4DB4A

Mss116p dead-box helicase domain 2 bound to a chimaeric rna-dna duplex
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
256
structure length
256
Chain Sequence
SIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna-binding protein/dna,rna
molecule keywords ATP-dependent RNA helicase MSS116, mitochondrial
publication title Structural basis for RNA-duplex recognition and unwinding by the DEAD-box helicase Mss116p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 82
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4db4A00
2IBMA 3FHOA 2RH5A 2V1XA 5HKKA 3Q5DA 4HSEA 5P21A 2QA5A 2R62A 3TVDA 4QFMA 1JQJC 2V7QD 5F9FA 1KMQA 1KK1A 4Q1AA 2DWPA 3TQCA 3A8TA 4PPFA 2F1JA 5HPYB 1P3JA 3U3JA 3B7GA 2UZ3A 4TTPA 3U7EB 3BK7A 4ACAA 3KTAB 1NMYA 5GJVC 3RRNA 4P3YA 2J0UA 2WSMA 3EW9A 4CW7A 3TQFA 2WKRA 4KSCA 4XD7A 2QRZA 1XMVA 4UNSA 3SBEA 3OE7A 4O25A 2ZRIA 3N5CA 4L15A 2F43A 3KXKA 2WWXA 4JZKA 2BKEA 3BGWA 2PLRA 5AJZA 4V0OA 5AJWA 2QPOA 4NCJA 1E32A 3KQNA 5FOUA 4B3GA 5EE9A 3ZZUA 2ZJ8A 1S0UA 1FX0B 2UVQA 4C2TA 3OIWA 2H16A 4NHOA 2RGEA 2PCJA 2ZYUX 1CR0A 2VO1A 4UXJA 3DOEA 5KSZA 1W1WA 1YVDA 4MUAA 4XWOA 4MKHA 4BGDA 1GTVA 1ZVQA 4LJ7A 3WBKA 1ZNYA 3T1OA 2B21A 2PMKA 3AKDA 4S35A 3ZIAD 2HF8A 3DEFA 3A6PC 1X86B 5HKKD 3VKHA 4RD6A 1KI6A 2BEKA 1KI7A 3D6TB 3NKVA 4TWZA 1IQPA 3O47A 3GJ0A 3EXAA 3SU8A 2QTHA 1NL3A 1U90A 4EJSC 5CIWA 3MWYW 2G1JA 4M4SA 3ND8A 4Q9JA 4ASUD 2VIIA 4D0NA 2ZJAA 5JECA 3NTUA 3OE7D 1BYIA 2J1LA 3CIOA 3I1FA 4XTRA 4TLAA 5KDDA 5J4YA 4PANA 1F3OA 1GZSA 4URWR 1Z2AA 3BB1A 3WYGA 2BC9A 2OFXA 2VHJA 4Z1MD 5FL7A 1U9IC 2I3BA 4L9WA 3R7WB 4JLNA 4BLSA 4QJ5A 3V00A 4DZZA 1ZIOA 4Q18A 4Q1CA 1Z5ZA 4ZKEA 1KI1A 5K8UA 2QPTA 1R0XA 1KSFX 1R0ZA 1FTNA 1JXOA 4P33A 3P4XA 4D82A 3GFTA 3NH9A 4CT5A 1JI0A 4B2PA 1KSHA 1M2OB 2J0SA 2ZSDA 4DXAA 3W6OA 2QN6A 1MV5A 1UBEA 2GVDC 1BH2A 5TDHA 3H4MA 2VP9A 4IXMA 1GDDA 3LXXA 4KYUA 1TU3A 3R9XA 2HT6A 3ADDA 1JJ7A 1LVGA 2P65A 4UNRA 4M9XA 4LUCA 4NTZA 5H1YA 4DSUA 1G5PA 1FP7A 1W0JA 1JB1A 2P3SA 1VG8A 4HDOB 4KLNA 1R5NA 3GLIB 4GNKA 2MSEB 4A82A 5AR1A 4ZI3A 1UFQA 3DDCA 2DWOA 1OYWA 4RFSB 1NMZA 1YZGA 3A58B 4JSTA 5IHPA 3AB3A 2JLSA 1GWNA 2OCAA 2WOJA 4A36A 3ZQJA 2CCKA 3A1WA 4HAUA 1KO5A 4PC3A 2WKQA 4Z51A 2GXSA 5L3SB 1E2IA 5DNYB 3K70C 5SZKB 4DLTA 4F93B 2FN4A 2MMCA 4XIGS 2IC5A 3IHWA 3H86A 4OQFA 3EPKA 4FD2A 5FL7D 4FWTA 1QG2A 3I62A 3PUVA 3AVUA 2ZANA 4OI1A 3FPAA 4QJ4A 2LWIA 1AA9A 1SVLA 1YZNA 1X8KA 1EX7A 4Q1FA 4FI3C 3ADBA 4MRVA 1T91A 4AYXA 2GILA 3RSLA 3IUYA 4KCGA 4M1SA 5JJKA 4M53A 2YWGA 4Y0VA 2QQ0A 1MO6A 1S9HA 4ZDIA 5KU1A 3VMFA 2GCOB 221PA 5TARA 1R8SA 1KJWA 2O8BA 1BIFA 2PEZA 3KKOA 1N6KA 1II8A 5A0FA 2I1QA 2JIZA 4IJMA 5E4FA 4IEIA 1W4AA 2XTMA 1W0JD 5DGXA 3ZVRA 1JEDA 2DPXA 4OQNA 1YKSA 3I73A 4IOLA 1M6NA 1EFCA 2WJHA 1ZC4A 2ONKA 1P2TA 4EDHA 4EPRA 3OZXA 1DVRA 1KJZA 3CF6R 3QVUA 2A3RA 1Q20A 2QAGC 3K1JA 4BZPA 2HCJB 1XJCA 3RWMB 1IOZA 4EQ6B 2ZU0C 3SFVA 3EIEA 3A4MA 2XAUA 1I4LD 2YOFA 3RC3A 2GHIA 1E2JA 5FTJA 2H1LA 2GAAA 3NBZC 2PEYA 4YC7A 1S3SA 3AVOA 1E4VA 2JATA 1US8A 2QL6A 2X8AA 3RS2A 2J3EA 2NO1A 4FCWA 2GF0A 2ZYTX 3I61A 3SC3A 3LLMA 4ARZA 4HB4A 3GEHA 4RD0A 3TR0A 2CMKA 2QP9X 2RAPA 3GJ5A 3EPJA 2ZRHA 1OJLA 2AK2A 1KHTA 3PFIA 4WZAE 5LBIA 4TL6A 2RGNA 2WWIA 1SVOA 4IDNA 3ZZTA 4C9BA 4GOJA 5JZVA 2B8WA 2REOA 3PQCA 6Q21A 1NNEA 1E1RA 2BBSA 1D2EA 2VH5R 1CF4A 3NC0C 5AUQA 5B30A 2F9MA 4TZ0A 5CK5A 3T15A 3IGFA 2WJVA 4I4LA 4KITB 4K46A 4Q9KA 4DRZA 2WM9B 4A8JC 2KI5A 3HP1A 3N70A 4PHFA 3A37A 2XJ9A 1G1MA 2E87A 2VYFA 3I92A 4MDFA 4OQMA 2Z43A 1XEXB 4QHYA 2W0MA 1CU1A 2XOKA 1FOEB 2VL7A 2FFAA 3L82B 1P73A 2IHBA 5FTKA 5JWHA 2W00A 1KDPA 2NMVA 2FZ4A 1Y3AA 2GA8A 1N6RA 4CT4B 3PEVA 4A2WA 4EPWA 1Q1ZA 2BVNA 1DPFA 5D3MB 3QBVA 5CM8B 2VSXA 4BZXA 2ZRKA 4AG6A 3GEIA 5LB4A 1KIMA 1XTSA 4LGMA 4Q4JA 3MD0A 1QHSA 4YMWA 2WIBA 4BECA 4IDPA 4GDFA 2JJ8A 2ODWA 1LS6A 3HPQA 4AWXA 2VLIA 2ZRMA 1P5ZB 1J7KA 4MKGA 3DZDA 4OKSA 4YDHB 5FBLB 2FG5A 2VHCA 3AF4A 1KKLA 1F5NA 1E1RD 3CF2A 2F43B 5EP1A 4YMTA 1TPZA 1W36D 2JDIA 1P72A 5DI9A 2QENA 4D4JA 2GXUA 3SN6A 1DEKA 4E07A 2FFHA 2K5UA 1JQLB 1UPTA 2WAYA 1QVAA 1FNMA 2FFQA 1G41A 1P2VA 2QPAA 4TT3A 4OYHA 1BOFA 4GMXA 3QEOA 3QI2A 3QSYA 3P1JA 2IK8A 1KSJA 3EX7C 1CBUA 3CZPA 2XOKD 1Z0AA 1S3GA 4EIWA 1G8PA 4F92B 5SZHB 1DARA 2D4HA 3B8HA 4Q01A 3K9NA 5FTMA 5KOYA 1J70A 4GOXA 1JR3E 1TQDA 2GKSA 3A1SA 2FE4A 1CJKC 4CZ2A 3PR1A 5JCZA 4AKHA 2CE2X 3PXGA 2FPLA 1AN0A 1OT3A 4HLUC 4C0QC 1Q1QA 2JJ2A 2F1RA 3WBJA 2IS4A 3AGQA 4AG5A 4OK6A 5JEDA 4Q7KA 3VHLB 3K0SA 3LO5A 3P26A 1YE8A 2GXAA 5FOWA 4C2UA 3SYNA 2QNRA 2GJSA 3C8UA 3B6EA 3L0IB 3BORA 2DFNA 5F2EA 2DY1A 1OFHA 2P67A 4M9QA 1LF0A 3ZD7A 1VYUA 2AWNA 2FSIA 1IY0A 1TADA 2G1KA 3B85A 3R20A 4GOKA 4HB3A 2ZE8A 4LI0A 2BEJA 2Z6VA 1RYFA 3DVLA 4Z8YA 5GJWC 2C99A 1OIVA 2JDID 4ZCIA 2XTZA 3BWDD 3LA6A 1BO6A 4NL4H 3LBHA 4LBWA 1TF2A 1HEIA 4BLTA 3EAQA 4EAQA 4TT3D 1GKYA 1CKEA 2VHQA 3H1TA 1TL7C 2QTVB 1JNYA 1NY6A 4H1UA 4JYCA 2YWEA 5E7MA 4F4JA 4Q7LA 1NBME 2ZR0A 5TV2A 2JAQA 1ELOA 3HYTA 3PEUA 4PQYA 5BN4A 1ZNWA 1QHYA 2EFHB 2X77A 4LJ6A 4NE2A 3O8CA 2GJ8A 1XMIA 4FCVA 4U5XA 3CRQA 4QXAA 4M9ZA 1DAMA 1IHUA 3LRPA 2WICA 3AF3A 1KZ7B 2KBFA 5G3ZA 4LWZA 4M1YA 2ZJ2A 1HYQA 2JJ2D 3REFA 3WHKA 3L2OB 4B2LA 2RHMA 4MYHA 5F3WB 5KSPA 3GLIE 4NYMR 1YR8A 4NU0A 1ODFA 5CDFA 3QJYA 5KDOA 1XFAA 2YHSA 3GLHA 3I8SA 1W4BA 4MKFA 4LHXA 3PG5A 2VF7A 4AYWA 4U7DA 2XZLA 2D7CA 3RS3A 2J41A 2UKDA 4G5GA 3SDZA 4BRWA 1RC8A 1N6PA 2ZRJA 5JSZA 4A2QA 4BWYA 2QGZA 3SBDA 2O8DA 1D2NA 1OF1A 1J8MF 3ZVNA 3FGNA 5KPDA 1AM4D 2JLUA 4NCKA 2NOAA 3WY9A 1XD2B 4Q4AB 5KHOC 1F2TB 1W4RA 1X3SA 5JS8A 1NLZA 1VHLA 3DM9B 4IVQA 3MWJA 4ZDKA 2D7DA 4AD8A 4WZBE 2QMUA 1RJ9A 4G3XA 4B3FX 4C4PA 3F8TA 5L3RA 3WXMA 1KK2A 4LSGA 3TUIC 3SQWA 1TQ2A 3U7GA 3B2EA 3LVRE 4QM7A 2FF7A 4D25A 1N2CE 3GQBA 5JBQA 3GJ3A 2EYUA 1XMSA 3LH5A 2NZJA 2REXB 4DLXA 4R2HA 4LJ8A 2C8VA 2QQEA 2W6JA 1DOAA 1GKUB 3Q85A 4DSTA 2OEPA 2C2HA 5FUYA 2F7SA 4JSYA 3Q72A 1XTJA 4IFBA 5K8TA 1N5IA 3AKEA 2G6BA 4DT1B 3VU9B 1EWRA 1GRNA 4C0SA 3B13B 2IXFA 5DHFA 3FMIA 4I99A 4WA7A 4YONB 3CLVA 5IDVA 3WNCA 4EFLA 1ZD1A 3HU2A 1G4UR 4ILEA 4HAYA 4TQUS 2R6DA 5CLQA 5LB2A 4DIDA 4JVLA 3BOSA 1MRNA 1Q1EA 3X1WA 4EPTA 2OESA 4H1VA 1EWQA 1JALA 2WBLC 4EFMA 5BW8A 2JEOA 4EUNA 2H57A 1Z0KA 5IF9A 3ZGXA 3I72A 1E2EA 4TMXA 2HXYA 2KWIA 4N0EA 3THOA 1BKDR 3M0EA 4FXPA 3RRZA 2ZEJA 1RE0A 3QXSA 1TQ6A 1ZUNB 5KYKA 2A78A 5CYOA 1KI3A 2J46A 1FL9A 1M7HA 3SEAA 4TN1A 1XXHA 3L0SA 1ZYUA 3DMDA 2BM0A 5L8VA 1A5TA 4PPGA 2W6JD 4HUTA 1XCMA 1Q21A 4NYJQ 1E9RA 1FPMA 1KYIA 5AK0A 1UKEA 5SZJA 3W9YA 1K6MA 1X8LA 1ZU4A 4MYCA 4N3NA 4E5UA 1KK3A 4MGIR 3K53A 4OHYA 4PZZA 1T6NA 2G0TA 2A5JA 2PX3A 4IEEA 5F9HA 1E2GA 1QHXA 4FMDF 4PHHA 1OLOA 4FMBB 2JASA 1JJVA 3RABA 4ACBA 5KNCA 2QBYB 1XD9A 4HEJA 4TL8A 2EVWX 2CCGA 4B75A 1W7AA 4I1UA 3QPVA 3ZJYA 1X1RA 5FTLA 2QROA 2PZFA 1I4DD 2G0NA 4AYTA 2ZS7A 4JMPA 1CJUC 3WNDA 3S1AA 1N6NA 5F98A 1IN5A 3P27A 4Z54A 5JI2E 1KDOA 2FH5B 421PA 2OILA 3DMNA 2GETA 2VP5A 5GVRA 1KMHB 3N2EA 3GJ4A 1XCPA 3NG1A 3BC1A 4BEBA 2ORVA 3IPXA 1DO0A 3TIFA 5L3QA 4W9MC 1DAHA 3RHFA 1G20E 4KBGA 3RANA 3JZMA 4OI2A 5J4HA 1E6CA 2JA1A 1W49A 2BJVA 2J5XA 1D8TA 1U0JA 3SE0A 1G64A 1OFUX 4M1WA 2GCPA 5HZHA 4M1KA 4IOJA 1V43A 3X1XA 2VEDA 2C9YA 1K5GA 1XTQA 5DISB 4ZO4A 3THXB 2W2XA 3H84A 4Z8XA 3GD7A 4A1FA 3CRRA 1C4OA 3JVUA 1E2QA 1S9DA 1Z6TA 1RFLA 3C14C 4G5QA 4B3BA 4YMVA 2VHUA 4KLZA 1GFIA 3IKJA 4BLQA 5AUPB 3KUCA 1MKYA 2N1BA 2NO7A 5J4LA 3Q3JB 3PVSA 3CO5A 2XNDA 2ZAMA 4DUGA 2PMDA 3T5GA 3GLGB 1RIFA 2O52A 1X6VA 2EFEB 1T3HA 3FKSA 3SOPA 1OH8A 3LNCA 1ZM2A 1Z0FA 5DIFA 1T0JB 3VR4A 1AGRA 1EFHA 3QQ5A 2V9PA 1MRSA 4IOMA 4LZZA 4MGYR 2ZS8A 2QT0A 3A36A 3KJGA 1MO4A 2B6HA 1EESA 1R0WA 2QG6A 2ZPTX 4HAWA 2D2FA 2NPIA 1IXSB 2ZI5A 2QT1A 2VHTA 3FHTA 1GSIA 1W2HA 2XZOA 4WVFA 4JLAA 2O0KA 4TYPA 4DB4A 1JR6A 4XSHA 2O8EA 4WAUA 1KSGA 1XWIA 4IVPA 4XVUA 1JPJA 1ZCBA 2OBNA 2VSOA 1JXMA 3BERA 4HZUB 3KQHA 2FFBA 2H92A 2HLDA 4L4UA 2ERXA 3AVWA 4H9GA 1WB9A 4HYYA 3T5DA 5A5GA 2RGGA 3BXZA 3BAFA 4OQLA 1G21E 3QKSB 1JAIA 1GNRA 3VKWA 2WAXA 4A6XA 4GBMA 4Q19A 1AZSC 2CJWB 3KXLA 4V0MA 2WOOA 2H8KA 5DI3A 3K9GA 2QZ4A 3KXIA 4PQRA 2XNDD 4DUGD 1NG9A 2QGNA 2IWRA 3DM5A 5EP3A 1Z2CA 3TUZC 4IDOA 1YJ5A 2ZROA 2P5SA 1B0UA 1E2KA 2BJWA 2O0JA 3CX8A 1G6HA 2V54A 3FKSD 1AJEA 1E2NA 2XZPA 4LHVA 4B74A 3GLHB 3H2YA 4MRNA 3TKLA 5FBRB 3V4FA 2HCBA 1LS1A 2YVUA 1E4YA 3AUYA 2EFGA 4LJ9A 3TAUA 1T3SA 2CL0X 4TYNA 5SZIA 1W5TA 1F2UA 4JLKA 3T34A 4PC6A 4JL6A 1QHHA 4M1OA 1Q44A 2G3YA 4ASUA 4DCVA 3FE2A 1UBFA 4JT2A 4BFSA 4BRUA 4TQ9A 1ZCAA 2ZI6A 5CB6A 2QM7A 2HLDD 3RC8A 3P4YA 3C15C 3QENA 1P2UA 2ASEA 5C2JB 3OIVA 4JLOA 1MOZA 4AKEA 5KUTA 3MWKA 2O8FA 4QJ3A 1GNQA 4C0KA 2C78A 1P62B 4Z1MA 1Y63A 3QG5A 4HLQB 1W4CA 3AVVA 4UJ3A 2CLDX 1UEIA 4DEYA 1T8TA 2IYTA 2WVJA 5IT5A 2IYRA 1S1MA 4CEIA 3BFKA 1BS1A 2IUTA 2V8OA 5HCIA 4P31A 1QHGA 1SKYB 3AP2A 2DFLA 3IEUA 2Z5FA 4LYFA 3BH0A 5C18A 3E5HA 2GNOA 4PQFA 1QF9A 1D9XA 1WA5A 4EFNA 1IN6A 1XZQA 3RDPA 2EW1A 3VX3A 4CVNA 3KJHA 4DWJA 4ZIRB 2WJGA 2JCSA 4P4SA 2OO7A 5FI1B 2ZUCA 3K0EA 2XXAA 1M34E 2OG2A 2GESA 2ERYA 3TW8B 1N3BA 4TMWA 2CEAA 3EZ9A 4LHYA 1COWA 5EE3A 4MKIA 1I4TD 3AF2A 1NN5A 1FMJA 2HF9A 3L0PA 2ZI3A 4PPNA 1ZP6A 2ZRDA 1KY2A 4C30A 1M7GA 4A15A 2NGRA 3MMPA 1ZUHA 5E7IA 4PC1A 4OHZA 1AZTA 3CPJB 4Q21A 5FUVA 3VTKA 4KFSA 2JJ1A 3EZ6A 3QF7A 1R8QA 4BFUA 1FFHA 1WBBA 1E9FA 2FSFA 3IO3A 2C9OA 1OB2A 2G83A 3J81k 2AXPA 3AP3A 3UATA 3K0AA 3NBXX 2R44A 3MUFA 1DAFA 3PENA 5EE1A 3V9PA 3WYFA 3GLFB 1CEEA 4KI0A 3UPUA 5FBQB 2JLZA 2OFOA 4B3DA 1XXHB 2AD1A 5JEEA 4UQOA 4WXRA 5BWMA 4EKDA 3AM1A 4PZLA 5H70A 3TE6A 2E9SA 1IONA 1LW7A 2AKYA 1YZUA 2F6RA 4P4UA 4YLGA 1IXZA 5KPJA 2FDCA 1UF9A 2FWRA 1WMSA 4LC0A 4AC9A 2ZVPX 3L8YA 3BH7A 3KZ1E 1DTSA 2C04A 3CF0A 4UJ5A 4LV8B 1COWD 1GP2A 2GK7A 1MABB 2Z83A 5JWRA 1GOTA 2O8CA 5H8WA 4DLVA 3QF4B 4YMUA 3IILA 3W5IA 4AKGA 2OAQ1 4TYQA 2Q9AA 5DYGA 1R4AA 1L7VC 1IY2A 3UANA 4OI0A 4DIEA 2AWOA 3BBPA 2IUSA 4R71A 4B73A 1GM5A 2VRWA 3TGPA 3U4QB 1EFTA 2JJ1D 1E3MA 1R10A 1Z28A 3AVQA 3R8FA 2W58A 4D4KA 3BE4A 4RFVA 2D06A 1E0JA 3CX6A 2CHQA 4HUQA 1AS2A 2CNWA 4LDJA 1F48A 1JECA 2R6CA 2XITA 3LBNA 2GBLC 4RVCA 3AVTA 1E9CA 3LFUA 1G9XA 1J2JA 1T0HB 1NN1A 4O0MA 3QKRB 3EZ2A 4IVRA 2QEQA 4QG7A 1S4QA 2V6JA 1KTVA 2IYVA 1SXJB 4IDQA 1KZGB 3HU3A 5FBWB 3UMSA 5JS7A 4UKDA 3BJIC 4I81A 3GJ7A 4HLCA 3BFVA 3RRYA 3N2IA 2ODEA 2ZUBA 5L3QB 4LHWA 4UNNA 3U44B 1SZPA 2CVHA 4YXWA 4R9UC 1PJRA 2RGXA 4DSNA 1NVWQ 3I5XA 1N5JA 1Z29A 4LJ5A 2FGJA 2OCBA 5EZ6B 1KAOA 4PR0A 2RB4A 2AHOA 2ZRCA 2V3CC 1TAGA 3PCRB 3KB2A 4BLPA 1J99A 1XP8A 4X8HA 2ZYVX 4JYBA 4TYWA 3U3OA 4D0GA 3TK1A 3T1QA 1YR7A 4B6FA 1G7SA 1KKMA 3GJXC 4FCTA 2LCFA 3W3AA 4BQSA 2NPFA 1J8YF 1Z3IX 3I32A 4IRUB 2HDNB 3MCAA 2IF2A 3GLGE 2O0HA 5B57C 2ZJZA 5GJBA 2R8RA 1YRAA 1DO2A 4KAXA 2CNWD 1UDXA 3PUXA 4LPSA 1CIPA 4EJSA 1S2MA 1NVVQ 3T1TA 3OFNA 3SHWA 3VR6A 3THYA 1NN3A 2KE5A 2DFKB 2EYQA 4DLUA 3C41J 4CEHB 4OBEA 3LWNA 4L5BA 3U6KA 5JLJA 4LX0A 4V0KA 5EUQB 4YXWD 3DZ8A 4QBGB 2DCUA 5J4VA 2V4ZA 1XB2A 4NBSA 1U9IA 1LB1B 1QHIA 2FZLA 1N0UA 3EARA 1E2FA 1C1YA 1P9WA 5AJYA 1TUEA 4OJQA 3THWB 3CONA 4RCYA 4Q7MB 1VCMA 2NO9A 5EXSA 1H65A 3LV8A 1Z8FA 3C7KA 1VKJA 3NDPA 2C9CA 1AIPA 3DPUA 4Q4HB 1YU9A 4B35A 5TXGA 2WWWA 2C96A 5GADl 3ONWA 4BFVA 1HTWA 4MGKR 4B47A 5DE3A 1EXMA 4QBFA 1DBSA 4KVAA 2EQBA 2AR7A 4CGZA 1EFRA 2IA5A 3OFND 2L0XA 4BFZA 2FOLA 1NSFA 3QKUA 1IM2A 1TU4A 3ZDQA 2OLJA 4RKEA 2H17A 3A1UA 4A2PA 1XX6A 4DSOA 4JBWA 2ONJA 4ZKDA 1AQYA 2J0UB 1A7JA 1KY3A 2PCLA 2KB0A 2AFHE 3R9WA 4JLJA 3RS5A 4V03A 1WCV1 2OZEA 3NBFA 2SHKA 3IEVA 1SVWA 5BQ5A 5HE8A 5DN6A 2IYQA 4LPKA 3D3QA 3LW7A 5FL3A 5BYKA 1QZXA 2A30A 4TTRA 4HAVA 4URZR 3GFPA 4DHEA 2O8FB 2KSQA 4KJZA 2VP2A 1P60A 5FI0B 4LV6A 4LV5B 4LY6A 4OHXA 1OXUA 2W83A 3K0CC 1CJTC 4JVSB 5TMPA 4X8LA 1SKYE 1DADA 3X1DA 4D80A 1UM8A 5J4KA 2CVFA 3UMRA 1LNZA 3EZ7A 3CKLA 2IUUA 2OCYC 1CJVC 4B48A 1UKYA 4A4DA 3QPWA 3KDSE 4JKYA 1EFRD 3MJRA 4XVQA 1ONBA 1Z0IA 4PTLA 4CEJA 1NJFA 4CYMA 3SNHA 1KI6B 5BN5A 2IS6A 2OLKA 1CS4C 5M04A 4TSFA 1RRCA 1O87A 2JLQA 5FUWA 1E0SA 2AFIE 4DCTA 3K70D 2QAGA 2X1VA 3RVBA 4NDZA 3KQLA 1E0KA 4I1OA 2Q0HA 2ZITA 4HAXA 3ZVLA 1WE2A 1G3IA 4ON9A 1OXTA 4C3ZA 2V6IA 5BN3A 4HLDA 3QXJA 1LY1A 5DN6D 5K8LA 4PO1A 1ZC3A 4MYUA 2ANBA 4QHSA 3FOZA 3AVPA 5HCNA 4RZUA 1NIJA 4GRAA 4R7ZA 4NKRA 1XDBA 2ZJ5A 3WRYC 2WWGA 2LKDA 3K09C 1X8JA 3KJEA 3GLFE 1HE1C 2MMGA 3HPRA 4W5WA 3Q5EA 1SVKA 1XXHE 4MGZR 4Q1EA 2ATVA 4LC1A 3FMFA 1SHKA 1J90A 3AF1A 5E3HA 3FMOB 1BMFA 3RRMA 3EIHA 1L2TA 1D2MA 1IBRA 2IF0A 4RZ2A 5JHGB 3NHBA 2OCPA 2ZE7A 4PHTA 4TSFD 4G0NA 1XF9A 4A8JA 4D0LB 5IRCD 521PA 5EP2A 5J5CA 5KNDA 1XZPA 2VP0A 3MLEA 4PFSA 2RGCA 2NO6A 3IBGA 1P61B 3IIKA 4POAA 3OHMA 1OSNA 3IQWA 1NIPA 4PSVA 2QSZA 1I2MA 3LQRA 3NEYA 3A1TA 3K0FA 4C7OA 3AV0B 4LBVA 3HR7A 1XEFA 4WOPA 1R6BX 4NYIR 5CM9C 2AD5A 4HUQB 4M1TA 2JGNA 1GNPA 4OI4A 1VG9B 4ZCLA 1Z06A 4GP7A 4O3MA 3EC1A 3CNLA 1NKSA 3AKYA 4QM6A 5TVKA 3U3KA 1SXJE 2WPDA 1AQUA 2DBYA 2MSCB 2WTUA 2VP4A 2NO0A 1QHNA 2TMKA 2QMOA 3NEJA 1AK2A 1BMFD 1NKTA 4JLMA 1II9A 5G53C 5FPYA 2GTPA 4ITRC 4JLBA 2D2EA 5HR5A 1SXJC 1IJFA 3LVQE 1R7RA 3C16C 2WMOB 3CRVA 3QIAA 2O8BB 3T1VA 5EXPA 3RS0A 3PEYA 1II8B 1U0HC 4HZIA 4JL5A 5J40A 1Q1BA 1T5LA 1OW3B 3IIJA 3AVYA 1VHTA 2F55A 4B6EA 1Z0JA 3AVXA 1QDEA 1TF7A 3W6NA 5J47A 3KFVA 1FX0A 4OL0A 4I1SA 4HDCA 3SQXA 2PLFA 2ATXA 3KX2A 2Q3HA 1KI2A 1N5LA 1YZTA 1G3QA 4UNQA 1KO1A 2RMKA 4BASA 1G8YA 1F60A 1GILA 3ZYCA 3NVAA 4HLUA 4D6PA 3IQXA 3M6AA 1GIAA 1ZM9A 3EA5A 1PLLA 3AF0A 3FDIA 4DKXA 1TNDA 2WWHA 1JR3A 2R2AA 4JJKA 4TYYA 4EJSB 4P0TA 2GF9A 4Y0AA 3VR1A 2WV9A 1G19A 1US8B 4GT1A 5CK4A 2CL6X 2WPDD 2IEZA 2OBLA 1G17A 4ARZB 4DCSA 5EE5B 1OB5A 2ZE6A 4M8NE 3ZH9B 4X8OA 1G5TA 1EK0A 5EUMA 3E2IA 4L16A 1IN8A 1G3UA 1U8YA 2ZSAA 1XU4A 4NCNA 1Z0DA 2QP3A 2ZE5A 3OIYA 4XWAA 3PUWA 2RGBA 2ZR7A 2IT1A 4URYR 3B1ZA 1G4AE 2I4IA 3TAHA 1ZW6A 2WJYA 1W36B 2HXSA 1N25A 1G8HA 3R7WA 3O8RA 1GKIA 3NXSA 1KI8A 3D8BA 4QBHA 2ZM5A 2YKGA 3SJZA 4JBXA 5FOSA 3GJ8A 2X19A 2VP6A 1NBMA 3CH5A 3U6BA 4JBYA 3K9LA 1UJ2A 2R6FA 3CM0A 5FPHA 2XNSA 4RSGA 4XOIA 1TEVA 2F1IA 2ZRLA 5HE9A 2BKUA 1JR3D 1NLFA 1WQ1R 2F3RA 2B92A 2YC4C 5C4MA 3TVTA 1ESNA 1IXRC 2QTFA 4JLDA 3B9PA 5K8IA 4TZ6A 2IYSA 1PV4A 2NG1A 2ZRFA 4EPVA 4X8MA 3W34A 3GLIA 4HB0A 2ZRAA 4Q03A 4Q4JB 3QXHA 1UBCA 2GEVA 2Q21A 2BMDA 4RFSA 2BMJA 2ZQ5A 3KKNA 3QUSA 1CTQA 1XPOA 4OK3A 2BV3A 1Z83A 2FMXA 2DFTA 1HA3A 3AH8A 4GFDA 5L3SA 4DVGA 2V55B 2B8TA 1UBGA 3U3MA 3SR0A 1FNNA 4PO9A 3LDAA 3T35A 3VFDA 5JJIA 4PO8A 4XTCS 3EPLA 2AL7A 1CRQA 4JJZA 4LYJA 2IYZA 2WJIA 4G01B 1KGDA 1K8RA 4OHVA 3LQQA 1I2DA 3O8DA 1JAHA 5IK2A 1NLYA 4D81A 5CITA 4GSYA 2PBRA 3BS4A 1SVMA 1NBMD 1G3MA 1Z07A 3OEHD 3GJ6A 1YR9A 4E22A 3CZQA 2W2TA 4TMZA 3X1YA 4DCUA 4F4IA 5C46F 1MH1A 4MH0R 1OHHA 2GCOA 1OIXA 1XPRA 3ASYA 1UDWA 1U94A 1WXQA 4RKFA 4F4CA 1OH6A 2JLRA 3KQKA 8OHMA 3HYRA 4KHZA 1WF3A 2GEUA 3AP1A 3WMGA 2ZTSA 4HDQB 2QAGB 1UEJA 4PAQA 2HV8A 1RKBA 2QMEA 4JLVA 4LBYA 1MR3F 4Q1BA 3SHFA 3SFZA 3WMFA 3O8BA 2GZAA 4JT4A 3DHWC 3QBTA 2RGDA 3P32A 1WDTA 3ZS9A 2Z0MA 1PUJA 1ZBDA 1VCNA 2WWYA 3U60B 4FMDB 2N42A 1O3YA 3MFYA 1FTSA 2HEIA 2UZIR 1OXSC 3QXXA 3IIMA 4FWIB 1XCGB 3MRSA 3IDQA 4TMKA 3K9HA 4BFXA 2GZHA 1TUIA 3ASZA 5HTKA 4Q1DA 5IK2D 1VTKA 1G8GA 3EPHA 4G5RA 1II0A 1OH5A 4GL2A 3QEJA 5ANRB 4AI6A 3CW2A 2HYDA 2RGAA 4CDGA 1GAJA 4Q7JB 4ABYA 4GPTA 1OHHD 3NWJA 2ZUDA 4ZI2A 3WMEA 4DDTA 2PZGA 3PEWA 3I3SR 5CYPA 3UWOA 5KSOA 3PV0A 2Z4RA 3TBKA 3EIQA 4LRWA 3B1WA 1XMJA 3ZS8A 1CR2A 1YHNA 2BHRA 4BFYA 1M74A 2FEMA 1G7CA 2B7CA 3KKQA 2ZRNA 4MA4A 1HT1E 2OXRA 4PC2A 3KKMA 3VX4A 5KTYA 4OHWA 3EG5A 3G5UA 5LD2B 1KAGA 3B9QA 2J0VA 1IAQA 2QE7A 1XEXA 4YDSA 4RD2A 1Z6YA 1VPLA 5JSZB 3Q7PA 4NH0A 2BMEA 4FMCB 4A0HA 4QC2A 4DDUA 2O8DB 4KFTA 1N6HA 3FYHA 4IKEA 1C9KA 1E9BA 2FGKA 3KL4A 5D3MA 3SJCA 1PVOA 1KI4A 3WNBA 1E1QA 2ODNA 2OT3B 1T9HA 2OAP1 4LOAA 1E0AA 2JLWA 4B32A 1RJ9B 3SS8A 4GI7A 3VR2A 1LTQA 1P75A 4WW0A 2WWFA 4PSAA 1KOFA 1M1YE 3REGA 3BD9A 2ZAOA 2QU8A 3B78A 1P7CA 2BBTA 3TJZA 5FH9A 1E99A 3LD9A 4KV9A 4ZDWA 2PJRA 4G5SA 2OFWA 3UG6A 3A4NA 2XSZA 1JBKA 4KO8A 3RYTC 3GMTA 3WYAA 1Z6GA 3L43A 3Q8XB 3SYKA 2E1RA 1NRJB 2ZSEA 4NCIA 2ZRBA 2F1HA 3HR8A 2QE7D 2HJVA 1G18A 4MYTA 1KDTA 1DG1G 1NN0A 4RZXA 1MT0A 4KFRA 2I1VB 2HYIC 2C5LA 3CPHA 4Q02A 2DHRA 3DL0A 5JFGA 2IWHA 1M8PA 4RZ3A 4US2R 4FIDA 1OYYA 5C4GB 721PA 2YWFA 5DSZA 4TLDA 3DKVA 2IEYA 4A9AA 1E1QD 3U5ZB 4A0FA 1HQCA 1B23P 2WSSA 1UADA 5FBVB 3D31A 3LX8A 2EU8A 4M0LA 2OM2A 1EGAA 3JVVA 3M4YA 1JEEA 3RS4A 4BLOA 5CJ2A 3GCGA 4XD7D 1E2LA 1MO3A 2QP4A 3ADKA 4R98A 4TL7A 3LXRA 2ECKA 1ESMA 3RSOA 2YOHA 1DELA 1A2KC 1AS0A 2OV2A 4JLPA 3F5FA 2ZS9A 3ND9A 2RGNC 2XSZD 4PAOA 2VQSA 4MRRA 2OBMA 1QBKC 4MRPA 3EZFA 5B64A 4QHTA 2CE7A 4EPYA 1DAKA 2GXQA 3W5JA 1W36C 4TMVA 1LFDB 4JL8A 4PXAA 3ICEA 2Q9BA 1ZAKA 1U2RA 2Q3MA 1P9NA 1SGWA 3MG9A 4C0LA 1ZD8A 1T4GA 2PT7A 4D26A 4E09A 3TH5A 1N6IA 4XSGA 2NZ8A 2HJGA 4CIDA 1A2BA 1W2GA 4NPHA 4AK9A 4PZYA 4TLBA 5JJLA 2J7PA 4B44A 1Q3HA 3H0KA 1A4RA 5AUNB 5FPKA 2WSSD 1H8EA 3B1VA 2EFCB 2ORWA 4R2IA 1VYVA 2R65A 3S1AB 2ZR9A 4QKQA 1NVUQ 4CF7A 3QXCA 3CX7A 3LY5A 2CBZA 2IYUA 1G7TA 3T12A 2XGJA 2NTYC 4HAZA 4RD4A 2GAOA 3MSXA 1FP6A 3PITA 2PH1A 2C77A 4BFTA 1DS6A 4V0LA 1V5WA 3VAAA 3W8RA 5DLQC 3G0HA 3HJNA 3OF5A 1KO4A 1R5BA 2IS2A 4FW9A 2YWHA 1XD2A 2W6IA 1GRQA 4Q4AA 2ODBA 3TMKA 1E9AA 2WJJA 3NBYC 1F2TA 3VNVA 2BWJA 4RD1A 1YQTA 3RNLA 3CWZA 2AN9A 2MSDB 2PZEA 4AKIA 4B3XA 1DAEA 3HDTA 1XTIA 1QVRA 1Q22A 4TTQA 3LW8A 1Q3TA 3R9IA 1QG4A 1KDRA 5CIQA 4V0NA 3BH6A 3SJBA 3QY0A 1OXXK 2YYZA 2Q9CA 2C03A 2P5TB 2J7PD 2BMFA 3KQUA 1ZNZA 2FPKA 3WP1B 1KO7A 1H8ED 3UK6A 1NI3A 2C98A 3CR8A 3HWSA 3I5YA 1OIWA 1RPZA 4WXPA 3RWOA 3CR7A 1NMXA 3MAAC 3U7FB 4DT1A 5KDLA 3VU9A 1SHZA 5G40A 4JVNA 4DCNA 1L4UA 1M7BA 1TQ4A 5B58C 4URXR 2IYYA 1XTRA 4G1UC 2ANCA 4A92A 1PUIA 1VIAA 3CB4A 4OK5A 1U0LA 1KI9A 3DOFA 3QNUA 5B2ZA 3ICQB 4QGAA 2A5DA 1G8FA 2DR3A 4G5OA 4O2RA 4MQBA 2O8EB 4A6PA 3B82A 3WHLA 3E1SA 2G77B 2W6ID 3FWYA 4W5JA 4C0JA 3ADCA 1GUAA 2ZRPA 1IN4A 3OESA 1CLUA 4U00A 2P6UA 3GEEA 4S2EA 3QE0A 1F6BA 2CLSA 2W2VA 4EPXA 3JZAA 3UWKA 2PJZA 3C5HA 4D4LA 2CCJA 5FUXA 4AURA 1TMKA 4AY2A 1W0KA 3CRW1 1G7RA 1SVSA 4D2IA 1YRBA 5DI3B 5DYIA 5JHHB 2FX3A 3LX5A 1WBDA 4HI0E 2F9LA 2JIZD 3CPEA 3CUEF 4GMDA 4Q00A 3UKDA 4ZPXA 4HB2A 4DLSA 4YQFA 2J9RA 5CDFE 3FB4A 2YJTD 1VMAA 3GLHE 1XRJA 2IYXA 4DJTA 4LJAA 1P9RA 4NZYA 1G291 5CLLA 1D9ZA 1SKQA 2H5EA 2D62A 3NH6A 4GZLA 4F91B 2J45A 1ZMXA 3FMPB 4DDVA 2ZETA 2ZJYA 4XH9B 3PIRA 3NHAA 4Q5IA 1F2UB 2VSFA 5LD2C 2QBYA 1BYUA 4QRHA 1E2PA 4IHQA 1R0YA 1QHHB 4CRWB 4M21A 5JRJA 1N0VC 1P2SA 2AK3A 2JLXA 2J59A 2BCGY 2IHYA 1HV8A 3B1YA 2GBLA 1ZINA 1HY3A 2BIFA 2QSYA 5BYJA 1Q0UA 1RRPA 1XJQA 1W47A 1VECA 2KBEA 4LHZA 4NP6A 4ESVA 4IW3B 2A5YB 1OPXA 1P4SA 4NYMQ 3BB3A 1XEWX 4CEIB 1KMHA 3CWQA 2CL7X 1W0KD 2IYWA 2FV8A 4PPQA 5GJCA 2FNAA 3ETLA 2H7VA 1A82A 4XVRA 4PX9A 1Z63A 1OKKA 3EA0A 4FN5A 4V02A 4E03A 3SYLA 4GZMA 4KYIB 2P0EA 1Z22A 1NVVR 2YV5A 3KFXA 2CK3A 3ZQ6A 4HATA 3QKTA 2YZ2A 5KO2A 4P4SB 2WKPA 3LBIA 4NYIQ 2VPPA 4IFEA 2XXAB 3QPUA 4ZV4A 4LBZA 1OFTA 1NVXQ 3THXA 4OJKA 5G41A 1Z08A 3IHLA 1WRBA 2XTNA 3SJAA 4QGFA 3I4LA 821PA 2H18A 3B5JA 2ZVQX 3OIUA 3ZVMA 2DB3A 1T3LA 2BM1A 4KXFB 5FPSA 2WZQA 2RHDA 3C4JA 1RVDA 4C0AC 1IJEA 1E69A 1HT2E 3B60A 3GLGA 1HQYE 4KVGA 3LAWA 1E94E 2GJKA 2V1UA 2QAJA 2NQ2C 1UAAA 1L8QA 4NCHA 4B43A 2ZI9A 1PLJA 1NJGA 2DYKA 1G6OA 2JLVA 1FQKA 3FTQA 4QGHA 5ELXA 2P2LA 4PAMA 2Z4SA 4A0RA 3K0AB 4K81B 2W0SA 2A2ZA 2ZJBA 1OKKD 1GVNB 5E95A 1D6JA 1KK0A 4GP6A 4Q66C 4QGGA 1ZD9A 2PT5A 3CBQA 2CK3D 4K8OA 4Q47A 3FVQA 1XJ0A 4JKIA 1VCOA 2F3TA 4IXNA 3DO6A 2VF8A 3GFOA 4HZUA 1E98A 3OEEA 2BOVA 2CHGA 121PA 1P6XA 5AUOB 5KNBA 4C0BA 5E7JA 1RYHA 2AKAB 3SZRA 3NC1C 3BB4A 5D3QA 1VIYA 1OFIA 2QM8A 3QKSA 3ZZ0A 3UIEA 1ZNXA 3FFBA 5FOXA 2CHVA 2O8CB 1KNXA 2CJWA 3AQ4A 1LF5A 2VA8A 3VQTA 1AKEA 4UXIA 2FSGA 2KJQA 4A0GA 4KSBA 3AUXA 4F7WA 2HT1A 2FEOA 1YZQA 4DLYA 2Q6TA 4B71A 1CXZA 4TLEA 5JWOA 2GVZC 2RKOA 1U8ZA 2Y8EA 3VR3A 4KFUA 1Q12A 1W48A 5FTNA 1N5KA 5G3YA 3EC2A 4DLRA 1AGPA 4MRSA 1HUQA 1UKZA 1W46A 4BZQA 5EXTA 3FFAA 1OXVA 4B3CA 3LLUA 2P6NA 5CJPA 2IS1A 3W90A 2OXCA 4UXHA 2LKCA 2XJ4A 1FZQA 1ZU5A 3A1VA 4DLWA 1Z6AA 3A4LA 5FPTA 3EWAA 4DDWA 1ZJ6A 2Q3FA 3KTAA 4KU4A 4M22A 2D3WA 1CULC 1FQJA 1D5CA 2XX3A 4Q4LA 4TMTA 3PUZA 3BRWD 4JIMA 5AJXA 1U99A 3F3YA 5JI3E 3TRFA 4URUR 1DAIA 5BXQC 1ZIPA 2GEDA 1EFUA 3OEED 1AS3A 2FPMA 2VBCA 5EE0A 3RAPR 4MUBA 5H68A 4NMMA 4BUJA 2IX3A 1GRRA 5LDDC 3U2QA 1EG7A 4NONA 1ZM7A 5FR1A 3D7MA 3K0CA 1S8FA 3QVVA 2QUZA 2REBA 4D4MA 3TSWA 1MO5A 4DEXA 1HE8B 3IBYA 1E9SA 1U81A 4Q9IA 3TW4A 1T8UA 1S1CA 4M2LA 1PLKA 3W6PA 3CRMA 3KKPA 2IXEA 3E70C 3F0TA 2ZRGA 5FR2A 4F38A 4I1VA 2XB4A 4JVMA 4YMSA 4QOSA 5FOVA 1FUKA 3K8YA 1GITA 3SI7A 4BE7B 1HURA 2GRJA 4L8GA 3VR5A 4PC7A 3KB1A 2ZIAA 4B34A 3B1XA 2IW3A 3ECCA 3WP0A 5AWFC 1NP6A 1N6OA 2B7BA 4ZIRA 4TLCA 3ZLJA 1VG0B 5JRZA 3MJHA 3NDBB 3VHXA 3RLFA 2P6RA 1E79A 3UG7A 2C95A 2OSBA 3TSOA 3P20A 1XBTA 2CLCX 3THYB 4AIIA 3FKQA 1U98A 4BFWA 4BPBA 2PL3A 1U8AA 4JS0A 2YOGA 1ZRHA 4KBFA 4P32A 1KO8A 4TQAA 3VKGA 4M1MA 4WZ6A 3PUYA 1Z47A 2BBOA 2WHXA 3DKPA 4QNRA 3WRXC 2CDNA 2GDJA 2R9VA 1W5SA 2FA9A 2ZJOA 5EXXA 1KJYA 2ZREA 3HU1A 3OAAA 3V4RA 2GJ9A 2ZSBA 4FINA 1NSTA 1PZNA 5FOTA 2FJUA 3K09A 4Q48A 1E9DA 1RW4A 1T5IA 5EJEA 1RRGA 5HZKA 2A5GA 1AKYA 4N0DA 2GK6A 4WIAA 3T61A 2OHFA 4V0ME 4WBSA 2FU5C 3GLFA 5LPNA 4DLZA 2BCJQ 1ZM4A 1IN7A 1GL7A 2QY9A 4P4TA 3UMFA 3OEHA 2BDTA 5GVSA 4KODA 4UNPA 2EFDB 5TB5A 1DE0A 3R8CA 2G88A 1XNJA 1A1VA 2ZXUA 4RD3A 1OE0A 4DB2A 1E79D 1XEWY 2YNMA 4QBIA 4URVR 2ORIA 3QG1A 3I8XA 1ZM3A 3T06B 2J0QA 2JLYA 4W5HA 1CP2A 3BFXA 4M9SA 2X2FA 1GG2A 1MABA 4RJLA 1E2MA 1WP9A 4QL3A 1FUUA 3ZD6A 1Z6XA 3K70B 2VTKA 4Q9HA 4ZDJA 4ESHA 1FW6A 3QF4A 5JCPA 2QI9C 4RY2A 1H8HA 4PSKA 5L3VA 3IO5A 5DO9A 4LJ4A 1OV4A 1GL6A 2WMNB 3TNFA 3U4QA 3OAAD 3W8NA 4BEJA 1S96A 2GZDA 1HH4A 4ZCMA 4LK2A 3GP8A 1QRAA 1XTKA 3L0OA 1X1SA 4II7A 3VNUA 3UXMA 3G82C 4J0QA 1NF3A 2EWVA 4LYHA 5DH9A 4PHGA 5EQTA 1SULA 3QKRA 2NIPA 1CR1A 4B2IA 2IYLD 1TF5A 1E96A 1SXJA 2DWQA 2A7QA 2AXNA 2R6GA 1CJMA 2A9KA 3L8ZA 2YINC 3EASA 2HUPA 5DHAA 3U44A 1GL9B 5JMTA 5CB8A 2OUKA 4XJXA 3Q9LA 4L9SA 1R5OA 4XWKA 2GWHA 4CEJB 3U61B 1TX4B 4C0HA 3IPYA 4FMCF 1YZKA 4IOKA 5TY0A 3C5CA 4LYAA 1VYTA 2J7KA 1YZLA 1XPUA 1DAGA 3TSZA 1N6LA 2O5VA 1E2DA 4LJYA 1SQ5A 1H8HD 4O2LA 3X1ZA 2QRNA 2RCNA 2FSHA 3CNNA 4NYJR 3TUJC 2N46A 2GCNA 2XEXA 3AGPA 2YC2C 3TR5A 4EQ6A 2A5FA 3MGCA 1VG1A 3EWSA 1K5DA 5AJVB 5UKDA 2XB2A 3QOFA 3TLXA 4U02A 3PJRA 2IL1A 3RS7A 2PX0A 4QNMA 4OQXA 2R6AA 4B76A 3AEZA 2ZI7A 2CXXA 1OH7A 1ANKA 1VDZA 1CRPA 3M1IA 3KUDA 2V7QA 1SXJD 1Q57A 4DC9A 4CEHA 1VCIA 1RRFA 1JPNA 4LCBA 3U7HB 1W44A 3CNOA 2ZI4A 3Q7QA 2OE2A 3U3RA 1NG1A 2IXGA 5EZ5A 4N1AA 2G9NA 3AKCA 2D74A 2X2EA 5A4JA 1NY5A 1XD8A 1ZUIA 4DBLC 1R2QA 3X2SA 1EX6A 3GPLA 2J87A 2ZU6A 2ZSFA 4B33A 5C1BA 3THWA 4A8JB 3MWLA 4Q9LA 2ZYWX 4TL9A 3FHCB 4MDEA 3W3ZB 1LV7A 5KSYA 4US1R 3KJIA 1DG3A 2EWWA 1KNQA 2AX4A 1UKVY 2QMHA 1ETUA 1G5RA 2WIAA 4RCZA 1E2HA 1RZ3A 4BLRA 5FFMA 1TTTA 1TEXA 4Q4HA 1CR4A 1YR6A 4W7SA 5EP4A 1SVIA 2QORA 3K0FB 1FMLA 4C7OB 1IY1A 1G16A 3CH4B 3NIBA 4ERNA 1L4YA 3BIFA 4MITA 1N0WA 4US0R 621PA 3ZIAA 2BBWA 1G3RA 1E9EA 2GJAA 4IDHA
chains in the Genus database with same CATH superfamily
2RH5A 1ISPA 4JOQA 2F1OA 3TVDA 1NFRA 2B6NA 4QFMA 4DGQA 1JN0A 1UM9B 2R4UA 5F9FA 5KQSA 4JUCA 4ISCA 1GTMA 4Q1AA 1Q1GA 1AMOA 5ALQA 2DWPA 2EAUA 2OBFA 5HJ5A 3ZN2A 2UZ3A 1UDAA 1E7WA 2FAXA 2HBYA 1ZVKA 4FDLA 1AKUA 2J0UA 2RI6A 3EW9A 3SHOA 4CW7A 2F48A 3OCYA 4RNDB 2ATCA 1NT4A 2P9GA 5I7SA 1VJGA 1GU0A 2ZIFA 4IH1A 2X3FA 1VP3A 4UNSA 4WNAA 3U1VA 1AA6A 3D6UA 1A8HA 2VPXA 3M6UA 3OKCA 3WX0A 2F43A 4CU2A 3KXKA 1CUWA 2WWXA 1INLA 3H5IA 2P9FA 4EOGA 3CLRD 4V0OA 2P9EA 1TJ5A 4MLZA 3I6IA 4IV5A 2JKZA 3PCXA 3UN1A 1MENA 2XCUA 5BRAA 2VK8A 1B8UA 1Z2NX 3OIWA 2H16A 4B9AA 1WZ2A 3DSRA 4DIBA 1GSHA 1Y8RA 3BSSA 1KKUA 1XZMA 3WQBA 1W1WA 4MUAA 1BROA 3QVSA 1RWMA 2IHUA 3ZGNA 1C3JA 1ZVQA 2OVFA 4LJ7A 4N5IX 3T1OA 3WBKA 2B21A 2H1SA 1I36A 3T4EA 3ZLBA 5KB3A 5ESWA 1PF7E 2WJ3A 3A6PC 2YXLA 1IHDA 4FEYA 1N1DA 4PF1A 5EQDA 5LNK1 1X19A 4CUKA 3FSEA 4IX1A 4KXQA 3D6TB 4TWZA 2HRQA 2OENG 2DRIA 4IGFA 4WECA 2C7OA 3EXAA 1IVNA 3SU8A 4EJSC 3GHHA 4UDNA 5JJBA 3TPCA 4DV5B 1ZD4A 1PDOA 4M99A 1K0UA 1Q0ZA 3NX4A 2QRJA 3ND8A 2PUJA 2Q99A 3QVGB 4PG4A 1T0UA 4Q9JA 4GWGA 5NLLA 4EKGA 2ZJAA 2NU8B 5EHXA 2HRZA 3OE7D 4IDGA 3LQFA 3C85A 1U1FA 2AE2A 4DQVA 1BFUA 4O2AB 1NJ2A 1XU9A 1NBAA 4ZHSA 2MYTA 4Q7EA 1G59A 1ZMBA 1W52X 3WYGA 2VHJA 4DV2B 4FKMA 3TCKA 1Z4PX 5F7JA 2ODQA 3K3PA 2UYQA 1TGYA 1QKIA 4CMAA 4QJ5A 3R3JA 1ZIOA 4U6SA 4JP2A 4NAUA 2NU7A 1EQAA 1YQDA 3EF0A 4P33A 3KAJA 3P9QA 4D82A 1E3WA 4ZN6A 3EB9A 4MTLA 1FNSA 2AG6A 1I32A 1DFHA 2IVFA 1K75A 3OG9A 1PZEA 2AI2A 3WB2A 2ZSDA 4ES6A 4RM2A 3VZPA 4KYUA 2CFTA 4G24A 5AI6A 1HXHA 1YI8A 2R6JA 3DQPA 4H17A 2E5WA 3S7ZA 1K63A 3ADDA 3OKPA 4O4IF 1LVGA 2L82A 2XMQA 1JT9A 2P65A 2QPLA 3AW9A 3EVTA 4M9XA 4NTZA 5H1YA 4MVJI 1YO6A 1JRLA 2P3SA 4JBHA 3GLIB 5D7NA 5E0OA 5AW3A 4YRTA 3TCXB 4BU0A 2VNKA 3ZXSA 4ZI3A 1UPBA 3IUMA 4L02A 2DWOA 1DC4A 4HSGA 4P80A 3A58B 1YMQA 4JSTA 4RFSB 4EUSA 5IFKA 2JBAB 3I2IA 3SIPA 1Z17A 3A1WA 3K0BA 1KO5A 4J94A 4GKBA 3UPDA 1JUDA 2CV2A 5DNYB 4FEGA 5L3SB 5ED0A 1PX0A 2XCQA 1SK8A 4OQEA 1OI7A 1FQWA 2UUPA 3GG2A 3H86A 3EPKA 1P7ZA 2Y0PA 1FFXA 1QG2A 1BWSA 1RRMA 1PEKE 3PSAA 3CR3C 3R4CA 3Q9UA 5E2AA 4ZXPA 4ECEA 1C8BA 4KLAA 4YJ3F 2OXTA 1YOBA 2OHHA 2YMPA 4CCAA 5EFOA 2LWIA 4PQEA 2H7YA 1YZNA 3TFQA 3IT1A 2BTQA 3HC7A 5AP9A 4CDNA 2BUCA 3U4DA 3NAZA 2HA7A 2V0NA 4WLUA 1RKUA 4AYXA 1FFGA 4G4SP 4ZVLA 2OYRA 3ZKWA 3KSZO 4M1SA 1XDUA 3C74A 4WZBB 5E9AA 2FQXA 2QW0X 1MO6A 2YW9A 4U5QA 1VHWA 5DV9A 4UFNA 5KU1A 4MCJA 3FLAA 4Q16A 4J0IA 4WK2B 1OOEA 4QTYA 1SG0A 1V1JA 2O8BA 5B5SA 2XCLA 1FSZA 3KKOA 1EK1A 3F71A 1IBKB 3MTDA 1II8A 5A0FA 2KM1A 1L3CA 1ZS9A 3LUKA 1W59A 4U9UA 5E4FA 3MHPA 4CR8A 1W4AA 2XTMA 3RIGA 3UPTA 1MX3A 1JEDA 2Q46A 2DPXA 4OQNA 3OP1A 1LV8A 1E6MA 1P2GA 1ZK1A 2QZ9A 2Q0QA 3I73A 1M6NA 3O8OA 5JXJA 2KX7A 2YH2A 4OYLA 4YPOA 1ZC4A 2VSYA 4QLOA 4EPRA 4POOA 4F72A 1W96A 2ZUUA 3OPNA 3K15A 1KJZA 1I0IA 1ZSYA 1YCFA 3FSJX 3JQGA 1ODSA 1AB6A 1LBSA 2HIHA 2QAGC 4YCMA 4KMSA 3K1JA 4BZPA 4U2DA 1TM4E 1HNNA 3UOAB 5K6AC 1XJCA 2WUFA 1MJHA 5I6DA 2PH5A 2J09A 4WKNA 4BJ6A 1YIDA 1NNI1 1F17A 2WHPB 2X8WA 3EOAI 3C2QA 1NZDA 3MZ0A 1D2GA 3PQ2A 5KYYB 3FTNA 4N12A 1ZD5A 3KVRA 3O7WA 5FTJA 1U4NA 2PEYA 1RQXA 3NBZC 1KVUA 4YC7A 3PNMA 5HA5A 3QUCA 3WB1A 3G79A 2TMGA 3N9IA 2IU0A 2V4MA 3LJKA 1GAWA 2BFMA 2QR3A 3P2KA 4IDDA 1EEXB 3GW8A 3NVKI 1W6UA 2WV7A 3W9UA 2C3UA 4JJ6A 1WV1A 2QP9X 4ARVA 3GJ5A 2ZRHA 3Q0TA 1JDUA 1G2OA 1KQOA 1PNTA 4PLHA 4ZYZA 5F5XA 2RGNA 4IIDA 4MB2A 3IJEB 5EN4A 4C9BA 4IUCS 4RGBA 2I3DA 4R05A 4WNCA 1G38A 2YUIA 1XLUA 2AOXA 5I7FA 4H4DA 1NNEA 5DGIA 1X39A 2VH5R 3NC0C 2O2GA 4F60A 2FZVA 3K05A 4TRNA 2F9MA 1EM8A 4KK4A 4TZ0A 3LPLA 2WJVA 4I4LA 4Q9KA 2NVUB 4QT4A 5CX1A 4XWGA 3OZFA 4DRZA 2WM9B 3VJRA 3AUUA 4F2WA 3A37A 1WPGA 2XJ9A 3TQRA 5FWYB 3MNFA 5LXTA 2E87A 2VYFA 5CCXA 3A9VA 1M54A 1YB5A 4PLYA 1DCMA 2E4ZA 2H1HA 1XEXB 2Z43A 2I9PA 4QHYA 4JAVC 3CYFA 2C94A 4KH1A 5TMDA 2PFKA 1M72A 3WA7A 2VJOA 5E9JA 1Y3AA 1CVRA 2GA8A 4J1SA 4OQPA 2W4QA 5ER6A 1KGSA 1Q16A 3G6KA 3HACA 2PUEA 1ULSA 2QYOA 1D03A 4XGKA 2VSXA 2YDYA 4K9RA 2ZRKA 3NZEA 4AG6A 3BX1A 3OEYA 1ZCZA 5CM2Z 1LA2A 2K6GA 4Q4JA 1H4VB 1TJNA 1QHSA 1VJ1A 2CB0A 3MD0A 4QULA 3ZV6A 4YY3B 3WBBA 1Z7WA 3L6EA 4BECA 3NNDA 4ZO7A 1A2OA 2PMBA 3K8OE 4UPDA 4B1FA 4BNJA 1C4WA 2VLIA 2ZRMA 1FDSA 1P5ZB 3DS8A 1HOXA 5BYAA 4KHPB 2FG5A 1UXKA 3AW8A 4WNAB 1PT5A 3RUAA 1E1RD 1GPMA 4KLCA 5JXIA 3KAKA 2F43B 4TUYB 4XZ3A 4BHTA 1LDNA 7YASA 2PM8A 5DI9A 5DHTA 3W5BA 2GXUA 4GI5A 5JPCA 1CZKA 1C7RA 1U3VA 1OBCA 2V7VA 3H87A 4YCBA 5AVZA 1UPTA 4BMOB 1U3UA 3R7LA 9GPBA 1QVAA 2FFQA 1EUCA 2YV4A 1P2VA 3CLKA 3U3ZA 3DUFA 5ECWA 2LCQA 4OYHA 1BOFA 3BCSA 4FM9A 4B2YA 3QSYA 5C7LO 1U6KA 2ZK7A 4NG5A 1KSJA 4QPZA 1CBUA 1Y8RB 3IKMB 3ESYA 3MJTA 3ZZ1A 4N6NA 1G8PA 2OXEA 3GGCA 4N3CA 5M3BA 1F6DA 3FOFC 4Z3OA 1CY2A 3IQFA 5HRUA 3BT7A 4KRFA 3DONA 1F8UA 4Q01A 3I9FA 1J70A 2W2OA 1JR3E 2O4UX 3OMWA 2GKSA 3NMUF 4CZ2A 2WW8A 1RRVA 3N7AA 3PR1A 1YB1A 2ZSJA 2HU2A 3IIIA 2CN1A 5JYDA 2FPLA 1LUAA 4J0KA 4DXHA 2HD4A 3IVMA 1Q1QA 2JJ2A 4YP7A 2IS4A 1Q0PA 3AGQA 3CVXA 3G7UA 1EE1A 2B1GA 4OK6A 5ALZA 1XVVA 3E5RA 1VA4A 3K5WA 2E2WA 4EA8A 3AUFA 5AW0A 4D56A 5C51B 1YB4A 3ABSB 3P26A 5AW9A 9ABPA 4CCYB 2GXAA 4D4HA 1FFAA 3W78A 4W7IA 1JQBA 2FW0A 2WILA 4Z4GA 1QUEA 7GPBA 2M2IA 2DY1A 3IUEA 1OFHA 1Z62A 2BW0A 2P67A 2NXEA 1V9SA 2XUGA 5KU7A 4X62B 1QV9A 1SWVA 4YCJA 4C07A 3HCAA 4GOKA 2W48A 4LI0A 1E18A 2BEJA 2H1CA 4NMWA 1OIVA 1FLVA 2V7PA 2RD2A 1TCCA 3H65A 1YL6A 2V03A 3BWDD 2FMUA 3WC4A 3CCFA 4KQHA 4NL4H 1FRQA 1VBNA 1TF2A 1HEIA 5EMLA 3EAQA 4EAQA 2OV4A 4U9IS 1NA5A 2H2FA 3GT0A 1FQOA 4F8JA 3K7EA 1CKEA 2VHQA 3H1TA 4H1UA 1QFYA 1C9DB 1NY6A 2QTVB 3QX3A 4JYCA 2O3SA 4MAFA 3S2EA 1ADFA 5HJ7A 1XRMA 1T35A 3DZFA 1LSJA 2PGIA 4MICA 4Y2TA 2X77A 1QHYA 4LJ6A 4OP2A 3Q8LA 4O6VA 1CCWA 2GJ8A 2B34A 4FCVA 4EX6A 1Q83A 2JARA 3I9MA 2X3UA 4M9ZA 1DAMA 1SBZA 4OSEA 2WUVA 4FNAA 1TYEB 2AW5A 2GN4A 3D1VA 5GONF 3F9IA 1N2OA 4OHBA 2KBFA 5G3ZA 3OLYA 1Z5NA 1YFKA 1TGVA 3WLNA 1GNLA 1IEWA 5F3WB 5IAKA 4GPZA 2WABA 3PC4A 4CQMA 1NVTA 1TIPA 3MGBA 5CDFA 3SFTA 5DZSA 5KDOA 1BXZA 3M81A 3OTOB 4QUAA 1H0HA 1Y5MA 5T6MA 2X7JA 1PEDA 1AC5A 3H2GA 4MMXB 2XZLA 3DA8A 1XZIA 3MAJA 4CLDA 1A5SB 3RS3A 2GHRA 3L4KA 2NPOA 2MYNA 2UKDA 4QO7A 4BRWA 4GQBA 1M2EA 3PHIA 1Y8CA 1X7ZA 1ZY2A 2ZRJA 2AE1A 1WXHA 2QGZA 3JQBA 3LKVA 4MJXA 4BWYA 3S55A 3RTAA 3DHYA 3Q5GA 5JPIA 3ZVNA 2QMZA 3JTMA 3JVIA 1BHO1 1EJ0A 2XNJA 4NCKA 1ES9A 4EARA 4EW6A 3WY9A 5BVHB 2YV3A 3O26A 3OU6A 4BO3A 1YDMA 5KHOC 5JS8A 5AT1A 1VHLA 2D5AA 1GN8A 3DM9B 3PDHA 3EDCA 4UHBA 5FXMA 4BEVA 3D4OA 1OZAA 2NVBA 1Z4JA 4AD8A 5AW4A 2BTQB 1C7JA 1VA5A 3EPPA 3SJ7A 5K0TA 3K9FC 3OCJA 3HBFA 1RJ9A 2XUKA 4RVOA 3STVA 4C4PA 4BVKA 4DBZA 4DVJA 4MI6A 3S2ZA 4EKEA 3TUIC 3L7NA 1TQ2A 1M67A 4BVJA 4D25A 1H0SA 3KV1A 3EPRA 3FLMA 5JBQA 2Y1LA 2GPSA 3GJ3A 4WEOA 1RXSA 1IOVA 1XMSA 1FEZA 2NZJA 1ST3A 1C9YA 1YMVA 4LJ8A 2C8VA 4CMGA 2QQEA 1VHQA 1PL8A 4GYYA 4LMRA 3TTXA 1E4EA 1RI4A 1CEYA 3KPVA 3IXQA 3Q72A 5A5FA 4ZHQB 4GBED 1N5IA 2IU6A 1K08A 1TW2A 2XA1A 3FVVA 1CWUA 3VU9B 3WKEA 3AR9A 3TNDA 4BB5A 1OVGA 3OLZA 5DHFA 3S6JA 1GR0A 3LGXA 2I3ZA 3CLVA 1P1KA 4EFLA 1WSDA 1V2GA 1ZD1A 3A10A 3MYRA 3OU7A 4RHCA 3F3SA 1RJDA 3GV0A 2HCFA 4R2XA 2QTNA 2Z5VA 4AZ3B 1OYVA 5LB2A 2IYPA 4GM0A 3DKRA 5KIAA 4LS3A 1HNZB 5IAAA 2IYNA 1A4IA 2F17A 3X1WA 4EPTA 2ZB7A 1C1HA 4EUNA 5IF9A 1Z0KA 2VT6A 4FOPA 4TMXA 3OX3A 4GDMA 4S0ZA 3M0EA 3BXHA 4ER7A 2BJHA 1BE8A 1RE0A 2ODTX 3HFRA 4P38A 2DQSA 3QXSA 4RE5A 5KYKA 1ISFA 1I51A 1OU0A 4UAVA 2BKXA 2Y6VA 2BGKA 4TTJA 4YAJA 3UO8B 1DC5A 4TN1A 1NU6A 1O08A 2WD8A 1XXHA 3KP1A 1ZYUA 4KWTA 4NOLA 5J9FA 1JPUA 2BM0A 4K6OA 1GD1O 3JZDA 4G0PA 4UBKA 2EBUA 4INOA 2AOWA 1YS6A 2B78A 2GB4A 1S3FA 3Q9NA 3STHA 4HUTA 3ND7A 5HGXA 1ODCA 4J0EA 2OGUA 3PVCA 3W9YA 2G71A 4E08A 2FPXA 4PLVA 3WK6A 4N7JA 1WSBA 2BGGA 1M1NB 1NW5A 3IP1A 4Y7DA 2ZUSA 3RYFB 4MRMB 1AD2A 4C4SA 1A9XA 1E3LA 1X1DA 4IYRA 1W34A 3L4SO 4GGOA 2GRUA 3T54A 4FMBB 4R01A 3HWX1 4M8KA 3MMNA 4NBTA 4EGAA 5JZOA 1ZRSA 2P78A 1YVRA 2O8NA 4P81A 2QBYB 2BZ1A 2ZCVA 2JGMA 3T7CA 2P1ZA 4HEJA 2Y4OA 4DJAA 3TW0A 3L6OO 3S2FA 2LD4A 5DX8A 5GOZA 1W7AA 1N36B 1PTKA 1Z7EA 2HB6A 4HX2A 4I50B 4LW8A 4CCSA 3DE2X 1KU0A 2AR9A 3QPVA 3A27A 3TGLA 5HEKA 2Q07A 4RPIA 1I4DD 2G0NA 2JFOA 3FDXA 4XIIA 3EWNA 4JMPA 3ZBQA 4AYTA 5KOIA 3MD9A 1Y5RA 5B53A 4ZCTA 4G0OA 1C2TA 3MJDA 4E2WA 3IDAA 2JHCA 3ZWCA 2VF5X 4BPRA 4ND3A 3OT1A 2SCUB 1W4LA 2GD6A 3JAKB 4NBKA 3ZW7A 2WUGA 1X0XA 1E5XA 1KMHB 3V80A 2RJ3A 3ORSA 4JENA 3N2EA 1DIBA 5K3CA 5HIIA 4GG1A 2C4NA 1K8YB 3AERB 1GPJA 3CLTC 4BEBA 2X8LA 1DO0A 3TIFA 2GCIA 4BIMA 1OI3A 3RANA 2ODPA 1VXOA 3T52A 1E6CA 2GM5A 1Y3CE 3EUWA 1W49A 1UMDB 1Z6QA 2BJVA 4OOEA 3VR4H 1VRVA 4TM7A 1G64A 3BZBA 1TIKA 2GCPA 5JALA 4UE3S 1W5AA 4YK7A 1W85A 5LOVA 3N75A 1K5GA 4WBNA 3BHMA 4JLUA 1YRQA 4YB8A 1KYZA 3TB4A 3G2QA 4DA8A 2REQB 3BCUA 2NAPA 4N5NA 1JEYA 4BC0A 2PGJA 3L1UA 1O95C 3GD7A 1P3Y1 3A3NA 4WFIA 4MHSA 3KD2A 2VCYA 1CR6A 1RFLA 1YJ8A 3C14C 3D8TA 2EF1A 5J59A 1VLHA 1WDWB 2CLOB 5AUPB 3EWIA 5K4AA 3KUCA 2IHNA 1DI0A 1MKYA 4HMQA 5EHZA 4CFZA 4P84A 3ZQKA 1B2LA 4G25A 3NUQA 4I4IA 3PVSA 4QJBA 4DUGA 3TX6A 2ZP1A 5HMLA 2EJWA 3UXEA 3ITKA 4UQPA 5EESA 5IX8A 2ZJ3A 1OBHA 3FKSA 1OH8A 1JXAA 4NBNA 1W1UA 2ETXA 3FN4A 1P4RA 4UHFA 4Y6SA 3GEDA 4MGYR 4EZBA 4EELA 1CDEA 2QT0A 5IMBA 4MQ4A 4UBNA 1EESA 1EDZA 3DB2A 2D2FA 4ZZ1A 1UMCA 3L1VA 1IXSB 2VHTA 3BBLA 1GSIA 3HY4A 1K8QA 1W2HA 1X1BA 1D1QA 2FW9A 2QRVA 2GGSA 4HNAA 1JR6A 3RTEA 4XSHA 4E11A 3BWYA 1XNQB 3CC8A 1KSGA 1M8JA 1SD5A 1JPJA 1ZCBA 2POQX 3O8LA 4RZQA 1IB0A 1U0EA 3IP9A 5J58A 1I33A 2WA2A 1AUQA 3EHDA 1J20A 4L4UA 2IYAA 1WB9A 1EFAA 4X1KB 3T5DA 2KPOA 4W9NC 1NJ6A 3BAFA 3BXZA 2PUAA 3OTQA 2ZPAA 5AI5A 1EFVA 2EARA 2J8ZA 5E4TA 3SC4A 3VM6A 2IE0A 2P91A 1JEQA 5FBKA 3E2PA 4A6XA 3LUPA 1UJ6A 2VAWA 2H8KA 3FLEA 5DI3A 2QZ4A 3OZGA 2H11A 4R4JA 5JCOC 2C0QA 3KYJB 3KTDA 2CYBA 1MVNA 4CM8A 2ZYRA 1NG9A 3ZEIA 2IWRA 3N5KA 5EP3A 3TCNA 4TLLB 3L0ZA 5AXDA 2NXNA 3O75A 4IDOA 2NUAB 3WXBA 1E2KA 2V54A 4WKBA 1E2NA 2GFIA 2XZPA 3W2HA 3FZGA 3WKBA 4LQDA 3OI7A 2YQ5A 1IJBA 4YUWA 3RBAA 4ZD6A 3V4FA 1JAYA 4F71A 4URHA 4B3RB 3L1KA 2HCBA 1V1RA 1KAMA 2EG9A 4LJ9A 4EB6B 5CFNA 1FXUA 1X7ZB 1T9DA 2Q4DA 2E4YA 3UA4A 2A9QA 5LQDA 4PC6A 1D4ZA 2DP4E 3JWPA 3ZE8A 3U60B 4ZCSA 1KOGA 4JJ4A 4JT2A 4TQ9A 1E5TA 4CKWA 4D3YA 3KQMA 2PH7A 2VQDA 4AZTA 2ASEA 3AY0A 3OIVA 4JLOA 1V0JA 1GPUA 1MOZA 3MWKA 4QQNA 1GNQA 4HJXA 2ES4A 1WDMA 2PVPA 1QGAA 2ZYDA 1Y63A 4HLQB 4I9NA 1NQOA 3JYQA 4UHJA 2DR2A 1T8TA 3QEMB 1UJBA 1F8GA 3BFKA 2Z2IA 1UWLA 2I7XA 3IAUA 1DLIA 3FF4A 3LIIA 4HWRA 1TE2A 5GAJA 4IHKA 3AUSA 1QHGA 4KGVA 1SKYB 3AP2A 5ALKA 3UFBA 3HCPA 3ZCQA 2DFLA 2BFEA 2VJLA 2ZIGA 2Z5FA 3R6GA 5C18A 1P44A 2GNOA 2BPOA 2ZBDA 4BE4A 2X4IA 2CXRA 3D64A 3P5BA 3PGLA 4Z4HA 4BEWA 1IN6A 4JK3A 1SOAA 2EW1A 1BDBA 4CVNA 1DTWB 3KUXA 5B3JA 4ALLA 2W37A 3KHTA 1C0LA 2OO7A 4P4SA 3QHQA 3QIVA 3K0EA 5FI1B 3R5XA 2WDPA 2C3OA 3BJEA 1OX5A 2ID8A 3OPYB 1T9GS 1GG9A 1ZGZA 1VCHA 5AHKA 1FP2A 1UKBA 3EXEA 1X38A 2H2DA 1N2GA 1COWA 3KQPA 5EE3A 3ECAA 4MKIA 3ZX5A 4G0YA 5M29A 3T9FA 1TKBA 3S8EA 2YJZA 4DWWA 1NN5A 1Y98A 2HF9A 1X7YB 2ZRDA 1M7GA 2AF4C 4JBGA 4A15A 4ZOLA 4BMCA 2NGRA 2B1JA 3VXKA 1QOQB 2V7WA 4PC1A 3A28A 2XDAA 1S8NA 1JJBA 1IZ8A 3SVLA 1YVPA 2JJQA 1RLTA 1VJ5A 4EMBA 3DV2A 3QF7A 3M4XA 3QYAA 4FDTA 3AEKA 4YRAA 1FFHA 2YY6A 4C0WA 1MQ8B 3EF1A 2W70A 4E4TA 2FSFA 3IO3A 4K03A 1SC6A 4OXRA 4RL6A 3MRXA 5DNUA 5JZMA 3Q8WA 1WIWA 5LM3A 4CQNA 4PXYA 1PRYA 3KZXA 5A3VA 4PG6A 3WYFA 3V9PA 1H6BA 2ZIVB 3DEYX 4KI0A 1QP0A 3P2MA 3IOEA 1XXHB 3GAMA 3WGTA 1CY0A 3L41A 2FUKA 3HSYA 2PZKA 3LHDA 4PZEA 3RR2A 1C50A 3HKCA 1Y4UA 2VBFA 2JI6A 1LW7A 1PGJA 1UKAA 2F6RA 4YLGA 4JJAA 1USVA 1AF4A 2X2OA 2FDCA 2P2GA 4K9DA 4LZAA 1L7BA 2HJ9A 1KEUA 3L8YA 4Y18A 1TVKA 2MWMA 4HN9A 4MWDA 3GUUA 3BHIA 3CF0A 1MABB 2H07A 3NHPA 2JS7A 4UOZA 4QIHA 1FP1D 3QF4B 4RPCA 3EMVA 1LSOA 3RT9A 1NLUA 5K3FA 4AKGA 3N58A 3UANA 1B74A 1IY2A 4YALA 3SYRA 4OI0A 2DQ4A 3EVCA 1IUPA 3BBPA 2IUSA 4MK4A 3AFMA 1QP7A 3C1UA 1I3LA 5BNIA 1UPXA 1X7DA 4D4KA 2C57A 3BF8A 5C5DA 2D06A 5IP5A 3CX6A 3VGPA 4BWFB 4KXLA 1IU9A 4WKCA 1X1AA 2FE1A 4ZZ0A 3DO8A 1F48A 2GBLC 1THTA 1D04A 2WNSA 3DBLB 4JUDX 1E8MA 1NN1A 4O0MA 5HKAA 3KQWA 2FG7C 3QKRB 2QEQA 4FLFA 3CLSC 2VDWB 4X63A 4EUFA 1SKUA 2FW8A 1ABEA 5DBEX 1DOHA 4GUAA 3L8CA 4N01A 2QD1A 4U1RA 4UKDA 2GLXA 3RRYA 5IKPA 3N2IA 1GZDA 2VDVE 1TB4A 1Z18A 2O3QA 4UNNA 4RXMA 4YXWA 4R9UC 3ZIDA 1PJRA 4YI5A 5E9QA 1GA1A 1N5JA 1V41E 1Y1TA 4LJ5A 2JAHA 3RYHA 3LY9A 4G0QA 2X0FA 2FGJA 1Z0UA 2YXEA 3AC0A 4WXMA 4L0CA 3WGVA 1R16A 1VL6A 2RB4A 1A9RA 5G1PA 3ROMA 5JSHA 2XQKA 3UXHA 3PCRB 4EENA 3KB2A 4YS6A 4M98A 4QTTB 5SV2A 3FJYA 3W2TA 4X8HA 3X43A 2O6LA 3SC2B 3WMRA 3WQRA 3BMQB 4BZZA 2WG2A 3USZA 3TK1A 3X3HA 4BMYA 1YR7A 4CUJA 4EGSA 4B6FA 3EBOA 1M0TA 1G7SA 1KKMA 2WMYA 3HEMA 3UGKA 1PZGA 3GJXC 4EM6A 4FCTA 3DFMA 5CT9A 1JPVA 3W3AA 3SX4A 4G1EB 1J8YF 2NPFA 4X66B 3RLIA 3OZUA 2MIIA 4AICA 2O0HA 2RHWA 3HXTA 4QOGA 4S1OA 1DO2A 3WIUA 4F84A 1XTTA 1OY1A 2PBZA 1CIPA 4GMKA 4MVJH 2EKLA 5TMBA 2ZBFA 1JP7A 3ONNA 3ZCVA 1FTWA 2OZKA 2KE5A 2QR5A 3OQ1A 2WAAA 4PYLA 5J5VA 1ULTA 3C41J 3WO1A 2HDOA 3KKZA 1P5HA 1Q6ZA 1QE3A 4LX0A 3JAMA 3N87A 4MV6A 2WINI 4ZEXA 1OZFA 5ADVA 1ZN7A 3DZ8A 4YUVA 4U7JA 1ZKDA 1BE0A 1XB2A 3CT4A 3O38A 1U9IA 1N0UA 1C1YA 1O9HA 3O2JA 4F1JA 1V4BA 1E64A 3TD6A 1F3LA 4P86A 3D6JA 5FPPA 4QO8A 4D1YA 5KTOA 2LW7A 3F6BX 1FJXA 1EFVB 1CZLA 4Q7MB 4QDJA 3KU1A 3CA8A 2Q49A 5EXSA 4QAJA 3LV8A 1EX1A 1OAKA 1JEQB 5L95A 3OTGA 3D02A 2VSQA 1XDDA 3P0FA 3DPUA 3R5TA 4Q4HB 1BD4A 1WULS 4X1IB 2XGGA 5JJ5A 1B43A 1H2RS 3IEIA 4FCCA 5GADl 1ECBA 3F4LA 4B47A 1Y3IA 4CNQA 2AC4A 1T36B 1R6AA 3I9NA 4QBFA 4R5HA 1JG7A 4KVAA 1AUVA 3EBPA 1EFRA 2UZ1A 2XMDA 3JQ9A 3OFND 4U2KA 4LF8B 5JAQA 2R86A 3VR6D 4WWHA 2C31A 1IIRA 3A3KA 1IM2A 1U8XX 3HGTA 5A0TA 4G1BA 4RKEA 4OCZA 2WF9A 2YZ7A 4HPXB 4OLHA 4A2PA 2VUIB 3NV9A 1K4KA 2FKAA 4G63A 4OYYA 3K96A 2XD9A 4LE0A 4Y9DA 1VFNA 2PCLA 2KB0A 3AJ9A 3ENNA 2PMEA 3RS5A 3OURA 3UZUA 4DNQA 2QLLA 3H5NA 2ALJA 2XCIA 3NBFA 4J9UE 4PCUA 2Y2VA 5GV7A 3KSBC 3M5DA 2E89A 2VQ3A 2HL6A 3KPJA 5HE8A 4EHFA 4J7AA 3AB8A 3UENA 2P75A 5AXCA 2CSXA 3OHSX 1J22A 4NJEA 3S2IA 3GFPA 4HYEA 5EYPB 2QZZA 4HDRA 3GMDA 3NIFB 2QUJA 1UXGA 3QFRA 2VP2A 4KJZA 3DLCA 3LI2A 3VYUB 2BHSA 3MJSA 1GZHB 2XE8A 1OXUA 3H8WA 3OZRA 2VJBA 3OZ7A 3RTCA 2HRDA 3MUOA 1RAGA 4JVSB 5G0WA 1NE7A 2DXIA 1PL6A 3H0EA 1UM8A 2ZCUA 1LNZA 1Z6PA 4Q3AA 2JHGA 1SHTX 2WTNA 3OLXA 4A4DA 5HQJA 3QPWA 1XZCA 2IY8A 3B6JA 3RAGA 2B4KA 4QQFA 3B7PA 4MUNA 3V8NA 5F7XA 1VFPA 3ZDCA 3PKIA 3MJRA 4HDNB 4XVQA 1Z0IA 4XYEA 2H63A 4O4LA 4I4TF 4X60A 1BRMA 3DL2A 4CYMA 2PRJA 5BN5A 1MA0A 5AVRA 2IS6A 1N32B 1TO2E 3R6DA 3LUBA 2D7JA 2YWJA 4RZHA 3WOHA 4JFAA 4MQUA 2JLQA 5FUWA 1E0SA 1F0KA 3EXEB 2B5VA 2X1VA 3M70A 1UFOA 5K0BA 3HM9A 4RELA 3KQLA 3M3PA 3K71B 1XXLA 3QEAZ 5CVTA 4S12A 4HAXA 5EKXA 1X1TA 1JBEA 4E2XA 2W6PA 3ONDA 4NSNA 3SXPA 3WKDA 4CDGA 4ON9A 1CYEA 1OXTA 1UQTA 3QNMA 4BMPB 1DRJA 3S81A 4HLDA 4UHEA 5EXDA 2IEAA 5K8LA 4MYUA 3IKVA 4QHSA 1NPYA 4PZ9A 4B3HA 4CLRA 1RZRD 3WYNA 4RZUA 4V1CI 3HKBB 1C7IA 4L5AA 4R7ZA 3ET5A 4M8IA 4NKRA 3GGSA 1XDBA 2ZJ5A 3PD1A 4IPTA 3K09C 2ZKLA 2FK7A 3E3LA 4Y1FA 3NDRA 3GELA 1CY6A 1WW8A 3Q5EA 1SVKA 4W5WA 4NATA 1PYDA 4DS3A 3SC6A 3QW2A 1J5PA 4Q1EA 4P36A 3LYLA 3PUJA 1NYLA 4YRIA 1WHSB 3N2ZB 4YV7A 3IAFA 3EIHA 5AIBA 1D2MA 1IBRA 2ACKA 2OCKA 3VNSA 1ZJ4A 4DSZA 1UFRA 2PO7A 5FNVA 3VHQA 5JHGB 2P7IA 5L51A 1PO7A 1WXWA 4MJ3A 5LR6A 3HB0A 5B6PA 1AKQA 3FDZB 2PD3A 3MIZA 5IRCD 2CLIB 4K6KA 1OBFO 2QE6A 3H11A 3BJMA 3NHZA 5FWXA 2DERA 3NS7A 3ZGZA 2GKGA 1JLLA 2QV7A 2VP0A 3O9VA 1CUXA 4QDZA 3GT3A 4PFSA 1P61B 3KWFA 4XUDA 5P8WA 1RBQA 5AVYA 3B1FA 4POAA 4V0QA 3VKFA 1ECLA 3C3BA 3OHMA 4PM4A 1OSNA 3FFTA 3GBSA 3WLJA 1NIPA 5K3FB 1IY9A 4PSVA 3NVDA 4FYIA 3F98A 4O08A 4FHDA 1BFKA 1U2ZA 4WBNB 3FPKA 2JIQA 4AP5A 1PYOA 4C7OA 4B80A 1XEFA 4NYIR 4QYIB 3R3UA 2B35A 5DNAA 1UDBA 5JANA 4M1TA 4HQ0A 1F14A 1P7PA 4L28A 4Z4FA 3FWPA 1VG9B 1IRIA 1UFKA 2C4UA 3PS9A 1Z06A 1T1IA 3EC1A 3CNLA 4TRRA 4U6QA 1CUZA 1NKSA 1ADJA 3F9RA 2QD2A 5LYJB 5BSRA 1GPWB 1WEHA 1M1XB 1ISGA 3U3KA 3GFFA 5K99A 3OUUA 1SXJE 3DTVD 2WPDA 1AQUA 3R9KA 1E5LA 4MV1A 1K92A 3FJ1A 2E1PA 1VE6A 2ZSIA 3ZTYA 3OQ6A 2QMOA 4FYHA 3BDVA 1NKTA 3HDYA 4JLMA 1II9A 2OV8A 3NHYA 3MF4A 4LMAA 5FPYA 4ITRC 1QTIA 1IULA 4J0DA 4MWOA 1IJFA 3TDNA 3W7BA 3WE7A 4J76A 2J30A 3HCEA 3K1TA 3WIBA 1SCUA 2WMOB 2QDKA 4NK5A 3EZXA 4NIMA 2J3LA 3A4YA 4U0JA 5KNDD 3IIJA 2NZWA 1XJ5A 4FE7A 2B1RA 1CY4A 3ROKA 2F55A 3AYZB 4YRBA 4YAGA 3AVXA 1NHGA 2QRMA 5JD3A 3W6NA 3DFKA 2W11A 1RI3A 3VYVA 2OBYA 4D92A 4HDCA 4CQJA 3HI6A 2J6BA 2I8LA 1E8NA 3TLYA 3SQXA 1I2AA 1WG8A 1KI2A 2Q3HA 4HCJA 2X9VA 1VSVA 4L4ZA 2D2XA 2RMKA 4NC9A 1G8YA 2AMFA 1GILA 1RM4A 3NVAA 4IHJA 4CJXA 3IQXA 1ZM9A 1RHRA 2YCBA 1PLLA 2JFPA 1FBNA 3EA5A 2G1AA 1C81A 2DTXA 2WWHA 3HGMA 3OSUA 1JR3A 4ESOA 1OJ7A 2AN5A 2HR1A 4RKRA 1Y4AE 4DE5A 2WV9A 3RUCA 1G19A 1TM2A 3ZIUA 1I10A 3C3YA 5KSWB 2A9VA 3FWKA 1N2ZA 3SQDA 3K6RA 2IY9A 1ZMRA 4ARZB 5TPZD 3HVIA 3IALA 2XRFA 2PKYX 1YGYA 4NESA 4JC8A 1BDHA 3SSNA 5H0IA 4KPFC 1EK0A 3VNQA 3E2IA 4L16A 2XNCA 3RTGA 1C30B 4A2CA 1Z15A 3N2NA 3PA6A 4BDSA 1Z0DA 1JWAB 1ORTA 3BE6A 3KOYA 4TVKA 3TTUA 4XWAA 2C5FA 1TUBB 2FRDC 5C8YF 4ARCA 2FPGA 2RGBA 2ZGVA 1KP2A 2IT1A 2ILTA 1G4AE 1JG2A 1RI1A 1RQGA 2I4IA 3BQNB 4H60A 4PICA 3M83A 1FYDA 3DNFA 2A86A 3V1TC 3M1LA 3N0VA 2XMZA 5EMHA 2Q7DA 2EGHA 3NXSA 4NXMB 2SBTA 3C3CA 3PR3A 3D8BA 3GGOA 1OI4A 4H15A 3PFFA 1R6VA 4QTXA 4Q4CA 1T4DA 1V8DA 2VP6A 2WSBA 2X19A 3O0DA 3A9CA 4NBLA 4ECAA 3LT2A 5HXAA 1UJ2A 2JZOA 4RSGA 5ICSA 1M2OA 2DBQA 4ZQEA 1ACLA 3GNSA 2I0FA 3HXOA 4IEFB 3OT4A 2F1IA 3UV3A 1Z4IA 2IBTA 3DDNA 2YC4C 2F3RA 3VZCA 5JVDB 3TVTA 1FMCA 4UU7A 3EDMA 1DC3A 1IXRC 3ETJA 3QEKA 3B9PA 3K4PA 3HN6A 3Q2IA 4EPVA 2O20A 1GG5A 4Z0HO 1BVUA 1AGYA 4HWSA 1CUIA 1P0CA 2PSHA 2GAIA 3QXHA 2EIXA 4YAFA 5DCYA 5KYGA 2BRUC 3LWDA 2FPSA 2FQWA 5F3RA 3QUSA 1QGED 3I76A 1QB7A 2O1WA 4TTAA 5KQLA 3REQB 5JXGA 3V2HA 3QTTA 5CFOA 2IPLA 1X7XA 1EIZA 3EUEA 5CDGA 4EFDA 1T0BA 4DVGA 4CKZA 3QY9A 2B8TA 5KKCA 3GGDA 1RJGA 1FNNA 1R9NA 4YI3A 3T35A 4LSMA 3VFDA 1M75A 3I9KA 3FMGA 5BPHA 3C5WP 2QYHA 2CNLA 1OWOA 3AHEA 3D4NA 3AY6A 4OUDA 1CRQA 4X7MA 5CXQA 9LDTA