5CG1A

Crystal structure of e. coli fabi bound to the carbamoylated benzodiazaborine inhibitor 14b.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
247
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic insights into the structure-activity relationships of diazaborine enoyl-ACP reductase inhibitors.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
total genus 91
structure length 247
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5cg1A00
4Z9YA 4D44A 4MIOA 3E9NA 4O59O 3WJ7A 1E6EA 1BW9B 2GN8A 4UULA 5TQVA 2ZCVA 1VPDA 4E5YA 2AG8A 3HSKA 2VZ0A 2W2LA 3LC2O 4W7HA 2JL1A 3WTCA 2ZTLA 3PHGA 5I8ZA 3EAGA 3GRKA 2EF1A 3GK3A 2NQ8A 4RF4A 2YFQA 4K26A 1GUFA 1MC4A 5TJ9A 4LSMA 3HHPA 1P1JA 1PJQA 1XKQA 2WM3A 3ZI0A 2VOEA 4IXTA 3F6YA 1B8PA 4EI2A 2QYTA 3INGA 5L7WA 4E21A 1A71A 5IDXA 3D5TA 4ZQEA 3WG9A 3PDUA 2I66A 4FOOA 4I5GA 4IJWA 3ICCA 4YJFB 1TB4A 4FIZA 5LDGA 4KWHA 4LVCA 5BNIA 4FBGA 3JQBC 4DLLA 3GC6A 3RFXA 3OJ0A 1V6AA 5JAQA 4XYEA 3OA2A 1OAAA 4PRLA 1YL6A 1I30A 3BA1A 3KEQA 1NVMB 1S7CA 4MO2A 3U9LA 4FJ0A 3CUKA 5G0TA 2OORA 5JCXA 1SEPA 2Q2VA 4P4NA 1JKIA 2Q49A 3GGPA 4J2OA 2V6MA 2J5QA 3UGKA 3GOHA 1R15A 3E18A 2HJRA 2FPPA 4IBOA 2AA3A 2AE1A 3WGTA 3TZQA 4IQ0A 1MG5A 4DYDA 4KTTE 3TSCA 3A28A 2PY6A 1LRKA 3H8VA 1PL7A 3WB9A 1GL3A 1T25A 5DBFA 2GASA 1R66A 4MVJM 4ZVVA 4EJ6A 2NACA 3EYWA 1YONA 2OL4A 5G2OA 4TSKA 1GZ3A 2W90A 1GEGA 1U8XX 3I9OA 5JDCC 5DCYA 4DL9A 4MKZA 2WEKA 3X2EA 4Z6KA 1HE5A 3SX2A 1BGVA 3CEAA 3W1VA 5B12A 3WBFA 5JAIA 1P45A 2IYPA 5IJZA 1FDVA 1JKJA 3AM5A 1CWUA 3C8MA 2F00A 1D8AA 1NHWA 3I9KA 4BGEA 1PQUA 1P1HA 4J43A 1FJHA 2PZKA 5FI5A 4ND5A 4W7IA 3HDYA 1DRUA 2EG9A 4YT4A 1XCBA 1DSSG 3V5NA 1V3VA 2D8AA 1C0KA 4E2YA 4MIEA 3VH1A 3DQPA 2O3JA 3HE3A 1MXFA 1LRJA 3LLVA 2DTXA 3FTPA 4XYGA 1QRRA 1MFPA 1JTVA 2VRBA 4II3A 4PG7A 4C7KA 4MPDA 2FY8A 5BT9A 2RHCA 1YQXA 2ZTVA 3AI2A 3T7EA 1Q1NA 2A92A 4AJEA 2NTJA 3I4CA 1J0XO 4U6SA 1N1GA 1NPYA 4PIVA 3V2GA 4FFRA 3H7AA 1LQUA 1I3KA 3I9MA 3RJ9A 4D0SA 2NVWA 4NJOA 1QYDA 3RBVA 1QV6A 5EESA 1UXHA 3GVPA 4L9RA 1NXQA 3WIEA 4INAA 1Z73A 2D0IA 3JD1A 2YV2A 3JYQA 3DAFA 5A02A 1Y9EA 4CLOA 5JPIA 2JHFA 3I52A 4NHEA 3GDFA 5L9AA 3M2TA 3UCEA 4NQZA 4ILKA 3VKVA 1OC4A 2I3GA 3ZNPA 4B8ZA 1QYWA 3H2SA 4CR8A 3QP9A 4W4TA 3PQEA 3ZWVA 5BSEA 1DRWA 5LC1A 1DIRA 1YRLA 1Z7BA 5JLAA 3QE3A 4UUNA 4RPJA 3GG9A 2GUGA 1HL3A 4BO4A 3ZW9A 1NX6A 3JYPA 1T1SA 4M1QA 3SJ7A 3PLNA 3C7DB 4EEZA 8ADHA 1EVZA 2DBZA 1KYQA 1HKUA 3ZWNA 4RVFA 1PQPA 3PWZA 3HZZA 3ROMA 1ONNA 4MVJF 2O3TA 3CPSA 4E6PA 1FDTA 5A4DA 1C1XB 4IS2A 2D1YA 1NAHA 4NK5A 3IQDB 2I76A 3GMDA 3KO8A 4CM3A 2PA3A 3RUEA 5COQA 3I4FA 4TVBA 3H4VA 4PZEA 4Y6RA 1B14A 4BNGA 2GSDA 4U6QA 3H6KA 4DQVA 4B7UA 4BQRA 3GHHA 4J4HA 4ZU3A 4LRTB 1PTJA 5IDWA 1YB4A 5CDTA 3GFBA 5AVOA 1AE1A 1ZSNA 4P22A 1NP3A 3VPGA 3QWAA 2AMFA 3WLEA 3S55A 4MVJI 4F46A 3M1AA 3VH4A 4P38A 1UZMA 1TA4A 1W73A 3SC4A 4LN1A 3WFJA 3MJ4A 1RYEA 2FN7A 4XYLA 4WPGA 2EGGA 2OO5A 3PQDA 2VT2A 4YEDA 3WYEA 4BKPA 2R2GA 3B1JA 1LTHR 3HB5X 5B4TA 4OSOA 4BVAA 2GERA 3IS3A 1JAXA 4UUOA 4WEOA 1I3MA 4ZQGA 1UZLA 1KVRA 5IFLA 1RM4A 1HDCA 3FCOA 4RVSA 1BTOA 2BLLA 2BI8A 3WSVA 4CMGA 3AUUA 1C0LA 1HSZA 1P1IA 4CMHA 1HYGA 4IXWA 2YFHA 1ZXBA 3RC2A 4BNIA 1HZJA 2VNAA 3QVOA 4NPCA 3ST7A 2E6UX 4E32A 1LDGA 2C5EA 4CLOB 2RCYA 1HWYA 3JQ8B 4PG6A 1Y6JA 4O0LA 3OFSA 4AJOA 1XQ1A 3FNEA 2FSSA 3GF4A 1QYXA 1NR7A 1M6HA 4UUMA 5H82A 1LXCA 4BNXA 2NSDA 3MTGA 4PLWA 4G81A 4GMFA 1F17A 1KVQA 3C7CB 4NK4A 3WJAA 3AOEA 1QSGA 1Q2XA 2YUTA 1KIFA 1M66A 5HS4A 4D7AA 5KKAA 3INTA 3KETA 2ZJ0A 2Y0DA 1CEQA 4RQUA 5JE8A 3GZNB 4LCEA 3AWDA 5JDIA 5JC1A 4PLTA 3WSWA 2EXXA 3DO5A 1U1IA 3F46A 2X7HA 3OSUA 2AE2A 4OSPA 1WPQA 5AXCA 2WSBA 3GZ4A 6LDHA 3KTDA 5BQFA 5I7SA 4JJGA 2AXQA 1AN9A 5DOZA 4NBRA 4YAJA 4I1IA 3D7LA 2AQKA 3TDKA 4HFRA 1VM6A 1AUPA 4M54A 4BL5A 1LSJA 1E3LA 4Z0PA 1DC6A 3KXDA 2IODA 4R1SA 4OH1A 2VZ8A 3PHIA 1NM5A 2FSVA 4G2NA 1MX3A 3FI9A 3OQ6A 1LJ8A 4J90A 5TT0A 5I8WA 1KC1A 5F1PA 2QRJA 1ZVMA 3HUDA 1PGPA 5A9SA 2Y1DA 4JP3A 1L7DA 4B79A 2DFDA 4Z9FA 4W99A 1N1EA 1A7KA 1MA0A 1P1RA 3W4KA 1YXMA 3GQVA 3QVTA 1Q0HA 2HDHA 1GQ2A 4DIFA 2FR8A 4FDAA 4E5PA 4BNLA 2NUAA 3L07A 5EERA 3FBTA 4R16A 1KC3A 2PD3A 3JQAA 4RF2A 5DDIP 3AM3A 2IXAA 3ITKA 2YQ4A 4PLFA 1ZFNA 4IGFA 4DRYA 1QKIA 3ZHZA 2ZTMA 3LK7A 4GH5A 1Z7EA 2JD1A 3BHIA 4IDDA 4BO0A 5GZ1A 1TEHA 3F3SA 4A73A 1DFIA 2VWQA 3ASVA 1N2SA 2HO5A 5COBA 1Z6ZA 1PGNA 5EINA 1I3LA 1P31A 3TQHA 5AXAA 2VQ3A 1ML3A 5CDYA 3I6QA 5L51A 2AW5A 2J8ZA 2VRCD 1BDMA 4Z9XA 5ITVA 2CD9A 1A27A 1NNUA 1V3TA 2FMUA 3K92A 4JGBA 4ZRNA 2B83A 3MJTA 4D45A 1X0VA 3D3EA 5KCZA 4TMFA 2SCUA 3DDNA 5IN4A 2OBYA 4CM9D 3H5NA 4J3FA 1E7WA 3FTNA 3UUWA 2DC1A 2VZ9A 4PLPA 3RUCA 4QFDA 1R6DA 1A72A 3OJOA 1GU7A 1FDSA 1I2BA 3TZHA 1XQ6A 1C1XA 3GNSA 4UVEA 4OOEA 4XD2A 1BW9A 3BIOA 4DPMA 4IQGA 1DC4A 3K2BA 4Q3CA 4JP2A 3QLJA 3ETGA 1KEUA 1QV7A 4B3JA 4CM4A 1E5LA 3K8ZA 4YJHA 3VDQA 3EHEA 1IUKA 3GDGA 4IINA 4CJXA 4P4GA 1Q0LA 3AFNA 1YDEA 3PIIA 3ZWAA 3BTVA 3EY4A 4E0BA 3GH3A 1V35A 1HSOA 2VUSA 4CV0A 5KJFA 1ZSVA 4BO8A 4PFJA 1ZEMA 1ADCA 2PH3A 4S1VA 1CF2O 4IJUA 1DLJA 3E8XA 1CERA 3VVCA 3O03A 4OOFA 3JSAA 4ND2A 4WOJA 1WP4A 1K0UA 1YE3A 4BKOA 4CM5A 4RPKA 5KJEA 3C3XA 3KUXA 4Z0TA 2ZK7A 1G0NA 1KS9A 2A9FA 2P4QA 1ZCJA 3U49A 1M76A 2E48A 5EPOA 3EVNA 2HK9A 2VYVA 3I3OA 3I9JA 5CAEA 3BXXA 1U5AA 2NLOA 4OXNA 4GKVA 4J1TA 4UREA 1KERA 5TF4A 1HDXA 1PJTA 5GZ3A 1IB6A 1HE2A 1SMKA 5ICMA 2X86A 1GYPA 3D5QA 3ZWXA 4CUKA 3UCXA 2GLXA 5FF9A 5IAAA 3AOEC 1UR5A 5T8KA 2AG5A 3TN7A 1H9AA 1T4BA 1LC0A 2O7SA 3LC7O 5K6AC 3WDSA 1WDMA 4DMMA 4NJMA 1ZSYA 3GT0A 1LLUA 3PK0A 4WCFC 4TWRA 5I9LA 1VRWA 2FOIA 3KYCB 3QVXA 1ENYA 1FF9A 1ZMOA 4DPKA 4J7XA 1NQTA 4R5MA 1E7RA 2EWMA 4BO9A 4KUHA 5L45A 1NQ5A 2GN4A 2Q1TA 1ZNQO 4MVJD 4IMRA 4QXMA 2BFMA 4F45A 1RKXA 2BGLA 4XKJA 1WMAA 5T57A 3D3WB 3RKRA 4CV1A 4MKXA 4DPLA 1P3DA 2X9NA 3CZRA 4OXYA 2C2XA 4B4OA 2XXBA 2ZTUA 4TKMA 4AJPA 1JA9A 5EL0A 2HUNA 4KMSA 1U3UA 1R0SA 1TLTA 2IEDA 2JD0A 5MGBA 3MEQA 1ULUA 4GSKA 3SEFA 2EP5A 1D7OA 4XDYA 4TVOA 3IDSA 4TQGA 3PLRA 3A9WA 2XOXA 2J3IA 3JD3A 3K31A 3NTQA 4HY3A 4MOWA 3GMSA 3FPCA 1A4UA 3K2EA 4AJNA 1BMDA 1UP6A 2ZB7A 3WIDA 4CL3A 3ZU5A 3JQFC 3TJRA 4B7XA 4D46A 3HFSA 3KYDB 4WCDA 3WQQA 1IPEA 2C7VA 4B3IA 2DU8A 4I8XA 3RFTA 1C0IA 3BYZA 3OP4A 1PZFA 1QLHA 4HUJA 2AQHA 3WBBA 4GPD1 3WGIA 1RM5A 1Q7CA 2AEFA 1S6YA 4HP8A 3ZHYA 4Q9NA 3FN4A 1PEDA 1KEPA 5TSDA 2X22A 2G0TA 2UV8A 3I9LA 3CSDA 2ET6A 4W9NC 2G76A 3D4PA 4XYBA 4YJHB 3ASUA 3MOIA 2FRDA 1I36A 4FJ2A 5HA5A 5B37A 3TOZA 3X2FA 5KJ1A 4KDEA 3LVFO 1E7MA 2VHZA 3AW9A 3KOUA 3OIFA 3O9ZA 2P68A 3GPDG 3PHJA 2D4AA 1IOLA 1QYCA 1SO8A 4LCJA 2X9GA 1KEVA 4A10A 5G4LA 4AJKA 4E4YA 4GSLA 2WWRA 1NWHA 3OMLA 3ZWYA 4YT5A 3H5RA 3IUSA 4BNMA 4YBZA 3UH1A 2VCYA 3ZWWA 1DAPA 4EEXA 3EK2A 4Y98A 3G1TA 1GCUA 2X58A 4R1TA 4B7CA 4IIVA 1LQTA 4GX5A 1UAYA 2PK3A 1EUZA 4BO6A 1N7HA 4AJ4A 1DFGA 2PD6A 1E1MA 1IHXA 2QIOA 3ETDA 1I32A 4UVHA 2X5KO 4L8VA 3GFGA 4MIYA 2YHIB 1JQBA 2LDXA 3RJ5A 4J91A 4R1UA 4RPGA 3PDJA 2YDXA 1UUFA 5F1OA 3SBOA 1K2WA 3DXFA 1SEVA 3ZGYA 3IKVA 2O3SA 4BO3A 3L6OO 1JKFA 5T6BA 3GGGA 3GN1A 4MVJE 4WUVA 5A05A 3AUTA 5JMWA 1YWGO 3OIDA 3DBHA 4IDAA 5U4QA 5IDQA 3DHNA 1DIGA 5THQA 4PLZA 1O9BA 3DOJA 4FPXA 1HT0A 1GTMA 2NU6A 1ZJYA 2WD8A 4HNHA 3NT2A 4O5OA 5L95A 1EQUA 2GPTA 4XR9A 3T7CA 3WGQA 5KTKA 5A5FA 3VPXA 3NRCA 3OJLA 3ZWMA 3O26A 1D4FA 4JNKA 3L77A 3STHA 4YJGA 1J49A 3K9QO 4KUEA 1DFHA 4FQ8A 4H16A 2EIHA 2Y1FA 4J2HA 5C5IA 3UKOA 1Z74A 4GVLA 4MVJH 4EJ0A 1BRMA 3D4OA 4IMPA 4X54A 5T67A 4GKBA 4J0EA 4BO5A 1DO8A 1EUCA 2ZB8A 3ZNNA 4DREA 1UZNA 4P8RA 3WOHA 4BMSA 3ORFA 4B4WA 3RBXA 5A9SB 2X0RA 1C0PA 3NX4A 3P2OA 1M75A 3LSYA 1GPJA 3WLFA 3NEPX 2OZPA 4ALNA 3KRTA 1PWZA 4ND1A 4BNYA 1CRWG 2VYVD 3U4CA 1PJSA 5F3RA 5CDGA 3C1OA 3OM9A 4BNTA 4NZ9A 1IY8A 1T2FA 5A5EA 4IZHA 3GN2A 5CPFA 4CM9A 3IP3A 4U0KA 1UDAA 3IAHA 3PTZA 2EERA 3QA9A 4U0JA 8LDHA 3N58A 3E9MA 4CQMD 4YT8A 4AJIA 1H2HA 4RPHA 1GPDG 3H9JA 2CFCA 3D4NA 2IXBA 4R3NA 3VPHA 4OJNA 1HDRA 1IE3A 1DJNA 3JQGA 3GZNA 3JYNA 3OETA 3G1UA 2P9CA 3UFXA 3CZMA 4ALIA 1PGQA 2ZB3A 1J5PA 2NTNA 1RWBA 2O3UA 1EBUA 2IZ0A 4HADA 3M6IA 3VZQA 4WE3A 5EIOA 4MP8A 1K6XA 1X7DA 5K9ZA 1R0LA 3F4BA 1EK5A 4RGBA 3ZU2A 5T8KC 3W6ZA 1QYVA 2X9VA 4M55A 4CMCA 1W8DA 4S3MA 3FF4A 3PGJA 1HDGO 2C29D 2BFOA 4O63O 3DZGA 4TRMA 3EZLA 2A35A 3JQ8A 3GHYA 2JJYA 3GUCA 3ZU3A 1HYHA 3WMXA 4D42A 2Y1CA 3O4RA 2W8ZA 3BZUA 4RDHA 2ZJ1A 1B0AA 1H9BA 5GZ6A 2BH9A 1R16A 2YZ7A 2BGKA 2VHVA 4RO0A 2YW9A 3E48A 2CF6A 4HV4A 4CR7A 4J0FA 3TPCA 3KLMX 4UEJA 4CMEC 1BVRA 4NFSA 4Z3DA 5H81A 1I10A 3QW2A 1ZK1A 5FEUA 3C85A 1XELA 4AICA 3TFQA 5IXSA 1XYGA 4RVDA 2NTVA 5AOVA 1R4MB 4CLHA 2VWHA 3M2PA 4JLWA 3JQBA 1HDOA 1PL8A 4LSWA 2WTBA 5L4NA 1Y9AA 1I5RA 5IF3A 4XR4A 2EP7A 2D5AA 1H0KA 1LSUA 4HFMA 4XJTA 5DBGA 2X8LA 1DOHA 3PFFA 1YH3A 3ROPA 3NV9A 3I6IA 3BMCB 4H3VA 4BV8A 2PGLA 3E03A 3KB6A 5ITWA 4NR0A 1I0ZA 5DF1A 3AM4A 2G82A 1NR1A 1MFZA 3S2FA 3JD4A 3OQ1A 1A9ZA 2H5LA 1F8FA 4L4RA 3O8QA 1KOLA 5IZCC 3I5MA 5ILGA 3G49A 1GAEO 4MINA 3H5AA 4YDRA 3HN2A 3ZV4A 1SBYA 1EEHA 2NVUB 3RBZA 3RSHA 4YJFA 4XGKA 4CQMA 1YQDA 2HAEA 1UP7A 4A26A 4D0RA 1ZUD1 4KQXA 2VHXA 1SB8A 2JFHA 3I83A 1TT5A 5B1YA 4RQTA 1RM3A 1K6JA 4Q3BA 1OC2A 5F5NA 3ZHBA 3KHUA 3MOGA 2UAGA 2I65A 4Q3EA 3G79A 4R9SA 1ZBQA 3NDIA 3NKLA 4YQYA 5EQDA 4EDFA 1OZAA 2YQ5A 4ZQBA 4J4TA 1A5ZA 2VNSA 3PYLA 3VKUA 3TZCA 3Q6IA 4N5LA 3JYOA 2X1HA 1LDYA 3IUPA 4KWIA 5C3MA 2OGUA 3VZSA 4RORA 4FFMA 4XRRA 4XGIA 3F5SA 5DT9A 4YVFA 9LDBA 3PZRA 4M89A 2J5RA 3OIGA 4BKRA 4B8WA 1VE9A 2GZ2A 4R68A 2QZ9A 2Y0EA 3UVEA 4E5MA 4CV3A 2X5JO 1O5IA 1SPXA 1R4NB 5CHEA 2X0JA 3PZBA 2B35A 5DCUA 3U3XA 4ZQHA 3BHMA 4XB1A 2V65A 1U2GA 4IM7A 1X1EA 3PFWO 4R01A 3ULKA 3AU8A 3BMCA 3OJFA 2OMEA 1GADO 4DA9A 2DQ4A 3LQFA 1T2AA 2Q1SA 5G0VA 5FWNA 4EITA 3GR6A 3ANLA 1CIVA 3GEGA 3H9EO 1DIBA 4E5NA 1U3TA 4CQLB 4YWJA 2PNFA 1UDCA 1RM0A 1WZEA 1XU9A 5KVSA 1YJQA 3PWKA 1JDJA 2EJVA 3N74A 3V8BA 4CM7A 4NBVA 4J9VA 4R4JA 3DTYA 4TKLA 1N9GB 2O7QA 4L76A 4EGFA 3RROA 1N7GA 1WZIA 2EKLA 4CLRB 3NGLA 2D5CA 3BMOB 5IZ4A 5JBIA 3M1LA 2O4UX 4CM8A 2FPGA 1M6WA 4H15A 3SLGA 1JN0A 5L3ZA 3ZCXA 5IDYA 1XGKA 2CDBA 4RVUA 1JW9B 2J3KA 5CFZA 1F12A 3BHJA 1Q0QA 4CL8A 3NAQA 4OKIA 4I5DA 5FFFA 4WNCA 4PG4A 1GDHA 3OECA 3RKUA 5I7EA 2PD4A 1FK8A 2DBVO 5LDHA 2B4RO 5AQ1A 3KVOA 4ZD6A 2P9EA 3D0OA 2D59A 1ZK2A 1PSDA 2I9PA 1YOVB 4URFA 3I23A 5CDUA 2I3AA 3DMTC 2NU8A 4A5OA 4BS9A 3EW7A 2BGMA 4XJSA 1ZKMA 4UVIA 3LT1A 1M67A 3AU9A 2XF8A 2OOSA 4RV9A 3V1YA 4A03A 1MUUA 2E49A 3W4JA 1YB5A 3PI7A 4EW6A 3AFMA 3P19A 5BSFA 5IN5A 4CV2A 3PYMA 2HLPA 5KOIA 3WNVA 2VHWA 3BMQB 1E1NA 1PS0A 2Q46A 3DMTA 3ETEA 4DIOA 2IE0A 3AUAA 3QWBA 4I9NA 4WCFA 3AY6A 5JYEA 3QRWA 4YAGA 3VH3A 1FDWA 1L1FA 2HMSA 5JMPA 1DDOA 1GEEA 2VWPA 4ALJA 3JQEA 4I5FA 4UEOA 3VPSA 1XSEA 3WYCA 4Q3DA 4EJMA 2C5AA 1T2DA 2Y66A 4TRNA 1ADFA 1CDOA 5TS3A 3BTOA 3MJEA 1X7GA 3R3JA 1RYDA 4IDEA 3PQFA 1T1RA 1WLYA 1K6IA 3B6ZA 4OHUA 3E82A 2DBQA 2BF7A 5DBIA 4EBFA 4RZHA 2HK8A 2O48X 3F4LA 3Q2IA 2H9IA 4YAKA 3JQ6A 4WGGA 2O4CA 3QQPA 4IQ8A 3GNQA 4KOAA 3TNLA 5JY1A 3RCBA 1LDBA 1NVGA 1WDLA 2J3HA 3BMQA 1MB4A 2G1UA 2ZKLA 1PU2A 4A2CA 4WLVA 4AVYA 5AYVA 1HDYA 2LDBA 3K96A 1LLCA 2QW8A 3JQFA 4RL6A 1R37A 4CR6A 3IOYA 1ZXLA 1AXEA 1BXZA 3VC7A 4C7JA 4Y8VA 5JDCA 5ICSA 2Y99A 3WGHA 4KZPA 5T64A 3R1IA 3S2EA 4OYRA 3ROQA 5ADHA 1PJ3A 4XEHA 4CMIB 1C3VA 2WMDA 5L4SA 1VSUA 4I9UA 4QSMA 3W6UA 5TJHA 3DBHB 4R3WA 2E37A 4BNHA 1U4SA 2JCYA 3ABIA 4XCVA 3ADOA 4XWYA 3VTFA 2UUOA 3ZHXA 4AJHA 4D43A 4F6CA 3P7MA 4N5MA 1U4OA 3PVZA 4EUEA 1HTBA 3DZIA 4KDFA 3DC2A 3L4SO 2C82A 2YY7A 4HWKA 4QECA 3KZVA 4CLRA 3AK4A 4CMKA 1J4AA 1GUYA 2W2KB 1SCUA 1H93A 1AHHA 3FNHA 3JQCA 2R6JA 3QWHA 3ZZNA 1E3WB 4OL9A 3PJFA 4KTVE 5DZSA 2G5CA 4PCVA 5A03A 1EQ2A 2PWZA 2Z1MA 4JX8A 4JROA 4MJLA 4CUZA 4D79A 3MJCA 4XIYA 3DZBA 2AHRA 2ZCUA 2P91A 2X23A 3MTJA 1U7TA 4R51A 3L6EA 2FPIA 3BMNB 2J5KA 2IZ1A 2EKPA 2GZ1A 1I33A 1ISMA 2O50A 3CMMA 2Q1WA 3HN7A 3RUFA 4F6LA 2AEMA 4QFCA 1I24A 3H65A 1B3BA 1FXSA 4BNNA 3ADPA 4IJKA 2J3JA 4K9DA 4NNJA 4BGUA 1ULSA 3WGZA 3WS7A 1B26A 4HNGA 2WJPA 1PR9A 1QR6A 1DC5A 2IEBA 3C7AA 3JQ9C 3NUGA 4PZCA 2DTEA 1R12A 2EW2A 5GY7A 5T5QA 3SVTA 3VPFA 1PJBA 2RH4A 3DZKA 1U28A 2EKQA 5G0WA 4WKGA 1PX0A 2GYYA 1K5HA 2BHLA 4GX2A 4LVUA 4R1NA 4WCFB 1VSVA 1T2EA 1Y8RA 1D1TA 1OI7A 1W0CA 2QYSA 3DBLB 4YCAA 5A3JA 4LISA 3OICA 4KQWA 3JTMA 1GY8A 5LCXA 4G65A 1U9JA 4BGVA 2FR0A 4WEQA 1OMOA 3ANMA 1KY4A 4GGPA 3WWYA 2A94A 4CLDA 3VZPA 1ZIDA 1QMGA 4J16A 5COAA 4IDFA 3VVBA 4YJGB 3H9UA 4DYVA 1KBZA 5BNFA 5MDHA 4E30A 3C24A 5CEFA 3HQ4O 2CDCA 2DPHA 1O89A 3AY7A 2WDZA 3PHLA 3OEYA 1BG6A 2JFFA 1SNYA 5G4KB 3RFVA 1E5QA 1E3SA 1LSSA 2ZYAA 4J1NA 4WECA 4L4XA 4FC6A 1JWAB 1E0DA 3A1NA 4UEKA 4BKQA 1VI2A 1ISGA 4BOYA 3QWFA 1EUDA 3JQ9A 3FR8A 5DN9A 1NBOA 3PP8A 3SJUA 4LMPA 4PLVA 5JC8A 4JJFA 2Y0CA 3WR5A 1XU7A 2YHIA 2GDZA 3JYLA 1H6BA 1HEUA 1YVEI 1P74A 1PIWA 2DKNA 3DL2A 2PZMA 1Y8QA 4II2A 4BB6A 3JQ7A 7ADHA 1KVTA 5JXWA 1PR3A 3DBRA 4NJMB 4R69A 3JQDA 2IYOA 3TFOA 4Q3AA 2YV3A 3AOGA 4WOKA 5I9NA 3MJSA 4RVGA 1F8GA 3EGOA 1F0YA 3UICA 3CH6A 2DLDA 1Q7GA 3JD0A 1U5CA 3L9XA 1GV1A 1AGNA 1PS8A 1XDWA 2R00C 4GWGA 4TRJA 4DLAA 4ALKA 4IS3A 2NV6A 4D3SA 2FZEA 1HF3A 2DFVA 1VJ1A 5F21A 5L40A 2OP0A 3DBRB 4YJDA 3MCVA 2C07A 4WLEA 4AFNA 5AXDA 4IPTA 4TRRA 5TX7A 3L4BA 1C1DB 5GMOA 2B0JA 1E7QA 1R4NA 1GCOA 3VDRA 4OGWA 3GAFA 1LDEA 1ADBA 1E7YA 4K28A 2HJSA 3F1KA 3UW3A 5HM8A 1DPGA 1E77A 1DIAA 4YRDA 2CVOA 3B20A 1N8KA 3F47A 4CM6A 1I01A 1YBVA 3H3FA 3O38A 4PLGA 1EMDA 2PGDA 4K6FA 3GEDA 2PH5A 3U0BA 2HMVA 5BR7A 2CNBA 1HXHA 4NIMA 3W4IA 4PLHA 1B15A 4N18A 4XX0A 4GMGA 4E2WA 4E3ZA 4FR5A 4GLLA 4I9HA 5DULA 2E4AA 1EE9A 2Y67A 2HK7A 3U4IA 4GL4A 1V9LA 4J49A 5JDIC 4JCOA 1X1TA 3EC7A 4KP7A 2VWGA 1PJ2A 5BSHA 1E7SA 1LU9A 2CMDA 2ZQYA 2EW8A 4PRKA 4W9NA 4EUHA 1V3UA 3LF1A 1LC3A 1ENZA 3COSA 1JLLA 4FFNA 2PZLA 1NFQA 1ZO8A 5HRUA 3E6AA 3ZDFA 3RUHA 1U3VA 3DONA 4LRSB 3LT0A 1T2CA 2IDZA 3I1JA 4IJVA 1IZ0A 1YB1A 1M2WA 3ROKA 4DIBA 3Q0EA 5ENVA 1BXGA 2Z95A 3PXXA 4RPLA 1U2DA 1P77A 5KWEA 3U62A 1RPNA 2HRZA 1TI7A 3CMCO 3R0IA 2YDYA 2G17A 3B70A 3F9IA 1P1FA 1KVUA 1F06A 4ROSA 1KVSA 9LDTA 4GLOA 1JU9A 4OQYA 3IL2A 4NBUA 5DCWA 1LDNA 3MZ0A 3PRJA 3NYWA 5EMHA 3WYBA 2CDAA 1VKNA 5JCJD 5KJ6A 4QO7A 3Q11A 2BI7A 3TRIA 4D3FA 5THKA 2X4GA 1X13A 4BKUA 2BD0A 2PV7A 3UCFA 4ESOA 1FDUA 4Z3KA 1LRLA 4D41A 3RAJA 3RIHA 2P9GA 5EN4A 2GD1O 1O95A 1R4MA 4ZJUA 4GQAA 4JBGA 3MWDB 4KUGA 1WW8A 3ONFA 3PJDA 4JK3A 4CPDA 1HYEA 1H94A 1N9GA 2X6TA 1UH5A 2IRWA 4ITUA 4U8GA 3ENKA 3QVSA 1UAGA 2WD7A 3ONEA 3LLSA 3FR7A 1OBFO 4U7WA 1LA2A 4ZN6A 1SC6A 5BNTA 1NTOA 4MDHA 1GQYA 4XDZA 3IC5A 5KVQA 3RD5A 4R41A 3SLKA 1HLPA 3ZV3A 4YT2A 4JQCA 2Z1NA 4IGEA 5U9CA 5C7LO 4LMRA 5CDSA 1ISJA 3RC1A 4YTEA 3WX0A 3IJPA 4JXKA 4B4VA 4YRAA 4BNKA 3WXBA 3EVTA 1Q7BA 2F1KA 4GAEA 3EDMA 2O23A 3ZV6A 1C14A 3VAZA 4BQPA 3GVHA 3RC7A 1GD1O 2RBEA 4A0SA 3I9NA 2P4HX 5ER9A 1K89A 1Y7TA 3HB4X 3CKYA 3QWIA 2VN8A 2GGSA 4GVXA 1H6CA 3CIFA 2PKRA 4CMAA 2GN9A 2O3RA 5TLSA 1XLTA 4LK3A 2I6TA 5L7YA 3RC9A 1BXGB 3RUIA 1MGOA 2VTEA 3UXYA 3HJAA 3E5RA 1XHLA 3W8DA 1KY5A 1ZK0A 2E82A 5DP1A 2Q50A 4OIMA 4RF3A 3RI3A 2CVQA 2I67A 2IZZA 3EMKA 4XGNA 2Q2QA 4RJTA 1BHSA 2OFPA 3KYBA 3H9QA 1DJQA 4OAQA 5DP2A 3GY0A 3ZV5A 4ZICA 4BGIA 3PGXA 3INRA 3S8MA 1Y5MA 4UAGA 3FBGA 2VUTA 3DZHA 4PN3A 3PEFA 1UJMA 5EQFA 3VTZA 4Q39A 3PIDA 2HMUA 1B8VA 1UXIA 1MLDA 2X0IA 4DWVA 4XIJA 5KVVA 1B8UA 4J9UE 4Y67A 5G4KA 5JO9A 4DVJA 4E12A 1LBEA 3FWNA 3SXPA 3P2YA 3HFGA 5DOVA 1DIHA 1JWBB 1H6DA 4W6ZA 4MKRA 2PTGA 3PPIA 5CP8A 3L0DA 4QUKA 4QX6A 1ZZEA 4BO2A 5JFOA 4DXHA 1H2BA 3NTRA 1JAYA 4YACA 5A04A 1OOEA 3HDJA 1DLIA 4J6FA 5HS6A 3A06A 3WQSB 2BKAA 4TZKA 3VH2A 1E6WA 1SOWA 5ER6A 1ZMTA 4E5KA 3NJ4A 5A06A 1A4IA 1TT7A 1ZK4A 3DBVO 4O6VA 4QEDA 1P9LA 4QQRA 1NASA 2B36A 1ZK3A 1Y1PA 2JAHA 3GG2A 2JD2A 5DNAA 3T4XA 1YOVA 4AJ2A 1EVIA 1ONPA 4FGSA 1YL5A 4HX5A 4GGOA 2C59A 4GI2A 4NMHA 2ZQZA 2O2YA 4MVJG 2B5VA 1HZZA 4QTZA 1EE2A 4ZHSA 3ON5A 1MG0A 1AHIA 3E9QA 2VUUA 1IYZA 4L74A 5F1KA 5IXYA 2EV9A 2ZIZA 5KJCA 4ALLA 2I99A 2X0NA 1SZJG 2YYYA 3KYCA 3JQ7B 1NYTA 4N7RA 3BMOA 3JCZA 4JBHA 3S2GA 4UVGA 4CUJA 3E5MA 2B5WA 2QQ5A 2XXJA 3GUYA 1SAYA 4ND4A 5G0UA 1T24A 3GVIA 3QY9A 4PLYA 3U5TA 2CZCA 1AXGA 1E6UA 1O6ZA 2RHRA 1CJCA 4M87A 3FHLA 1A9YA 1MV8A 4Y9DA 5L53A 3DHEA 4L73A 3CE6A 4MVJP 2YJZA 2V7PA 1NAIA 3B1FA 2WE7A 1BDBA 4YPOA 1MC5A 4CMIA 4HFJA 3D1LA 4WLFA 1YL7A 1E3WA 3L4BC 2W98A 1Y5RA 2WD7B 3ZN2A 3UAGA 4C4OA 5CPBA 4D3DA 5TT1A 4FFLA 2W2KA 4BNUA 1GYRA 2Q1UA 3DHYA 1LUAA 1D1SA 2DPGA 3NT5A 5KKCA 4NH4A 5JY6A 1ZJZA 4XA8A 2B69A 4FD3A 1PGJA 3RUAA 3LZ6A 3GPIA 5K0ZA 2GN6A 1CQIA 5IG2A 3LT2A 2B37A 5HWSA 4R9RA 3NJ8A 1P1KA 1TVEA 4JJIA 4E13A 1XWFA 1Y8RB 3DBLA 1G0OA 4NFYA 2UYYA 4BMVA 5TIIA 2Q4EA 3NDRA 3RVDA 4L4SA 3D3WA 1O94A 2NQTA 2Z5LA 3JQAD 3GGOA 3KSDO 5BSGA 3BAZA 1L7EA 4AJ1A 1W6UA 1B7GO 1SB9A 1HRDA 3FSRA 4YB8A 4ZGWA 3IP1A 3LF2A 4BO1A 1SOVA 1X7HA 3FNGA 3V2HA 3WFIA 3ICPA 3JD2A 5L7TA 2PZJA 1U8FO 2P5YA 1BVUA 3QIVA 1WDKA 2Y1GA 3FNFA 3CINA 3ZW8A 4PVCA 4LGVA 5C7OO 4H7PA 2V6FA 1I2ZA 1N92A 2UDPA 3T4EA 3JQGB 4QT0A 1DXYA 1VJTA 4J1SA 4IUYA 1IHYA 3HWRA 1YO6A 1B3RA 4CQMB 3PWSA 1MXHA 2H1SA 2TMGA 4EYEA 4K6CA 3AI1A 2VYND 2EEZA 1GFSA 3QVWA 2B4TO 1HLDA 1XR3A 5TRTA 2GCGA 5CEEA 3GLQA 2CUKA 3FPLA 4O1MA 4BNWA 3CXRA 4GX1A 1JVSA 2EJWA 4IY1A 4PGFA 3BTUA 3W8FA 4F3YA 2PLAA 1LSOA 3KM0A 1NFRA 4ZQFA 2GZ3A 1DHTA 3DWFA 2JHGA 3HADA 2QZZA 5AXBA 2C7GA 2Q2WA 2DUUA 2DAPA 4P4LA 1EZ4A 1NHGA 1K3TA 2GNAA 3OBBA 3RU7A 5A3VA 1VL6A 3TL3A 3F1LA 4HBGA 1KETA 2BFAA 3NT4A 3KEOA 1WMBA 2CY0A 4OM8A 3GEMA 1GR0A 3OA0A 3U4HA 3MWEB 4AL4A 3MJVA 1YJ8A 2RAFA 4CLEA 1YQGA 4OO3A 1PJCA 5G0SA 2AQIA 1RJWA 4YQZA 1D3AA 2QG4A 3S1LA 1WVGA 4WASA 5A9RA 4L75A 1WNTA 2CSUA 2O3QA 3HDQA 1DBVO 1IULA 4YXFA 2DBRA 3V2UA 5TGDA 1KEWA 3G0OA 5A9TA 2CF5A 4Q3NA 4UVDA 5EJ2A 4FFOA 1IZ9A 3HNPA 4Z0HO 2NNLD 1NWCA 1P0FA 3D64A 2Q3EA 4I08A 4WLNA 3LT4A 2FHSA 4HXYA 4BIIA 5TC4A 3OH8A 3DFUA 2PKQO 3QV1A 4FOSA 3DTTA 4FS3A 1QG6A 2FWMX 2DUWA 2DTDA 3JV7A 1DHRA 4I5EA 3C1AA 1BSVA 2DM6A 3EZYA 1U3WA 4XB2A 3OJEA 3DZFA 2Q45A 4M49A 3Q3CA 2O2SA 3PYXA 3ONDA 4JBIA 4RCVA 5JSFA 1NVTA 4ZRMA 1GV0A 6ADHA 1O0SA 1X15A 2QRKA 1VL0A 4XQEA 2B4QA 1ONOA 5HBRA 1R0KA 2AQ8A 3VOSA 4HKTA 2V6BA 1PZHA 5U1PA 3IJRA 2W4QA 2WYUA 4ONEA 7MDHA 4WNIA 3G3EA 3QHAA 2C54A 4JN6B 3W8EA 4OQZA 4CQLA 3DMYA 2VHYA 4M86A 4G5HA 1EK6A 1ISHA 4PLCA 1EFLA 1W4ZA 1Z82A 3PJGA 4AJLA 1GZ6A 5FI3A 1QORA 5JW6A 4NG5A 1ARZA 2ZYDA 4B4UA 4BB5A 4ND3A 2C2YA 4E33A 4BV9A 1PZEA 1XA0A 1NPTO 5I9MA 2BRUA 4DUPA 3NTOA 4YAEA 4EUFA 4WJZA 4ZA2A 2TMDA 3TWOA 1H6AA 3Q1LA 3NDJA 1WXDA 2JCXA 3DZJA 4FW8A 4ID9A 2HKIA 5ENDA 1PL6A 3WICA 2HMTA 4DBZA 2UUPA 3G17A 2VOJA 4BNJA 1EVJA 4AG3A 5B4UA 1E1LA 3H3JA 4CODB 4MP6A 3TZKA 3PJEA 1XEAA 2VT3A 1ENOA 3A4VA 2Q99A 2PGJA 4BHTA 2XPCA 3DEYX 1QLJA 1JVBA 4EZBA 1IPFA 2NVUA 4GX0A 4CLXA 4K1LA 4OMUA 1U7HA 2C0CA 1XIVA 2EHDA 2FZWA 2H63A 2X5OA 5J23A 3KSZO 1ORRA 2QHXA 3DFZA 1DC3A 1PWXA 1TXGA 5C37A 3O8QB 3GRPA 5I7FA 2BELA 1YBAA 3NGXA 2NU9A 4J7CA 3FWZA 3AI3A 4ALMA 2GRAA 5ES3A 2OP1A 1EFKA 4DLBA 3TF5A 1E3IA 2GR9A 4RLHA 1G1AA 2A4KA 3AUSA 4NFHA 3V1TC 1DAOA 1TT5B 3VHRA 4A27A 3L9WA 4YA6A 4BMNA 3DOCA 1N5DA 2PR2A 4PZDA 4OKNA 5KIAA 3AJRA 5CEJA 4FC7A 4Y6SA 3TZ6A 4NI5A 1MP0A 1YS4A 3F5QA 4WLOA 3S2IA 3WTBA 1LX6A 2ZB4A 1YBMA 2GF2A 4YRBA 3FD8A 4A7PA 2D3TA 1CYDA 3QJ5A 3KLPX 4U5QA 5B4VA 3GA0A 5JAZA 4GBJA 3WWZA 2EGHA 3TOXA 3RASA 2VTDA 4NU6A 1BWSA 4IDCA 3WQRA 3U09A 3UOGA 1O8CA 2YV1A 3RU9A 2WYVA 2NADA 3EUWA 3K6JA 1CETA 3ZH2A 2HU2A 3LDHA 3WGOA 2QX7A 1PJLA 1G6KA 5F5LA 1UDBA 3HDHA 4W82A 4YAIA 5JAMA 3ENNA 3Q9UA 4JIGA 3UHAA 1PZGA 4RLSA 4BNFA 1X14A 4XQ9A 3H9GA 5A1TA 1BXKA 1WWKA 4PG8A 2HRBA 3KV3O 5JCJA 4DQUA 3C1TA 1UXJA 3K30A 3KYDA 3R3SA 2HCTA 4PG5A 2OXIA 1Z75A 2GO1A 4E2XA 5I7VA 5C7IO 1GUZA 2PKQP 1I8TA 3A14A 3DAGA 3GNTA 3ITDA 4HFNA 3V1UA 4IIUA 4N5NA 1P33A 2JCVA 3RUDA 3RQSA 1OFGA 3UN1A 4E2ZA 3IKTA 1CQJA 2Y05A 4XZ3A 3LYLA 1GZ4A 4B3HA 3ZWPA 2RH8A 5ILOA 3ZWCA 1YGYA 1PJ4A 1DEHA 1WAMA 3SC6A 3ZWBA 1HE3A 1EDOA 4FB5A 4WK6A 3VZRA 1VJ0A 1I3NA 4AJJA 1A7AA 1YDWA 1F14A 2XAAA 4MP3A 1HDZA 4J4BA 2Y1EA 1HETA 4FN4A 1LLDA 5JO0A 3K73O 2JAPA 4DC1A 4LW8A 3WGGA 4J7UA 3DOOA 4FFPA 4CM1A 4DMLA 1P44A 4IZIA 2UVDA 5H83A 2BMAA 3K5PA 4R5HA 2POQX 3Q2KA 4NBWA 1ISFA 2P2SA 1FMCA 1X0XA 2WE8A 1YKFA 4DGSA 2ZYGA 1T26A 4RF5A 3LC1O 4RZIA 2OBNA 2D2IA 5KVCA 2AEJA 3FRJA 1ADGA 5JNLA 1ID1A 2ZATA 4NU5A 1LDMA 2W2LD 2DVMA 2FP4A 2OHXA 2Y68A 4DTIA 5K6AA 4NDNE 3UF0A 1NFFA 3ANNA 3BMNA 1V8BA 2NWQA 3DR3A 1IL0A 1ZW1A 3CTMA 3KSUA 1DB3A 4DC0A 5KNLA 1PGOA 1DRVA 1VL8A 3GVCA 4CMBA 3WNQA 4FCCA 4FJ1A 4BUCA 1ENPA 1B16A 2HSDA 1ZEJA 1J6UA 4FSHA 2RIRA 3JQAB 2HMWA 4WLUA 2Y93A 5L4LA 3GDOA 1UP4A 1XG5A 1P0CA 4UUPA 4M8SA 3N7UA 4J1QA 2V6GA 1E1KA 4PVDA 4L0QA 4RVHA 3BTSA 2J6IA 1UXGA 1Z45A 2I5PO 2WYWA 5JYDA 1V0JA 2Y1OA 2HQ1A 3OHSX 3WGYA 2NVBA 2C20A 1E92A 3GAZA 3OF2A 1VLLA 3ZU4A 3U4DA 4BNVA 4E31A 5CG2A 2DT5A 1ISIA 1E3EA 2OUIA 4IDGA 3WMWA 1QXSA 2BFPA 3DB2A 4FGWA 5IZCA 3AY3A 1EVYA 3KBOA 4YR9A 1T4DA 4OXKA 1LLQA 5JS6A 1I2CA 3ZWOA 1GQQA 4CM8B 1C1DA 3QSGA 1GYQA 4RDIA 4DBVO 1VC2A 5HTOA 3L6DA 5TNXA 4R54A 5CG1A 4Y6PA 4CMJA 1PQWA 3ZNOA 4BO7A 2FR1A 2PFGA 4DQXA 3IMFA 3OEWA 2JKVA 3OQBA 4YYZA 2P5UA 1LI4A 3IIEA 4N54A 3P5SA 4NBTA 3TL2A 3B1KA 3ZNQA 1NPDA 2YHUA 4TZTA 3LU1A 4XYMA 2Q4BA 3GVXA 1UXKA 1EBFA 1Y81A 3HG7A 1LEHA 1B2LA 2ILTA 4TROA 1LNQA 5FYDA 1H5QA 2NU7A 3Q9NA 2QRLA 4QO8A 4IDBA 4BNZA 3PHHA 2CVZA 2VRCA 1HE4A 1EDZA 1ZH8A 1E3JA 4GWKA 3H2ZA 1Y8QB 4XRGA 1NQOA 4XQGA 4MVJA 2H6EA 2R00A 2VYNA 3E1KA 1NQAO 4XQCA 1VKOA 3R6DA 1PS9A 4CM4B 1QP8A 4CMEA 2JFGA 2NM0A 3RWBA 3DAPA
chains in the Genus database with same CATH superfamily
1VIAA 2XT6A 2IH4A 3B78A 3HUEA 3KJNA 4N4AA 3E9NA 3MM4A 4Q3KA 1E6EA 1Y4ZA 2G67A 3RM3A 1K2VN 1M5RA 3IV7A 4KR9A 1AQJA 2QUJA 1VPDA 4M0CA 3ZS8A 1CHNA 4E5YA 3O8LA 1AXRA 2FCRA 2VHCA 3A26A 3HSKA 4QNRA 3RSLA 4X64B 5JCPA 3FKQA 5F78A 1CVIA 1X6VA 5EYPB 1GG9A 1SA0A 1P4HA 2YICA 4EQ6A 2CJPA 4I0WB 4QWWA 3NALA 2O9JA 4QFMA 3N2KA 1Q0RA 2EF1A 3GK3A 3GT4A 1RQLA 1J8DA 5A5DA 4E94A 4ESHA 4ZKDA 4LSMA 3HHPA 1K4YA 3QU9A 1Y8ZA 1XKQA 3O74A 2ORED 2PZAA 5E3IA 3ZI0A 4AN1A 3B9QA 2BKUA 3BWYA 2M6KA 3UK0A 1ZWKA 3F6YA 1B8PA 3FDZA 1MD9A 2G83A 4EI2A 4P7BA 3QSYA 3INGA 2Q5JA 4QDKA 1FL9A 4LDNA 4E21A 1DBQA 3BDIA 4WX2B 4P4SB 4QVKA 5IDXA 3WG9A 5KC8A 2O8BA 1VGRA 2I2AA 4YASA 2ODWA 3CGWA 3MWFA 5T4BA 2D00A 4HAYA 1DTEA 1E2FA 2CNOA 1I5EA 2X7JA 2GPNA 2A30A 5FBLB 1BU8A 3NOXA 4W1RA 3CZAA 3WKEA 4LF6B 2DY0A 3ZHCA 2J07A 4F84A 4IHJA 4LVCA 2VEOA 3BGWA 4BWGA 1DXQA 1F6DA 4D9MA 2QX4A 3GT3A 3RFXA 2MT9A 4A2WA 3KXPA 2YV5A 4WOCA 4MICA 5JAQA 4PRLA 2YZGA 4GMXA 5J4VA 1CUFA 2Q6TA 1D2RA 3R5FA 3HN6A 1NVMB 4MO2A 5DYTA 5TDHA 2O8EB 5DHQA 4P4NA 4C7BA 4EKDA 1XZHA 1IY0A 3DL0A 3QHPA 3SS9X 2V6MA 5KTTA 3EZ7A 1G20A 2AOXA 3MTIA 2WFMA 1SU7A 1N57A 1RBMA 3E2MA 1BWQA 1JPUA 3B85A 4XPZA 4DYDA 5KQPA 4WDQA 1VMIA 2DH6A 5LBTA 5FNVB 1LRKA 4F4UA 1PL7A 1AK1A 4B1FA 1V5GA 4FE3A 1GL3A 1NNI1 4LF9B 2JEZA 3IAS6 2D5BA 1GPUA 2RB4A 1V71A 2WIFA 4MVJM 4ZVVA 1XNRB 3PD1A 5DIZA 1E2HA 2BLNA 2A9VA 2HXSA 1FUIA 2W90A 3R7FA 2FMIA 1NBIA 4J8PA 4RD1A 5D87A 4YCCA 1BQ3A 1PI3A 2HMAA 2CUNA 2PRSA 1NJGA 4Z6KA 4QBIA 2P78A 4KFSA 3W1VA 3L7CA 3HGQA 3SE7A 1P45A 1BHO1 3NH6A 3RVRA 3R9KA 3C8MA 1CWUA 2HWKA 3I9KA 1NHWA 1MZVA 5HIMA 1MQ8B 4J43A 2A1TS 3OU7A 2LPMA 3Q6MA 2YMMA 2GPJA 4GHWA 4JKOA 2JLYA 5D84A 2ALJA 1QJCA 1X7WB 3AKEA 2C2OA 4W7IA 4YT4A 4YAOA 3NKFA 1G7SA 1DSSG 3FYUC 4IYRA 4KWEA 3V5NA 4AUNA 2D8AA 4MDFA 2BGJA 4MIEA 5EQTA 5FUBA 3TTUA 3VH1A 1J8QA 4ZZ1A 4X7MA 3D31A 3HE3A 1P5JA 1J0AA 2GAOA 2KW5A 1MXFA 4HNUA 2XUJA 2VQDA 3TG8A 2XYHA 3EOBI 3EA4A 1FW8A 2Z1DA 3LLVA 3FTPA 1AA9A 2C42A 4BRWA 1JTVA 4II3A 2Y1KA 1NZJA 4MPDA 2ODEA 2JHCA 2HCRA 1O54A 3AI2A 3P5BA 2NTJA 3U3DA 3LV8A 1X7WA 4FFRA 2R6ZA 3FPSA 1LQUA 4O29A 4IFIA 1GQRA 4A0QA 3WL6A 4YMVA 4RHYA 1LNZA 1QYDA 2EBWA 2YY6A 1VPTA 4GGMX 4C5CA 2PU5A 3AINA 5EESA 2JF0A 3V97A 4DLXA 3LY9A 2XOKD 2D2XA 4M0PA 3H8JA 2IYWA 4L9RA 2DXIA 1Z3IX 2WSIA 2D0IA 1JZTA 3JD1A 1QQTA 4UHKA 2YHAA 3VBEA 4R6WA 1R6VA 2PUTA 4MV5A 3FCAA 3AXSA 1U8CB 2WFAA 3I52A 3Q6NA 4H31A 4P7JA 4UAUA 5AJHA 5IVPA 3SS8A 5L9AA 2BGWA 1QK3A 5J5CA 3RYFA 2D1FA 4XLZA 1OC4A 1UK8A 4X6LA 2I3GA 1Z88A 4K8OA 2VJMB 5AHRA 3U3RA 2ZSJA 1R2QA 2A5JA 1GSIA 3QP9A 3F49S 4HLCA 5LJLA 1AUQA 1AUVA 3LPDA 3PQEA 4GMDA 4I2NA 1P2FA 3SEAA 4EENA 1DIRA 1U0EA 1YRLA 4DLNA 3FYUA 3OSZA 3G68A 1G5IA 2XWSA 4RPJA 1DBWA 3GG9A 4EB8A 2GUGA 4BLVA 1HL3A 3D8UA 3LBFA 2BZ0A 1JHZA 4AMUA 4BO4A 5BV8A 1T1SA 3SJ7A 4BGDA 1Q16A 2GM3A 4BFWA 4ZZIA 3C7DB 4EEZA 2DBZA 1QJ4A 2IX3A 2M32A 3WADA 3PWZA 1T2VA 3T35A 1R5BA 2O3TA 1DQZA 3UUGA 4BLTA 1IFXA 1E5XA 3IO5A 1E3TA 3M1IA 1YHZA 4A6PA 4NK5A 2HR1A 3IQDB 4G89A 3KO8A 4CM3A 5BV2P 4MW2A 5COQA 4C4TA 5HHTA 4TVBA 4UFOA 3UEOA 2QDXA 4FGJA 3MS4A 2CL6X 2WAMA 3OT1B 4BQRA 2FF5A 1OBVA 4J4HA 1DCFA 3NXKA 1R0XA 3S8EA 3K15A 5AVOA 3WL3A 3VPGA 3JASB 3M9LA 5DYYA 3MINB 2AMFA 2ROQA 2WLSA 1XXHE 2HF9A 3KT6A 3KOMA 4LKOA 4G6ZA 2JIPA 3VH4A 3CVWA 2H07A 1G20B 1UZMA 2IEAA 2PMDA 1W73A 1H8EA 4DBLC 3MTAA 2GBGA 1Z13A 4LN1A 4G63A 1R6TA 2E4UA 1C7EA 1BZYA 2IVZA 3MJDA 3WKAA 4OLAA 3FKSA 4BKPA 2R2GA 3LP8A 4JXZA 3HB5X 5JD5A 2BEWA 4BVAA 1EAMA 1T6XA 3IS3A 5B7NA 3D8TA 3BL5A 1I3MA 5GONB 1NVFA 5FCDA 2VJQA 3MWYW 4DLRA 2WQ7A 1Y34E 1RM4A 2Z09A 3W2EA 5ITSA 1HDCA 1WMFA 3FCOA 5CXUA 3WSVA 3EQZA 3JQQA 1A1VA 4CMHA 4CNQA 4YGXB 1KO1A 4K9NA 1ZXBA 2C0PA 3RC2A 5IYZA 1R8YA 1XZNA 4BNIA 4HTFA 3CZ9A 1C9EA 1A2KC 2GM4A 1YAJA 2OPHA 4URVR 4IIEA 1LDGA 4QELA 2BEVB 1RAHA 2GZAA 4IHJF 1Y6JA 1E8DA 1U8TA 2F64A 5KYUA 3ZHVA 1F0PA 1QG4A 3OFSA 3SQNA 3FNEA 1IRIA 3TE6A 3GF4A 3VGPA 2W2QA 4OL0A 1I1OA 5H82A 1VI6A 5IT0A 5DEOA 2NSDA 3F3KA 3DT9A 2OXFA 3MTGA 2V7BA 4G81A 3P2IA 2H1FA 4GMFA 3P26A 4RYLA 2FPWA 1F17A 3V3KA 1SC1A 1I4TD 1ZA1A 1QTIA 1CY2A 5KNBD 4WGFA 4C43A 3EDRA 1RIFA 2X0FA 3CO5A 3RT9A 5HOQA 1BWPA 1PR1A 1G9XA 1SIBE 2P9TA 3TMKA 4E51A 3EXHA 4D7AA 2FQXA 3KJFA 3PBKA 4KO2S 2XUAA 2ZJ0A 3MC1A 3EB9A 1TIPA 2IQIA 1WX1A 1YR6A 4DCTA 1BDJA 1I4DD 1YRWA 3CUSA 3OE1A 4PLTA 5JXHA 1AQYA 2EXXA 4IZ6A 1JHYA 4HDKA 4ZI7A 3P20A 3OSUA 4O4HA 1X9GA 2AE2A 2WSBA 4OATA 4PCLA 2V5UA 1M2HA 1QONA 4RSMA 2AXQA 2CW5A 2WJGA 4NICA 4PCAA 1JHOA 2QN2A 2V9PA 4CF3A 1G9SA 3B5JA 4YAJA 4CEJA 4QE3A 1TM4E 3U4AA 3LY8A 2P35A 4BVJA 1P1BA 1OUMA 4M54A 2WNSA 4Z0PA 3TGPA 1DC6A 3EZFA 4WVFA 4UOEA 4D99A 1UBTS 2IPNA 2VZ8A 4P7FA 3DKKA 2JFUA 4UD2A 3JX9A 3U13A 4CKWA 1N5JA 1QDLB 5IC4A 1MX3A 3FI9A 3DXZA 2AB0A 3UXHA 2ZJOA 1EE1A 3AVQA 4G86A 5LYJB 4EJFA 1L5YA 3IKLA 3V3TA 3W5CA 3THXB 5EIWA 4JP3A 2XHEA 3KFVA 3O3CA 1MGPA 1JGTA 3S81A 2DYKA 3W5BA 2LCIA 5HNKA 4W99A 3QKRA 5HR5A 1F9EA 3ND5A 1V43A 4HYTA 4OHVA 4CKEB 3QVTA 5JHHB 2W6ZA 3R5HA 4Y1RA 4EGQA 2HDHA 4ZU6X 2SBTA 1XTPA 1JJBA 2ZI5A 1WCIB 3KYIB 4HZGA 4FDAA 1JYFA 1UBMS 2VAWA 1FSZA 4I4TB 4BNLA 2G63A 3G2KA 2F3PA 5DN6D 1MJHA 2PD3A 3JQAA 4PX9A 3T0IA 1E9FA 4GM0A 1WXXA 1XT6A 3OX1A 4NYJR 1RC0A 4CG3A 1XPUA 4LHWA 4EB3A 3ER9A 4LJLA 3RT7A 3KDPA 1ZFNA 1F1BA 4IGFA 3ILSA 5CLGA 2RK6A 2QRNA 2GJSA 3TAHA 4D0LB 5GVSA 2EZ4A 1UINA 1JJFA 1NNLA 2JD1A 3BHIA 4RM2A 3M3PA 5GADl 3NDBB 1PYDA 2GEBA 4CKYA 2Z9CA 1CIJA 2XUGA 4U7FA 6PFKA 4BC0A 1NXTA 2VZEA 4LXGA 1WZNA 3PC7A 1AHNA 2CNDA 2VSQA 4NBLA 1CR6A 1PGNA 2HYDA 3NYIA 5COBA 1CB0A 4M1YA 1EZ1A 2NO5A 1XD8A 1Z5UA 3BFKA 3R0ZA 1P31A 2Q4OA 1YC5A 4Q02A 3TQHA 4D9EA 3F0TA 5CDYA 3CZQA 2WA1A 2WAXA 4UM5A 1MRNA 1UPFA 2OV4A 1OZ0A 4Z9XA 2PX4A 1NNUA 4D45A 1TJ5A 2E4WA 2PWYA 2LBPA 3FMIA 1MTOA 1GLNA 3HB1A 4B76A 1PJRA 5CFMA 1RI5A 4TMFA 1Y42X 621PA 4U00A 2G06A 1D0VA 4J3FA 4I3GA 3W05A 4GD3Q 3FTNA 4N1AA 1ZAYA 5I4KA 3EODA 2Q1XA 4PLPA 3KQLA 4B3GA 4KXNA 2R86A 2P6UA 3RS8A 4AXBA 2OEPA 2WIGA 1FNDA 1A72A 1P9WA 4HNSA 4NABA 5IDVA 3RE1A 4BTEA 4EI8A 1FMFA 3DA8A 1KJ8A 3HRKA 1HX7A 2MYPA 1XCLA 1KMCA 1C1XA 1Q0ZA 4UVEA 4BUZA 1ZY2A 2BR4A 3OOHA 4KQGA 1BGWA 3IHKA 5CVUA 1AHPA 4DXAA 3FOEC 5FADA 1NOKA 3RREA 3R7WA 2C3PA 3K2BA 1BKDR 3JWGA 1EFVB 4JP2A 2PUDA 1E6MA 1MAWA 3OLVA 4ARIA 4B3JA 1ORWA 3VR1A 3U56A 2Q5FA 1M2VA 2ZTSA 1DG3A 4JSTA 4M9SA 2YUIA 4JJZA 3S2ZA 1IVSA 2VF5X 2JIOA 1U3CA 1WDTA 4AO8A 1IBRA 3VO1A 3AFNA 4CJXA 1YDEA 2LUOA 3V8PA 3H6HA 2JH8A 3IILA 1N5RA 3PQ2A 4FUTA 4KFCA 2HQOA 3CRW1 4C88A 2Z8ZA 1SKBA 2DWUA 1AKRA 1K7XB 1ZSVA 2BBSA 2OXCA 3HU3A 1ZEMA 1BHQ1 3OCUA 3NVAA 4BO8A 1CF2O 1W8IA 1P29A 2DQSA 2PTHA 2H4JA 2OM6A 3FI0A 4DE5A 2Q3LA 1XZJA 2YC2C 4FGUA 4P4TA 2FV8A 5JPCA 2WJWA 3VR4D 4A6XA 5HVNA 5EAIA 4AYWA 1ABEA 4BKOA 1POWA 4RPKA 4RKFA 5KJEA 3KUXA 2ZK7A 4IV5A 2AF3C 3U49A 2UZ1A 1M76A 2E48A 4HYQA 5EPOA 3S2SA 4IFTA 1RMYA 3MCZA 3CLUD 5LWQA 3EVNA 1A2BA 4BWVA 3JU3A 3H99A 3MHTA 2TSYB 3I3OA 2B1IA 3WLAA 1L5WA 1AMUA 2XH8A 4KAXA 3IBTA 3O90A 1NZDA 4YNBA 1TGVA 2JJ1D 5FV7A 5TF4A 5GZ3A 4Y2HA 1IB6A 3IVAA 4N0QA 1SXQA 3D1JA 2X86A 3SX4A 1PJ8A 1JLSA 2REXB 4CUKA 4C6TB 4N3CA 3OE7A 4JD5A 5IAAA 2RC6A 4B6OA 5AKZA 4I4CA 2XHZA 4H2DA 3TXXA 5FBQB 1LC0A 2J0EA 4EG3A 2DECA 3LC7O 4RJKA 5CU7A 1N75A 3NOOA 4HSEA 2IEGA 4EHAA 3WDSA 4BCDA 1LZKA 2C78A 4RIGA 4DMMA 4NJMA 1ZSYA 3ISVA 3EZ2A 4F9FA 3EJWA 2H85A 4AO6A 3WAGA 2OHVA 4TWRA 4CDNA 5I9LA 1JE0A 3NV7A 2WG2A 4UJ3A 1YK1A 2LWIA 1VRWA 5FYQA 1FF9A 2F1OA 2WMNB 1Y7HA 4R5MA 3KFLA 1E7RA 1VZ2A 4BO9A 1VHWA 1K5GA 1XKLA 3HGTA 4C2UA 4HH0A 3WIVA 1EX1A 1ZNQO 1GPMA 3PQ5A 2REOA 4WFQA 4QXMA 3SY8A 1Q44A 4F45A 5JAPA 4X65B 4PZYA 2BGLA 2HHLA 1WMAA 1OHHA 2JH9A 2VR1A 3D3WB 4EG0A 1DAFA 2AN5A 5E4FA 5A0VA 3IT0A 1SVNA 3H2HA 3CZRA 4MGZR 2C2XA 1J5XA 1C7JA 1KMIY 3LQRA 4OI4A 4QGBA 2XV1A 2IHYA 3GXOA 2P2CA 5FBHA 3VTKA 1C0EA 2OO7A 2X9LA 4JLUA 4YS6A 4B4OA 3OX2A 1EP9A 3S40A 1JH9A 2AC7A 2VK2A 3CVJA 4N6NA 2XZDA 3RODA 5IT5A 4YLYA 3TIXB 1FUUA 1R6UA 3OMWA 1C29B 3LQ2A 2EP5A 3CB2A 4NV1A 5B1IA 3SEFA 5LKRA 1YIOA 1BXRB 5K8CA 3O75A 2NU9B 3G9TA 2HJWA 4KITB 4TVOA 1L4GA 4TQGA 2I0FA 5IASA 2VH5R 4ZV9A 4TOIA 2XOXA 3T1VA 4UW9A 1W0JA 3SZRA 2UXCB 3NTQA 3WWDA 1AVTA 3GLIA 4G67A 4MOWA 3MA0A 3O4JA 4CL3A 4AJNA 1OH6A 3O7MA 2ZB7A 1X8KA 5DRTA 3WIDA 4WCDA 3WQQA 4A2QA 4S1WA 1IPEA 3WGUA 1A98A 2VP6A 4I4LA 1JSLA 1TF5A 3THRA 5JWRA 3OP4A 1OFVA 1PZFA 1QLHA 5LKAA 4FEGA 4D25A 1XRQA 2HWWA 3CHYA 1L5VA 2HRDA 2O2HA 4I55F 3WBBA 3KK0A 2Q0SA 3K0AB 3KAJA 1RM5A 4REQB 1ZRMA 2JB9A 2ZVDA 3DV0A 2ZRAA 4OXRA 1EM8B 1OBHA 1SIUA 4OKSA 1HE1C 1KEPA 1SBHA 5BSWA 2EARA 1Z6PA 3EFOB 2QN6A 5TR9A 1SUSA 3N8IA 3KKQA 2G76A 3VNBA 4O2AA 4YJHB 5J4YA 3MOIA 1NC1A 1GARA 3GCXA 3MRSA 3B7PA 2PSHA 4FJ2A 5P21A 2FUG1 1GP2A 3FPAA 3DKVA 3FWHA 4OQNA 4RIEA 3TOZA 4RLSA 2R1ZA 1E7MA 2M9MA 2VHZA 3L7AA 5CCBA 2FX5A 2B6HA 4LBWA 5F1YA 3M7IA 2D4AA 1IOLA 1QYCA 2QUBA 4OIFA 4A10A 4LS3A 2AN4A 2WWRA 1NWHA 3OMLA 4HB4A 4HO1X 4WA7A 4D97A 1L5HA 4HNTA 4RULA 3AHGA 2XGJA 3H5RA 1OV6A 4OBEA 1A96A 4EKGA 3OPYI 2FEWB 5AW9A 3S2YA 5C7YA 2PGNA 3ZWWA 3AVWA 1DAPA 4EEXA 5DI3A 4ZQCB 3QLEA 2PRZA 4S1OA 4IIVA 1GKKA 1LQTA 1PNQA 3EN0A 4NEGA 4RQBA 3MPUA 1UMCB 1EUZA 1ZJJA 3CX4A 1G8FA 1E4VA 2NZYA 2Q3MA 2RKOA 1FU4A 3FHJA 3RJZA 2FEXA 3ZWDA 2GEFA 3SSMA 4C6SA 1KEEB 5KUTA 1A9RA 1L4BA 2ZUTA 4N0PA 4W8OA 4UVHA 1RWNA 4OI2A 2VJKA 3KR9A 2C5BA 3GRRA 1QHGA 2I6UA 2YHIB 4YUYA 1JQBA 2LDXA 3GJYA 4R1UA 2JIQA 3KTOA 1OAOC 3QYFA 1V95A 2ZSIA 1C4KA 4EFKA 1K2WA 3QUSA 1SEVA 2REBA 1P9NA 1B42A 2O3SA 3B3FA 3DR5A 1JKFA 1RI1A 3IBCA 4JB8A 4ACAA 4RMIA 3TLGA 1M1ZA 2QRQA 3KKPA 5DNEA 1J9GA 5JMWA 1GRRA 2IV2X 3SEZA 2YWGA 1EGMB 1YR1A 4KLAA 5HJ7A 3DBHA 3JRXA 3ZG6A 2YMLA 3U3MA 3GD5A 2HQSA 4BP1A 1K7SN 5ALDA 3U19A 1DIGA 2C96A 1J1UA 2WOJA 2J85A 2PL5A 3L7KA 3U61B 2PJZA 1QTNA 1MH1A 3REQB 2WD8A 3O84A 3SBEA 4HNHA 3AEZA 2JLWA 2C5LA 3DDOA 1CUXA 1RP7A 4XR9A 2DJ5A 2GPTA 3WGQA 5A5FA 3VPXA 4MCAA 5BWOA 2I9KA 2EFDB 3ZWMA 2PXCA 3O26A 1Z5WA 4CTMA 1KI2A 4WKOA 4WL0A 4CIYA 4KUEA 5H3CA 2NP7A 2EIHA 4J2HA 4PBSA 3UIEA 1Z74A 1QLWA 2C3YA 4GVLA 2JFBA 4MVJH 1A50B 1QP7A 4GKBA 4UOQA 3VPCA 4JQSA 5GVRA 5F2EA 1EK2A 2ZB8A 3CA8A 2KWIA 3FYCA 1E9RA 4UDOA 5LZ5A 4ZPJA 2PQ6A 2XITA 1VMAA 3Q7SA 4X1IB 5ENZA 4MI1A 5K0NA 3TLCA 3UHJA 2PU7A 3ORFA 4F85A 4TS1A 4HI0E 2WPDA 2X0RA 5A9SB 3PICA 2IK8A 3BBLA 1D2GA 3KPJA 3L0SA 5F7XA 3WLFA 4WACA 5AMXA 2I4MA 5FWDA 2OZPA 3S1AB 1TJYA 4Q48A 4WMLA 4BNYA 1DC8A 3IELA 1E1RA 4MUBA 1JDBB 1L8AA 3U4CA 1PJSA 4EELA 4WUTA 2ZETA 5F3RA 1NVVR 5EUMA 3OM9A 3IPYA 2A0FA 1FXWA 4MYHA 5CTAA 2WJZB 3GN2A 1XUOA 1NRWA 2XQKA 1U65A 4CM9A 4CL2A 1SVMA 1CE8B 3ABZA 4TKZA 4U0KA 5LIPA 3L8EA 3IV6A 1O4VA 1QHHA 1S3GA 2YZKA 3G9XA 3ISTA 3KUCA 2CC2A 3PTZA 1AS3A 2FFAA 2XD9A 1Z0AA 1IK6A 2XNJA 3N58A 3MW8A 3O95A 4KZKA 4ON9A 4B6JA 2R8BA 1H2HA 5IH7A 1OI4A 4QYTA 5HDQA 9MHTA 4TV8A 4MW9A 4WOBA 2CFCA 3D4NA 4R3NA 3DCIA 3N86A 3ZDEA 1R4AA 3NHBA 4E11A 4QXOA 2XCOA 4U7GA 1NJ5A 5CB8A 5CM2Z 4E22A 1KMHA 2P9CA 3EGVA 3M6XA 1YE8A 2FHPA 3CZMA 1PGQA 3ZEIA 2NTNA 5BW4A 3UGQA 4F5ZA 3K32A 4U2FA 4DMGA 3PDHA 4MP8A 2Y27A 1SU6A 1CQZA 1K6XA 2O8FA 5AR1A 1S8FA 1X7DA 2WINI 1FQWA 4LGYA 5ALRA 2W8BA 4RGBA 2G1KA 5T8KC 2X9VA 4JYBA 4M55A 1W8DA 1GGEA 3FF4A 3CSUA 3CLHA 5JAHA 5JOQA 2Z4TA 5FA5A 2BH2A 3ONNA 2GX6A 2A35A 3JQ8A 1M2GA 3GHYA 1SGWA 2PYIA 4OQQA 1EU1A 3SBXA 3H2JA 1A77A 2FPXA 5A4AA 5E3HA 2IY8A 2Y1CA 3QLUC 2W8ZA 4D42A 3M6LA 5AKHA 4RDHA 2C1ZA 2V55B 3QTLA 2BH9A 5EWLA 2BGKA 2VHVA 3KSMA 2PUEA 1VKJA 3E48A 3PUIA 5KAPA 1QIEA 1T3GA 3M4NA 2IF2A 4Y9TA 4CR7A 5KHOC 3VX3A 2EYUA 4UEJA 3EQ7A 3EG5A 1TZJA 4NFSA 1A7UA 4Z3DA 4QD3A 1EIZA 5DKFA 3ZE2B 1BX0A 1UPUA 4KWTA 1Z4JA 5EHZA 3Q88A 5FEUA 3EXIA 4ZYVA 1WBDA 1H1TA 2WUFA 2ODAA 3TFQA 3HVUA 1S2IA 2PLWA 2PWAA 5CA1A 1E6CA 3I6BA 3AX6A 2ZR7A 1VBNA 3G02A 3TS1A 1UBOS 3D6HA 5AOVA 5AVVA 3OHMA 1U0JA 4BJ5A 4OLFA 1E96A 3A1DA 1HDOA 3M3HA 4PHHA 1DDIA 1W44A 3JZIA 4LSWA 2E2WA 2P5SA 1YMQA 1QRAA 1WSAA 2CWDA 2WWHA 3GJ7A 5AFSA 1H0KA 4F1WA 1C2YA 3HA3A 2IC5A 1QRUA 1VCNA 3GMIA 1DOHA 4CQNA 1T91A 4U2BA 1ZMRA 1TJ3A 2D62A 5LJIA 1JFLA 3HI4A 4BRSA 1XMPA 3TAUA 4H3VA 4U2KA 3OZGA 2FP4B 1BC5A 1D04A 2PGLA 3E03A 2FW1A 2VH1A 4DR4B 1W30A 1J42A 3A2KA 3QYJA 5DTEA 2VHTA 2G82A 2YBEA 3L4EA 2WIKA 3OQ1A 2H5LA 2GB4A 3W5IA 4NCHA 1S1CA 1IWPB 1KP3A 3K9CA 5FJJA 5EWMA 2PT7A 4NBSA 1NJSA 3G49A 2ENWA 4A8JB 1IZ8A 1IUPA 4AK9A 1NN5A 4FGKA 3BJRA 4M9UA 5C80A 3IUBA 1CK4A 2H17A 3JQRA 3K5IA 4MWDA 3OY2A 4HQKA 5J4KA 3RSHA 2GD6A 4CQMA 4WFIA 2HAEA 3D6UA 3TE7A 1UP7A 5K6TA 3C4VA 5HQ3B 4F5WA 5DPMA 2BDTA 1RADA 3CS3A 3MNFA 4MV6A 2OXTA 1E2DA 4F3RA 2OPBA 1JHUA 3FB1A 3T41A 4MR9B 2XTAA 3EVEA 3OPVA 3I3SR 3A7EA 3MOGA 4DG9A 2FZGA 2NUAB 2UVQA 3HWWA 3QLUA 3U80A 4B6PA 4EDFA 4DV5B 1E6KA 1ZBQA 3NDIA 4F2WA 5AD1A 3BRCA 4MRMA 4BFCA 3CPEA 4HUQB 1N36B 3R3VA 2WG0A 4IL5A 2MSCB 2UVPA 4C5AA 1DTWB 4B9EA 3DMPA 4J4TA 5AKJA 1B8NA 1G8AA 2XKAA 1GU1A 3YASA 5ICGA 4A8TA 3TZCA 3Q6IA 1IH8A 4ZEXA 3T1OA 3SIXA 5AIAA 2RHMA 2WQ6A 4WKNA 3IP8A 2M1XA 3GI1A 3NC0C 4IIJF 4UUQA 3VZSA 5AOAA 1JHQA 4FFMA 4XRRA 4Z7JA 5LDDC 4TZ6A 1E4EB 4CE6A 5BXQC 4OUDB 1AKWA 2BEUA 2Z0MA 1ST2A 2ZRHA 1E60A 3OIGA 4LCBA 1KOLA 4RKYA 4BKRA 3FMVA 2BGUA 4IVNA 1XMSA 3EBLA 1R3UA 2GARA 4WINA 2GZ2A 3FX2A 3TKYA 1QIJA 2FZVA 4KB5A 4E5MA 2NXNA 2HH9A 3NCTA 1XRJA 1XTSA 1PX2A 2PL1A 5CLLA 3T9CA 4CV3A 1XMVA 3B51X 4W1PA 3VJKA 1JIIA 3HSYA 2C2WA 2OV6A 2X0JA 1EUYA 1ZD9A 3P0FA 3L7LA 4GL2A 1TKAA 2Z9DA 4ZQHA 3BHMA 2PSEA 1U2GA 1VFPA 1IMJA 5CT9A 1X1EA 3TIIA 5H9VA 1XL1A 1CZLA 3HXTA 1KZGB 2QLTA 2OILA 4JYAB 2ZI4A 3KLOA 4G1VA 2XUFA 3G0DA 3F7OA 3PF8A 3SPXA 4EITA 5CDHA 3ANLA 2R6R1 4FVTA 3SE0A 1CIVA 1XU4A 3WA6A 1QVRA 5AK4A 5IANA 1DIBA 4Q1DA 5KTOA 4E5NA 1CUHA 3RLFA 1PT7A 1TZBA 2K2WA 4JVNA 1J06A 4YWJA 1AO0A 2B98A 2PNFA 2O2DA 4R40A 5KVSA 4YP5A 3AF2A 5F64A 1YJQA 3IE1A 3PWKA 2EJVA 3BD7A 3K6SB 2NTYC 3O73A 3AF0A 4FI3F 2EC5A 3L7NA 3FOAA 2I7TA 3JZAA 1QHEA 4KAFA 4NBVA 3BJEA 3B7WA 4TKLA 5EXDA 1N9GB 4KJZA 2OK7A 2WHYA 1NBHA 1JVNA 4EGFA 2BEJA 2XECA 3CEMA 3Q87B 4IUCS 4CLRB 1N2HA 3NGLA 1KMQA 5A4IS 2C2GA 5I7UA 2O4UX 1PBTA 1RJ9A 4HRVA 3PDCA 4H3SA 2CZGA 2J45A 1JN0A 1QRTA 1XGKA 1UQRA 4EG8A 3VV2A 1NUPA 3KR1A 5CFZA 2Q28A 5DH9A 3R8XA 3KQTA 5JLJA 1CJSA 3MCWA 3NAQA 5FUQA 3GELA 2H2DA 4N8DA 4QGSA 1ZINA 3THWB 3C8HA 4XFJA 3CH7A 3ZE9A 1SBZA 3FOCA 4PG4A 1NUAA 2I3DA 3V4VB 4KMMA 2VDUE 1BO6A 1FK8A 1V96A 3ESCA 4WY5A 4ZD6A 2XUHA 5B53A 4TLBA 4URFA 3KU4A 4IFEA 1G8KA 3I23A 4UU0A 4DA6A 5CDUA 4QVIA 2YYSA 1U0SY 4A5OA 3JVVA 3EW7A 1IJKA 1XNGA 1GL9B 1NV9A 3B52X 3TB6A 1YFLA 1M67A 2DCMA 3AU9A 2FFQA 2QT1A 2XF8A 3KEMA 4QM7A 2OOSA 3LIIA 3I6MA 2YVKA 3NPMA 2YV4A 4DJEC 2XKBA 3QEOA 1KPHA 1MUUA 2I8LA 2GEUA 3A1VA 3IP9A 4IIFA 2OHOA 3BWEA 4MPTA 4DWOA 4Z5XA 3AFMA 1EWRA 2ADOA 5ESRA 5IN5A 2IYEA 2OYSA 4CV2A 4YCNA 1GVHA 5KOIA 3JPYA 1A9OA 1QCYA 1EFTA 2VHWA 2OXEA 2EJUA 3BMQB 1JFSA 1JEYA 1PS0A 3AEQB 4Y6LA 4CKZA 3HCNA 4I8IA 1PG5A 4JB2A 5B3KA 3R9IA 1PLLA 4I9NA 2BBWA 4FHEA 4A0GA 1H1LA 3QRWA 1ESNA 2CYBA 1JLLB 2F3QA 3DP7A 3X1XA 1WHSB 1XZQA 4PIMA 2W43A 4G1FA 4K7JA 2UU9B 2XB4A 1KR2A 1IUNA 4PSAA 3U0VA 4ALJA 4B3XA 4C4RA 4PAOA 4TPKA 3U81A 3VPSA 1XSEA 1W52X 5JZOA 3ZDXB 1T4CA 1T2DA 1QZTA 3HXPA 3SSNA 4IO0A 5LLSA 1ADFA 3OESA 5BN5A 5AW7A 3STWA 5T3UA 5E9JA 4J94A 3GFOA 1X7GA 1HQCA 1RYDA 3OUUA 1MV5A 4LYYA 4QLOA 2C04A 3ICVA 3OF5A 4IDEA 1T1RA 1WLYA 4ENPA 3E82A 5A5VA 1UANA 3UWSA 4AUEA 3CRNA 1P7CA 4ISBA 4J29A 4D4LA 2HK8A 1I0LA 4ER0A 5J47A 2H9IA 4DV7B 1KRHA 1CUEA 4IQ8A 3TNLA 5JY1A 1W1UA 3HZHA 3NONA 5BURA 2XQIA 1H4TA 2G88A 2J3HA 3BMQA 1KARA 1WG8A 5FUXA 3RD5A 5CYOA 3C3CA 3PCRB 3T9DA 3ZDCA 2ZRMA 3SVZA 1DJLA 3BF7A 2EFJA 2G4LA 3OOEA 2W48A 5EHIA 4HAOA 2LDBA 2WJ3A 2WILA 4JI7B 2BJWA 2GVZC 5E7MA 4RL6A 3JRNA 1R37A 3BCRA 4CR6A 3DZ8A 5FWYA 3RFUA 1PYGA 1BCSB 3IOYA 4H6XA 4Q6WA 1AXEA 2XA1A 2R6CA 3HJRA 4Y8VA 1TM2A 3GLFA 3L0PA 4CGYA 4PHTA 2ZJ7A 1VIDA 3WGHA 5CIWA 3MGAA 3SU8A 2PYZA 4BMOB 2VJPA 3KD3A 4N65A 1E2PA 1OXMA 5CFOA 3KJIA 5ADHA 3ZWKA 2WMDA 3OEEA 1EFAA 5IM4F 1AB5A 1Q20A 4QSMA 5AUQA 5I3ZA 1PWEA 4MYRA 1DX9A 1GRCA 4H6PA 2H7VA 4C2BA 2CJFA 5KNBA 4US1R 4HLQB 5EUCA 4XWYA 3RK0A 3WKCA 1KI9A 5REQA 5KWSA 4D43A 4IRUB 4IIJA 1YMVA 1J90A 2PQ2A 1TJNA 4ZVUA 1G7TA 4LYHA 1BYUA 1G291 1O5TA 3K09A 1FFHA 1RXWA 3QBDA 3ZDRA 4Y7DA 3DC2A 2C82A 4MQFA 5DSTA 3N53A 2C4HA 4F1KA 4CLRA 2H4XA 2ZAMA 3OVMA 4ITRC 5KI6A 4EKYA 4Z8YA 1T9HA 3A2NA 4OP1A 2R6JA 4I9FA 1F2UB 1SELA 3P9QA 5I01A 2VHQA 4OL9A 3O4VA 4TTRA 3GJ8A 3PUHA 4CCAA 1QHXA 5A03A 2NPFA 5HF6A 3K0HA 4JROA 1O5OA 1FP4B 3B6IA 2EDCA 3RHSA 3PV0A 4KMOA 4XIYA 3DZBA 2AHRA 4FNGA 2WU4A 2X23A 1GG5A 1U7TA 1T5SA 1M2OA 4TLMB 3ZE0B 3L6EA 2FPIA 4UZFA 1XCPA 2YIVX 3P71T 4LRXA 1I33A 5DI9A 1LNSA 2DZDA 2HLDA 3HN7A 4MEBA 2XWPA 3EFBA 3PXDA 4MR7B 4DR2B 4YRQA 2YZ2A 3HPRA 3ZHOA 1TEVA 2AEMA 2QLFA 4R81A 1Z37A 3P0HA 1I24A 5DLQC 1CS0A 4C76A 1SC3A 1FXSA 2XUQA 3HA2A 2CEAA 2CMFA 4GU5A 3LYUA 4IJKA 4LFAB 1TYAE 1A76A 3VOBA 3PWTA 2CFOA 3O4FA 4HR7A 1JALA 2I7VA 4NNJA 1ULSA 3WGZA 3WS7A 3KB1A 3L3BA 5HK8A 6NULA 2H1VA 1PR9A 1QR6A 3L2OB 1FC0A 4X45A 5CJJA 3RC8A 5F3WB 3BILA 3ZQJA 1RKBA 2DTEA 1M74A 1NIJA 4L6CA 3T9EA 4KQ6A 3SVTA 4HGOA 2BE9A 2JAOA 2WVGA 1PJBA 2PL3A 3ANXA 4OU4A 2IPAB 3PEYA 1ZH6A 1D6MA 2EKQA 5G0WA 4ID3A 2YMPA 1PX0A 1TO2E 3TW0A 2D7CA 4LVUA 4QTXA 4TYMA 5ALKA 3TLXA 1I13A 1T2EA 1X8JA 1Y8RA 1T36A 2EAUA 3Q7EA 4RHTA 5A3JA 2AJCA 2CE2X 1G17A 4L95C 1I4OA 3OICA 3ZKWA 3JTMA 3C3EA 1GY8A 1L5GB 3E15A 2R4QA 2QI9F 3DVRX 2FR0A 1RZ3A 4GGPA 2A94A 3PFHA 5J5AA 2CNLA 1ZIDA 4HUQA 4AROA 4GFDA 3KQKA 1ULZA 4JUCA 5F4BA 4Y2YA 5BNFA 4ANFA 2F67A 3VC2A 5E6SB 1NLFA 2DPHA 1OWLA 5A7FA 2DSNA 2W0SA 3Q7QA 2AMLA 3DWGA 3GIWA 1JG7A 4JLMA 3TLZA 4IMIB 2JGDA 2J3LA 1N3IA 3GLHE 1JZQA 1SA0B 1FU7A 5IM4A 3U60B 1H2FA 4GDMA 5JIBA 2ZYAA 4QAJA 1L5QA 2JFVA 1R0BA 4KN5A 3LDAA 4AZWA 5BMVB 1EAYA 4BKQA 3MJHA 4L07A 4YQEA 1V8ZA 3VKWA 1VI2A 3EVCA 4EO7A 1JEQA 4KPUB 3AUXA 2F9LA 2H52A 3QWFA 5DN9A 3SHVA 2PSSA 1GWNA 1YS9A 4NJEB 4OHRA 5ERYA 3T4PA 2B2NA 2BSQA 4LMPA 1PHPA 1ZITA 1YQQA 2HNBA 4V03A 4IKEA 3WR5A 1XHEA 3JYLA 1H6BA 1HEUA 3GJ5A 3IPLA 1P4GA 2KJQA 5HTKA 2PZMA 2V6JA 4II2A 2IEZA 2VYQA 2XCUA 3OQIA 2RI6A 2N47A 4NJMB 1BN7A 1KP9A 5BO5A 1L5ZA 3ESQA 2NQ2C 4WOKA 1U0BB 5I9NA 3HDTA 4RVGA 5D3QA 1JPVA 1RRFA 2E1RA 3GLKA 1ZD2P 2G6BA 3AR4A 2H65A 3MQFA 1FY2A 3NWEA 1JEQB 2P4SA 3CH6A 1AB6A 2DLDA 3EGEA 3SQDA 3OF3A 1RXCA 1Q7GA 3JD0A 4H4DA 1AO3A 3L9XA 4J3JA 1PS8A 3QX8A 2PLNA 1RI2A 2IP4A 4ZCSA 3K1AB 1KO5A 3IP6A 1TYCA 2GETA 3GJ0A 4PC1A 4D3SA 1L7AA 3MMSA 3AIIA 2VIIA 1BFUA 2FN9A 3C5WP 4IF6A 2RG7A 1J5EB 5F98A 1Z4PX 1ZWLA 2A8YA 4WLEA 3IVXA 4S2UA 5AXDA 2YVLA 3OKFA 4JDUA 5J4LA 1EWTA 1ZUNB 1E3QA 2G9RA 2R6HA 4RA6A 5E2AA 3RIXA 5GMOA 4K9OA 4UNPA 4AU1A 3H86A 1GCOA 4IDQA 4I1VA 4M1SA 1GGKA 1CTQA 1TFUA 2G72A 3OPQA 1O9GA 4Q4HB 1IBSA 4IVQA 4W5NA 1DPGA 2PUBA 1E77A 4HC4A 5JEDA 3I01A 4YRDA 4BAZA 3B20A 1G38A 2OBLA 3KVRA 4CM6A 2HK6A 1I01A 1OBOA 1WHTB 3H3FA 2R4TA 4Q9JA 2ZYSA 4OX9Y 4PLGA 4R1OA 1H8HA 2QJWA 1IXZA 1PKXA 3KTFA 1G2OA 1FLAA 2PV0A 3QPAA 4I50F 1Y9JA 1HXHA 1SD5A 3C97A 1LS6A 4TUYA 1XDGA 2XEDA 4E3ZA 3UAYA 2FE4A 2DFNA 2Y0BA 1MPXA 4HJRA 3DZDA 2GFIA 5DULA 1W75A 3QF4B 1SG6A 3KTAA 2O7NA 5JDIC 2CHVA 2WQZA 1P62B 1UDXA 4FFSA 4EGSA 2VWGA 1XVLA 3A31A 1JR3A 5EWJA 5BSHA 3TCNA 2F59A 3B3GA 4IDNA 4YDHB 2PUCA 2CMDA 2ZQYA 4OU5A 4W1SA 1GFZA 2NZJA 1TO1E 3LF1A 3SZLA 2OQVA 2XVYA 4DARA 1TNDA 2QMOA 2VF2A 4F71A 3RNOA 3TEMA 2GKOA 2HA3A 5IF9A 4XJXA 1ZO8A 1OKKD 3AEXA 5ESXA 4G3XA 1T9KA 3ZDFA 5HRUA 1P7YA 1T4GA 2YFYA 1P0QA 1PEAA