 4BNYA 2GN6A 3OJOA 1EBFA 1U1IA 3B1JA 3KLMX 5EL0A 4IBOA 2DFDA 4FGSA 3E9NA 3AUSA 3Q9UA 4CMJA 4B4WA 4NU6A 4DC1A 3C1TA 4J9UE 4ALKA 4RPGA 4LGVA 3HHPA 1JVBA 3TZKA 4KQXA 1VKNA 1NQTA 3CZMA 3QWAA 1K6IA 5JAZA 3ZWOA 4FW8A 2EV9A 1ENZA 1VKOA 3BAZA 4Q3BA 4YA6A 5TSDA 3D5QA 1LDGA 1GR0A 3RUEA 1D1TA 2OBNA 4E0BA 1EDZA 4KOAA 5TC4A 4NNJA 4DQVA 3QVXA 3CMCO 4B7XA 3ON5A 1GZ3A 3ETGA 1GUFA 3GVPA 4CM5A 3IDSA 2ZQZA 3VTZA 4XRGA 4OXNA 1JN0A 4J9VA 4R01A 1TT5B 2NQ8A 3UHAA 1BW9A 4GBJA 2I6TA 3K5PA 2VOJA 4ZA2A 1GPDG 1UXGA 3CUKA 3MTGA 5L9AA 4L73A 2WEKA 4RLSA 4RPHA 2BELA 5DP2A 2VTDA 3P19A 2OHXA 5ES3A 3ZDFA 4IGEA 4GX2A 3WQSB 4CQMB 2ZIZA 2X7HA 3FF4A 4H3VA 1O89A 1BWSA 3Q3CA 1ZFNA 3SBOA 3MCVA 3RU7A 1Z73A 3DZGA 3KEQA 5TQVA 1EK5A 1YBMA 1EVJA 2QW8A 3DFZA 3INGA 4AJPA 1T26A 5CEEA 3I3OA 2RH8A 2C7GA 1PGQA 3TOXA 1SPXA 3HB4X 2O3UA 1KEVA 4RPLA 3IKTA 4PLCA 3GVCA 1JKJA 1ZK3A 5TRTA 1LQUA 4L76A 1IY8A 1ULSA 3OEYA 2Y1DA 5JDCA 3M1AA 4UEOA 4PRKA 4GKVA 3GH3A 2DVMA 2W2LA 4Q3AA 1V35A 3SXPA 5C7IO 2QRLA 5FI3A 3KSZO 3MWEB 1DRUA 3FNGA 3U49A 3NUGA 2O3SA 3PWSA 2PGJA 1KEUA 3QW2A 3I9KA 4I9UA 2OL4A 3GY0A 4B7CA 1VM6A 1V3UA 4BO9A 1NNUA 3H8VA 3CKYA 2VNSA 3A14A 4JROA 4XEHA 4CLOA 1Z82A 3E6AA 1LNQA 5GZ6A 2YHIB 2PZMA 3INTA 1TEHA 2JAHA 2P9EA 4RO0A 4YJFB 1I2BA 3OHSX 1NR7A 4UEJA 4Z0HO 5G2OA 4YR9A 3ABIA 4JXKA 4Q3EA 1X1TA 3CH6A 2AQHA 1JWAB 1TXGA 3HN7A 3I52A 4GX0A 3JQAD 3TZ6A 2YZ7A 1K6XA 4H15A 3ZI0A 1NPDA 2CDAA 4AG3A 5KJ1A 1U28A 2JL1A 4AFNA 1DJQA 1XYGA 4YT8A 3DOJA 3F5QA 1UXIA 3RSHA 4BNHA 3IKVA 4NU5A 1H9BA 2VN8A 3GGGA 1L1FA 2DBVO 3ZHBA 4KMSA 2NVUA 1JQBA 4NQZA 1BDBA 9LDBA 3WXBA 4E5KA 3GVIA 5BNTA 4AJNA 4BGIA 2AXQA 4RLHA 2PNFA 2V6BA 4KUHA 4DYVA 2GN4A 3WGGA 3HADA 1EFKA 5G0SA 3RUCA 1EUDA 3JQFA 3B6ZA 4II2A 1EE2A 3AUUA 4CLDA 2X0RA 2O4UX 4HUJA 4U0JA 4E33A 5F21A 1MFZA 3KYDB 4DREA 1DC6A 1YBAA 3RUAA 3WG9A 5THQA 2WJPA 4DLLA 2VQ3A 3ANMA 4NBTA 1PGNA 4CLRB 1DLIA 2C5AA 3FBTA 5KJEA 4NK4A 1J6UA 3KB6A 5ENDA 1UUFA 2AQIA 4XGNA 4JBGA 2IE0A 2G17A 1MA0A 1TVEA 1E7WA 1U3WA 2NADA 2VT2A 3JQ9C 3L9WA 4Y6SA 2I3GA 3NTRA 3L6EA 1K0UA 2B4TO 1HF3A 1PSDA 2C29D 5L3ZA 5TIIA 5IZCA 3AOEC 3NT5A 3PLRA 1O0SA 3KUXA 3S2FA 4ZN6A 2NV6A 3JQAA 1LX6A 1AE1A 1R16A 2BI8A 3BYZA 1QYXA 3H9UA 1C1DA 4XQCA 2H5LA 1YQGA 5JAQA 1ML3A 4N18A 5A02A 5G4KB 1H6BA 2I65A 4BO6A 3W4JA 1SAYA 2EJWA 4GLOA 5FI5A 2Q1SA 1D3AA 1IYZA 1ADCA 3V8BA 2JFFA 4EJ6A 1F06A 3K9QO 4UVDA 4D42A 3KVOA 3KXDA 4UREA 3ZV6A 1EE9A 3PHLA 3Q11A 4JLWA 4QEDA 1SEPA 3I6IA 3M2PA 3QWHA 3OICA 4PVDA 4YXFA 3PGJA 3VKUA 3JYQA 3OBBA 2R00C 4DPLA 1ADGA 2HSDA 4EUEA 4B4UA 3Q9NA 2WYVA 1LC0A 4WEOA 2VZ0A 4YRDA 2VYVA 1C0PA 1H2HA 2AMFA 2EKPA 5TX7A 1E5QA 3C1AA 3AFMA 4OO3A 3ROQA 3H3JA 3JQAB 2O48X 3KSDO 1PL6A 4FFRA 4S3MA 2VYNA 3ROKA 2JFHA 3Q0EA 3S8MA 2WYWA 2ZJ1A 3LDHA 2B36A 4ZRNA 3D3EA 3WR5A 3IQDB 3U4HA 2BFOA 2OOSA 1O8CA 3RI3A 3F46A 4R54A 4BO4A 4CM9A 5HS6A 1SC6A 3WGZA 5C7OO 1IZ0A 5TF4A 1R4MB 3UCFA 4M54A 2Y1GA 1ISMA 2ZATA 5DOZA 1KVSA 5F1PA 1X0VA 3G79A 3G1UA 1DJNA 4K6FA 3WJAA 2CNBA 5EESA 5CHEA 2ZTMA 4CM6A 1T1RA 3BIOA 3I9JA 2V7PA 2ZCVA 3WGOA 5THKA 3O38A 4P4GA 4DRYA 1UZMA 3S2IA 1M67A 5ILGA 2G82A 4CR8A 2AG5A 2X86A 1XQ6A 3GPDG 3NT2A 2NLOA 3GAZA 4EW6A 4AJIA 1WMBA 2CMDA 4J4BA 4NJOA 3H9JA 3M6IA 4E21A 5G0WA 4B79A 3WYCA 4RJTA 2VHVA 1F17A 3L9XA 5H82A 4DQXA 2GZ1A 3HG7A 1HE2A 2WTBA 3KTDA 4D0RA 4WKGA 1MLDA 1P1IA 2QIOA 1FJHA 3A06A 3PQDA 1T2DA 3D3WA 4YYZA 3FNEA 4ZQBA 4LW8A 2O3JA 4K6CA 2POQX 1WXDA 2J5RA 4N5LA 5K0ZA 1DEHA 3DR3A 4MO2A 3N7UA 4Z9FA 4BNLA 4WK6A 3RUHA 1X15A 2HQ1A 3D4PA 5KJ6A 2PZKA 2CUKA 3E9QA 4ROSA 1ZMOA 5CEFA 3WX0A 4IXTA 2JHFA 2NU9A 1KVTA 1KC3A 3DMTC 3ZWBA 1P0CA 4H16A 2GLXA 1PWXA 1T2CA 2CF5A 3BHJA 4YQZA 1FF9A 3RD5A 4E5YA 3ZGYA 4R9SA 3SLKA 4NIMA 2PV7A 1DC5A 2GRAA 5JDIC 3QLJA 4AJLA 1CQIA 2YHIA 2C2YA 4J90A 4JX8A 4LVUA 4NK5A 1TB4A 5GMOA 1EVIA 1PJLA 4QSMA 1VE9A 1HDRA 3ONFA 3I9MA 3F6YA 4R5MA 2J8ZA 1ZJYA 1M66A 2V6MA 3E48A 3WGHA 3RIHA 1U7TA 4ZU3A 2OGUA 4II3A 4J0EA 1KOLA 4D41A 4FS3A 2EP7A 2JCVA 5H83A 3PDUA 1QV7A 2D8AA 3KM0A 4HP8A 4AJHA 2ZYDA 4IDBA 2VHZA 1JTVA 1ZXLA 4OQZA 3P5SA 4BGVA 1X7DA 3F4BA 1MXFA 1LBEA 4PRLA 3MOGA 1RM3A 3WGIA 1GCUA 4C7JA 1T4BA 1DPGA 3SVTA 4XX0A 1BVRA 1G6KA 1UJMA 2JKVA 2WD7A 3ICPA 2EEZA 4I9NA 1W4ZA 3WDSA 4P4LA 3STHA 4IQGA 4A7PA 1FDUA 2J3JA 2Y93A 3C7CB 3V1TC 4YAEA 1KETA 4LSWA 2X0IA 3OJLA 4XQEA 1XU7A 2D0IA 1B26A 1IULA 2AE1A 3NEPX 4Y6RA 1HDGO 2AEFA 4FJ1A 4O0LA 2X1HA 3DBHA 3EAGA 2EKLA 1FMCA 1NYTA 4Z3KA 4LN1A 4YWJA 8ADHA 3K30A 2YFQA 2Q2QA 1LA2A 1A72A 2I66A 3X2EA 5IXYA 5L7TA 3GNQA 3KYBA 3OMLA 5FYDA 4YB8A 3TL2A 4I08A 2DKNA 1UR5A 3WFIA 2VWGA 2B0JA 3D1LA 4Q3CA 4Y9DA 3U62A 4BO7A 1ZSVA 2P2SA 3WSWA 3DAGA 4LK3A 1LEHA 3PI7A 1UZNA 1CRWG 3D7LA 4K9DA 5KTKA 4NMHA 3MOIA 4KUEA 1KY5A 2FR0A 4BMVA 3TFOA 3QWFA 4WLFA 4BNVA 3AI2A 2HMSA 2GD1O 3R0IA 4LSMA 4J1SA 1GQ2A 4FC7A 1LTHR 4PGFA 1QP8A 3NKLA 3GZNB 4E30A 5LCXA 3VVBA 1OBFO 2YFHA 4JNKA 1Z75A 3JQGA 1U5AA 2YY7A 4GAEA 1UDBA 4F3YA 3ENNA 1G1AA 3OEWA 5L53A 2P4QA 1BHSA 4UAGA 3ST7A 4EI2A 1JVSA 4BNGA 3AI1A 1E0DA 2JJYA 1U5CA 5ITVA 4P8RA 3A28A 1NPYA 2YQ4A 5A06A 4FPXA 3BTUA 4FDAA 2W2LD 3DHNA 4ZGWA 2P68A 3U4DA 3E82A 2C54A 4NZ9A 1R66A 1HRDA 3L07A 3ZH2A 5TNXA 1U3UA 1JU9A 1ONNA 3E1KA 4MVJH 3GNSA 1IHYA 3RJ5A 4HFNA 1ZBQA 3I23A 3MJSA 3PXXA 1XEAA 3WJ7A 4IZIA 3WNVA 5A5FA 2A9FA 1PQPA 3PVZA 4ITUA 4Z9YA 4GGOA 1GV0A 3BMNB 1AGNA 3WMWA 3UVEA 1HDCA 3IUPA 1J49A 5CDSA 3LSYA 2SCUA 1HZJA 3GK3A 1OOEA 1Y6JA 1AN9A 5ILOA 3ITKA 1YOVB 5CG2A 1NASA 2JCYA 1I32A 2B37A 3T4EA 2X5OA 1B3RA 1I24A 2I76A 4TQGA 3H6KA 3WMXA 2LDBA 3MTJA 3RFTA 3QE3A 1GV1A 4F46A 5EN4A 2OBYA 4JJFA 5JE8A 2WE7A 1QYDA 1ZK4A 4HNGA 1HDXA 3OJFA 3WTBA 3WGYA 4CQLB 1ZO8A 4X54A 4DWVA 2IYPA 2DUUA 2VYVD 2DPGA 4WGGA 3FPCA 4CMEA 1SOWA 4MVJE 2P9CA 2FOIA 2JHGA 1ARZA 1RM0A 2ZTLA 3MJTA 4RVSA 1V3TA 3HJAA 2J5QA 4RVUA 3JQFC 4A73A 3GG9A 4J91A 4RL6A 2IXBA 3F1LA 3NGXA 2E48A 3C85A 1I2CA 2WDZA 1JAXA 1KS9A 3VPGA 3I6QA 2BD0A 3OH8A 5DULA 4TRJA 2D59A 3G3EA 4DPKA 4N7RA 4Q3DA 3CE6A 4BO8A 5JYEA 3OIGA 5ER9A 3MJCA 4XKJA 2VZ9A 2IZ1A 5IFLA 3HUDA 1NVMB 2O2YA 3JQ9A 2HDHA 2OP0A 1RPNA 4FB5A 4LRSB 3P2OA 1UZLA 3KYCA 2CVOA 4I5EA 1OZAA 3PJGA 3OJ0A 2F1KA 4CL3A 5IJZA 4OOEA 2BFAA 2UVDA 2ZK7A 1WAMA 4B3HA 1LSSA 3QVOA 3DBLB 4INAA 4CLEA 1F14A 4RZHA 1I10A 1NX6A 3ZU4A 3KHUA 3BMCA 3ULKA 1I2ZA 2I5PO 1Y9EA 5A04A 3GVHA 3K6JA 1W0CA 4FOOA 5C7LO 4BHTA 2QZ9A 4CV1A 1IB6A 3O03A 2XXBA 4Q39A 5C3MA 1PL8A 2FHSA 4F6CA 1DB3A 4WJZA 4EGFA 1O94A 4PLTA 1DXYA 4U5QA 1SMKA 2CVZA 5C5IA 4CMHA 1J5PA 4OSPA 4CUJA 4RF3A 1P1HA 2VOEA 1Y5RA 1DFGA 3LVFO 1HLDA 5F5LA 1U8XX 3DO5A 5JO9A 3HE3A 3O8QA 5IDXA 3NV9A 1FDTA 4FOSA 2Q46A 1E3WA 3Q1LA 1F0YA 1XDWA 1ZNQO 1N5DA 2JCXA 3DBHB 2W8ZA 2WE8A 4ZVVA 2PR2A 4CV2A 4EZBA 2VUSA 4ALMA 2Z1NA 1Z45A 2EP5A 3PQFA 3VZPA 1PJ2A 2NWQA 1YDWA 1I3LA 3K92A 2A94A 3T7CA 4MDHA 4UVEA 3IOYA 2CDBA 4I5FA 5CAEA 5KIAA 5FWNA 4BNNA 2FMUA 1KVRA 5IZ4A 1ULUA 1V8BA 1JKFA 2GNAA 3VH2A 2EERA 1NHGA 4FSHA 3HWRA 4EJ0A 1KBZA 3GEGA 1P1RA 1Y5MA 1EMDA 3HQ4O 4YT5A 4ZQFA 3DZJA 2NUAA 3PEFA 4HFMA 1HTBA 1YKFA 5U1PA 3WLEA 2EHDA 4E6PA 3TRIA 2D4AA 1ZEMA 2XF8A 4XIJA 3OP4A 3GHHA 5DBGA 2NU8A 3WS7A 4TMFA 5TT0A 4Y6PA 1I33A 4ND5A 2Y68A 4Q3NA 2PD4A 3U5TA 1E5LA 1XA0A 1YDEA 2H1SA 3GZ4A 4JIGA 3GDGA 4BKPA 4CQMD 4EJMA 1J4AA 1I3NA 2PD3A 4UULA 1HETA 1VL8A 1T1SA 3GMDA 1HL3A 4XB1A 3AY6A 3L4SO 3RASA 5JYDA 1HSOA 1CERA 1RKXA 1KEWA 3VPHA 3FNHA 1Y8RA 1TI7A 4YACA 1FDWA 1QG6A 1E92A 4B4OA 3NGLA 5EQDA 1EFLA 3OQ1A 4J7XA 3NRCA 4OJNA 1LLDA 1U3TA 4E2ZA 3VPSA 1ZSNA 3DC2A 1I01A 1I3MA 5JFOA 4IDDA 1LC3A 4Q9NA 1OC4A 2Q2VA 2V6GA 5IDWA 2O3QA 4GWGA 1VSUA 1EBUA 3TWOA 4BNMA 3ZNNA 3L4BA 1XWFA 5DDIP 4QO8A 3KZVA 3VKVA 4AJEA 5LDHA 3UN1A 1BDMA 1L7DA 5B37A 3ZU3A 3WSVA 2X0NA 4PLGA 1PR3A 2GYYA 4BO5A 3GLQA 3CPSA 4FN4A 4YJHB 4JQCA 3U3XA 2CVQA 3ZW8A 1R0KA 2X22A 2YUTA 4XWYA 1O5IA 5JY1A 4MINA 4ILKA 4MVJF 3JQ8B 4EEZA 1T25A 2IXAA 2WYUA 1QMGA 3FPLA 3VH4A 5GY7A 4WCFC 1H0KA 3MZ0A 1KVUA 2X4GA 3JD4A 4ZJUA 1PZFA 4LCEA 3WTCA 4A27A 2BFMA 5DT9A 2VHWA 3VZSA 3EGOA 4J16A 3UCXA 3WYBA 3JQBC 4OIMA 2V6FA 4WLNA 4PLPA 1XIVA 5BSFA 5T6BA 4E5MA 4HFRA 1ZK1A 1JA9A 1JDJA 1A7KA 3QHAA 2IZ0A 3RROA 3GN1A 4J0FA 3ZV4A 3G1TA 3KBOA 1H6DA 1C0KA 4WLVA 5IXSA 2CZCA 3INRA 4KQWA 4GWKA 5I7EA 1B2LA 1XKQA 3GFBA 4CMCA 2X8LA 2FRDA 2W98A 4L75A 2O3TA 2Q4EA 1ENYA 3V2UA 4W4TA 1GPJA 3RBXA 3GZNA 2D2IA 1K5HA 3WLFA 5GZ3A 3GEDA 1C1DB 3KOUA 1BMDA 3LC7O 4EUFA 4R3WA 3HSKA 4WLUA 1ISJA 3FSRA 4M86A 2QYSA 2Q3EA 4BV8A 3NX4A 4FC6A 4XIYA 4FGWA 4KZPA 1ONPA 2CFCA 1MB4A 5JDIA 2CSUA 3BA1A 1YE3A 4I5DA 3DZFA 3HFSA 5AXDA 2UV8A 3FR8A 4YJHA 5DN9A 3BTSA 1E3WB 3DMTA 4UUOA 1PZHA 3QVSA 4O5OA 2Q49A 4FFPA 4TRMA 3WQRA 5CDUA 3VC7A 2Q2WA 4IMRA 3CTMA 1HKUA 1N1GA 4UUPA 1ISIA 4M55A 1VSVA 1EUZA 1FDVA 3U09A 1GUYA 2BRUA 3C8MA 1P0FA 5I7SA 4KWHA 3QSGA 5JMWA 1ZVMA 3IC5A 3ZU2A 3GRPA 2VZ8A 4K1LA 5EJ2A 2PK3A 3TOZA 1LUAA 1VJ0A 2Y67A 4MKRA 2EGHA 4ZHSA 4PCVA 4EUHA 4ND3A 3BMOA 4YQYA 3EVTA 3GQVA 1LRLA 2IZZA 2QHXA 1GZ6A 3KYDA 3W1VA 1PJ3A 1H93A 2BMAA 2QG4A 4I5GA 2Y0CA 3CMMA 3UGKA 4RVDA 2Y05A 1EVZA 1NQOA 2HUNA 4UVIA 5U9CA 1V9LA 1UH5A 1GYRA 4PIVA 5C37A 3WIEA 1WZEA 3D5TA 3L0DA 4OMUA 3ZV5A 3FTPA 3PDJA 1ZIDA 3BTOA 4J2OA 1ISFA 1YJ8A 3V1UA 3WICA 3SJUA 4IDCA 4YAKA 1Y9AA 5G0UA 4BVAA 4ALNA 4IJVA 2EF1A 3EK2A 5TJ9A 4TSKA 2PFGA 4OYRA 4W6ZA 1RM5A 4IJKA 5JC1A 1P1FA 4BO1A 1E6WA 1GL3A 1BRMA 3BMQA 1YL7A 2ZCUA 1RYDA 4MIYA 4AJOA 4DIOA 3T7EA 4ZQGA 4CV0A 1B8PA 5AOVA 1ZEJA 4XYBA 1KEPA 2ET6A 4M87A 3IUSA 4CM4B 4BNTA 1HYEA 4BKOA 1MC4A 4WLOA 1NP3A 1P1JA 1V0JA 4HKTA 3H5AA 5COQA 1NQAO 1EVYA 2VWPA 2ZTUA 4ND2A 4BS9A 2X9GA 3WFJA 3QQPA 2V65A 4KDEA 5HA5A 1LDBA 5IN5A 1P77A 2ZB7A 4Z0PA 3LYLA 2C7VA 3ZHXA 2E49A 1E3LA 1PJ4A 2HK8A 4RVHA 3GDOA 3X2FA 1H6AA 2Q50A 3Q2IA 3RUDA 1ADFA 3B70A 4HY3A 4XDZA 3PK0A 3UF0A 4MVJD 6ADHA 1P45A 1V6AA 3F5SA 3QIVA 1U7HA 5CEJA 4IDGA 3G17A 3IP3A 3P7MA 3ZNQA 4ALIA 1QR6A 1O9BA 1NFFA 1CYDA 2X0JA 1M2WA 2VTEA 1T24A 4DMLA 2NSDA 1RM4A 3JSAA 4GX1A 3RVDA 1P31A 1HYGA 3RC7A 1H2BA 3RFXA 3ZWMA 4L8VA 4PZDA 3DHEA 1C0IA 3QA9A 4TRRA 3W8EA 4QFCA 3PFFA 3PTZA 4B7UA 5IDQA 1UDCA 2HJSA 2CY0A 5G0VA 1A71A 1T4DA 4HV4A 5I9NA 3LLSA 4HXYA 3JYNA 5BNIA 2W4QA 3AM5A 1OI7A 2O7SA 3DBVO 3VTFA 1C1XA 2NTNA 1NHWA 1GADO 3OSUA 4MKZA 1X0XA 1PGJA 5GZ1A 2DBQA 3ASVA 2JD2A 4JK3A 1T2EA 4MPDA 1SEVA 1PJTA 2GR9A 1OFGA 1YH3A 3GDFA 5BSEA 3DBRA 5ADHA 1ZJZA 3LLVA 2ZJ0A 3KYCB 1LU9A 4JBHA 3ZWYA 5BR7A 3F1KA 1ZZEA 4BQRA 4I8XA 2VUTA 1LLCA 1Q7BA 3IS3A 3W4KA 3I4CA 3GEMA 1BTOA 1WW8A 3CIFA 4ID9A 2WD7B 5H81A 4GMGA 1KY4A 3KRTA 4GVXA 2TMDA 4CLOB 3QVWA 4D44A 1EQ2A 1NWCA 4LVCA 1XU9A 4J7UA 2B4RO 2HK9A 4LMPA 4LRTB 1LJ8A 4PG7A 4PG4A 1A27A 1XSEA 1HT0A 1O95A 4W7IA 5CP8A 2FP4A 5EINA 4IY1A 5JXWA 3H2SA 4L4SA 1QLHA 3HDYA 4WECA 2ZB4A 4BKUA 3TZQA 1Z7EA 3EHEA 4RVFA 5DCUA 1DIHA 1GQQA 1C14A 2GF2A 2PKQP 3GN2A 1E1NA 4PLVA 3IJPA 4DXHA 3PHJA 4KTVE 4P22A 3JQ7B 4URFA 1DRWA 3PJEA 4YJGA 3VDRA 2WMDA 3M2TA 2QX7A 5ER6A 4MP6A 5HWSA 3OQBA 2IODA 3JYOA 2DTXA 4M8SA 4BO2A 1D1SA 3V5NA 2F00A 2UUOA 1ZXBA 3P2YA 4ZQHA 1NXQA 1VC2A 1YB1A 1Y8QB 2E37A 5FFFA 2I9PA 4QT0A 5A9SB 3RC1A 4L4RA 5MGBA 4E5NA 3IMFA 5HBRA 2Q1UA 4FFOA 1DFIA 1JW9B 1YWGO 4J1NA 5KVSA 3GFGA 4WUVA 2HMVA 3LT2A 4DVJA 3ZN2A 5I7FA 3TZCA 4AJJA 3ZWCA 4BMSA 3L77A 3GGPA 4OL9A 2YYYA 3FR7A 5KCZA 4DBVO 2Y0EA 1HDOA 4E12A 4YT4A 2TMGA 5ICSA 3DZIA 4CJXA 4KWIA 2RAFA 4NBUA 4IQ0A 2WM3A 3BZUA 3OF2A 3QJ5A 1I36A 4D3FA 4GX5A 1YO6A 3OECA 2VT3A 1CETA 2PZJA 4Z6KA 2NACA 3A4VA 4QFDA 4WCFB 4C4OA 1NM5A 4R4JA 4XD2A 1GQYA 2FY8A 4CLXA 5FF9A 4TWRA 4U8GA 3S1LA 1PGOA 2HMWA 3NJ4A 1CWUA 2EW8A 3LF1A 1N9GA 4NR0A 4XDYA 3W8FA 3E5RA 1BXGA 4ND4A 1MUUA 1Y8QA 4G5HA 5JLAA 3FTNA 1E7YA 5A3VA 4GQAA 3ZWAA 1KERA 1DSSG 3ETDA 3LC1O 4QTZA 3T4XA 2AG8A 4D7AA 2QZZA 4FCCA 3N74A 3UUWA 3LZ6A 1XG5A 1E3IA 1Y81A 3OFSA 3PGXA 4Z0TA 4AL4A 4U0KA 3PWZA 3S55A 1B3BA 1DLJA 2X23A 4IMPA 1BG6A 3FWZA 3R1IA 4QX6A 3FN4A 4RF2A 3O9ZA 5TT1A 3NDRA 3NJ8A 4TZTA 5TJHA 4D0SA 2OZPA 3AUTA 5COBA 4B4VA 5L95A 1E77A 2HMUA 4E32A 5JW6A 4BQPA 1R4MA 4YJGB 2C0CA 4OHUA 1ZK0A 3U0BA 4I1IA 4G65A 4R69A 3MJEA 2RHCA 5DZSA 2BHLA 4CMIA 6LDHA 1SZJG 2D3TA 3L6OO 4OKIA 2FR1A 1BSVA 4CODB 2NU6A 1H5QA 2YV2A 4GI2A 4BB5A 1YGYA 4A10A 3MJVA 4ND1A 4PLYA 3PYMA 4DGSA 1PJBA 4CM9D 3COSA 2D1YA 4W99A 4B3IA 2EW2A 1AHHA 4A03A 4DLBA 3UXYA 1DIAA 3GF4A 4CM8A 2GN9A 3SEFA 2Y1EA 1LDMA 2VYND 3EZLA 2P4HX 4JJIA 4W7HA 4AICA 1TA4A 2VHYA 4FIZA 3TQHA 4XGKA 4W82A 2ZYGA 3FWNA 4CMBA 4PLWA 4J2HA 1R12A 3JCZA 4ALLA 3BTVA 4PLHA 3DTTA 5T57A 4OSOA 4IPTA 3H65A 4RF5A 3D3WB 3RCBA 2BI7A 5AXCA 1LDEA 3HDHA 3AOEA 4R68A 2NM0A 2YV3A 5JNLA 1QV6A 1BGVA 1CEQA 4BGUA 5CFZA 5FEUA 3UFXA 1P74A 1QYVA 2Y66A 1AXEA 2OORA 3CEAA 2GGSA 1WP4A 4MKXA 2Z95A 4KDFA 1HXHA 1YB5A 3W6UA 1D8AA 4ZD6A 5MDHA 4DPMA 1U8FO 4FJ0A 3HDJA 4FFLA 4XJTA 5LDGA 5AQ1A 1AXGA 2NTJA 1HE4A 1QLJA 1PS9A 1RWBA 1LLUA 1B8VA 4UUNA 1DDOA 4QQRA 3W8DA 2I99A 4NFYA 1E7QA 5G4LA 3BHIA 1IOLA 2O2SA 2PA3A 3TL3A 1ADBA 4TKMA 3ONDA 3HN2A 3C3XA 3UW3A 4CM7A 4K28A 1LRKA 4K26A 2ZYAA 4NFSA 3GG2A 4FFNA 4BIIA 2IEDA 4R16A 5JO0A 2HAEA 5L45A 1DBVO 1SNYA 4PLZA 5L51A 1F8FA 5CDGA 3B20A 5BSHA 3AY7A 4GH5A 3TZHA 3PZBA 4Y67A 3SLGA 3ZNOA 4NJMA 4EEXA 2JD0A 5CDYA 5JCXA 3NDIA 3QV1A 1HEUA 1PJSA 4E5PA 3KETA 3PHIA 1QYWA 3OM9A 1NPTO 3NAQA 1Z6ZA 3V2GA 1N7HA 4R1SA 3ZCXA 1E1LA 1N1EA 1PQWA 1ZMTA 4IS2A 4CPDA 3EMKA 4QECA 1QSGA 3H9GA 4D46A 2NQTA 1U4SA 3VDQA 1I30A 4J49A 3FHLA 3ZHYA 2E4AA 1P9LA 1WDMA 4TZKA 4M89A 3RFVA 1EEHA 3JQDA 2DT5A 2HU2A 5HM8A 3I9OA 1MX3A 1ONOA 4OXKA 1TLTA 1WNTA 3JQ7A 3GAFA 4XJSA 3TN7A 1M75A 2NNLD 4RORA 5G4KA 5IF3A 1B15A 5DNAA 5JDCC 4J7CA 4TROA 1SCUA 3ZWXA 3DQPA 4HFJA 1DIGA 1D4FA 4IIVA 4UVHA 1ZH8A 3CINA 1Y1PA 3GMSA 1B0AA 1GAEO 4R1NA 4TKLA 2DFVA 3ANNA 4WE3A 2DQ4A 2P9GA 2VHXA 3PHHA 3PJFA 3TSCA 5TLSA 1A5ZA 4JJGA 2AHRA 1X1EA 2Q1WA 4AJ4A 5A9SA 1YL6A 1N7GA 2AEMA 2ZB8A 3QVTA 4RPKA 2LDXA 4E13A 2FZEA 3RKRA 4NBVA 2R2GA 4NDNE 4E2YA 1YXMA 5TS3A 4W9NC 5T67A 4MIEA 1BXZA 3V1YA 4AJKA 1Z74A 4GL4A 5JC8A 4Y98A 3AUAA 1VPDA 2DUWA 3OIFA 2PH3A 1N9GB 2GERA 2OUIA 1RJWA 2P5UA 4YRBA 2BKAA 1XCBA
chains in the Genus database with same CATH superfamily
3L1JA 2O8CB 4DPMA 2ZSHA 5FB3A 4B31A 5DWQA 3S1AB 1PR0A 2GH1A 3PGKA 1MVLA 1R5BA 4II7A 2QRUA 1HOXA 4JEMA 4M49A 5A3JA 1T34A 4KFSA 5CG1A 3QXGA 2AHOA 1NUHA 1T29A 1PJQA 2OQVA 3VC3A 4HB4A 1RE0A 4JS0A 4GOXA 4W9RA 2QTMA 4Q4JB 4ZI2A 2C5BA 3LGSA 3VGJA 3EPJA 5HJ5A 3JATA 4M1ZA 2QTLA 1MG5A 1VLLA 1XZHA 3ZUGA 3SNKA 4QNMA 3IMGA 4UEKA 2HREA 1Z37A 1NC1A 3RBZA 5FWXB 2VPWA 1GA4A 1A9TA 5HFJA 3TNYA 4CBVA 2D13A 2NO7A 1RHQA 4QOIA 2ZETA 4YDRA 1NBAA 2QVGA 2EJVA 1ZN8A 1J8YF 4P34A 2CFIA 2OLEA 3ZK7A 4HQRA 1EU1A 1XTSA 2J0EA 4DMKA 2PIAA 2WWFA 3TD9A 3CH5A 4W5RA 3HJRA 1W76A 5T4FA 4BFSA 3EPLA 3RC8A 2FUNB 3M6AA 3P27A 3D0OA 2RIRA 3LF2A 4P98A 4KMOA 4KFUA 5EKTA 4XPIB 5JBQA 3PUWA 1UXOA 3ED1A 3EODA 1ST3A 4RPIA 1SVOA 2VJYA 3R7LA 1Q84A 3G0GA 5H7XA 3NV7A 1CJSA 4TWBA 2CYAA 4O2AF 4YNBA 3VR5A 3FB4A 2K7FA 1ZI8A 4QYIA 1VRWA 1P4HA 3A3NA 4DZRA 4F0JA 3UH1A 1G2OA 4AJ9A 4F85A 3EZYA 4Y6QA 3EZFA 4WLEA 5FQNA 4OHYA 3WNQA 2QE7A 1D2GA 4AZSA 1ZSYA 3WAGA 2VJQA 3M81A 4CQLA 3TPCA 1H0RA 3MGKA 1DL5A 1G8KA 3BRQA 2BPOA 3PQ7A 3ROPA 5JOQA 4J07A 2AFHB 1BE1A 3BE5A 1Z9BA 4MW0A 1NF8A 3T3GA 1D4AA 2E6UX 2HWXA 2QD1A 4IQ8A 2HQOA 2CL0X 5JR3A 1D09A 4IWNA 4TMVA 3B9BA 1I7LA 5TGTA 1PDVA 2GBLC 5DW0A 3ENKA 4MTLA 1KO7A 3RVBA 3TRDA 4R6WA 5ECYA 4ZCIA 1YIOA 5BQ3A 3H4VA 2JI7A 2GCEA 1G60A 1RWWA 1L5OA 1OXKB 1UKEA 2VUUA 3ORFA 3T5MA 4TKVA 5JJCA 5DRTA 3L8HA 2B35A 1YDFA 5B6IA 3DEJA 4IGIA 1Y7TA 1T9KA 3JQQA 4B6EA 1EJBA 3PITA 5EZYA 2H2IA 1EWKA 2G70A 3PKZA 4G8CA 1YS2X 2RHJA 3EDQA 1T36B 2KX7A 3L4BC 4W8HA 4QU0A 5YASA 2MSNA 4DIBA 5CPBA 1W4AA 2IRWA 2OLKA 3QUAA 2NV2B 3D8BA 3HI4A 3MT9A 1P44A 2CDCA 3CWZA 3F4LA 3BMQB 3NC0C 1QFSA 1V7QA 3EC7A 2DBZA 2R48A 4DKXA 4XZ3A 4GPBA 3QWBA 3GLKA 2XVAA 1XPRA 2K2WA 2IV7A 2P0EA 2V3WA 1VJ1A 1ZOIA 4JUDX 1HPLA 1M6WA 5F5NA 2FG6C 3QF4B 5LXTF 4FHFA 2QVYX 3IBGA 3W3AD 4DRXA 3PP8A 2CSXA 4EBFA 3DMDA 3OURA 3JD3A 5EOVA 3UQYS 4D3ZA 4DZZA 4W7SA 3QWIA 5K0CA 3V1NA 1NQVA 1LVGA 3JTMA 3AWDA 1UP4A 2B4QA 4HADA 4OM7A 4PINA 1VGVA 3GLTA 4IH4A 4XI9A 3ZKWA 1J06A 1PS0A 3OCVA 3LHIA 2O5EA 3QP9A 4OY3A 4H1UA 2HQBA 1OTHA 4TYNA 1E1KA 3DZHA 1H5NA 3QJYA 2G7ZA 1Q1NA 4MUNA 2HJHA 3CSUA 3EBLA 4QYTA 3TQRA 1N2BA 1TO2E 2J3MA 4GLLA 1DBPA 3IAAA 4MWSA 1TCUA 2VP3A 4LISA 3JQRA 1VA5A 3DFIA 3PFWO 5BT9A 4MUBA 1WXXA 2QV7A 3CEPB 4QDKA 1CP2A 4YAOA 4EX6A 4C3OB 1Q6YA 3ITDA 1FFAA 3UJDA 1GPLA 3LC2O 3KAKA 1G3UA 5AHRA 4FDTA 5KYUA 1E6MA 1GSOA 1B43A 2WABA 3F9IA 1DO8A 4RMIA 4NMXB 2XUGA 5A71A 4PFQA 5GWXA 3DXFA 1KAQA 2UYQA 1IPEA 1Q7TA 3DF9A 4FX5A 3T5CA 2Z9DA 2IIPA 2UYCA 4IHJB 1RIIA 5AI6A 1ORTA 2QGNA 3DWFA 4P93A 1GZ5A 1WU8A 2YW9A 3T4PA 4NBRA 4F71A 4KUGA 3MYRA 4MQMA 1N5KA 1FFEA 1I14A 4F6RA 1OLUB 4WADA 1OE0A 4IZHA 4Q9DA 2P3QA 5DYWA 1P33A 3H2IA 1IEQA 1AKTA 2JFUA 2VRWA 2QGZA 2CFSA 2WWXA 2ZI4A 2EW1A 2IWRA 3UY4A 5B12A 1NX9A 5HTOA 3T7DA 3LRTA 5J9FA 4E6EA 4YUVA 2QTVA 3E5MA 3UMYA 3MNFA 3WQBA 2EL7A 3P97A 4JV5B 2FJPA 2BKXA 2IBTA 3FVQA 1NR1A 3U9LA 1WDKA 4FU0A 1F4LA 5B5SA 2YYZA 3FHTA 1AB6A 4DV2B 1YF3A 4RVGA 5EYPB 4MCAA 3DAHA 3I12A 4FFSA 1C2YA 4OH1A 4RF4A 5L40A 5K3FA 3PRJA 4LC1A 1OXUA 5HFNA 3UANA 3NHYA 1GPBA 1AHIA 1HZZA 3PXUA 3W8RA 2R751 3OE4A 4C0XA 4EUKA 2FSVA 4MQ4A 1HE8B 4RTOA 1IE3A 2CXPA 1E2HA 2WOJA 2CLSA 2FUKA 3B3AA 5TPWB 6YASA 2W4MA 3K6SA 4HXGA 4LHSA 3EB9A 5LIPA 2AXEA 3ZDQA 4L0CA 4DLKA 5K8VA 1MJ5A 3HB7A 4R8LA 2VDWA 3SM9A 4MDFA 3NH9A 5A3SA 4BNUA 2EBWA 2SECE 2GCGA 1ZM7A 1DEXA 1ODSA 1J22A 2GPTA 4X93A 4ZO7A 2V96A 1CR6A 3ER6A 2PT7A 4LAFA 1YBVA 2AN4A 4BZWA 1PVVA 2WWIA 2WB2A 1PBNA 5H8WA 5GOZA 5D86A 1R0RE 2P27A 3N2IA 3QI7A 3R9IA 1WF3A 2JVKA 1K6JA 2ZJ8A 3SF8A 3H4TA 3TAHA 1Y1KE 4FD3A 1Z63A 1BMQA 2XNJA 3K94A 5JAIA 4WDQA 1NMEA 2HTFA 2YJNA 4WXPA 4HGZA 3SIWA 1G7CA 1MB3A 3RUIA 2Q5EA 3KWLA 3OA2A 1YS7A 4O4IA 1AH2A 3ZZUA 2DHRA 1O57A 2WC1A 2ZYRA 3OWHA 2HLPA 2G9QA 4Y2UA 1F12A 4L2IA 3ZTTA 4CKWB 4LRYA 5CBPB 3FOEC 4CT0A 4C4XA 2ZBDA 2VDNB 2ZIFA 4H0FA 4ZXFA 5F73A 3D8UA 3A1WA 4O25A 2FRDC 2N42A 4UMDA 2B69A 2VHTA 3IIEA 3VR3D 3T7SA 4B09A 4DIKA 2V0GA 1N78A 2KB0A 1U98A 2ZPTX 2QY9A 2A1TS 2P40A 3OKAA 1Y1SA 4JP3A 1VHTA 5KDLA 1CR0A 4HL6A 3SBDA 4BNIA 5JS6A 2WIGA 5A5GA 5C8DA 4MEAA 4HUTA 4JDUA 3JSXA 4DCJA 7AT1A 4XQGA 4BVFA 3AB3A 3X0DA 1PJZA 1GIAA 3C6QA 2ISSD 1B41A 3DWGA 3R7SA 2FFQA 3ET4A 4D92A 1NUSA 5FX2A 4DR1B 5IH3A 1G16A 2X58A 1Z4IA 1FZQA 3DEIA 2DLDA 1CSEE 2R00A 4ZEWA 4CM3A 1XLTA 3HCWA 3C14C 4Y1RA 1VXRA 4TM7A 1SQGA 2C84A 4AYWA 2PX5A 3KLOA 2DJIA 4ESHA 1WSBA 4KK4A 2VKTA 4N5NA 3PSHA 2RGNC 4RQAA 1JQAA 3RAJA 4LOLA 5IUKC 3ADOA 1JFFA 1JAYA 3B36A 4KYTA 2Q6TA 4EPTA 3D8SA 1INLA 1T2FA 2OO5A 1UAGA 4AWXA 2VSNA 5JY6A 3O8QB 1E5VA 4EFKA 3H42B 4Z7QB 1DIBA 4A0SA 5CFMA 4OXYA 3OF5A 5DBIA 4XUDA 5I8ZA 2DKOA 2NU7A 2H16A 3EGXA 1US8B 4N47A 2BGWA 2WIFA 4WPGA 1L5HA 5JS2A 3EIOA 3VO9A 4CQMA 1JG2A 5JQGF 1NTOA 1VHJA 2OPHA 3S2EA 3E18A 3H9EO 1ORRA 1SA0B 3CWCA 3HI6A 3L1VA 1M34E 3CKLA 3NHBA 1EHCA 3DHYA 3NBFA 1SRRA 5P8WA 4I3FA 1G20E 1VI2A 2JAQA 3I01A 5I9BA 8LDHA 2XKKA 3COJA 2MINA 1W8DA 3BJZA 3ORYA 2YWXA 4CFYA 2C4TA 3ICOA 8ABPA 1VJTA 5LA6B 2YN2A 4TZ0A 3RYFA 1P3DA 3U4CA 4DFDA 1ZMXA 3QUCA 4PAWA 3SYTA 2QJWA 1L6IA 2EZTA 2P41A 3W2TA 3WGLA 2ZRLA 1QB8A 1KE1A 1Y4UA 5LD2C 4CQJA 1RLMA 4U6QA 5EZQA 3X44A 1SJ9A 5F4BA 3IE2A 2X0EA 4JP2A 3OIYA 3VOSA 2MYPA 4BIMA 1S1CA 2Q6VA 4YRQA 4HB0A 4D9NA 2VH1A 4KP7A 5D3KA 2Q4RA 4HNAA 1E7RA 1VE5A 3HB5X 5D3MA 5EMJA 1ZD1A 4P3YA 5H80A 3LD9A 1D1QA 2ODTX 1AKWA 3URKA 1KI9A 2CVPA 1WUKS 2W6ZA 3H0KA 3OHPA 4TLAA 4JB2A 3N0TA 5WRFA 1V1RA 1RC0A 2D7CA 2OM2A 3R6DA 4HX2A 3WMRA 2B83A 3H1FA 3H3FA 5DM2A 4M0EA 4DY6A 1CEXA 3RS3A 1L3BA 3DSRA 1KP9A 1UJ4A 1KYTA 3PWKA 4H3SA 2A0KA 3A6PC 1E9RA 1KMMA 5KQPA 1OLSB 4RADA 2XEDA 4QDXA 3UOAB 2CXUA 4CTOA 3BD6A 5DSTA 2PH5A 3PR3A 4RSRA 4XQ0A 1UC9A 4L02A 3K4HA 5F51A 3AM3A 1MO5A 1UFVA 5B4VA 4US2R 1LB1B 5C8XA 2GXAA 5KVVA 5K45A 1WW2A 4F45A 3JVVA 4FE7A 3WWOA 2IZ5A 5DHAA 1VCNA 5FWAA 4UUMA 4BNJA 2DAPA 2Z5VA 2YJ4A 2WD9A 4YUWA 4YXWA 3QMVA 3VSAA 1Z2PX 3RK4A 3C7TA 3DEHA 2RAUA 2YRWA 3QEMA 1AA6A 1XK7A 4HWGA 5HCUA 2ZSBA 2AMYA 2H9IA 5E3HA 4KR9A 2PYIA 4NBNA 4K8OA 1AX9A 4GDMA 4CM8B 1OW3B 1E7MA 1JDUA 4CVNA 3PFBA 3ZHSA 3WNBA 3TFQA 1VFPA 4WASA 5KOJA 1C9EA 4MA0A 3WNCA 3DJYA 5ICMA 3LT0A 2ORED 3WIDA 2EG9A 2FSSA 1VDMA 1SGWA 2I3AA 3ZW9A 2R47A 3JAMA 2X7XA 3OTHA 3K72B 1JLLA 4Q9HA 3OM0A 4TYQA 1NJ6A 1TYCA 1LRJA 5A4MS 4A26A 4R71A 1U8CB 5LZ7A 4BZPA 1LPNA 5AUNB 4FNAA 2KM1A 4F8YA 1AF7A 1DKPA 2WWWA 4RU1A 3PHGA 5CPFA 2C94A 4CN9A 5KYYB 3EFOB 1ZW1A 2PGLA 1QYCA 2JDIA 2COEA 5EQFA 5A9TA 4X92A 4AQDA 4ZYZA 1I0LA 4F2DA 1D03A 3LT1A 1IJBA 3PVSA 4BVLA 1L8XA 5L4NA 1GYQA 1GLVA 1RI1A 3DMYA 4HEQA 4WXEA 1AV6A 4GHWA 5LQKA 4C2AA 4F7WA 2EKDA 1KK3A 2J9ZB 2A59A 1ENPA 3G2HA 4CMIB 4S04A 3QG1A 4LF7B 3U7JA 3M3HA 1QWSA 2ZUVA 1GA6A 3A3YA 4TKUA 3SS8A 2DT8A 2HL6A 2GA8A 4NYIQ 2CL5A 3R6GA 2YWGA 2J3KA 1E1RA 1GN9A 2DWUA 4H0NA 3KJZA 5FBZA 5A9RA 3A36A 3EFOA 3OQ6A 4MVCA 3ABOB 4D80A 4DSNA 1I5RA 1PJCA 3EIXA 1JDVA 2G6TA 2CHGA 3K8ZA 1TRKA 3HVUA 2G04A 2ZSDA 1PUJA 5K8UA 1RYEA 5FJJA 3GLFB 4PZEA 1M9NA 1HO3A 4WERA 1LXCA 2EX1A 1DGQA 1IN4A 2J5XA 1KVQA 5AW9A 1BGWA 1K8ZB 3T5GA 4OPMA 4GSKA 2HIHA 2ZAOA 4QUIA 3L7BA 5HILA 1XZKA 1N8SA 2H08A 3QUQA 4KSYA 4XFJA 5H1YA 1TZCA 2W70A 4J1TA 2I1QA 3GW8A 1CUFA 5EERA 1CIVA 3ZWNA 2PXAA 1T3HA 3LQ4A 3LX5A 3U17A 1L1EA 1IBKB 4CI0B 1U9ZA 1A4RA 3OC6A 4WGFA 4X1YA 4BJ5A 3GPCA 2TRSB 4U2KA 1VLZA 1PNTA 1ZCJA 3A6GA 1H2EA 2HPZA 2UYGA 4OF4A 1RAGA 3C1OA 4LGMA 5DYTA 1K2VN 1LSJA 3I92A 1HX7A 1QO0D 4FR5A 4I2VA 4CMEC 3A70A 5ITWA 1GCOA 1KS2A 1VB5A 3HJHA 4MLZA 5EWJB 3TQQA 4B2LA 4KIGA 5CVUA 4FCTA 3OZTA 3GRRA 1M33A 3KVVA 1JLRA 1Z07A 3O8DA 2WSBA 5J63A 1DZIA 3IUNA 4DDUA 2PX8A 3NCTA 3H5NA 3EIHA 3SR3A 2ZYUX 3SEAA 3ABQB 3RSLA 4DDKA 4YT2A 5JCJD 3L7IA 2FWNA 4ZO4A 3RAGA 4OFWA 3VPAA 3NTOA 3RIMA 4MKFA 1YONA 1GSAA 2G77B 3BH0A 4ZOLA 5ERGB 1STOA 3OFNA 4XQ9A 2VA8A 5EMKA 1E58A 2YXPX 3HCOA 1FYEA 3LG2A 4Q9KA 4EI8A 4HGPA 3UPUA 1YULA 1YZVA 5KTRA 1T8TA 3LVBA 1E2MA 4GWLA 5HTKA 2ATVA 2RHRA 3ZVMA 3E1GA 2OAP1 1UL1X 3E05A 4M4SA 1G0OA 4ZCSA 5I47A 1PX0A 4I4TF 3EAQA 1N2JA 2AMJA 3JWIA 3R24A 3WBFA 4HBGA 4DA9A 5B55A 3BHNA 3G13A 3HBJA 4ZQIA 3JV7A 4IMJB 2IEGA 3TJRA 3SQMA 1WD7A 3S0JA 2QRVA 2ZP1A 3KXPA 1WB9A 1PJRA 1DO0A 3WAKA 2C99A 3HZZA 1XKTA 1DAKA 2Z1MA 1HNZB 3D4OA 1P8AA 5B2ZA 3KKLA 4BXOB 2QTHA 1BCSB 1FSFA 3L0IB 3A31A 1BFUA 1HT2E 3QTBA 4P9NA 3A9SA 3EASA 3SN6A 1O4VA 3EPPA 5I7OA 1BCRB 5T6MA 1E0SA 2XVMA 1LY1A 1NVXQ 1G4UR 3K32A 1ZD8A 2WJYA 1XJQA 3R6TA 3NALA 3PRHA 2ZIXB 2X3FA 1EAMA 1AS3A 1S3FA 1X80B 5KKAA 4B8ZA 4KMMA 1THTA 2ECOA 1EXWA 5F3RA 3Q72A 5ISMA 4YI3A 2H6EA 2B8EA 4YCAA 4C4ZA 4NBSA 4TV9F 4EFDA 4UHEA 5IYZA 1DIRA 3AR4A 2M6LA 3UWMA 1TKAA 4BZZA 1E8DA 2JJ8A 5CFRA 3IA2A 3IDQA 5K6AA 3LV8A 3FTFA 1Y3FE 2H29A 3TIGA 1EZ1A 1U2RA 3R5FA 5A2GA 4RZIA 1D2NA 3FTCA 4RQTA 3ZS8A 4UHHA 2FMKA 5DN6A 4EECA 4GPZA 3RS0A 2H5IA 5C9ZA 2CXOA 2D62A 4DTIA 2WP8J 2FQ1A 1XTVA 3JZIA 1AMNA 1B7GO 4JR2A 5SY4A 3KNZA 4DBZA 1L7NA 3BPSA 2OEPA 4KRFA 1FU7A 2P78A 4HZUA 1IN8A 2CZGA 1AS2A 3AFOA 3C6BA 3LY5A 3AY3A 1O97C 1QZUA 2Q45A 1Z5UA 3FROA 4HEA6 2A0FA 3ODPA 3V48A 2JLZA 1S1MA 3FLAA 1LDNA 1SOVA 3HKDB 3JARB 4AXXA 4GXQA 4NMMA 5DV9A 4DQUA 1T35A 2NXCA 1X9HA 1L5WA 1WPGA 2ZLBA 1XV5A 3ZCPA 2XUDA 1UBNA 4ZJZA 2PSFA 2WINI 3BSYA 3WQHA 1OYWA 1N4DA 2X9VA 1S6YA 3OSZA 4BX9A 5AVQA 4FYJA 1Y5NA 2OFPA 3CY6A 1CUJA 3RC9A 4OGWA 4O02B 2K4MA 3V3TA 2W9XA 1ZVJA 4MPTA 5DNVA 3V42A 2W58A 1XR3A 4M37A 1R6UA 2FDRA 1ISSA 1CJMA 1FDRA 2OV6A 4QFBA 2RHBA 4GSLA 3RAFC 3D3NA 4E5DA 3KEOA 3W04A 1ONBA 2P5YA 1KPIA 1I0IA 5BSUA 1G9SA 1EEXB 1JEJA 2FI1A 3H2KA 3KP1A 2GN1A 3RVLA 1EUCA 1T5OA 5IWCA 1X9IA 2VHUA 3EWAA 5IAJA 4F4JA 5I45A 1WBDA 3WK8A 3ZY3A 4HQLA 3RAPR 3C3WA 3TKYA 2QT9A 4KZKA 4PG5A 3EX7C 2J6IA 1GU7A 1QCZA 4HZUB 3ZDXB 4C08A 1VSBA 4O2BA 5JCZA 2H3HA 4IP0A 2B8NA 2IV3A 3AM1A 1ZN9A 3PNVA 4DLAA 5KNDH 4Y8VA 1DHRA 4AW9A 3CZRA 4REMA 2DPXA 1XZFA 2Y0DA 4ZVPA 3TKAA 4E5VA 1NW8A 5I9LA 1MRZA 3P4XA 1C3EA 1OR8A 4NYJR 4NCIA 5DEIA 1SBNE 1T5IA 2WLSA 2O2DA 3K31A 5HFAA 1DFHA 2YASA 2BFBB 1UANA 4V0ME 4R8RA 3DCYA 2RH4A 4B8WA 3W2IA 3FPGA 3TDKA 1HYHA 4UHKA 3HCFA 4CMAA 5F64A 4JITA 4PLFA 2JASA 2NXWA 3E4DA 4Y9RA 3VVLA 1J0EA 3DLBA 1HYBA 2BTEA 4IXWA 2N47A 2VWHA 2Z57A 4G81A 1A9XA 2CMGA 1GRQA 1VMKA 1WNFA 4NHEA 3BFVA 1XQWA 2XWPA 1T6NA 2X4LA 3P9KA 3GFQA 5IAAA 1BHJA 1S9DA 3OU2A 4KE8A 2ERYA 1YDMA 4EJSA 3HJFA 1GLNA 1D6SA 2BDEA 3O83A 1S02A 1RJGA 2AW5A 3W6PA 3MAAC 1TAUA 3FTEA 4M0DA 4HNQA 3GLUA 2WU4A 3L3BA 2GN6A 3OJOA 3FSJX 3REOA 3RTGA 3FNBA 1EBFA 4XWKA 1GZHB 3QU9A 2ALJA 3H87A 3DB1A 5ADWA 3V8VA 1FUKA 4J16C 3AX6A 3LCMA 2WILA 4D0GA 1EFRA 2GTPA 4CMJA 3FZNA 4P08A 3UEOA 1L7PA 4UTNA 3LHFA 2CJXA 2R8ZA 1MVNA 4HEJA 3HHPA 4LGVA 4BQEA 4EELA 4ZIRA 2VDWB 2C4UA 4X44A 3RM3A 4DJDC 1GPUA 2ZGVA 4HUQA 6REQA 1K6IA 4LHYA 5AM3A 1ENZA 4Q3BA 3F5MA 2R96A 3QU7A 3D5QA 1IY1A 1GR0A 3AETB 4DR6B 3HBFA 2GD2A 2OBNA 3NBMA 1RYNA 1TQ4A 4HAYA 2HNKA 4O0MA 4QUEA 5LNK1 2V55B 3KLNA 4IH9A 1XO1A 1CVLA 2IEZA 3JASB 4RVCA 3E0QA 4YJ3F 1GKLA 5D1NA 3T7AA 5FJIA 1TK9A 2NUTB 1KDTA 2ZSJA 3VTZA 2GPYA 3RBAA 1QF9A 1G2PA 1XX6A 3C98A 1RRPA 1DKUA 2OFOA 2XDYA 2YWFA 4L08A 1TT5B 1UF9A 3HRKA 4PPFA 4GBJA 2WUVA 1YZ3A 1GPDG 5CU7A 4C6TA 1QGUA 4WVLA 4L73A 4YV1A 2WEKA 4JI0B 5NULA 5DP2A 2VTDA 4KBGA 3RIXA 5K0SA 4MIKA 3ZDFA 3W5DA 5EXEA 4GX2A 4B3DA 3M83A 2QB5A 3BVPA 2HRDA 4BPBA 1NATA 5B6PA 1XWWA 3Q3CA 2HA5A 3DBOB 1U2ZA 4QAQA 4OK5A 3SBOA 5I7HA 2GFHA 5T7BA 3TSAA 2C7PA 3DF7A 2NVOA 2ZBUA 3LPNA 4PCLA 4RDXA 2B4YA 4F1WA 1EVJA 2QW8A 3INGA 3SYKA 3TNJA 4AJPA 2JI4A 5CEEA 4UCFA 4MQ5A 4WA7A 5LNK6 4ZQCB 1PGQA 3RS7A 2WZDA 2YWJA 4ZDKA 3SG0A 3IKTA 4Z4QA 1X7ZA 3KD3A 4YRKA 1JKJA 1ZK3A 3E27A 4TSFD 5TRTA 3KQYA 5G1PA 3ML1A 1PCXA 3F71A 5IUNC 3A9TA 3WLQA 1IY8A 2HM7A 3EH2A 4A8PA 2CGEA 2BZ0A 3DDOA 4TTQA 2YFYA 2FSPA 4LFCB 2QR5A 4K88A 1MEOA 4Q3AA 1V35A 3SXPA 2QRLA 2R8PA 3TSZA 1ULTA 1DRUA 1AQJA 2J08A 1NW7A 3NUGA 4NAVA 3PWSA 2ZE8A 5TS2A 3T6KA 2YC4C 3TUJC 1FVFA 1OGIA 3A9VA 4I9UA 2OL4A 1KEEB 1UINA 3CNQS 2C5FA 4Q1FA 3WZLA 4ZCRA 3IAXA 4MVYA 2WUGA 2NV0A 3AINA 4LKOA 3MS2A 2FPIB 4XEHA 1W87A 2GZHA 4N49A 4ISBA 1XF1A 1LF5A 3I8XA 1JG6A 2WAXA 2P9EA 2YMPA 4WUTA 4RO0A 4YJFB 3TOVA 1QFJA 1NR7A 3CPEA 2QTFA 1UJNA 1XTTA 3DH0A 3GUZA 5G2OA 4HAUA 4DT1B 2OZEA 3JQAD 3T5PA 1QFXA 1Z2CA 4H15A 3D6UA 3ZI0A 4BFXA 1F2DA 1MW8X 3CLSC 4I55F 5KSPA 4AG3A 2JKYA 3CUEF 3MW8A 2OPBA 3N8KA 4RZ3A 2I71A 2VDVE 2EFDB 4YT8A 4ZHQA 3DOJA 1WMDA 2FA9A 5CM9C 5HF5A 1X7WA 1AC5A 3QUBA 1H9BA 3HGTA 1S5PA 4PGAA 1L1FA 3BWBA 1THGA 4IIEA 2ZYSA 1FUUA 2NVUA 1CRZA 3AKYA 3VU0A 1UMDA 3M49A 2CDRA 3QW4B 1UK9A 1E9EA 3EW9A 3GVIA 4ZVNA 3ROTA 4L6CA 4BGIA 2AXQA 1NP7A 3ZUPA 3ASZA 4TWJA 3A04A 1QK5A 4WW0A 1I2MA 4JODA 1Y4ZA 3VHQA 4N3AA 3J7AC 1NVVQ 1S7GA 4KGVA 3ZPXA 4BTVA 1SBZA 3B6ZA 4II2A 4QEZA 2I3BA 3H2HA 1H23A 4UD2A 3W1EA 4CLDA 6Q21A 4U0JA 2WIDA 1W85A 1QWOA 3QFFA 1MFZA 1WIWA 3EZXA 1FXWA 2VLBA 1XKLA 1BU5A 3VJKA 2FB9A 1QVVA 3FSGD 4LECA 2GVZC 3AXSA 2JLAA 3RFUA 2BP7A 1VLVA 1YK1A 4G1FA 5KEIA 3U7GA 2VQ3A 1U7XA 3ANMA 1PGNA 4NBTA 1DLIA 1L5GB 5ELXA 2C5AA 2ZRKA 1BU8A 3IJ5A 2HCJB 4ZV9A 2X19A 3TGWA 3HCRA 4YDSA 3AR6A 3HM2A 5KNCH 5IKMA 1LGYA 5HUJA 5CTJA 5EHGA 1WB4A 2VSYA 2TS1A 3IE1A 3WB0A 1E7WA 1U3WA 2FZCA 5LP6C 3C3CA 1J2RA 1HQDA 4DJAA 4IIBA 1XTPA 3NTRA 4OHPA 3TNDA 4PYKA 2C29D 4LJ8A 3WMEA 3AOEC 5IZCA 3WAJA 4L22A 3AG5A 4LDAA 3PLRA 3V8QA 2Z04A 1W2GA 3C48A 3P71T 1U9CA 4NWIA 2CLCX 2E87A 2PAAA 1CE8A 4HJRA 3COPA 1F2VA 3EGWA 1KWKA 1IOVA 4ERXA 4F3NA 2VJPA 2OD7A 2D5IA 3NANA 2DH5A 1RRVA 1NXPA 1QRSA 4XQCA 4ZCQA 4ZIRB 1ML3A 2VP5A 3FLEA 2V3CC 1CLEA 2BJVA 3KTAB 1U28C 2OY0A 3AUJB 5E0KB 5CFLA 3TECE 4GLOA 1OT3A 3O4VA 1GN8A 2I1VB 2RHWA 3V8BA 5KX5B 4MDEA 3CRRA 2R6HA 1BQEA 3P2JA 4IIHA 3C3JA 4RKWA 4UVDA 5DRYA 4D42A 2HHHB 4PY2A 1YR8A 4C6SA 5KPDA 3Q11A 3U4QB 4JLWA 4QEDA 1G9XA 1FSPA 3GRVA 3QWHA 1JHXA 1GG9A 1OASA 1P0QA 2WG2A 4OGFA 1RP1A 4XX1A 4DCTA 4RVNA 1JJFA 2V9ZA 2O2EA 2DFPA 5M29A 1AMOA 1G18A 1XNGA 2H92A 3AL2A 2CJYA 4OD0A 4EUEA 4WACA 4B4UA 4EJSB 2ADOA 3PQ4A 1I6MA 1F4PA 4FKMA 3ET5A 4C7OA 2H8KA 3CG0A 3GFRA 4IGKA 4BVKA 4K46A 5JZOA 5FTMA 1JNYA 1TADA 4YRDA 1KARA 3KVYA 3WGNA 1H2HA 2GXQA 5TX7A 2I2XB 1E5QA 4Z1OA 3O4IA 4PEVA 4FLFA 3WK7A 1FX0A 3KAPA 2QMZA 3ROQA 3H3JA 2HIMA 1VHDA 2OCDA 1MPTA 1O87A 1JPUA 2OCPA 4KPGA 2DZDA 2VDQB 4C05A 4Z4HA 2PMBA 2VYNA 2FH5B 1R9MA 1RLIA 3L01A 2VXYA 2RI6A 2ZJ1A 2H7CA 4C01A 1XZGA 4CEIB 2XGOA 3UTDA 3ZGXA 2UZ4A 3DO6A 4ZRNA 4PC1A 1OH8A 1OLXB 1WV1A 4HDSB 1A50B 2HDWA 2XECA 4HGNA 3RI3A 1OTYA 1WBJB 4CM9A 5EE1A 2OM6A 1BX1A 5HS6A 3KE8A 1EX1A 3CX8A 3ZDCA 4NH0A 1ZUIA 2ZRIA 3MVEA 3NOXA 3PXGA 2EDCA 4M54A 1ISMA 3D31A 3SXUA 2ORYA 1V47A 4BBJA 1WZCA 2K6GA 1IUPA 2WSIA 3LZDA 4MV9A 3FPAA 5D2CA 1CZLA 3IR5A 3LL7A 3T61A 2PWBA 5FL7A 4ND8A 4U7JA 5IXYA 1DJNA 2FEPA 2YVQA 3BDIA 2A7QA 4DV5B 2JA1A 3HKBA 3BIOA 5EZ5A 3IOEA 5KNBA 1I4EB 5THKA 1GPH1 3O38A 3R23A 4IIXA 4Q4LA 4C20A 4FSDA 4OHOA 1M67A 2GD6A 1G66A 4BMOB 1JBKA 3NT2A 3OZ7A 4QGBA 4M9SA 4MJ3A 4BQNA 1JTFA 4AJIA 1CR1A 3GPLA 1MU0A 1VG8A 3F8SA 3KKNA 2R86A 3G7SA 1N0WA 3F74A 1TNDA 1I1OA 3NHAA 4NJOA 4NV3A 5EMNA 3WYCA 2XB2A 1Z15A 2IS4A 2OCYC 5H82A 2AOUA 4FFBA 4B3FX 5E1MA 1T5TA 1VQ1A 1HE2A 3KTDA 3PJRA 1T2NA 3DE6X 2GA9A 4IFTA 4FB4A 2KLBA 4GNRA 1EHYA 1CIJA 3PRYA 1T9GR 5F2EA 3ZCUA 1FJHA 3A06A 3VR6D 5ALTA 4XWWA 1UODA 3K0HA 4P4SA 4QXPA 3SZOA 3FNEA 4TQUS 1R5NA 2XUHA 5I4BA 1OV6A 2IDJA 2O3JA 4GP9A 1N2CA 5K0ZA 3C16C 3G59A 1IAQA 5H0IA 4QBFA 3B6EA 3I37X 4MO2A 2QE7D 4X1IB 4Z9FA 3PHBE 4F04A 1F2UA 4O2AB 1OIWA 1Z6TA 4JXJA 3TSWA 2HQ1A 1Z16A 2RHGB 3OJWA 2OK8A 2E5LB 1F1JA 2FGJA 2ROQA 3UM9A 5KQRA 4HB3A 3E9QA 1SVIA 3WB1A 1O6GA 3QA3E 2BMFA 3VQTA 3PFKA 4IHKA 2BDTA 2GLUA 4IXTA 1N0IA 2NU9A 3Q9LA 5ESWA 2QTVB 2X6RA 3ZWBA 5CA1A 5F23A 3KG2A 4KPEC 4GR4A 2XBUA 4RY0A 5EJFA 4PZUA 5FOXA 1T2CA 2CF5A 1MGPA 1A7JA 3BHJA 4M3NA 5TEWA 4BLRA 2VPZA 4RKFA 2J09A 1MOPA 2ODPA 4MEBA 5AFSA 3DE1X 5KWJA 4MDYA 3BL6A 1T6YA 2FPGB 2OHVA 5CJ2A 4YONB 3C4QA 2QK4A 4QXAA 3SLKA 1WLSA 2AN1A 2YVAA 1FMLA 1LW7A 4GYWA 5DTRA 5HE8A 3TBFA 1D6JA 4EZEA 3NGMA 2RGNA 4FQ7A 1CQIA 1IUNA 4AMUA 2LGJA 5BQOA 2C2YA 1TB4A 4ND6A 3SJAA 4PGGA 4G89A 4I5IA 1M2VA 4QSMA 3X1MA 2PBFA 2ZBGA 1HDRA 3DO8A 4Q02A 3KE9A 3LUKA 3I58A 1T0JB 1FQOA 3ONFA 4Y6GB 3T35A 2QT0A 1H3FA 4R5MA 4WESA 3UHOA 4DB4A 1KAEA 2BZSA 3B7PA 4IJ5A 5ETJA 5EZYF 4ZU3A 1RE1A 3RIHA 1ZESA 5JRDS 1ZL0A 4F92B 1KOLA 1LK7A 1RYHA 1SZDA 3FPBA 3RS2A 2I6FA 1OXMA 3KU4A 3O2SB 2NAFA 4J75A 3ZEAA 4JKOA 3WKEA 3R41A 1PNQA 4HP8A 1W49A 1E60A 2ZYDA 4YO8A 4IDBA 3I5UA 1FQJA 1HFKA 2P6MA 2VHZA 3ZYZA 5GVSA 2OQRA 3QHPA 2JI6A 4YECA 1KRXA 3P5SA 4EA9A 2WM9B 4OI1A 1X7DA 3TMYA 3BK7A 1G8MA 1JZSA 3GWZA 3VR4H 2Z9CA 4WRRA 3LKZA 3KDSE 1GCUA 4C7JA 1T4BA 3VV2A 2KMLA 3ZOZA 2VJNA 1XVUA 5EPEA 1NKSA 3SVTA 3KC2A 5E38A 5ICFA 1Q44A 4I0WB 3RW9A 4C6HA 5IK2D 3KJXA 3OPYA 4RNCA 3FUWA 3N0RA 1XOIA 2YY6A 2YCLA 3Q3GE 4Z9AA 3HCAA 4MR9A 1U0FA 1W4ZA 1DQRA 1EP1B 2OBFA 1E2BA 3TL6A 4IQGA 1K5GA 1N2OA 4WKPA 5REQA 1LTQA 4MXDA 3DFMA 2BMJA 4LHZA 4A7PA 1YB2A 1JHRA 2QD3A 1TKBA 1C7ZA 1V1RB 2XB9A 3H7IA 4NCJA 3W5UA 4YAEA 4LSWA 1Z0UA 2X0IA 2C7OA 1MW9X 1XU7A 3MXTA 4A6DA 4OJYA 1K06A 4PFSA 3WVNA 3I72A 3ZCTA 4JYZA 1S3IA 4QA9A 4QLBA 3B82A 3R6LA 2VJMA 4FJ1A 2REQA 1WOYA 4FZ3A 4RYLA 2YWHA 1DV2A 3G5MA 3LP8A 621PA 4AKIA 1I7PA 1V1JA 3EAGA 1NYTA 1U0RA 4Z3KA 3I6BA 5CX1A 4YWJA 4EG1A 4RCYA 3U40A 1QONA 1A3CA 1LA2A 3EIUA 4KSBA 2C7RA 2I66A 1PAUA 4W8GA 1N5MA 3X2EA 4MTCA 2IV2X 2O59A 5E6UB 3C43A 3RVPA 2VWGA 2B0JA 3D1LA 4HWTA 4QGFA 1WUTA 1OWOA 3WSWA 4LK3A 1K66A 1GRVA 1KAMA 5CRIA 1UZNA 5LYJA 2O0JA 3A3OA 2D1SA 3QE2A 1DKMA 3D7LA 3I3SR 4G8DA 4NMHA 3X1DA 1X1SA 3OC0A 4KUEA 4BMVA 1E9DA 1U99A 2QJOA 2WHPB 3TFOA 1RXUA 4QBHA 3TQTA 2ZRPA 4DCOA 3N2GA 4YALA 2GD1O 4LSMA 4J1SA 4PGFA 3CFYA 2WUWE 3C6MA 3GZNB 3QIAA 5KTYA 2OV4A 1EE1A 1OBFO 1UKBA 2FKNA 5E6RA 2YFHA 5FUMA 2WA1A 3BT7A 3ZJUA 1IZ7A 2WSSD 4H59A 2CV1A 2Z3VA 5EJAA 3R3YA 2QTZA 5AJZA 3OEWA 4M8LA 1Y1LA 1OY1A 3LJKA 3U6BA 1BHSA 2ZYWX 1VKRA 2QORA 1JVSA 3U4GA 3OZFA 2AH5A 3AW8A 2PSEA 4GUAA 4JLVA 1Z7YA 4P8RA 2H1IA 1M2FA 1GO2A 2P90A 5CDFA 4FPXA 1OBVA 3DHNA 1YI0A 3U4DA 2ZW9A 1R66A 4AN0A 1WHSA 3FTDA 3H5OA 4DCSA 1RHRA 3EWNA 4ZYLA 2ACKA 1TUEA 2HSWA 3TINA 4DSUA 4RK0A 1B42A 2H0AA 3KVRA 2RGAA 3FKSA 3WNVA 2HC9A 2BM8A 3T0IA 4CKBB 1J25A 1IK6A 1L5FA 5CCBA 2O0MA 4TMTA 4ZVTA 3U7QA 3QYJA 3WRWA 4E22A 5F98A 2Q3FA 2ZJOA 1AGNA 4LJ5A 3UVEA 3CKMA 3IUPA 4NZYA 2ZEJA 3WMWA 3B6KA 1N7IA 3D2BA 2VEDA 2XUAA 3LSYA 4IJ6A 4QJ5A 2JLBA 1OOEA 3V4SA 1TF5A 4FWTA 4W5NA 1AN9A 3DLAA 4I6JA 1KZ4A 1GZDA 2CNWA 3MQ4A 4PC6A 5CGQB 4OVKA 5CG2A 4K05A 1OZFA 2NTYC 1C7RA 2WVGA 2X5OA 2I76A 3ZLUA 5IABA 3SHOA 3H6KA 2C4VA 3FFWA 1M83A 3G2MA 3OPXA 4HRVA 1I7QB 4KQGA 2O8DA 1XMJA 2LDBA 4L15A 3FFTA 4EY6A 1VMAA 3QE3A 1QRUA 1Y5LA 4HHEA 4GM4A 4HQNA 5EN4A 3UYLA 5JCOC 5JE8A 4GC9A 1Q1GA 4YPVA 4P5PA 2WE7A 4I1UA 2JH9A 1XDZA 3FYHA 1ZK4A 2NO4A 4HUQB 3TSYA 1N5LA 3OJFA 3QXXA 3T4UA 3FPJA 4MHSA 3UUEA 4Y1FA 3WTBA 2ZZNA 1PF7E 3K1ZA 2AJ8A 4S12A 4Y2JA 4BVHA 5UKDA 1A8UA 3ND9A 5JYCA 4C29A 1X7ZB 2VF5X 3LX6A 3P8ZA 4KHZA 4CMEA 4CEJB 1E32A 4OK3A 1O0BA 1SOWA 2YV5A 3MFQA 4C0LA 1RM0A 2ZTLA 3IQEA 3O0DA 4LBVA 4UCQA 2AG6A 3HJAA 4RTQA 2UVQA 2UUAB 3GG9A 1Y9ZA 1Z4QA 4BTEA 4YCCA 3RFCA 4F4HA 3K6SB 2IXBA 3F1LA 1Z62A 3NVAA 3TPFA 1X1CA 4DLUA 4B87A 3WMFA 4N5IX 3ZD7A 3S68A 3RR2A 2X0FA 1YBFA 4KYIB 4GP6A 5T4BA 1FRQA 2V7XA 2OYCA 1JAXA 4Z4GA 2NT4A 2K5UA 1KS9A 3S2UA 3VPGA 3NYIA 3V1MA 3OH8A 1ZGBA 3ASYA 3LK6A 4TRJA 3VX3A 3NU1A 1WABA 5JS7A 5E4YA 1V6SA 1ZHFA 3OIGA