3UAOA

Structure and catalytic mechanism of the vitamin b3 degradative enzyme maleamate amidohydrolase from bordetalla bronchiseptica rb50
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
199
Chain Sequence
DLGSYERQGFGAALPLKAPYGLLIVDFVNGFADPAQFGGGNIAAAIETTRTVLAAARERGWAVAHSRIVYADDDADGNIFSIKVPGMLTLKEHAPASAIVPQLAPQAGEYVVRKSTPSAFYGTMLAAWLAQRGVQTLLVAGATTSGVRASVVDAMSAGFRPLVLSDCVGDRALGPHEANLFDMRQKYAAVMTHDEALAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative isochorismatase
publication title Structure and Catalytic Mechanism of Nicotinate (Vitamin B(3)) Degradative Enzyme Maleamate Amidohydrolase from Bordetella bronchiseptica RB50.
pubmed doi rcsb
source organism Bordetella bronchiseptica
total genus 66
structure length 199
sequence length 200
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.1.107: Maleamate amidohydrolase.
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3uaoA00
3LQYA 3V8EA 4H17A 2H0RA 3KL2A 4WGFA 1X9GA 4WH0A 1YZVA 3TXYA 1NF9A 3HB7A 3TB4A 1ILWA 1IM5A 3EEFA 2WT9A 3MCWA 1YACA 2FQ1A 4L07A 3UAOA 3R2JA 3PL1A 3OQPA 3S2SA 3O93A 1XN4A 3O90A 3O91A 2B34A 3OT4A 3O92A 1NF8A 4L08A 3IRVA 3R77A 1J2RA 3TG2A 2WTAA 3HU5A 1NBAA 2A67A 3O94A
chains in the Genus database with same CATH superfamily
1DKQA 3M6AA 4NJMA 2ABWA 3OQNA 3D7KA 3B6IA 3G1TA 1HNZB 1KY4A 5A6SB 1DL5A 3R3SA 4ALJA 4G5RA 4UAJA 3TJRA 2CV0A 1YOVA 2X6QA 3LWNA 3DXYA 3FYTA 5A3JA 4RAQA 4LGMA 1YMVA 5C5EA 3RROA 2HFJA 5BN5B 3UA4A 4RYLA 4XJSA 4NU6A 3C43A 3AHFA 3C41J 3OZEA 4P82A 4B4OA 5AI4A 2I8LA 2YV4A 4E46A 4P4NA 1MKYA 3HP4A 4Q3OA 1FFAA 2IYUA 2XA1A 3DLTA 3L6BA 4J1NA 5LCXA 4DC9A 2DUNA 4DR4B 3Q1LA 3NLLA 2XNDA 2P5YA 4G4SP 1Y6QA 3H65A 3IE2A 3SC3A 4DJDC 4WY8A 2JW5A 5E6SA 4C0KA 2ZAOA 1F8XA 4O4JA 3NIDB 3NWEA 2O0LA 2P5TB 3FIUA 2VQ6A 3E22B 1WO8A 3MUOA 4EJ0A 2QGNA 4DCPA 1P4AA 1XJQA 1XMIA 2KE5A 1THMA 1NXTA 2OFPA 3I6QA 2Q2QA 3PYMA 3SLKA 4IDPA 1NHGA 3JRXA 2YN2A 2OVFA 3QPWA 4KO8A 3EVTA 4AX8A 4DDVA 2O5VA 3A1FA 4UC0A 4DDHA 1XQXA 1E3SA 5DYIA 1E7MA 1PU2A 1NFFA 2GBCA 1K27A 3RIYA 1DTWB 1OC4A 3GUHA 3G2QA 3L7IA 4QU9A 3VO2A 4HUQB 3ZCPA 1SURA 2C61A 1S2LA 1L7DA 3G2KA 4GLBA 4BO3A 5TPWA 1VZ3A 1CJSA 3FETA 4XAQA 4CN8A 3X1XA 2Y93A 4XVCA 1FRQA 1NXPA 2LD4A 2YWXA 4F2DA 1ECLA 4HLNA 5D3MA 4D98A 4EDHA 4CM3A 1TU3A 4PC6A 1JIKA 5C8ZA 1NR5A 2ZDHA 4MQFB 3T3HA 2XD9A 1OHHD 2TMGA 3SD7A 4B2IA 4PLYA 2ISQA 4OBXA 2IUFA 3I53A 4BLPA 1CETA 2PEZA 3KHSA 4HJRA 2JLYA 3FMFA 4QREA 2PJRA 4MV7A 4MW9A 4NCJA 3S44A 5CJPA 3L7YA 4YAEA 2WU3A 1J39A 1MEEA 4HNUA 2ODBA 3TLXA 2OAP1 4F56A 5M2QA 2FPKA 4ARZA 1N0UA 1KK2A 2G6TA 3L2OB 3VZDA 1M1NA 1Z88A 5LYJF 2GZAA 1MQAA 4QE3A 5DYGA 4EATA 3A3KA 1J97A 1LF0A 5IHPA 3OM1A 2ODEA 4C89A 5JSYA 2HDWA 5EZYF 1U81A 4UVDA 4YV2A 2DQSA 2VP5A 2GPJA 5KAMA 5A4KA 2QL5A 1ZH8A 2QD4A 3RSHA 1MIOA 2ZROA 3P2KA 4GWKA 4Z53A 2W2MA 4ZMSA 2LVBA 1QKJA 1BKDR 2R6FA 2FPGA 5KMGB 1KBQA 4RTKA 5C34B 1J2UA 4ED9A 4UUPA 1LI5A 4HADA 1JQKA 1P2UA 3FCSB 1L7AA 4ALKA 2YJNA 3FVTA 2VHWA 3U7EB 3G82C 5G40A 1P77A 1T4CB 4M88A 3EWSA 2W42A 2DPGA 4OA5A 3ZUPA 4YAKA 1N6KA 4UPDA 2AUTA 1W59A 4UTPA 3O4GA 3QUAA 4Y6RA 1PNVA 3DMHA 1KDOA 3BWYA 4UPVA 5CLGA 3Q3IA 2Q8NA 1VJGA 3G9TA 5JRDS 4ITRC 3EFBA 5JY1A 4RKQA 3ZNQA 3FFXA 4JJAA 3H7IA 4HWTA 4ONEA 5SYNA 1QPGA 3DC7A 1Z12A 3R0VA 4NTZA 4LTDA 1M2WA 2C9OA 3VO8A 5I47A 3N6RA 2CZQA 1JWAB 2PZGA 1HZZC 3ZWPA 4B5LA 4PYJA 1PX0A 1U5BA 1XD8A 4IDDA 4KTTE 1JE1A 4K81B 5DM0A 1XK7A 2ZJ2A 5C1PA 1MC1A 3B12A 4NBSA 3ICQB 1RADA 1A4XA 2VBFA 2QLTA 3AHGA 3DL4A 5DULA 4BQEA 3HDTA 3VHQA 4QM6A 4P7KA 3CURA 3SHTA 4HXGA 3ZY4A 2ZI6A 1OPXA 1M8GA 1Q0SA 1GHTA 3PC6A 5BUSA 1U7XA 4YHHB 3PT9A 1VPWA 1IHDA 3W3ZB 5BW8A 3RVDA 1NBEA 3VX4A 1FBTA 3DP9A 3Q0IA 1ZJJA 3Q7QA 4BP1A 3DCJA 1JFFA 4Z4CA 3GJ3A 3NYWA 2VS1A 4ZU3A 2QNIA 3KEQA 2R8PA 2Z8ZA 3ZK9A 1IEVA 3HUFA 1OWNA 3B7WA 3EXEA 1F5SA 3AESB 4KE8A 2WYOA 4AZVA 4DRXA 2GXAA 4LYYA 4MW7A 4HGZA 1JR2A 4Q6WA 4BKPA 1ZFNA 4FI3C 2ZR8A 1USKA 1NW9B 4L3OA 3P9IA 5FUYA 3R9XB 2SECE 2Q4TA 4OJTA 2R47A 1JKJB 2O2IA 3QITA 1IYZA 2H59A 1FB5A 2QN2A 3CUTA 4CTJA 4UFPA 3V97A 1T5DX 5H16A 3LHKA 2L42A 4JU8A 2Y27A 3WWDA 1K9SA 4JIMA 5B1IA 4JLNA 4RD6A 3BWCA 3HJFA 4UBLA 3TIGA 1UEXC 4JQSA 2FWJA 1CZUA 4DRZA 1KEKA 3W0LB 4C14A 3PDJA 4R81A 1LW6E 1QCCA 2LPMA 2WYWA 3SP1A 3BJZA 3DWEX 3ND8A 3OCYA 2CFIA 2YASA 3OOSA 4DLNA 4UKDA 2GVDC 2OFWA 3V1KA 1G8KA 3MMSA 3GLFE 2JJ8A 1JA1A 4WQMA 3D3KA 3RWBA 1QFSA 2CVQA 2UZAA 3OPYB 3WRXC 2C5GA 3L04A 3T7KA 1ZOLA 5IZCA 3BPSA 3FTQA 4RF4A 3WLEA 1AGNA 2NU9A 4WK4B 4X1IB 2BTOA 5BSWA 2Q1SA 1X8KA 2VJKA 2I7VA 5D6OA 3W77A 3SZLA 2P9BA 4MUAA 1PX2A 4J9VA 4OJKA 3IT1A 3TS1A 3QVUA 4DVGA 1T8UA 2QAIA 3DFMA 5AQEA 2BDEA 4I5DA 5MDHA 3DMTA 2Q0QA 2QJFA 3L7CA 5UKDA 3NXKA 3CF2A 4P4TA 4ASUA 2M32A 3MCVA 2GEBA 5IAAA 2FW9A 2WU4A 4OAPA 3TIIA 5JFTA 1O0BA 1X9IA 3REQB 3UV7A 2RGNA 2WG1A 4FOSA 2CNWD 5CLQA 1CR4A 3LBYA 4P3NA 4R84A 3QU9A 5FTJA 2XXBA 2CFSA 2CFCA 3EIWA 5EGSA 4LV6A 3H2JA 4YHBA 4RZ3A 3UEOA 4BTVA 2II6A 1DARA 3SC4A 3NRCA 2CMKA 4C6HA 1FUUA 2Q7XA 5ECYA 4Z1MD 2I78A 5BWLA 3SKVA 4RXMA 3TG2A 1KH2A 2CL7X 4YRMA 1A5SB 3E0QA 2C1ZA 5L53A 2VPZA 2JFOA 3KXIA 1QG0A 1ENOA 1XRJA 1Z2EA 3M6IA 1T6NA 3LLSA 1TE2A 2AYZA 4Z86A 1J06A 4AJJA 1QGDA 1BDMA 2HF8A 4KL8S 3HYSA 1T8PA 3H3FA 1OXXK 1AQ6A 1KNQA 3JTEA 2I65A 4FHDA 1X7ZB 3RUAA 1W0CA 3MGBA 3TRJA 1XZMA 3HA2A 4CG0A 3D8SA 2ZYUX 3IXQA 3ZZUA 3IQFA 2WYUA 1A0OA 4B0PA 2NU6A 1IOWA 1YZQA 4NJEA 4TT3D 5DCUA 5EJ2A 2WUEA 2VF2A 3F8SA 3GV0A 3J81A 1U2GC 3J81k 3UBTA 2J9FB 4MINA 5EZ6B 1ZNZA 3K1JA 1EP3B 3LECA 2NOAA 5SZIA 4GBJA 4OEHA 1JALA 4PVCA 3ZWAA 4QU5A 4CWAA 2ZSDA 3GD5A 2JIBA 1I2CA 2G06A 1HORA 2Z1DA 1IJKA 3L41A 3OAAD 4PQEA 3RB8A 4R3NA 3L1VA 4MV4A 3S2FA 4UXJA 1XZQA 1R15A 3I9JA 1Z4PX 3T1NA 4LF4B 3BZWA 4QHYA 3IQDB 4RMGA 4B32A 5DJ5A 5HZHA 2F9MA 5AVYA 3DONA 3ZXYA 4JNKA 4AWXA 1K0FA 2QF7A 2IQ5A 1WCYA 4M7PA 3JQBC 4XGIA 3RYTC 2MR5A 4CFYA 5A0VA 2XTAA 4PWYA 3IP9A 3KBBA 5FCDA 3WMGA 1SMKA 1F0NA 1YIAA 1SN7A 2HLPA 5DO9A 1U9ZA 3GBVA 5IM5A 2DKOA 1A95A 3NAQA 5DWVA 3NW9A 2WZDA 4HQKA 4EI8A 4X90A 4MKFA 4MQBA 2DLDA 5J5CA 1M7HA 5I45A 4WGGA 3QVVA 4E51A 2A5JA 2A1TS 4J07A 1VHJA 3HB0A 1X9GA 4ZVPA 5HS6A 4Q9NA 3JW8A 3S68A 3TJMA 4XM1A 3U3MA 3ZOZA 5AVRA 4Q18A 3V2GA 3KZVA 4MW4A 1ZRHA 3KYDB 3GA7A 3PJEA 1PR4A 1YTUA 5DBGA 3U4GA 3VH3A 5K6AC 5EJ4A 3IHLA 2ZJYA 4CYMA 3RG8A 1V5FA 3H2HA 4TZ0A 3P4XA 1OV4A 2D0IA 2YYSA 1TQ2A 4QLOA 4IDNA 4JXKA 4E5DA 5IYZB 2DQ4A 1HT0A 3NEJA 1E9BA 2BEWA 3G8AA 4M1OA 1M6EX 1QHYA 5J47A 1I36A 3Q8XB 2YDXA 4QELA 2FCRA 1R6UA 2XNCA 2Z9CA 3TWOA 1CUGA 1ZC3A 1ZK4A 3CRQA 3R5FA 1NXOA 2H1HA 1EI9A 3EEYA 2DAPA 3FMOB 2R4TA 3DPIA 2ZB2A 1DOZA 4P7FA 4YN3A 2V0CA 1FDRA 1EG7A 1MW9X 1I7NA 1UBSB 1UPAA 4W1SA 3GLQA 3I1FA 3GQBA 5LZ4A 2G1AA 2KJQA 4PQRA 3SYLA 4D45A 5AHWA 5DIZA 3S8YA 4BN0A 4U6QA 2HLDA 1EUQA 2OBLA 3LVQE 1E9DA 4QDTA 3QX3A 1Z6TA 1JAHA 1BEUB 3FNQA 1KA9H 5JCXA 4E21A 5AIAA 1YB6A 1A27A 3LHIA 4DJJA 2YJGA 1ISHA 2EKPA 3C85A 1VL8A 1U0LA 1ZZEA 4KO4S 3SBEA 5JAUA 3AUFA 2CVPA 2NQTA 4OHYA 1H2RS 2DQKA 4QL3A 4FFOA 4QSHA 4QEKA 5FOTA 3TVYA 2DTDA 3BQMB 3M7IA 1W8DA 4IM7A 1JZQA 2ZJ1A 4R05A 2WWIA 3UJCA 4DABA 4IOMA 1YGYA 5J1TB 4Z4QA 1GTRA 4JKIA 4A0FA 3DEIA 4H3HB 3BJMA 4PGHA 3ZX5A 2JBWA 2YC4C 5JLJA 3SIXA 4ZEMA 4O5AA 2IZ6A 2WU8A 5EE5B 5FQNA 3WL5A 3KBOA 4YP0A 3KEGA 3RARA 2PAFA 3RFFA 3HEBA 1TVCA 2VBIA 3THXB 4JBGA 2QYTA 1E9RA 5AVOA 1NM5A 2IOHA 4Z4GA 2QNRA 4AUEA 2R7KA 1EE2A 3ZD6A 3Q0EA 3W8DA 1IY1A 2NTVA 4BNVA 3HY4A 2GEJA 4M9XA 5JD3A 1MJGM 3JVUA 3W4KA 2EF1A 2FXIA 3VZBA 2G5CA 1H2EA 1JDJA 2WSYB 5I48A 4MA0A 4GWLA 2PUHA 4X66B 2ACEA 1WZUA 4URYR 3VKUA 3WG9A 2XGOA 1P1KA 1ZUNA 3NS7A 4FHZA 4Q1BA 4FZJA 4TV8F 3T9EA 4J90A 4BTEA 4CCWA 5I01A 1XVTA 1ZHOA 1A9OA 4FMDF 1EGQA 3U40A 5BN3B 3QOWA 5CCBA 2BPOA 3PXBA 3U81A 3PGKA 1UDCA 4GEKA 3TMYA 4F4JA 1ZR2A 4EY4A 2PKEA 1EAMA 4G0YA 4Q12A 1PKEA 2CLDX 1E1RD 4FUTA 4J49A 4RKFA 4G5SA 2QTLA 4DNXA 4Q3AA 4M6WB 1F0YA 1E1CB 3HU3A 5KVVA 2G0NA 4GAEA 4NKRA 4IYJA 4NBUA 3RR2A 1Z07A 4HT3B 3WGYA 5HILA 3SSOA 4F06A 4FWTA 4F11A 3DCNA 1RABA 1TVKA 1P1RA 3R7BA 4BNGA 2MINA 1X39A 3LQYA 1KAHA 2GZ3A 4IHJF 5G3YA 5IAKA 3F90A 1YRBA 5SICE 5F7XA 4H6PA 2J41A 5B36A 3K09A 3E15A 2O2JA 3UT5A 2BOVA 1NJ5A 4DY4A 5C53B 1TAHA 2ZRMA 4PPFA 2UZ3A 4Y2HA 1ISIA 2WT9A 3C4JA 1GYQA 1Z0JA 5DN6A 5H83A 3COJA 2A9RA 2LGJA 3B6ZA 3OICA 1NT2A 3F47A 4R9RA 1OPRA 1LBHA 4JITA 3MTBA 5KYXA 3TIXB 4FW9A 5SYMA 4F4HA 1TYDE 2GWRA 2B0JA 1HQCA 4KRGA 1IVNA 4CL3A 1M5UA 2NW6A 5E0OA 4E3WA 3NBUA 3WGUA 1QGED 1THTA 2R5NA 3O2NA 4QJBA 5IPFA 1KO8A 2F1HA 3A4NA 1S2GA 4KQXA 5AT1A 4K9NA 2P9TA 1TEVA 4RK1A 2ZBVA 3E53A 3FCCA 2FEPA 3ZD7A 4BGIA 3LK6A 3I30X 1QHFA 4J2OA 5J3JA 1KGDA 4QJ4A 3JZDA 4FZRA 4HAYA 3RJZA 1JXMA 1MENA 2CMGA 3PPIA 4GNKA 4J0DA 1VPEA 1SG0A 3M3PA 3NEYA 3FN4A 3HSYA 3BD9A 2NU8A 4OCZA 5ICGA 3VKGA 1QGAA 1TQHA 2R6R1 3HN7A 2PX3A 3GROA 2HIMA 5EE1A 2QQ0A 4HNGA 1SG9A 3L7MA 5AVJA 4BATA 3ZI0A 1K75A 1W34A 2XUHA 2XOEA 2R96A 4G0PA 3FW1A 1K5HA 3QFTA 1MG0A 5JFGA 4AL4A 3BGWA 3HCFA 1O94A 4IDBA 1C8LA 1Q16A 4KXFB 3V4RA 4OY3A 2IP2A 4RQTA 1OIXA 4TQAA 1OT3A 3P9QA 3JQ8B 4CLRA 5BUQA 3SOZA 2V7QD 4Q4JB 2XMZA 1I3MA 1JKIA 4ESEA 2O5CA 3CNLA 3I37X 1BOFA 1DEKA 1YHZA 3CJQA 3PENA 1ADGA 5SY6A 3THRA 5NLLA 2ZSFA 4FLMA 3ECCA 3UCEA 3ZNOA 4C30A 4N0DA 5CURA 1UMCA 2YYAA 3GRPA 3KSAC 2PGJA 5JAZA 1X15A 3Q2KA 2D1FA 5HIMA 3JZIA 1WB4A 3G2HA 3AX6A 3Q6IA 4Q01A 3KZKA 3O4JA 4G5YA 4LOLA 1M3SA 2OB2A 1MHPA 1PWHA 3G7SA 3LOQA 1KETA 1QH1B 5GV8A 4WN3A 3VQTA 1AM4D 2BM9A 4F1WA 5I7HA 4CM1A 1Z36A 4BBZA 3WLAA 2J0SA 3WQSB 5LJIA 1OTHA 3H5IA 3HBNA 1XXLA 1YA8A 4Q3CA 1JBEA 2B35A 5BQ5A 3TIFA 5JZMA 4UDOA 3NHUA 3O2QB 4UM7A 3GZ4A 1H5QA 1X70A 1UPCA 4FKZA 2PA3A 4GOMD 4RCYA 1QIIA 2OGTA 4PQFA 1CTQA 1RQ2A 2FPOA 2JHFA 4GKKB 2FZ5A 4BGDA 2W6PA 1U7TA 4Y2TA 1V16A 4RSMA 4EELA 1VE6A 1W2HA 3DFKA 1KMQA 3CVUA 1J2YA 4IDHA 3I9NA 4BQSA 4M9QA 3NEAA 4KPGA 3L4BC 5DTQA 3NBAA 4Y9UA 4EP1A 1CEYA 3O82A 5CRIA 2FSGA 1AH2A 1GDTA 4TVSA 1GA4A 4H35A 3WL4A 2VF5X 5EVCA 1Z68A 1SUPA 2UVDA 4RH0A 3DFFA 3IP7A 4RESA 2WFZA 4TL6A 3CZ5A 1P1IA 2DPMA 1YJQA 2CBXA 1UXOA 3EY9A 4GLFA 2CFTA 4FFPA 5AVKA 5A5DA 2OYCA 1WA5A 1N5DA 2BEJA 2VJAA 4IW3B 4KHZA 1ZESA 4UU8A 4E5MA 5LLSA 2H16A 4ME6A 4DSAA 1RI2A 4HDRA 2HO5A 1ACJA 4HMQA 4YRRA 2R5WA 2PD3A 1WPXA 2GEDA 1A8IA 3BMCA 4JI7B 4XIFA 1SZDA 1XP5A 4OI4A 4LSZA 2VH1A 4J0FA 2H07A 3C3CA 3ZW9A 2HT1A 3BE6A 3PA8A 5KYKA 5TGTA 1JSLA 3HBFA 5CX1B 4A8JA 4BBAA 4B73A 4C20A 2O7SA 3OJXA 3NKVA 2HUPA 1SRQA 4JL8A 1E2IA 2XMQA 4OO3A 2RE8A 5HIKA 3ZJTA 5GONB 4NFYA 4I8XA 2ATVA 2XNDD 3WL7A 3CO0S 5BQXA 4ZJUA 4WLUA 2BEVA 1E3JA 2DYKA 3P0RA 1T15A 3KQSA 1FFDA 3PE6A 4NOLA 1BXRA 2L69A 3H13A 3QVGB 1L6IA 4J1SA 4P38A 4WCFA 4DA9A 2IP4A 1L7OA 4PLVA 2EL7A 1QRUA 4JCCA 1KI6B 2FSUA 1JQ3A 3INTA 5HVNA 3HCRA 3AKDA 1QX3A 4M60A 3BRSA 4RY2A 2JI7A 1JDSA 2ET6A 3CRZA 3PHIA 3RG2A 3BWVA 2B4TO 1QQ6A 4EJFA 1WV0A 4P3OA 2J33A 3WLIA 1YQDA 1UJMA 2NU7A 5CW1A 5HUJA 2RHWA 5DNUA 5KYYA 3LF1A 3KE9A 4QUHA 5KQLA 3NAGA 2JFPA 5EMNA 4ZCSA 5HKAA 1WMDA 2Z9BA 5K99A 4GZ3A 2G67A 4FKBA 2W0MA 3WBKA 3PTAA 5JHGB 4UBMA 1ZLYA 2HF7A 3ETJA 3EVCA 3HYTA 3LPLA 1L5MA 3OECA 4JT2A 4NMXB 4TYPA 2IYZA 2B9EA 1VSQA 5AI0A 4J2TA 1YMUA 3A1SA 2N9UA 2VYVA 4ZQHA 1W46A 1Q12A 3MQ2A 1Y6GA 3P0EA 3FHJA 3K9CA 1N8TA 4FK8A 3E9ZA 2WW8A 2Q2VA 5E6UA 3WDSA 5L6MB 3PEYA 1CG6A 1NVUQ 1S89A 1ZNQO 2XNHA 3DKVA 5I6DA 3FGZA 4ZVTA 3WNCA 3PKJA 1U99A 2CNOA 3M1LA 2KS6A 5AXCA 2J7PD 3H4MA 1IDOA 2VC2B 3VPXA 5EIBD 2BVNA 3FROA 3MCWA 3PWKA 4RO0A 5EUMA 1H9BA 5FTNA 3UV3A 4L16A 4UHFA 4L4YA 4I9FA 4NK4A 5G0TA 4V1CI 1QONA 3WAJA 3X1KA 3TSCA 2YXPX 1JBQA 4F97A 3O03A 1RWMA 6YASA 1UMBB 1IQRA 4JLUA 1PJ8A 4LYEA 3ZWDA 2CCKA 1PBNA 3RSOA 3AUTA 4MTLA 3SBDA 5L51A 2ORED 3FF1A 3RHFA 4HLCA 3AFHA 1KIAA 2Z2ZA 2D5BA 5ABPA 3Q40A 2WA2A 5E9WA 4KLRA 5IK2A 4Z0PA 5HWSA 1HFEL 1V11B 4TTTS 4QVKA 3RW9A 2B92A 3P0FA 4MWGA 5E2AA 2G5PA 4MKGA 4V3CA 1SHJA 2W4QA 3OX4A 2CDRA 2V7TA 4INPA 4FFDA 4X8HA 5EJ7A 3A6HA 3BRWD 1Y4AE 1EM8A 4XEHA 3O1LA 2WSIA 4JBIA 5HQ3B 3GA5A 2IHTA 1ICEA 3PB3A 4MA4A 1JDTA 1YMQA 4L07A 1WS6A 5ILQA 2QBYB 4BXOB 4S1NA 1V5EA 3B70A 1DZ3A 1EFCA 1GZ6A 3VUEA 3GJ8A 1QG6A 3L7JA 4EYGA 1H85A 2GGSA 1YQUA 4D9HA 1JL3A 4M9RA 1UKBA 1T9GS 4C01A 1ZHFA 3V1TC 2YNMC 3JVEA 4DIDA 1DPGA 4ZXFA 2FPXA 1B41A 1A9SA 5CPFA 2O8NA 3ENZA 3EPPA 3EZFA 1TK2A 3HQ4O 4AMYA 1EWRA 2RI6A 3K5PA 1JTVA 3K53A 1R16A 4MWZA 1JA9A 1M72A 1NX6A 3ZQUA 3TW4A 5JDIA 5BW4A 1CEXA 1RWNA 1PJ2A 1HDIA 4H7FA 2W8ZA 3WGMA 2X8AA 2AZMA 1PGNA 3QXSA 1A97A 2OCIA 3EXIA 3DA8A 2SKEA 3OBBA 1KZHA 2DWQA 3S5UA 2IS6A 3AMVA 2ZBFA 1JKXA 3JR7A 3RV3A 4NBKA 1CRLA 5B6IA 5JCPA 1LSJA 1UK7A 1G3IA 4MKZA 3M4XA 4FHGA 2FW0A 3TD9A 3H84A 3WWCA 3OU7A 1E9FA 2R65A 3AKCA 1QK3A 4RA9B 4B3CA 1ZD1A 3DAGA 4KW7A 5BOVA 4WBNA 5CEFA 4H7KA 1XJWA 4OK3A 2DFLA 2PX5A 2YWHA 3P9KA 1HBJA 3H8WA 1K9VF 3F3KA 1EVQA 1XDBA 3RS9A 2CLKB 4GR5A 3WGKA 3HNRA 3JAWB 3U4AA 3T5AA 3GLGA 3CPEA 3AJ8A 3A32A 4QDZA 2HJHA 1EXMA 5KNBH 1QP4A 1F2DA 3AB3A 3LCUA 4BMDA 5I7RA 4RSHA 3TNYA 4E6PA 1X1EA 2GM4A 4Y0NA 5JC1A 1XQYA 3QPVA 5FL7A 1EUCA 1JAYA 5IH7A 1A5TA 2R25B 3R09A 1TXGA 4C7XA 3G5TA 3UT6A 4H18A 4HNAA 3VHXA 4AMZA 3ID6C 1XAHA 2FI1A 4QYMA 2H4YA 4KO3S 3EPLA 5JSQA 4X61A 4PV7A 2ZP1A 3Q8WA 4WNYA 1T29A 3FPSA 3RS2A 2UUOA 3G2JA 4WL0A 1XKLA 2FA9A 2C57A 4US1R 1W36C 4E07A 1ECFA 4S35A 2WIFA 1PAUA 2ATXA 2B36A 1KY5A 2WD7A 1EX6A 5E7MA 4LJRA 1U4SA 4FX2A 1E61A 4HO1X 2IYRA 4I66A 4PLCA 4X6UA 3WR5A 4MPTA 1V5IA 2AXQA 3TG8A 1VHTA 1X8XA 5A2QA 3A70A 2WOOA 4CGZA 1WJGA 1X2BA 1W1UA 2HBZA 2V6BA 4DYVA 3EAQA 1AUVA 2B2NA 2H2FA 2YJ6A 1P61B 3WIBA 1ONSA 3V5NA 3UMRA 3D3WB 4ASUD 4KIWA 2BFEB 3SX0A 3UJ7A 2IELA 1YOBA 4GGOA 5FLKA 4YT2A 1KHHA 2FJUA 5HF5A 4WKNA 4RK7A 3KKKA 3NDJA 5G4KB 1O6ZA 4KTVE 2D5CA 5BV2P 3BIWA 4DADA 5A9RA 5KCMA 1U3WA 4KWIA 1U7OA 1EFKA 3IEIA 3IC5A 3ZZMA 4KX3A 1S2MA 2W8BA 5ALUA 3TZ6A 3DE1X 1NJ2A 5ERGB 3TTUA 3O8RA 3JQPA 5KTKA 4X84A 5HMMA 1TA0A 2O23A 1GZUA 3LNCA 4V24A 3T7EA 4LYGA 1ADFA 2YIVX 5M7EA 1R4NA 2WQ6A 2GPAA 4RVOA 4TZ6A 3WFIA 1Q44A 1TGYA 3OZVA 3EC1A 4UHJA 2VHYA 1G21B 3AY0A 3NQ41 1J0XO 5CA1F 2B2XA 2IDJA 2NTJA 3QELA 1B8VA 2OAEA 3RF7A 3QA3E 4DCUA 4DLRA 5FH9A 1QP7A 3EGEA 1DAGA 3VR3A 3A3NA 2HGZA 1WRBA 1U2RA 2JIQA 2PGIA 5CCDA 1PZNA 4HC4A 3PFFA 1HMPA 1O95C 4B6OA 3LC0A 3FNFA 5AKGA 5F7JA 1D09A 2H1WA 1UC9A 3DD1A 4TS1A 4B79A 4Z51A 2XXAB 3HC7A 2TS1A 3E58A 3MNFA 2VVTA 4FIZA 4LZOA 3B6MA 4R9UC 4C7OB 1FSPA 5CFLA 4XD7D 2QYSA 5HOEA 1EK2A 1YCGA 2XWQA 2XHEA 4TL9A 4J16C 2H4XA 4NJMB 3KYBA 2HA7A 2B4RO 2NVOA 1B15A 2XCSB 2EATA 2XUFA 2IWHA 1WSBA 4FGZA 1OFIA 1YOVB 5D7BA 3L06A 3REGA 1EFHA 2POQX 2Z95A 2FHSA 3EQ8A 3GJYA 2DM6A 1KMCA 4XKJA 3MRXA 4OKSA 5EMMA 2KPOA 3O9MA 2M6RA 1PYGA 1O03A 1E6KA 3R6WA 4DQ0A 1B16A 1KAGA 2EEPA 2JLBA 5ED4A 2G83A 2E18A 4QNMA 1LJ8A 4JEMA 4HNVA 5E6SB 5MF6A 2JATA 4HYYA 4O4JB 4ZAYA 4JIGA 3RVKA 3HVRA 4ETIA 1NTRA 4KFSA 1B3RA 2XUZA 2V7UA 2NZUG 1BX0A 1VMEA 5KNDA 3NP9A 5HBGA 4DQVA 3FNBA 3DNFA 5LIPA 4QULA 3WQQA 4Z0HO 1OH5A 4H7HA 2VWHA 1PR3A 2Z3VA 3JVIA 2R9VA 3JYNA 2C4MA 2VF4X 3U1BA 1R37A 4D4KA 3DL2A 2K2QB 2BDUA 1Q7BA 3O8QB 3DM5A 3VPAA 4D74A 5TPWB 3DVSX 3FBGA 3BF7A 2DPXA 1K7FB 5AHOA 5GADl 1BQ3A 1AN9A 4BKUA 2C97A 4IICA 1U3GA 1JEOA 5L3QB 2A86A 5D3MB 5F12A 3H6GA 3F7OA 3I8OA 1LPBB 4RIGA 1GN8A 1TYAE 2JDIA 3ZY2A 2DWPA 3LVFO 4P58A 4BFWA 1GOTA 4LF6B 1JHOA 3TBFA 3VKVA 1YNOA 3QIAA 1XBTA 4PYNA 4U00A 1JEAA 1W48A 4GMDA 4O3MA 1EUDA 1FZQA 4A8PA 2HJWA 2P9YA 3I52A 5CXQA 1KOJA 4B46A 1ABEA 2JFQA 1Z56C 1WXGA 4ZT2A 1Z0DA 4KGVA 4EY8A 2UYQA 5HYVA 2F8SA 2XVXA 1XA0A 1YCDA 3R3VA 3ZWCA 1H3EA 4HRXA 4JLSA 1T8TA 4HAIA 1P7ZA 1Y4UA 2HMVA 3UAOA 2O8BA 1NQWA 4R8RA 3TZQA 4XCQA 3DEKA 4ARZB 4HPJB 2P8SA 3N5KA 1M1NB 1OVGA 2YIMA 3FY4A 1PK9A 3EXG2 3KQWA 4LYFA 1L4HA 4A2WA 1S0UA 3ITEA 3OQOA 4LDQA 2CEKA 2ENUA 1A9TA 3FB4A 5BNIA 2A0WA 3I2JA 1CHNA 5FFNA 4JI8B 1SXHA 4V0LA 1ZZGA 3HDHA 4N5MA 4W8OA 3FGOA 4BNYA 4LYDA 4B5KA 5A7FA 2E0IA 1A96A 1JSXA 4LDZA 3VOAA 1GL6A 3FZYA 4RD1A 3D0RA 3NPAA 1HC7A 2O3RA 3H8VA 1XNHA 2O3SA 3MXTA 3E18A 2FVXA 4GP6A 5F5NA 2IYYA 4ZKDA 3G5MA 3ICPA 1IK4A 1OYOA 3LX6A 1V1RB 3NBYC 2JPDA 3P0IA 4IQFA 1UBJS 2DPLA 4LZWA 4ALMA 4BUZA 3CNBA 2HBRA 3G8CA 3CLHA 2F55A 4U6NA 5LBTA 3HI6A 2P5UA 2W2QA 2QU8A 3UW3A 5H9VA 5JMTA 4QVIA 5EJ6A 3GLIA 3E9NA 1IXSB 1P3Y1 1CQIA 1FYWA 2OORA 3QI2A 1THZA 3DKRA 4PX9A 3GFPA 5A7GA 3ZE7A 5L4SA 1JHYA 2FHPA 2I2CA 3CG4A 3W6ZA 1MNQA 4PBRA 3RCBA 3ESBA 1NUUA 1F2UA 1KZGB 5CT5A 5AUNB 2ECQA 1AQIA 2XF2A 1JR3D 2EL9A 1CHDA 2AEEA 4OJMX 5EIXA 2NSHA 1U5BB 4EAAA 1W44A 2BI8A 3GRAA 4XR9A 2GVZC 4JI3B 4KXYA 4TMYA 2Q49A 5AVTA 1TFRA 2GKSA 3OC6A 2IX9A 1RJFA 4AYWA 4II7A 1DWQA 3PCXA 5A5FA 2PKWA 4J4TA 2WDPA 1TLLA 5JBIA 3E35A 4ZAXA 4ALIA 3KETA 4A0HA 3HJBA 3W5DA 4G1FA 3BWEA 5TLSA 1MHTA 2X2PA 2JAWA 1E8NA 1JFFB 1ZA1A 3KD3A 5C8DA 5IKXA 3V4PB 3H42B 2E4UA 4XVRA 5GJBA 1G20A 2Q6KA 1VJRA 1HEYA 2WD8A 1ULAA 4IOJA 3P27A 5IMSA 1ZGAA 1GSOA 1TT5A 2QZZA 1QUEA 2ZSBA 3BXFA 3E7WA 3DLCA 3EXEB 3OE1A 3TSOA 2W6JA 1NN0A 2ZI9A 1SVLA 1EVIA 4KU4A 1YB7A 2FN7A 4MS4A 1AY0A 3KYJB 1Q14A 3PEVA 3R0QA 4RD4A 5J2TF 5TT1A 3MJFA 2Y99A 4F2WA 4F9EA 1OX5A 2AI1A 3MTJA 4ZT3A 3WA6A 2FQQA 1UL1X 2PXXA 2IYVA 2VHJA 1TU4A 1ZOOA 3RFVA 3AVWA 4QAQA 1Z2AA 2P41A 4RD3A 1ZLXA 2VWGA 3GEDA 4GEGA 1VYUA 3UJHA 2QD5A 4HLDA 3AJDA 4Y6SA 2VZ8A 1VP9A 2BMVA 3HACA 5BP7A 3CCCA 4AKGA 4NK5A 4OYRA 3M4JA 2I33A 4BAZA 3QX9A 3WIEA 2GN1A 5H7XA 1ZPDA 2HXYA 1Y6FA 4MGKR 2NPFA 4O2BA 3U48A 1QU3A 1YB4A 2BBSA 3CLUD 3U62A 4MW2A 2E3JA 2IF2A 4BAGA 3Q10A 4Z7NB 4KXXA 3KTOA 4UUAA 2NYVA 5BV0A 1TRKA 4PIMA 5K20A 4HNRA 4B6SA 1R8YA 4K3UA 3H5AA 3F5SA 4QFBA 5HRCA 4PAOA 1YHYA 3FHOA 2I3GA 3EQ2A 3U3OA 4ZC1A 2PL3A 4ID3A 4BIIA 3QFSA 4DDKA 2X4DA 4MRSA 3IQWA 5B53A 2C8JA 4OTZA 2ZRCA 1Z2CA 3B2NA 2NU9B 1U8UA 3JWEA 1BA2A 4G1CA 4GUAA 3W9BA 4CDNA 5FPPA 4DV5B 5JU6A 2WKSA 3RC3A 4PAQA 3OZIA 1LTQA 3GLHE 4LF9B 3IEXA 1MT3A 1OBHA 4LRWA 5EXSA 4COOA 2V7BA 3K96A 1MB4A 3A1DA 4ER7A 2FJPA 4WJZA 4QUDA 4L08A 1DRJA 2W48A 2EZ9A 3RUPA 3JU3A 1WD7A 3RTCA 3ZKAA 1WDKA 5FPSA 3AERA 4KK3A 1VE9A 2G3YA 1Q1GA 4WKOA 5JYCA 1GCIA 5L4NA 4I9UA 4QRIA 4F6CA 1DKNA 1GN9A 4P7GA 4GMGA 4L2IA 1CDZA 1BO6A 2H5JA 2GAOA 3UAZA 4AZ0A 4ZCQA 3R9WA 2VRCD 1SC3A 3BSSA 4YV0A 2G1UA 1RPJA 1T9KA 2P62A 1XLTA 3AETB 2AOVA 2QGFA 3OOJA 4P2BA 4ZI2A 2FN4A 2X7JA 3AXTA 4HGNA 4WK0B 2DX7A 3RE1A 2Q3DA 4MR7A 5A03A 4F04A 2QV7A 1TB4A 3I2KA 1GGEA 4Q19A 3T06B 4AS2A 3TF5A 4HXYA 1NA5A 2BUCA 2DHEA 2PIDA 2WJVA 1JECA 1MVNA 3UMMA 2AKEA 2DHCA 1RMQA 4MVXA 2B82A 5HKOA 3X44A 3KHUA 4BNNA 3NHPA 4I1IA 3FTDA 1J42A 3KXKA 4AXXA 3K70C 3W8EA 4KXUA 4O4IF 1RWOA 3HNPA 5CH8A 4C6SA 2NU6B 1H5NA 4NJEB 2OYRA 3TLJA 2GNPA 2E4YA 3BXHA 3FSEA 4C4ZA 2HPZA 4F45A 1XMOB 4I81A 4DTIA 1KNXA 1EVZA 3JV7A 3OE4A 3P32A 5K6RA 4HDOB 4HN4B 2FZGA 3NETA 2HGSA 5C81A 1F14A 3QX7A 2A0XA 5LQSA 1LNZA 3F73A 3DZKA 2IS4A 2W11A 4JP5A 2V3CC 4KNYA 5K4AA 2QU7A 4E1BA 3OQ6A 3OZ7A 1BH6A 3A37A 3DEHA 3IKMB 1XAJA 4BMZA 4E5VA 1JEDA 1QFJA 4JFAA 4RZHA 1OBFO 3A1CA 4DLBA 3H5OA 4YP6A 3FUWA 3D1JA 5FNVA 3RUDA 1VIAA 4N40A 4ZODA 4EPRA 5FOXA 3TPZA 3GW8A 3IKVA 1MX9A 1MNAA 1KL7A 2OKCA 3TJZA 2AS0A 2D1SA 4P36A 4URVR 1RAEA 4N3GA 2AK3A 1NW4A 4RADA 3MUEA 4IGIA 5DHRA 3U7FB 3NJ4A 1RE1A 2AJDA 2GFIA 4M1ZA 4QBKA 1OJLA 4CF7A 1WVGA 4C9BA 4JWTA 4MO2A 1P5JA 1JB9A 4YWJA 2H2WA 2VFAA 2PWBA 2PGXA 3OOYA 4J6FA 4GI7A 4HGQA 4MWEA 2VQFB 2A8YA 4P53A 4LGVA 2J9YB 1I1HA 1K63A 1S8NA 1RM0A 1X86B 2BE9A 2BGJA 3JQ9C 3L6UA 2DC1A 3PFIA 1SH7A 4IRUB 1A8SA 2A5GA 2BEWB 4ND6A 1UBRS 4Z8YA 4RMJA 5AKEA 1Z5WA 4Q5IA 1N6OA 3AFMA 3G2NA 4OX9B 4I4IA 4QQ8A 3ASZA 2ICAA 3GFSA 3KXLA 2GK6A 2E6KA 2QN1A 4KXWA 3CWQA 4OATA 1XD2A 2VCYA 3GQBB 4H27A 3PYXA 4TPKA 3UKOA 2CLMB 2OP0A 2B5OA 1MB2A 4IIBA 3AV0B 3TRIA 3LCJA 1FFWA 3HXLA 4E0BA 1OI7A 2HA4A 4KJXA 5BUCA 1VG1A 2FSSA 3OIYA 3NHYA 3OZDA 3MTIA 4AJNA 4EZBA 4K9LA 2L82A 4DV4B 4BLQA 5TVKA 4D42A 4ZT7A 1G38A 2CXOA 4KAJA 4RSGA 2WP0A 4M1QA 5EIFA 1VXOA 1J9EA 3SZUA 5DK6A 4II2A 1EX1A 2SCUA 1PQWA 3H1GA 4U2BA 2WB4A 1G98A 5G53C 3OZAA 1RXSA 3FPAA 2B83A 1OGJA 1I3OA 1NP7A 2X1HA 3PNPA 4Z9FA 4CM4A 5EIEA 3W5BA 1GVHA 1UAYA 1UDXA 4HFNA 4BS9A 3ISTA 4EJSB 5K0CA 5LQAA 3ZW8A 1SBTA 3WWYA 3DW3X 3E9EA 4YXWD 3RRFA 3SGLA 3IUBA 4ZFNA 4O63O 4EA8A 3CVWA 1P2VA 4QTUB 3D6AA 3PNBA 1JHXA 4IQ0A 3C4VA 4GLLA 4NDAA 3QXHA 2V7XA 3GRRA 3O47A 5C7IO 5FOVA 2QIOA 3CS3A 2C9ZA 2YWFA 1Z6ZA 3HUUA 3D7SA 2Y0BA 4WJKB 5FB3A 4Z2YA 4F1JA 5IK2D 5LIRA 1CYEA 1TM1E 7YASA 1N4AA 5IFLA 3E3MA 4BNIA 2G28A 2MSCB 1SHLA 3K7EA 4JB3A 3N05A 4ZEXA 1VL0A 4QQNA 1WXFA 3X1DA 1ZUNB 3P45A 4GRAA 2Y77A 4XRGA 5JD4A 1COZA 2DWCA 1U1FA 3H9EO 1OV6A 5F1OA 4DDMA 5I7UA 3ZE9A 2CYCA 1FBNA 3KKNA 4NZZA 3RS7A 5EQDA 3EUEA 4JKYA 3WWEA 4GRDA 1Q1BA 5EJMA 3U44A 2P0AA 3P52A 4OJNA 1X19A 2EKLA 1LJLA 2HJVA 3DMRA 5FR2A 5EHNA 3K0AA 4NMWA 3GPCA 5MGBA 2YMMA 3ENNA 3FWPA 2QIPA 3KYCA 2EIXA 2A59A 4ZU6X 3F97A 3LRXA 1L8XA 2ATCA 1XK6A 4X93A 4Q21A 5JDCC 3L7AA 1TVKB 3UC5A 2R751 1QLWA 2MINB 5IKOA 5JD6A 3KZCA 2BCEA 2EGGA 1SPBS 1V6CA 4OIMA 4KYVA 4TKMA 4W5TA 1G6Q1 5TNXA 3VBCA 3KE8A 4PGFA 2GX6A 3RANA 1F38A 1XALA 3F4LA 2K87A 3UT5B 1PSZA 1U5AA 2PL5A 4O4JF 4R2MA 5FAXA 4B4VA 1WPGA 1H22A 3M34A 3EZ6A 3BMQA 5JFOA 1S4MA 3OWOA 5TMEA 1EU1A 7REQA 5KYXB 3T1OA 4BQRA 4G01B 4MXDA 2GKOA 2G9VA 4B9EA 1TCUA 2QI9C 4BX2A 1NFQA 1Y1LA 3LM8A 3STVA 5IASA 1SBNE 1C0KA 3WO0A 1T25A 4YJ3A 1E9VA 2Y1LA 3D8HA 4ERNA 4OM8A 1F60A 2XIQA 1AS2A 2BEUB 5IS2A 5LWQA 3LQ1A 2ZZKA 1RW4A 3SF8A 1BMFD 1JHUA 1HI9A 4E70A 4R6XA 3VPFA 3RSSA 1U3FA 2DHRA 4H60A 2I7CA 4WLNA 2P35A 4RZIA 2CYBA 2Z6QA 2ZCJA 5DX0A 2XOXA 3D1VA 3TW6A 1IZ7A 3G17A 2IJGX 1SKBA 1RMYA 4B44A 1RWWA 2HLHA 1MX5A 2P7IA 4JJ8A 1JBKA 5C4MA 2TRSB 3GRVA 4JQZA 4R2LA 4KPFC 1TC1A 1Y42X 2ZJZA 1ENZA 2EKDA 2A6PA 4L50A 2AFIE 1EM6A 3OKFA 2JFXA 1FJHA 5HKLA 4EFDA 4FYIA 5I9SA 4RNCA 5E4YA 5BYKA 1QYIA 3EFOB 3AM5A 2NUPA 4BEBA 4CLRB 1VHDA 4W7IA 2OCYC 3AVOA 4BAUA 4WDRA 2AN4A 3GJSA 5JNVA 1M34E 2W2XA 2WF6A 3P2EA 3FWYA 5T64A 2XRYA 5CVVA 5K3OA 2XUIA 1UMCB 4NYMQ 4U7WA 5C5DA 1V7ZA 1JT9A 5CJ2A 3I09A 4IJMA 5B3JA 1WCWA 4BVGA 1YF3A 2VP3A 4BWYA 2J7KA 4HS9A 3ROEA 1F8GA 2WYHA 3QKSB 1J24A 4HDNA 4LWOA 1L5YA 3RBAA 5BWMA 2W58A 4B71A 4C0HA 3NIBA 3KQMA 3TE7A 2D0OB 2G0AA 4GOXA 1LDMA 1Y1TA 3HVUA 5BWNA 4KRFA 1U6IA 2L17A 3ETNA 2WEKA 3PHGA 4UNSA 2CUTA 1P9OA 1VLHA 1ESMA 3IERA 1KO1A 4HWGA 4KQ1A 3F7TA 3LFTA 2NV2B 4MQLA 1JHZA 1AK1A 4Q7KA 4LJ5A 1JXQA 3L7DA 3NCHA 3ANSA 2AQHA 4DIMA 2AW5A 4B6EA 1V16B 1FSSA 3FUVA 3KRTA 4EQZA 3KLPX 3R76A 2QQGA 3B51X 3TFWA 4L5BA 2ZS9A 5BYBA 4K3VA 4C5AA 4HDSA 5DXJA 4IGAA 2BSAA 2NN3C 4LPSA 3T3NA 1P44A 1XV5A 5TS3A 3WKCA 1N6LA 2XYGA 2GCEA 3E3NA 1JQEA 3O4IA 3V4OA 5I8PA 3I45A 3WV4A 2J9XB 4EBFA 3PC8C 2PR2A 1EMDA 3H18A 4FP9A 3IIMA 4CM6A 2C7BA 5K01A 4JEIA 4ZCPA 4DTCA 2E1PA 3JS5A 1MVOA 4CEJB 3V7FA 4UZEA 4L9WA 5KPDA 4RL4A 1G5TA 1SBZA 2P9GA 2Q9BA 2Q6TA 3MMXA 1F4LA 1GT6A 4XB6B 4AJLA 3MJTA 4NYMR 2Z2KA 5CR9A 2QDXA 3BMCB 5KVSA 2UZ1A 1OZHA 1ZA2A 4R2WA 5K8TA 2ZZNA 1V2HE 3HV2A 2REQA 4FYHA 3WLHA 1VSVA 4EY3A 3LGXA 4LGYA 3NCTA 1CDEA 3F6PA 4A8JB 1XX6A 1N4DA 2Q4EA 2ZG6A 1LH0A 3FTNA 4KMOA 3A11A 4XIIA 1NRIA 1XRSB 3QF7A 3PQEA 3QGMA 2I6TA 1ZUD1 1GCGA 5FX2A 3ZV3A 3QF4B 1USGA 1Z3IX 1CR6A 2Y68A 4WZAB 2QZSA 5EMJA 2ZLBA 2HSEA 4KPYA 2LBPA 5DMHA 4OJYA 3N3BC 2BEVB 4OOEA 5FKJA 4U3JA 3HCNA 4MB2A 5M04A 5ARBA 1E94E 2ORVA 4MWCA 1BXRB 2VNKA 5K1ZA 4M8SA 1Z15A 1IC6A 1YRLA 1Z5PA 4Q9HA 4DA6A 4ZD6A 2AD1A 3NIGB 5J5VA 3CGWA 5C51B 5KNDD 2I55A 2PPLA 3KQTA 2WPNA 3OCJA 1AUXA 1RWVA 3B53X 1T1EA 1P0QA 3BREA 5DBIA 5ETJA 5A3SA 5I7VA 4OXXA 1ZNWA 4IKPA 1R0ZA 4R4JA 2NZYA 4RGQA 3U60B 3RVNA 1G41A 1YDHA 2JF0A 1DC8A 4B74A 1UWVA 4X7RA 3MGKA 2R68A 2NU7B 4KV9A 1TPZA 3S28A 2H2AA 1DG3A 2YJ3A 4A6DA 1PI3A 1A98A 1XTIA 3STXA 3C24A 1H94A 1J56A 1G17A 1L5SA 4JQOA 5KYYB 1UZLA 1XLVA 2O06A 4ZYXA 2BBOA 1QNLA 4O25A 1PLKA 3L0BA 3MMNA 1N8KA 2Q6VA 1EXWA 3GDGA 4IMIB 3P4YA 4XQ9A 3U9LA 3VRHA 4AS3A 4W1RA 1XJ5A 1Y4DE 5BR1A 4U7PB 4CM9D 2NIPA 4TLLB 2JIOA 5IDXA 3VPHA 3DBLA 3T7JA 3VZSA 3TOCA 1XHEA 1QTIA 4UJ5A 1O2DA 1WW8A 3IDSA 1OUMA 3GGDA 4Y8VA 3EVBA 4MVWA 3P19A 1OOEA 1HO3A 2V65A 1X94A 2VBCA 1N92A 1D1PA 2PKYX 2VHXA 1ESNA 2J0EA 3N6VA 4PIVA 3WP1B 4EI2A 5EP4A 1M1XB 2B0CA 2NNLD 1CT9A 4I4TA 4YY3B 3FFTA 5CGQB 1MT0A 1YTLA 4WLVA 1CJTC 3ZYZA 3ON5A 2XTMA 3BMNB 3OO0A 5E6UB 3R7DA 3TTSA 4BU1A 1CRZA 5JS8A 2VDWA 1WW3A 2PRZA 2FLVA 4GMKA 1BJRE 4LY0A 3A6ZA 3ICEA 1EB9A 2RGYA 3LRPA 3NB0A 3M3DA 3WJ2A 1M66A 5THQA 1D04A 1WQ1R 5MN6A 3GI1A 4PG7A 2ZUTA 3MD0A 2J30A 2ZUVA 3L49A 4P0QB 3IAM6 2ZR0A 1GA6A 1QRSA 2EC5A 4OFXA 4N0EA 1JDUA 3RI3A 4DBVO 5DTIA 4RJTA 1DQPA 2I29A 1WTAA 2KX7A 3IUJA 4JWKA 3A7DA 5K09A 4S12A 4UBIA 4OHRA 3G5UA 4I55F 4LY3A 1GU0A 1AMNA 4TLAA 4V03A 3LQ4A 4MDHA 3RTGA 2UUCB 4M1KA 3V7WA 3SPXA 1D1SA 1TF5A 2RBEA 2N47A 5F7ZA 1I6WA 2WB2A 4QOGA 3B20A 4ZGGA 5CITA 5JUWA 3VDNB 3JYLA 2HZ7A 3I32A 4K2AA 4MRMA 2GETA 2R8RA 4AK9A 1WBJB 2AFRA 3MWJA 3QBTA 2W43A 3S70A 3E82A 5IARA 5AM3A 2CDCA 1ORWA 1EM8B 2ODPA 2QTVA 4COKA 4DWJA 4F9FA 1G1MA 2B1JA 4ZJZA 1AA6A 4YK7A 1KEUA 5FJIA 3RAPR 3M6UA 2VUUA 5DWQA 5JI3E 3GLFA 5JSUA 4PAWA 4GS5A 1WQ4A 1Z8DA 3A7EA 1YS6A 2YY7A 1LI4A 1M33A 3LQQA 3KVNA 3VJMA 4C06A 5IBRA 3A9WA 4C07A 1PTJA 3BH0A 1PFGA 1MQ8B 3WWPA 1V43A 3S8MA 3KLMX 3TLEA 1SUIA 2A35A 4DUGD 1SVUA 3V42A 1P1BA 3C74A 1GEEA 3BB3A 4GICA 5E4JA 3UN1A 3M3HA 4TRNA 1MJHA 2H0QA 5B2EA 1Y8AA 1KJNA 5ELLA 3ZLBA 5H82A 1JG7A 4R2JA 2V7PA 4G1VA 4JR2A 3EARA 3AFIA 3EXIB 5CW2A 2BISA 4LZPA 2DY1A 2HRBA 2QPOA 3FRIA 3IQXA 3LLVA 2IH4A 1J49A 3AR7A 5H5JA 3UQZA 1G5PA 2AF4C 3KLNA 2BSQA 4MIEA 1WL8A 4DV3B 2FW8A 3ROXA 3HEMA 3WZMA 4AJEA 1MCZA 1KC3A 1KJWA 2BI7A 2IVZA 1FUYB 5TARA 4X0EA 3QG5A 1SNYA 4WBNB 1OW3B 2HX1A 2Q4BA 1R0KA 2ORWA 5IJAA 4Q7MB 1H3FA 2OAGA 5DHTA 2D62A 1ZD5A 4Q7LA 3TLGA 3VPSA 3JR3A 3OC0A 4Y3UA 4JT4A 4RV9A 1I2DA 4J91A 1Y4SA 3GQVA 1RWPA 4KO2S 4MEAA 5B37A 4C7MA 5LDDC 5JPIA 2JA2A 3GA0A 4U0JA 3GLGB 3LTEA 4B35A 1ECBA 2BUBA 2DJ5A 3H1PA 3LZDA 4EARA 1DUVG 3HL0A 4ETMA 1BEZA 4L5IA 2BR5A 2ZATA 4TWAA 4Z5XA 2XE6A 3HN6A 4BYMA 4JU9A 1ENPA 1EUCB 2LZ0A 2YKGA 2WU0A 5GM2A 3GCWA 1PZFA 2GLUA 3HRHA 3OTIA 1QRTA 4HNAB 2HAEA 4YLYA 3VHXB 2M6LA 2XVAA 3ZXIA 1C14A 4HZUB 4CMGA 5BMOA 4AG6A 2QORA 4QG3A 1Z0UA 3L8MA 1X1BA 3UY4A 4K6GA 4QJ5A 1WMSA 2JIMA 2WD7B 2J6BA 2X4IA 2Y4OA 3CUKA 4Y1EA 1C8VB 2I6XA 3GT4A 2PLFA 1ZCAA 4FOTA 3T52A 1VQ1A 1OLSA 1SO8A 4C3ZA 1W8IA 4BKQA 2C9BA 2EZ4A 5LZ9A 1VKNA 1LW7A 3PUHA 4ARCA 3FAKA 3GBPA 1XCGB 3NATA 4NOMA 4LNUA 1U80A 5F52A 5JXIA 2XMGA 4PPYA 4LGCA 1MAHA 3I5MA 3JAMA 2V9CA 3ONFA 4JR0A 3VNUA 3N8DA 5ER6A 4DN6A 1NBIA 1XEAA 3NONA 1RNLA 1CNFA 5EIWA 1C9KA 1NSYA 3A36A 4ZV9A 5J9FA 4EWLA 3ZJVA 3I58A 1PLJA 2EQBA 3A1TA 3C87A 1PLLA 1M2FA 1KI9A 1W7AA 4G5QA 1S9HA 3JWGA 1EBFA 4XJTA 3I0NA 7ADHA 3S2UA 3QYFA 1YJXA 4XSVA 1NVXQ 3CXUA 4NPAA 1E6MA 4Q4HA 2C42A 2Y1XA 2NO9A 1AB5A 1I2MA 3QLVA 2QWXA 1L7QA 1Q0HA 1R4NB 1ZM4A 1FPMA 3A9VA 3CEMA 5A02A 2OP1A 3K31A 1DLIA 2ZBGA 4E5KA 1PUJA 4LV5B 3ELUA 5KCZA 4UBKA 4D6PA 5HKBA 1OLUA 1U02A 2WM9B 3TI9A 1T8RA 1KH3A 2FEAA 1AKMA 2G70A 1VLZA 1D8TA 4YS6A 1JHQA 4BX3A 4F86A 4WY5A 2VDUE 1X7XA 1PGQA 1T1RA 1VB5A 1C1XB 4G56A 3RT7A 3E3AA 4LMPA 1SUWA 4H31A 5EHGA 1ZJZA 1YFKA 3O92A 2GVNA 4CKZA 4C88A 1IEQA 1N9KA 1UJ6A 2CWDA 1OY1A 3GFRA 4XVHA 1J5PA 1U7WA 1L7NA 3AR2A 4JI5B 2IDZA 1GSIA 1PT5A 1OF1A 2V0NA 3CX6A 1ZEMA 1NMEA 4N3NA 4P7BA 3HP7A 1NDUA 4M1MA 3T1TA 1OAOC 2O2YA 3SFTA 3HLYA 2AZ4A 2B2CA 3D4LA 1LPPA 2HWXA 1Z34A 3I92A 3UOWA 1RBMA 3FXAA 1T0IA 4NOJA 4BE7B 2P67A 3W7AA 1VIVA 3GLUA 3TNLA 3AGPA 1CDDA 4HY3A 1H2AS 3MPUA 2V9PA 3AU8A 3CB2A 2XQJA 3I3SR 4QT0A 4TTIA 5JWRA 4HG2A 1UANA 2WHRA 2PKCA 1RAAA 2HCBA 3QE0A 4Q34A 5CFQA 4BFSA 1N5LA 3AUJB 3R6DA 3AOEC 2VCEA 5DBOA 4AMBA 2WKRA 2WAAA 4ZTUB 1FRFS 2MSDB 3MJEA 3O83A 1OA0A 2VSXA 1NATA 1YE8A 4HFRA 4NULA 2ZAGA 2F9FA 3F67A 3Q9UA 4OHPA 1FRVA 2AX4A 2V59A 4B9AA 5KKNB 1PJCA 4EB6A 1HRDA 5C8YA 4ML3A 4JA2A 1T2EA 5E9QA 2OR3A 1PJBA 2NUAA 2D1RA 3I72A 3NOXA 4YMHA 5HPYB 3WGHA 2CXXA 4XX0A 2B3TA 3EGXA 2NWQA 5DNEA 5GZ6A 3G9UA 1JG6A 4NJOA 5KWEA 2XKKA 2H1OA 3EIFA 1GGHA 4WAUA 3NJ8A 4XW2A 4OK6A 2WWHA 3EG9A 1I7PA 1U7ZA 2PBFA 2PZBA 3KDPA 3OQHA 5FTLA 4QFDA 3RTAA 4EFLA 4JHXA 4EAQA 4KACA 3BM5A 3K73O 4HH0A 4A6EA 5AHRA 4D4GA 3H5NA 3KU1A 3K0SA 3KT3A 5CLLA 3A6JA 1BXZA 4ILKA 4JJ4A 3R75A 2P9HA 3HZZA 5KQMA 2ZVJA 3QPCA 2I4RA 1TYBE 4P54A 1PJTA 2O07A 3W78A 4RHEA 2GEVA 2H8KA 1BD3A 1EUDB 1KY2A 1QORA 3DFUA 5NULA 1MOPA 1HL7A 1NV8A 4DQLA 1NASA 2Y2UA 3IQEA 3AM3A 3QMMA 4L0MA 5KO2A 5DCWA 3EBPA 4DHEA 2D2XA 3WLRA 3NM4A 3R5TA 4LRXA 1NG9A 2XECA 4R8VA 3P5SA 1Q3TA 1XROA 3GRFA 2O8BB 1JJBA 2QN7A 1FJGB 3KEMA 1RVDA 2IIPA 1V1JA 4K6OA 2GERA 2UDPA 2QTBA 2XR1A 4LA4A 4R8KA 4C2BA 2QJRA 3PXEA 4D02A 1EGVB 1C3LA 1XU9A 4IXMA 2CHQA 4LX8A 1MH9A 1JKFA 5ILOA 3HWWA 3U4MA 3MT7A 3R0IA 5H81A 4E4TA 2WJ3A 1NYLA 1U9IA 2RHOA 1AKWA 4G8BA 3OWXA 4D41A 1ODLA 1B1CA 2IXBA 1HFKA 5ILGA 4GPBA 5IF9A 2XSZA 1QH8A 1AT1A 2OLJA 2Z3ZA 1FDSA 1E32A 3OMLA 4GKBA 4AN4A 5GMOA 4G0WA 2UKDA 1LBIA 2Z9DA 3W9YA 1K6EA 2Q9CA 2HJGA 3GFBA 2JJ1A 4FBGA 2VSFA 1FFBA 1YZKA 3ZDZB 3A25A 1Q74A 1NXWA 2ZTVA 4OXKA 4MUMA 5DOZA 3RYFA 2LW7A 4ND4A 5ESWA 4IEIA 3RRMA 4CG3A 1O6BA 4ZZIA 2IPNA 2ZRAA 1SG6A 4Q9AA 1NPDA 2J3LA 1N32B 1G2QA 3F5DA 3FKSA 1GT91 3LUFA 5CNIA 4XSGA 5DYWA 5F2NA 1QZXA 2BKUA 2ZRPA 3G9ZA 4HNQA 3IP1A 1RRCA 3Q1KA 4OIFA 1FQKA 5JECA 3GLIB 1KJIA 1CQIB 2C2GA 3ZWMA 1VI2A 2D4HA 5LZ5A 1HYQA 2W6IA 3PGJA 3X0DA 5LDHA 2VP6A 2C5HA 3CWCA 4HEA6 1NW3A 1W85A 2F17A 2GMWA 1F2UB 1TTPB 3B36A 4AC9A 1QUFA 2PUFA 2AXNA 2NO0A 4WHMA 4K9PA 3ZX4A 2PCJA 3EN0A 1FMLA 2OXFA 2CLHB 2YCBA 4URWR 4WK6A 3K6KA 2YWEA 1I9GA 3I1YA 4R16A 2J31A 2CMFA 2VZ0A 2UYCA 5FTWA 5KTMA 1CEQA 4UVGA 4B8WA 1V7QA 2VP0A 3SQNA 2DH6A 1SCNE 2C2HA 4NY1A 1HQKA 1U1IA 2QRHA 5IVHA 3IHKA 2PN1A 1Q2UA 4PC7A 1R8JA 2Z09A 3HB4X 2WAXA 3KKMA 3MA0A 4NABA 5TJHA 4OMCA 4M86A 4QU0A 4ZAVA 2FZ4A 5CA0F 3D8UA 3B1VA 4BX8A 2OD7A 4M38A 4V2IA 3F6CA 1JPJA 3AFOA 4QOHA 4RELA 1G20B 4BC1A 4E5NA 1R0LA 1W1IA 2XQIA 2IC5A 3FVWA 2VRNA 4IXDA 2C7GA 1M73E 1VDMA 3EULA 4ITVA 5EZQA 1HQYE 2WLTA 2O9JA 4CTNA 1VRVA 4MS4B 5A05A 3U7QA 4JJFA 3QHQA 1RAFA 2QUAA 1IE3A 3WIVA 4RZSA 3ESDA 3BGDA 1LSSA 3ILXA 1R6XA 3E8MA 1JFVA 1O58A 3IPLA 4G67A 3USCS 3W5AA 3RFXA 2PX8A 4BGEA 3GFVA 3RAJA 2F1KA 3SM9A 1EUZA 3KAPA 5K4GA 2DCUA 4XJVA 1ZJ6A 1GZ5A 1OKKA 1VIDA 4CKEA 4LC0A 3RNOA 3VGJA 3LBHA 1ZIYA 3ZDFA 4GZ5A 4F2HA 5JZOA 1OD6A 2ZSKA 2IVFA 5JS2A 4IVPA 3OI7A 1LFAA 3K8ZA 5AICA 3FSRA 3IMFA 4O2BB 4ZCTA 2AL7A 2QUIA 5DSXA 3GJQA 1N3IA 1W52X 1ECGA 5ICFA 3R3HA 1OI4A 4QYWA 1Q0LA 3KTAB 4P92A 3MSXA 4I3HA 2VPXA 2VHVA 3RKUA 2OFOA 1JQAA 2G0TA 2Z98A 3UJ3X 1D2HA 2GN4A 1G19A 5KTRA 3RRZA 4QNNA 3JD3A 5JXGA 5DRTA 2BHNA 1JJFA 4QA9A 5BQOA 3GEHA 2VJMA 2WUVA 2X0NA 2GA9A 4R9SA 2C2WA 1DMSA 1DG9A 1EFPA 2ZT8A 5HTKA 4BFVA 1BFDA 1W73A 2MSKA 4BNMA 3FFBA 2JGJA 2C7OA 1A72A 1HY3A 4A10A 4MW5A 3D2AA 4TQ9A 1A7AA 1A8PA 1J21A 3I39X 2HSDA 3O4VA 4KSYA 4U2GA 7AT1A 3TOZA 2Q5QA 1I51A 4AP5A 1G21E 5TSDA 1EEXB 4KKVA 3O21A 3OIDA 3R1IA 2XHZA 4NNPA 4J3NA 1BH2A 3AERB 3CKYA 1Y9AA 1GL7A 3TGLA 1U5CA 4GL4A 5LL6P 1LA2A 2I5PO 2GYUA 3QHAA 3DLBA 1TAQA 2XB2A 2J5RA 1ONBA 4L2IB 4AZ0B 3SEFA 4D8XA 2YHBA 2YXNA 2ZIXB 3U19A 1NVVQ 3N87A 4XFDA 5AQ1A 2OM6A 2PGOA 3Q7RA 1V3TA 1G3QA 5DT2A 5JRZA 3PUZA 1ZK3A 2J9GA 4Y9SA 4ZEOA 1J22A 1E1QD 2P2CA 2R1VA 2GYVA 2WJWA 4AMGA 2NAPA 1L4GA 1ODKA 4MR7B 1A5ZA 1VFPA 1D9ZA 1L7MA 2BFPA 4K26A 1MDBA 2PJZA 1ZD2P 5T8KA 4D0GA 3U09A 2CUNA 3UB4A 2E1RA 3LK7A 4B3SB 4LECA 3ROQA 4MUGA 2LUOA 3K0KA 4E08A 3MGGA 3JALA 1TQ6A 5IBCA 1GUYA 3WOHA 4O2RA 2BHRA 4FDMA 4TV9F 3KKQA 3CSUA 2IP1A 1K7EB 2EBUA 2WHPA 3UFXA 4JYBA 3K6JA 1IZ8A 3NHJA 4RETA 3FSGD 1Y7LA 4FS3A 5KAPA 1BKYA 1BN6A 4R2XA 3AWDA 3C14C 3EIUA 1LK5A 3NIFB 3VR6A 2P9ZA 4MPPA 4OX9Y 4TTVA 4I4CA 3LWZA 2BV3A 3G7NA 2J4CA 4E13A 5EUQB 1P72A 3ES9A 2EG9A 3A1EA 4R8LA 3N2IA 3FR8A 4DCGA 1Z28A 2CSUA 3IP8A 3NPMA 3RK1A 1W5AA 1BXGA 3UJNA 1OJ7A 4RIEA 4ADSG 2TECE 3GDFA 5EJ8A 4E32A 3DYBA 3G2PA 1E6EA 4KRXA 1JI0A 4FNGA 4HX2A 2A9VA 5KUTA 1O6GA 1L3BA 3LOUA 4DZRA 4ZZ0A 5FNVB 3WYCA 3O91A 4UCXA 2ZYWX 5FR1A 4M87A 4UU0A 4C0LA 3HXMA 3CUWA 2X5XA 3ND5A 1G4HA 1CVRA 2WFLA 3O9ZA 4BN5A 1MF7A 1UK9A 3G02A 4X1OA 4BGVA 3HWX1 4WMLA 1XD9A 2GESA 3OPQA 3RBVA 3K35A 4IMPA 4WBNF 1LLFA 2IHVA 4QC2A 1J4AA 2NVBA 2RC5A 1AIPA 4AZTA 2V7GA 3ELBA 2IZZA 2FF5A 5I5EA 4JXXA 4FFNA 3U3ZA 4R3WA 2XPCA 3L8DA 4G0ZA 1RKXA 5BRNA 1ABBA 3G0OA 5DTMA 2NSLA 2QSZA 4D9BA 4CUZA 1BCRB 1T43A 2A33A 3BGSA 3RYCA 1H0RA 4F72A 1TCCA 3G8YA 3RBZA 2CVZA 1J5XA 2VXYA 3M1IA 1ZISA 5C3UA 1EJBA 1L5KA 1MA3A 1B14A 5MGNA 3HJNA 3AHCA 1B0UA 2B5WA 2I3DA 2XDQA 3D6MA 1JKMA 3O3NB 5GTDA 2JBAA 1TO6A 1BWRA 1WB6A 3IVMA 4MJ3A 3ZLJA 5HJ2A 2GAIA 1I5EA 1SHTX 1Z0SA 1R0YA 1FPQA 2R7NA 2RGDA 4LJ7A 4OHVA 4XDZA 4F84A 1NWCA 2QK4A 3WADA 3A4MA 1TMGE 2GO1A 3LYAA 4HNSA 1ECPA 3CKKA 3ZQKA 1Z45A 2XGMA 4PX3A 3KOUA 1T3LA 1TJ3A 3OESA 3K9HA 1XD2B 1XVVA 1L1RA 1MR3F 4FZ3A 4KKXB 3F3SA 3UWSA 3HJUA 1P39A 1VKOA 1KO7A 5BT8A 3H1FA 4NV1A 2VJYA 3MJ4A 1FFXA 3Q3EA 3S2ZA 4KSBA 2H9YA 3ABSB 1KORA 3SFZA 4URFA 3DBOB 1EYZA 3IT3A 2XCRB 3DD5A 2GHQA 2I2XB 3WGNA 1EFDN 4UHBA 2A0UA 1YR2A 2GM5A 1TC2A 4DBLE 1QV6A 3CE6A 3QKUA 1BC5A 1KZ1A 3FNGA 3ZXSA 1VL1A 3LA8A 4NS4A 3UJDA 4PC3A 2WJJA 1VMIA 3THWA 1G16A 1MTZA 3E6AA 4HGRA 3SZ3A 2SCUB 1U8TA 1OYVA 1V5GA 3T94A 5EWLA 1FNNA 2N1MA 1Y7PA 2J08A 2XH8A 4R1QA 4CM4B 2FUEA 1DDIA 2AH5A 4GC5A 1FNSA 2QB5A 2X3UA 4LDPA 4MEJA 5CLFA 3S99A 1PEAA 1VDZA 1Z8FA 1HEUA 3UXHA 4UAGA 4UFOA 1YU9A 3V8QA 1G8PA 3BTVA 1JIVA 3K20A 2GCIA 3ZWNA 4ZI3A 3CLTD 1GGNA 1UBTS 3NM6B 2YZ7A 3W8RA 2PSEA 4ZEWA 3S2IA 4RFVA 4D4IA 3BGVA 4KHPB 4IXWA 1RJEA 3WNDA 1A8QA 2H7YA 5H1YA 3KB6A 2IYSA 4XYLA 2GJAA 5IUJC 1OR8A 3P20A 4B8YA 2I3AA 2IKSA 2X0IA 4TMKA 1YRAA 2Q2WA 4QATA 4LMRA 4XUEA 4INAA 1B74A 1DO0A 3DSRA 4JOBA 1IXYA 5CK5A 2IEAA 4NVRA 4WOCA 5IZCC 1A9PA 1M7GA 2ISSD 4YDHB 1PG0A 3OZFA 5AW8A 4FR2A 1AQUA 1Q5PA 1Z7BA 5CTJA 2VJOA 3DUFA 4CMCA 4DUPA 1WZ2A 1RQRA 4PC2A 5ALXA 3U44B 5T41A 2C5EA 3K9NA 1TPYA 2QN8A 4MRAA 1SY7A 3U4HA 4Z4FA 1T2NA 1MXFA 2ACKA 3DMTC 3IQIX 3QVMA 2RK3A 3K0AB 4MGIR 4WT7A 2RBKA 3WMXA 4AX4A 3FDZB 3F2VA 1P7YA 3TE6A 4C6RA 2FZWA 4R2KA 2EW8A 3KYCB 4IILA 4MJLA 4JI4B 4X71A 3Q12A 4OHWA 4KE9A 5LQUA 2RGNC 4RIHA 4UASA 2NADA 2WHYA 9LDTA 1I9CA 5DZSA 3GJRA 1G60A 2MOKA 1FMTA 4HH3C 4CF3A 3D6FA 4DT1A 4R31A 2FPPA 4G0OA 2WM3A 4G5HA 4WASA 5FORA 2HA2A 4TN5A 4KWTA 3AIMA 3SOPA 6ABPA 5KU1A 3ZU5A 1J2JA 1ZW1A 3BMQB 7REQB 1JFLA 3OSUA 3RIMA 2QMQA 1D2AA 4ZYVA 2CXNA 3V3KA 1BIFA 5I3ZA 1QO7A 4KQ6A 4PZUA 1DWPA 4UTRA 2HBYA 4MYSA 4DLLA 5HUQA 2JB9A 4B3BA 4D5GA 4QXPA 1D4ZA 2RHJA 3RSZA 2EFEB 1RI5A 2W93A 3A27A 3LKDA 2W70A 1RKQA 3AH8A 1S8OA 5JROA 1L0BA 4WWHA 1PVVA 3GAZA 5KYUA 4I50B 3L0OA 3CF4A 3E9MA 4R83A 3H4IA 4L6CA 1WHSA 3L3BA 2NZ2A 3V7UA 4FNOA 4Z1OA 5BNZA 2I6FA 1H1DA 1YDWA 2J3EA 3BEDA 5JQGF 1P6UA 2O1WA 3TQSA 2C4WA 2I9PA 3D0QA 4QTZA 8ATCA 3HU5A 1NBME 5K0JA 4PRKA 3GUCA 4AZ3A 4EL0A 1J0EA 4NHOA 4ANFA 2JEZA 4UXHA 1ZGZA 3AZPA 4E11A 5A5EA 3RSCA 2GO7A 2QVYX 4UJ3A 4OBWA 3TUIC 3VNSA 3VVCA 1PFUA 4LBYA 4YRQA 5F78A 4IF4A 5BMVB 2Q4OA 4JX9A 4HQ0A 4X63A 2XBLA 1K7SN 3THOA 2I91A 1P80A 2FZEA 2AEJA 1RBZA 4UOEA 4O4LF 2ZB3A 3HCDA 4XM2A 3UH0A 4BPBA 2H1FA 3OM0A 1MO4A 1H4VB 1KVUA 4PZ0A 3FOFC 2PKXA 4ZAFA 4A2CA 1PZHA 2AG0A 3DJFA 1T91A 4HDNB 2J59A 3LW7A 4TLBA 2RHBA 2IU0A 2O2ZA 4N7MA 3S3TA 3BBPA 3PQ4A 4MQEB 2WJGA 4BNTA 1DE0A 2IW3A 4K2HA 4A8TA 4L6IA 4ZJYA 4L5AA 3U7HB 5IUNC 4JQYA 1ZH4A 3LUKA 3ZPXA 4BIMA 4MUEA 3A9TA 3E03A 1YL6A 4R2HA 1NF9A 3EZ7A 5FPYA 2J87A 5G1OA 4NPCA 2R8OA 1DU4A 2PLAA 3AZOA 4NMLA 1MJFA 1TVMA 3HN2A 1FUIA 1LUAA 3ABRB 4TMZA 4AF7A 2LCFA 4LBVA 1EA5A 3NMUF 1PD1A 4EHJA 3A4TA 4YJGA 4ABTA 2VDOB 1AO0A 3NVAA 3T4PA 4XIGS 1QZZA 5CXSA 3VX3A 1E2EA 1RYYA 3CZPA 1Q7CA 4PZDA 3RUEA 3OX3A 4WXHA 5KNCH 3AB8A 3N2KB 3Q7PA 4L72A 4YT8A 4L02A 1DRUA 3PNSA 3PDIA 4HDSB 4X95A 1B8PA 4LYHA 3EGDA 1WIWA 4Y6GB 1K3FA 1RI4A 1JVNA 3I61A 1W0KD 2IXFA 4Q1CA 2Z57A 4NARA 1LZKA 2WTEA 5AXDA 2IZ7A 2WTNA 3R3WA 4KP7A 2VKQA 4OP3A 2W2NA 2KYRA 4CMJA 1YB1A 4F6RA 3TD6A 1DC7A 1P0MA 4QDOA 4P4UA 4P93A 3EHEA 2WHQA 2CGEA 1G8JA 2QLJA 4GKVA 5ERXA 1T9DA 2WV7A 4CL8A 3CGGA 1E98A 1SJ9A 4HDAA 4D0SA 1K4YA 1KSFX 3LY9A 3DE6X 4HGPA 1B73A 4E2XA 4O4HA 3IMEA 2UZ1B 3CA8A 4A6XA 1DOHA 2O7QA 2JLVA 4OI2A 5FUBA 2REQB 1AMOA 1SOMA 4K9KA 1T3SA 1ZJWA 2QUHA 4BNJA 1KDYA 5ULLA 1NM5C 2GJ8A 2VI5A 2ETVA 2YCLA 3ETEA 2XUKA 2ZBRA 5KQRA 3LCMA 1YCFA 3JWJA 4DCJA 1BU8A 4OLAA 3FCAA 3PFHA 1DTSA 4RXUA 3ADDA 4HWSA 1GRVA 4M0CA 4U3JB 4BV3A 3OP4A 1N2SA 5B12A 2GD1O 2FEXA 2IPAB 3IAAA 1U4NA 4HLQB 4CETA 3G0BA 4PFKA 1W25A 2B7CA 2X8BA 3QEKA 2DTEA 4GPZA 2XYVA 3BTSA 5FIUA 3SCZA 1BMDA 1IPHA 2BF4A 4JMPA 2O48X 4DM3A 4U5XA 4D3YA 3BB1A 5B58T 2Q4DA 2H0AA 2FUKA 4BJ1A 4DIKA 3O1JC 5DGDA 3OPNA 1FSGA 1S02A 4O2BF 2ZTMA 1E18A 3ZHUA 2EIHA 3MJCA 4NH0A 4Z7QB 5I8WA 2L0XA 1YZUA 1DG1G 1ZL2A 2HQBA 3N6XA 1B0PA 4KYTA 1OWPA 4HB3A 1DBRA 4L8FA 4D5EA 2P2ZA 3VBEA 3AF6A 1NJ6A 2QMOA 3VR2D 1C9DB 4OP1A 4URUR 1YBFA 3L7LA 4RVFA 4RVNA 3UGKA 5FI5A 4CR8A 1YVPA 1V8FA 1XB2A 1RYDA 2EX4A 3H99A 1GPNA 2DEUA 1G6HA 1UC4B 3QJYA 4IIGA 2QL9A 4MQ4A 5C1DA 1QK4A 1ZWLA 5HR5A 5CDTA 5LNK6 2G08A 1KYWA 2B25A 2HH9A 3KELA 1LI7A 4QEZA 3DBLB 4U9HS 1V6AA 4H15A 3K09C 4MUFA 3T12A 4Y2PA 2HNKA 2AYXA 4HMOA 1Q92A 1W93A 2R1TA 2XDAA 4X24A 1SB9A 5AW6A 4ACBA 2A0YA 2H0RA 3JVDA 4JB8A 5IMBA 1KDVA 2B1GA 4I4TB 3BTUA 5ITWA 1VPTA 4LXQA 4PX2A 1Z7EA 5TPZD 3L9XA 4PG8A 1SC9A 1ULHA 1JA0A 1K0UA 1JJ7A 1NU6A 1S3SA 2VDWB 2X13A 4LWPA 1GDDA 4Z4IA 2XEXA 4FGWA 4TWRA 5DKFA 1K8ZB 3UG7A 4ENQA 4YRKA 1IJBA 1ZL0A 3FZNA 4IV0A 1WB9A 2XD4A 1U1CA 3IV7A 4OAQA 2JD2A 3TECE 5L8VA 5BR8B 2GN9A 1JR3E 1NRJB 2XWPA 4ZGBA 3MCUA 4MB0A 1KMIY 2R8BA 4Q3BA 1BDJA 1E5QA 4D92A 3GPBA 1T0JB 5CBPA 4POOA 5K45A 3C6YA 1XIVA 2H65A 5DM70 4QXAA 4J4HA 1AS3A 3N8KA 3C7DB 3V8RA 5DGCA 2P75A 3IUPA 5LQDA 2ZANA 3V34A 4FPXA 2QL6A 3I05A 4H1HA 4TZKA 4QYSA 2V3VA 4YRBA 1NQ5A 4C1BA 4WV3A 4F2GA 3TVTA 3FKSD 3HJHA 4R98A 3ZHXA 1MN6A 4MRMB 4V0ME 5BQFA 3LPAA 2CD9A 4NFHA 3NYRA 1Y9JA 5F76A 1AO3A 3V6LA 4F38A 4GYKA 2QTVB 3JQ7A 5PGMA 1FX1A 1I3CA 1O94C 3MN1A 5HS4A 1SK8A 5EPEA 1M5TA 3IHWA 4R9VA 4ZAWA 3WNQA 2CB9A 4M21A 4LKRA 5A9TA 4BO9A 4V39A 1P1CA 2A7XA 4RK6A 4FR5A 1M6VA 3GLFB 4EHIA 2QNBA 2R6CA 2ZB4A 2GDZA 4MTCA 3SNHA 1DO8A 1KFKB 2XZPA 3V48A 1U0FA 3A8TA 5KYTA 1A2BA 1P18A 1RWXA 1MB3A 4I8DA 4P86A 2NXEA 2DQZA 4C6TA 2YVUA 5CU7A 821PA 2QA5A 5T5QA 4DHWA 2A9OA 1OI3A 1T6ZA 2PH1A 1CJVC 1U8ZA 4IDGA 2OQVA 4C4XA 4Q4LA 3GLHA 2BJVA 4TKUA 2EJCA 2Q07A 2O50A 1NF3A 3LY7A 3LXXA 1YH3A 2MMCA 1F8YA 1GGMA 1GUAA 1RYMA 2ZJOA 5TB5A 2PNJA 1BS1A 3VKFA 5FBWB 1H2ZA 1Q50A 1V6SA 4ZXPA 1T5BA 5GAJA 1WCV1 2HZBA 3TL2A 1BGXT 3WYEA 1LB1B 3QX8A 4JS0A 1D1QA 4NCHA 4BBPA 2PE5A 2PY6A 3R7NA 1H6AA 3CG0A 2V1UA 4KXVA 5GVSA 1NW8A 3UTDA 1Q1AA 2ZUBA 1IH8A 4DPKA 2JLZA 1TFUA 1IHPA 2YHUA 1FLAA 1CUJA 1G7TA 4KI0A 3WSTA 3LPNA 4XR4A 1GRQA 1SOWA 4BEJA 1GCAA 4Q7QA 2V8BA 4PSCA 2WG2A 3Q8KA 3GJTA 1QCZA 2X5NA 4O3FA 4BOYA 2IUSA 2CZGA 2VUHB 3BGOS 4RQBA 5A7HA 3P71T 1CUCA 2OOKA 4JOSA 3SQMA 3TLGB 3DT8A 4PSVA 3AR8A 4ZK6A 4OK5A 1YS9A 3IR5A 2X42A 4JB0A 3S55A 4UUMA 2VKTA 3WK8A 4XQ0A 5BW6B 1BMTA 2SKDA 3T4EA 2XVYA 2XCUA 5GGYA 5BN5A 5C80A 1Z0IA 3UCFA 4D4JA 4TL7A 1RTKA 2WM8A 4QJ3A 1P7PA 3COSA 1ZOPA 3ZJ5A 4IDAA 3FHTA 1HLGA 1GM5A 1QYCA 1CQJB 3KX2A 2GB4A 5DT9A 1CD5A 5EKSA 5EXPA 3IBCA 3GFOA 3RVPA 1EWKA 1H8HD 3NEPX 2ZJ5A 2JFWA 4JCOA 4A27A 1P1HA 4S1TA 5CVJA 4DE5A 4C4RA 3H0KA 1UT6A 2AMVA 1KARA 2Y9MB 2G25A 4S2UA 3U17A 4BVKA 2FAXA 3ADBA 2P30A 5CP8A 3UFBA 1ZGCA 5F9HA 3QOYA 2PZJA 1GPWB 2FPWA 2X14A 4AICA 3BXGA 2E4WA 2VTBA 2BGWA 1Z25A 1IOZA 3QFRA 4ICIA 4M53A 1VE3A 1OLSB 4A8JC 3PYLA 4PYIA 3SJ7A 3AJRA 2IEGA 4R51A 4UDXX 2E4ZA 2C3PA 3E1GA 4HUQA 1GPH1 2QMYA 4ZYWA 3AYZB 2ONYA 1IN5A 4FFMA 4JP3A 1ICIA 2OBXA 3QK7A 3G0IA 2UYHA 1N1GA 1AE1A 3T9DA 5KDDA 2B8WA 4DXHA 4WESA 4F7WA 2AWOA 4WCFC 1OXTA 4AKHA 3VNBA 3ND7A 4QQFA 1WXHA 3CN9A 3JD0A 4G0NA 1BX1A 5L45A 1CUHA 2H3HA 2QP4A 3SE0A 5JCJD 2VAWA 1BHJA 1H3NA 2PKRA 3PXXA 3IYLW 3E9QA 3NOQA 1NOIA 4IO0A 2HSZA 2Z5GA 5ECGC 4JASB 1PFVA 4D97A 1Q6YA 3EA5A 2FWNA 1HFWA 3OBIA 4Q4HB 3NTRA 4EPYA 2GM9A 4GO1A 1MRSA 1VMAA 3LQKA 3DMYA 2VZ9A 3OE7A 4Y1GA 3K92A 5IM4A 1QTQA 2YUIA 4YROA 3RSQA 1C0EA 1XJCA 1ZI8A 3VVMA 3U3RA 3K0HA 5GINE 3DBIA 1OLUB 1CF2O 1T3TA 4R1LA 4JBYA 2XUGA 2WTXA 2FW7A 4IRMA 2PU7A 3FNHA 4C1NA 1ML4A 1KERA 5BORA 1VLVA 3K5IA 4H7JA 4MGYR 3ZDDA 1TQDA 3FH0A 3UJ8A 4CMIA 1ZVKA 2WPDD 2X6TA 4JSRA 2JHGA 1RVV1 3NVDA 3OQMA 3D0OA 3KZOA 1ZSYA 3UHPA 2PM8A 4WZAE 2ARKA 4NE2A 4TOIA 4YAOA 4RJ2A 4YWHA 4XVQA 4BO8A 4CR7A 2NPOA 4D9GA 4QPDA 3OF2A 1E79A 1S7CA 1NP6A 4MIKA 3UPDA 3VC3A 7MDHA 1Z4QA 2E6UX 2DZDA 1OIVA 1PNTA 1V39A 3DTTA 3HLKA 4FD3A 4OYYA 3ELWA 4YVFA 1WABA 4TS3A 4UEJA 3SIWA 2R00A 2YV3A 3FVRA 2PUBA 1D6SA 1ETHA 5KSWB 3OCCA 3OT5A 5EQJB 3WJ7A 1NQAO 2YXBA 3DYVA 1ZMTA 1ISJA 1NG1A 4LDAA 4BFTA 3BH7A 3BK2A 3N74A 4FYMA 1GFSA 3T9BA 3WYGA 4RLSA 3QMVA 1NHWA 3LI2A 3NIWA 4FGLA 5BV8A 5JIBA 1GUFA 4B3FX 3ESXA 1VJ5A 5JRJA 2CUKA 3QBJA 1GZ7A 2NZVG 1I80A 4L3WA 4NONA 4PCAA 3ZUGA 4O0MA 3GRCA 4EGAA 3CPHA 3NTLA 2EZ8A 4QFCA 5SZJA 4QBGB 4TZTA 4EB6B 4YJ3F 3UATA 5C8YB 1FVXA 3TN7A 3GP3A 1YKGA 2AF3C 4AROA 1EQ2A 4B2LA 4CG1A 3OLXA 2NUAB 4IFIA 3GJZA 4XX0B 5JNRA 4KVFA 1ES9A 1HF3A 2P1ZA 3EGXB 4NF2A 5D2CA 1MAAA 2JJ2A 2MSNA 1HTWA 3WK7A 2O4CA 2Q46A 4LOAA 3EG9B 4LC1A 1KZ6A 3BIJA 2J4DA 2YOGA 3GMSA 1B8UA 3LUJA 1JHMA 4TLMB 4YAFA 3I6ZA 5DM1A 5DW0A 3RREA 4B8ZA 5M3BA 5HRUA 2TMDA 8AT1A 1M6HA 1I0IA 5JWHA 3T3MB 3AEZA 3EGWA 1CK4A 2VJQA 2KMLA 3WGIA 2VPYA 4GPIB 3BIFA 3OHMA 4BUJA 3CB4A 4U7GA 2VK4A 1MZPA 3R6TA 2AC2A 4CLXA 3WJ1A 1O5TA 3Q0TA 3K8YA 3W9UA 1CIPA 2ZK7A 5KINB 2MT9A 2V98A