4DB4A

Mss116p dead-box helicase domain 2 bound to a chimaeric rna-dna duplex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
256
structure length
256
Chain Sequence
b'SIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase MSS116, mitochondrial
publication title Structural basis for RNA-duplex recognition and unwinding by the DEAD-box helicase Mss116p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna-binding protein/dna,rna
total genus 82
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4db4A00
2IS6A 1S3SA 2KE5A 1GVNB 1M1YE 2OEPA 3RNLA 4LJ8A 2WZQA 2QBYB 3JZAA 3VFDA 1G1MA 3OZXA 1OXSC 4TT3A 1G8YA 2GJ8A 1U90A 1E69A 3DO6A 3RC3A 4G5OA 4POAA 1KO1A 3TSOA 3Q8XB 4V0MA 4BFYA 1T9HA 3X1XA 2BM1A 1U81A 3LRPA 1VMAA 4YC7A 3ZVMA 4HAUA 3ADDA 4FCTA 4QBIA 3P20A 3CNLA 4ZDIA 1TTTA 2CHQA 3ZVNA 2JLQA 4GFDA 3W34A 3N2IA 3LLMA 3AKCA 4RCYA 4FN5A 1NJGA 4M1KA 2XSZD 3QG5A 2QN6A 1GRRA 2OFXA 2R65A 4EFMA 2X1VA 4JLAA 1SHZA 3KUCA 4GMDA 4GPTA 3U7GA 4Z54A 4G5RA 3MWLA 2GJ9A 1PZNA 3LQRA 3LA6A 1GKYA 4HAWA 2BMJA 4LHXA 4NKRA 4I81A 2V1UA 2CE7A 2IS1A 1HV8A 3AVXA 2X19A 2YWEA 3O8DA 2D3WA 3GLIE 1Z0FA 4LHYA 4LYHA 3EAQA 4KHZA 2H7VA 1HTWA 2JAQA 3RYTC 1CJTC 3ECCA 2YINC 3GLFA 1WCV1 2QP4A 2CJWB 5B58C 5CITA 3GLHB 3BOSA 1OLOA 2RGNA 2OESA 3MFYA 5J47A 1WBBA 2FOLA 3DOEA 3LW8A 4Q02A 4JVMA 4FD2A 1LFDB 2UZIR 5JJLA 1EFCA 3ICEA 1XFAA 2VSFA 1YRAA 1M8PA 1Z0IA 4MKFA 4R7ZA 5J40A 4XSHA 2R6DA 1FL9A 2BKEA 2Q3MA 3QKSA 3RHFA 1UDWA 3KTAA 4E03A 3W8NA 2PMDA 4HB3A 2FPKA 5FUWA 5AWFC 2HLDD 5H70A 4BRWA 4F91B 3W90A 4YMSA 3IHLA 4XD7A 2ZVQX 1AN0A 4EJSA 4Q4AA 4YMWA 1ZNZA 4GL2A 3MWYW 4PPGA 5EXTA 3MRSA 1P72A 2C96A 4CVNA 5LDDC 4JS0A 2ERYA 4HEJA 1FNNA 2JCSA 4Q7KA 4RZXA 5FBVB 4W9MC 2EYUA 2WKQA 4HAXA 2ZSAA 5AR1A 5JSZB 2QP9X 5JWHA 4QRHA 4LYAA 4F93B 3K70D 4IEIA 4C7OA 3CR7A 2OE2A 3PIRA 1FFHA 4UJ5A 2RGCA 2X2EA 4EFLA 3K9HA 2WJIA 1KMQA 1MRSA 4FI3C 2ZJYA 3GFTA 4DDVA 2H5EA 1F2UA 3IBYA 3K8YA 3GLIB 1EG7A 3OIVA 1ZNXA 3B9PA 2EU8A 1NKTA 1TEVA 4DWJA 4DB2A 4LGMA 1UM8A 1U9IA 4KVGA 2NQ2C 2O8CB 1CR0A 3CRW1 4NCIA 1G6HA 3LBHA 1G17A 3F8TA 5LBIA 5DHAA 1R0WA 4NHOA 4JLJA 2O8EB 2ZRNA 4LJYA 3IPYA 2CVFA 1DAEA 2ATVA 3A1WA 5C46F 4BFWA 2J45A 1M6NA 3WNCA 5L8VA 1CR1A 4QXAA 2YOGA 4HLUC 3NG1A 4M9SA 2O52A 2WHXA 4EPYA 2QL6A 4O3MA 2BMFA 1EFTA 4OHVA 2NG1A 2PCLA 2F9LA 3AVUA 2JJ2D 3KXIA 1YZTA 3HU2A 3I32A 3RWMB 4DVGA 2FEMA 4EDHA 4II7A 1IN8A 1XRJA 2ZR9A 4LZZA 4AKEA 4B6EA 2ZREA 1A7JA 2QT1A 5F9HA 1R0YA 3K09C 3NDPA 4ZDKA 4JLKA 2X8AA 3LWNA 3PENA 2VIIA 3CRMA 2ZUDA 1E9EA 1SXJD 3KJHA 4JLDA 4JYBA 1E9RA 3I62A 5DIFA 1JR3A 3LX5A 2Z4SA 3B8HA 4Q03A 2PZGA 4Q4JA 2ZRDA 4QJ3A 2W6IA 2VL7A 3BIFA 2QNRA 3QJYA 3QVUA 2WIBA 5B64A 1AS2A 1S1MA 1F5NA 4M21A 2O0HA 2ZJOA 2RGAA 4O0MA 4GOKA 1ZC3A 3GCGA 3CNOA 3KFVA 1Z8FA 2FWRA 4OL0A 2GESA 1G21E 1BMFD 5HKKA 3UKDA 1XCGB 1YJ5A 1TF7A 2XNDD 1OHHA 2R8RA 1YZUA 3JZMA 3KJIA 4LI0A 3GJ4A 3H84A 3I5YA 3A4LA 4EQ6B 2R6GA 1R0ZA 1S8FA 3BORA 3TKLA 1P9NA 5EQTA 4RCZA 4YMVA 4PHTA 2ATXA 3TUJC 3NC1C 4B6FA 3GJ8A 4KLNA 5FTLA 1HH4A 1OB2A 4PQFA 2Z43A 4XTCS 3AVYA 3ZS8A 4H9GA 4UXJA 4XIGS 3K1JA 3OEED 4A9AA 2CNWA 2QUZA 4LY6A 3L0SA 4CT4B 4B3CA 1Z83A 5HCIA 1W4CA 3NBZC 1QHXA 3V00A 2O8DA 2WICA 4LRWA 1E2MA 4TZ6A 1P5ZB 2VP9A 3ZGXA 3LXXA 5BXQC 4JYCA 4BLSA 3G82C 4M1MA 4EPTA 1RYFA 4OJKA 5F3WB 2GK7A 4JMPA 3ZIAA 5LD2B 2OCAA 4DSNA 5SZIA 5FBWB 1NI3A 1DAIA 3EPJA 1TAGA 5HZHA 4ITRC 4TQAA 2ZYTX 5C1BA 2A30A 2XNSA 1GKIA 3W6NA 2Z5FA 5JJIA 1KI2A 2XX3A 5J5CA 1SVOA 4IOMA 4JT2A 1L4YA 2REXB 2AL7A 2IUUA 4C2UA 2B7BA 3EA0A 5CIWA 1GOTA 5DI3A 2VH5R 4P33A 5GVRA 3SHWA 1NSFA 3A4MA 4B75A 1OIVA 4MGKR 1UBFA 3VU9A 1HE1C 1OF1A 1IN5A 1QDEA 2F6RA 4BEJA 3VX3A 1TQ2A 3TH5A 4AWXA 1PJRA 1VECA 3THYA 4DXAA 5L3QB 5KYKA 1A4RA 3CLVA 2WWXA 4M9ZA 2VHCA 3OF5A 2CK3D 2D4HA 2EWVA 1LS6A 3CUEF 1EX6A 4Q1FA 1HY3A 3GP8A 1A1VA 4B3GA 4D4MA 3AVWA 3NWJA 1II9A 1ZM7A 1AZTA 2GWHA 3EZ2A 3U3MA 3LDAA 1R5OA 3K9NA 4M1TA 2D74A 5IHPA 1HUQA 3UXMA 2ZVPX 3KL4A 4MRRA 5C2JB 3U7FB 4D0GA 1LF5A 4IXNA 4LWZA 4RZ3A 3GEHA 4PZLA 1E94E 2ZUCA 1NBMA 1GFIA 4M8NE 4DEXA 1NY5A 1PLKA 5FOWA 2O0JA 3W8RA 3ZZ0A 1XMJA 4KAXA 1G3MA 2WAXA 3IIMA 1F60A 4KBGA 4Z8XA 2DB3A 4QL3A 4RSGA 2FSIA 2ZEJA 3A1UA 1X1RA 2PBRA 1SVKA 3CKLA 1IJFA 1KO8A 2ZSDA 1RJ9B 3ICQB 1R5NA 3A4NA 4UQOA 2AD1A 5IK2D 3KKPA 5TDHA 2VF7A 1J70A 3CF0A 1UKZA 2QY9A 4UXHA 1KK2A 3IKJA 2C78A 1VYTA 2CE2X 4L9WA 1U94A 2IYZA 5F9FA 1GKUB 2V6IA 2IT1A 1HQYE 1XTJA 4NU0A 4PQYA 1T6NA 2ODEA 3OEHA 4I1SA 4IXMA 4NYJR 3WHKA 5M04A 1JEEA 1E2IA 5C4GB 1WB9A 4LJ6A 1FTNA 1OSNA 4OHYA 3MGCA 2GETA 3AKYA 221PA 4G01B 5FOTA 3QF4B 3AGQA 4TMWA 1XEFA 1LV7A 2W0SA 3GLGA 3MLEA 3X2SA 2J7PA 2FZLA 1CR2A 3CRVA 2C2HA 1Q3TA 1QF9A 3QBVA 2FNAA 3AUXA 4Q4HB 4K46A 3D31A 5FH9A 1NG9A 2NIPA 1CKEA 4GOJA 1DG1G 3B85A 2GJAA 5ANRB 4B74A 4B2PA 1EWRA 2AD5A 2A5GA 3C7KA 4Q9LA 1M7HA 1ESMA 2OCPA 1SGWA 4ACAA 4H1VA 4MYCA 4Q9KA 1FQJA 3TVDA 3ZS9A 2WWWA 3RANA 4LJ4A 4CDGA 4DLWA 1GAJA 2DY1A 2P5TB 421PA 3TR5A 5BW8A 1NVXQ 3BB3A 3PEUA 3E70C 2JIZA 4QKQA 3PJRA 1KO4A 2JLWA 2GNOA 2OBNA 2C9CA 2YWFA 3TUZC 2RGDA 2FH5B 4YMUA 1H8ED 1ZJ6A 4JSTA 3AM1A 1U0JA 5KPJA 3FE2A 2F1HA 2GKSA 3D7MA 3K53A 3T06B 1BS1A 4Q4LA 4BFVA 4URXR 5L3RA 4A2QA 2CCJA 5EUMA 2QRNA 1WDTA 1K8RA 1JEDA 2YKGA 4AKGA 2I1VB 4YDSA 3HJNA 1NKSA 1Z0DA 1VCOA 2OAP1 5CJPA 5HE9A 3TAHA 3EPLA 3R8FA 4LBWA 4BLOA 2GXAA 2BDTA 1W4RA 2HXSA 3THXB 1Q20A 1R6BX 3MUFA 5EE3A 1E0KA 4NYMQ 5FPTA 2OILA 4QNRA 1XTQA 3DZDA 2KJQA 3LNCA 1E3MA 4PC2A 1E4YA 2W2TA 4TL9A 1G16A 2I4IA 3L8YA 2CJWA 1VTKA 1W46A 4QJ5A 3CNNA 3GLHA 4QBFA 1HURA 1TUIA 2QPAA 1R5BA 3OIWA 1S0UA 4IVPA 2YWHA 3O8RA 5C4MA 1G18A 3AF2A 2DFTA 3CPHA 4D25A 1G41A 1VIYA 4NL4H 1F2TB 1OE0A 1XZQA 4ON9A 3UPUA 1QG4A 4O2RA 4QG7A 5LPNA 3OFNA 2A5FA 1CIPA 1ZUIA 4MYTA 2J59A 2OFWA 5DE3A 5EXPA 3EIQA 3EWSA 5CB6A 4QOSA 1KZGB 1U8ZA 4FIDA 4LYJA 4MGZR 4OHZA 4IDNA 1UBEA 1XBTA 4ABYA 1E4VA 1JI0A 2CXXA 1JXMA 1E1QA 4PO1A 2OXCA 3SEAA 3OAAD 3WBKA 2FGJA 1JPJA 5JMTA 1U0HC 1DAGA 2G0TA 1IY1A 1OYYA 1T0JB 3THWA 2IHYA 5E95A 4MQBA 1DPFA 3P1JA 3SC3A 3DKPA 2HF8A 2OXRA 1BOFA 4FCWA 1CLUA 2B8WA 3PUVA 4UXIA 3RVBA 3RAPR 3DMDA 1IQPA 2NO6A 3SJZA 1M7BA 4C4PA 2IL1A 2ORWA 2PT5A 3VAAA 3KQHA 1SXJB 1NIPA 3U44B 4Y0VA 1N6NA 3GLIA 4PX9A 1Z07A 1COWA 2IBMA 2OBLA 4UNNA 1G4AE 5IRCD 1W7AA 1T5IA 1NVVR 3FGNA 1EFHA 1GL6A 1OXXK 2ZQ5A 3REFA 2W2XA 1CP2A 1E2DA 4RKFA 2VHTA 5F2EA 2EFCB 2YHSA 1ZP6A 2B8TA 2X2FA 5A0FA 2O8EA 2Z83A 3FMOB 1XMSA 2FSHA 2GEUA 2P6UA 3P32A 4FWIB 3IUYA 1S9DA 2GA8A 2IYWA 2J0VA 4MGYR 5CB8A 2O8FB 2IF0A 3GMTA 3X1YA 5JFGA 5KU1A 2Q3HA 2AR7A 2QMUA 4BZXA 3AQ4A 2V4ZA 1Q22A 5D3QA 2LWIA 2EYQA 2FDCA 4ZCMA 2BJVA 3ADCA 2YVUA 1ZNYA 1CXZA 1TQDA 2ORIA 1W0JD 1UKYA 2RGNC 2XXAB 4RD1A 5AUOB 5DN6A 4TMTA 3O8BA 2QEQA 1ZVQA 4Q18A 1W48A 3DM5A 2WKPA 4MH0R 4HSEA 1AM4D 4MUBA 4DIEA 1ZC4A 4DLYA 1SVMA 2OM2A 2HJGA 4Q7MB 3C5CA 4NCKA 1N5IA 1SVSA 4OKSA 4TYYA 2GBLA 4ZCLA 2JLZA 1RRCA 2IWHA 1XEWX 2VP2A 2IYTA 3E1SA 5GJBA 2FFQA 1UDXA 4A2WA 2A5YB 1UBCA 4O2LA 1E2HA 3T1TA 5EP1A 4TTRA 3BAFA 1RC8A 4CEJB 3PEYA 3AF4A 4AY2A 1S9HA 2JLSA 3SFVA 3TE6A 3ADBA 4CZ2A 1Q57A 1QHSA 4A82A 3NDBB 1GZSA 3FFBA 3SR0A 2REBA 5G40A 2YC2C 4YONB 4AG5A 1BYIA 3UANA 2O8BB 3REGA 5TY0A 3QUSA 3Q7PA 2RHDA 2QGZA 2EFHB 3KJEA 1P9WA 5CJ2A 4L15A 4EQ6A 2ZM5A 1N0UA 5GVSA 2ZAMA 3VQTA 2C8VA 4EUNA 2A78A 1G20E 1KJWA 2RKOA 3NBYC 4TL8A 5JHHB 4GT1A 1CJUC 1ZW6A 4BFZA 1Z2CA 1LF0A 1SQ5A 1NVUQ 1DO2A 4HAYA 4KBFA 1NLYA 2BC9A 5EE5B 2V7QA 3VR5A 5E3HA 3BH0A 1BKDR 5CDFA 2NMVA 1GSIA 3FHTA 1NN1A 3R20A 2H1LA 1E9CA 3GJ5A 1OFTA 1XTSA 2FU5C 4NPHA 3C8UA 4LOAA 4UNPA 2XOKD 3N5CA 1RRPA 4MRVA 4ZIRB 1WE2A 3LD9A 4BFSA 3BH6A 4B43A 3AVVA 4URUR 3BFKA 2R6FA 2JJ1A 4Q7LA 5FOVA 2QQEA 4NDZA 1HEIA 2A2ZA 3KKQA 1XX6A 4NCNA 2J0SA 2IYVA 1Y63A 1SVIA 2ANCA 2OG2A 2XJ4A 1IOZA 1X6VA 4ACBA 2G3YA 3B1ZA 2A3RA 2GZDA 3PFIA 3VTKA 4A92A 4OBEA 1DOAA 4D81A 4OHXA 4P31A 1GDDA 4TWZA 4UNRA 4TL6A 4UNQA 2GCNA 1G7SA 1TEXA 2DHRA 2OO7A 3JVVA 3H86A 1U0LA 5L3QA 5F98A 2DWQA 4DC9A 1S3GA 4PSVA 1N5KA 2QTFA 4KFUA 4D26A 1OH8A 4KI0A 4AKHA 3ZVLA 1IN7A 1XNJA 4EPXA 2GDJA 2WVJA 4BZPA 5E4FA 3I8SA 4CW7A 5DNYB 2GK6A 2Q3FA 4TMKA 2C5LA 3BH7A 3RSOA 3TK1A 3DMNA 3K0FA 1E79D 3O47A 3TUIC 2QT0A 4JT4A 4M9QA 3PUZA 1XWIA 1SVLA 1VCNA 5AJVB 4WZ6A 4CEHB 1OKKA 1SULA 2B92A 1Q12A 2ZI9A 4FXPA 2G9NA 3ASYA 4JBWA 5EZ5A 2GEVA 1GNRA 2BEJA 4KO8A 2PL3A 2ZE7A 2HT1A 1OFHA 1XJCA 1XDBA 4A15A 2BJWA 4KSCA 2WOOA 2V1XA 3KFXA 4CF7A 4IDQA 3K9GA 5FI1B 3FWYA 4B76A 1MO3A 3FMPB 1RJ9A 1OIXA 1E79A 2ZTSA 3B13B 1KI8A 4DCNA 1G9XA 4TLAA 4PSKA 4BWYA 5BYKA 2PCJA 2W00A 4FMDB 1TU3A 4R2IA 2G6BA 5A4JA 3NTUA 2HT6A 3FOZA 3PEWA 3WRXC 4RFSA 4UNSA 4DLUA 5TXGA 1P61B 1LTQA 1ESNA 4JBYA 4DBLC 2CBZA 1JBKA 4D82A 5KSZA 1NMXA 1TPZA 4JJZA 3KB1A 1ELOA 4BLTA 1E96A 3I72A 1Q0UA 4M1YA 1XTRA 4DUGD 4ESVA 1ZIOA 2BMDA 2ZRFA 1EK0A 1SKYE 1OT3A 4N0EA 3KDSE 3W5IA 1YQTA 2REOA 1IY0A 3TVTA 4EPRA 4YXWD 2GTPA 3H0KA 4Q4HA 4LBZA 2XSZA 1G5TA 1KMHA 2WWHA 2ZRPA 1MABB 4NP6A 4PAMA 2QM8A 3CPEA 4C0KA 3DHWC 121PA 5TARA 1QVAA 4A8JA 1UPTA 4IDPA 5FOUA 2MSDB 2FFAA 1OPXA 4JIMA 2IYUA 4PQRA 2DFKB 4W5JA 1ZM9A 4AYXA 3QQ5A 2FFBA 2QPOA 5J4VA 4JLOA 2WIAA 4DSTA 2K5UA 1KZ7B 2JLVA 2XZPA 1T3HA 2ZRIA 3K0CA 1DO0A 1KSJA 1NVWQ 2GCOB 2HXYA 2QAGB 5E7JA 1N5JA 3QVVA 5EE9A 1KJZA 1R8SA 3RSLA 2KSQA 2L0XA 2J7KA 3UATA 2IS4A 5UKDA 1E0SA 5FPHA 1W2HA 4GBMA 4U7DA 1JR6A 5G53C 621PA 3I73A 1U98A 4XVUA 3EW9A 1KO7A 2A5JA 3QKUA 5E7IA 2WWFA 4B3DA 1N6PA 4DRZA 1E9FA 5ELXA 2WJVA 5CYOA 1VPLA 1GIAA 1JAIA 3I5XA 3OIYA 2AHOA 2FG5A 3QXCA 2ZYWX 4KCGA 2I3BA 3ASZA 5FOXA 3RS7A 2HLDA 3VR4A 3W5JA 3ZYCA 5KUTA 3KQLA 1AKEA 2VP5A 3A58B 3RRNA 1Z6YA 1Z0JA 2H18A 1KDRA 2WM9B 3WMGA 1IJEA 4MRNA 3VR2A 1UEJA 5JEDA 5BYJA 3THXA 3ZZTA 1QHIA 3CZPA 1J7KA 2C95A 1SKYB 1N3BA 2JEOA 2JA1A 3P27A 4HUQB 5SZJA 2VLIA 1N6LA 1P3JA 4QJ4A 3AF1A 2GRJA 1CJMA 3B7GA 1YZLA 2EFGA 5JWOA 3CBQA 2AKYA 5J4LA 4OJQA 3EIHA 4M2LA 3BRWD 4UJ3A 1BYUA 5AUPB 3FTQA 2XEXA 1UEIA 3P4XA 4JLMA 1G8GA 3LO5A 8OHMA 3MJRA 1B0UA 1C4OA 2QAJA 4IFEA 3TQFA 1F2TA 4HZUB 1E32A 2QORA 4LHVA 4C30A 4A1FA 5KO2A 3FHCB 3CWQA 2IYXA 2C99A 1II0A 1W47A 3F5FA 1ODFA 1C9KA 3RS5A 1CJKC 5EE0A 1X8KA 2ZR0A 2BCGY 3DVLA 4KXFB 5P21A 1VG1A 4IDHA 3E5HA 5H8WA 3IIKA 2IXGA 3CR8A 3DL0A 2X77A 3GJ3A 5JCPA 2BHRA 1IN6A 5KSPA 3U2QA 1YZQA 2ONKA 2QM7A 1II8B 1W0KD 2PH1A 3CH4B 5H68A 3CWZA 2CL0X 3GFPA 3U7HB 5CK5A 1XJQA 1IXRC 3X1DA 2JJ2A 4TLEA 4IJMA 4DKXA 4C0JA 1E0AA 3KQNA 1Q44A 3GJXC 2FMXA 3K0AB 4M4SA 2MMCA 2W83A 4OQLA 1E2KA 3EASA 1G19A 3ZD7A 2YOFA 1HA3A 2G77B 2Z6VA 2IYRA 1S96A 4P4UA 3KQUA 1M34E 1EFUA 3S1AA 4TSFD 1J90A 4B34A 4OK5A 1SXJA 3U44A 4U5XA 4DSUA 1FMLA 5CYPA 4RKEA 4TLCA 2OZEA 3JVUA 4Q7JB 3V4FA 1VDZA 2XTMA 4V0OA 4B71A 2YOHA 3RRYA 4BZQA 5JI2E 4IFBA 4TQUS 2RGGA 2PT7A 2BOVA 2IYQA 5DHFA 2O8FA 3BE4A 4Z1MD 1XB2A 1EXMA 5H1YA 1W36C 2WJJA 1BMFA 2W6JD 3A37A 1Q21A 2V9PA 3RWOA 5B30A 4TSFA 5FL3A 2XNDA 4ILEA 4D80A 1MO5A 4JLVA 3VKHA 4MRSA 2OFOA 2AFIE 2OCBA 3QEOA 3BD9A 2XXAA 3LV8A 3IEVA 2ZETA 3RRZA 2YJTD 4V0LA 4AKIA 3BERA 2GZHA 3GEEA 3D8BA 2TMKA 4XOIA 1ZM3A 2GF9A 4DCVA 1W44A 3FMFA 3F3YA 3OEEA 4TTQA 1SZPA 3IGFA 3P4YA 4HAZA 1SVWA 2CCKA 4US0R 4V0ME 4U00A 1KAGA 4A0GA 4L9SA 2HYDA 3BFXA 4NYIQ 4Q21A 3QKRB 5AK0A 3I4LA 1WP9A 4M53A 3A1SA 1G8PA 5KNCA 1WF3A 1XD2B 2IA5A 2FEOA 3HR7A 2ZYUX 1VKJA 3WXMA 1ETUA 2QG6A 1L4UA 3PUXA 5FUVA 3W3ZB 3U4QB 4D0NA 2O5VA 5JWRA 3FKSD 1YR9A 1FQKA 4ERNA 2CHVA 5EP4A 3HWSA 5EUQB 2O8BA 4A0RA 1ZNWA 3IO3A 1XMIA 1JB1A 2P5SA 1VHTA 4NONA 5CM8B 5EXSA 2IXEA 3G0HA 4F4CA 1DBSA 2PZEA 4IDOA 5KDDA 2DWOA 4LPSA 1D2NA 2VSXA 2BBTA 4XH9B 3GLFE 3QKTA 4KYIB 2OAQ1 1AK2A 4QBGB 2EQBA 5LB2A 3BJIC 3BK7A 1E2LA 1YRBA 2CK3A 4AD8A 1W5TA 1EFRD 3MSXA 5EZ6B 1P4SA 3SYLA 4LHWA 3AKDA 2KWIA 3TSWA 1FUKA 2FFHA 3SOPA 1E1RD 2NPFA 3NH9A 1TNDA 3Q72A 1IN4A 5EP2A 4CGZA 1VG9B 1B23P 4ZIRA 4R71A 4EAQA 3BBPA 2JLRA 3RRMA 3SYNA 1ZMXA 3EC1A 1XPRA 5KSOA 1CRQA 1NN0A 2D7CA 1GM5A 2HCBA 2IXFA 2N46A 4W5WA 1Z0KA 1GL7A 4I1OA 4QGHA 1NMYA 2IYYA 5JJKA 3EZ9A 1RE0A 1KI6B 2GAOA 3EXAA 3CM0A 4TLDA 4ESHA 1IHUA 2Q21A 4XWKA 3FFAA 5K8UA 2XAUA 5JECA 1FTSA 4XSGA 3LFUA 3LQQA 3NHBA 3MMPA 1VYVA 1FX0B 1W5SA 3QXSA 5GJWC 5FOSA 1W4BA 1I2DA 1RIFA 4LV8B 1DADA 4QBHA 1FW6A 5IK2A 3NEJA 4D2IA 4QGGA 2WWYA 2VP6A 2QE7D 4MYHA 3IEUA 4FWTA 5FPKA 1QHHB 2GJKA 1AA9A 5TVKA 1U2RA 2WSSD 4PAQA 5L3SA 1DEKA 3C41J 2J0UB 1AS3A 3NHAA 1TF5A 3AVOA 1DS6A 4LC1A 3CX6A 4B2IA 2QBYA 3T1OA 3QXHA 5K8IA 3GLFB 1ZRHA 1MO6A 3U6BA 4XVRA 1ZD9A 3WY9A 4NYMR 3EX7C 4I1UA 5BN5A 4BLQA 1H8HD 1W4AA 3Q85A 2GXQA 2WKRA 4BRUA 4CEHA 4JVSB 4TMVA 4V0NA 5B2ZA 3AVPA 3VKGA 3I1FA 3AEZA 2AFHE 3L43A 3IIJA 1RRGA 1AS0A 3AF0A 2QE7A 2QMEA 2XB4A 3K09A 5AJZA 4J0QA 721PA 1CEEA 1YKSA 4PXAA 2VHUA 2J3EA 2ZRCA 2AK2A 4RY2A 3KTAB 3AGPA 4L4UA 1ZD8A 1P7CA 3NXSA 2IUSA 2GXSA 4C9BA 2ODNA 2D7DA 4YQFA 2RHMA 4URZR 1G8FA 1KKLA 1WA5A 4PTLA 2J41A 5TV2A 1OB5A 4YDHB 1DARA 4DIDA 2ZRLA 3SBDA 1TQ4A 4AI6A 4OYHA 3L2OB 1RVDA 1DAFA 1N6IA 1H8EA 2QSZA 3H2YA 4NH0A 3W9YA 4EIWA 3C15C 3ETLA 4ZDJA 2QTHA 3K9LA 1W36D 2WTUA 3OIUA 1A2BA 4LV5B 4Q01A 2VHJA 3SJCA 2G0NA 1X3SA 1TX4B 4IKEA 3TNFA 4LSGA 1NN5A 4PPFA 4MDEA 2JDID 2C98A 3MWJA 4PPNA 3B82A 2IUTA 2ZS7A 2VHQA 4RD4A 3PVSA 3FPAA 2R62A 2WJGA 1LY1A 1AQUA 4EPVA 4NBSA 5JLJA 3L8ZA 2HV8A 2QP3A 2JATA 4RJLA 4TYPA 1WRBA 3T34A 3TAUA 1T91A 4K8OA 5K8LA 1ZINA 2ZRGA 5G3YA 3TGPA 1DAMA 2OLKA 4S35A 3ZDQA 1VYUA 2FJUA 3GPLA 1E2FA 4LBVA 3B1WA 1C1YA 5JBQA 2ZRMA 3GJ6A 3B6EA 2GCOA 1MV5A 2QAGA 3TW8B 1JQLB 1P75A 2WPDD 3DEFA 4AC9A 4MKIA 1P9RA 3H1TA 4Q47A 1KNQA 1P2UA 2ZRJA 3CH5A 1MT0A 2NOAA 1VG0B 3MD0A 4Q5IA 2ZSFA 4M1WA 1KIMA 2PX3A 5JSZA 2VRWA 4QC2A 3EIEA 4EPWA 2EWWA 1NF3A 4O25A 2LCFA 1Z28A 5FL7D 4OK6A 3HU1A 1UKVY 2Q9CA 1OH7A 1Q1ZA 3LAWA 3GJ0A 2Q9AA 3PG5A 2F7SA 5FR2A 2WAYA 4Q4JB 5FBRB 1JALA 2KB0A 4LCBA 3EWAA 1KK3A 1MH1A 3T15A 3OAAA 2F1JA 4PHFA 4DLRA 2DPXA 4IHQA 4TMZA 1XTIA 4R98A 4FMCF 1G6OA 1G7CA 2O8CA 4DB4A 3K0SA 2BBOA 3SJAA 1SHKA 1N2CE 2OBMA 4RZUA 1E9BA 1FUUA 2NO7A 4E07A 5FPSA 1F48A 3FKQA 1TADA 4OI2A 1KI3A 4M9XA 4BGDA 2OV2A 2R44A 5BWMA 1KY3A 4D4JA 3IQWA 4C0BA 4HAVA 3NEYA 4LJAA 1Z06A 4GMXA 4I1VA 4BFXA 2VF8A 5BN3A 2ZJ8A 3ZQ6A 4EJSB 1J99A 4UKDA 4AK9A 5KNBA 1E2EA 2EFDB 4KFTA 4A8JC 4QHTA 5DGXA 1GRQA 1JXOA 4F38A 1YZKA 1AKYA 3BFVA 4HB2A 2ZJ5A 3HPRA 3Q9LA 2E87A 1NBME 1ZYUA 1II8A 3GFOA 2O8DB 1YR8A 1IM2A 1E2PA 3K0CC 1Z22A 1E9AA 4EJSC 1N0WA 5D3MB 3IHWA 5E7MA 4XTRA 2WBLC 1NLFA 4JVLA 4R2HA 1W0JA 2VSOA 2F1RA 4MDFA 3THOA 3AUYA 4HLCA 4RD6A 3RS0A 2NO1A 3QY0A 1Z6AA 1MKYA 4Q9HA 3TRFA 3HP1A 3SNHA 1AGPA 1E6CA 3ZZUA 4BLPA 4P0TA 1RYHA 4LUCA 3EG5A 4BECA 4F7WA 3QOFA 4KITB 2ZE8A 1R8QA 2ZI4A 3QF7A 1NJFA 2F3TA 2FSFA 1WQ1R 3VU9B 2QRZA 3BB4A 3KKNA 5K8TA 2EFEB 1D8TA 2DFNA 2H8KA 5JRZA 2P2LA 1YE8A 1OYWA 3KUDA 2JASA 3QPVA 3R7WB 3BC1A 2FZ4A 4HLDA 1RZ3A 4LJ9A 1U9IC 3GLGE 4TMXA 1R2QA 3FVQA 2GVDC 2IEYA 3M6AA 4E09A 4RD3A 2A7QA 4KYUA 1KOFA 1DAKA 1N6KA 4QNMA 1HT2E 5DSZA 4EFNA 3LVRE 1HT1E 5KHOC 2ZITA 3K70C 4OHWA 4IOKA 2QTVB 4D4LA 4MUAA 3VR1A 4A36A 2P67A 3U7EB 4M0LA 1UFQA 1PLJA 4B33A 3PEVA 4G3XA 4DT1B 1L8QA 1S1CA 2AXNA 1DVRA 2FA9A 5JI3E 4X8MA 5BQ5A 4JBXA 4OI0A 4IVRA 4Q48A 4NMMA 3R9WA 4B35A 1OH6A 4D4KA 1U99A 3I61A 1TMKA 2WWIA 4JZKA 1ZBDA 2ZUBA 1P62B 4PHGA 2R2AA 1XEWY 1ZCAA 4K81B 3WHLA 2YV5A 1J8YF 1NL3A 1AGRA 2CMKA 3PITA 3SHFA 3QKRA 4PR0A 1KGDA 1HE8B 4LC0A 3M4YA 4CYMA 3T1QA 2ZSBA 3B1YA 4BUJA 3SDZA 3VR3A 2XOKA 3Q7QA 2P6NA 4YMTA 4KFRA 1BH2A 4ZI3A 1NIJA 3U4QA 3T5GA 5HZKA 1DTSA 1E2NA 4WAUA 3ND9A 3RABA 3QIAA 1DG3A 1Z63A 1X86B 5DYGA 2A9KA 5KSYA 5LB4A 1N6OA 4TT3D 2ODWA 2GVZC 2G1JA 5JCZA 1CJVC 1QHGA 1Z6TA 2VEDA 4C0AC 1SXJC 3GLGB 1R0XA 1XPOA 2PMKA 3AKEA 3W6PA 5CIQA 3X1ZA 3BS4A 4PSAA 4BPBA 1YZGA 1XCMA 1T8UA 3NBXX 3TR0A 1I4DD 3AV0B 3E2IA 3HU3A 3GLHE 3UG6A 1YVDA 4BE7B 4KLZA 4CIDA 4Z8YA 1Z5ZA 1KTVA 1QG2A 5GJVC 4ZV4A 3WMEA 1LNZA 4FMBB 4IW3B 3A1VA 3IILA 3QG1A 4MKHA 4B47A 4DJTA 1E99A 4MITA 1LVGA 2MSCB 2YZ2A 4FINA 1OXTA 2WWGA 1OFUX 2RH5A 5HCNA 4LYFA 2HEIA 3IDQA 4GZLA 3T12A 2FE4A 1E9DA 2VTKA 1KAOA 2HJVA 2ZS9A 2IHBA 1N25A 3MG9A 1KI6A 1Z08A 3KKMA 2GEDA 1NG1A 2D06A 4JLBA 3VX4A 5KDOA 4NZYA 4JL8A 2OCYC 3R9XA 3VNVA 2H16A 2WV9A 1CS4C 2NZJA 2RGXA 2DCUA 3MAAC 3QF4A 1FX0A 4LJ5A 2GF0A 5G41A 1V43A 3CX8A 4F4JA 2G1KA 1OH5A 3CO5A 4WZBE 1QRAA 2GILA 1AQYA 2Q0HA 3AVQA 4DLZA 1EWQA 1GILA 3QXJA 4HYYA 2NZ8A 1JJ7A 1QHHA 2AK3A 5SZHB 1QHYA 1A5TA 1AZSC 2CLSA 2J0UA 3WNBA 4Q1BA 2NTYC 2ODBA 4KODA 3U3RA 1RKBA 3UMRA 3N2EA 1X8JA 4FMCB 4GSYA 4A4DA 3QSYA 2GCPA 4G0NA 1W36B 5JHGB 4XD7D 3SYKA 4DUGA 3V4RA 4C0LA 1FZQA 3H4MA 3U5ZB 3SJBA 4URYR 1DE0A 2NO0A 1KDPA 4PC7A 3SS8A 1CRPA 3M1IA 4WVFA 2OLJA 2F1IA 4WA7A 4RVCA 4HB0A 4M22A 3R9IA 4YXWA 2ZI6A 1ZUHA 4GZMA 2EVWX 3AP2A 3C16C 3I8XA 4E5UA 3KZ1E 4DDUA 5JEEA 1MOZA 4URWR 4DLXA 1XD9A 2HUPA 2W0MA 3WRYC 4AYTA 5IT5A 3KQKA 2CCGA 2IX3A 5AJXA 1XZPA 4DCTA 4EKDA 1D2MA 1UF9A 2ZAOA 2I1QA 4LDJA 1KI7A 4WZAE 1DAHA 4WIAA 1KI9A 5FTNA 3J81k 4GP6A 2FF7A 2IS2A 3EZ6A 3WYFA 3ONWA 3PUYA 2J87A 5C18A 821PA 1I2MA 2F43B 2BV3A 2ZR7A 5EE1A 4OI1A 2JLYA 4TYWA 2E1RA 2FN4A 1MO4A 1HQCA 2PLRA 2V6JA 2ZJZA 2FSGA 4P3YA 3W6OA 2O0KA 1KNXA 3THWB 2YYZA 4KV9A 3SQWA 2D2EA 1IXZA 4NTZA 5J4YA 2BIFA 1XXHE 3ZJYA 3AB3A 5DO9A 4HDQB 3GQBA 2KI5A 2GZAA 3T35A 4A2PA 5TMPA 4ARZB 2ORVA 3SBEA 4Q1AA 1FNMA 1JPNA 3X1WA 1M74A 3AP1A 4PC1A 4GNKA 4US1R 3UIEA 2ZYVX 3IO5A 3PXGA 1J8MF 5J4HA 2BKUA 2PX0A 4X8LA 2CLDX 3A36A 4N3NA 1G7RA 1KDTA 2ASEA 3LY5A 2DFLA 3T1VA 2BBSA 2VPPA 4P32A 2KBFA 4DEYA 5FBLB 1OFIA 1G3IA 1Z2AA 4FW9A 4A0HA 3TQCA 1JR3D 2HDNB 5FBQB 5KNDA 2SHKA 4Q66C 4E22A 4IRUB 1DELA 4FCVA 3VR6A 2W6ID 2ZI3A 3QENA 4HZIA 4ZKEA 5KPDA 1T5LA 4QFMA 1L2TA 1UKEA 3UWKA 3ZH9B 5CDFE 4BLRA 5JS7A 3U6KA 1W2GA 2YWGA 1Z47A 3I92A 2B6HA 4D0LB 1XTKA 4XWAA 3WP0A 3O8CA 1XP8A 1GRNA 2CEAA 2OSBA 3CB4A 3CRQA 3SN6A 4DZZA 1E0JA 1OXUA 1TL7C 2VO1A 1N5LA 1GWNA 3A6PC 2VP4A 5HKKD 4LV6A 5FFMA 1XMVA 1WXQA 2ZSEA 1OHHD 4B32A 2V55B 3HYRA 2NGRA 2JLUA 3VNUA 1ZD1A 2AWNA 2BM0A 1CULC 2ZE6A 4B3BA 1T3LA 1EX7A 5G3ZA 1W0KA 3U3KA 1P60A 1QBKC 1XXHB 2ZRBA 2C04A 4LX0A 1LB1B 1KJYA 4G5SA 4GRAA 2QENA 4M1SA 4NYIR 3VHLB 3DPUA 1PLLA 2CNWD 1NMZA 2QA5A 3QI2A 3UMFA 2J1LA 2IWRA 2ZJBA 3IPXA 2P6RA 2ZXUA 2ZI7A 2XB2A 1D2EA 1ZU4A 3CF2A 1GP2A 1IXSB 2JLXA 1HYQA 3TJZA 3R8CA 3BXZA 2DBYA 3B60A 3ZIAD 3Q3JB 1IY2A 4QHSA 3B5JA 4CEIB 4JKIA 3ZVRA 4TQ9A 4PANA 1FPMA 2KBEA 1G291 3OESA 4PHHA 3DOFA 2G83A 1ZAKA 1N6HA 4OK3A 2CDNA 1XEXB 2HCJB 3N70A 6Q21A 3ZLJA 2BCJQ 4MYUA 1RPZA 4Z1MA 5HR5A 2BWJA 2J46A 5AJWA 5EP3A 2ZROA 1U8AA 3HR8A 4HI0E 2W6JA 3D6TB 3M0EA 3EPHA 3CRRA 2QAGC 4Q19A 5D3MA 1R7RA 3D3QA 3LX8A 1G7TA 4PZZA 1KSGA 521PA 2AXPA 4LHZA 3WP1B 2QGNA 1KO5A 4CEJA 4IVQA 4PC6A 2AN9A 2AKAB 2XGJA 1CTQA 1JNYA 2Q9BA 1L7VC 2LKDA 1US8B 5IF9A 2XZOA 4KFSA 4P4SB 4HDOB 1X1SA 5B57C 4PO9A 4Q1DA 2E9SA 2CHGA 3RLFA 4OQMA 3QBTA 4WW0A 4KJZA 1P2SA 1KKMA 1W1WA 3Q5DA 4LBYA 4N0DA 5FTJA 3U60B 1KK1A 4PFSA 3SQXA 3CF6R 4V03A 5KTYA 4CT5A 2GAAA 4I99A 4AG6A 5FUYA 3R7WA 1NN3A 1QVRA 2VA8A 1NBMD 3U3OA 4US2R 2IYLD 1JJVA 3AVTA 2HF9A 1GNPA 5L3VA 3CONA 4I4LA 4MRPA 3SE0A 4C0HA 3UG7A 1PV4A 4GDFA 1VCMA 3QE0A 4F4IA 3U61B 1R4AA 2FGKA 4QGAA 3EARA 3LLUA 4AURA 3EA5A 2DWPA 3FKSA 3PR1A 2OT3B 2J5XA 3K0FB 4Q9JA 2UZ3A 3KB2A 1FP6A 2CLCX 2WMNB 2IYSA 3DDCA 3SZRA 1PUJA 4HLQB 3L0OA 4XJXA 4BASA 3RS4A 3SI7A 2F55A 3NBFA 4DT1A 3BB1A 4G5QA 1ONBA 3SU8A 2ZS8A 1I4TD 1WBDA 1FMJA 1GG2A 3L0IB 3RC8A 1I4LD 1YZNA 4DLTA 2RAPA 1JQJC 3OEHD 3HDTA 3KJGA 3CX7A 5CLQA 1Y3AA 1ZU5A 3QPWA 4BFTA 2ZJ2A 1F6BA 1XF9A 1ZM2A 2Y8EA 1PVOA 1P6XA 1EFRA 5JRJA 4IEEA 4B3FX 4L5BA 2ONJA 3CW2A 1D9XA 1E1RA 2J7PD 4QGFA 1MRNA 1XD8A 2GBLC 2WMOB 1BIFA 1TU4A 2VQSA 1CU1A 3Q5EA 4JJKA 4W5HA 4QM7A 2PEZA 1Q1BA 2R6AA 2V3CC 1S2MA 3B1VA 1H65A 4RFSB 4TZ0A 2BVNA 4HATA 1NSTA 1XCPA 4OI4A 4OQNA 5BN4A 1E2QA 1FP7A 2JGNA 2PEYA 4C2TA 3CIOA 4TYNA 2B21A 2RGEA 1YHNA 5JS8A 4HLUA 2G88A 3C4JA 2QSYA 1VG8A 4KU4A 2JIZD 2QZ4A 2H92A 1UAAA 4PAOA 2RMKA 1KMHB 2PJZA 1YR6A 1NLZA 3NIBA 4L8GA 1G5RA 1S4QA 2J9RA 3VKWA 1AJEA 5DLQC 5IDVA 2Q6TA 3L82B 2ERXA 4A8JB 4DLVA 2WSSA 2N1BA 2QQ0A 1D9ZA 1VIAA 4XVQA 4DHEA 3QKSB 1KSHA 4Q00A 3B2EA 2CL7X 4W7SA 2ECKA 2CL6X 5DH9A 1KYIA 5HE8A 2RB4A 1K6MA 3WYGA 2C77A 2RGBA 5KOYA 1G3UA 1T3SA 4Q4AB 5FPYA 1KK0A 1KDOA 2P3SA 3AF3A 4ZDWA 1KI1A 3PQCA 4NYJQ 1XU4A 1H8HA 2WOJA 1WMSA 2ZPTX 4TYQA 4BQSA 2ZE5A 2YC4C 5LD2C 1YR7A 3IQXA 1JR3E 1RRFA 2RCNA 3FHOA 3UWOA 5CM9C 4H1UA 4S2EA 1T8TA 4RD0A 3QNUA 3MJHA 4JLPA 3SFZA 4C7OB 4B44A 4MGIR 4NCHA 3KKOA 3PUWA 4JL6A 2GHIA 3WMFA 3PCRB 5JZVA 5FR1A 1E2GA 2IF2A 4B3XA 5HPYB 3B1XA 1P2TA 4MA4A 1K5DA 2FV8A 5A5GA 3NVAA 4RZ2A 1MABA 1F2UB 1UJ2A 4PC3A 2H17A 2B7CA 3NH6A 2PZFA 3OFND 1SXJE 2BEKA 2FX3A 3L0PA 1R10A 1EGAA 2Z0MA 3A8TA 4WBSA 1UADA 2W2VA 3B9QA 2ZU0C 3GEIA 1P73A 4V0KA 3RS3A 1D5CA 1KY2A 5CLLA 1JECA 3FDIA 4A0FA 3K70B 1E1QD 4TL7A 3OE7D 5GADl 3C14C 4L16A 1ZM4A 2JDIA 4AYWA 3UK6A 2GXUA 4G5GA 4GI7A 4GOXA 2QMHA 2D62A 4FMDF 4Y0AA 1MR3F 3ND8A 4ASUD 4B2LA 5EJEA 2OHFA 1N6RA 1A82A 1CR4A 1E2JA 2C03A 2H57A 2R9VA 2VBCA 3V9PA 4MKGA 2C9OA 2WJYA 3OE7A 4ZO4A 4JSYA 1COWD 4HUTA 2P0EA 1ZUNB 1W49A 1LS1A 2F43A 4TTPA 3LVQE 4LJ7A 5FI0B 3PV0A 3VMFA 2WPDA 4X8HA 1P2VA 2F9MA 4HDCA 4IOLA 5SZKB 4B73A 1Q1EA 4C0QC 4WOPA 1QHNA 2UKDA 4B48A 5TB5A 2XTNA 2AWOA 2QROA 4HUQA 3P26A 2OUKA 1KHTA 1O3YA 3W3AA 1G4UR 1Z6XA 2J0QA 1N0VC 3TW4A 4ASUA 4NCJA 3B78A 4NE2A 4ARZA 5GJCA 4V02A 1NP6A 3OHMA 1VHLA 3S1AB 5FL7A 3ZD6A 1GITA 3AP3A 1OV4A 2YNMA 3IBGA 5DISB 3KX2A 2NO9A 5DN6D 4X8OA 2WSMA 4HZUA 1TUEA 4ZPXA 1CBUA 4URVR 1GTVA 3HYTA 3BGWA 2MMGA 1VCIA 1OIWA 1Q1QA 2LKCA 1BO6A 1OW3B 2IK8A 2WJHA 2XITA 2ZRKA 4JVNA 1E98A 3ADKA 2QPTA 2DYKA 3LBIA 3QEJA 5FUXA 2A5DA 3KXLA 2NPIA 2VYFA 1ANKA 2PJRA 3CZQA 1Z6GA 4BEBA 3CPJB 5DYIA 2ZIAA 2ZU6A 4M1OA 1K5GA 1RFLA 1F3OA 4DDTA 3T5DA 3QPUA 5L3SB 4YLGA 1SKQA 3EPKA 2FPLA 2ZRAA 3TBKA 3VHXA 4F92B 1G3QA 1G5PA 2C9YA 3DZ8A 2VP0A 3RS2A 2BBWA 4PPQA 3K0AA 3HPQA 1E9SA 4PZYA 1PUIA 4RD2A 4ZCIA 1M2OB 1X8LA 2XJ9A 3NC0C 1NVVQ 1U8YA 3WYAA 4C3ZA 2IEZA 3A1TA 3AH8A 5DI3B 4Q1CA 1G64A 4TLBA 5HTKA 4OQFA 2D2FA 1V5WA 2FPMA 1G3RA 1XXHA 3EC2A 1IBRA 3TMKA 1EESA 2W58A 4U02A 2V8OA 2V54A 4XWOA 3THYB 4DLSA 2DR3A 2IC5A 2V7QD 3F0TA 3G5UA 3RDPA 2QMOA 2PLFA 4RFVA 4DSOA 1OJLA 5AUQA 3FYHA 4WXRA 3GD7A 1XPUA 3MCAA 1Z29A 4LK2A 4Q1EA 3I3SR 3MWKA 4JLNA 1AIPA 1KSFX 1ZCBA 4Z51A 2ANBA 5EXXA 3TSZA 5AUNB 4TN1A 1NRJB 3TLXA 2F3RA 2JJ1D 1XJ0A 4CEIA 2ZRHA 4D6PA 3DKVA 4GP7A 4WXPA 2MSEB 2ZJAA 1FOEB 1JAHA 3QXXA 4A6PA 3EZFA 2EW1A 3NKVA 4JL5A 4ZI2A 3LXRA 2AX4A 4C0SA 4QHYA 1XEXA 3FMIA 4IOJA 2IW3A 2CVHA 4KVAA 1YU9A 4N1AA 4OQXA 4HB4A 1A2KC 3U3JA 3WBJA 1CF4A 1LW7A 2BMEA 3LBNA 1NY6A 2ZI5A 4JKYA 4DCSA 4KSBA 1RW4A 1M7GA 5J4KA 1GNQA 1T4GA 3WNDA 1XD2A 2QI9C 4AIIA 1KI4A 5KDLA 4DCUA 2UVQA 1T0HB 2R6CA 1O87A 1ZIPA 3LW7A 1US8A 3TIFA 4ZKDA 2P65A 5CK4A 1G8HA 4P4SA 3EZ7A 3GJ7A 1J2JA 2Z4RA 1GL9B 1OXVA 2N42A 1GUAA 3BWDD 3FB4A 4DDWA 2JJ8A 2GJSA 3UMSA 1QZXA 3ZQJA 4PO8A 5AJYA 5FTMA 4CRWB 4G1UC 1OKKD 1NNEA 1Z3IX 4P4TA 1TF2A 3T61A 4A6XA 1Z0AA 3LH5A 1TQ6A 4BFUA 1D6JA 2XTZA 3KXKA 2HYIC 2XZLA 1IAQA 3DM9B 1UBGA 4LPKA 4QM6A 3C5HA 5DI9A 2QU8A 2ZANA 1Q3HA 3K0EA 4Q9IA 4R9UC 5FTKA 1IONA
chains in the Genus database with same CATH superfamily
2IS6A 3AILA 1XVIA 1NJSA 1YZVA 4NECA 2OEPA 1OMOA 3RNLA 3NVMB 1AMUA 2OBXA 1FSSA 2WZQA 2BGTA 4FR5A 3W1WA 2F1OA 3JZAA 3PQ8A 1Y7PA 2AUTA 1E4EB 1HNNA 2YWDA 1U90A 3FN4A 3HWX1 3DO6A 3TSOA 3BZUA 4POAA 3HSKA 3Q8XB 4M89A 3BRCA 3MMNA 2CXHA 2JK1A 5GONF 5GV7A 3LSTA 3ZU4A 1UFVA 4MB0A 2FP4B 4JGGA 4Y6QA 5CT6A 4EA9A 1RC1A 2BMWA 4J3NA 4DZRA 3I6YA 4HAUA 2V7EA 3Q3EA 3P20A 1FFCA 1ZZGA 4AJHA 3FNEA 1U9YA 5F4BA 5M5BA 4CQJA 4XX1A 2UUOA 4P3PA 5DLYA 1QYXA 1AKNA 1YNOA 4UTPA 1U0EA 4NMXB 2W71A 3LLMA 5KTMA 1RLJA 3JYQA 1OAOA 1K3TA 4PBTA 1CQIB 1KDVA 3H42B 2OR3A 4UZEA 1V5EA 4K6HA 3IQGX 4M1KA 4Z9AA 3K1ZA 5B36A 3QG5A 2QN6A 1TTHA 4DAEA 4DN6A 1YBVA 4H77A 3MJTA 4QRIA 3W5SA 3KEGA 3KUCA 3U7GA 3TXAA 5DTQA 4Z54A 4G5RA 3MWLA 4TXNA 3ZCUA 4BJ5A 3G0IA 3IV9A 3M4NA 3GWZA 1JG7A 4EGJA 4DV6B 2IS1A 1YBAA 5LMCA 4YJHB 5ALHA 4LOJA 4EY4A 2YWEA 3JD0A 3O8DA 4ZYYA 2D3WA 5REQA 1M8FA 1Z0FA 3QVLA 3WLRA 1NGSA 3GLIE 2X9LA 3DULA 1HTWA 1SKBA 1JS1X 3AIOA 3PZRA 4TS4A 5AICA 1QH8A 2JGLA 1U7HA 3ECCA 4LGVA 5HOQA 1ZHOA 3KYCA 2F8LA 3QTLA 5IAGA 1QVZA 2QD4A 1OXKB 2CJWB 3TFWA 5B58C 1O1YA 1R18A 4DABA 1UBMS 1L1EA 1OLOA 4F6RB 2BFDB 3BIOA 3MFYA 4HH1A 5J47A 1M1YB 2FOLA 4EECA 4JVMA 1CEQA 3BWYA 5CNIA 2RGWA 2H8GA 1PW7A 3AR7A 3WNVA 2UZIR 1OI3A 4K1XA 4AY6A 3ICEA 2VSFA 1Z0IA 1M8PA 2R1UA 4MKFA 4TRMA 3WGMA 3WV4A 3ZCQA 1F8UA 1E61A 1Z56C 1XTTA 1FL9A 2BKEA 3DFKA 3EFEA 1VSTA 3RHFA 1ZITA 1GTZA 4QTXA 1SVNA 2P91A 4E03A 5KYUB 2PMDA 1MB4A 1M8JA 1NR1A 2H2IA 3Q1LA 4LISA 4RXUA 4UUBA 5FUWA 4EGCB 1HFEL 2VBIA 2X23A 3IHLA 3GMSA 2VDWA 3DE7X 4ZU1X 1SCNE 4QPDA 1OY1A 4YMWA 1ZNZA 2JAWA 2P4HX 3MWYW 2G4CA 4Y7CA 3NYQA 3VR6H 4M0CA 1KY4A 4B0PA 2AZTA 1GG8A 2W2LA 5LDDC 1SOVA 3MJFA 4HEJA 4XGKA 4BJ3A 4YJGB 4WESA 4YGXB 2RK3A 5FBVB 3NOQA 5ALKA 4QUGA 2I33A 3ZXXA 2FRVA 1SA0A 2WKQA 3JYLA 4HAXA 4F97A 1E66A 1OR8A 2ZSHA 5JSUA 4RZIA 4TV8B 5AR1A 5JSZB 1LFAA 1WPRA 1ZOPA 3ZD9A 4WZBB 4EB8A 2XADA 4LYAA 3AR6A 3A4VA 2V7WA 4IEIA 2LUOA 3CR7A 2OE2A 3PIRA 1FFHA 1TOAA 2LVBA 3FWNA 5AW3A 2FZGA 2XMDA 4EFLA 2WJIA 3GZ4A 5B53A 3JYNA 5I7SA 2XYHA 2ZJYA 1W5BA 5GGYA 4DDVA 3TPCA 2Z8XA 3K8YA 2YQ5A 1HDXA 2EU8A 1TEVA 4WCFB 1BD4A 2WSYB 4HVAA 3M81A 1PEAA 3QLTA 4LGMA 4F84A 4DB2A 1L8AA 3CRW1 4NCIA 5JO9A 2WJWA 4QFDA 1G17A 2O54A 5IBCA 2JI7A 1JMYA 1DEXA 5DHAA 4XM2A 4LOHA 1YBMA 3FSJX 3W4IA 2LIPA 1WB5A 4HDAA 2CVFA 3UV7A 5HFNA 2CFTA 2E6KA 3TLGB 1GZ3A 4EITA 2O2ZA 1CR1A 2YIVX 5L8VA 4G37A 4JJ4A 2VOEA 1TJYA 4M9SA 4OHKA 2O52A 4C5AA 4EPYA 2QL6A 3G2KA 1EFVA 1KVTA 2DFDA 2PGJA 1RE1A 2O50A 2R8YA 2XWPA 3JQ7A 3RV4A 3ZUGA 3DJFA 2RKBA 2PCLA 5CMLA 2F9LA 2Y4OA 4ZVPA 4MVJI 1PK9A 4DIOA 3MN1A 3BXOA 5ECWA 3RFUA 3I9OA 4TXMA 4UCFA 4FFLA 3RWMB 4N9WA 4GYJA 3DZJA 5CB4F 4II7A 1LPAB 1XRJA 3A25A 4DYDA 1PGNA 3BHIA 1M0WA 1UH5A 4MVCA 3D1JA 3F5DA 1A7JA 4FEGA 3UVEA 2XXJA 5F9MA 2QJOA 5FV4A 4GI2A 1Z3CA 4GGPA 4E4YA 3PT9A 3I3OA 3D3WB 2ZUDA 1E9EA 1RM3A 3R3HA 4JYBA 1LLCA 2HJ9A 1E62A 4RMNA 5GZ6A 5H4GA 1TE2A 2AG6A 5CCBA 4NENB 5JTUA 1A2QA 1NSYA 5LN1A 4ZVUA 3LZCA 1LCIA 2QIOA 3B8HA 3UFXB 2AGVA 3OWOA 1QHEA 5DGHA 4DNPA 1JTEA 4AJJA 4K05A 5JG7A 3T7KA 3VPSA 2G08A 5AI5A 3VDRA 3O8QB 3QVUA 4X1YB 2GM9A 5B64A 4HH0A 1S1MA 2BGIA 1YJAA 4M21A 2Q5OA 2O0HA 3GRKA 1E9VA 4IXDA 5I01A 5EJ9A 3LI2A 5FB3A 1JKMA 3FPFA 4KX3A 1VLJA 1BVRA 1Z8FA 3DUFB 4PGGA 1C81A 4OBBA 4PYMA 2FLKA 1BMFD 4N8DA 4QBKA 3DW1X 1U0NA 5HKKA 3VV3A 3F4LA 3PFNA 2TRSB 5BO5A 2GARA 3IKVA 1T2UA 4H7EA 1YZUA 2XUGA 2HD4A 4Z0NA 3GJ4A 5IZ4A 4O5AA 3D5EA 1JLRA 4O6VA 4RLFA 4QPCA 5CVJA 3T3IA 4DLAA 4GRDA 1DOHA 4EQ6B 1P9NA 5EQTA 4UDYX 4RCZA 4YMVA 3QWFA 3RYCA 3WE7A 1YQXA 1DG9A 1I6KA 3IQIX 4G5XA 3QFFA 2ATXA 2H1WA 4PO3X 3UB2A 3EXIB 3NC1C 3GJ8A 1HH4A 1P7PA 5L4NA 2XH8A 4XTCS 4LY3A 3AVYA 4DR4B 4XIIA 5ALQA 3O4IA 3ZS8A 5EJ4A 3QVGA 3KAJA 2ZKLA 1OX6A 4FBLA 3THWA 2A1TR 3GGPA 3L7JA 3WB9A 2H51A 4W9NA 4B3CA 2JVKA 4QPPA 1FPQA 4HNRA 2J9GA 1JIUA 5CLHA 5HCIA 3S2EA 3Q0TA 5BMVF 3C8MA 3UMCA 4IIBA 5AM1A 4UUOA 4CQMB 2VP9A 5F7XA 2FPPA 3D4LA 3HXQA 2ZSUA 3RADC 3ZGXA 3HDYA 1JDNA 4JYCA 1MHPA 5KNCD 1K2VN 4KGVA 4M1MA 4XEUA 4JMPA 5LD2B 3WLPA 2OCAA 2WHPA 4DSNA 3EGXA 1TIPA 3I5UA 4ITRC 2ZYTX 5LQCA 4DV7B 2H48A 1XKTA 3RW9A 2Q2WA 1NC1A 3PQFA 1HDRA 4I55F 4IOMA 1I4WA 2H4WA 2A0XA 2AL7A 2Y71A 3E27A 2AE2A 5CIWA 5GVRA 2VH5R 3WGZA 5KQMA 4QXPA 2I8CA 3DBLB 3CTMA 1TGYA 4B75A 1A4IA 4NAVA 4MGKR 3ADPA 1IRXA 4G2TA 1JVNA 3MJVA 4M0UA 4A73A 5IMSA 1IN5A 1X87A 2K87A 5JAZA 3QX8A 1SU7A 2OM6A 1GA6A 3DZGA 3IQZA 3WRWA 4LMPA 4XVHA 4ZV7A 5IFKA 5K5EA 3UW3A 1QCZA 1C3OB 2WWXA 1BTOA 5JHHB 3KHKA 1UPAA 3R0XA 4N39A 3EPRA 5GOZA 1RYNA 1BRTA 2B69A 2CGEA 2JJYA 5JU6A 2ALJA 3ABSB 5AI6A 1SUFA 3PJFA 5L95A 3WGKA 1JILA 2PZLA 4KIWA 2BKXA 4ALJA 1FC0A 1U3WA 1AZTA 5IJXA 1P18A 2GWHA 2F90A 3EZ2A 3ZY2A 4CF3A 3LDAA 3K2IA 4KVZA 1K6XA 2X5XA 5E8JA 4Y1RB 3Q8KA 4H2DA 5BORA 1K66A 2YS7A 1N5MA 2ZVPX 1WMFA 5KOJA 3T9BA 4AZ3B 5A02A 5C2JB 4CIYA 4MUJA 4D0GA 3EXHA 3GEHA 3ET4A 4DDMA 2BZ0A 4FVTA 1NBMA 1T2FA 5THKA 4UPVA 4TYMA 1JFTA 2VZ0A 1NY5A 1ZONA 2IXDA 4OYRA 4D9KA 1H6DA 5IX8A 4NJMA 2EP7A 3ZHQA 4CFSA 3MCZA 4QL3A 4RSGA 2FSIA 2ZBRA 2ZEJA 1X1RA 3CEHA 2B83A 1JDSA 1SVKA 2HU5A 2PBRA 3OX4A 3Q3CA 3FZNA 4RPIA 5LLSA 4P3XA 2V6GA 1RJ9B 2ZSDA 2O2EA 3E1GA 4UQOA 4CKYA 3WL3A 3PQ2A 2AD1A 1OGJA 1XZLA 3R9KA 1TYCA 7MHTA 2G1AA 3JASB 1WQ4A 2Z2KA 4UXHA 3QTBA 3IKJA 1AUPA 1VYTA 2FWPA 3S81A 2PPVA 4TLLB 1U94A 1UZUA 3IIIA 2V6IA 2IT1A 3MS7A 1SUPA 5ILGA 3ZXSA 5CCEA 3TX2A 1UINA 3EOAI 2O2IA 1R8YA 4I1SA 1QNFA 4IXMA 3WHKA 4BXOA 2NAPA 1P0QA 5A05A 1E2IA 3A0UA 4JMLA 3TGWA 1FTNA 4PPYA 3RVOA 3S55A 3MGCA 4AKEA 2EX1A 2JH9A 4D3ZA 2XMSA 1U28A 4M98A 5C1DA 1VXRA 3QOXA 3ACDA 3W6ZA 4BJ1A 1C9JA 3ENZA 1D2AA 1TCUA 1XEFA 1ZO8A 2Z57A 4KPYA 1LQUA 3W6UA 3X2SA 1W5EA 5K0LA 1Q3TA 3AW9A 3NASA 4DJJA 2JANA 4Q4HB 3GVIA 3VSBA 2KLBA 3D31A 5FH9A 1IBLB 2NIPA 1SR8A 3OZUA 1DG1G 4L75A 2C29D 1GCOA 2W5UA 4Z2AA 5C51B 3G2QA 3AJ9A 5AVZA 3DAHA 5DMXA 2AD5A 4MVXA 4Q9LA 3MT9A 1ESMA 3B6JA 2Z2IA 2ZSJA 4ZYLA 2J30A 5DBOA 2VEOA 3N39C 3OM0A 5ES3A 3TVDA 5CCDA 3RANA 1WZIA 4FYXA 3HJFA 3ZHBA 5AVTA 4P35A 1GAJA 2IP4A 2P5TB 2CFRA 1ISJA 4FR2A 1QTRA 2Q3EA 1B3BA 1NVXQ 2BFOA 3BB3A 3CW9A 4ND5A 2OFFA 2UUPA 3O8LA 4O4IB 3G2PA 4JBGA 2JIZA 3T9DA 5B6IA 4QKQA 2EXXA 1KO4A 4N3GA 1WW2A 1TFRA 3CNQS 3GRFA 3J81A 3TMYA 3TUZC 1ZMTA 2RGDA 2FH5B 3O3CA 4LYEA 3DHVA 4QT0A 4UHJA 2EX0A 2H1SA 4EG5A 5KPJA 5JQGA 2P8SA 3FE2A 3FB1A 1YL5A 1KE2A 1PW5A 3TSCA 1HNZB 3T06B 1Y80A 3OQBA 1RXSA 4P8RA 4Q4LA 5T6BA 4NOLA 4BFVA 5CB4B 1CVLA 1HLFA 2O8NA 1NW6A 3PEEA 4AKGA 5HF5A 3VM6A 4OP3A 1RQPA 2I3GA 4Q82A 5CJPA 4G8CA 2H5IA 3LBAA 1ZHFA 1R00A 4INJA 5HE9A 3PICA 1JHXA 1YOVA 1GQQA 5G4KB 2W2NA 2X13A 5K3BA 3GIWA 4K9MA 4UU7A 4LBWA 3ZOKA 1THMA 4BLOA 2BDTA 5B5SA 5JUWA 5LP1A 4QT4A 4W8GA 2GXAA 4DLLA 1Q20A 3U1TA 3GF4A 5ILOA 3WSVA 4KRFA 3A26A 3KZNA 5EE3A 2WTXA 1E0KA 4NYMQ 3UTCA 2OILA 1PG5A 3AFIA 1W94A 1E3MA 1EG2A 4YS6A 2J3IA 4TL9A 1HWYA 2I4IA 1ISMA 2H0RA 1AGXA 3L8YA 3A4YA 3DS8A 1VTKA 3OFSA 5JE8A 5T4EA 3W3AH 4QJ5A 1APBA 3GLHA 3HRIA 5I4IA 1HURA 1TUIA 4RHUA 3WGLA 2W48A 3P0RA 4MW2A 3SSOA 2J08A 2H2FA 3GPBA 2OZLB 4IVPA 3E8SA 2YWHA 4OQZA 2GA9A 3GNTA 1G18A 2FXIA 4KH1A 3V8PA 1KAHA 1CETA 4CKCA 3AF2A 3FDZB 8MHTA 4YRCA 3T7JA 4YT4A 2AXEA 4WDRA 3QY9A 1F2TB 4O2RA 5LPNA 3SP1A 2J48A 4JASB 3WFZA 4MVJG 3ZGVA 4MYTA 5D7NA 5AQEA 3EIQA 5CB6A 2XUOA 4J1SA 1H94A 2QG9A 3FIUA 4FIDA 5KZMB 2JCXA 1UBEA 1KBQA 1V1RB 1JI0A 1G4HA 1V2HE 1YB1A 2DT5A 5I9MA 2D2IA 4BAGA 2XHEA 1N2SA 1U0TA 4ZVLA 2OXCA 4MCJA 3F49S 3OAAD 3P9ZA 3KPJA 1A5BB 4DR3B 2R7KA 3KKKA 4IGAA 2A6PA 3QLUA 2ZJ7A 3BGOS 4C4TA 4B2YA 2G0TA 2IYPA 1IY1A 5EEHA 4C0QC 3DVQX 4L76A 1WCIA 1MAVA 2IHYA 4MV3A 4Z2YA 2OGWA 3QU4A 2X1HA 3NFYA 4MQBA 1DPFA 2YJ4A 1KDZA 1QF6A 2HF8A 4N6GA 3ZDEA 1NNLA 1W1UA 2D1RA 3ETCA 3DMDA 1O6ZA 3ZIDA 4ZARA 3N0TA 3TTSA 5BSUA 1XHLA 3U19A 1FYVA 4HBGA 2FWJA 1XK7A 3K92A 4BNMA 1M0EA 1U4OA 2RSLA 3U44B 1V96A 3H0EA 3O4HA 1IFXA 1PYOA 3G0GA 2J3DA 3GLIA 1Z07A 2HA7A 2LDBA 1AQIA 2JH3A 1Z7BA 1Y9JA 3G0OA 2P5UA 3V5NA 3FMVA 4Y67A 1QB7A 2EJBA 3H2ZA 4LQ4A 4X6YA 4CQLB 2PANA 4NMHA 1E2DA 1HSZA 3UAXA 2ZDHA 4ZMRA 2FEWB 4MLPA 2BMVA 2VHTA 3HBNA 3QE2A 4DUPA 5JJBA 2DTXA 2QB5A 5HS6A 2O8EA 1VE1A 3HB5X 1U3FA 3FMOB 1C7EA 1XMSA 3G2OA 4FWIB 3OEYA 3P32A 4N3BA 1Z4PX 2HNBA 2WT9A 4RVUA 2GA8A 5B58T 2FW9A 2QSJA 3QNMA 4MGYR 5LMUB 3GMTA 5KU1A 2CMGA 2D0DA 2QMUA 2CMHA 3HN7A 4K6MA 4MCIA 4TLMB 4WX2B 4AUKA 4H4EA 3T7IA 4YHHB 2BJVA 4Z9XA 4B09A 3ADCA 2WNIA 1JU4A 1ZNYA 4WERA 2RHWA 1CXZA 1TQDA 3MOIA 5D01A 2ORIA 2HA2A 5KJCA 1W0JD 1PZFA 1WVMA 2RGNC 1V3VA 5AUOB 1P5HA 2B8JA 4AB1A 5ITWA 5DN6A 4TMTA 3U13A 1HQKA 3UTDA 2VHZA 3WZ2A 2JFQA 2NWQA 4RM3A 1DZIA 2XMRA 1QAOA 1W48A 1T2EA 1FBNA 2WKPA 1HYHA 2DBZA 5CDHA 4JELA 1W59A 1AM4D 1CC1S 4MUBA 1WLYA 1ZC4A 2H63A 3MJDA 2PGAA 3EG9A 1YJXA 4C0XA 3O26A 5FEMA 1I6LA 2XMZA 4X45A 1TT7A 2FE1A 3H5WA 4PVDA 2F59A 3Q3HA 4HVLA 1ECBA 1OWOA 3UMJA 4FQ7A 4GYWA 4XLZA 5JR3A 2PYIA 3D02A 2P69A 1TMYA 1DSSG 1NVBA 1ZZEA 3E1SA 4TTVA 4WUTA 3NOOA 2A5YB 2IUYA 2EWMA 3EUWA 1JHDA 3TWOA 4GOOD 4TTRA 4UQPA 1JAZA 3BAFA 1RC8A 3CFYA 1L7OA 4UEOA 4CEJB 1VPEA 3AF4A 3WB2A 4JI4B 4TROA 4CHGA 3LYLA 4NIMA 3ADBA 1Q57A 1V1MB 4BUZA 2O2JA 1NVMB 3FFBA 3IMKA 2REBA 3TG2A 4ARCA 1PR0A 4JP5A 2YC2C 3UJCA 3KYDA 1TCBA 3C6MA 1A9PA 5ICSA 2DT8A 3REGA 2AOUB 1SBQA 3CXUA 1JKJA 3QUSA 1KZ6A 3WGJA 3RUFA 3PVCA 2RHDA 1IBSA 3O1JC 4GLBA 1P9WA 5CJ2A 3F6SA 3B6ZA 4LRXA 3O4RA 1GCIA 5GVSA 3R41A 2NZYA 4LRSB 3VQTA 3JD1A 5IJ0A 5K0TA 5KOHB 3SIWA 3BEDA 5H9WA 2CL5A 2AI2A 2GPWA 2OP0A 2G76A 4IZOA 4LXGA 1ZW6A 3EAFA 3UW1A 1VMDA 1DJQA 5EKSA 1LF0A 3L8EA 5EE5B 2UZAA 2V7QA 1G8KA 1BKDR 2OYCA 3AONB 3CCCA 3OPQA 4KQIA 1CF9A 1D4FA 2H1LA 3H9UA 3P9KA 5C1PA 2WIFA 5C9ZA 5JANA 1FLNA 2K7ZA 1NXVA 1A77A 3LIPA 4Y2JA 2IH4A 1FMFA 2IOHA 2JAHA 1RRPA 2FPWA 2JIMA 3GBPA 3I1JA 3LD9A 4AQ7A 3GVPA 2GF2A 5DYNA 3TF5A 4Q7LA 1NASA 2RHLA 3V2IA 2I9KA 3BMQA 3VOSA 4NDZA 2FVYA 2ZOSA 2EZ9A 2IEBA 3I2IA 3OPVA 5JCOA 4HQ6A 5DTRA 5AVKA 3AKZA 1HLGA 1WV1A 1Y63A 1SVIA 3DC7A 3PKJA 4QJBA 4D8WA 2LP4Y 2VJMA 4J1TC 1NVTA 4E88A 1WDMA 5D3ZA 2Y1DA 5FCDA 5B1SA 4E4RA 5L53A 3AT1A 3MTIA 3QU2A 2AR0A 1XRSB 3MBKA 2XIJA 2GZDA 1FU8A 3PFIA 3VAYA 4A92A 4AP6A 1M0TA 1WSDA 3NIGB 4OHXA 1YRQA 3PHHA 1Z4IA 4P31A 4UBLA 5TQ2A 4AS3A 3QMPA 4KPFC 3V1YA 4UNQA 2HIHA 4D02A 4JT8A 2OO7A 2YBDA 1IUOA 1I14A 3EF3A 3N0VA 4R40A 1T15A 1C0LA 1D6SA 4ZQEA 5F98A 4RYLA 2DWQA 3T3OA 3QUQA 2WHYA 1CE8B 3D2AA 4RLHA 4X95A 3URKA 4D26A 2P2GA 3R9WA 4MJ3A 2WVJA 2AC7A 2NUAB 2QTMA 5JQWA 2MJLA 2MTBA 5E4FA 4KQHA 1UQTA 2Y0DA 3AY0A 2CNDA 4UHCA 3BH7A 2QYHA 1M6VB 1XKXA 3GVXA 3WOHA 4MVJA 1VL1A 4J1NA 3P4UA 3DMNA 3K0FA 3O47A 3C5WP 3TUIC 3VHQA 5KYNA 1U1FA 1F20A 1MJFA 1ZQ1A 2Z95A 3AEQB 3WKAA 1J2TA 1Z36A 3LIIA 4LJRA 5ADWA 1SVLA 1VCNA 2LCIA 3HJRA 4CL8A 2ZI9A 4JBWA 4PICA 3W9SA 2OK8A 4YR9A 3VNQA 3GEGA 3PPIA 2VBFA 4CXMA 4IIDA 1OFHA 3CQ9A 2BJWA 1P19A 2GJ4A 2SCUA 2EFJA 4D9FA 1U2ZA 2CFOA 3K9GA 4QYSA 2DQSA 4ZVNA 5IW8A 5EKTA 3FMPB 4OAPA 1I3OA 2C2YA 2DRIA 3EGWA 4L28A 1V11B 2X8BA 4RA9B 1OIXA 1GKKA 1E79A 2AW5A 2ZTSA 3B13B 3O4GA 4QUDA 3AOGA 5ARCA 3O0TA 4FMDB 1REQB 1TU3A 1J8DA 5JFOA 3NTUA 4R8MA 3PEWA 3WRXC 4RFSA 5JNSA 4OSEA 1YFLA 3V1TC 4DBLC 5F3RA 1JBKA 3ROGA 3NM4A 4D82A 5KSZA 2RAFA 3WK8A 1EQ2A 3OZVA 4DM7A 2Q5JA 3OQ6A 3UUWA 1E96A 1ADGA 1MUUA 3MRXA 1SPBS 1UT5A 3UZUA 1FXSA 4R5HA 5G2OA 1W9MA 2A35A 1EK0A 1RJGA 2BKAA 1OT3A 4A0SA 4L5AA 3E3OA 2REOA 3FBTA 3YASA 2DLDA 2WILA 3TVTA 3WFJA 2GTPA 2HPZA 2J6CA 1N9GA 1EK5A 1KMHA 1PJZA 2Q4OA 2I99A 4MEBA 3PDUA 2IZ7A 3ZNNA 5HW0A 3UQZA 2FPIA 3NAQA 5TARA 2D5IA 2RBGA 1QVAA 1XWWA 1GSAA 4IDPA 4I9HA 5FOUA 2FFAA 5AXAA 3ASUA 5J5AA 1VBKA 2IYUA 2DFKB 5EA2A 1ZM9A 3DE3X 2IU6A 3QQ5A 4MGHA 5CGQB 3REQB 2AOXA 2FFBA 2QPOA 1YULA 2PRKA 3HQ4O 3HLYA 4PGFA 1N75A 3CEPB 2B8NA 2BFNA 1EUCB 1MEOA 1JQKA 4HVCA 5KNDH 3M5PA 5E7JA 1PS8A 1PJ4A 1N5JA 4BX0A 4LKRA 4PWYA 2H4YA 1UJBA 3K7EA 3QFHA 4HGZA 2HDOA 3DVSX 3FG9A 4MIYA 4RV4A 4WK6A 5FPHA 4POOA 1P44A 2EKDA 3QKWA 1SIBE 1SUDA 5G53C 1V3UA 2MWMA 4OL9A 3SF8A 2FK8A 3EIUA 4MR8B 4XVUA 1CDDA 1LH0A 3EW9A 3K16A 1KO7A 1U1EA 2A5JA 4Q16A 3VPGA 4EKYA 1PD1A 1RWPA 4OBWA 2A84A 4UM9B 2ZIGA 5CYOA 1MB0A 2GSDA 3SQDA 3DXZA 3IR7A 1FNCA 2VYNA 4BKPA 3JQGA 3R3WA 2J3QA 2AHOA 3I01A 6ABPA 2ZYWX 2QTAA 1SZDA 5JD6A 2HLDA 3VR4A 3W5JA 4ZJZA 1FUEA 3AF6A 2Q3BA 4YCCA 3RTEA 1WOYA 4UASA 3ZUPA 3WMGA 5TF0A 1IJEA 1EQUA 1GAQA 1SCDA 1UEJA 1EJ2A 1Y1KE 2J09A 3MXTA 3NV7A 4HMOA 4OQDA 2E37A 2GM5A 2EW2A 1QHIA 4OQQA 1J7KA 4F45A 1M2EA 1SKYB 1BEEA 1IY8A 1N3BA 4QTYA 2Z56A 3R7AA 3CRNA 3FLEA 4DV0B 4HUQB 2VLIA 1N6LA 1P3JA 1IHPA 4EUHA 1NPTO 1MDBA 5CX1B 5KWSA 3F5SA 3HEMA 1YZLA 4FZ3A 5JWOA 3PNLA 4GR5A 4UBKA 4TVSA 3O2SB 3ROXA 2ONZA 1E92A 1XYVA 5EYPA 1KJ9A 2XNKA 3JD4A 4XPIA 1BYUA 5DRTA 3FTQA 2XEXA 1UEIA 4RQUA 1O0CA 4JLMA 4JX8A 2J3JA 3A3KA 1G8GA 3E23A 4FHCA 1B0UA 5BWOA 3KQPA 3W7VA 4YBRA 3TQFA 4HZUB 1NM5C 3O1LA 5JYDA 3D59A 4YJFB 5E1DA 1XOIA 5A6SA 2C99A 1Y5RA 3L40A 2XYRA 1UT8A 4A1OA 5EJEA 3VU1A 2RD2A 3OIDA 2VSYA 2HWKA 1MB9A 1SKAA 3KPUA 4ZOEA 3DZKA 1AO0A 2E55A 2D0PB 1VG1A 4BNFA 2P6PA 4JD5A 3DBIA 3FPLA 1J2UA 3E5HA 4RO0A 5ICGA 4WY8A 3DF7A 2Q0XA 2XGSA 3CR8A 3I76A 3IT3A 2OQIA 3MZ0A 4YRFA 1EMDA 1JT9A 4YQEA 5KSPA 3U2QA 5THQA 3IT2A 5HF9A 2CXRA 1C9MA 4GWKA 3U5TA 4G0PA 3WIBA 2CL0X 3U7HB 1XJQA 1IXRC 1KC3A 3X1DA 3CZRA 3QFRA 3PR2B 2A57A 4UC0A 4C0JA 1TU0A 3O31A 3PHIA 4LXUA 4MUFA 2OA0A 4C7VA 3KQNA 5E9JA 2FMXA 2MMCA 4MS4B 2P27A 2NW6A 1G19A 2VJQA 3DVAB 4IMPA 3WLSA 4DZTA 2YOFA 3B70A 3TVYA 4P4LA 1HA3A 1S4MA 2BTQB 2G77B 3CT4A 3V7UA 3CX3A 1KH3A 1M34E 1WHTA 3ZY4A 3IUEA 4TSFD 4D8TA 4OK5A 5HXAA 4UHHA 1GYQA 3JQ9A 5A9SB 5KKAA 1S8AA 2JFUA 4F04A 4WK0B 4DSUA 5CYPA 4JR1A 3DBRA 3TZLA 4D4HA 4FW8A 3J7AC 1JSXA 1P2FA 4TLCA 3D6UA 3JVUA 4KAJA 1B0ZA 5G0WA 1VDZA 4V0OA 3PNQA 3L1VA 4MWZA 4ZQCB 3RRYA 1WW3A 4BZQA 1A8UA 2WAOA 3FJOA 3IVMA 4IFBA 4L4RA 5JROA 1L4GA 2JZNA 2PT7A 3PCTA 5FLKA 3FTEA 3H11A 4LXXA 1MD9A 2IYQA 3IOMA 1Q74A 5AKKA 4J2HA 5DHFA 5KKNB 4QNNA 4JQCA 5C3MA 1RQRA 2O8FA 1XB2A 5JNVA 1W36C 2M32A 1Q21A 3JYHA 4X93A 4XB6B 5E1OA 2JGEA 3LQ4A 1LBEA 1XZDA 3OJLA 1DCFA 3HZOA 3KTOA 5EL0A 4AUMA 5KOIA 3INYA 1HOTA 3GU3A 4ZYVA 3EY9A 2Z8YA 3BD9A 4X44A 1JEQA 4IMRA 3RRZA 4V0LA 1E6MA 1QOZA 4AKIA 2BKLA 1T1RA 3BERA 2XGGA 1VPTA 3BXGA 4X84A 1MFPA 2O2CA 1A88A 3ZOZA 1QK4A 3L04A 1H66A 3M83A 2GF9A 3GJRA 2YYYA 9GPBA 1NF9A 3BGSA 2H4XA 1UWVA 1W44A 1SQFA 4ALKA 1KFJB 2EGGA 3OEEA 1M2WA 1FRVA 2UZ4A 3IGFA 1CNEA 3K30A 3P4YA 4UUAA 1SVWA 2CCKA 4V0ME 3R7DA 2FP3A 1YONA 3PFBA 2JGFA 4LN1A 4Y2SA 1DWQA 2POQX 1T10A 2HYDA 4JSRA 4Z4GA 5ALFA 5HZGA 4CT0A 4KEAA 5KQPA 4Y6GB 2O7VA 4LNHA 4WN9A 1NONA 1OLXA 5CXUA 1G21B 4BKQA 1QLWA 2IGTA 4DLNA 1RWBA 1VPDA 2ZYUX 1VKJA 2HRCA 3EQZA 2VK4A 3HR7A 3I42A 3W3ZB 4DV3B 1E1NA 1FJXA 1HZZA 4D0NA 1JHAA 3C3CA 4FT4A 1WXXA 1K75A 3HHEA 4ERNA 4UPDA 1JMVA 5EUQB 4R0NA 5AW4A 1GPWB 1GKLA 1SMKA 1M1NA 3PNBA 3MAJA 4F7DA 3I01M 3HA2A 1JTVA 4Z3OA 3AHCA 5HS4A 3EBOA 4CMIB 4OD0A 1GNTA 1I8TA 1THTA 3NDIA 4XRRA 3H99A 4F4CA 1DBSA 5KDDA 3RVQA 2EG9A 3PNSA 1IY9A 3DXYA 4C6TB 4GLFA 1UMKA 1H3FA 2OENG 1TQHA 2OAQ1 2PX2A 2VQ3A 3DONA 2VRCD 4AJLA 1E5VA 3BJIC 3TQRA 2CLFB 5C8ZA 2W8ZA 1EFRD 3MSXA 2A9QA 5ECYA 5JLAA 1DUSA 4LHWA 3AKDA 4DADA 2AFIB 1NAIA 2BONA 4XWYA 1ORRA 3CVUA 3P97A 4XWWA 3E2MA 1TNDA 4AMYA 4NNPA 1IN4A 3L41A 1JGTA 2KQUA 2XQIA 3DZCA 4UUNA 4DRXA 3FSGD 2DSTA 1J7JA 5LVAA 3OU6A 2B8EA 3UICA 3KKZA 2CZGA 4I2NA 2C1ZA 4EL5A 2QXTA 4RPLA 1VLQA 2JHPA 1RM0A 4PZDA 4RYDA 4YAOA 3MCTA 2WIJA 3BE5A 3MJ4A 3SZLA 5JMOA 1ZMXA 3EC1A 3EFBA 1NN0A 3S6JA 2IXFA 3QFSA 5EERA 4QLBA 5I7AA 3A6LA 2JFOA 1K7FB 2Z08A 1YQQA 5JJKA 1F4PA 2YWCA 3DE1X 1N1MA 1V41E 1J1ZA 2NV0A 1R9NA 4NZMA 3OQMA 1BWQA 1ECGA 2FR8A 3CM0A 4TLDA 5EJ8A 3FLBA 2OKGA 3R9XB 2WF9A 5K8UA 2XAUA 4GMFA 1FTSA 2Z1NA 3Q40A 1W5SA 3OBBA 4TKMA 2C4UA 5G1NA 1NDUA 3K6KA 1KJIA 3DT6A 5LYJA 3IKMB 4MKXA 2X1LA 1FW6A 1IPHA 3FZQA 3B3AA 4YJ3A 4JOCA 5FXMA 3N7UA 3QU5A 2QE7D 1YMVA 3G5MA 1NQOA 1P81A 5FPKA 1P0MA 1X7GA 3PWSA 3ICVA 4L8VA 1PFKA 4NBKA 1RBMA 4MAMA 4HDKA 1HORA 1WU8A 4LC1A 1K08A 1TF5A 5JJ5A 3H17A 5REQB 4PTYA 1Y81A 2QBYA 1OV6A 1SO8A 4R7GA 1ZOLA 3F98A 1ZRHA 4NOJA 1MO6A 1EUZA 4ZU3A 1CUIA 4NYMR 1N0HA 3OO1A 4YASA 1C1DB 4I1UA 2ST1A 4BLQA 5BN5A 2I22A 3HN6A 3IQDB 2WKRA 3NETA 1Q2UA 4JVSB 4Q9DA 3KCQA 5B2ZA 3GEMA 5HSGA 2ZDGA 3EEBA 3AEZA 2AFHE 3B20A 3L43A 1LKZA 4J6FA 1RRGA 4NQZA 3AF0A 4JB2A 1NVGA 2NU7A 4XQEA 2QMEA 2EGHA 4CUJA 1DX6A 2ECOA 3W1EA 1MVLA 3E7WA 1JJFA 4ND3A 1YKSA 1IE3A 2B35A 721PA 4IHJB 2ZAYA 2ZRCA 1W73A 2XYGA 3PL5A 3AGPA 4X5OA 1QE5A 5JALA 1MQSA 4UVEA 3KR2A 2D2XA 1Y8QB 2VZ8A 5TX7A 3NXSA 5HIAA 5LU9A 1ND5A 2GXSA 4E2XA 2IDJA 3E61A 2AUMA 4FGZA 2VJLA 2D3TA 2RHMA 3AIKA 3UAZA 1WA5A 4H6PA 1NHGA 2P9TA 4PN3A 1C9YA 1BKYA 2C5SA 2Z8YM 4IV8A 2HK9A 2VG8A 5E6RA 3SBDA 4DC0A 2HMVA 1IQUA 2H08A 3KJXA 4C21A 2IVZA 4FYJA 1WKBA 1BNCA 3L2OB 5BRAA 5AVWA 3Q7TA 4K1LA 1H8EA 3H2YA 3WO0A 3ETLA 4OJNA 2ZYAA 4ZDJA 3K9LA 4D0SA 1OPRA 1I1QB 1A2BA 1H1LB 1WXIA 3G2JA 3VOTA 4Q01A 2VPZA 3BWBA 1ODKA 2VHJA 1W1IA 2WDPA 2NZVG 2R2GA 4RHYA 2OQVA 4CCAA 5H83A 3FHLA 3PFWO 2OOKA 3L8HA 2XRZA 3H8SA 3BJZA 2JDID 3OZEA 2C98A 1X1TA 3GZJA 4PPNA 4BN5A 6NULA 1P6QA 3AHGA 4RD4A 1P4AA 3SX2A 4BQOA 4F4FA 5ED4A 1A8QA 2JJQA 4JXZA 5I7RA 2C4TA 1IULA 3K2QA 1H2WA 5JLJA 1NKVA 4LJSA 4FOTA 1YHZA 5T4BA 4AO6A 4W1QA 3KCNA 1DIGA 2PGIA 2QF7A 2JATA 4HWSA 4QJIA 1USIA 2VSNA 3N9IA 2F4NA 4TYPA 5CVUA 5CVTA 4ZTUB 5G3YA 4BNGA 2YBEA 2QVZX 2OLKA 3ZDQA 1QGAA 1CG6A 3IFSA 3KSZO 2ZJFA 3GDWA 1E2FA 3VC1A 1DBWA 4TWIA 5IVIA 1PVVA 3GJ6A 4J0GA 2QAGA 1QYDA 2B4RO 5HM8A 4B6OA 1IM8A 1LW6E 2IH2A 1P75A 1ULAA 2WPDD 3PHLA 5A9TA 1P9RA 2MSWA 3JQ7B 4L6CA 4MV7A 2A3NA 3CB2A 5JQGF 3ANYB 1O6CA 3B6MA 1K6EA 1DCKA 3HVUA 3H2KA 4NC9A 4CTNA 1AMOA 1TAUA 4TS1A 4L4SA 4J0HA 4CLHA 1XA4A 4OHOA 2BZGA 3T5MA 2O7NA 3D6VA 1IEWA 3F71A 4DCOA 4WBNB 2QVYX 3JAWA 4RZHA 4KGZA 1ZKDA 5EN4A 5BXYA 2G1UA 4QC2A 3EIEA 2OORC 2XKJE 2AOTA 2EWWA 2GEJA 1ADFA 2C7GA 1EAYA 2BP7A 2E4AA 4JHLA 2GN8A 2LCFA 4MX8A 4QYIA 3RPEA 1IYZA 4WY2A 4KMOA 4CM6A 2BRUC 4B6RA 1EDDA 3LZDA 1A95A 3KSDO 3LYHA 3MB8A 5C5CA 1JJBA 1QO0A 2QDXA 3F5QA 1SHJA 4DPMA 4EUEA 2I7VA