4DB4A

Mss116p dead-box helicase domain 2 bound to a chimaeric rna-dna duplex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
256
structure length
256
Chain Sequence
SIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase MSS116, mitochondrial
publication title Structural basis for RNA-duplex recognition and unwinding by the DEAD-box helicase Mss116p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna-binding protein/dna,rna
total genus 82
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4db4A00
3GJ8A 4RY2A 4NHOA 1JXOA 4JBXA 3QNUA 1ODFA 2RMKA 5C18A 3IBGA 1T3LA 5SZKB 2QMEA 2YV5A 3QXCA 4CDGA 4IOKA 5DE3A 2UZIR 2CCKA 4U02A 1ZINA 1XJQA 3QSYA 1R8SA 1JQJC 2FFQA 3MWKA 4Z8YA 3REFA 3MRSA 2QY9A 3VR2A 2FNAA 3QG5A 2IXEA 1P9RA 2RH5A 1NN0A 1D2EA 3PIRA 4LC0A 1KO7A 2R44A 3CNLA 1T0JB 3CX7A 1E9RA 4B3DA 5CB8A 3FMPB 3VR4A 1DAGA 3O8DA 3GPLA 1IY2A 1OFTA 1Z08A 1XRJA 1Z29A 2BDTA 4GZMA 2WOJA 4ITRC 5IT5A 1QHGA 3WNBA 2P5SA 4CEJA 3CR8A 1G8YA 1IBRA 3HYTA 5KSYA 4C2UA 3ADDA 3AVWA 2ZS8A 3CB4A 3WY9A 5J4KA 1F2UA 2EFEB 3NEJA 1YZNA 4PSAA 2OUKA 5FL7A 3SFZA 2N1BA 2O8EB 1KK2A 1JR6A 4AKGA 2YC4C 1L4YA 2ZRKA 4B6FA 2QU8A 2JDID 1H8HA 1IN6A 2DFNA 3NHBA 4URVR 2GXAA 4Z1MA 4KJZA 3TIFA 1HURA 1GG2A 3SZRA 2W2TA 4M4SA 4C4PA 3FKSD 3KDSE 1V5WA 3GLGA 1K5GA 2YWGA 3WBJA 3VU9B 1D9XA 1U98A 4EQ6A 1LVGA 4IKEA 1ZD1A 6Q21A 3VMFA 4L5BA 4IXNA 3ZDQA 5KSOA 4B3CA 2P5TB 5AJVB 2IBMA 2VP0A 3T1OA 4OI0A 5FOVA 1XMIA 2OXRA 1E79A 2NO7A 2REXB 5FUVA 3GFOA 1OXSC 2V55B 1XD2B 2B8WA 2CCJA 2HT6A 4PHHA 121PA 1SXJE 3OAAA 1PLLA 3SFVA 4D80A 2DHRA 4RFSB 1KNQA 821PA 2GJ8A 2IXGA 2Q3HA 4ARZB 1SVIA 4WAUA 5DHFA 1A1VA 5LDDC 3SC3A 3FFAA 4RSGA 1LTQA 3EZ2A 4NYIQ 4IDQA 2G6BA 2ZI7A 2IYYA 1RRPA 4HZUB 4TMTA 5DISB 3AF3A 4QKQA 3QEJA 5AUQA 3RS3A 3SBEA 1D9ZA 1M34E 4D6PA 1MRSA 1J7KA 1GL6A 3W90A 1S1MA 3LDAA 2G88A 1U0HC 4JLJA 2JJ1A 2IYQA 3G0HA 1E2DA 3R7WA 4F92B 2IYSA 2GRJA 3SBDA 2FWRA 2C98A 3CIOA 1TX4B 4PFSA 2J87A 3FMIA 2IWRA 1NLYA 3CX8A 5JLJA 3B7GA 5SZJA 2Y8EA 4TMXA 2GCPA 4V0KA 4G0NA 1P2UA 4JSYA 1NIJA 5EE1A 1AM4D 3SR0A 1TU3A 1BIFA 5B58C 4Q00A 4WZAE 4MH0R 3O47A 5AJXA 2J0UA 1FZQA 1VYTA 4KLNA 2ZEJA 3GJ0A 4O3MA 4IHQA 4LCBA 4ACAA 2WWHA 2GAOA 1ZUIA 5FBQB 1Z0JA 1VPLA 4HDQB 3ZLJA 1SXJD 2TMKA 3KKNA 2KJQA 3AF0A 3WYFA 4PC6A 4HLCA 3SI7A 3ZIAA 4EPWA 1Z5ZA 4BFTA 1U99A 3CPEA 1UBGA 2WOOA 3SQXA 4ZIRA 2FFBA 1GL9B 1XTIA 2E1RA 5G41A 3UANA 2ZVQX 2QE7D 1GSIA 1TF7A 4FWIB 2PH1A 4GP7A 1Z83A 3DL0A 2H92A 2IWHA 2G1KA 2FPLA 2ZU0C 5EXTA 1P61B 3N2IA 2PLFA 3O8BA 4ZO4A 1XD9A 5EXXA 2G1JA 4LJ8A 3B85A 3K0CC 3W6NA 2ZREA 4WOPA 1Z0FA 2FN4A 3EG5A 4CZ2A 3F8TA 3T5GA 5LB4A 4E22A 3F0TA 3ECCA 3GJXC 5EXPA 4IOJA 3DM5A 3AEZA 2W83A 3EPHA 4UKDA 3T61A 5AJZA 3WHLA 2FEOA 5J40A 8OHMA 1XXHE 2V6IA 3RDPA 4IVQA 1BH2A 4ZCLA 1N6NA 1DG1G 1QDEA 2V54A 2VSOA 3KUCA 5H70A 2VH5R 3B9QA 5TV2A 1E2NA 5L3VA 1W0KA 2IF2A 2X2FA 1Z47A 3A1UA 3IQXA 1SKQA 4YC7A 2VYFA 1YU9A 4ZV4A 1R2QA 1P9NA 3A37A 1KI3A 4DLRA 1D6JA 1T0HB 2L0XA 3NBFA 4D82A 1S3SA 2ODEA 3EAQA 3RAPR 4Q21A 3CW2A 4LYAA 2XOKA 3SJAA 1WA5A 2CJWA 2OEPA 4EPTA 1QG4A 1XEWX 2P6NA 4JL6A 4QHSA 1OIWA 4NMMA 2I3BA 1TQ4A 2KE5A 2CLDX 3N70A 1TUEA 2V1UA 5FBVB 1MABB 1FMJA 1XCPA 3THWA 4Q4JB 4PO8A 2CL6X 4CEIB 2FMXA 3ZD7A 4C30A 3UATA 2Z43A 3N5CA 3UPUA 3S1AB 3PEWA 3HJNA 4CYMA 1GM5A 2BBSA 1NKSA 4NYJR 1QG2A 4M1SA 4DDWA 1SKYE 3BXZA 5DSZA 4FCTA 1HE8B 3EC1A 4BRUA 2QG6A 3EWAA 2XITA 4ASUD 3B9PA 3KJEA 1RYHA 2J3EA 1RRCA 3SJBA 4DSOA 2GXUA 4NZYA 2J7KA 1VCMA 4ZI2A 1M2OB 1KKMA 5AUOB 1P73A 4G01B 4P32A 4B35A 5DI3B 2DPXA 4TTQA 4PPFA 3TUIC 2ORVA 3PUVA 4L9SA 4MKIA 1QBKC 1ETUA 2Q9AA 4RCZA 2GCNA 5LB2A 1B23P 2OESA 3WXMA 1AS0A 3NBXX 1E2GA 3OESA 2VP4A 3AKDA 4DXAA 4ZDIA 3AV0B 1GWNA 2FG5A 4BFUA 1GRNA 4MGYR 4QBIA 4V0OA 2R6DA 3K1JA 1UBFA 2V8OA 3I92A 4DLUA 4DIDA 3AKCA 2RGNC 4DC9A 1KI6B 3ZZTA 4KV9A 1NVUQ 2QMUA 1QHIA 1GIAA 2HXSA 1QVRA 4Z8XA 2FZLA 3A4MA 5IDVA 3SEAA 2BJVA 5CM8B 3QE0A 4DUGD 4E5UA 5HKKD 1KMHB 4TTRA 3CZPA 4Z54A 2JASA 4TQUS 3MG9A 3SE0A 3KZ1E 2WV9A 2WKPA 1DO0A 4IRUB 4OL0A 4Q7KA 4Q1EA 5FOWA 2OG2A 4N3NA 4AIIA 2IW3A 4DRZA 3AM1A 4AYXA 4B2PA 2IYRA 4XD7A 4A8JA 1E2IA 1II8B 1R4AA 3OEHD 3PUZA 1FQJA 5FPHA 4ZI3A 2FZ4A 2CHGA 2NTYC 4PPNA 4P31A 2ZSFA 2B7CA 3D3QA 1VDZA 1UM8A 2NZJA 4DLTA 3IGFA 2JEOA 4JJZA 2PL3A 3DKPA 3KFVA 5FBWB 4DCSA 1EFUA 2JJ2D 2Q6TA 5L8VA 3K8YA 3PG5A 3RRMA 4N0EA 3DZ8A 1M7GA 2ZAMA 5JSZB 5KU1A 1T8UA 1MKYA 2X1VA 4WIAA 4A0FA 5JZVA 3U60B 4M2LA 1P2VA 4MKHA 1E9CA 4MYHA 4TLCA 4WBSA 1KO5A 1XPOA 1WCV1 5FH9A 1DBSA 1RW4A 3LXXA 5E7IA 5GJVC 1EFRA 5EZ5A 4DBLC 4U7DA 4Q1BA 4R9UC 1I2DA 2WWXA 5TY0A 3QKRB 4FINA 4DSNA 1ZM2A 5JRZA 2YZ2A 3B1YA 4BLTA 5DO9A 2WKQA 4OHWA 1Z06A 2EFCB 2ZS7A 5K8LA 1ZVQA 2D4HA 3FKQA 4TYNA 3SDZA 5UKDA 2VSFA 3ICEA 1KY2A 4V03A 1MO5A 2GEUA 2KI5A 1JAHA 1M6NA 1N5JA 2QL6A 4KSBA 1TTTA 1E9FA 2XJ4A 5E7JA 5B30A 4TZ6A 4DVGA 4KI0A 5DN6D 1NF3A 4LWZA 3AVPA 3QQ5A 1SXJA 4D4LA 2C8VA 1EWQA 5BN3A 2XXAB 1OB2A 3CF0A 5JHHB 3EPJA 2IYZA 1KYIA 5KDDA 4ZCMA 4LBVA 4BWYA 3X1DA 4HLUC 2NO6A 2JLVA 3EZFA 2IS1A 4MQBA 5EE5B 2CE2X 3HR7A 3K70D 2HDNB 3T34A 4FD2A 3GLGE 4IVPA 4GL2A 1YZQA 4JVNA 1G4UR 4CT4B 3J81k 1BYUA 1UKZA 1WMSA 1HA3A 2NG1A 4JT4A 1BYIA 4EJSA 4CEJB 1DTSA 3LLUA 4LJ6A 3GLIE 2IS6A 3EZ6A 1UEIA 3AVYA 3CBQA 1G64A 2WWIA 2XAUA 3TW8B 2GEVA 4GNKA 3KTAB 1JPNA 5CYOA 4EAQA 1Z63A 4AYTA 2QRNA 5EUQB 1XFAA 2FU5C 4D0GA 5H1YA 3A1WA 3B1VA 3PUYA 2ZYWX 1CULC 4Q48A 1E2FA 3M1IA 2J0VA 3HWSA 4MKFA 4QFMA 4X8HA 3BK7A 3TSOA 1SULA 3KQNA 2WMNB 4GOXA 3RRYA 3CWZA 1AS2A 4JS0A 4WXRA 1TEVA 4BASA 1NVWQ 1PLKA 1E0AA 2DYKA 1Q44A 4NU0A 1LFDB 1TL7C 5FL7D 1E98A 5EZ6B 3NBYC 2FPKA 3K0SA 1VHLA 1RKBA 4M1KA 4ZCIA 4LOAA 4B32A 1E2KA 2YWFA 3LH5A 5JS7A 4F7WA 5AUPB 1M7HA 4IVRA 4BLPA 4YMWA 3IBYA 4TQ9A 2IK8A 4KBGA 4YMSA 4PHGA 5E4FA 4AK9A 1ZP6A 2JLRA 5FTNA 3ZGXA 1Q3TA 1UADA 2BC9A 2X77A 1Q3HA 1KI7A 5EJEA 1ZM4A 2V9PA 2BBTA 1UKVY 4NH0A 1OE0A 4QBHA 4CGZA 1OW3B 4Q9IA 2J59A 1GZSA 3WNCA 3WMGA 1KDTA 2NO1A 3MJRA 3P20A 4JL8A 4BFSA 1OHHA 1ZUNB 1FMLA 3ZVNA 4TLBA 5FOTA 1VYUA 1E79D 1E0KA 3C7KA 5KHOC 2QP9X 2G0TA 3LD9A 1EWRA 2D7CA 2VL7A 4DT1A 1AIPA 2WIBA 2ZUCA 4QL3A 5JJIA 3X1WA 1GKUB 1F6BA 3A1SA 1XMJA 4L16A 2GESA 4PC7A 4YQFA 1XXHA 2JLQA 3A8TA 2ZJYA 4LC1A 2GILA 4XVRA 4ASUA 1RC8A 1X8JA 4PR0A 4CF7A 4LV5B 5FR2A 4A92A 1S8FA 3WYGA 1HT2E 2GDJA 3LQQA 1TQDA 3L82B 3B2EA 1P72A 4IEIA 2KWIA 4RZ3A 2ECKA 4Q01A 2J46A 3UG6A 1X1SA 2WWFA 2OM2A 1QHYA 1EXMA 2J0UB 2OSBA 3KX2A 4LHYA 4BFYA 1OYYA 1S1CA 2A7QA 4RD4A 2VLIA 3I61A 2C77A 3EIEA 2J7PA 3QXJA 1C1YA 3CO5A 5FUXA 3OF5A 1G7RA 2ORWA 4OQNA 3U4QB 1NSTA 1GTVA 5J4VA 4HLQB 1Z6TA 1ZM9A 3GFPA 1X3SA 4HAYA 4URYR 2QT0A 4XIGS 3PV0A 3THYA 3TBKA 4CEHA 1YJ5A 2ZROA 3TQCA 3AP3A 4C0QC 5KNDA 2ZI9A 3SN6A 1XZQA 2V7QA 3IEUA 3ZVMA 4LSGA 1KSFX 1ESNA 1W49A 1WF3A 2WAYA 3I72A 1KAGA 4Q9KA 5AJYA 3RS2A 2F55A 3AP1A 3RRZA 2ZJ2A 4II7A 1E2EA 1VG8A 4HATA 4NBSA 1OF1A 4B74A 2ZI5A 5JEDA 2DR3A 4DUGA 1R0ZA 1U0LA 4TL8A 3A1TA 3L0IB 2QUZA 2C95A 2V3CC 4WA7A 3ZIAD 1OKKA 4N1AA 5JBQA 2QENA 4D25A 3TNFA 2AK3A 2ONJA 1JJ7A 5C46F 1KDPA 2QSYA 4LHWA 3EIQA 2G3YA 4I1UA 4KXFB 5FTJA 1NVXQ 3NWJA 2FFAA 3RYTC 2DBYA 4IDPA 1ZD8A 1DVRA 1OYWA 4JVSB 2CL0X 2IHBA 1IXZA 1I4DD 4I1OA 4RCYA 3OEHA 3QVUA 4JYBA 2F1RA 4DWJA 3F5FA 2BJWA 3CH5A 4MRPA 4A2PA 4KITB 4HAXA 4Q9LA 3GJ5A 4BFVA 4TMZA 1KSJA 4IEEA 1N6KA 1H65A 1O87A 1ZNWA 2QAGA 3T1TA 2XX3A 5LD2B 1Z28A 1OXTA 1Q20A 2IEZA 1ZUHA 1KAOA 1LF0A 2F3RA 1E9EA 3BB4A 2XB4A 1G1MA 4P0TA 1NY5A 1II9A 1WRBA 5JWHA 1IOZA 3A4NA 4A0HA 5AK0A 1E0SA 1CR2A 1KO4A 3LAWA 1G8HA 2JLXA 4XVQA 4O2RA 1J2JA 3GD7A 1NN5A 1IM2A 3R9IA 3IPYA 4UNNA 3O8RA 1W0KD 3JVVA 3A36A 4BEBA 3OIVA 3AKEA 3I1FA 3REGA 3THWB 2IXFA 2DCUA 2R6CA 1RVDA 2QM8A 3VHLB 1KMQA 1YR7A 2WWWA 3TVTA 1GVNB 3EX7C 3X1ZA 2QMHA 5G40A 4UXHA 3K53A 1SVMA 1JB1A 2X19A 1Z6GA 2XOKD 3TRFA 3VR6A 2FH5B 1JXMA 2RGDA 1KZ7B 3P27A 1P6XA 2RHMA 4YXWD 3LNCA 3EA0A 4ACBA 2H7VA 4GPTA 2HCBA 1P60A 4Q9JA 4M1TA 4MRSA 1KO1A 4C0BA 4JIMA 4EKDA 4YDSA 2IYXA 1MR3F 1HQYE 2BMJA 2ZRMA 2C9OA 3AF2A 3IKJA 3QXSA 4US2R 3U3JA 4PHFA 1KDOA 3B8HA 4ZKEA 4XTCS 2RAPA 2R65A 1U9IA 1W1WA 2FSIA 3EWSA 1TADA 2A2ZA 1KI2A 2WJJA 1JECA 4PAOA 3RHFA 3ZYCA 1Z0IA 3CRW1 1OXVA 1ZU5A 4UQOA 2X2EA 1L7VC 5BW8A 2G0NA 3R20A 3MLEA 1YR6A 1SVLA 3FYHA 1X8KA 1GP2A 2H17A 2WSMA 3Q7PA 1N5IA 2AD1A 4HAUA 4IFBA 1NP6A 2OLKA 2RGCA 3NC1C 4A15A 3LWNA 2Q21A 2G83A 1G17A 1IN8A 4P3YA 3UK6A 1D5CA 3RVBA 4OJQA 1G8PA 1P9WA 2CXXA 3VR1A 1SGWA 3R9WA 1G18A 3CUEF 2DB3A 3MJHA 3RWOA 2EVWX 4E07A 2REOA 1PJRA 1IJFA 4HAWA 4R7ZA 2QM7A 5FI0B 3A1VA 3FE2A 3IIJA 3RWMB 4YMVA 5HPYB 3QKUA 4JL5A 2VP2A 1KJZA 5BWMA 1P2TA 1Z6AA 2VHUA 5KSZA 3KFXA 1BKDR 1QHXA 2BV3A 2A5YB 2OO7A 1Q1BA 4PPGA 3TUZC 4ZDWA 3VAAA 2RGBA 1GL7A 3KQKA 1W36D 2MMCA 2PMKA 2ZE5A 1M8PA 4JLAA 3UKDA 1NVVR 4HUTA 2MMGA 3R8FA 3D6TB 3Q85A 4Q7JB 3U5ZB 2ZSEA 3AGQA 2IYWA 5KOYA 5EQTA 2E9SA 3NH6A 1ZNZA 2HYDA 2V1XA 3GJ3A 1EGAA 4XSGA 2PLRA 4G5GA 2XZLA 1KHTA 4C7OA 4BPBA 1CJKC 2FJUA 3OE7D 3P26A 2WHXA 1G41A 2B21A 2WM9B 1G21E 3U61B 3D7MA 3GLIA 3Q7QA 1ZCAA 2HV8A 2GCOB 3ZVRA 1T5LA 1P5ZB 4A36A 1NG9A 2GTPA 4XD7D 3TMKA 4OQFA 2OCYC 3L8YA 1E0JA 4HDOB 1FOEB 3RNLA 4QBGB 1TAGA 1KJYA 4A1FA 2ZYVX 3FWYA 3KJIA 2QROA 2QTVB 4F91B 4M1WA 3FVQA 4BLQA 2PJRA 2ZYUX 1UJ2A 2EYUA 2GXSA 2ZRCA 4K8OA 3ZJYA 5FPKA 4RD6A 1E2LA 5JMTA 2CDNA 4CRWB 4MDEA 4LPSA 3PITA 2WJGA 2GAAA 4P4TA 1CS4C 1GNQA 5EUMA 1CBUA 2AL7A 3AUYA 4Q4HA 2EYQA 2JA1A 1QVAA 2C5LA 1YHNA 5G3ZA 3ZS8A 2ODWA 3AVOA 4Q66C 3Q3JB 2OLJA 3W3AA 1KI1A 4V0NA 3OZXA 1EFRD 3AKYA 3JZAA 1D2NA 3T5DA 1KK0A 2QQ0A 2I1QA 1NJGA 1SXJB 1YR9A 2ZI4A 2LCFA 2UKDA 1N25A 4QNMA 2EFHB 3DHWC 2P65A 5H8WA 5CK4A 3HP1A 3RANA 1SHKA 4LX0A 3OHMA 4Q02A 2QRZA 2RGEA 3PEVA 1E2MA 4IW3B 5B64A 4G5RA 4GRAA 4BLRA 2OBNA 1OSNA 2XSZA 3PUWA 4M22A 5ANRB 3KB1A 2FFHA 3QG1A 3QVVA 4URUR 3SHWA 2QI9C 5CITA 2R6FA 4EPXA 2ANCA 4PHTA 4CIDA 1HY3A 4K46A 2P3SA 1HEIA 1E1RA 4JBWA 1E9DA 4Z51A 4UNSA 1G8FA 1JPJA 2J45A 2O8CA 5D3MA 5JWOA 1EK0A 5FTMA 1G7SA 2WKRA 1KJWA 3K0FA 2Q9CA 5F98A 4HI0E 2CEAA 1P62B 3TLXA 5CM9C 3QPUA 3B1WA 4ZDKA 5JCZA 3W6PA 4NYMR 1GFIA 1GUAA 1YRBA 2O8DA 2ZR7A 5DI9A 3QKSA 2ZE7A 2PZEA 1LF5A 2Q3MA 3QUSA 4NP6A 4ABYA 2GJSA 3QKTA 1XNJA 3KKPA 2WPDD 3V00A 4PAQA 1JR3E 3LV8A 1XPUA 2ANBA 1P3JA 2BKEA 3WP0A 1XMVA 1J70A 2PJZA 2WTUA 2XTMA 4Q7MB 4DCTA 4B3XA 1AKYA 1XDBA 4GMDA 2JLUA 3GJ6A 3QBVA 1Z3IX 3DOFA 3VQTA 4TYYA 1UFQA 1Q22A 4X8OA 1XBTA 3THOA 421PA 2N46A 1JEDA 4I81A 1EFCA 3QY0A 4RJLA 1E32A 1T91A 4C0AC 2VPPA 3VR5A 4PC1A 1H8EA 2OAP1 3NKVA 1N6LA 3QOFA 2ASEA 2ZRAA 4M53A 5IHPA 5K8IA 2PX3A 4AWXA 3L43A 1N6RA 5HE8A 2ZJZA 4XWKA 1DAIA 2WMOB 3EZ9A 2HJVA 4YXWA 3MWYW 2A78A 4B71A 1RJ9A 4Q9HA 5HR5A 1XXHB 2PMDA 2W2VA 4MRRA 1RYFA 4Q47A 1Z22A 2CLSA 1MV5A 2QA5A 4B75A 2JLSA 2QPAA 2GHIA 2MSDB 1G4AE 2REBA 1OHHD 2WSSA 1AZTA 5L3SA 5FL3A 2F3TA 4B48A 2F6RA 3T1QA 4QOSA 2QBYA 1KNXA 2PCJA 3MCAA 1IAQA 1P7CA 1U8YA 3DMNA 1UPTA 1NNEA 1TU4A 4PQYA 3ZQ6A 2J41A 3GLFE 4CW7A 4Q4LA 4JZKA 4HB0A 3Q8XB 4PPQA 2ZJOA 2DFTA 1X6VA 4QM6A 1XJ0A 4HB4A 4MUBA 3UWKA 1JR3D 4TYWA 1F48A 1IN5A 3CNOA 4BGDA 2G9NA 1OT3A 1N2CE 3W8NA 5KYKA 1I2MA 2ZVPX 4CEHB 3CLVA 3FHCB 1NMZA 2D62A 4HUQA 2HF9A 1Q21A 5L3QB 4MRNA 5J5CA 2VHCA 4LYJA 2K5UA 2W6JA 1Z6XA 2JJ8A 1EX6A 1Z6YA 5EP2A 1U8AA 1Z2AA 4AYWA 4HYYA 1P75A 1T5IA 2A5GA 3RABA 2J7PD 1G3IA 2XZPA 4BFXA 3E5HA 2OILA 4WXPA 1SXJC 2FE4A 3GLHB 3NC0C 3TAUA 521PA 4QRHA 1UAAA 2QT1A 1Q1ZA 3Q5DA 3VX3A 2OCPA 5JCPA 3NVAA 4J0QA 3RS4A 2V7QD 3QF4A 3P32A 1BO6A 4M21A 2BM0A 3NH9A 2FF7A 3NXSA 1KK1A 3EASA 2WAXA 4XVUA 4TT3A 1A2KC 1CR4A 4LJ9A 2AN9A 4LRWA 5DGXA 5FBRB 1CR0A 2V4ZA 1Q1QA 2HXYA 1GAJA 4KCGA 4QGGA 4B43A 4F38A 1CXZA 3CWQA 1RPZA 2XB2A 4MDFA 1CJUC 1E2QA 4ON9A 5CIWA 4ESHA 1CF4A 2FSHA 2YC2C 3X2SA 3L2OB 4OK6A 3OE7A 1OKKD 4PZZA 3RSOA 1PLJA 1NLZA 3RC3A 4OK3A 2ZE8A 4QJ5A 4GDFA 2ZRGA 3P4YA 3CPHA 3BIFA 4BLOA 4DDUA 1VCIA 2VP5A 2VF7A 3C4JA 1J8YF 3BAFA 1GKIA 3AB3A 4YLGA 1W46A 4O2LA 1HH4A 4JLBA 1W5TA 5JI2E 2VTKA 4H1UA 5C1BA 4A0GA 5CDFE 4Q1AA 2D74A 1ZM7A 3PQCA 1BOFA 4XWOA 4KLZA 4V02A 2O8EA 3THXA 1HTWA 2C78A 2JAQA 5KUTA 3V9PA 3D31A 3X1XA 2A30A 4ERNA 3LVRE 1G9XA 4MITA 2ODBA 1C4OA 1U90A 4PQRA 2V6JA 4UNRA 2C9CA 2R2AA 3FHTA 1Q0UA 2VHJA 3VKWA 1QHHB 1UDXA 1RRFA 5J47A 3WMFA 1YRAA 2FA9A 2ZJ5A 1LW7A 2F43A 3I8SA 3U44B 1XEXB 2ZM5A 5JJLA 1LS1A 3PR1A 2Z0MA 1E2JA 3E2IA 1IY0A 2QNRA 1FP7A 3LRPA 1CJMA 4ZKDA 2ZRLA 1VTKA 1ZJ6A 1YQTA 4M1MA 4Q7LA 1FUUA 1YZLA 2ZE6A 4LJYA 5GVRA 1SHZA 2ZUDA 5DH9A 3PCRB 2LWIA 3W34A 4B73A 2IYVA 4GZLA 5FR1A 3SNHA 2IS2A 1OIVA 1D8TA 2GZHA 1XD2A 4LHXA 2EFGA 1XZPA 4A6XA 3ADCA 1JALA 3QI2A 3K70B 2CE7A 2YINC 4JJKA 5DYGA 2ZRIA 4HAVA 2RHDA 4HLDA 1G5RA 4LPKA 2IC5A 2P6UA 3FHOA 4ARZA 5JRJA 2XGJA 1N3BA 2J0QA 3H2YA 2D2FA 1HUQA 1E2PA 2OAQ1 3SJZA 2PT5A 1NMXA 2YVUA 4M1OA 3BB3A 5J4LA 4FCVA 4TZ0A 2KB0A 2ZYTX 4BZXA 3WHKA 3GJ7A 1YZTA 2A9KA 2IL1A 2NO0A 2EU8A 3MWLA 2PZFA 3I5YA 4IDOA 4XH9B 2CK3D 1FUKA 2G77B 4DDVA 3K09C 2I1VB 2VA8A 3VX4A 4P4UA 1R5OA 4BZQA 2B8TA 1CLUA 3CRVA 4QHTA 1VMAA 4KYIB 2HLDA 3ETLA 4W9MC 2VP9A 4PC2A 1ZNXA 1ELOA 1KKLA 2ZS9A 3R8CA 3RS7A 1Z0AA 1F2UB 3K9LA 4LHVA 2JATA 1G5TA 2C99A 2XNDD 4FIDA 1ZRHA 2BEJA 2WJIA 4DJTA 5P21A 4W5WA 2ZXUA 1QZXA 1FL9A 4NYIR 2NOAA 2IUSA 4K81B 2QZ4A 2WWGA 2O8BA 4Q4AA 4XSHA 4IXMA 4JSTA 2WPDA 2BOVA 4PSKA 3TW4A 1R0YA 1HT1E 5C4GB 1TQ2A 3FB4A 4H1VA 3T35A 2W6IA 5FUWA 2O5VA 4Q1CA 3AVQA 2ONKA 4R71A 2FX3A 3GLGB 2A3RA 4EQ6B 2LKDA 4KFUA 5KNBA 4LV6A 1P2SA 1S2MA 1FP6A 4NCIA 1OH8A 5ELXA 4GOKA 1KY3A 1JEEA 3GLIB 1G3QA 4D4MA 3QPWA 1IJEA 1PUJA 1UKEA 1E6CA 1N6IA 2EFDB 3KQUA 3AVTA 1L2TA 4C0JA 4M9XA 3GQBA 4NKRA 3DO6A 1YE8A 4UNQA 1N6OA 2NIPA 1XCMA 1Q12A 3BC1A 4MGZR 5KSPA 1CU1A 2R8RA 1KZGB 4QM7A 3UMFA 2PEYA 1EFHA 1GOTA 1G6HA 1Z07A 2EWVA 3WNDA 2OHFA 5EE0A 1Y3AA 4QGFA 4AKEA 1KI9A 3MUFA 5GVSA 3NG1A 1KI4A 1W2GA 1X8LA 2LKCA 4X8MA 3UWOA 1T6NA 621PA 3JVUA 4Q4HB 2EWWA 1FQKA 5FOSA 2ZRDA 4Q1FA 5J4YA 1HQCA 3UMRA 4KVAA 1F60A 1X1RA 4YMUA 1Z0DA 3VTKA 5KPDA 4FMDF 2RB4A 2Z4SA 3FMOB 3R7WB 1V43A 1N6HA 1JR3A 2Z4RA 3AP2A 3CM0A 4LYHA 1WBDA 5JECA 1ZC4A 1IQPA 1OXXK 4PQFA 4UJ5A 2AKYA 4AKIA 1S3GA 1ZM3A 1E69A 2QTFA 2ZETA 4DCUA 3U2QA 721PA 3UIEA 3ZVLA 1IN4A 4URZR 3IHWA 4DIEA 5G53C 2IHYA 1T3SA 3HPQA 2IEYA 4RFVA 3FGNA 4LGMA 3MSXA 4B47A 2XTNA 2WWYA 1U81A 3LLMA 4JMPA 1UEJA 2IYUA 4OHZA 1NMYA 1AZSC 1OFHA 1SVOA 1XP8A 3EW9A 4JYCA 1VECA 5DNYB 3DZDA 3BD9A 2YJTD 5JHGB 1E9BA 1OB5A 4TSFA 2O8FA 1OFUX 4NPHA 4M9ZA 2D2EA 4OQMA 4HLUA 4QNRA 1AN0A 2QMOA 4D4JA 4GI7A 4JKIA 2WICA 3IQWA 4DLZA 3K70C 1DAMA 4ZIRB 2FV8A 2B92A 3V4RA 2O8CB 2OV2A 5D3MB 4JT2A 3PJRA 2GVZC 2DWQA 1Z2CA 1R0WA 4M0LA 3BH0A 3LXRA 3VKGA 2RGXA 3K0FB 2J5XA 2QAJA 2XSZD 4TL6A 4UXJA 5F2EA 3GLFA 5CB6A 1G291 1FNMA 2C2HA 1K5DA 1T4GA 4C3ZA 5SZHB 2O8DB 3CKLA 3F3YA 5DI3A 3VKHA 3RRNA 1E1RD 5FPYA 3HPRA 5HZHA 2J1LA 3OFNA 1E94E 4B76A 4KVGA 1E4VA 4HZIA 3BERA 4XJXA 4DB4A 4TL9A 2N42A 1FFHA 4B2LA 2Z6VA 2DY1A 1COWD 5TXGA 1GITA 2OFWA 4BLSA 4C0SA 5IK2D 1IY1A 4DEXA 1DAKA 2FSFA 3L8ZA 4NCHA 4NL4H 3TSZA 5FOUA 1R5BA 4D26A 3IHLA 5BXQC 3VNVA 5C2JB 1YZKA 3C5HA 3I3SR 4NTZA 3W8RA 4NYJQ 4Y0AA 1KI6A 1I4LD 1CR1A 4D0NA 1KO8A 1U8ZA 1G16A 4F93B 4V0LA 4RZXA 2H18A 2P67A 3SQWA 3UXMA 4LHZA 3EZ7A 4MYTA 2CJWB 4KHZA 1KIMA 1UBEA 3IO3A 1DADA 3GJ4A 4EDHA 1CP2A 1KMHA 1XWIA 1XB2A 2DWOA 4MGKR 4TMKA 4DLSA 1XTRA 3TAHA 2XJ9A 4US1R 5FBLB 5A5GA 1CEEA 3FMFA 4NONA 4AC9A 3HDTA 1H8ED 3HU3A 4PO9A 2QGNA 4C0HA 1J8MF 2ZQ5A 2XTZA 2QBYB 2IF0A 2VHTA 2CNWA 2PCLA 2SHKA 1OXUA 1U94A 2UVQA 1NIPA 2KBFA 3DEFA 1ZW6A 4GMXA 3KB2A 5AR1A 3DDCA 1F2TA 2ZR9A 2GEDA 2C04A 1W2HA 4R2IA 2HF8A 1E2HA 1S9DA 3OEEA 4RKFA 5DLQC 2WSSD 2RGGA 4GFDA 5CDFA 5KPJA 2VO1A 3U7GA 1L8QA 1NSFA 4HUQB 4I1SA 3P1JA 2GETA 2IS4A 1VG9B 2VBCA 2CK3A 4PX9A 2XNSA 3K9HA 3PUXA 4FXPA 3OIUA 3N2EA 3TE6A 3AVUA 4URXR 1BMFA 3NDBB 5CLQA 5AWFC 3GEEA 1IXRC 4OI4A 3KXLA 4PO1A 3VFDA 2YNMA 4DCVA 1R5NA 1TEXA 2IT1A 2BHRA 2O0JA 4JLNA 3CR7A 2ZJBA 1K8RA 2AFIE 2GBLA 1AJEA 4MGIR 3BB1A 3QENA 4WZ6A 2XNDA 1W36B 4FW9A 3MMPA 3QF4B 3BH6A 4P4SA 3MGCA 5TB5A 3ND8A 2QEQA 3DOEA 3T1VA 2W6JD 4FMBB 2Z5FA 3MD0A 4JLVA 4F4JA 5M04A 2WJHA 2KSQA 3KXIA 4IOLA 4W7SA 2XZOA 3LFUA 4G3XA 4QHYA 2ZUBA 1R8QA 2R6AA 4DLWA 1S0UA 1Z0KA 2XXAA 2ZSAA 3I73A 3OIYA 2JIZA 4PXAA 5DHAA 3B1XA 3ADKA 5BYJA 4QXAA 4B34A 1W44A 5B2ZA 4C9BA 2GK7A 1DEKA 3D8BA 5FPTA 4AG5A 1WXQA 4XTRA 2PBRA 1AK2A 1L4UA 4OBEA 4TT3D 1AA9A 5FFMA 1VHTA 4FMDB 5H68A 4A8JB 3QF7A 3U3KA 1KK3A 1PUIA 2W0MA 1LV7A 1Z8FA 2R62A 3B60A 1S96A 2GNOA 1NRJB 2OE2A 4JBYA 2X8AA 4H9GA 3BJIC 1E96A 1G20E 3THXB 3LBNA 1SVWA 2D06A 3MAAC 3KTAA 1UKYA 4GBMA 1J99A 1AKEA 5BYKA 2CMKA 2CLCX 5KO2A 1ZIOA 3R9XA 5GJBA 4X8LA 2AKAB 1CTQA 1W4BA 2QQEA 1RZ3A 1N0VC 3H1TA 3M6AA 4LK2A 1ZMXA 2VRWA 4POAA 5LBIA 2F43B 3ASYA 3K0EA 3LQRA 2DWPA 2ORIA 4QC2A 3AF1A 5LD2C 3QXXA 3LX5A 4D81A 4GT1A 3H4MA 1XPRA 4V0ME 1S9HA 1GRRA 4OKSA 2NQ2C 2QPOA 1PZNA 5CIQA 1E1QD 5G3YA 3EA5A 4C0KA 1AGPA 1TF2A 3CH4B 3LVQE 4TYPA 3QPVA 3IIKA 4B44A 1BS1A 1II0A 1XCGB 2OBLA 3RSLA 2FOLA 1UBCA 2BMDA 4LJAA 4M9QA 3ZS9A 5J4HA 3W5IA 3A4LA 1GKYA 4HB3A 1M7BA 5DIFA 4PC3A 3X1YA 1DG3A 4KFTA 2GKSA 3U6BA 3WRYC 4A82A 1LS6A 3L0SA 1MH1A 1TF5A 2QN6A 5K8UA 1CRQA 2Q3FA 4MRVA 4DLYA 3T06B 4EJSB 5BN5A 1NKTA 2VEDA 2HEIA 1ZCBA 3MFYA 1ZYUA 2YHSA 4P33A 4RD2A 1EX7A 3C16C 4NCNA 3U7HB 3BWDD 3VR3A 1FPMA 3B1ZA 1EFTA 1SVSA 4YDHB 3T15A 3Q9LA 5HTKA 2O8BB 4Q4AB 1MT0A 4KYUA 2ZIAA 5EE3A 2I4IA 1COWA 4Q18A 5CK5A 5IK2A 3WBKA 2J0SA 3U4QA 2HLDD 1ANKA 2ZRPA 4ZDJA 1NG1A 2GJ9A 1CKEA 4US0R 3LX8A 1NBME 2BIFA 2UZ3A 1W36C 2BWJA 1ZIPA 2EW1A 5E95A 2B7BA 1N5KA 3G82C 4NE2A 5CYPA 4UXIA 3W3ZB 5AUNB 4EIWA 5JJKA 1DO2A 5K8TA 2XEXA 5BN4A 4ESVA 1DAHA 3ZD6A 2W6ID 1AQYA 4EPVA 4B2IA 1S4QA 1E9SA 1JAIA 2A5FA 1JBKA 5FI1B 3LBIA 2MSEB 2BCGY 4HEJA 2ZRNA 1DELA 2GWHA 1R0XA 4MYCA 3LO5A 4TLDA 4A2QA 1FTSA 1E4YA 4F4IA 2GF0A 3AH8A 2QP3A 2J9RA 5KNCA 4B3GA 5KTYA 1F5NA 3BH7A 4UNPA 4A8JC 3BGWA 2OFXA 3ZQJA 3QIAA 2QPTA 4OHVA 4DT1B 1G3UA 5LPNA 4ZPXA 2AHOA 4KO8A 5EP1A 4DEYA 4IOMA 3SYNA 3FFBA 1FX0A 3HYRA 2JCSA 2PZGA 2BVNA 3TJZA 4EFNA 3PEYA 2YOFA 3BBPA 3BRWD 3KL4A 1W4RA 1JI0A 1T9HA 2YYZA 3QEOA 3UMSA 4B33A 1U0JA 4GP6A 3LW8A 3K0AA 3HU2A 1W4CA 2F1HA 2WBLC 4DDTA 2HCJB 1NBMD 4BECA 1O3YA 1QRAA 4FMCF 2VF8A 4KSCA 1OIXA 4RD1A 4PSVA 3PEUA 3SOPA 2ATVA 4FCWA 4HB2A 3B5JA 1X86B 4YMTA 3KKMA 3U3RA 3LBHA 4S35A 1RFLA 5FUYA 1KGDA 5HCIA 1U2RA 4M8NE 2PT7A 1LB1B 5JEEA 2FSGA 4LJ4A 4GSYA 3AUXA 1IHUA 1A7JA 1G3RA 1US8A 1KOFA 2H8KA 3THYB 2O8FB 4O0MA 5FTKA 1W4AA 3KJGA 3W6OA 2ZRHA 3CRRA 3K9NA 4Q03A 5EE9A 3BS4A 3B78A 4TYQA 2OCBA 3HR8A 2H1LA 1FW6A 3I8XA 2BKUA 4AG6A 2NPIA 2ZSDA 3GLHE 2DFLA 4G5OA 5TVKA 2GXQA 4TN1A 3Q72A 1T3HA 4AD8A 4D4KA 3GLFB 2YWHA 2QSZA 3E70C 4FN5A 4MUAA 1SKYB 2JLZA 4TSFD 3B6EA 3AVXA 1QF9A 1IXSB 1N5LA 4MYUA 3UG7A 3LA6A 4UJ3A 1W0JD 1MO4A 1N0UA 2YOHA 4MKGA 5KDLA 5L3RA 3TK1A 3CX6A 3PXGA 1GNRA 1ZAKA 3CRQA 2P2LA 1FTNA 2FGJA 2GVDC 3DMDA 1LY1A 4TMVA 4FI3C 2BBOA 1G6OA 3U7EB 2CCGA 2R6GA 4LBZA 1G5PA 4EJSC 3NIBA 5CLLA 3ZZUA 3ONWA 4QJ3A 3TSWA 2W2XA 5F3WB 3BFKA 4DLVA 3OIWA 3K0CA 3RS0A 1XEFA 2NMVA 2QAGB 2ZTSA 1XD8A 2NPFA 4GOJA 4LBWA 2QGZA 1QHNA 1ONBA 4QJ4A 1TUIA 1HYQA 3OFND 4DB2A 4D2IA 4KFRA 4WVFA 4OI2A 2JDIA 3ZZ0A 5KDOA 1WDTA 5C4MA 1DAFA 4TQAA 1G3MA 4PZLA 1DOAA 1GRQA 2H16A 2WIAA 3NHAA 2WJVA 3FKSA 4L8GA 4NCJA 3CPJB 3FTQA 5IF9A 1VIYA 4CVNA 2HJGA 2YOGA 2D7DA 1AQUA 1HE1C 3GEIA 1OLOA 3U3OA 4RZUA 3RLFA 5IRCD 1NI3A 4C2TA 2AX4A 1VKJA 1ZBDA 1CIPA 1VIAA 1E1QA 4BE7B 2ERXA 1NJFA 4EUNA 1DPFA 4DKXA 3CF2A 3GEHA 4DZZA 4ILEA 1C9KA 4LJ5A 4OI1A 3VU9A 1JJVA 1GILA 2P0EA 1F2TB 4W5HA 1A4RA 2MSCB 4E03A 4Q1DA 1WE2A 1G8GA 1UDWA 1EESA 3TR5A 2BMFA 2OCAA 3L0PA 1Q57A 4AURA 2VHQA 1R10A 5A4JA 2GCOA 3G5UA 3QXHA 5A0FA 1MO6A 1WP9A 2BEKA 4OHXA 4S2EA 4OJKA 3A6PC 3AGPA 3I4LA 2CNWD 2QORA 2FPMA 4NDZA 4D0LB 1SVKA 4RFSA 3ASZA 3TR0A 3DPUA 3EPKA 5FTLA 3QBTA 2O52A 3IUYA 4QGHA 4RVCA 1KDRA 3TUJC 1A2BA 3GFTA 4HZUA 3C5CA 3OEED 3NEYA 3GCGA 1IN7A 3KXKA 4NCKA 3CZQA 1NY6A 3DM9B 3P4XA 4DLXA 1NVVQ 1YZUA 1J90A 4RD3A 3EPLA 3VHXA 2JLYA 3IEVA 1OFIA 4U5XA 1RE0A 2NGRA 1XTQA 2BBWA 4AY2A 2YWEA 2GF9A 4M1YA 4P4SB 5GADl 3EIHA 3KJHA 5E7MA 5CJ2A 2GZDA 5HE9A 4LYFA 4G5SA 4V0MA 3RC8A 2F1JA 2VQSA 1BMFD 3PFIA 1RRGA 4JVMA 1KI8A 2FEMA 1E9AA 4BUJA 2ZJAA 4KBFA 3LW7A 4L9WA 4PANA 1GDDA 1T8TA 4IDNA 1CJVC 4YONB 4TL7A 1OH5A 3AQ4A 2FDCA 2NO9A 2AXPA 4XWAA 3WRXC 1TPZA 3E1SA 1XF9A 2CHVA 2RGNA 1OH7A 4PAMA 2BCJQ 3B82A 2QE7A 3A58B 3CF6R 3K9GA 3H86A 3NBZC 2HUPA 2BMEA 4IDHA 3KQHA 1MOZA 221PA 2F9LA 3BORA 4JLOA 3W9YA 4CT5A 3CONA 1W47A 4KAXA 2JIZD 3U6KA 4F4CA 4BFWA 4C7OB 3ADBA 2C96A 1G7TA 3QJYA 4DSTA 4FMCB 1XMSA 1SQ5A 2W58A 4JLMA 1FNNA 4TLEA 1ZD9A 2ZU6A 2ZRFA 1AGRA 4JLKA 4Q19A 1DAEA 3GMTA 2GJKA 5HCNA 4IJMA 2F9MA 3KQLA 1N6PA 3TH5A 1G19A 3H84A 4JKYA 2WVJA 3O8CA 2RGAA 2CHQA 1YR8A 3H0KA 1XTKA 1WQ1R 2C03A 4L15A 1KSHA 4KFSA 2EQBA 4I1VA 4URWR 3GP8A 1YZGA 2QAGC 3EC2A 3AVVA 3B13B 2PEZA 4TLAA 1HV8A 4C0LA 4RKEA 1MRNA 4WZBE 1VCNA 4AKHA 1H8HD 2GZAA 5AJWA 4DSUA 2W00A 1NBMA 5B57C 4EFMA 2IUUA 4A6PA 3ND9A 4Z1MD 3FPAA 2ODNA 4R2HA 3TGPA 2IYTA 3C15C 5JWRA 5TDHA 1RIFA 1VCOA 4XOIA 2Q9BA 4AI6A 2AWOA 1XJCA 1TQ6A 3IILA 2VP6A 2IA5A 2D3WA 5D3QA 3TKLA 3I62A 1OH6A 1KTVA 2AD5A 2AXNA 1N0WA 5E3HA 1F3OA 2CBZA 1NL3A 3I5XA 4I4LA 2JGNA 2AR7A 3V4FA 3PENA 5JS8A 2AWNA 3OAAD 4KODA 2OBMA 4M9SA 1OJLA 2ZJ8A 5HZKA 4TWZA 3LY5A 5CJPA 4NYMQ 1OPXA 3W5JA 2PX0A 1MABA 2GK6A 1R6BX 4HAZA 1CJTC 4Q4JA 4CEIA 3CRMA 2B6HA 1E99A 5EXSA 2Z83A 4RD0A 1KSGA 2ERYA 4LI0A 3SYLA 3EARA 1W0JA 3S1AA 2JJ1D 1U9IC 3K09A 2OZEA 4Y0VA 1WB9A 3Q5EA 4PTLA 4DHEA 5JI3E 2HT1A 4HDCA 1E3MA 1GNPA 2W0SA 3SJCA 2A5DA 2AK2A 3KKQA 1PV4A 3I32A 3NTUA 4QBFA 4DCNA 1SZPA 4G5QA 2GJAA 2KBEA 4O25A 4BQSA 2GBLC 3PVSA 3T12A 1I4TD 2OFOA 5GJWC 2QP4A 1W5SA 1XEWY 4E09A 3IPXA 4TMWA 3FOZA 3TVDA 5L3QA 3QKSB 5EP4A 4LUCA 3JZMA 1R7RA 2VIIA 3EXAA 3CNNA 4OQLA 1VG0B 2ZSBA 2R9VA 1IONA 2OT3B 2P6RA 2O0KA 4EFLA 1ESMA 4KU4A 5FOXA 2CL7X 1P4SA 2OXCA 2ZRBA 4PZYA 5FPSA 5JFGA 1ZU4A 4BEJA 3C8UA 2ZPTX 4BRWA 5HKKA 3GLHA 2C9YA 1WBBA 3HU1A 2WJYA 4LBYA 1DE0A 4JLDA 1NN1A 2A5JA 1CRPA 4LJ7A 4WW0A 3IO5A 3ZH9B 1TMKA 2ZI3A 4OYHA 2AFHE 4LDJA 1Q1EA 2ZITA 3ICQB 1LNZA 1G7CA 4FWTA 2O0HA 3M4YA 3NDPA 3AF4A 5TARA 1PVOA 4EPRA 4JLPA 5F9FA 1ZNYA 3WMEA 4L4UA 1FX0B 3MWJA 1AS3A 3DKVA 1RJ9B 5EP3A 3U3MA 1YKSA 4A9AA 4BZPA 3WP1B 2H57A 1DS6A 1K6MA 4OQXA 1UF9A 2JJ2A 2ATXA 3U7FB 2WZQA 4LV8B 4TTPA 4JVLA 1QHSA 2H5EA 5L3SB 1XX6A 1ZC3A 2E87A 1XU4A 2ZR0A 4Q5IA 2CVHA 3K0AB 1NLFA 1OV4A 2IUTA 2HYIC 1EG7A 4LY6A 2DFKB 1A5TA 2Q0HA 1II8A 2QTHA 2F1IA 1W48A 3IDQA 1D2MA 1XTJA 2VSXA 2BM1A 4MA4A 3SU8A 2JLWA 4HSEA 3RS5A 1JNYA 3SYKA 4W5JA 2ZAOA 2RKOA 3FDIA 1YVDA 4EPYA 4B6EA 4A4DA 3WYAA 3C14C 3SS8A 1US8B 2GA8A 2IX3A 1M74A 2CVFA 3KUDA 4U00A 1XTSA 4IFEA 4RZ2A 5GJCA 5JSZA 2YKGA 1VG1A 3BOSA 2F7SA 3M0EA 2IYLD 4B3BA 1QHHA 2RCNA 5BQ5A 1A82A 1JQLB 1M1YE 3L0OA 3TQFA 4OHYA 3U44A 5F9HA 5SZIA 1Y63A 1XEXA 1TNDA 4N0DA 5DN6A 2FGKA 3DVLA 4QGAA 1VYVA 4B3FX 4I99A 4LZZA 3SHFA 4R98A 3QKRA 5TMPA 2NZ8A 4QG7A 2ZRJA 3IIMA 1NN3A 4G1UC 4OK5A 4A0RA 2ZI6A 1DARA 4BFZA 1W7AA 3BFVA 3BFXA 3BE4A 2ZANA 4A2WA 1MO3A 3KKOA 5DYIA 3C41J 3VNUA 1B0UA
chains in the Genus database with same CATH superfamily
3KXPA 1ZRNA 5HSGA 3OE4A 5BWLA 2HU7A 4DWWA 1XN4A 4H1HA 3LRTA 3EZXA 1JEQB 3DTNA 4JBXA 3UK7A 4V0QA 2BR4A 2RMKA 5IULC 1ML3A 4JUBA 4BNLA 2QMEA 4AJIA 4CDGA 1SCUB 4IOKA 2MJLA 5DE3A 1C8BA 2DHDA 4FHEA 1ZD3A 2CCKA 3IS3A 2WE7A 3L9WA 2A35A 2ZB3A 3LUKA 3QSYA 2JGKA 2XWJI 2A9RA 3L0DA 1A7KA 4UM7A 3F7NA 5TPWA 3SD7A 3MRSA 3RIMA 2WYVA 3V46A 3ZHQA 3E23A 3TW0A 1Y3IA 2RKWA 5JNUA 1K63A 3UAXA 1WXXA 4B3DA 3CNLA 4B2YA 4XIIA 1E9RA 1JLRA 4ENUA 3FMPB 3O8OB 5H4HA 2IBTA 4FFNA 3O8DA 4D0RA 1L5GB 1Z29A 4LXUA 3R1IA 2VDWB 1QHGA 3QVWA 1JZQA 2O2HA 3EEBA 1HE3A 1YXMA 2CLHB 4PG6A 4W8HA 3WNBA 3Q7TA 3KD3A 5LQMA 2H3HA 1KEZA 4C2UA 1PG2A 1NLUA 5J4KA 1MBZA 1VSBA 5FL7A 3FTNA 3NEJA 1L9KA 1YZNA 2F4VB 1I3KA 1RQLA 2N1BA 1JR6A 3GC6A 2R5FA 3F5SA 4KX5A 4XKJA 5C5DA 2AOUB 5ALFA 3IIEA 2XBMA 2NVWA 4B6FA 4YMLA 4DLKA 4F5ZA 5KTKA 3DTYA 3CURA 2GEJA 1HTBA 3AR3A 3KCQA 1Q0RA 4ZU6X 4JJEA 2DFNA 1GZUA 2X4IA 2XB9A 3C6XA 3NO4A 2QTAA 3P8ZA 4OGGA 2HMAA 1T8SA 4BAUA 1B6RA 3NHJA 1HNZB 4O8ZA 4C4PA 3WDLA 5IM4A 4F5YA 4W5QA 3GLGA 3W2FA 3H17A 3PTZA 3NFYA 3SMVA 1FVXA 1NATA 5JAIA 4G4SO 3GNTA 3D2BA 1LDBA 4J0EA 3R8XA 3UFXA 3WL7A 3ZDQA 1ZVKA 2DT5A 5TQVA 1FXWF 2ZFUA 2IBMA 3V7NA 4EQZA 5IYZA 3ZKAA 5JAZA 2J5BA 2ZUVA 2OXRA 3T9CA 1A1SA 3QSGA 1Z2PX 2BRUC 2R6HA 5FUVA 1OXSC 2V55B 3E2PA 2B8WA 2CCJA 3U56A 1P6QA 1Z7EA 3SF8B 121PA 1SXJE 3EMBA 4LZWA 2Y1FA 5IM5A 1R1DA 2DHRA 3KAKA 3RFFA 2ZKLA 4RFSB 3S5UA 4KREA 3LF2A 5GP1A 2GJ8A 3TS1A 4ARZB 1SVIA 2I34A 3G2OA 1EIZA 1QCZA 2QTCA 3F1KA 3FFAA 3OX2A 4MP8A 4RSGA 4QYXA 3SC3A 3JQ7B 3INNA 1LTQA 3TLEA 4QU5A 2SNIE 2G6BA 3BICA 3N2YA 1SEVA 4IHAA 1FB5A 3AF3A 1X92A 1YS7A 2WD7A 4L0QA 1R4NA 2W6ZA 3CJQA 5U4QA 4QKQA 4TWIA 1M34E 1C30A 1MRSA 4D6PA 3FTFA 3FZYA 3ETDA 4B5LA 4LQLA 3ZVKA 4KK4A 3LDAA 3HRHA 5BT9A 1HG0A 1PT9A 3BE6A 4JLJA 4OD0A 2H3EA 1KWKA 3BA6A 3N2KB 1MDFA 2NUBA 3BWEA 1IBSA 3KL2A 3UMJA 4LFCB 1MV8A 4NLLA 3TDKA 1SRQA 1BDHA 2IYSA 2GRJA 1CDDA 1Q1NA 2C98A 2R4TA 2W2PA 3CIOA 3QWHA 3OU2A 4UAJA 2J87A 4X1KB 5SZJA 5CM2Z 1GQRA 2YS7A 2XCIA 5C80A 1KS2A 2HJSA 4RNCA 4EHJA 2FLWA 4JSYA 4GUDA 4RESA 2XDQB 2WHPA 1BIFA 5B58C 3K0BA 2DFPA 4HDMB 3Q8WA 5AJXA 3KTDA 3GNSA 1I0IA 4B5KA 4ZYTA 3W6UA 4NNPA 5C7YA 3RI3A 9ABPA 4BNUA 4LCBA 2WWHA 2GAOA 3MUOA 4OM8A 5FBQB 1IC6A 4GI2A 5F1YA 4K2AA 4WCVA 3EOBI 3TWOA 2VSNA 3AU9A 4R9RA 1SXJD 2QX4A 3O4JA 3VOBA 1CUGA 4K8RB 2LCIA 3ANTA 1JQEA 1BGWA 4QOJA 3H9CA 3A4YA 2B37A 1M54A 3LC2O 5ALZA 2VK2A 3K6JA 3QNMA 4CJXA 4DJFC 1R66A 1GL9B 4JBIA 2E1RA 2HQOA 2IXBA 2ZVQX 3IQFA 3V4OA 5A6SA 3JWPA 4I5DA 1K4YA 1JUDA 3HB5X 4NBUA 5FWNA 3T7AA 5DPMA 3T3HA 4GP7A 2WSYB 4UEJA 3ZW8A 1Z56C 5D8DA 1EA5A 4XI9A 2FPLA 2IIQA 1JKFA 2ZU0C 3RUEA 5EXTA 5JY1A 3H4IA 4F2WA 1PQYA 5GIPE 4J43A 4LJ8A 3LUFA 3W6NA 1CUXA 4W1QA 4WOPA 3PHCA 4L4RA 3L01A 3LDGA 4GZ5A 3T5GA 3H5IA 4E22A 3ECCA 3LLCA 5EXPA 3X44A 2OPBA 3DM5A 5G0VA 1SJ9A 2W83A 3DMGA 4C6TA 4YRRA 3T61A 1CY4A 3D3JA 3R0JA 5J40A 4IVQA 2XA1A 1XEAA 3AR8A 3WL6A 1F0NA 3SKXA 1X87A 4X95A 2B2NA 1N6NA 3WG9A 2DQKA 2V54A 1G2QA 2I6GA 2VSOA 1H0SA 3Q8KA 3M1AA 3ENKA 4Y1FA 1D3AA 4BKUA 1MGPA 3H05A 1Q15A 1POWA 4JT8A 1MTOA 1Z47A 2Q3LA 2WW8A 1MPTA 5FAXA 1SKQA 3V7UA 2JFYA 5CCBA 5ALVA 2NTJA 2P2NA 4TZTA 2JLCA 1D6JA 3DOCA 4JJGA 3KOYA 2ODEA 3IXMA 4YJGB 3EAQA 4XDZA 3RAPR 3PR3A 1AB6A 4OBXA 5H9VA 4LYAA 2XOKA 2WAAA 1YBFA 1WA5A 1NYQA 3NBKA 2GB4A 2OEPA 3WL3A 2QX9A 3MUNA 1XEWX 1DIBA 2MOKA 3I05A 4U6QA 1D7OA 2I3BA 2EOAA 3G89A 2KE5A 4RBNA 5CGQB 2CBGA 3VKFA 3I42A 1YB7A 3EEFA 3OOEA 4M46A 3B5IA 3EVFA 1MABB 1MC8A 1NR7A 2JH3A 1DQYA 1FMJA 2FHSA 1LK5A 3Q10A 4RHEA 4WK6A 3PL1A 3VZCA 3X43A 1JHUA 3UCEA 2V7BA 5IVHA 3FYTA 1JDTA 3IQZA 3P0HA 2PUWA 4TXHA 2RIPA 3E15A 3ZBUA 1U2EA 4C30A 4EY4A 5ALYA 2Z43A 4RPLA 4OMDA 1V2GA 1YRWA 4S05A 4NJMB 3FPEA 5HMMA 3A1CA 2GN2A 2PFKA 4YAGA 4FZ3A 1NKSA 1INLA 3DMTC 1SBNE 2AIRA 3NOVA 1BHQ1 5JARA 5LL6P 1GPLA 4PG7A 1SKYE 4LWOA 4NK4A 4R2JA 3RTBA 3L7MA 3BXZA 4BV3A 4E70A 4HTFA 5DSZA 4BRUA 1G0NA 1ZUWA 4ASUD 1QQ7A 3B9PA 3RK1A 1RYHA 4J8PA 3UB2A 1U65A 4LMBA 3SJBA 4CV0A 1WTAA 5DLPA 1Q7TA 4NZYA 4R51A 4NU6A 2EKQA 4C0WA 1I24A 2DPXA 4PPFA 3PHBE 4RPJA 1XA4A 1A9SA 3H83A 2JF0A 2ORVA 5DX1A 1ZMBA 4L9SA 1IYZA 3L0BA 1QBKC 3N2GB 4MVJF 3C70A 4WCFC 5FTWA 3V1TC 1BVUA 4M9UA 3F3SA 3NYRA 1NRXA 2YVLA 1R74A 1T6XA 2VOJA 2X5NA 2QX8A 1V8BA 3AY3A 5KTMA 1M1YA 3SXUA 4R16A 4DXAA 3GELA 4ZDIA 2OC4A 1VSVA 4WLVA 3TIIA 2E4UA 4TOIA 4QDXA 4BHTA 2RHGB 2DP4E 3K1JA 3R5TA 3I9V1 3HKCB 3ZWNA 4CM8A 3I92A 4DLUA 3SY8A 3I45A 2G9RA 4YR9A 3P71T 2HIAA 2RGNC 5HQJA 3ZLBA 2EATA 5BSKA 1WV1A 4DC9A 4FSXA 1KI6B 4CKCA 1RLMA 3I1JA 1P4JA 5BURA 1REQB 1P0FA 2BFOA 3OX4A 4O2BA 1QHIA 1GIAA 1SFRA 1G0OA 2C4WA 3HB7A 4W6QA 4QUIA 2FZLA 4EY5A 4OIMA 3KOWA 5EJ8A 3ZWYA 4E5UA 5HKKD 2IJGX 4E13A 5CB0A 3GLUA 4RPCA 4U8HA 1YS6A 4EWLA 1C9DB 2HREA 1YKGA 2LUOA 1FYFA 4TQUS 3DE3X 1Z5NA 3DJYA 3MCZA 3ZE7A 4EHBA 2R2GA 1GGFA 3ITNA 1Y5IA 2WKPA 3L0ZA 1X7XA 1DO0A 5FOWA 4N3NA 2C2KA 3SYMA 3L7AA 3DLHA 3A11A 2X22A 4QUBA 1G55A 4MWOA 1E2IA 1II8B 1R4AA 3KQTA 4WCDA 5B3JA 1N9GA 3ZZTA 4ZI3A 5LFAA 2XEDA 2CHGA 1DCTA 1EVQA 1L5KA 3BQMB 2JFNA 3UJCA 1GPNA 2VAVA 3AJ9A 4OHKA 2A84A 4LRUA 4GC5A 4L9RA 2E6UX 1XGKA 1FDSA 1RMQA 2I4LA 2VJYA 3DHVA 3DT8A 3U7RA 4E2FA 2W93A 2Q6TA 3K8YA 1UMDB 1X7YA 4DV5B 3H9GA 3P9ZA 4XDHA 3DZ8A 2ZAMA 5DM4A 3PXAA 4IGKA 1YASA 5KU1A 1T8UA 3H2SA 1RQPA 2A1IA 2UVPA 2ZCUA 2O2YA 2HPVA 1DBVO 1T6BY 5D3ZA 4NOKA 5D85A 4A0FA 2C59A 4M49A 5JZVA 2OORA 4IQ0A 1P2VA 4MKHA 5KOJA 3U60B 1KO5A 5KEIA 4PGAA 4PM4A 4MV7A 5FH9A 2B4QA 2FPWA 2QTVA 4DYHA 4ZMSA 4CKWB 3T7EA 3OICA 3RNOA 3WIBA 2CNLA 1K8YB 4RV5A 1R0RE 4TXJA 3WAGA 2WEKA 3FX2A 4MGHA 3KVVA 4FINA 2FUCA 5K4AA 4DSNA 1CUZA 4ZGWA 5LZ2A 1JWLA 3JQ9A 2CWDA 2A67A 2WKQA 1TUBA 3BJRA 4OHWA 2ECFA 1OQAA 5D86A 4TYNA 1ZK1A 2GPTA 4BKPA 4OJMX 1IRXA 2A86A 1OYOA 1P8JA 2AJBA 5UKDA 4LOJA 4UEQA 1CNFA 3V1KA 1KY2A 1Y3BE 2ODPA 3EGOA 4V03A 2GEUA 5CX1A 3VC3A 1JAHA 1IHOA 1N5JA 4X64B 4B8ZA 5B30A 1BQEA 2Q8NA 4DUPA 4NMXB 2QLTA 2E4VA 3KR1A 4FZ5A 2M6KA 4EG0A 1SR8A 2CZCA 1NF3A 4DA8A 1SBIA 1RTKA 4BDTA 3KWLA 5D01A 5ALEA 3O7WA 1SXJA 1GUYA 4C05A 2HB6A 5AVXA 1EWQA 1PZFA 1I1OA 2YN0A 3R2JA 5HYVA 1XUOA 5KINB 1EFAA 4XCQA 2IYZA 2NQTA 4D9JA 1KYIA 5C8YF 2ZK7A 4LBVA 3K6RA 4U2KA 5JSYA 4BWYA 3K05A 5TPWB 3ZUGA 1IFXA 1LPSA 3H13A 5AOVA 3SQDA 4BL5A 3WIEA 1W6RA 1Y6QA 4L1KA 5HILA 2HDNB 4FD2A 2JGDB 2GCEA 2RHRA 1WHTA 4QULA 1YZQA 3T5BA 3J81k 1M34A 5C8ZA 3N8KA 1Y0BA 1ONPA 1UKZA 1E7MA 1WMSA 4LYYA 4JT4A 4X41A 5HG0A 1BYIA 5K05A 4PZAA 3E5MA 1B16A 2OR3A 4WLFA 4NARA 3AEXA 3EZ6A 3DH0A 2RHCA 1G64A 1GGNA 4D5EA 5J5VA 3TW8B 4LNUB 3W2IA 3F71A 5F21A 4E46A 1T9KA 3NATA 1GZ7A 3HJCA 3EBPA 3B1VA 3VR4H 3GARA 1CULC 3ICVA 3EFOB 3M1IA 4KXYA 4XIYA 1R0CA 1RQRA 2JAHA 3HWSA 4QFMA 2QQGA 2VUTA 3UM9A 4ZI5A 2AB0A 1GXSA 4GOXA 4P0PB 1KRWA 4I55F 4WXRA 5EJGA 4TZKA 5AQEA 1PLKA 2DYKA 1Q44A 4CODB 1O7JA 3NBYC 1EFKA 4O4JF 1EK2A 4QOHA 3X0DA 4QRIA 5CEFA 1HNWB 4ZAFA 1CY8A 4JH0A 2IU6A 5DBFA 5GY7A 3UWPA 4ZCIA 1SBTA 5IYZB 2ZIEA 3FDJA 1DI0A 2YWFA 3HB1A 3LH5A 1N4AA 2RHBA 3M6VA 5TE9A 4S0XA 4FYJA 1JS1X 5JALA 3G49A 3GH1A 4K86A 4YMWA 4KBGA 3TRIA 1DT3A 2J31A 5HHTA 2PMBA 2FZVA 3OUUA 1L4LA 1ZP6A 2DE0X 1DV1A 1E5XA 1OUMA 1HRDA 3KOXA 5EJEA 1ZM4A 4NH0A 4RKRA 5CURA 3RSSA 1R50A 1FSGA 2J59A 1FDRA 4UEOA 2WYUA 3WMGA 1XKLA 1KDTA 4PFJA 5TS2A 3R75A 4MW5A 4RACA 5CDHA 1NUUA 2MT9A 2EF1A 4M3NA 2HMYB 2WD7B 1RWMA 1SKMA 1C30B 3EEYA 2OAEA 5KHOC 2QP9X 5BWNA 2YJ3A 1Y5MA 1O03A 1BCSA 2XRYA 1EWRA 1GTMA 2FK7A 2OCGA 1AIPA 2WIBA 4GBGA 4QL3A 3O9MA 1LNSA 1GKUB 3H9QA 4LCJA 2A14A 3LPMA 2GESA 4XIJA 5IAEA 1JR4A 1MT3A 2EW2A 4UFNA 3GRYA 3VC2A 1LLCA 1SUPA 4ASUA 4B6GA 4ZYXA 3ESQA 4G0PA 5JVDF 1GZ4A 4HZGA 4LV5B 1AQ6A 4A92A 4Y1RA 4JX9A 2GDJA 3UNXA 5K2MA 4MVJH 4DE5A 1J5EB 1Y9EA 1BKSB 1P72A 2E85A 3UJBA 2ECKA 2OENG 4NEQA 3CE9A 2WHPB 3ORQA 5DMXA 2VTBB 5DBHX 5AJUA 5HKOA 5EESA 1IL0A 1E4EA 1QHYA 2I4TA 1WP4A 2OSBA 2ZBUA 4BFYA 4D44A 1OYYA 4RD4A 2J9ZB 2VLIA 1IOVA 4GEKA 5LXTA 2B98A 2C77A 4YRJA 4O63O 1ZIYA 2PBLA 4C01A 3CO5A 4P2BA 1RD4A 3ZWXA 5CCEA 3OF5A 4OQNA 4B6QA 4LHSA 1J9EA 3IBSA 1X3SA 5K3FB 1IATA 2QT0A 1F8GA 3PGLA 4URYR 3RPEA 3S2IA 1NV8A 3TBKA 2I80A 1AKNA 1YJ5A 3HU5A 4CEHA 3TQCA 4BO4A 3H3XA 2NUPA 2W7TA 4GP9A 4ZVKA 1PI3A 1XZQA 1O0BA 2V7QA 1WEKA 1O77A 2LE0A 4CU5A 3HACA 3RS2A 1O08A 5KTNA 1V3QE 2GM9A 4RVFA 5ICEA 4YJ2A 1ZCJA 5BN4B 3BMCA 2YWCA 4II7A 5IBRA 1VBFA 3W77A 1PDVA 1CJBA 1GPUA 4MARA 3S8MA 4P1ZA 3OPYA 2FRDC 3G9QA 1R0ZA 4TL8A 4LRYA 4UD6A 4ENVA 2DPLA 1PQWA 1O94C 3WB0A 4PN7A 3VYSB 3ZIAD 1OKKA 5JBQA 4D25A 2DZDA 4XLTA 4DC0A 2PRSA 3A05A 1VXOA 2BI8A 1KDPA 3P2KA 2FPUA 5BSTA 5C32A 4XWGA 2G3YA 2G4LA 5FTJA 2YJGA 3NWJA 3NTQA 2DBYA 2WJPA 1ZD8A 1DVRA 1QIHA 2XLBA 3L40A 4JVSB 4KUHA 2IHBA 4HC4A 3RTCA 4E14A 3ECSA 1DDIA 3AEQA 3LUAA 4JYBA 2O1WA 3HJRA 4DWJA 1B6GA 1QE5A 4RF5A 1U2GC 2B4YA 5T57A 1BROA 3HI6A 4RS4A 4F1KA 5ICMA 1NU8A 3R4VA 4HGRA 4KVFA 3VPGA 4KITB 1UIMA 4H35A 1DDOA 1NUPA 2NP7A 1KSJA 1N6KA 2ADOA 3T1TA 2DQYA 1JAZA 1U7XA 1ODCA 4LECA 3JWGA 4AY5A 1Z28A 3JU3A 4RDHA 1OXTA 1Q20A 1EQUA 1ZUHA 2EG5A 3KLOA 4H4DA 5L95A 1T36A 3BB4A 3HCAA 3SICE 3EHEA 3HUDA 4J1TC 3ZDDA 4Q3OA 4P0TA 1P29A 2ZUEA 4GKKB 3LT4A 5B1HA 5JWHA 2IV3A 4WBNF 5JT1A 4BJHB 5DCWA 2ETVA 4G4SP 1VFNA 5AK0A 4EP1A 1CDZA 2PQ0A 1KO4A 3LAWA 5J2UF 2JLXA 1WEHA 2J9FA 4LOKA 4JI2B 3JRWA 1AC5A 2BONA 3W8DA 1XLTC 2PGXA 3RVKA 1A88A 3O8RA 1X39A 2QTWB 3UO8B 3A36A 1E3EA 4AJNA 3AKEA 3I1FA 1JHRA 4J16C 4BVGA 3VR5D 5CD1A 4ENTA 1USKA 1EH5A 4D3FA 5BWCA 1E3DA 2BF7A 4TXMA 1JW9B 1YR7A 3TVTA 1GVNB 2J85A 3X1ZA 5BSMA 4C5CA 5IPFA 1QP7A 3SZLA 4DPMA 3G17A 2X19A 1HDEA 1MA3A 3AHJA 2AA3A 3GFQA 4QYSA 5ERGB 1TA4A 3T6KA 4DM7A 3O83A 5D3KA 5J59A 5A1JA 5H16A 1GU7A 2BEVA 3V2UA 4EKIA 2QD4A 3N3BC 2OP0A 3P27A 4YXWD 3PPIA 1E5LA 1Q3KA 3DNPA 2Q49A 1NQVA 5BXYA 4GPTA 3JVDA 4CIYA 4M1TA 4D7AA 4HQLA 1XO1A 3A6KA 3EE6A 4HFNA 2Q5LA 4UFPA 1MR3F 1GAXA 4U39A 1JR2A 5AM2A 1HQYE 2BMJA 4C4ZA 2C9OA 3QXSA 1QF7A 5I7WA 3LT0A 3U3JA 1V7PC 1V26A 3GJTA 1KDOA 3IP9A 3ZU5A 2XRFA 3DEAA 4NBWA 5ADVA 2R65A 1R12A 3AIIA 1U9IA 1J49A 3IVCA 4L8LA 2FSIA 3RWBA 1TADA 3KJFA 2WJJA 4FFMA 1YA4A 3ZYCA 4UQOA 2FG6C 4G07A 5BOSA 3R20A 2JK1A 3MLEA 2ERCA 1SVLA 4QU9A 4WINA 2HGSA 1FK8A 1M1YB 2H17A 3SXUB 1KORA 4L07A 4A15A 4JJFA 4BV8A 4P4GA 2ZPUA 4GBED 2IITA 4WHMA 2JAUA 3W5DA 4X65B 1G17A 2Z9CA 1IN8A 5EZSA 4CM8B 4JB2A 4P3YA 4ER3A 3N7TA 2C20A 1L1FA 1D5CA 2AW5A 4FLMA 3CLSD 5JSKA 2CVZA 1G8PA 1P9WA 2CXXA 1ZOSA 4DIOA 3BILA 1UUFA 3ELBA 1NBIA 3CUEF 3T1NA 2DB3A 4E07A 2EVWX 1C3OA 3H1EA 1IJFA 3U4CA 2QM7A 3OFJA 3RWMB 1DBPA 1QS0A 4GXQA 4YMVA 1C29B 1LLQA 4HD8A 4JL5A 4CMBA 5BV1A 4YT8A 1CUFA 1R37A 1P2TA 1T9CA 4D3DA 5KTOA 1GPWB 1SQ0A 3VZPA 5KYXB 3KFXA 1KFKB 2BV3A 1Z5VA 2CXUA 3GRCA 1Q1BA 2C9BA 1EUQA 3SMQA 2C61A 4E4TA 3G5AA 1UM9A 3NMUF 5KREA 1MEEA 1K7SN 4YT2A 2AEFA 3VAAA 1HK7A 4P5PA 1CZHA 2FWMX 1SD2A 9ATCA 1X7XB 3GT3A 1KS9A 5B3AA 1BU8A 1M8PA 4BN4A 4U7FA 2A0UA 4ZJYA 4CIAA 3KUXA 5HGJA 3D64A 1AHNA 1ZICA 2BHLA 2Y3IA 1NVVR 1OILA 4HUTA 4YRFA 1EHYA 1L3IA 1N9GB 4V1CI 1I7DA 3GFFA 3Q85A 3MTAA 1QH1A 3U5ZB 2ZSEA 3AGQA 3GA0A 5KIAA 1QBGA 3BJMA 5KOYA 3E8XA 2TSYB 4FC6A 3OPXA 3AHCA 4G5GA 1DIGA 1KHTA 3NJRA 2FK8A 3OZVA 4PLGA 2B34A 2ZBGA 3WADA 4DC1A 4TTIA 5DYTA 1XTVA 1T2NA 2FJUA 3OE7D 3ZJUA 1FUEA 1XZGA 2WHXA 1G41A 3F6EX 2R1TB 4F84A 3U61B 3UN1A 1PGOA 2P6PA 2ZB8A 1PK7A 3BWYA 3C24A 3ZIDA 1ZGCA 2UVPB 4KUGA 1KJIA 3DW1X 4BNHA 2FQQA 4QX6A 2CGEA 1G38A 1V4VA 3DEYX 3FUXA 3PX3A 4OATA 3V9AA 1TAGA 1DTEA 1Z45A 5IC6A 5B4VA 1O95A 1TK3A 2QTVB 2V7XA 4J1SA 5J1SB 4M1WA 3DOHA 2VT6A 4BLQA 4JLUA 1AV7A 1WW3A 2XWBF 1HLDA 3GROA 1QNFA 4KQIA 3K9CA 3OQNA 1MHTA 1I6WA 2MYTA 4KE6A 4BJ6A 4RD6A 3A27A 2B1QA 1E2LA 3VKVA 1V71A 3NM6B 2WFMA 5L51A 1TUBB 1HDRA 4MDEA 2RJ3A 1N3YA 4IZIA 4FDTA 5AXBA 4CIXA 4DQDA 3AUYA 2XD4A 1B1AA 1E3SA 2JA1A 3B89A 1HI9A 3RF6A 1JHXA 2I3DA 1NR5A 3ZS8A 2ODWA 1JDVA 1CZLA 1MFZA 1SIBE 3AVOA 5LMUB 3Q3JB 2OLJA 3LS2A 3W3AA 1QRDA 2JIMA 1HDZA 3KVYA 1EFRD 4FNGA 4RVGA 3T9EA 2XF8A 3O8LA 3SR4A 1LBIA 4Y9RA 3UCFA 3SC6A 1MB0A 1NJGA 3FLBA 1SXJB 3PYMA 4LXGA 2C2WA 4GM4A 4MMXB 5PGMA 1LLFA 3V2GA 1QVWA 3P2YA 4LZJA 2OV6A 4RV9A 5FEMA 1W29A 4WDQA 3UJ3X 3RANA 5K4GA 3ESXA 1SHKA 3A3PA 1DBIA 2CVPA 2BGUA 3DDSA 3F6RA 4UMEA 5CFQA 1GPH1 3ZHUA 3L79A 4RY9A 1V47A 1WHTB 5CDUA 3OOWA 3PFCA 2IZ5A 3ZJTA 1P81A 1SHTX 3D8TA 3FFXA 1UXKA 1PT5A 1O96B 3LBFA 2KX7A 3CW8X 3DKRA 1L8OA 2OBNA 1OSNA 4IQ8A 2WYOA 4LY3A 3PUWA 4RQTA 3MJFA 4ZVMA 2P4UA 1XLVA 5ANRB 5CCXA 1V1MA 3QVVA 1FQOA 3MT9A 3N8NA 3BCRA 1LGYA 3JWJA 3NHFA 2NSDA 5EFZA 4LZLA 1TW2A 2QI9C 2R6FA 1JVBA 4LDAA 1HY3A 3ENVA 1E1RA 4Y2UA 2GPJA 2V7VA 1VMKA 2P9JA 5C31A 5TQ0A 1CG6A 4UNSA 4KXXA 4Z51A 4RXTA 1JPJA 3PTLA 2WIFA 5KX5A 4B4VA 5J2TA 2QY6A 4MW2A 5JWOA 3WHPA 1RPNA 3CZAA 5CT4A 1ULAA 2H31A 4HDSB 1KWGA 1GXSB 2Q9CA 4UATA 4HI0E 1VIVA 2CEAA 2ZDQA 5CM9C 4ZDKA 5KOIA 1JEJA 1WPQA 1C9JA 1AMOA 2O8DA 1K4KA 4LTNA 3H2GA 1K3UB 2W37A 2ZE7A 1KAHA 2PZEA 2GOYA 4ZK2A 2Q3MA 1TKBA 2FPXA 2YFKA 2GJSA 3QKTA 2QTTA 4G0ZA 4ABYA 1A50B 4PLVA 4FCCA 1WXGA 4P5EA 5JY6A 1S4MA 3LV8A 4ZTBA 1LJ8A 4OAPA 1XPUA 2ANBA 2F8TA 2Y92A 2WTUA 2I8AA 2VK4A 1MGOA 2FPOA 5F3DA 2B30A 3UW3A 4Q3KA 3EVDA 2X6TA 1RXIA 3DOFA 4NV1A 5DGDA 4OOFA 1UFQA 4M98A 4G86A 5B7PA 3K6SA 3IJRA 1CUCA 4MQMA 3V4SA 4PYIA 1TD9A 5AI8A 3GI1A 4RJLA 4RABA 1E32A 4NSNA 3VR5A 3CUTA 2OAP1 4EI8A 3NKVA 5AHXA 1ZXLA 5I7HA 1AHHA 4M53A 4X3PA 2RBKA 1BCSB 1FMFA 3BHJA 1CUBA 1R4ZA 4BMVA 3MPUA 3TX6A 2WB2A 2ZJZA 4XRGA 1HEYA 3M1LA 2G67A 4QATA 4XWKA 2XDWA 4BNKA 3CEPB 3AG6A 3C3XA 5EIBD 4B8YA 4YXWA 2DETA 3KZMA 5E9WA 2GPSA 1JZTA 4FWBA 2PMDA 4FBLA 2W2VA 1AE1A 3UOAB 4Y2TA 1JTFA 1BA2A 4NIMA 1NULA 4O4LA 4RQBA 2JLSA 2GHIA 1OLUB 3TR6A 2REBA 4Y1RB 3HXPA 3TPZA 2WSSA 1AZTA 1IB6A 2X0KA 2E4YA 1AMNA 1A7UA 4YBZA 2C4VA 4R8MA 4PXSA 1JLHA 2BZSA 4RKWA 4ZC1A 3TZLA 1KNXA 1PUXA 2PCJA 5EJMA 3T9BA 3L41A 2PNJA 5IH7A 1H5QA 1SURA 1E4EB 3FRHA 1GN9A 1NI5A 1HDXA 2PT6A 4NBKA 3JD0A 3PDCA 2J41A 4JZKA 4JYPA 4PPQA 3LHFA 4KQWA 3I6BA 3TDNA 4MUXA 1X6VA 2RSLA 4D9NA 3QNWA 3UWKA 4TYWA 5C52B 3OCXA 1F48A 1MMFB 3FDXA 2VJDA 4BGDA 3KOUA 4ZVLA 1N2CE 4L76A 5LQCA 1Q6ZA 3MJTA 3CLVA 3QOYA 2I7TA 4CEHB 1RRMA 3B7WA 4TT8A 3SLRA 3S2SA 3SSOA 1EZ4A 2HF9A 2Q99A 5L3QB 3VI4B 3HXQA 2WNIA 4WADA 3MILA 2W6JA 3GJQA 4BRSA 3RREA 4HX2A 3KWFA 4YJ2B 4DDHA 1U8AA 3BMCB 4HYYA 4C7KA 4KK3A 2XZPA 5CT6A 4D4HA 3KSDO 2WM2A 2I54A 2ZULA 3MW8A 1IULA 4G84A 3VPCA 4E5NA 4OYRA 4EI7A 1GA1A 1T29A 4ZEOA 5ALMA 2J3QA 3HRIA 2VJAA 3PB3A 1QUFA 3I30X 4J0QA 4QXRA 1N7GA 4LAFA 3EXEB 4IJWA 3VDMA 1V5IA 1BO6A 1YDEA 2C88A 5HJEA 2YZGA 3NXSA 2FF7A 2QRGA 3MJ4A 5CRIA 2I7DA 3S0JA 2AV6A 3EASA 4XVUA 3BF7A 4OFWA 1UAGA 4LJ9A 3NBAA 3V8QA 1CQWA 3AUAA 5DTRA 2X23A 5F2KA 2Q4OA 3LT1A 1CR0A 4KIUA 1Q1QA 2BI7A 4KCGA 2ZIXA 4JXKA 5EJFA 1CXZA 5JO9A 1EG2A 2GBIA 4D98A 4E11A 3Q2OA 1ULZA 5IWAB 1LFAA 4ON9A 3H8VA 4OHFA 3HDVA 2FSHA 2ZYAA 3CUYA 3LCCA 4TTSA 4YP9A 5JXWA 1TGYA 4EITA 4I50B 3HO1A 4QO8A 3OE7A 1UMCA 4PZZA 1PLJA 3RBVA 1NLZA 1VZ3A 4WX2B 3CUVA 4JQCA 5A06A 1DIRA 2Y1CA 4AP5A 1PQUA 3HBJA 3B9RA 3Q3EA 3OKCA 3H3FA 3BG5A 4WDRA 3CPHA 2F8LA 1EJ2A 2FWPA 1F8FA 2CUNA 2G04A 1PBNA 4HPXB 1VCIA 4DDUA 1GPKA 3CUSA 4GXRA 4F2PA 1FRFS 3GUYA 1VPWA 3NFRA 4N7BA 4JLBA 4LXXA 4H1UA 4KQ6A 3GT0A 3RVRA 1QH8A 3VSBA 2R7MA 5FUBA 4TVSA 1YVEI 4Q1AA 2BFWA 2C0PA 2LZ0A 3RK4A 2Q2QA 4KLZA 2O8EA 3M7IA 2B2XA 2C78A 3QVSA 2RC5A 3EIFA 2QN7A 3D31A 3KZCA 4ERNA 1YE5A 2X7JA 3TI7A 3TMAA 4OLFA 1JHMA 1TCAA 1U90A 2F59A 2HJ9A 3GUZA 1A96A 1IUKA 2V6JA 3EG9A 3GWZA 2ZDGA 3BMNB 2VHJA 2JKZA 1P33A 3WC4A 4AJ9A 1Y33E 1D8AA 2O7NA 1UDXA 1FFBA 1R6XA 2WYIA 3L8CA 2C31A 3VNAA 3WMFA 3U44B 2CMDA 2UVDA 1JIVA 2VTDA 3EB9A 2HL6A 4IUCS 3WJ7A 4F5EA 2EL7A 2WU8A 4K9OA 2QNRA 1UC8A 3T52A 2EP8A 1F2VA 2XV1A 1C7IA 2VDMB 3PF9A 4RGVA 3OWHA 2ZRLA 1UPCA 2J07A 2ZB4A 4FFLA 5K3AA 4ZKDA 1FFYA 4M55A 3AZQA 4M1MA 4EUEA 2ZE6A 1ENPA 3SOZA 2HA6A 3TZCA 2LWIA 4ALIA 1P5HA 4GZLA 1U0GA 2QRHA 1MB2A 2ZXEA 1XD2A 1SELA 1XRPA 2EFGA 3I6MA 1JALA 1XYYA 3IR5A 3QI2A 4NU8X 4R1UA 5EZYF 4AJEA 3FAZA 1TZKA 1GADO 1YS4A 2ZRIA 4HAVA 4IHKA 4AO6A 3S8YA 4KFCA 2OV8A 3GIDA 3GWGA 3QBDA 2V74B 3P2OA 2P6UA 3FHOA 2XMRA 4M8KA 2XGJA 1UBTS 1N3BA 2NSHA 2OCKA 3H2YA 5B1SA 1CIJA 3U9SA 4D9IA 5BOSB 6ABPA 4BB9A 5JSQA 3BB3A 3QLEA 3A6GA 4UDYX 2XUQA 3WWPA 1SH7A 4L27A 1UWCA 2GHTA 3FRIA 3QTBA 1ZG3A 3HE3A 1PT7A 1EK1A 2JK0A 1WSBA 1I01A 2PZFA 3MWLA 1QP0A 4IDOA 1FXSA 1UOPA 3LKVA 2G77B 4KQKA 3ZTYA 3AJ8A 3VX4A 1C3OB 3I5AA 2HFKA 2PZBA 3HM2A 4P4UA 4ABTA 2PYZA 1FVFA 1R5OA 4BZQA 2A0XA 1B6TA 1KAQA 1A04A 1P39A 2B78A 1QAQA 5DJ5A 1F1BA 4QHTA 2R8BA 3R76A 3QA3E 1YIOA 2X4GA 3IDZA 3EYAA 1ELOA 1EX1A 1NBWB 3CFYA 3SG0A 1Z0AA 4B4DA 1SKUA 2PIAA 4C29A 1UM9B 3EWNA 3HXMA 2C2BA 1A4IA 2XNDD 4M38A 1OZFA 4Q7EA 4NZZA 3JYNA 1TQHA 1FX1A 1T3TA 3D8RA 5P21A 4ALJA 5BR8B 2G63A 2ISQA 2WWGA 1U3CA 1T5TA 2GPNA 4IAOA 4AZTA 2IFTA 1CCWA 4JK3A 5IT0A 2YY5A 2PSFA 4F3CA 1HT1E 5C4GB 4GW3A 4YUYA 4NCXA 4BGIA 1GGJA 5K8VA 4AJKA 2NXEA 1ESDA 2O5VA 4RZHA 4AS1A 3AVQA 3FUUA 2XUGA 2YBEA 3VU0A 4R71A 1V41E 2ECQA 4B4OA 1BFKA 3FGPA 1CD5A 2AI2A 2GZ1A 4KFUA 4JYAB 3I0ZA 1NW5A 1XNQB 1LH0A 1PF7E 4N18A 1HFEL 4EW2A 3TB6A 2DPGA 5ELXA 5CJJA 1JEEA 1RQ2A 4U0JA 2NNLD 3G7SA 1P0MA 4NV3A 2WT8A 4ND4A 1PUJA 1PCXA 3A3NA 1E6CA 1FS4A 3PHLA 4IX1A 3RK0A 4CDNA 5FRDA 1L2TA 4M9XA 2YXNA 5DT9A 1PWZA 3TJMA 2VJNA 1YE8A 2CXHA 3DO6A 3H9JA 1Y6GA 2GS9A 1XCMA 4MPDA 4RNDB 4UVGA 4GMFA 3PQDA 4Z7NB 1LRKA 1CU1A 2R8RA 4RV4A 1XTZA 3TD2A 4OHOA 1RT9A 3ITKA 4RO0A 1RCTE 1VB5A 1UPFA 3R5SA 1EFHA 1GOTA 1H2HA 3F5QA 1V96A 3F9IA 3GZ4A 3WNDA 4BNMA 1YQDA 1PWYE 3WK7A 5EE0A 1G42A 4QGFA 5GVSA 1KI9A 4M87A 1WMDA 5B37A 1KI4A 2Y05A 1SZJG 2ACWA 4PZ0A 4CLDA 2FSUA 2LKCA 3R3HA 3ACCA 2P7IA 1T6NA 3STXA 3JVUA 5A5VA 3NJ8A 2XXJA 1VHWA 4U3JB 5J4YA 3B1FA 4KVAA 2PE5A 1X1RA 5KS2A 1C0IA 5LQKA 4KE9A 2RB4A 2Z4SA 2OHXA 3GP3A 4J9UE 4N7MA 4WZBB 3UXHA 3L07A 3AP2A 4LYHA 1WBDA 4UUMA 2WPNA 4QYMA 1Q11A 2CKDA 2HQ1A 1OXXK 1NSYA 2AOVA 3IKVA 1E69A 2JGLA 3ZPXA 1R8YA 2DUWA 2WY2D 1E3WA 3L6DA 4RQUA 3PQ5A 4NE7A 4COOA 3TLCA 2CVOA 3G2MA 5G53C 3WWCA 2H2FA 4XRRA 1Q16A 1B8NA 3KHUA 4TRNA 2IEYA 4UDNA 1M2VA 5DHTA 1XQ1A 4R1PA