4DB4A

Mss116p dead-box helicase domain 2 bound to a chimaeric rna-dna duplex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
256
structure length
256
Chain Sequence
b'SIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase MSS116, mitochondrial
publication title Structural basis for RNA-duplex recognition and unwinding by the DEAD-box helicase Mss116p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna-binding protein/dna,rna
total genus 82
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4db4A00
1J7KA 1N5JA 821PA 1E98A 1KI6B 3LW7A 1NF3A 3L8ZA 4ZPXA 1KK3A 2NZJA 2QUZA 3PUZA 1VYUA 4B76A 1XTIA 2ORWA 3T1OA 3SJCA 1OH6A 4JLKA 1T5IA 1KAOA 4B3GA 3BE4A 2D2FA 3AVUA 5GJBA 1WQ1R 1XWIA 5HKKA 2ZJOA 3KQUA 2F1HA 5KDOA 4QBHA 3DOFA 1GKUB 3GEHA 5EE0A 3GLGA 1KO7A 2QZ4A 4DZZA 3GLFE 2IYWA 1IJFA 1CXZA 3W34A 2YWGA 1E9EA 4ZIRA 3GPLA 5JI3E 3UK6A 3RWMB 1A1VA 2HJVA 1ZJ6A 2X77A 3RRNA 1D6JA 4IVPA 2IWRA 1GL9B 1WBDA 3W3ZB 3REGA 2A5GA 2VP9A 1TNDA 2C9OA 2ZXUA 3LVRE 4UKDA 4CEHA 2G83A 2J87A 3AF3A 2J9RA 2YOHA 4HZUA 2Z5FA 5AJXA 5AWFC 4NZYA 2ZRDA 2NTYC 1NBMA 1U99A 3Q85A 1KJWA 1WF3A 1UAAA 3DVLA 1YZUA 4LC1A 5HCNA 4PO1A 5JCZA 3ASZA 4GSYA 4TYYA 1R7RA 5J4YA 4DIDA 1X3SA 1LV7A 3L0OA 4HAVA 4C30A 2QMUA 5DGXA 1E1QA 1DG1G 3RWOA 1NNEA 4TMXA 2JLQA 1E0KA 4LV6A 4CEIB 2J1LA 4I99A 1TL7C 4ZIRB 1YZQA 2GXAA 4Q7MB 4B32A 1SVIA 3OEEA 3TNFA 1UKYA 2CCGA 3HP1A 3KUCA 3GD7A 1RVDA 1J70A 4W5HA 2OLJA 3KB2A 1NY6A 1DARA 3U7HB 3PXGA 1P9WA 5DI9A 3UMRA 4WZ6A 3UANA 4KBGA 2YNMA 3TUIC 4GP6A 4KLNA 4BFWA 4CEHB 2R44A 5DE3A 4HZUB 5E95A 221PA 1OB2A 4B3BA 3ZH9B 3BOSA 3R9XA 2VQSA 2R6AA 4LJ4A 2Q9BA 1VKJA 4QBIA 3X1WA 1C4OA 1W2HA 4OI0A 1VTKA 5F2EA 1MABA 2OAQ1 3M1IA 3PR1A 4TZ6A 4IVRA 1CP2A 1E0JA 5EQTA 2OFXA 2F55A 3ECCA 2Z4RA 2JLWA 3ZIAA 4KODA 4X8HA 1N6IA 4RCYA 3V4FA 4LUCA 4Q4LA 3U4QA 1NVVQ 4QGHA 5FOWA 3GMTA 2EFGA 3GJ5A 1CJMA 4LCBA 2RAPA 2GTPA 2QTVB 1RW4A 2ZS7A 1FMJA 3KDSE 4OI1A 3ZYCA 1XCGB 4TYNA 1RRFA 5BXQC 2BEJA 4IFBA 4KLZA 1A4RA 4FD2A 3KXIA 3LLUA 3F0TA 3OFND 4U5XA 1MABB 3RC3A 2OV2A 4URUR 4JL5A 3VKHA 5JCPA 2QPTA 2B8TA 3SJBA 2HXSA 2RCNA 4P32A 1VYTA 1KJZA 1ETUA 3ZZUA 1ZMXA 2R6DA 5GJVC 5KSOA 3U4QB 1D2NA 5F98A 3REFA 1TQ2A 2R8RA 4BFTA 3KKMA 5AJWA 3CM0A 3T15A 4YONB 2IUUA 2PCJA 2PMDA 1NJGA 2ZYWX 3ZS8A 4D80A 2OBMA 3ETLA 2V6IA 3H0KA 3PUYA 4DT1A 1OH8A 1VG8A 4Y0VA 1Q21A 2OEPA 1E2PA 1CS4C 2YOFA 2IS1A 2B8WA 2V1UA 1H65A 1A7JA 3PCRB 2WIBA 1KZ7B 5B64A 1EK0A 3AUXA 3FFBA 4PZYA 4R71A 1LF5A 2J41A 3QKTA 1UKEA 4PPGA 2GZAA 3AB3A 3K70D 2UZ3A 2C77A 1W49A 4HUTA 1XNJA 4RFSA 3B1ZA 4MYUA 4TMWA 3UKDA 1YR6A 1TEXA 1KY3A 2OM2A 3HJNA 2IXGA 5FTMA 1T3LA 2GXQA 4DT1B 4WIAA 3FMFA 3J81k 4C0SA 3CNLA 1KIMA 2F43A 2NO1A 4HLUA 4MRPA 3CW2A 4ESHA 4YXWA 1XTSA 3VR6A 1KO4A 2FOLA 3OE7A 2JJ8A 3B13B 4V0KA 3IPXA 3WMGA 5HTKA 2QMOA 3LVQE 4YMWA 4B74A 4LJAA 2O5VA 4XOIA 1E2MA 1UBCA 1SKYB 1E9DA 4QBFA 3C8UA 4Q7LA 1GZSA 5G3YA 1AA9A 3CF0A 2PJRA 5CITA 3QF7A 3FDIA 2B6HA 1J2JA 5FBVB 4JBYA 4RFSB 3LX5A 3U7EB 1N0UA 1OFIA 1ZIOA 1YRBA 2YV5A 4MGZR 5L3SA 1E99A 4ERNA 3A1TA 2CL7X 1JQJC 3P4XA 2I4IA 4KVGA 4EPRA 5BN4A 2F43B 4HSEA 4B6FA 4EPYA 4PZLA 1CR0A 3VTKA 2IHBA 5TARA 2CHVA 1N0WA 1XMJA 4Q00A 4LJ9A 3A8TA 4A6XA 2IK8A 2OO7A 4HAYA 4Q9HA 4Q47A 1LTQA 1ZNZA 3RSOA 3VR2A 1EESA 4Q9LA 2EYUA 1XEXA 1K5DA 4U00A 3T12A 2ZSDA 5CK4A 1Z0IA 2PX3A 4NYJR 2IYVA 3PQCA 4PC7A 5P21A 1E9BA 3IPYA 5FBLB 2QU8A 5L3SB 2IS2A 1NL3A 3GJXC 4OL0A 4DEXA 3C15C 1SKQA 2QM7A 4UNRA 1BKDR 4QJ5A 2VBCA 3QG5A 2ZRHA 5JI2E 2H17A 1E1RD 1ZVQA 3FOZA 1OXXK 3Q72A 3K0AA 3CWQA 2GXSA 1G4UR 5DN6A 4RJLA 5AUOB 2HXYA 4GOXA 1UPTA 3X1DA 3VHLB 2P6UA 1IY0A 1COWA 1FP6A 1YVDA 1N5KA 1II9A 1XEXB 3T1TA 2FFBA 4N0DA 4JJKA 1U0LA 1U2RA 2QG6A 4V0LA 2QT1A 2BBTA 5JHGB 2FMXA 2GHIA 1DPFA 3QJYA 2IUTA 3CPEA 1FOEB 2BV3A 2OBNA 3QPVA 2XTMA 4KCGA 4H1UA 3CRRA 5DSZA 5J4VA 3U7GA 3Q9LA 4V0MA 2ZU6A 1XXHA 2DFLA 3K09A 1VG9B 3K0AB 3WNCA 5F9FA 2QRNA 4TTPA 3UWOA 1XD9A 3K70B 4HYYA 1Z06A 2QGNA 2YVUA 2QP9X 3KX2A 4JS0A 3PUWA 4W5WA 2X1VA 4PANA 4BLTA 4LX0A 5FUVA 1XEWX 2IYRA 2RGDA 1HT2E 1Y3AA 2XXAA 5BYKA 4I1SA 3LXRA 4OHXA 5CM8B 4D81A 1W0JD 5JS7A 2D74A 3QNUA 4Q03A 3GLIE 5AK0A 2G0TA 4IDQA 1E2NA 4GP7A 2P3SA 4L9SA 5GJWC 3FMPB 4F93B 3I8XA 3HU3A 5EP1A 3FHCB 4Q9KA 1E79A 1E2JA 1PLJA 3NHBA 1XXHB 3K09C 4XVRA 2NPFA 1WE2A 3O8DA 4Q7JB 3FWYA 2O8CA 1P73A 4M9SA 3SEAA 4MYCA 3I5XA 1O87A 2D06A 4URWR 2QQEA 1P61B 1ZM3A 2DWPA 4OQNA 3O8RA 2IHYA 1XMSA 1XJQA 4DWJA 2B21A 4B3FX 3WMFA 3NXSA 2JLRA 1TU3A 3A6PC 3ZDQA 2O52A 1GNQA 5DO9A 2ZANA 2XXAB 3GLHA 4I81A 4QHSA 1OJLA 2WIAA 3N70A 2ZSFA 5KUTA 1E1RA 1KI2A 3U3RA 2I1VB 4F4IA 5GVSA 1FMLA 5J40A 2EQBA 1GTVA 2WMOB 1KSHA 4G3XA 2O8CB 1GRNA 3W5JA 1OKKD 1I2MA 3L43A 3AF4A 2KBFA 3ZVMA 4II7A 2OCYC 1KDOA 3QEJA 5EP4A 5FR1A 5G40A 3V9PA 2AKYA 2H8KA 2W6JD 1R0XA 4JVLA 1JQLB 2H57A 4GOKA 3G5UA 3WBKA 1YRAA 4D4LA 3GLHB 1YJ5A 1E4YA 4D4KA 4R98A 4ACBA 4EDHA 1T3SA 2IF2A 2V4ZA 1KKLA 4TYQA 3N5CA 3NBZC 2ASEA 2C78A 1UBGA 2F6RA 2OG2A 3MCAA 1EX7A 2GZDA 3TSWA 3BH7A 3PEUA 1Z0AA 1U81A 1YR7A 1LFDB 1LW7A 2CCJA 3AP1A 1SVMA 2C03A 1G3UA 2HT1A 1JPJA 1KO1A 1XP8A 3RC8A 4QBGB 2FNAA 1M7BA 4WZAE 2C96A 1EWQA 2EWWA 4B34A 1P60A 1EWRA 1W0JA 2V9PA 2ZUCA 1GM5A 4XVUA 1KGDA 1IN5A 1DVRA 2GJSA 2REBA 4OK3A 3GLGE 1ZCBA 4ZDJA 2QMEA 1FTNA 2WWIA 3U60B 3L0PA 1QHYA 4NU0A 4ZCMA 3FKSA 1WRBA 1WMSA 1J99A 2Q0HA 1KK0A 3KTAA 2W00A 4BLRA 3EZFA 4YC7A 4G5RA 2GKSA 3U3OA 5AUPB 1E9SA 2ORVA 4FMCF 1F2UA 2WSSA 2C98A 1KDTA 2H5EA 3I73A 5E7MA 2FN4A 3Q7QA 2DYKA 3KJIA 1NLFA 4OK5A 5TMPA 2RGNC 1G3QA 2R65A 1GILA 1A2BA 3NKVA 4WAUA 1ESNA 1KHTA 1CR2A 3LBNA 5SZJA 3MLEA 4GI7A 4TLEA 1G21E 1T91A 1M34E 1W5TA 3K9NA 2OAP1 2ZREA 2GJAA 2P5TB 1TEVA 4D26A 2ZS9A 3HWSA 2O8FA 1TF2A 2XSZD 2L0XA 1MO3A 1Z29A 3IEVA 3KTAB 4QKQA 3D3QA 2A5YB 5HE9A 2ZAMA 1F2UB 1R4AA 5CM9C 1GG2A 4A0RA 3B5JA 3IIMA 4A15A 3WBJA 3GEIA 1AS0A 2IS6A 1H8EA 2KWIA 2J0UA 2WAYA 5EJEA 4RFVA 3CKLA 3ZVLA 5KU1A 4NYIR 3CNNA 2GEDA 4DLYA 1M1YE 3C41J 3CB4A 5EE3A 4RZ2A 3I61A 3PG5A 4D4MA 1I2DA 2W58A 2FPLA 2O8FB 1U94A 5DISB 1OXUA 4JLMA 3RANA 1KOFA 2J7KA 4JMPA 4Q4JA 4FW9A 4NYMR 3B82A 2VP4A 3SOPA 1QBKC 4AD8A 4A0HA 4JSYA 2XTZA 4MKGA 4RZXA 4IDPA 1M74A 5L8VA 2W2TA 1RYFA 1ZINA 2J0UB 2HJGA 1P72A 1Z6TA 3B8HA 4KFRA 1W0KA 5SZIA 1FZQA 1KTVA 3WY9A 3TR5A 5L3VA 5JRZA 4PQFA 3EA5A 3GFOA 2JDID 4WVFA 1I4LD 3AP2A 4ZDKA 4IDOA 4UXIA 2QRZA 4JT4A 4ZCLA 2PX0A 4HB2A 3F8TA 4Q4JB 4BFXA 4QXAA 3DOEA 1Z0FA 1OYWA 5GVRA 2P6NA 3SR0A 3FVQA 1E2QA 1Z6AA 3QEOA 1BYIA 4AKGA 5FPYA 5C4MA 3EC2A 2IW3A 1XTQA 2ZETA 1OFTA 1WA5A 3D7MA 3AVXA 5CJPA 1E2DA 4IOLA 3PENA 2JLVA 5FL3A 3BB1A 5JWOA 1L2TA 1KDRA 4X8MA 3I62A 2BBWA 2V7QD 3NDBB 4I1VA 4L5BA 3W8NA 3CR7A 4XWOA 1PV4A 3U5ZB 1IN7A 4D0LB 4F4CA 1GSIA 1KSFX 3QUSA 3OHMA 1Z6GA 1P75A 3UG7A 3LQRA 2GCOA 3A1WA 2AXNA 3FKQA 3KKPA 3ZJYA 2GBLC 4BZPA 4R7ZA 3VAAA 2UKDA 1N0VC 1SKYE 3KXLA 1X1SA 4O2RA 4M1MA 1GNPA 2ZRLA 6Q21A 3BFKA 4FCVA 3PJRA 2E1RA 1CU1A 3FMOB 1BMFD 1KSJA 2BJVA 5HKKD 1E2GA 3X2SA 2WWYA 3QKUA 2Q3FA 1W4CA 2D7CA 4X8OA 2IXFA 2DY1A 3CZPA 2ZI5A 3MWLA 5B58C 5DHAA 4RD4A 2ZJYA 2ZR9A 1XJCA 4BFYA 1ESMA 1OSNA 4M1SA 4NBSA 4KO8A 1FNNA 2YKGA 3TIFA 1Z0KA 4ZDWA 3CO5A 3LBIA 1MR3F 3W9YA 2GCOB 4B2IA 4LI0A 3CF2A 4EPVA 3W6NA 3C14C 2WAXA 1G3RA 1B0UA 4L4UA 3C4JA 2VO1A 1EFRA 2IF0A 3THOA 2EWVA 4HDOB 3GEEA 1O3YA 3U44B 1NBMD 5EXSA 5CYOA 2NO7A 1JXMA 3NBXX 121PA 5HR5A 3HR8A 4U7DA 1W2GA 5EXTA 1QHXA 2FFHA 2VTKA 4AKEA 5EP2A 1DAFA 3GFTA 1I4DD 2I3BA 1BO6A 1U0HC 2VIIA 1ZNWA 3MG9A 421PA 1T8TA 3K0CA 4C4PA 4DSNA 3OEED 5EUMA 3A4NA 5GADl 1MV5A 1JXOA 4PXAA 1SXJA 2FGJA 4XD7A 1U9IC 2WWWA 3ZQJA 4A82A 2WOOA 1Z83A 4UQOA 4G5OA 4NCJA 3A37A 1G18A 1IOZA 1WP9A 2GJ8A 3NEYA 3Q7PA 3AGQA 3GJ6A 3QBTA 4O0MA 3MWYW 3L0IB 3ZVRA 3TQCA 2ZRPA 3MD0A 3O8BA 3X1ZA 1FW6A 2BKUA 2JJ2A 1XJ0A 2KI5A 2WWGA 3K53A 4NTZA 4JL6A 4PX9A 3CRQA 3QKSA 2HT6A 2IS4A 3C16C 5JHHB 2VHUA 3EC1A 2AWNA 3K0CC 2GCNA 3BFVA 1GRRA 4MITA 3CX6A 1SXJC 3MWJA 4D4JA 1SXJB 3ZIAD 1MO6A 1R5NA 1S3SA 1U90A 1ZIPA 1NSTA 2BBOA 4TTQA 4YMUA 4EAQA 4LJYA 1BMFA 1JEDA 5IT5A 3VU9A 1DOAA 2QMHA 4JBWA 4Q48A 2KB0A 1W4RA 4EPTA 1V43A 4KSBA 1LVGA 1N6LA 2R6GA 1ZNYA 3LQQA 4DCNA 4CEIA 4JSTA 2VHCA 4F92B 5CB6A 4MA4A 1LS1A 2CCKA 1NSFA 4NONA 1QDEA 1OYYA 4KXFB 1NRJB 3QKSB 2CLDX 3KKQA 5FBQB 2D4HA 5CIWA 1XCMA 4PPFA 3QPWA 1E0AA 3ADBA 1Q0UA 4V0ME 4JZKA 3RRMA 1IY2A 2LCFA 4UXJA 3NH6A 3IIKA 3QI2A 1DAGA 1QVAA 1JAIA 2MSDB 2QT0A 5JWRA 3QVUA 2QROA 3VU9B 3P32A 2FSHA 1N6HA 2WJGA 4KITB 4TLDA 1C1YA 4BECA 2QM8A 3U3MA 1G7TA 4TTRA 1NKTA 3P4YA 4KFSA 2V6JA 3TUZC 5KHOC 4IFEA 4LSGA 3B2EA 3KFVA 3RS5A 1Z63A 2IYZA 2F9LA 2GAAA 5DI3A 3SYNA 4V0NA 4BZXA 1E9RA 1EXMA 1T5LA 1NIJA 1TAGA 5KOYA 3TW8B 1N2CE 4JBXA 1ZAKA 1UFQA 3SHFA 2B7CA 1F5NA 4RZ3A 4Q1CA 4DC9A 4MKIA 4UJ5A 1XZQA 1BIFA 1D5CA 1U0JA 1AZTA 1JR6A 4KV9A 2XX3A 5FR2A 4DKXA 3NTUA 5FPTA 1JALA 4C7OA 4PAQA 1Z22A 5DYIA 4F91B 4DCTA 2JIZD 3GLHE 4YXWD 3OE7D 5CYPA 4KSCA 2WTUA 5TDHA 4FWTA 1DAKA 2R6FA 1NI3A 3FGNA 4YLGA 2ZJZA 4BE7B 1Q22A 5DI3B 1JEEA 3WRYC 5JBQA 2Q9AA 4FMDB 3ADKA 5G3ZA 3GP8A 2IYXA 1HQYE 2GILA 2V55B 3B7GA 3SJZA 3SJAA 5ELXA 3AV0B 3THWA 2OE2A 4AYTA 3EA0A 3K0FA 1YKSA 1KK2A 4TYPA 2CL0X 2P2LA 4MGYR 1WCV1 1NG1A 4MQBA 3B9QA 1FX0A 1Z2AA 1JR3D 3NEJA 3EZ2A 4QGGA 5BWMA 2HCJB 2AN9A 2VSOA 2D2EA 1CJTC 4C7OB 1D8TA 2EFCB 5JWHA 4HAXA 2XOKA 4PO8A 4PQYA 3SQXA 3WP0A 3FHTA 3ZD6A 2VP6A 2JASA 2PEYA 4HB0A 4HB3A 4LOAA 5JS8A 3ICQB 3NHAA 4PPNA 4IEEA 1WXQA 4DB2A 4DCVA 5UKDA 4OKSA 4AKHA 1VECA 1ZBDA 4LBWA 4LPSA 4M1KA 1E2HA 2BMDA 2X2FA 5AJVB 5KSPA 4F7WA 2ZEJA 4RSGA 3THWB 3K0FB 2ZROA 4M1OA 1VCIA 1TTTA 5JJLA 1E2IA 4DLTA 3BAFA 3I1FA 4JKIA 1QG4A 4HAUA 1FX0B 4CF7A 1DO0A 1G41A 1HV8A 3IILA 5LPNA 1S1CA 1SVLA 3OEHA 4GL2A 1VG1A 4XJXA 4KJZA 1DBSA 4XSGA 5KNDA 1PLKA 2ZR0A 2EFEB 1OFUX 3WYFA 3CRW1 3R8FA 2W6IA 1XMVA 5DN6D 3EPHA 2QQ0A 2XEXA 2KBEA 1AKEA 1RKBA 2FEMA 5M04A 4Z8XA 3SBEA 1COWD 1ZU4A 2CK3A 2C99A 4TL7A 4PHGA 3QF4A 4QG7A 3W5IA 4TL9A 1G7RA 1E2FA 1RRGA 3UIEA 1N6PA 4E22A 4DIEA 3BERA 2JIZA 1U98A 4JLJA 3AGPA 4UNPA 2RHDA 1QHSA 3LNCA 5TB5A 2MMGA 4LY6A 2IBMA 2N46A 4R9UC 4DLRA 4PSVA 1JPNA 4HLCA 4B44A 2CLSA 3LW8A 3AKCA 1G6OA 3U61B 3LX8A 3LA6A 2QL6A 5HE8A 3FTQA 3OIVA 3RAPR 4QJ4A 2EYQA 2C9CA 4IVQA 1W5SA 1W7AA 4URYR 4OJQA 4RD1A 1Z47A 1AQYA 2NO0A 4R2IA 1WDTA 1Z08A 2ODNA 2H16A 4DLXA 1Z3IX 3TSOA 2AD5A 5CK5A 1CJUC 2FGKA 3H4MA 1AJEA 5CIQA 2QAJA 1JR3A 1GL6A 2FZ4A 3QF4B 5IDVA 4QC2A 4JLVA 1OLOA 4MRRA 2R62A 4JLDA 1W46A 3A36A 5L3RA 5C2JB 4QM7A 1NMXA 4C0KA 2FPMA 2O0HA 1UBEA 2RHMA 3SQWA 1ZP6A 4M4SA 2F1IA 1SQ5A 1P9RA 3W6PA 2J0QA 1NMZA 2YINC 2ZE7A 1ODFA 2ZU0C 1JJ7A 1SVSA 2ANBA 1ELOA 1Q44A 3IDQA 1W36C 3CWZA 5G41A 1E79D 1W36B 1TQDA 1G1MA 5C18A 2OXRA 2AL7A 3BD9A 2IUSA 1W44A 5GJCA 1YZKA 3CIOA 3I3SR 1S9HA 4E5UA 1L4UA 1DS6A 1ZYUA 2N42A 1CULC 4GNKA 4PHFA 2G1JA 2V1XA 2CHQA 2RGGA 3DKPA 2G9NA 3QXJA 2YZ2A 4BFZA 3LXXA 3DM9B 1GFIA 4WW0A 4FINA 2JEOA 1NN5A 2WWFA 3S1AA 3R7WA 3CRMA 1M8PA 1NMYA 2AKAB 3PVSA 3BORA 4IEIA 3KL4A 4UXHA 2BVNA 1QG2A 4BLOA 1D9XA 3IQWA 1FFHA 3D31A 4X8LA 1C9KA 1W4AA 1JNYA 2CVHA 3TBKA 4PFSA 3A1SA 1SVWA 1CR1A 4H9GA 5FBRB 4G5SA 2IXEA 3RRYA 2GRJA 4EFNA 3PIRA 5LB4A 1OF1A 4TLAA 4GOJA 4WBSA 4DRZA 3THXA 3VR4A 3W6OA 2CNWD 3E2IA 2QPOA 3EAQA 3GLFA 1J8YF 3S1AB 3R7WB 3SN6A 1OHHD 1XEFA 3R8CA 3L0SA 4H1VA 4OHWA 1DELA 1E9CA 4EQ6A 2VHQA 3EG5A 2FEOA 4C0BA 5BW8A 2IYTA 4IOJA 5B30A 3C5CA 3EXAA 4FI3C 4QOSA 3QG1A 1CLUA 4PC3A 3C7KA 3RS0A 4AURA 5AR1A 3TLXA 1KK1A 3LFUA 2OCBA 1GNRA 2C5LA 1P9NA 4M22A 2F1JA 4A0FA 2ZI6A 4PZZA 4DLZA 4URXR 3T34A 4F38A 1KMHA 4FN5A 2NIPA 3FFAA 4FMCB 1OE0A 3UG6A 2ZE8A 1XD8A 1Z0JA 3FKSD 3VX4A 1MRSA 3THXB 3HPRA 1MH1A 3LH5A 2PH1A 4OI4A 3WP1B 3GLFB 3AF1A 3TKLA 3WYAA 1US8A 2AX4A 1G8PA 2GESA 2WSSD 4C0AC 2HF8A 2FJUA 3N2EA 3UATA 2A3RA 1YZTA 2AK3A 3NWJA 4AYWA 2AWOA 4EQ6B 1R0ZA 3B6EA 4US0R 1MO5A 2FFQA 2H1LA 4FCWA 4IRUB 2P6RA 2Z43A 1JAHA 2HV8A 4MKFA 1IY1A 2ZI9A 3TAHA 4ABYA 1KO5A 2CXXA 2GVDC 2OXCA 4PSKA 4B33A 3CR8A 2XB2A 2IEYA 2WJJA 3BFXA 1KMHB 3UMFA 2J59A 4P4SA 4Q4AA 2XNDA 2A5FA 2QAGC 2OCPA 2RGBA 3NH9A 2J0VA 4OQMA 1RYHA 3T1QA 4US2R 4Q1AA 1US8B 3SNHA 4UNNA 3VX3A 1KZGB 1DAMA 1AQUA 2J5XA 3RHFA 3AF0A 2PCLA 4M9ZA 1X1RA 2KJQA 3OIUA 1H8ED 1LY1A 3IBGA 4NP6A 4QNRA 4C0LA 1IQPA 1G8HA 3R20A 4KYUA 3SBDA 4Q66C 4B3DA 1XX6A 2MMCA 1N25A 4R2HA 1K5GA 4MDEA 2YC2C 1TADA 4D0GA 1G17A 2CNWA 2H7VA 2ZR7A 1RZ3A 1XPRA 1RJ9A 4LK2A 1AS3A 4MRVA 1OHHA 2EW1A 2ZS8A 3LV8A 3OESA 5FUXA 4P4SB 4Q4AB 3AEZA 4ZI2A 5K8LA 4Q5IA 3LLMA 5JFGA 4A1FA 3W8RA 1DEKA 2RGNA 4DSTA 2WKPA 1WB9A 2P0EA 1FUUA 2J0SA 1KI9A 3LAWA 3NIBA 4HB4A 3DHWC 1M7GA 2J45A 3OIYA 3W90A 3AVQA 2AD1A 3EPLA 3EZ7A 1NLZA 1N3BA 3L2OB 1TF5A 4PAOA 5JECA 2GF0A 1S0UA 2Q21A 4LBVA 2IC5A 1W0KD 3A1VA 1WBBA 2ZI4A 2BIFA 2WZQA 4Z8YA 4AKIA 1TMKA 1XU4A 1FUKA 3BH6A 4GDFA 3GJ3A 5B57C 3QVVA 4CYMA 5CJ2A 1KI1A 2WM9B 2OFWA 1RJ9B 4A2PA 3CUEF 3MUFA 2CE7A 3TUJC 2QY9A 1CBUA 1JBKA 2QP3A 2ZVPX 4M9QA 3X1YA 2BKEA 3IEUA 5FOTA 4AG6A 2A7QA 3H2YA 2O8BA 3MAAC 2JLYA 4JLOA 5FI0B 4D0NA 4GRAA 1NBME 1NJFA 1OIXA 4BQSA 1IJEA 3SDZA 3FPAA 4UNQA 4XTRA 4IW3B 5CB8A 2Q3MA 4TQAA 5BN5A 5KDDA 1ZM4A 3FHOA 1UF9A 3EIEA 3L8YA 4P4UA 4DSOA 4UNSA 2OCAA 4L16A 1Q3TA 2DFKB 2QPAA 3NG1A 3TVDA 1NVWQ 4IXMA 1VCNA 3SHWA 1S1MA 3U6BA 1YQTA 5EUQB 2ANCA 2O8BB 3IQXA 1G291 5FL7D 4C0HA 1TU4A 4URVR 5KSYA 5H8WA 1P62B 4DLUA 1QHGA 4HATA 1RRPA 5CLQA 2GETA 2BC9A 4Q01A 2N1BA 4C0QC 2HLDA 2ZRMA 4A2WA 1XPUA 2VL7A 4CIDA 4POAA 1FNMA 3VR1A 1OB5A 2ZRBA 3B78A 2QBYB 3B60A 1RRCA 1FP7A 4LPKA 2ODEA 2WPDD 1G8YA 2WSMA 2VPPA 4GFDA 1EFRD 3AQ4A 4P4TA 2FX3A 2XB4A 1Z07A 5BQ5A 2C2HA 2BWJA 1G20E 2C95A 2BMEA 5FTNA 2KSQA 1G5RA 4LHZA 2VF8A 3HDTA 2WWXA 1SZPA 4JVSB 2G6BA 2X8AA 4U02A 1CR4A 1OXSC 2B92A 2IX3A 4ACAA 2GXUA 2QA5A 4V03A 3E70C 1G5TA 1SULA 1G3MA 2HUPA 3GCGA 4A2QA 2GBLA 2OUKA 4BZQA 3SYKA 4XD7D 1SXJD 1UBFA 3CX8A 2GA8A 1T0HB 3ONWA 4PHTA 2A30A 5F9HA 5F3WB 1ZU5A 2XAUA 1ZRHA 1ZUNB 1FL9A 3QIAA 4Q7KA 3B9PA 2JAQA 1N6NA 2ZIAA 5JSZA 1KNQA 3CX7A 2W0MA 3BWDD 3I72A 1Q1QA 1II8A 1R0WA 2ZRCA 4AWXA 1OXVA 4PPQA 3AVVA 2JJ2D 3MGCA 4D25A 1VIAA 2GCPA 1D9ZA 3WNDA 5JEEA 4FMBB 1T9HA 1P2VA 2VP0A 4OQLA 3EZ9A 4XH9B 2RB4A 1X8JA 4KFUA 1D2EA 1N6KA 2X2EA 1FQKA 4IJMA 1TUIA 2CLCX 2I1QA 4KVAA 1SHKA 5FL7A 1S4QA 4OHVA 2GDJA 5A5GA 8OHMA 3U44A 3E5HA 5IK2D 2AXPA 2DBYA 4XVQA 4L15A 1G7CA 4YDHB 4RD3A 1M6NA 2QTFA 4UJ3A 3DMNA 3IO5A 2BEKA 3T06B 5JSZB 1EX6A 5LD2C 5LD2B 1SVKA 1TPZA 4EFMA 4L8GA 2BMFA 1T3HA 1II8B 1Q3HA 1UM8A 2BMJA 3CONA 2BCJQ 4O2LA 5DIFA 3KQHA 1UJ2A 3CZQA 4QJ3A 3Q5DA 1MO4A 1GWNA 1EFHA 2WPDA 4DDWA 2XGJA 1N5LA 3K8YA 1KNXA 1U9IA 2C8VA 3QQ5A 2ZUDA 1NLYA 3BB4A 4TMKA 1CEEA 2PMKA 1XDBA 1BH2A 1QHNA 3TSZA 2FDCA 2HYIC 2FPKA 1UEJA 1NIPA 4PR0A 4DB4A 2DCUA 1XPOA 4D82A 4LHVA 2CMKA 1RC8A 1Q57A 4Q9IA 1VIYA 4AI6A 3FMIA 4CEJA 5KNCA 2G1KA 2JCSA 3BB3A 4GZMA 4TWZA 1JR3E 4B2LA 4LC0A 2IWHA 4OHYA 4MGKR 2F9MA 1A5TA 1R2QA 3JVUA 1E9FA 1RPZA 1ZM7A 1X86B 2CVFA 2ERYA 1G8FA 2WBLC 2ZPTX 3PITA 4OI2A 5DNYB 3B1YA 1V5WA 1H8HA 1F3OA 1GRQA 3QKRA 4HI0E 2DFNA 4QL3A 3MFYA 1A2KC 5AJYA 2ZUBA 3RS2A 2BBSA 2NPIA 2LKDA 3H1TA 1XCPA 3L82B 2FF7A 1SVOA 4ILEA 1S96A 2Z4SA 5EE5B 4FIDA 2VYFA 2BM1A 5HZHA 3T5GA 2K5UA 3B85A 1DE0A 4CEJB 1XBTA 4B3XA 1EGAA 4MDFA 4PC2A 2TMKA 1NN3A 4Q1EA 2Z6VA 1OH7A 1KSGA 1QHIA 4QFMA 3VR5A 4JLBA 3LBHA 5E3HA 4BUJA 5LDDC 1FTSA 2BCGY 3WHLA 4DDVA 2QSZA 5IK2A 3QKRB 2QTHA 3DPUA 4PC1A 3T1VA 2E9SA 2PZEA 2ZRKA 1RIFA 1Z8FA 4ESVA 1HEIA 2OLKA 3KXKA 5EZ6B 3SZRA 1E2KA 2DWOA 3WXMA 1JECA 4TZ0A 3M6AA 1CRQA 4FXPA 3SE0A 4E09A 3X1XA 2RKOA 1DG3A 1JI0A 1ANKA 1UDXA 3E1SA 4ASUA 2NZ8A 3GQBA 1GOTA 3Q5EA 2JLXA 4RZUA 2BOVA 2OSBA 2ONKA 3BK7A 4PHHA 4A8JA 4QHYA 3M4YA 1HY3A 1G16A 1TUEA 4FWIB 4JLAA 3R9WA 1GAJA 2XOKD 4NPHA 4TMTA 1HTWA 1SGWA 4JLPA 4Q18A 2JLUA 5FTLA 1XXHE 1ZUHA 1KYIA 1BS1A 4S35A 4B43A 3VR3A 1OW3B 4NDZA 1AN0A 2CEAA 3G0HA 4ARZA 1G9XA 3MRSA 2VP5A 3R9IA 5TV2A 1P4SA 3CF6R 3UXMA 2BDTA 3TJZA 4LJ7A 3AUYA 3WMEA 3WYGA 1XFAA 2JJ1A 3QSYA 2GK7A 1YR9A 2F7SA 3U7FB 5FPSA 4I1OA 2QORA 2A5DA 4F4JA 4M0LA 1VDZA 1NKSA 1LB1B 2UZIR 2VSXA 1AIPA 4M1WA 4Q19A 3TQFA 2A2ZA 5DYGA 5EXXA 4A8JC 3ZD7A 3OEHD 4Q21A 1AGRA 1P2SA 2J7PD 3RYTC 4A8JB 2A9KA 1CTQA 1RFLA 4MUAA 1QHHA 2GJ9A 2GAOA 4WXRA 2D62A 3HPQA 2OZEA 3A58B 1EG7A 4ITRC 3CPJB 1X8LA 3EARA 3EW9A 3ND8A 1IXSB 2BHRA 4DUGD 4C9BA 3O47A 1YZGA 2W6ID 4BWYA 1G4AE 3BXZA 4TLCA 3GLGB 3DEFA 2REOA 4TL8A 4ARZB 1L8QA 4Q4HA 1ZC3A 5FFMA 2ERXA 2EFDB 1EFUA 1F60A 3A4LA 2CK3D 1ZNXA 3ICEA 1YU9A 1OPXA 4B73A 3RS4A 2FA9A 3FE2A 3VHXA 4S2EA 4OYHA 3ADDA 4C3ZA 1T8UA 2LKCA 1YE8A 4DDUA 4LRWA 2W0SA 3T5DA 1XTJA 2FV8A 4AG5A 2OESA 4WA7A 2YHSA 4YDSA 1QHHB 2G88A 2H18A 2Q3HA 1TF7A 4BRUA 4ZCIA 3EPJA 4DCSA 1PVOA 5B2ZA 1U8AA 3I92A 1W36D 1GITA 4HUQA 2ZYUX 4A9AA 2ZE5A 5EXPA 2ZJ8A 4GPTA 1XTRA 3EASA 2DFTA 2F3RA 2XZOA 3ZS9A 4Q4HB 1KI3A 2QN6A 2WJIA 1RE0A 1MRNA 2ZRGA 3M0EA 1XF9A 1DTSA 2AR7A 4KHZA 4IDHA 4RKFA 5IHPA 2UVQA 4MGIR 4CDGA 2ZTSA 4Z54A 3G82C 1MKYA 1ZCAA 2D3WA 4E03A 2XITA 4B48A 5DHFA 721PA 4Q1BA 3TW4A 5JJIA 4ZO4A 4LJ6A 1B23P 4RKEA 2XJ9A 2FSIA 4HUQB 1E94E 3HYTA 3U2QA 4CZ2A 1R6BX 3EWSA 2DWQA 3RSLA 1IHUA 5KO2A 1KDPA 1VYVA 1DO2A 2GWHA 4GMDA 3P1JA 4EJSA 1IM2A 4DLSA 2IYYA 4GMXA 1K6MA 3V4RA 2J7PA 3CLVA 4LV5B 5KTYA 3ZZ0A 4C2UA 4JYBA 1BYUA 3HU1A 1ONBA 4YMTA 1NG9A 1FPMA 2ZITA 3OAAD 5IF9A 2WJYA 5IRCD 4NH0A 3MJRA 4M8NE 4DUGA 3H84A 3Q8XB 1E6CA 4ZI3A 4M1YA 1U8ZA 1XZPA 2SHKA 2W2VA 3LWNA 4J0QA 5EP3A 5HZKA 3SYLA 3U3JA 1FQJA 2PT7A 1AGPA 1Z6YA 2V3CC 3CRVA 4B6EA 1R0YA 3ZVNA 4MH0R 4KFTA 3MMPA 1NVVR 3TMKA 1QF9A 4RD6A 5DLQC 2RGEA 3EX7C 4LJ8A 4ZDIA 2YWEA 4IDNA 1E69A 4EJSC 5FH9A 4EJSB 1R5OA 2PT5A 3T61A 2P65A 3KJGA 2OHFA 3P20A 5JZVA 2HYDA 2XNSA 5JJKA 1UKVY 4DCUA 4G5GA 2ZJ2A 1BOFA 1J8MF 1VMAA 1UADA 4JJZA 4NYJQ 4DJTA 4JIMA 3KKOA 3CBQA 2F3TA 3K9GA 5EE9A 1UDWA 4EPWA 2ODWA 4HLQB 2R9VA 1GKYA 2REXB 4OBEA 5CLLA 4IOMA 4CRWB 2RGAA 1T6NA 4QNMA 2WJVA 5FOVA 4AY2A 1HE1C 2Q9CA 3VQTA 2ZSBA 1Q1BA 4XWAA 3IGFA 4BRWA 2NOAA 3T35A 1YR8A 1E4VA 2AK2A 1E9AA 2ORIA 3FB4A 4G01B 3IUYA 2GJKA 2PJZA 2ZRFA 2ONJA 2QGZA 4Z51A 2VSFA 4NHOA 4DDTA 3PUVA 1NP6A 1P6XA 3UWKA 4TN1A 1G5PA 2OFOA 3OIWA 2ZSAA 3GJ8A 2P5SA 3BRWD 4PC6A 3VFDA 1A82A 5E4FA 1KI8A 1W47A 4NL4H 4FMDF 4QGFA 3ZQ6A 2VP2A 2XZLA 2IL1A 3D6TB 4CGZA 5HPYB 4BFVA 3QY0A 4CVNA 1W48A 4O3MA 1L7VC 1E0SA 2G0NA 3KFXA 4HLUC 2PZFA 3OFNA 2OBLA 4DLWA 1NVXQ 5LB2A 1VHLA 4A92A 3ZZTA 3VKGA 2CL6X 1QRAA 2H92A 2QEQA 2VF7A 3KB1A 4JKYA 3GJ4A 3OAAA 4RCZA 4XTCS 4NKRA 1Z0DA 3QXHA 3SS8A 4DXAA 3BBPA 2X19A 1G8GA 4EPXA 5CDFA 4PSAA 4IHQA 2ECKA 4M21A 1UKZA 1E2EA 5C1BA 1VCOA 2XNDD 2PLRA 4PAMA 2FE4A 3AF2A 3K9HA 4HDCA 4PO9A 2DB3A 2VRWA 2NO6A 1S8FA 3AM1A 4BEBA 4CT4B 4BEJA 621PA 4W9MC 2ZQ5A 5A0FA 4KAXA 1CJVC 5LBIA 3GJ7A 4AYXA 1GDDA 1PJRA 4W5JA 1IAQA 1G19A 3NBYC 4TQ9A 2V54A 3EZ6A 4OJKA 3OF5A 1QVRA 3QXCA 4D2IA 4Z1MD 1P5ZB 3HYRA 1ZD9A 5JEDA 3TE6A 1GL7A 2WJHA 3EPKA 5BN3A 3ASYA 2ZRAA 5J4KA 3JZAA 3SFZA 3D8BA 2ZM5A 2ZJ5A 2QNRA 2E87A 3SU8A 4CW7A 3HU2A 1L4YA 4JVNA 4G5QA 2WICA 4NMMA 1K8RA 2ZI3A 1NVUQ 1Q1EA 2WKRA 5FOSA 2CE2X 4FCTA 1IXRC 1P2UA 2JLZA 4YQFA 3K70C 1I4TD 2O8EA 4LHYA 4XWKA 1XMIA 2R2AA 2AFIE 2QAGA 5FBWB 1KO8A 5FTKA 2EFHB 2NO9A 4PTLA 3H86A 3BH0A 5D3MA 1HA3A 1R8SA 2GK6A 4LGMA 3JVVA 2XZPA 4EUNA 5KNBA 1UEIA 3TAUA 5J47A 1YZNA 2FU5C 4JVMA 2YC4C 1AZSC 1G64A 4V02A 4N0EA 3KQKA 1W1WA 3TH5A 4QHTA 3IHLA 1HUQA 1HQCA 1ZUIA 1DADA 2NMVA 4OQXA 1ZM9A 2CJWA 4IXNA 4TLBA 1JB1A 2EU8A 1CIPA 1ZC4A 4MRSA 2D7DA 2WKQA 4JYCA 2O8EB 2YWFA 1OV4A 1JJVA 2PBRA 1NN1A 5FPKA 3A1UA 4B75A 4BASA 3B1XA 3K9LA 2ZJAA 2QAGB 4HLDA 4EKDA 3NC0C 4LYHA 3RS3A 1DAHA 1QZXA 4ON9A 1GVNB 5D3MB 1IBRA 2YOGA 4HAWA 1SXJE 2J3EA 1G7SA 1KMQA 2RGXA 3FYHA 2P67A 1GIAA 4D6PA 1OXTA 1CKEA 1N5IA 1M2OB 3EWAA 3NDPA 4TMVA 2ZRJA 3EIQA 2WMNB 3QOFA 1OT3A 5E7IA 5FUWA 2HF9A 4N3NA 3AVWA 4YMSA 4LJ5A 3I5YA 4LHXA 2CBZA 1AM4D 4EFLA 3BJIC 4Z1MA 2CHGA 1EFTA 5BYJA 1R10A 2CJWB 2BM0A 2HEIA 1AS2A 2HLDD 2ZAOA 3F5FA 2HCBA 2VA8A 4NCIA 5HCIA 5C46F 5L3QA 4K8OA 1HURA 4WXPA 2WOJA 1Q20A 1W4BA 5A4JA 3UPUA 3RVBA 1Y63A 3DL0A 3F3YA 4CT5A 3KZ1E 3A4MA 2FH5B 4LBYA 1X6VA 3B1WA 3PUXA 2ZVQX 3AKYA 3C5HA 2NQ2C 4M53A 4KBFA 5AUQA 2J46A 3HR7A 3THYA 2VHTA 3KJEA 2HDNB 5H68A 4LBZA 2FZLA 3QPUA 5H1YA 2YYZA 2G77B 1KJYA 3GJ0A 4IKEA 4K81B 1OH5A 1XTKA 2G3YA 4RY2A 1Z28A 3I8SA 5L3QB 3DO6A 2A78A 2QSYA 3LRPA 4A4DA 1XD2A 4NYIQ 2WV9A 3LD9A 5FPHA 2F1RA 1HT1E 3VNVA 4KYIB 1R8QA 1IONA 4A0GA 2ATVA 4W7SA 2V8OA 4B3CA 5SZHB 2GNOA 2ATXA 4Q1FA 3QXXA 4HZIA 4KU4A 4LYFA 4HEJA 4YMVA 3SI7A 3PEVA 3TR0A 3EIHA 2IT1A 1HYQA 1KY2A 5K8IA 3VNUA 4NYMQ 1N6RA 2PEZA 3THYB 4DBLC 2ZRNA 3NVAA 4LDJA 1NN0A 4TL6A 5K8TA 1ZW6A 1ZM2A 1KI7A 4N1AA 1LF0A 4P0TA 1CRPA 3DM5A 2QBYA 2KE5A 4XSHA 2LWIA 2ZI7A 1F48A 1NY5A 3I4LA 3SFVA 1P2TA 2IYLD 2VLIA 1XD2B 1SHZA 4TSFD 1YHNA 1E2LA 3BIFA 3LO5A 1S2MA 2WHXA 3VKWA 1Q1ZA 2XJ4A 4B35A 2QE7D 2RH5A 3AVTA 3IKJA 4Y0AA 2O0JA 5H70A 4DLVA 1LS6A 4BLSA 3KQLA 4LYJA 1VHTA 1X8KA 3K1JA 1S3GA 4TYWA 2O0KA 4B71A 1OKKA 3KKNA 3OZXA 4MYHA 4WOPA 5AUNB 1HH4A 2WVJA 1G3IA 4LYAA 5K8UA 3W3AA 4I1UA 3KUDA 2FSFA 2DHRA 1D2MA 4P33A 1LNZA 3IIJA 2JLSA 4TQUS 3TRFA 4TT3D 5KPDA 2W6JA 2IYQA 4JT2A 4GBMA 1PUJA 2BJWA 3U6KA 3AH8A 5KDLA 3RNLA 4MUBA 3PEYA 3ND9A 3CPHA 2EVWX 3BC1A 4TMZA 5EE1A 1TQ4A 2CDNA 4M2LA 1ZD1A 5FI1B 3AP3A 4EIWA 4Q1DA 4US1R 1IN8A 1Z5ZA 2NG1A 2GVZC 3MJHA 3V00A 1CF4A 1KAGA 2GEUA 1IXZA 1VPLA 3KQNA 2XTNA 2Z83A 4M1TA 2ZJBA 1OIWA 3CH4B 4LV8B 2B7BA 2PZGA 2JA1A 2RMKA 1R5BA 4Q9JA 1AK2A 4LZZA 4RVCA 2DR3A 3DMDA 5E7JA 3ZLJA 1E3MA 3K0EA 4ZKDA 1P3JA 3IO3A 3TGPA 2DPXA 4LHWA 5EZ5A 4K46A 5J4LA 2C04A 1Z2CA 2ZRIA 4DEYA 1H8HD 3LY5A 2RGCA 2A5JA 3DZDA 2GZHA 2YJTD 3DDCA 4IOKA 4QGAA 4A6PA 5KPJA 3AVOA 4AK9A 4HDQB 5KSZA 1CJKC 2MSCB 1II0A 2OILA 2Z0MA 5KYKA 1TQ6A 5TVKA 2PL3A 1KI4A 2WWHA 1Q12A 4URZR 1E32A 3QXSA 1U8YA 5TXGA 1EFCA 1AKYA 1J90A 2JATA 4BLQA 4BGDA 2O8DA 5JRJA 3ADCA 4BLPA 2W83A 4TSFA 1T4GA 4P31A 3K0SA 3Q3JB 2ZE6A 4NCHA 2QE7A 2IYUA 2IYSA 3O8CA 1F6BA 3JZMA 5D3QA 4MKHA 1KKMA 4P3YA 1F2TA 4B47A 3SC3A 4V0OA 1HE8B 2IEZA 1MT0A 5FOXA 5C4GB 2XSZA 4E07A 1N6OA 2ZSEA 4JL8A 2AHOA 3WRXC 4BPBA 4G1UC 3WHKA 1PUIA 4JLNA 4GT1A 3UMSA 4ZV4A 5J5CA 4C2TA 1GP2A 4WZBE 2ZYVX 3B1VA 3IHWA 2ZYTX 2YWHA 4M9XA 4ASUD 1ZD8A 1T0JB 2FWRA 1DAEA 1IN6A 4NCKA 4MYTA 2VEDA 4TT3A 3DKVA 4RD2A 4AIIA 3AVYA 1OFHA 2O8DB 2FG5A 1YZLA 5AJZA 1XRJA 3RABA 3BGWA 4DVGA 3P27A 4G0NA 2OT3B 4HAZA 3WNBA 4L9WA 3GLIA 2C9YA 5J4HA 2Q6TA 4C0JA 3BS4A 3IBYA 2GEVA 1XB2A 1F2TB 1GKIA 2GF9A 5TY0A 3RRZA 4AC9A 2QI9C 4XIGS 3TK1A 4B2PA 4DSUA 2JGNA 3CH5A 1E96A 2PLFA 2QENA 3U3KA 5FOUA 2Y8EA 4NE2A 5FTJA 1Z6XA 2VHJA 2JJ1D 3RS7A 4PQRA 3VMFA 3PFIA 4OK6A 4Q02A 5FUYA 521PA 5DH9A 5ANRB 1XEWY 2FFAA 1IN4A 4MRNA 4QRHA 1S9DA 2ODBA 3MWKA 3DZ8A 1VG0B 4OHZA 3NBFA 3N2IA 4A36A 4KI0A 3GLIB 2R6CA 2QP4A 3LDAA 4I4LA 2AFHE 3ZGXA 3QE0A 3PV0A 1TX4B 1GUAA 2JDIA 3GFPA 3RLFA 5JLJA 3PEWA 4LWZA 3CNOA 1OIVA 1KI6A 5G53C 3QENA 1DAIA 1E1QD 2IA5A 4DHEA 3AKEA 3I32A 3P26A 4QM6A 4BFUA 1PLLA 3AVPA 1VCMA 1P7CA 3MSXA 3RDPA 1PZNA 3AKDA 4ZKEA 5SZKB 5JMTA 1G6HA 4BFSA 2NGRA 2W2XA 1MOZA 3NC1C 3TVTA 3QBVA 4OQFA 4O25A 2FSGA 4NCNA 2V7QA 2MSEB 2VH5R 1M7HA 5CDFE 3KJHA 4GZLA 4RD0A
chains in the Genus database with same CATH superfamily
2HJSA 1FJXA 3Q1LA 1A0OA 821PA 1KI6B 3PB3A 4E5PA 1KJJA 3ILXA 3LW7A 2F8LA 1C30A 4PYIA 1DCTA 4M0KA 1BOOA 4MQ6A 1KK3A 2FVYA 2GO7A 3OURA 3PXCX 3HY6A 3ZHZA 3OZSA 2RHCA 4YV0A 3NIDB 2D1TA 2AZXA 3LWBA 2K7FA 3FY4A 3X2EA 5F21A 2XZDA 2XGSA 3HA3A 4XX0B 1Z4JA 3OEWA 4JLKA 3SJCA 4D3FA 1T5IA 1KAOA 2EQ5A 3KHKA 4B3GA 3AVUA 3JVEA 1KA9H 3TFQA 3DOUA 3L8HA 4KPUA 1VLVA 3DOFA 3IUPA 3GEHA 4QBHA 4EITA 4JU8A 3GLGA 3FAKA 3ACCA 4GUAA 3W5AA 3I9NA 2CT8A 4CMKA 4B45A 1IJFA 3JQ8A 1T9BA 5AQEA 3W34A 2P9HA 3VR5H 4ZIRA 1L5MA 3DLAA 3R6TA 3PHGA 1NVAA 3UK6A 3RWMB 4IJ6A 2HJVA 4KNWA 3WMRA 1A1VA 3OWXA 1D6JA 1FY2A 1YDMA 4IVPA 4NMWA 5DCUA 4GO1A 1SCNE 2G63A 4BFCA 4KIJA 1I7LA 4D56A 4ZI7B 1GL9B 1R9GA 1NZDA 2JANA 3DT8A 3W3ZB 5AVKA 3C3EA 2VP9A 1WXHA 1X38A 3LVRE 3WKEA 4CEHA 1L4BA 1PR6A 5AJXA 2J9RA 4HZUA 4NZYA 2CKDA 2ZRDA 1Q14A 1P44A 4XDGA 1KJWA 1M34A 5JCZA 1YZUA 2C42A 2VT2A 2ZT7A 1J00A 4LC1A 1FNSA 1XZKA 2R66A 4B17A 2NT3A 1DG1G 4TMXA 1E0KA 1J0XO 1B74A 1SELA 5KYYB 4TTVA 1YZQA 4B32A 3PE3A 2CCGA 1CQZA 3L6RA 1QKKA 2OLJA 2XUZA 1NY6A 1DARA 2B78A 3I2HA 4LNUA 3UANA 2X58A 3DV9A 2J32A 3GF4A 4KBGA 4KXUA 4LECA 3H3FA 4R01A 4PRLA 2FDXA 4IFIA 2BF7A 1SKUA 5E95A 1OB2A 2CL5A 1QK4A 3GU3A 1RXUA 5EFZA 2VQSA 3RF7A 4C7MA 1G21B 3O3OB 1NW8A 4KQJA 4M89A 2R6AA 1VKJA 3K9WA 1NC3A 2D5AA 3X1WA 3JV7A 2GKGA 4WUTA 5I3CA 4XW2A 5ITWA 3IV9A 2AT1A 2ZM6B 4DV5B 5BNZA 1HEUA 1PEAA 3FPLA 3OOEA 4FOOA 1G5HA 4A10A 2FOIA 3EISA 3FA2A 3OUTA 4YWHA 4TZ6A 3AHDA 4KDCA 3VR6D 4D4IA 1CP2A 1E0JA 3AM3A 3I52A 1L5NA 4MW0A 3I76A 2JLWA 3A2MA 3ZIAA 1EP2B 1Q15A 2PRKA 4GYYA 4J2OA 2D1YA 3PHHA 4HWRA 5IWAB 3HBNA 1EFLA 3PQ2A 2H3HA 2D00A 2JH8A 4HGRA 1YB5A 4OXYA 1DNPA 2EFGA 2ID8A 3FOCA 1CJMA 5HF5A 1I3OA 2RAPA 1NXTA 3CPSA 3CUVA 1O9GA 4JENA 4RWEA 3SQMA 1XMXA 2X7XA 2ZS7A 3KDSE 4QUHA 4H1TA 4E33A 3IIEA 4D4GA 4GP9A 5BXQC 2BEJA 3KOYA 4G6ZA 4F7DA 5TPZD 3LHKA 2AUMA 4FD2A 4M0MA 4YB8A 4M8KA 4U5XA 2VRBA 2Y0DA 2OV2A 4TWAA 2P75A 1B00A 2GMWA 3E9YA 3V6MA 4MHTA 2XKBA 2D59A 2QPTA 2B8TA 1F1BA 2Z2KA 1VYTA 1ETUA 1UL1X 3ZZUA 1P2GA 2QM0A 1FFBA 4MKRA 5LJIA 5A4KA 3PFBA 1RWOA 2PUVA 3M8KA 3REFA 1WCYA 1TQ2A 2R8RA 4G23A 3WLHA 1LPMA 3KKMA 4C6TA 3CM0A 4G5HA 3UJ9A 4YONB 3DYVA 4KWEA 3ITEA 1NJGA 5DNCA 3EQ8A 1EGMB 3PUYA 4RTRA 4K6CA 2Z2YA 4L08A 2BGWA 4ER0A 2CJPA 2OEPA 1MEJA 3KXPA 4ESOA 2I66A 4ZZIA 1CS4C 4IIJB 1IUKA 2P4EA 1Q83A 2QX4A 2Q7OE 3SMQA 2RBEA 2IS1A 3INRA 2Z5LA 4X9XA 2HXGA 2VI5A 4QXQA 5B64A 3H2KA 1R9JA 3OPVA 2RBKA 4J6EA 4N7BA 4XRGA 2PVSA 4MI3A 4KQEA 1YS4A 3KCNA 2FLWA 2PKWA 1UKEA 1PNVA 2HC9A 2YXNA 1P4RA 4PPGA 4R3NA 2IX3A 4OXRA 4M7RA 1CUAA 1Z56C 4TV8A 4WZZA 3AB3A 3K70D 5C1OA 1JKMA 4CN9A 1F12A 1V8OA 2HW8A 1RQXA 3AT1A 4J29A 1Z33A 4C01A 3SBXA 1TU0A 1YR6A 4MUJA 4J6FA 3HJNA 5EERA 2G4CA 2IXGA 3SXUA 1T3LA 1ZXXA 4NI5A 1V6AA 4NX2A 1EHCA 1H2YA 4D0SA 4BQQA 2DUNA 4JYZA 1XRQA 4C0SA 4B3JA 4HDKB 3VC7A 1VJ0A 3CW2A 5CDUA 3VYWA 3VR6A 2FOLA 3BK1A 1A69A 3SCZA 4IUBS 1SHJA 2G4LA 2QMOA 3LVQE 4LX8A 2QK4A 4PYNA 3DEKA 3HC7A 4XOIA 4YH1A 1TMGE 4MVJE 1MORA 5SY6A 3TQIA 1E2MA 1QGED 1UXHA 3SZOA 1QZUA 5KTTA 1CDOA 1J0AA 3DCJA 3C8UA 4QBFA 2GH1A 1GZSA 3NLLA 4DY4A 1AA9A 3RVQA 2PJRA 4N65A 5D7NA 4MR9A 4FSHA 2DFPA 2FB9A 3QF7A 3UH0A 3MINB 1J2JA 4JOBA 1MB9A 4F56A 5JAUA 2R25B 3DLPX 1N0UA 3ET4A 3DV0A 4OSPA 1YRBA 2YV5A 4YT5A 5L7WA 3D0QA 4P08A 1BG6A 1SZCA 2CL7X 3P4XA 4CKEB 3T3HA 1U63A 2KLHA 4GWLA 4I3FA 2F43B 4NWIA 4R1SA 3NKLA 4WLUA 1TQHA 2H1HA 3QWBA 4EPYA 4F8JA 1YVUA 2ZBEA 1JAYA 2FI1A 2X4DA 4HYEA 4I8DA 3O0DA 4L4RA 4ZTBA 2JFQA 2HB6A 2I29A 3PUJA 4Q00A 4BN0A 3FNEA 4EB6A 1CQXA 4HAYA 5K4GA 2Z58A 1ZNZA 5GQSA 4CDRA 4GOOD 1X7ZA 1V35A 4FXOA 5FLKA 3RSOA 1H22A 3ZI4A 1QRTA 5KZMB 4DNXA 4CLRB 2Z9DA 1EESA 1PW5A 2EYUA 2X5OA 4LDPA 1QKIA 1K5DA 4RMJA 1XGKA 4U00A 4ZRNA 4DS3A 1CSEE 1LQUA 5A5EA 3UM9A 4G56A 3O93A 1QO7A 3G2PA 3PQCA 3PQ3A 5P21A 3RSHA 2FW8A 2C2YA 3HFRA 2Y6UA 3D8RA 3IPYA 3OOWA 5L3SB 2DR2A 2AMLA 5EPOA 1NL3A 3D8TA 3GJXC 1ZOLA 2YYAA 5AIAA 3KWJA 3L6EA 5K3BA 1QE5A 3UJBA 1BKDR 1B8NA 1BKYA 1YRQA 2RG7A 3QG5A 2ZRHA 2HI0A 2XLBA 3RHTA 2X1HA 5LQKA 4CL0A 3UAWA 2BKVA 3KT8A 2CVPA 4BNGA 1A9XB 1FFAA 4RV4A 1PL8A 1UDRA 3K0AA 1Z5PA 3CU5A 5AUOB 1OGIA 2IEIA 3DMGA 1UPTA 4B7ZA 2C83A 4ZYWA 1FTWA 2QRKA 2F3QA 3FNIA 1YVDA 5DHUA 1RP7A 1XEXB 1HWYA 1V7PC 3T1TA 2V7BA 3IEIA 4Y6LA 3AQIA 1BE0A 1QYCA 3FB1A 4DA4A 3G9XA 1K7FB 2VUTA 1YL5A 2BKAA 4RHXA 4V0LA 2FMXA 2GHIA 4RKYA 4ND7A 3LECA 1VBKA 3GXBA 2RHJA 2EKDA 2WWVD 3ZKWB 1KH1A 4EHDA 2C2MA 3DQPA 3NI2A 3QJYA 1XC7A 3IEXA 4CU5A 1NYRA 4H1UA 3WK6A 4XI9A 3Q9LA 1PJCA 1TUBB 2ZU6A 4XYBA 1XXHA 4DDKA 1XL1A 4JIGA 3K09A 4X6LA 1IOWA 1VG9B 2LV8A 4LDAA 4S1WA 1PSDA 3PSAA 2JFNA 4TTPA 1T43A 3UWOA 2DJ5A 1Z06A 3H9BA 1REQB 2VPQA 2Z9BA 1LSSA 4FFPA 5JNLA 1J9EA 4PANA 2W71A 2A0XA 2UYCA 1P4HA 5FUVA 1PD1A 1XEWX 3RKUA 4Q7QA 1HNNA 3L0BA 4EX7A 1WZIA 2GBIA 1RRMA 3NHPA 4M76B 5BYKA 4I1SA 3GJZA 3LXRA 4IILA 4OHXA 1W0JD 4V3BA 3TQQA 3EMDA 2D74A 4Q03A 4D81A 4DBZA 3PI6A 1OX6A 3OSZA 3PJFA 1YDGA 2LCQA 1HNWB 1E2NA 1NOIA 3ID6C 2JZCA 1OZAA 2GZSA 3QYPA 4AM8A 5C5EA 1Y4SA 4GRIA 4Q9KA 3AB8A 1E79A 1E2JA 1NDHA 4IDGA 2HLNA 4M7OA 4OP2A 4RMIA 1WE2A 2NPFA 4QFDA 4EG8A 2P69A 4IX1A 1QVZA 3SEAA 4MYCA 1MDFA 2QYOA 5F2OA 4KQ9A 2DWPA 3OQVA 1BRMA 1L7OA 2PBFA 4KNVA 2W42A 2B61A 1BE8A 3CVUA 3O9ZA 1L1EA 3NXSA 4W4TA 4O2BB 1CQJB 3QU9A 5DO9A 1DKUA 3F4KA 1OJLA 5KCMA 3IQDB 3NP7A 2WIAA 3N70A 5CLFA 4EAAA 3AY3A 3U3RA 2PL9A 4GWKA 3EULA 1QTIA 1KP3A 1WUKS 4DJJA 3SQDA 2PANA 3ABOB 1Z8HA 2W2LA 1KSHA 1U9ZA 2WDZA 4XLZA 3W5JA 3IEKA 1RI1A 3DF9A 2CNBA 4IJUA 3L43A 2IEGA 3A6KA 3AF4A 5T5QA 1WDMA 3ZVMA 4II7A 1JQEA 3STTA 2D2IA 3QEJA 2WB2A 2B9VA 1H6CA 2JZOA 3VDXA 5I9TA 3W7AA 3AEQA 2H2WA 2VCHA 4KP7A 4OHBA 2FRDC 2QD3A 4HRYA 4BVBA 3V9PA 1U8TA 4FYYA 1O2DA 2H8KA 2FSPA 4BNUA 2W6JD 1YWGO 1BJTA 5LNK1 1NQAO 2QRHA 4CIYA 3G5UA 4MVJG 5C32A 2HWWA 4NEGA 3VNQA 1YJ5A 1J2YA 1CY4A 1NNLA 1U3VA 2I6SA 2IDJA 3CLUC 3DA8A 4LXHA 4MVWA 4ACBA 1U2GA 4EEKA 1KKLA 2YDYA 3PGKA 5IYZB 1XDUA 2BMAA 3NBZC 1V9CA 3NOOA 4QATA 2OG2A 4A27A 3TSWA 3BH7A 1JA0A 3DZHA 4XUGB 1Z0AA 2JD0A 3IUBA 1XA3A 4DLLA 5BWNA 3EYWA 2JGIA 4CPDA 2H4JA 2AMJA 5EUCA 2M6LA 1A1SA 2PKEA 4B3MB 3OTGA 4RY0A 3F5DA 2C03A 2OHXA 4QBGB 2FNAA 1M7BA 3BBLA 3DTVB 3ZV7A 5LP1A 1E2UA 3KYDA 2Z6UA 2EWWA 2N47A 2VAXA 3ZHYA 1P60A 4B34A 1W0JA 4I8XA 3M2TA 3QLJA 4E5MA 1GM5A 1KGDA 2Q50A 4YNBA 5K3OA 1IN5A 4HWSA 1FSZA 1EVKA 2JKZA 2REBA 4PVDA 1U2EA 5H3HA 5GPBA 1ZCBA 3RIYA 4TRMA 3PDHA 3FKSA 1WRBA 2Q0HA 3LQYA 4FYHA 5FWXA 1U0RA 2J4FA 3MS4A 4W8OA 1TAHA 1H9BA 2IX9A 1F2UA 2ORVA 2ZWMA 2C98A 3B6MA 4FMCF 3RBAA 5HEKA 3GUUA 2E1PA 3WADA 3LIPA 5J5AA 3Q7QA 1FS4A 3KJIA 4IIYA 5CGZA 1X15A 5ALUA 1UWCA 4FEYA 3AOEA 3OLXA 3BFPA 1MFPA 2W2PA 1NVKA 1Q50A 3AR7A 3HKCA 2YIJA 3PJGA 4K6HA 4KLCA 8AT1A 4DF3A 5H9WA 2PQ0A 1PJLA 1ABEA 4O4JA 1ESNA 1KHTA 4ISBA 4CM9D 1WG8A 3MLEA 4TLEA 1G21E 1T91A 2XNJA 1SHTX 4BNMA 4PLWA 2ZREA 2P5TB 2DFDA 3DB2A 2B1JA 1XYGA 3OQHA 4TS1A 5ALWA 3NRCA 4B0OA 5I48A 1GR1A 4D97A 1VLQA 2L0XA 4J1SA 1V96A 4O3FA 4IYRA 3R0VA 4OBXA 3IEVA 4DQDA 4ZVLA 3RAFC 3KTAB 1D4AA 3D3QA 4R2XA 1FFXB 4NH4A 5IAEA 1FRVA 1Y81A 1PR5A 5EG5A 1R4AA 1SCDA 2RH8A 2ZOSA 3PC6A 4YP7A 5C51B 3QTTA 3B5JA 2O7QA 3E5NA 2JH3A 3WBJA 1OLXB 1CY0A 3EY4A 1AS0A 4MI1A 5DX8A 1DEOA 1H8EA 1L7EA 5ALIA 1GV1A 1ZW1A 3C6XA 3EJ6A 3KT6A 2NU9A 3B7WA 3EZLA 3QBDA 4JNCA 3CKLA 4O29A 4RFVA 4CQLA 5CDYA 4IKOA 4ERXA 3RIMA 4H0NA 3NHUA 1TLLA 2FWNA 4I4TA 4EA7A 1IATA 1FUIA 2CFRA 1LDEA 3CNNA 3QVSA 1PWHA 4MKXA 3Q8MA 4U6QA 2OO5A 3SP1A 4EVSA 5EE3A 1DX9A 3L18A 4KE9A 3AL0C 2NNLD 1GQQA 2I6GA 2A9OA 1E92A 2RKWA 3RANA 1RP1A 5TS3A 5B37A 4DTIA 3SQOA 2JEZA 4OP3A 3R0JA 4NYMR 3A0UA 4NF2A 5EQJB 5TGDA 4URFA 4Q3OA 2HMWA 3B82A 1ZR4A 2B4YA 3RC9A 4AD8A 4A0HA 3QV2A 1M2EA 4TV9F 2LVBA 4RZXA 5C81A 2FE1A 3VNAA 5CH5A 2UYYA 1XZFA 3AFGA 1YF3A 3W3AH 1SOUA 2J0UB 1Q95A 1P72A 2HSDA 2NSHA 3B8HA 8ATCA 3D7LA 1X13A 3NWOA 1GXSB 4YAWA 5L3VA 3G49A 3GFOA 5AI0A 3C45A 1W25A 1TA0A 1F4PA 1TYDE 5JXWA 3KR2A 3GVIA 4PYMA 3OLVA 2QRZA 2JGFA 5C37A 2PX0A 2JFYA 3F8TA 5JJ5A 3IT2A 1KVUA 4G5XA 4BVGA 3GUCA 3VU3A 5AVZA 1OYWA 5EKXA 5GVRA 1Z6AA 5EEGA 5C4MA 2GLTA 5IMBA 1YS1X 1QDUA 3MTJA 5LQSA 3ZJTA 4O4IB 4BGUA 3LUPA 3I64A 3OFKA 3AVXA 3FBWA 4IOLA 4HFJA 1PRYA 3PENA 1E1NA 1KEWA 1SB8A 1L2TA 1DO8A 3LX4A 1MDBA 4REMA 4X8MA 4X97A 3A28A 4PBRA 4BBAA 4IH4A 3VPDA 1GPWB 2HJWA 5FUQA 3I62A 2HBYA 2JGMA 3O2JA 1C9DB 3K1AB 3RE1A 5AVRA 2QJTA 3FHJA 3VKFA 5KQLA 1EEXB 3ZY2A 1JG3A 5K8VA 3WA7A 3U5ZB 1IN7A 1F8UA 4D0LB 4F4CA 3S2GA 3G8BA 1KSFX 1VSVA 2OC4A 3KXDA 1J25A 3OHMA 1E7YA 1P75A 3ORRA 3R7SA 1EUYA 3C6ZA 4MINA 3KKPA 2GBLC 3JWGA 1K5HA 1XHFA 5CLIA 2JGEA 2UKDA 2VHEA 3LT2A 5EJGA 3BD8A 4INJA 5AXAA 1NI4A 2XQJA 2P9CA 5EQDA 1GNPA 2PRYA 3U26A 4F9FA 6Q21A 3QZUA 3PJRA 1BFUA 3HGQA 5K6TA 4PWYA 5KX5B 1XQ6A 5AVWA 4RJJA 4PEVA 5HKKD 1A72A 1PFGA 2P40A 4DCPA 2WWYA 2XBLA 3QKUA 2Q3FA 3WE7A 3ZH2A 2O1SA 1I3MA 2DY1A 3I3OA 3U62A 1C8BA 4P84A 3KZOA 4UPDA 5E0KB 2NU6B 5B58C 5DHAA 3F46A 2ZJYA 3M70A 4WA8A 4R54A 4FT2A 2CXSA 4M1SA 2GDZA 2GT1A 2YH2A 1WXIA 3A10A 3ZQUA 2X3YA 1CZRA 1RXIA 4TSRA 3NOXA 3M6XA 3CO5A 4JCCA 1YASA 3LBIA 3RKSA 1AHPA 3W9YA 2GCOB 3KYJB 4IIHA 4ND8A 4LI0A 4FKBA 4LRTB 5DTQA 1SKBA 3HCAA 3NFYA 3C1AA 1B0UA 2XY4A 1HTBA 5I4KA 4RSHA 3EOBI 1K6EA 1Q7CA 3ENWA 3IMGA 1N5OX 3KETA 5FKJA 3ROMA 1TZBA 4OTZA 3H19A 1V4NA 3RG8A 3U44B 1NBMD 3NAZA 4WLFA 3EXFA 2C5EA 1PZMA 1Z82A 1JXMA 3DDNA 2A57A 1QYRA 2EG9A 3HCCA 1QHXA 3ICOA 2YZ7A 4WRRA 3EGDA 5ILGA 1FLDA 4QXPA 5B3JC 3HA2A 5EP2A 3FWZA 4JJAA 4Z7JA 5JD5A 1U1DA 1KYZA 1ZGJA 3MTQA 4KR3A 2VNIA 1ZNWA 421PA 2WYOA 1GTZA 2ZUTA 3AILA 3K0CA 4C4PA 1KE2A 4C6RA 1Q0QA 3H17A 1UKCA 2FGJA 4AB1A 3ZQJA 2IE0A 2X4GA 3KEGA 1BXKA 2FPIB 3INYA 3FSGA 4A82A 4B4OA 1L7RA 4BAZA 3P2MA 3BEOA 3NNSA 1VLZA 2WYVA 2VXOA 4NCJA 5AW4A 1R15A 1C4WA 2ZJ0A 4X1IB 5GZ6A 13PKA 2Q2OA 1T2CA 3Q7PA 5L40A 3QBTA 5A3VA 3ZJUA 4WBNF 4O0MA 1E6UA 3L0IB 3ZVRA 2WVHA 4KWHA 3TQCA 1E6MA 1T5OA 2BKUA 2G7ZA 1XJ0A 1ZMBA 4JL6A 2HFKA 3HSYA 4AJLA 2P35A 5MN4A 1L5YA 4Y2HA 3ODPA 3GZJA 4OHMA 4M7WA 1HQKA 4KIFA 4WY5A 3UICA 3D8UA 2AEFA 1XAIA 1XQXA 4LOHA 3EC1A 6REQB 5JHHB 1AMUA 1SH7A 2A6PA 1Y8CA 3S6JA 3S68A 3JQAD 1G66A 4JUCA 4MX8A 1GRRA 2XA1A 3N6VA 1N5RA 1HYHA 3DTNA 4CKXA 1NURA 1TDJA 4MNTA 1G2IA 4OGKA 1O89A 3GEDA 2BBOA 4DOMA 3D7RA 1U5BB 4TTQA 5HZMA 1TZ2A 1IC6A 4NPCA 2OK7A 2PWZA 5C52B 4RIEA 5IT5A 4AX4A 1CK4A 7MDHA 3NBAA 4EZEA 1TYBE 2QMHA 3N75A 3TSCA 2E37A 1C3OB 1Y5NA 2V7PA 5AVXA 4HGQA 5FFNA 5KQSA 4L73A 3H0EA 4NDAA 3PQ7A 5H80A 2EWMA 2GN1A 3K30A 2I2BA 4E5NA 1AC5A 2OHJA 2YHIA 1YBFA 2H5LA 1THTA 1LS1A 3PE4A 5EY5B 1QDEA 2FQXA 1HC7A 2CLDX 5K0NA 2FPPB 3CQ9A 4PFJA 5ETJA 1XNHA 5EJEA 7AT1A 1DC4A 3MC1A 4IZOA 1XCMA 1QYXA 2C2ZA 1NJ2A 2J9FB 1Y1PA 3COPA 3KWMA 3WQRA 3TW8A 1IY2A 1WZNA 2ZYDA 3NH6A 5ALZA 1F51E 5H3CA 2XD9A 1QVAA 5E1DA 2VVTA 5IUNC 5TJ9A 5EJ7A 4YRPA 4JUBA 2FSHA 3LGAA 4NMHA 4PWZA 2WJGA 2WZCA 3BMOA 3VRHA 3PR3A 3GNTA 4YCDA 4EMTA 2EBUA 1JAXA 1G7TA 1Y9ZA 3Q3GE 3WLAA 3TAXA 1H4TA 3ZKAA 3LLCA 4J90A 2CF6A 1X3LA 4W5RA 3QWFA 5K03A 4IFEA 5DLPA 5CVVA 3HCFA 4RK4A 4LSGA 3C5WP 2WWRA 1N8NA 2L82A 1RWWA 2NTVA 3WB2A 1GAXA 2IYZA 2XD4A 2B94A 2AF3C 3CUUA 3WLPA 5BUQA 4BMZA 1E9RA 4BNZA 1TAGA 1GQFA 1R9MA 3PF9A 3T5TA 1MOSA 4HDAA 4E11A 2VNSA 1RC0A 1NI5A 1ORDA 4TX1A 2B7CA 4RZ3A 2B2NA 3E3MA 3RUHA 3O03A 1XZQA 1THZA 3WWDA 3E2PA 4MROA 1BIFA 5LOVB 1KPGA 2B1QA 1AZTA 1JHVA 4IQ4A 2XX3A 4MSUA 1NVDA 2R6ZA 2A67A 4DKXA 1VI5A 1PR4A 4N6GA 4LRXA 2XH8A 1WNTA 1Z22A 4MMXB 3IAAA 1KP2A 1B1AA 1M8JA 1SFRA 1N7HA 3NIFB 3JQAA 3OE7D 4MVJP 2Y1OA 3DE4X 2LD4A 5I3ZA 2IZOA 1DAKA 4S1OA 1DDIA 4ZAFA 1QRDA 2R6FA 4R8SA 4DR1B 2ZJZA 4MVYA 3ZCXA 2E4XA 3RVSA 1E3LA 2FMUA 2YCLA 3BGOS 4FMDB 2HQRA 2I9PA 3TEMA 2MU1A 4BQIA 4F3RA 1JMKC 2G40A 3HJCA 5EJFA 3ZOKA 1RI2A 1VPVA 2ODTX 1KRHA 2V55B 3SJZA 3IUQA 1JYFA 4B4WA 2WF7A 3BXOA 3GFFA 4BNXA 1IWOA 1KK2A 2W6CX 1LDYA 4MGYR 3GRVA 4MQBA 3T95A 5A3RA 1Z2AA 1JR3D 3NEJA 1Y7IA 2G76A 4MUIA 1LLFA 3V55A 3LKDA 2D2EA 1NOJA 1D8TA 2EFCB 3H87A 3DCNA 4UASA 5BT9A 4M8LA 4ENTA 5JWHA 4GMFA 1HFWA 1U1EA 2XW6A 4PQYA 4Y6GB 5ICCA 3SQXA 1J7JA 2ACVA 4UTRA 3K6SB 4HB3A 2JASA 2WF6A 4MZDA 1IHXA 2C4WA 3R7LA 5K3DA 2HSZA 2NNWB 3NHAA 4IEEA 1HDXA 4R8VA 4DBLE 1R4NB 1I80A 2VHWA 3K16A 4DB2A 1D07A 3ISJA 3B38A 1W8IA 4LBWA 4LPSA 4M1KA 4PG7A 1PNRA 4F7WA 1PL6A 3TZHA 3VZPA 3ZWKA 2PD4A 4QYIA 1U2TA 2ZROA 1BX1A 1G98A 2PWBA 4Y9DA 1FVHA 3GBPA 1ESEA 1QG4A 4RENA 3HBAA 3OTOB 4R0VA 4EWLA 3OECA 4AJEA 1SVLA 1EYZA 2D5BA 3OEHA 1VG1A 3P2KA 3TNJA 2YBDA 4KJZA 1DBSA 4GI5A 4XPIB 3TJMA 2OSVA 3GLUA 2EFEB 4ZQIA 5EGSA 4RLQA 2IITA 1OFUX 3BMXA 4LOLA 1JKFA 1W85A 5D6OA 3RARA 1BNCA 5M29A 3GN1A 2W6IA 1VGVA 4J0KA 2H8GA 4EF4A 2I4OA 3EPHA 1KZ6A 2WDPA 2YFHA 3R77A 1AKEA 1UZNA 3GA0A 3I2FA 4OU4A 2RI6A 4Z8XA 4Z0TA 1S01A 1RXSA 1V8FA 2XYPA 2J3DA 1GCUA 1T4MA 2C99A 1Z37A 2FHPA 4WZBA 4ZQBA 4TL9A 4FFBB 5ICFA 2AG1A 3WDKA 4E22A 3D6MA 4DIEA 5EWJA 2BE9A 1IXYA 3T3PB 4ZGGA 1UP4A 1KEUA 4MQ5A 5B1EA 4EBBA 1QHSA 4E1AA 5BUSA 1PS0A 3PU6A 1NP7A 3UCFA 5CU7A 1TCCA 2VJMB 4HLCA 3SX0A 2YJGA 5F4BA 1CUUA 3IBTA 3LX8A 2QG4A 5GOTA 2V3VA 2FZCA 3A4YA 5HE8A 3FTQA 3RAPR 5ALNA 3O95A 3EXG2 1WUYA 3KDPA 1W5SA 1W7AA 1SUFA 4URYR 3AERA 2JG3A 2FHSA 4KWCA 3T7CA 2GD6A 1HDCA 2HL6A 4G07A 1Z08A 4NBVA 5FV7A 4DLXA 5KNDH 4MA0A 3QA9A 5CK5A 3S3TA 1MGOA 1CJUC 2XWQA 3AZOA 2B8JA 5EMNA 5C35A 3DAPA 1JR3A 2C8JA 3MMXA 4YP6A 5IEJA 1GL6A 2FZ4A 3KBBA 3QF4B 4HKTA 3MYRA 4MRRA 5C2JB 4I5EA 5DEIA 3OQJA 4C0KA 4ZTUB 2O0HA 2JK1A 5HF8A 1R8JA 3WR5A 3EGOA 1ZP6A 1G8KA 2X4IA 1ZQ1A 2F1IA 1JEAA 5L4LA 2DQSA 3QNMA 2YS6A 4J0FA 3W06A 4KJXA 3K9BA 3TZQA 5CDSA 2QL9A 1VYHA 1JJ7A 1E1YA 3E81A 3ZE8A 2C2WA 1ISJA 2FR1A 3IDQA 1Q44A 4RL4A 3K0HA 3WSWA 1WEKA 2B1GA 3PHLA 4BATA 3Q9NA 2DH6A 4EY5A 1EVYA 1RLJA 4LHEA 5HF9A 4Y2SA 2UYQA 4BGVA 3G0DA 2KQUA 4M49A 4MAFA 4DZRA 2J0EA 3HDQA 4RA9A 4ZYYA 1JZSA 4BQEA 4IJWA 1PR3A 5CIYA 1U6IA 5HP4A 3NRBA 2P7HA 1CULC 2BRUA 1O6BA 1P0FA 1WCXA 4BJ6A 2ETXA 2V1XA 3IERA 4R41A 5I8WA 4QGBA 5CB4F 1A8QA 3CLUD 2MIIA 1PT6A 2C1XA 3SJUA 3PRYA 4BO8A 8LDHA 1IFXA 3DDHA 3MTGA 4F06A 4WW0A 1X87A 2JEOA 2TS1A 3VC3A 3E84A 3X1KA 4ZK2A 3R7WA 4J1TA 3ECSA 1ZX1A 1RCFA 1SCKA 1Z2DA 2QWXA 3PPIA 1XNQB 2FFJA 1MD9A 1UPUA 1OUMA 3C3JA 1XOIA 4N41A 2F17A 3KL4A 3QFCA 1QG2A 3MFQA 4UPVA 4C88A 5HQ3B 1JFSA 1FFHA 1ZS9A 1QRRA 2P5UA 3D31A 4X8LA 1C9KA 1JNYA 4QVIA 3HL0A 1YDFA 1U28C 4PFSA 3NHYA 3MGGA 3A9CA 1VKOA 5IAKA 3U7JA 4BQOA 4H9GA 3I6MA 1K6XA 2Z3ZA 3GAFA 1GUBA 1ISIA 4PZUA 1XDGA 2DTEA 2YR0A 4K1LA 5LB4A 3EVCA 4GOJA 2UUAB 4EY8A 5G0WA 4X7MA 3MZ0A 4U7PB 3FVVA 5H83A 4WKBA 4TKUA 3W6OA 3U4CA 4CMBA 1SMKA 2CNWD 2QPOA 3EAQA 3S1AB 3LE8A 3SN6A 4UULA 3RRJA 3SC6A 3BGDA 3F7TA 3AEUA 4BP9A 4FYVA 1HM5A 1SJ9A 4OHWA 2HPAA 2WR8A 3NM5A 1JIJA 3IHTA 1ZNQO 5DYNA 4AMZA 1KZYC 3AXSA 3EG5A 2FEOA 5EKSA 1HETA 3ZLBA 3RW9A 1KH2A 2B0JA 4TWRA 4AP9A 2GD0A 5JRDS 3ZWXA 3CSSA 3AW8A 2ECOA 3ZHTA 3GARA 1CLUA 1DRKA 3N9IA 2YV2A 1O6FA 3L5KA 4AURA 3D3KA 4BMSA 1J42A 3HXOA 2PVCA 3BGSA 3L8GA 1YHYA 2F1JA 4A0FA 2PVPA 3PDUA 4PZZA 1ZN8A 4DLZA 3HUFA 2ZUUA 1BDJA 2R4TA 3CUTA 2HR1A 1KMHA 1PZGA 2RONA 1OE0A 3GK3A 4KC0A 1XD8A 5SY4A 3K35A 3VX4A 1PGJA 4HX9A 3HPRA 5IBRA 3CTMA 3THXB 4E5VA 4OB7A 1Z5WA 3UEOA 3TKLA 1US8A 2XB9A 2AOUB 5DT2A 3U4AA 1WHTB 1N2OA 1UJMA 3L7LA 5CPFA 4Y1RB 5T4BA 1QXSA 1TD9A 3B6EA 4US0R 3AF5A 4L5AA 2H1LA 4FCWA 4F21A 4QQFA 4AF6A 4U6NA 4U9IS 1JA9A 1COZA 1LJLA 1Q7TA 1UDAA 3D0KA 4MKFA 2ZI9A 1ECFA 4JT8A 4N6OA 1QGDA 1S2OA 4L8FA 1ISFA 1NTRA 3KP1A 2CXQA 5AI6A 1XNRB 2GVDC 5LIPA 2LBPA 2BEVA 2FWBA 1B8VA 1VDMA 1WY5A 4MIYA 1E0DA 3GRYA 3PNBA 1FYEA 4MS4B 3RBZA 3RVMA 3UMFA 4FP9A 3GFVA 1GUYA 1KRXA 2QR2A 3O90A 4JI5B 3WGIA 1DC5A 2QAGC 2RGBA 3UC9A 1PX0A 2F00A 2J0VA 4TV9A 4TOIA 2NU7B 1ML3A 4MS3A 4Q1AA 5DBIA 2GBFA 2Q6IA 4H59A 5DPMA 1Q17A 2A0FA 4NFSA 5LNK6 4UNNA 3VX3A 3DL4A 2EGHA 2PFGA 2VWHA 4WKNA 4PYJA 1SR8A 5JE8A 1DAMA 1AQUA 4WEQA 5ALOA 5D8DA 1VRWA 1Z2NX 4KSYA 2RD2A 2P6OA 4FE7A 3UB2A 2OMKA 3IBGA 4QNRA 4DGSA 1E89A 1G8HA 1NV9A 2B30A 3KKZA 1Z2EA 5JO0A 4K9PA 2X6RA 4ZT2A 3ZWDA 3KQOA 1DDOA 1NONA 1N25A 1XX6A 4R2HA 3ZE1B 5M2QA 2YC2C 1EUDA 4D8TA 5KIAA 3WLFA 1QF6A 4E4TA 1FDOA 1V3UA 2CNWA 2ZR7A 1RZ3A 3IAM6 4XDHA 3HP7A 4MRVA 3HI6A 1V47A 1V5GA 4NK5A 3AEZA 3TE7A 1H0KA 1X1EA 2AIRA 3GPDG 3LLMA 4MUKA 1RQ7A 4I5GA 2B2CA 1XJWA 4KMOA 2O7VA 1MVOA 1DEKA 1X77A 1E62A 3D6VA 3A6EA 1S89A 2YXPX 1KI9A 4G1FA 3NIBA 3GCDA 3OQMA 1M6VB 2CMGA 1GPH1 5TGZA 3AVQA 5KKCA 2AD1A 3EPLA 4YRAA 1WSWA 2VATA 2WV7A 4FGSA 3A4TA 2HRQA 3N74A 1S0UA 4GU5A 4LBVA 2IC5A 1W0KD 1WBBA 2WZQA 3S28A 1N3LA 1GADO 4Z8YA 4ZMSA 3L7IA 3BH6A 4GDFA 3GJ3A 1EJBA 3QVVA 2OFWA 1RJ9B 5C80A 3ZD9A 4P0PB 3L1IA 1CBUA 1JVSA 3SK0A 2Q3DA 1QE3A 3OQPA 5COQA 3CKYA 4YV2A 2PPVA 1JU9A 4GZ5A 2O8BA 1ZIYA 2HDWA 3AIIA 3MAAC 4DNFA 5MDHA 2G70A 3U17A 1JV2B 5ADVA 1WPQA 2XRYA 3F6SA 2JCYA 4TT3D 4D0NA 4EI9A 3EEOA 2HJRA 4J0CA 3HLTA 1J1ZA 1Y1QA 4AJ1A 1O96B 4UUBA 1J4AA 3PIDA 4V24A 3UOAB 2HH9A 1M1XB 5CB8A 4D6YA 5KDDA 1FYFA 1UF9A 3L8YA 1A5SB 3IDFA 4QREA 4P4UA 4R5MA 4CNQA 4MLPA 3QEBZ 5CVTA 1L6IA 4DDHA 3EXIB 4IDCA 2HIMA 4G9EA 1X80A 4RV5A 4RTKA 3AG5A 3WB1A 1WKBA 3I12A 3FFTA 3GLRA 1Q3TA 1VC2A 3NG1A 4JOSA 4MK4A 1I4WA 1I24A 2DQ4A 1VCNA 3EK2A 2DWCA 3U6BA 1UOQA 3EXHB 4LXXA 3AF6A 5EUQB 2ANCA 3IQXA 2JBAA 1F3LA 2ZCUA 2ASVA 3JQDA 4AN1A 2B8NA 2XMCA 4C0HA 1U0GA 4CR7A 4URVR 5KJ6A 4ABTA 2OL4A 3K20A 1GXSA 3GVXA 2V5AA 4HATA 4RTNA 1Z4PX 1N2HA 2R7LA 1P5HA 1AHHA 1ODSA 1QFSA 2XIQA 3PLRA 4CIDA 5CFPA 3KZCA 1J2UA 1FNMA 3O0TA 3HBJA 2PN1A 3LNTA 4JGIA 4UM8B 1OB5A 1WB6A 4P3KA 2PWYA 3NX4A 1ZCFA 3OJCA 4JP1A 2VBFA 2QBYB 4ISCA 4KQHA 1J1UA 3A27A 3I9V6 5KVVA 2GJ4A 3T38A 2IKQA 1BH6A 2AJBA 4Q39A 1XA4A 3MOGA 4B7AA 2V45A 4EI2A 4WBNA 3ILYA 1V1RA 2FMFA 1Q7BA 3AQ4A 2IU4A 1MJGA 5BQ5A 3U3DA 3UJ3X 4ZMBA 2BWJA 2C95A 2BMEA 3GOHA 4WJKB 4OAOA 2KSQA 5HCUA 4FJ2A 1YOVB 4DNPA 3W78A 3V4VB 3HDTA 1OQAA 4UHJA 1JLHA 4JVSB 2NU8B 3RV3A 2WYUA 4F46A 3N87A 3C85A 2GXUA 3E3NA 5CEEA 3K8ZA 2JIMA 5AXCA 1DDGA 1SULA 3HB5X 2ADMA 1YDWA 4ZAGA 3VYUB 2GBLA 3MXOA 2J5KA 4EGJA 1GRVA 2H00A 2D54A 2Q2NA 2R8XA 3T7DA 2NM0A 3G8CA 2VZ9A 4G4GA 1UBFA 2VHYA 1T0HB 3ONWA 5J58A 1EX1A