3UAOA

Structure and catalytic mechanism of the vitamin b3 degradative enzyme maleamate amidohydrolase from bordetalla bronchiseptica rb50
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
199
Chain Sequence
DLGSYERQGFGAALPLKAPYGLLIVDFVNGFADPAQFGGGNIAAAIETTRTVLAAARERGWAVAHSRIVYADDDADGNIFSIKVPGMLTLKEHAPASAIVPQLAPQAGEYVVRKSTPSAFYGTMLAAWLAQRGVQTLLVAGATTSGVRASVVDAMSAGFRPLVLSDCVGDRALGPHEANLFDMRQKYAAVMTHDEALAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative isochorismatase
publication title Structure and Catalytic Mechanism of Nicotinate (Vitamin B(3)) Degradative Enzyme Maleamate Amidohydrolase from Bordetella bronchiseptica RB50.
pubmed doi rcsb
source organism Bordetella bronchiseptica
molecule tags Hydrolase
total genus 66
structure length 199
sequence length 200
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.1.107: Maleamate amidohydrolase.
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3uaoA00
3TG2A 2A67A 4WGFA 1YZVA 2FQ1A 3R2JA 1NF9A 3IRVA 3O91A 3O93A 1ILWA 3R77A 3O92A 3HB7A 3MCWA 3V8EA 2WTAA 1NF8A 3PL1A 3OQPA 1IM5A 4H17A 4L07A 3TB4A 3O94A 1NBAA 2WT9A 3HU5A 3KL2A 3O90A 1J2RA 3S2SA 2H0RA 4WH0A 1X9GA 1XN4A 1YACA 3OT4A 3TXYA 4L08A 3EEFA 3LQYA 3UAOA 2B34A
chains in the Genus database with same CATH superfamily
2H8KA 1X0XA 2JJ1D 2H1CA 3VOTA 4L0DA 4GLOA 4AJKA 3V2UA 1YR3A 2QRVA 3ZZNA 5BSFA 2ZR8A 1EWYA 4RDXA 4E21A 2ADOA 1JPNA 1LXCA 2Z1NA 2I0FA 3P71T 3A2MA 3ANMA 2JBWA 1RQLA 3ACDA 4YGXB 3W1EA 2HK8A 3GT4A 2LRHA 3LDAA 4QG3A 1IOLA 2Q2QA 1QGDA 4Y2JA 2D1YA 4B3DA 1ZGAA 4YAWA 3Q1KA 2ZTMA 3ZLBA 4BFXA 2YWGA 4J6EA 4FMCF 4CKXA 3COYA 4NECA 4PFQA 4ZVQA 3QE3A 3CMMA 1M2HA 3KEQA 5JRJA 2DLCX 1E2BA 2H7YA 4MV6A 4PXAA 5L3VA 3ZWDA 4OLHA 3IOYA 4AXXA 5L40A 3K0CA 3KJEA 4WKGA 5FI1B 5T57A 3WG9A 1MOSA 1T8RA 1O4VA 1QIGA 1WUTA 1IBLB 2J41A 2N42A 1J49A 4R83A 2PZBA 4II3A 3IE2A 1RJWA 3N59A 4K40A 5IJAA 1NPDA 1WPQA 3UTCA 3W9SA 1E7RA 3PQ7A 1ODKA 2BMJA 4DM7A 4JYBA 3BC1A 5FLEX 2NPIA 2ODPA 5BNIA 5AW0A 1RI5A 1P29A 1ZNZA 3AK4A 4JLVA 1NM5C 1SKUA 1GFZA 3CBQA 3TTSA 2D1FA 3HLYA 4G84A 3W6UA 3MAGA 1JZQA 2HYDA 2NZ8A 3AJDA 4ZJYA 2EFDB 5TGZA 5DXFA 5C4GB 1O87A 1N6IA 4MS3A 1Z0ZA 3KS9A 4TKLA 3OY7A 3H1PA 3UH1A 3NBXX 3E7XA 1Y4UA 4LZLA 1TUEA 2GHQA 3DVAA 3NYIA 4TOIA 4A9AA 4MSUA 2B2XA 3DGFC 4GKAA 1FNNA 2VT3A 1XD2A 1CC1S 2JS7A 4UEKA 2IK8A 1GAEO 4IF4A 2EYUA 1E7MA 4CNBA 1G8SA 3AB3A 2P3SA 3B8EA 2BONA 3WL7A 4P33A 4WT7A 2WG1A 1XNJA 1CIVA 1OKKD 1BS2A 4C30A 3FSRA 2GZHA 2OT3B 1PGQA 4HAUA 2XKBA 1A98A 1THMA 2I6QA 4RHFA 3R7NA 3UJPA 1AK1A 2BRUA 4ND2A 3VPAA 5AXDA 2DEUA 5CYPA 3SVZA 3I4CA 3GBVA 2C2HA 3PIRA 5CH3A 3MGKA 4H7FA 4AD8A 5JWRA 2R5FA 3COSA 3HEBA 2JIQA 1Y7HA 2YRFA 5M29A 4AJ1A 2HQBA 1N2EA 1M2JA 2YXBA 3V1TC 1EGHA 4F5YA 4BY9E 3FUXA 2WTBA 5KOIA 4W7SA 4EI2A 1FVXA 2I4MA 3WNVA 2B35A 4MNTA 3TK1A 3I1IA 3FPGA 1G8MA 1AUVA 1KEEA 3DL7A 3H86A 2WIKA 2G67A 5C5CA 1JAZA 3AXSA 1U1DA 3OY2A 3GRFA 4FSDA 2ZFUA 3RFCA 1SR8A 1JZTA 3KPUA 3SK0A 1RHJA 3D64A 3ZQ6A 4AN0A 4EATA 2G7ZA 3LUHA 4WJKB 4G81A 1OA1A 3QU4A 1KDPA 1LLFA 2FW8A 3CUTA 4Q7LA 3I37X 3BUSA 4JJFA 4DDMA 5EMNA 2VC2B 3OJXA 5C0OE 5EESA 5DWVA 3O2QB 3D81A 1D0SA 1GPMA 2OKCA 2WF9A 5GV7A 2IPAB 3HN2A 1OBFO 1E3LA 4E0BA 5ALPA 1PT7A 3I64A 1ZM2A 1ECGA 3IP1A 3SHFA 1BHO1 1KH2A 1RSZA 3PA8A 4RACA 4AO7A 5J2TB 5DXJA 3REOA 3D6HA 1R5NA 4NZNA 4KXYA 4X1OA 4KFCA 1IK6A 1CERA 3IILA 3ZWCA 3D9QX 1J9EA 1D2MA 1OGJA 1RQNA 1U3TA 2ERXA 3ENWA 1QO7A 4OHFA 5ICSA 3MHTA 2R66A 4LF9B 3S0JA 3TW8B 1Q0SA 1MBZA 3VDRA 2O5CA 2Z43A 3QW2A 1ZUNB 2AOWA 3IPCA 5A05A 3WLHA 3CX3A 1T9HA 4AJJA 1HDIA 3FKSA 4J4HA 4QXPA 1OB2A 1NLMA 4L4ZA 2MJLA 1ZGJA 3HBMA 1YZLA 1TUBB 5IJ0B 1QB8A 3FWHA 4I55A 2CMFA 1XRNA 4QJBA 4XYMA 2I6FA 2O2XA 3IOCA 4LQ4A 1XNRB 2CCJA 5D6OA 1UK9A 2W90A 3DZ8A 3RWOA 1IUOA 1Z5UA 2HV8A 2WIAA 2X0KA 3DC2A 4MS4B 1JIJA 4PSUA 1CJSA 3Q11A 4OLJA 5BYBA 2J6CA 4DLNA 4YPFA 1LDBA 1E1YA 2NQ2C 4AJPA 4C4YA 5JXJA 1E3SA 2C58A 1Y6RA 2BR4A 2X8JA 3L0OA 1GCGA 1B26A 4P34A 2L17A 3C6KA 3KOUA 4LOJA 4DNOA 1QQ5A 3B82A 4LRQA 5F7XA 3UKJA 5AK0A 4M9CA 2ZB4A 5K8JB 4CIVA 2QG4A 4LJYA 5JCJA 2HIHA 1LB1B 3KAQA 4RFSA 5BSVA 3QBDA 5TLSA 5A2GA 1W36C 1ZXXA 4GFDA 1BXGB 1KC1A 5HXAA 5C51B 1EHYA 4KMSA 4LXTA 4N6GA 1BE6A 3FGNA 1O94C 3Q0EA 4IIUA 5BVGA 2DAPA 1SCNE 1FPQA 2IOFK 4P86A 5EVJA 2QENA 4YJHB 4HQ6A 1I36A 4C87A 1NQAO 2J0VA 3H7IA 4PE5B 5DM0A 4WADA 5G3ZA 5H4HA 1YRWA 4KNYA 4GSLA 4OHBA 3FHTA 3OCJA 2ERYA 2XYHA 3FR7A 3ZY4A 2ZB8A 4IXTA 3IAM1 4DLWA 1WS6A 3QWAA 3ZKAA 2VSYA 4UPEA 2I6GA 4Y2XA 3JWPA 4EG3A 3TIVA 2PSHA 3VTAA 4CKEB 1GVHA 2OWEA 4KREA 3F6BX 1RVDA 1XN1A 2POQX 1A9ZA 1GU0A 1YB7A 1G8HA 3HKEB 4B2PA 3RVQA 4E03A 4CLHA 2CUZA 2Z8XA 3X1ZA 3S29A 4OXIA 4XUEA 4A5SA 2IX3A 3I30X 3QE2A 3EMBA 3O21A 3VYTB 1RYFA 3JWGA 1D6MA 2J0SA 3AM1A 2ZZKA 1DX4A 3SLGA 3Q7RA 1JUDA 4H0NA 5FL7D 3TDNA 4CQMD 1Y6GA 3H5IA 4MVJA 1PT6A 2RGGA 1RJDA 3HKDA 4GO1A 4ARCA 1VGQA 1XNHA 4EKNB 4Q1AA 1NFRA 2C83A 2YMQA 1BKSB 3OCUA 3QOFA 4XIGS 2Z3ZA 5ADHA 2GNAA 1M1YA 4NFYA 4Y7DA 4DXAA 4BECA 4E2YA 1KDTA 1CZRA 4U02A 5F2EA 3CXUA 5KWJA 3RS3A 3OOWA 1C81A 1D6NA 2OQ2A 2HCBA 4R05A 1HEYA 2HR1A 3GVPA 3R3YA 4LTMA 1KXJA 2AMYA 2F59A 5LYYA 1FDVA 1M5TA 2MSEB 2R62A 1L5OA 1PBNA 3H8JA 3CNEA 1TVKA 5DF1A 5HA5A 5KJ1A 4W1SA 5IKXA 2C1XA 1USUA 3AJ9A 2PH7A 4P7FA 3RC3A 4OB7A 5HBGA 3OVMA 3SF8B 4LWQA 1H1LB 1L7QA 3BX1A 3LI2A 3UGQA 2PT9A 2X4IA 1EINA 4Q16A 5TQ0A 4YMUA 3LQFA 4YMVA 1A3CA 4IUYA 4WE3A 5ESXA 3NTUA 1NHGA 5KDOA 2Q3DA 5IS2A 1EHCA 5AW2A 1NVKA 3T7KA 2HMYB 2AYXA 1JEQA 2RHBA 4LBVA 4AZ3A 1W44A 4I5FA 2DWPA 3BBPA 1R00A 2WPDD 5B7GA 3KVYA 1P2DA 4JI1B 4YCMA 4URUR 1D4OA 4EYOA 2P79A 1ZU5A 4ENPA 1O9BA 1BOFA 3EIEA 4P7BA 4L27A 1CBUA 3LCVB 1UADA 3PTZA 3RVPA 3CRMA 1J09A 1DRUA 3AYZB 4XWOA 1SXJE 2I6SA 3TRIA 4LY0A 2FSIA 4JASB 3VTZA 1WDMA 2OOSA 5CVUA 2J0QA 1XVTA 3B6IA 3OF5A 3T9CA 1M74A 2FZCA 3WC4A 5JALA 1F1JA 1KO5A 2X9LA 3DB2A 1V16B 2PKCA 2WF6A 3PNVA 5K0LA 4JBHA 4CKBB 3C3PA 3ORYA 3SR4A 1CP2A 3ZJYA 4EHLA 1NRWA 4OH1A 1FRNA 2VATA 4ZT3A 1W30A 4W1RA 4NJMA 2PUVA 1WUHS 4FOOA 2LDBA 3D8BA 1E20A 1YK1A 3O26A 2Z83A 3RYHA 3CISA 4PAGA 1ENZA 2P2LA 2O2JA 1H42A 2RI0A 3CNHA 1XCBA 2Y27A 5DGHA 2DFLA 4IV0A 5EXPA 4FDUA 4Q3KA 4RJLA 2J08A 3BTUA 4EL5A 3LNTA 4ZJPA 1VI2A 3KALA 1WMEA 1XZCA 2XMZA 3NKVA 3SEZA 3VSEA 4FNAA 2JFXA 2VSFA 3G85A 3NDRA 4BP9A 2Y1LA 4ZYUA 1SHLA 5KVSA 4CN8A 4A2PA 1FMLA 2PKXA 4QO7A 3WYEA 1IAVA 1P5ZB 2H17A 2VDOB 3HVRA 1B1CA 3QSYA 4TTRA 4R7GA 2FEWB 4KXXA 1CUCA 1M6WA 4OBEA 1K0FA 3AEKB 3Q5DA 1O6FA 1PAUA 4P32A 1JG4A 3IDAA 4R8MA 4OGFA 2VJAA 1MAUA 3NDJA 2GEKA 3GZTB 4ZXPA 4LJ9A 4F6RA 1W59A 4TUYA 4C22A 1V39A 4YMLA 3KUUA 5T6BA 4F96A 3PXAA 1EX1A 1I7QB 3U6KA 2FWPA 3JX9A 3L6CA 3UUWA 5JWHA 4RKQA 2EXXA 4MMYB 1PGOA 2C57A 3N5KA 4KR2A 3CONA 3TZKA 4QREA 1IWPB 2BGMA 3C98A 4DJAA 3KQQA 4MUKA 5FWDA 5FYQA 1Q1GA 2YUTA 4TV9A 4A3SA 1ZN7A 4D80A 3AI2A 4QHTA 1Q7EA 3QXXA 5FH9A 2V6BA 4LNAA 4QJ5A 4ZQHA 2ZSAA 4KXLA 5EZ6B 5JFGA 4GLFA 1RWQA 3PXEA 1F1BA 4MVJI 4Q3BA 1JQKA 3JQ9A 3O90A 5EWMB 1QMGA 1G1AA 4DCMA 2VAVA 2HZBA 5HQ3B 4NPHA 4ARBA 1DAFA 1V96A 4FI3C 2E5WA 4LKRA 4C0XA 3D6AA 3Q7PA 4GOLD 3DVQX 4LZPA 4MHTA 3D59A 1S8AA 3K16A 3NIDB 2H4YA 2PD6A 2R2GA 4U63A 4ZOCA 4DDUA 4FM9A 1N36B 3AG5A 4C4TA 5DYWA 4KX3A 5CBKA 3R24A 5LR6A 5JLJA 1A71A 1GT6A 1EI9A 3F3SA 4A8HA 4ZDKA 1ZVQA 2RH9B 3LOPA 1VLVA 1GQSA 2Z30A 2FSHA 4KXWA 2J9RA 4OJNA 3I23A 2PSJA 1K6MA 4RLHA 4GC5A 3GX1A 1JECA 3K9CA 4PPNA 1Y8QA 1RWOA 3FR8A 1JIUA 1ISPA 1Q11A 1EE1A 1ISSA 1EFHA 1SUIA 2V45A 1ES9A 1KQNA 3ROPA 4OK3A 4E13A 2GFHA 3RBZA 1QR6A 2JI6A 3OIDA 4KGZA 4EKDA 1S6YA 4RTMA 1IIRA 1YBAA 1Z56C 4FX5A 5J2UF 2NUAB 2BZ1A 1FXWF 4QPZA 3BQNB 1RMQA 2X5OA 4GMXA 2J31A 3K4PA 4HPJB 1GZUA 1AKWA 1NLFA 1U1EA 2G25A 2QIOA 4QOSA 4TL8A 3V8QA 3WLJA 4ER5A 5AUQA 2PGDA 2GCNA 1Z07A 1ZGGA 4WY5A 1FFEA 4KV7A 1IXZA 2QVYX 4WZAE 3IVMA 4OQPA 1W85A 3W34A 2ZPUA 3QG1A 2BFNA 3ZHRA 1PJ4A 3OCVA 4PZPA 4EVRA 1QG6A 3SZLA 2L0XA 3RRBA 1X2EA 2A2ZA 3FKQA 3SJ7A 2RD2A 3SQLA 4V0MA 4CT4B 1MOZA 5TX7A 5LBUA 5I48A 1EVQA 2Z4RA 1NI4B 4R98A 4X1YB 5B3AA 3JD4A 3ELBA 3AP1A 4ZVRA 2CVOA 5KCMA 1NT4A 4G4JA 4G0VA 4YJ2F 3LKZA 4HN4B 3HA2A 1JKFA 3IP5A 1WETA 2VKTA 1F4VA 1T15A 1M0TA 1SG0A 1T1IA 1TGYA 4LMAA 4X85A 3TEMA 2C98A 2CHQA 4ZPXA 1G21A 1UMBA 1ZC4A 4PXSA 5CDTA 1M0EA 2H08A 3I2YX 2R1ZA 1P4GA 4EVSA 3G8YA 2OFFA 2XUAA 3MOSA 4FCVA 4K9QA 3SJZA 4G1CA 2GF2A 2V3VA 3KVOA 3GEDA 1XZNA 1NI5A 2WMNB 3I04A 3U4QA 1NR1A 3AF0A 5C80A 1QV6A 1SZJG 2GBGA 3MMNA 1UFOA 3PHIA 1IXKA 4O2BB 4ZK6A 5JMWA 3Q2KA 4NMLA 4GDMA 1TB4A 1NXXA 3EULA 3R3HA 2FFRA 3ON5A 3DAYA 1U4OA 4NCJA 3HEMA 2ABWA 3MUNA 3UWMA 1V71A 3I6MA 2XIJA 3C2QA 4D5EA 1IBMB 1YIAA 1VPEA 1O5TA 1KRHA 1O8BA 1W96A 1TYAE 4L08A 1YBFA 3B85A 3Q4GA 4BUCA 3GBSA 5KOHA 3ZTYA 4GI3A 1BW9B 1K7FB 2FR8A 3OJLA 4R2IA 3ONDA 1P7VA 4JUDX 1I30A 5DMXA 3TWOA 4Z7NB 5CVTA 4PSAA 2PX2A 1E66A 4DLPA 1TFUA 4TMZA 3RAJA 3R40A 1GT91 1KSJA 4M7WA 5EGSA 1CQIB 2O52A 3NPAA 3QOWA 4WNAA 2P75A 1Z5ZA 3NKFA 3VO8A 3I62A 3V8EA 3QVUA 3RVRA 1TI7A 1XCMA 4DUYB 3RVSA 1LF0A 2O9JA 3BD8A 4LK2A 1O95C 2C5FA 4ZANA 5F73A 4DEXA 1ETHA 1T6YA 2FQWA 2CK3D 2Z8ZA 5DT9A 1DBIA 2ANCA 1J7JA 2E18A 3O74A 1N33B 2F9MA 4MQLA 1CCWA 3GFGA 1BN6A 2RGBA 3KKZA 4UNSA 4WDRA 2ZE6A 3TDMA 4Z53A 2I2CA 4MI9A 1HT1E 4IOKA 3F4KA 2VZ8A 2D2XA 1GGJA 5CPBA 3W7AA 3X1YA 4E4YA 1M0WA 1RPZA 2TYSB 4MYSA 5I8ZA 4P08A 2Z8YA 3ZVNA 5ECWA 2LUOA 1UOQA 2QUIA 4FHCA 2OCDA 1UXGA 4BB5A 2LGJA 2P67A 2ZJAA 1US8A 2Q28A 3CKKA 2O5RA 1AN0A 4HGZA 3IAHA 5F76A 2CVHA 3AF2A 4EHDA 1N7JA 1P5FA 1K2WA 2PMFA 4AL4A 1ZN9A 5AM4A 2YN4A 2O05A 3IBGA 2HB6A 4BGUA 5ALLA 1EWKA 1ADYA 4GBMA 1VA5A 4QAJA 4HDRB 4DLSA 1UQUA 1QHNA 2JGRA 3R4CA 3KOMA 4MV9A 3D2AA 5ILGA 4Q05A 1X8KA 5IVKA 2JG3A 4F4CA 2A94A 1DC7A 1EB8A 1T4GA 3MWEB 4G23A 5LU9A 3HFJA 3PC6A 5M7EA 4OATA 4BYGA 2H4WA 1EFLA 3A4MA 4LJ5A 4MS1A 4U5QA 2CCKA 4CU2A 4DMGA 1U8YA 2G08A 1PFKA 2RCYA 5BWNA 4KNWA 1ELOA 4NXMB 5T3UA 3KTAB 4MWDA 5JAIA 2IYRA 4KRXA 2Q1WA 1A5TA 4IINA 1U7DA 2CD7A 5E9QA 4WSOA 3RFXA 1N2GA 2HX1A 4AY2A 1JU9A 4S2EA 3WB2A 5B5SA 3H9BA 1V41E 1G41A 3IAS6 4OFBA 4H1UA 4UKDA 5AKYA 2XUOA 4NABA 1YVEI 3OIYA 1HMYA 5JCPA 4B2LA 4TM8A 3CIFA 4EY5A 3MGBA 4YRDA 3URKA 1V3VA 5BYKA 1NVBA 4XGKA 3DBHB 4NARA 3ZIAD 5CA0F 2VQFB 2ORYA 4BN4A 4F93B 1YS7A 4D44A 1AKMA 1YASA 5FAKA 1Z34A 4F2WA 6LDHA 4HXYA 3TR6A 2J1LA 3A1EA 1QGED 1GNPA 3AMVA 4X20A 5I8PA 1CUDA 3VYWA 3GLGA 4Q24A 1GKLA 4CFSA 1VL6A 2FE1A 1EK0A 1XRJA 3MWFA 4LN1A 4XH9B 1T4BA 1JR6A 1Z2CA 3E2IA 1VPDA 4BO6A 5HKBA 4ETNA 5FFFA 4K9LA 3ZWYA 1FFBA 1YJ8A 2MYTA 4X6LA 1NMYA 3GZNB 5TT1A 1DJPA 1LZKA 1LPMA 2V55B 5FBKA 4C6HA 1X38A 5A5FA 5AQ1A 4OX9Y 3CX6A 1XTVA 1ZN2A 3OQIA 5FNZA 2NW6A 1IH8A 1JR3E 3TMKA 1Y42X 3OQ6A 2H92A 1G18A 1S7CA 3QKSA 3QWFA 1L5NA 2GAJA 7MHTA 3Q9SA 1RU3A 3KC2A 2WF7A 5LCXA 4HAVA 1H0SA 3AKYA 3R3XA 1U5AA 2Z6UA 1XAJA 2IC5A 3E3OA 2FDRA 2Z08A 4L0CA 1R15A 3EBOA 1Q74A 5KCZA 3BD6A 5C1DA 1WV0A 1Y5LA 3E9NA 1YONA 1HSZA 3DMTA 1IOWA 4U2FA 2VJQA 3M1LA 1E9DA 1NBWB 1ZCBA 3AJAA 2WUFA 3NM6B 4LDAA 2VDQB 2LP4Y 5T7BA 4FS8A 4JY7A 4LHEA 2XJ4A 3ZXIA 3H2HA 1RYHA 3KJXA 4JK3A 5FA8A 4G85A 1I7DA 3E9MA 2QRMA 1A9PA 5C8YF 4CODB 1AQNA 3IE1A 2WABA 3GGOA 1T0BA 3K73O 3K0AB 3KQSA 4R84A 5JDCC 1C7RA 4R2WA 4A2CA 5CAEB 4LOKA 3LGXA 4DKJA 2AGVA 3QVTA 1X1RA 1JQBA 2Z95A 4XX0B 2VRNA 1MA3A 4MR8B 5BOSA 2PUBA 3VJRA 2HGZA 3E18A 1ID8A 4RZSA 1E9CA 3CH4B 1A95A 1OTYA 2C2GA 2VDMB 3ONNA 4TZTA 5JOQA 3BK1A 3LIIA 4QATA 4K9KA 1QRRA 3SYMA 3T41A 4CV2A 1PNRA 1TXGA 1VYVA 4YWJA 1C30B 1XU9A 2WF5A 4J07A 1YR6A 4NONA 5BPHA 4XOUA 4Q18A 4CF4A 4C05A 1U9YA 3H3XA 3VYUB 2P6OA 1GUDA 4MDEA 1Y37A 2JGDB 2RKOA 3S1SA 3F96A 2JBAB 3N6RA 2GEFA 4JQZA 1G9SA 5AI4A 2OCKA 2XVYA 4FYYA 4XGNA 5K0ZA 2AR0A 1VKHA 3G8AA 1WZEA 4NH4A 2GBFA 1FTNA 4L3OA 4IDDA 4LBWA 1BFUA 4NV0A 3T5DA 2RCNA 2CJFA 2V98A 2GETA 5A03A 2OXIA 2HRCA 4LSWA 4ZWNA 4PSDA 3OWHA 3G2MA 4Z4IA 1H2WA 1V9CA 2C04A 3B9RA 3U3OA 1AB5A 1RLTA 2FX3A 4TZ0A 2NTNA 5MFPA 4L2IB 3CT4A 2RHRA 3KKKA 2F64A 3QVMA 5GJBA 1KXZA 3AH8A 3J81A 1JEAA 2JHPA 2CJWB 4KTVE 4NBTA 1X1DA 2B34A 4N4AA 4AZWA 2Z2XA 3FW1A 3OWOA 4INOA 2HPZA 4JQYA 1NV8A 1RRGA 4NJEA 2V9CA 5B53A 4MV0A 1N8KA 4EYKA 1S3IA 1NDUA 1RRPA 2P4HX 2PRJA 4FILA 4R41A 2NM0A 3LUJA 1R8JA 4YQFA 4MYCA 1GOTA 3VU1A 4RULA 1NVWQ 1GQYA 3MINB 2C4WA 3AJ8A 4AO8A 1FMTA 4PZZA 1ORHA 4D96A 1UBRS 1PFQA 3K9LA 3RVBA 2XXBA 2QROA 4WZBA 2A5JA 4MP3A 1NOIA 4DA8A 1A69A 4EY6A 1PSDA 3X2SA 3K0BA 1WY7A 3D4LA 2W8BB 4UUBA 4KIUA 4BJ5A 4GSYA 4MVJM 1NW7A 4Z9YA 1J5PA 1Y4AE 1J2TA 3H7AA 4C20A 1MOPA 1T9CA 4QFBA 5KOYA 1EIWA 4IZ6A 3SGLA 2BY4A 3UA4A 2W2LD 3RT7A 3GFPA 3LY5A 4LHVA 5HP4A 1GLNA 3FHLA 4FFRA 2RONA 4FDVA 3QE0A 1U0LA 3ZCRA 4D3FA 2GILA 3V9AA 4LMPA 4BMDA 1F6DA 1ZO8A 4HB0A 2P8SA 1W93A 2D1QA 1Z17A 1EK2A 2FSVC 1HDXA 3LBAA 4LRSB 3MGGA 4K6MA 5D3MA 4C0BA 5LDHA 2FMUA 3GPDG 1DGQA 4F84A 3WISA 4Y7CA 4JLPA 1N2CA 4GPTA 4ZVPA 3TNFA 3DFKA 3SQXA 4LY3A 5JQGB 1AKTA 1U0BB 1Z8DA 2FOIA 4YVFA 3KRTA 5TJHA 2X4LA 1J00A 3L04A 5TT0A 4D2IA 3GEEA 2FN7A 2UYOA 3GQBB 3OOEA 4G9EA 4QELA 1TQDA 4IFEA 3BAFA 1NKTA 3U7GA 4UUAA 5BMVB 2QRNA 3A7DA 3I72A 1BCSA 1EX7A 3NHFA 4UE2A 4QULA 1PZHA 4W4TA 3WBBA 2NTEA 3DNMA 3R23A 1YS6A 5EWLB 3R7WB 3LA6A 3C3BA 1CS0B 2K2WA 4RF4A 5HIIA 3IAUA 4KE8A 4TSFD 4ZC8A 3WQBA 2JW5A 4ZCRA 1T2NA 3PQ6A 5KYWA 4D9EA 3UMYA 2GN9A 3PHHA 4DIFA 4DR7B 3Q3VA 1W5SA 2CWDA 3NGXA 1YKFA 3TZ6A 2W2XA 4W8OA 1NNLA 1ZS9A 3EOZA 2E5FA 3K72B 1JDBC 2I33A 2J3QA 3OQBA 5IDWA 1E1MA 2WNHA 1DAEA 1FC0A 3LWNA 2X0FA 1TM3E 4LJAA 4OHXA 5HJEA 4C4RA 3DZDA 3PJFA 1A9QA 4CI0B 4H2DA 1LBTA 2LCIA 5JCXA 1MB0A 1EJ2A 1WHTA 2FPSA 1M2VA 4XVHA 4FKZA 3GGGA 3M4ZA 1PUIA 2PPLA 3DTVB 3JSXA 1IUPA 2JGIA 3KZCA 2JA1A 2QMHA 1ZCAA 3H5RA 1E5DA 3AR6A 3U44B 3CMCO 3A06A 1QQTA 2ZIXA 4GQIA 3ZQJA 3PUYA 1OTHA 2HLNA 5AHKA 3FDZB 4GUAA 4QUIA 3LPLA 3MPUA 3U1VA 1L4BA 5BR7A 4BOYA 4FCCA 4YACA 3VNQA 2QZSA 2DR0A 2OFOA 3IAFA 2Q29A 2DUUA 2QTFA 3PE3A 4MVWA 2JD1A 1LV8A 1L5RA 1W0CA 2AR7A 4O4IB 3LX8A 3ZK9A 2F1JA 2GPTA 4D5GA 3DD5A 3DVRX 3U7JA 1C4OA 2F43B 2H4XA 2C31A 3BBLA 4IJMA 3ND8A 5CFQA 2WUVA 5J4VA 5ISMA 2G80A 1DT3A 3OU7A 1OF1A 4CM9A 3K30A 4M0FA 5IDVA 3WLKX 4NICA 5IWCA 4DC1A 2PMEA 1DT5A 2OR3A 3ZJ5A 1VJ0A 3LLUA 4MCIA 3U0BA 3M9WA 3E7FA 4RDCA 1JH9A 4JB0A 1P91A 1JDSA 5LOVF 2O06A 1VPTA 1MEJA 2C20A 1GFSA 5CM8B 2X86A 2XECA 5KYYA 1XGKA 2J3LA 1FXSA 2ET6A 2PBFA 2ZRIA 4QUJA 5DTJA 3WFIA 3MMZA 1G8KA 4X63A 1Y7PA 4DLVA 1P6XA 1JGTA 2OV6A 4M6WA 1Y7IA 1A4IA 3VZQA 5JEEA 3KR2A 2BEJA 4MLCA 3L5KA 1LJ8A 3JQFA 4LQCA 4AS3A 1LK5A 2CNOA 3PQCA 1G5QA 5FTJA 5KNBD 4MWGA 5K8IA 2B8TA 3ESDA 4PX9A 5EZ5A 5B58T 3PWZA 1LV7A 4MITA 1ONPA 4QNNA 4WXMA 3BGSA 2UZIR 1WP4A 1VE1A 4ENVA 2YN2A 1Y33E 5KYVA 2ZG6A 3QVGB 1ABEA 3O0DA 3HXTA 4MWCA 4RNCA 5LMNB 1XVAA 1ZK1A 2G9VA 3EDQA 4Y18A 5AVRA 5JDIC 2YS6A 3WTCA 4PLZA 1SWWA 3I8OA 4FE3A 2DUMA 1BO6A 4L75A 1PCXA 1CB0A 1I2ZA 3TNLA 2PY6A 3OT4A 1XMOB 3SR0A 4DLKA 3NPMA 2OG1A 1Z63A 3S2ZA 3J7TA 3SDZA 4EGAA 5K99A 3UAOA 1Z7BA 2FXIA 4M21A 4BWGA 2OGTA 3DULA 3NWJA 5A5VA 5HKKA 4JI7B 4FBGA 3U4HA 2WTEA 1WDTA 2CZGA 2GJ8A 2AG0A 2CLHB 5DM60 1NLZA 5C5EA 2XLCA 1R0CA 3FVQA 1W34A 1YZFA 4F91B 1RYNA 3UQZA 5JXHA 3TTXA 1J8QA 4G1FA 3TB4A 2ID4A 1OZGA 4NE7A 1SPBS 5F1PA 4ZEXA 3OZTA 3RASA 3RTEA 4QU5A 5A4MS 3PQEA 4LDPA 5FBHA 3ID6C 1Q7GA 3FLMA 1U0OC 4UPVA 5HHTA 4K9DA 2AUTA 4OV6B 2J3MA 3V1NA 2D06A 4H4CA 3G2LA 4Q7QA 3NJ4A 4WLUA 2ZJ7A 1Q0PA 3GJ7A 3HJFA 2Q8PA 1J56A 3BHJA 1OBOA 1LC0A 2Y71A 1FP6A 1ZOLA 1SOVA 1JHMA 5AW7A 1HTWA 4MULA 3P9XA 3VPCA 3B1FA 2EIHA 1FSFA 1CRWG 1JT9A 5BNFA 3T5PA 4X60A 1UPFA 1XVVA 1ZBQA 1JS1X 1FYFA 1PGNA 1RTKA 2F17A 3C8ZA 3CSSA 3GLQA 4R1PA 5F33A 3LRXA 3VJKA 1DMSA 1NP6A 3AL3A 4I1YA 1ULZA 3G0DA 1OD6A 1DBPA 3SD7A 5GVSA 4BMCA 5DH9A 2NT3A 4FIZA 5EC8A 5KTRA 1V2HE 1VSBA 4GPIB 4WHMA 5CP8A 1TO2E 4M0KA 1QK3A 4ECEA 4JR0A 4IJ5A 3BZWA 3C5HA 1IZ8A 5ALMA 5J2UA 2IT1A 4O4HF 1U1CA 1KI1A 3L46A 5JYDA 1FXWA 2DULA 1KEPA 1W0JA 3T3IA 1L4UA 1L5WA 2PUEA 1SUCA 2GPYA 4P7KA 1XJ5A 5LP6C 5C7IO 2RHGB 4IYJA 4CT0A 3FPEA 4DLXA 1MDBA 4G0ZA 2AG1A 2IWHA 5DNYB 1WULS 3CO0S 2YJNA 3DBOB 3R5FA 2SKDA 2ZAIA 2J4CA 2H4JA 3OM9A 1QHXA 3A7EA 4G63A 3SC4A 5L45A 1ZX1A 1N6LA 3ZLUA 4RL6A 4L8VA 4OQDA 3QLVA 4ZHQA 1C1XA 1U3WA 1X7WB 4K6GA 4KE9A 2OMEA 1EFKA 2QD1A 4FYIA 2Q0QA 3RYFA 5JJCA 2YHSA 2GZ2A 3AC0A 2GTHA 2VA8A 1VCIA 3BK7A 1TC1A 4HVLA 3DOJA 2HLHA 1Z3CA 3JQPA 3A2LA 3EVZA 4EHBA 5LA6F 4Q3DA 3PI7A 2J6HA 1PYGA 3ROMA 3NH9A 3SFTA 3AKZA 2H00A 3H5OA 3KWMA 2C5GA 1RM3A 1O58A 4HB3A 5EUMA 3I04M 1XRRA 1TEXA 3PXBA 3GW8A 1NJ5A 4DRXB 4LOIA 1P1BA 2YFHA 4YJ2A 4IIFA 3RC2A 3EC7A 4GX5A 4PGGA 4CM6A 2FW9A 3OKFA 2V3WA 3ZCUA 5AJYA 3RM3A 1W8IA 1MJGA 4E31A 3RYCA 5FXMA 1BH6A 3QYFA 4CT5A 3NWBA 3O4IA 1P4HA 3S28A 1BVRA 5GONF 1YFJA 2DTXA 4ES6A 1JE0A 1PR5A 1H8ED 4GYJA 4L02A 3WWCA 1QOQB 5T5QA 4DCOA 1QVAA 2B25A 5F77A 2H48A 2Q8NA 1ESNA 4NY1A 3MMXA 2DFNA 4QPDA 3T52A 3OUUA 1GCIA 4RVGA 4FSXA 3K05A 5L9AA 2QTRA 3A0RB 3TF5A 2PYDA 3MRTA 1N1DA 5AW9A 1M6VA 1U7ZA 3BM5A 5G4KB 3MRSA 5JSZA 2QSUA 4RNDB 4ETWA 2V0CA 1CR2A 3VKFA 3HHEA 4XD7D 2IPMA 5DN6A 1VFPA 2WPNA 1I9CA 3DDOA 3P96A 4AKHA 4TTIA 3O8LA 5EZQA 3UO8B 3SKYA 5K3EA 2RARA 1HXHA 1FFYA 4QWWA 2D0IA 1IYZA 4R31A 3W2TA 3KSBC 5T4EA 3KZMA 3HYRA 4LJKA 1QWOA 1SC4A 2OENG 3B13B 3NAMA 3RQIA 3TQOA 3D0RA 4BGIA 3QF4B 4JI2B 1SVMA 3DMFA 1QH1B 3BRWD 1VHQA 1HLPA 3EA4A 3HDHA 3Q3GE 4E5NA 4UD2A 4U7WA 5FHRA 2Z8YM 3VYRB 3ZGVA 2O8CA 1JMKC 2ICAA 2R8OA 4BFTA 1A5BB 1FW8A 3JTEA 4BDTA 1WSWA 1YIOA 4I1RA 3HU2A 1NW5A 2X0DA 2A33A 1HZZA 4AP6A 4QDJA 3CZRA 4RTNA 1U9JA 1Y7LA 2E4WA 2G1KA 1A88A 5CHYA 4IJWA 1E1RD 3FMPB 2VPWA 1RJEA 3RGGA 4CKYA 3ZV5A 2ZKIA 3RS8A 2DB3A 2JH8A 2WG0A 3RYIB 3PIDA 3KT6A 4M1YA 2YYZA 4RTOA 4JJGA 4G01B 3L0SA 3HL0A 3IUJA 3GUUA 5CMLA 1UR5A 2WIJA 3C8DA 3DJYA 1DAOA 2QTMA 2Z98A 2CF6A 2NXJA 4FFBA 3BMQB 5D00A 5K3SA 1WY5A 4A5OA 2M6RA 1UXHA 4TL7A 2DPYA 2OLJA 4PG8A 3DLHA 3NXKA 2F8MA 2HI0A 3CB4A 3ODGA 4UHKA 1CUZA 3HTXA 4HEA6 1ZH0A 2YVAA 1C9EA 5SZJA 4BMYA 5IBCA 3CB2A 3HKBB 1FPMA 4DUZB 2WSIA 5LNK6 2PX0A 1LSUA 5EZSA 4YY3B 1TIBA 3CR8A 3KT8A 4R71A 2AJTA 2JEOA 4QDXA 4DHWA 1OAKA 5C4IA 1MQ9A 1QH8B 3UWDA 3L43A 3P26A 4JNCA 2IY7A 3JRNA 4WV3A 3CEAA 4G1UC 5F21A 2ECOA 2IKQA 2LBPA 5GADl 3ZE6A 4FYPA 4U7JA 4RTJA 4AICA 4M54A 4NBVA 1YXMA 3GP3A 4H60A 1CV2A 2F00A 4IWYA 4KV9A 4MPPA 4UAGA 1GZ6A 3GAZA 4KLCA 4UE3S 2GN1A 3DMGA 3V6MA 3I6QA 2E3JA 1BZYA 1R2QA 5D7BA 3TYXA 1JR4A 5CA1B 4PRKA 4F46A 4E70A 4KZKA 1KJWA 2VYNA 3OA0A 1RBMA 3DV9A 4R68A 4M7RA 4N47A 4P81A 4AQYB 3EQ2A 5KVQA 4ZAXA 4UHDA 5DKFA 4Z2YA 5CA0A 3AUSA 1RM4A 2QI9C 2QVBA 1Y3CE 4IHKA 3I2GA 1V5WA 3NHWA 2O59A 1K8XB 3SOZA 1HYHA 4M38A 2W2TA 3BWVA 3KP1A 5BV7A 1WEHA 4F72A 3UW3A 2O7VA 2F3UA 3LQYA 5K09A 1E79A 1H4TA 3KK0A 4OHRA 4XA8A 5KU7A 1KSGA 1B0PA 4OUDB 5DCUA 5K3AA 3E7PA 5EJFA 2J5KA 2X19A 4NYMR 1GPYA 4YUZA 2YKGA 3KQHA 3L0PA 3ERCA 1MHTA 2FDXA 4H1VA 3C6MA 2C4UA 1KK1A 1WXXA 4W5HA 1CZNA 1HOTA 1FP7A 3QEMB 4WOBA 2AFIB 3WAKA 2DF8A 2PMWB 4Q5IA 4CLDA 2A9RA 1MJHA 1XPRA 1QP4A 1S0UA 4WASA 4EARA 5TVGA 4B3MB 4KUHA 1JI0A 3U3KA 3HCDA 3NHAA 1Z4PX 3MT0A 5A7FA 3DTTA 4D8TA 3GEGA 4O4LA 3T3NA 3QWHA 2GSWA 1V11B 1MD9A 4LF8B 3OLZA 4X84A 4PLVA 1MVLA 2XT6A 1DELA 2YIVX 2FSPA 5LXTB 2IRWA 4NWIA 4ZHSA 2BOVA 3L6OO 1CJVC 1TF7A 1ONSA 3KZVA 4KDCA 3SYTA 5E7QA 3I2HA 3A6KA 1L9KA 2UUBB 2QJOA 4HNUA 3TD6A 4M1EA 1YQDA 1PX0A 3FPHA 3M7IA 2ADMA 4EGFA 1KU0A 2HOQA 1S02A 3IV7A 2YASA 4U7DA 3DNPA 4LA4A 1LX6A 3ZWWA 4J0JA 1C7FA 5C8YA 2CY0A 1YMUA 5LZ2A 2GUWA 3NUQA 3GLIB 5AKGA 1N3IA 1KY5A 3IBSA 4PCLA 4RYDA 3B7GA 4N48A 2H2IA 1AQLA 2PZEA 3N8HA 3ES9A 1OW3B 4PZEA 5CEJA 4LHYA 1UQRA 4QDZA 5L53A 4QEDA 4KPEC 1KMIY 2Y0BA 5C81A 1QS0A 4B31A 1II9A 4MUMA 1U9IC 2NSHA 2VAMA 3UJ7A 1UT5A 1BX0A 3R7LA 3DD1A 3AYXB 4KDFA 1H66A 2XGJA 2QA5A 1CEXA 3LY9A 3NRCA 3OD1A 4JSTA 1EVYA 2G28A 4YJ3B 3EZ9A 2JF0A 3V33A 3RIHA 4RETA 3MEQA 3QIAA 1RZRA 2OP1A 2V59A 1I3CA 1VI5A 3H5NA 3QFCA 2ZVDA 5I4BA 5I47A 1LBEA 1IULA 3PQDA 2I22A 4L6AA 1V7CA 3TRKA 4E2WA 1GPLA 4TV8F 1OHHA 1ZJJA 4J75A 1UOOA 3BMOA 5AJWA 5JRDS 4MWEA 2Q6VA 4KYVA 4CCYA 9GPBA 5AUOB 4XSHA 5IC6A 2ECFA 5C31A 1GA4A 1P1KA 3DE6X 2P5UA 3RHSA 2I4RA 3L1KA 5BOVA 4N3BA 3B5IA 5CG2A 3H5VA 1X7YB 4DA6A 4P1ZA 4IHAA 5FBQB 4R5MA 5KNBH 2FDCA 4CEIB 3EYAA 4HAZA 1I1QB 4MRNA 3R9KA 4AYWA 5DOZA 4EY7A 4X62B 3IBYA 3K53A 1CB7A 1PHRA 1T3LA 2DWCA 1V26A 5JO9A 4B8WA 3DV0A 5KX5B 5HS4A 1JHYA 3OH8A 1HQYE 1UOEA 3K0FB 2IW1A 3SICE 2NYUA 5EJ7A 5HQJA 2FKNA 4ID3A 4BMPB 1TRKA 4IF6A 4QOHA 5BYAA 2YZNA 1VB3A 2X7HA 1JU4A 3C43A 3R0XA 1WXQA 1XWWA 4QOIA 1KJIA 3QVWA 4R16A 4YPOA 3MTBA 2P90A 3PFHA 4HVTA 2JJMA 1FUUA 2Y0DA 4LE0A 3MCAA 1PJQA 3AJRA 3USCS 1A97A 1REQB 3H9QA 4IR7A 2ZWIA 1AU9A 5DW0A 4PSVA 4ZI7B 4TMTA 1YL6A 3HEAA 3V4LA 2RDMA 2XGOA 3NGMA 5DCLA 3INNA 3L6UA 5K7SA 1PQUA 1BCRB 4R3UC 3PC3A 1NXWA 4M9XA 3M9LA 3U7RA 3VU9B 5K3FA 1GITA 4ZALA 3BZUA 3OAAA 1XOIA 3K1TA 4W1QA 2IDZA 4LGMA 4N7BA 2G04A 2PG3A 3AVPA 4QUDA 4MR9B 3VPSA 3ND6A 1K8RA 3GDHA 3DLTA 4IILA 4C0AC 3GGDA 4K8RB 4UCQA 1UC9A 1YU6A 1VL0A 2C9YA 1XPUA 2JIBA 3V7UA 4TQUS 1NVEA 3BXHA 1KEKA 5JBIA 2Q7DA 3B3FA 3VU0A 3VX3A 3VV3A 4YIKA 1ZVJA 221PA 1T3TA 3T94A 2OC9A 3W6PA 4YT8A 4EG4A 2ZB7A 3PHBE 5GVRA 3U7HB 2VO1A 4BJ3A 2XYPA 4AYTA 2IY9A 2O5VA 5DV9A 1Q6YA 1BGVA 1KZ1A 3FRIA 4YJFB 2WDZA 4LE1A 1TK9A 2Q0XA 3L07A 1K9SA 4Q9AA 1KJ9A 1Z5VA 1JHVA 3EZYA 3SSNA 1MG5A 2V7VA 4P4NA 3UB2A 4BRWA 3PKJA 3WFZA 4Q1VA 4B7ZA 4BPBA 1RQXA 1P31A 2EKPA 3ICCA 4QUKA 1SXJC 2HRQA 5CT4A 1J2RA 3TMYA 2PXAA 2G4LA 2DX7A 1CQPA 5ECGC 1TPYA 1ISRA 2IPOA 2YVUA 4LFCB 5JD4A 4TRRA 2ZITA 4YCBA 2ZUEA 3L79A 2EX1A 1NSTA 3FZQA 1A9OA 3IO3A 2W6NA 1NLUA 3BKWA 5EJEA 2P9TA 1UZUA 2F8LA 2HK7A 2OXRA 3GLHA 5B6JA 3KOZA 4TLDA 3SR3A 4W5WA 2DBQA 4FP9A 4K6HA 1OZFA 1XDZA 4KRFA 4TM7A 4NNJA 1TRHA 1ZLYA 3LPAA 2AK3A 4B73A 1VGRA 4ER0A 1JFTA 1DKLA 3GJ8A 1YJBA 2QVXX 1U7TA 2EOAA 2NO7A 2ZIUB 3BOSA 1YQQA 4F60A 3SE0A 5J63A 3CV3A 3U7QB 4D3DA 1RAHA 2P91A 4G3XA 5TQ2B 4IFIA 4Q9NA 4F9GA 3ZOKA 2CVFA 1P61B 1E1QD 1WF6A 4MUGA 3V1UA 3B6ZA 4Y30A 3BS4A 2XNDA 1Q7RA 1JJAA 4X5OA 4QBTA 3VOBA 4A6DA 1QGZA 1OCEA 4HK4A 5CNMA 4GW3A 4HNAB 1OH7A 5D87A 2BGJA 2ZR0A 1BS1A 4QTTB 2QP9X 3I92A 1S2MA 4XUCA 5IZ4A 5CEEA 3GEBA 2I80A 4JENA 1E2LA 2BJHA 3WGOA 3QHPA 1NJFA 4LF4B 3EEIA 4BO3A 3L4EA 4FOPA 1JEYB 4KQIA 4I4LA 1KYTA 3NBUA 3CZAA 4QJ4A 1ZGBA 3GVHA 1CW2B 5DMHA 3V7WA 1D2NA 3FOEC 3RRNA 3GPBA 1KIFA 3RUEA 3P2MA 3SJCA 4L8WB 1S2GA 4PONA 4JJAA 3T4XA 5A5GA 3UXHA 4JYAB 3B89A 4K7JA 2F1KA 1GLVA 5SICE 3K70B 2XV1A 4LDNA 3KL4A 4NU6A 4RY8A 5IAGA 3FNGA 2GR9A 2AL7A 3KSUA 5DWQA 4D4MA 5BV8A 1QIFA 3WGVA 1U0JA 2RHHA 5KREA 5LOVA 4YEDA 2C03A 4GKVA 4EUFA 2G83A 4HNGA 5DNEA 4E2ZA 2D5IA 1IN1A 5JSHA 1D4AA 1C4KA 2FWIA 3H11A 4GE3A 4GMDA 2V9ZA 5CCBA 4HWPA 4CG3A 4LYDA 2XE7A 1YFZA 1T35A 3F7OA 5H81A 4FFOA 4NR0A 1KVTA 2RK6A 3IB3A 1DBSA 1JKJB 4IFBA 1Z2DA 3AEUA 4DMRA 1M1YE 1YKSA 4C88A 1G1MA 1CS4C 1SOMA 2XD9A 3R5TA 1QX3A 1E79D 2UYQA 2XTMA 4J90A 4WCFB 1ZMOA 4XSGA 2Y0PA 4KN5A 3HZZA 2XLBA 4F06A 1WAMA 3KZKA 3DQPA 4GI2A 3H6HA 4I4TB 1XAGA 3FSEA 3LX6A 3G2HA 3N2NA 4IIEA 4WK2B 2E1PA 5JMTA 1V47A 1WUJS 4KWIA 4KWHA 3MS7A 3T3PB 3TTUA 3K0EA 2QVGA 5T41A 5BXYA 1B23P 1PUXA 4YDHB 1R6UA 1H0RA 2EKDA 4WK6A 4PZDA 2ZJYA 4RGYA 2PJDA 1KJYA 4FLMA 4IHQA 3WKAA 4PINA 2FRXA 3CRQA 3MB5A 5F7JA 3WBJA 2XDQB 3HDQA 4TQ9A 2PJUA 5E2BA 1O2DA 4LYGA 4HAXA 4QICA 1ZRMA 1Z4IA 2FWBA 1PO7A 1Y82A 2I6TA 5J1SB 4J2HA 4JLKA 1ZR4A 1EJBA 2OAGA 3ABSB 2F9FA 3H97A 4UMEA 4TTQA 3KL2A 5F23A 5E1OA 3LUCA 1Z0JA 4FMDF 3SJBA 3UFBA 3O1LA 2N3ZA 5EYPA 4P0QB 1DHTA 1KY2A 4KE7A 1UKAA 2AN5A 4AJHA 5A4AA 4PNEA 2JH9A 4H0CA 4UOZA 1H65A 3WL6A 3M3DA 3D7MA 5EP2A 2H1IA 2VHVA 5FTKA 5EE3A 3DSRA 3SOPA 1SQ0A 2WK1A 3W4JA 1HORA 3SMVA 5H5JA 3U17A 3BSFA 5JHGB 4QX6A 3CLSC 1MX5A 1TU0A 4HAIA 1CD5A 4RIHA 2D00A 2KS6A 1XG5A 4MIEA 1L5HB 2EX4A 2RGYA 2X9QA 3KVRA 5TMEA 4DDWA 4IGFA 1NOKA 3K09A 1PR1A 4NU5A 2FFAA 1E61A 1NF3A 3CLUD 5DYIA 2ILVA 2AT1A 2XW6A 2DY1A 4I8DA 3V6LA 2HY7A 1QHHB 3UJDA 2LCFA 5HOEA 1U7WA 1B8OA 1TJ3A 5L3SA 2RG7A 4NESA 2I8AA 4N5DA 1D7OA 1E2QA 4WOJA 1A5AB 1XZIA 1Z4QA 3G82C 2FPWA 5B2ZA 5LLSA 1JEJA 4MROA 2OBBA 3TLCA 1LVGA 3B7PA 3A6GA 4TTSA 1QRDA 1NW3A 3PGA1 3G5MA 4C08A 4GXNA 4DTCA 4ETIA 1UL1X 1NG1A 1R0WA 1PSWA 3OX3A 4KFUA 3IAAA 4UFNA 2ZU6A 3WBFA 5A4KA 5CYFA 5LP6F 2PL1A 4UAJA 1Q1EA 3EHEA 4Q3EA 3ZVMA 4BIIA 3BA6A 4O4HA 2CKMA 3ENQA 3QX7A 2ZW9A 3MCVA 1UFKA 2GLTA 3H9GA 5CH8A 3AKEA 3BL5A 3STHA 5A7HA 2YV1A 4BLUA 1R6VA 1RXWA 4H7EA 3PC2A 4QQ8A 2MU1A 4RIIA 1PUJA 3BIFA 3W8FA 4HLDA 3VR6D 3RHTA 3P0JA 2CL6X 2C9MA 4QXOA 4JWTA 1JQ3A 1LSJA 4WLEA 1GR1A 3AU9A 1MJGM 2R68A 5FPPA 2XF8A 4OLBA 1DIAA 2GERA 2VSNA 3PEFA 3PXGA 4CNQA 3IP3A 3O7MA 1E6CA 4GM0A 1PL0A 3ISVA 2V5UA 4MPRA 4OOEA 5LA6A 5JY1A 1O94D 3DHVA 4PGAA 1DKMA 2A0KA 2J0EA 3EVGA 4AKSA 1CP3A 3DO5A 2H5LA 3FWPA 5FBWB 5KQPA 4ED9A 5JPCA 3NHRA 1L7MA 2XMBA 4KVFA 5DLYA 3T7CA 4K6OA 4KRYA 5AKHA 3M4YA 4GL4A 5JU6A 3O6VA 2V1UA 2I6UA 3LT5A 4OFXA 3T1HB 4CMBA 4Z86A 3A4IA 3ITKA 1HLDA 2H63A 2GJAA 2DR2A 1FU7A 3FPBA 3BWEA 2R5NA 1DJQA 3O4GA 3MJFA 4U2DA 1RYZA 3QVLA 4OJTA 4UVEA 4HXEB 5GONA 4EG8A 1CWUA 2R8RA 1JL3A 2WJHA 2NV6A 4GLLA 1A9SA 2IYVA 4AIRA 3HXMA 3JWJA 1U2EA 1LZLA 5HOQA 4DBVO 1BJRE 5CTJA 4AJIA 1WABA 4DLTA 4P98A 5KYXB 3ZVKA 5AM5A 1JKMA 3QV2A 4JHXA 2RKBA 1ZOPA 1M8FA 2YZ7A 1K7YA 2C2MA 2LIPA 2PSSA 3FBTA 4OHMA 1PLJA 1E77A 1F8GA 1NUPA 5E2AA 1JG3A 4BWVA 4WI1A 3OQNA 3Q98A 3ZNNA 2FPMA 2IVFA 4JVLA 3USZA 1P1FA 3LP5A 2VYFA 3TQSA 1T0UA 1COWA 4OFWA 3VJMA 1M7HA 5EHIA 4HAWA 2CD9A 4OM8A 3B3QA 3FE2A 2DLDA 2J9FB 3ND7A 1E3QA 1QG2A 5INTA 3ADDA 1PTJC 1U0NA 1KYQA 2C9OA 3N8NA 3VHQA 1EMDA 4MUHA 3TZLA 4CGYA 1KBOA 1LTHR 1DUSA 1TO1E 1N5DA 3KIPA 4MCHA 4F9FA 1ZH6A 1WRBA 1ZICA 5G1OA 1K4MA 4DR2B 4A8TA 3F9RA 1WZCA 1SHUX 1Z08A 4MB2A 4QECA 2WQZA 4KK4A 3UOWA 1FIUA 3F97A 2NU7B 1TCAA 2QY6A 1YRQA 3PIIA 4MV1A 4O1HA 3TL6A 4RVUA 3KE9A 1BH2A 3V7FA 5JECA 2NN3C 3EIFA 1Z6QA 2CDAA 4YIHA 3U39A 3EFEA 3HYNA 2F62A 4IY1A 4JLOA 2Q46A 5KYNA 2FPIB 2P3QA 3C3XA 3K70C 3V4SA 1PGPA 3T1OA 5K0JA 2R79A 5ALGA 2P77A 3L18A 4OQXA 5EE0A 3WGLA 1LPBB 3LYLA 3EXFB 1R16A 4OB8A 3WK6A 4WECA 5IKEA 3IEKA 1FDRA 2CGEA 2WVAA 4V0ME 2NIPA 1FJGB 3KBOA 2G17A 3G49A 3IQFA 4GMHA 4HGRA 3O2JA 4BNMA 1MB4A 2QWXA 1Z15A 1T6ZA 4GAEA 5A9RA 2OV1A 3GWGA 2CFSA 4A91A 1ZIOA 4F86A 4BGDA 1ZJ6A 1R5OA 2F1IA 4PXYA 3CEMA 1G7CA 1N7GA 1FJXA 4TT3D 1Y6JA 3FLBA 3KLOA 2JLVA 3FWKA 2JJ2A 1N0WA 5BRAA 2XZPA 3A0UA 2WHPB 3OE1A 4FMPA 1LI5A 1BN7A 1G21E 3QXJA 1HLGA 3P0IA 3PQ4A 4PLCA 1XO1A 3F9CA 4F11A 5ICMA 1Z6PA 1P0CA 1TTQB 4AW9A 4HDSA 2D8AA 2HBZA 2NX2A 1TEVA 1GGEA 3VC1A 2YWDA 1M2OA 2AXEA 5FQNA 3PSAA 1RKBA 4HHEA 3NTVA 3IB6A 2ZRQA 1JIKA 3AZOA 3RK1A 4YHBA 3F2IA 1CY1A 5TARA 1RMYA 2OAP1 3ZGLA 1E3WB 4OI2A 1CF2O 1KIMA 4P9NA 3ANLA 1K6EA 2Q5OA 1OYYA 1W0KA 1XROA 2XWQA 4INPA 4M0PA 1GSOA 4MRMB 3LUBA 4GICA 3FZYA 2SHKA 4OGGA 1HI9A 2HMWA 3COPA 3KD3A 3VUFA 2JASA 1XE3A 3JQ7A 1J1ZA 2QE7D 3LP6A 1LLDA 1ILEA 1V0JA 1P5HA 5B7NA 3NT5A 4ZAVA 4B3FX 4OMCA 2GEDA 1MFZA 3NQ41 4LS3A 4EGSA 4ZEWA 1CUFA 3ADCA 1IN7A 5TB5A 1YS2X 2WU3A 3A32A 3M33A 3OI7A 5U9CA 2REOA 5B37A 1N1MA 1NIJA 2Q07A 2XMRA 3NBFA 4F6LA 2G9UA 4OXKA 4YBRA 4HYEA 4WXPA 2FN9A 3PNKA 3Q3CA 3AHIA 1GPDG 1UBMS 1N9ZA 2CWWA 3NDBB 4IGAA 3O4VA 1F0NA 1JSXA 2NMVA 2W6PA 1VHTA 5EHXA 1J0EA 2XTJA 3KUCA 3U48A 1FLNA 3ODPA 4PAWA 2OC4A 1YR1A 4MWBA 3IA7A 1ZU4A 4LHSA 4YECA 3SQDA 5FUBA 4OM7A 4MRRA 5KHLB 2XXAB 1MQ8B 2HFJA 4MI6A 4TL6A 2QR2A 1XKQA 3U3DA 1RACA 4QYWA 3OFVA 4Z99A 3D5TA 2BMAA 2BEVA 4QUBA 3S99A 1T1JA 3DWGA 3ILVA 6AT1A 1XJQA 4ZAFA 4G1EB 1B0AA 4LRXA 4XDZA 3OTQA 4GBJA 4Y3UA 3U7IA 2W2NA 2ZYWX 2WFLB 4US2R 2HNAA 2DQYA 4S04A 2GKGA 3NEPX 2QUJA 4IIDA 1SXHA 2JFFA 4GBGA 2QNIA 4L4RA 3G5TA 3B6KA 1S7GA 1VHWA 2VDVE 1XZPA 4KAXA 2UZ3A 2QYHA 2LTAA 1G6KA 4FKMA 5BWMA 1D09A 1XQWA 5HF6A 1PDOA 2J5XA 1QLHA 2QM7A 1I5RA 1XEFA 1C9YA 2BMFA 2O4UX 3DOFA 3W3ZB 3THYB 2Z2KA 2XWPA 5D3QA 2YQZA 5JPDA 3RUCA 5C8XA 3BPSA 2H9YA 1N2BA 2FOLA 3TNDA 1DFGA 3JYLA 1Z7WA 3BD7A 1YSCA 3EPKA 1AUPA 3FYSA 3G59A 3LHSA 6REQB 3FNBA 2JCBA 4K1LA 4NBLA 3I6IA 4MV3A 2NVBA 3K1JA 4K2AA 3AB7A 3N7AA 5FJIA 3CJRA 3TBHA 1IATA 4MW9A 1MABA 2NVOA 4R9NA 2OK8A 4LRUA 5AXBA 3WIOA 4D6PA 2QZJA 1L5VA 2HDWA 3C6YA 1KK2A 3BSYA 2EC5A 4JKIA 4NE2A 3VNVA 1PZXA 4F4DA 2JRLA 1W5BA 2XDWA 2X3FA 3T4PA 4AZVA 1CY8A 1XPJA 3N6XA 4JYCA 4LI3X 1RD4A 1FLAA 1PBTA 4JBYA 1IVSA 3U4MA 4ID9A 4PR3A 4QYIB 2YV3A 4LCJA 3V48A 4TV8A 1CJCA 3GLGE 3HN6A 5ITWA 1F2UA 5C7YA 3MMPA 5HK8A 2ZJOA 1RKVA 2X42A 2UDPA 4Z6KA 4JL8A 3U13A 4JEMA 4C0QC 3CLTC 5CXXA 3M6LA 3RFUA 1SVWA 2ONCA 3E22A 3EPJA 1LBIA 2VFAA 1EZZA 2P4UA 1GCUA 4UVDA 2PGIA 3OOJA 4YI3A 1I7SB 1Y48E 4BNWA 4BHTA 3BILA 4K6FA 3EVNA 3PFBA 4PYQA 4QQRA 3BTSA 4PYJA 3F0TA 1NN0A 3FOBA 5PNTA 4R0MA 4J7CA 4OQNA 5CCDA 3V4FA 4CEHA 2Q5CA 4JV5B 3U80A 1DKQA 2XSZA 3ONVA 3SQNA 4I3FA 1OXTA 3C24A 1KNQA 2YDYA 3AHFA 3D8RA 4UW9A 3HYTA 4NK5A 2E55A 4UBKA 1NBIA 1VZ3A 3EVFA 3OT1A 3CF0A 3ZD8A 2Q50A 1ZMRA 1D1QA 3U2QA 4CF7A 3IXMA 3QTBA 2BF4A 4K3UA 3TLEA 2VWGA 3I8SA 1X3SA 4CGZA 3JQ8A 2HJSA 1ZA2A 3NJRA 1N2XA 3GVXA 3QUBA 4QT0A 2HIAA 1XZMA 3SP1A 4MPTA 1QCDA 1S9DA 3ENVA 4JBGA 4LNUB 3VO2A 3KSRA 5AK3A 2XWSA 2QS9A 1TF5A 3E8MA 1XEXB 2DHCA 2YNMA 3EGIA 3M2TA 1PE0A 3PQ3A 4HMOA 3RT9A 3TL2A 3PD0A 4CR8A 4FX2A 1KC3A 2ZUCA 3R3UA 5EG5A 5FF9A 3HB7A 5K4AA 2OHFA 3C15C 4Q82A 3ZJVA 4LFAB 4CJXA 3S3TA 5F51A 3W5VA 4DUGA 2E87A 3KHKA 4IKOA 2WBLC 4R51A 4WINA 1K7CA 4LTNA 1V1RA 5AK5A 3ZXUB 4DADA 3CVYA 1Z5WA 5KNDD 3WHLA 4ESHA 2B6NA 2YH2A 4FD3A 2GXSA 5EQJB 1T6BY 3U0VA 5IT4A 3N2GA 3JV7A 3RNOA 1PS0A 2QSZA 2Q7XA 4FIDA 1XF1A 4D74A 1EEHA 4EGCB 5BR1A 2FJPA 3V3TA 5KO2A 1MNAA 2J5QA 1KRWA 1A2KC 4NYJQ 4YQYA 7ABPA 3K4HA 4LX8A 4X61A 2AOUB 2A1IA 3O82A 4U2CA 4U7PB 3WIVA 2WU0A 3R0QA 4A2WA 4KLZA 4P3NA 3IT0A 1O95D 1VBMA 2XWBF 3OSZA 3IUMA 2EWVA 4GM1A 5K8UA 1UAAA 1T4DA 1IIBA 1Q1BA 3REFA 4BKPA 4OHWA 1O96A 3MT8A 5A3RA 2AVDA 4PLHA 3PNSA 3SZOA 3RCBA 1WUKS 1V4VA 2REBA 4EPXA 1ST2A 2Z6AA 1W94A 1KR5A 1ZW1A 5EJIA 1NZDA 1WSBA 5ENDA 2ADFA 1DQSA 2DE0X 4DR3B 2IEAA 1JE1A 1IWBB 3T95A 3UWSA 3H1AA 3RD5A 3UCFA 3P2OA 3MCUA 4UTZA 1XQXA 3DQQA 1JWAB 5BO5A 2AFRA 2AJDA 1AB6A 1NF9A 2R6GA 1QQ7A 1K5HA 3V97A 3ZE1B 5IC4A 1YV9A 3K5WA 4RVCA 1GGFA 2Z6VA 1AGXA 2EFJA 1W5AA 3VR6H 1KI6B 4LMRA 4NCBA 4DF3A 3OZWA 3QPAA 3ISJA 3UA3A 1EYZA 1D2GA 3MA0A 3O31A 1NTRA 3EIHA 2P1DA 1UFQA 2FF7A 1JB9A 4IIXA 4AWAA 2ZSFA 3NDPA 5A62A 1JP7A 1KMNA 1KI4A 2EERA 3LO8A 2W2KB 5EWJB 3NXSA 3G02A 4EA7A 3EWAA 3M82A 4CM4B 2JH3A 3ZNQA 2I7TA 3THSA 2PKQP 5ALUA 2C0CA 2DHQA 2VYQA 4YA6A 2WZBA 4K9SA 2YN0A 3FOCA 1OWLA 2C07A 1P2VA 1PFYA 2XOKA 3MSCA 5BURA 2J3HA 3FN4A 5LKRA 2IV3A 2YRXA 2HWUA 3PG5A 1RXYA 1PDWA 4Q93A 1O5OA 3T9FA 3FJYA 1Y8RA 2B4KA 3G9XA 1T5SA 2KBEA 1I0ZA 2I55A 5KYUB 2LDXA 3N8KA 1OWOA 1ZXLA 4KI0A 3T3HA 1PYOA 1RLIA 2ISSD 2ZRGA 1PEKE 1YJAA 2IP4A 2VRCA 4O2RA 4I0WB 2OILA 4U2GA 1WCIB 4HXGA 3TGWA 2A57A 1N2CE 1XMPA 1HYEA 2OO3A 2P0YA 4JU8A 4LDRA 3AWDA 4P54A 3OHMA 4PNZA 1TAQA 5DE3A 4BO4A 3MYYA 3HA5A 4BX0A 2CV1A 4HTFA 2C2YA 1WUYA 2MT9A 1BXRA 4IJQA 4O33A 3VOAA 1YDGA 5E4JA 2HDNB 3W6ZA 3AFOA 2FMKA 4O25A 4XM1A 1KHHA 4ZI3A 1A77A 3GD7A 1QPZA 3OZRA 4E51A 1DV2A 2PXHA 1HR0B 1J1UA 1XXHB 3JQAA 1BHQ1 3OPNA 3QXGA 1XCLA 2OZEA 3GLUA 1S2OA 4I9GA 5DSTA 1IY8A 1HL7A 4E5PA 1ADJA 1W9HA 4RJKA 4CFYA 4RSMA 4LXGA 3ZBQA 4WJLA 1XD9A 2AOVA 3HSKA 4A2QA 4YX9A 1EBFA 4D4LA 1EFRD 2H5EA 2OESA 3AF3A 5CGZA 3O3CA 4Z9XA 3KDPA 4KYTA 5CX4A 2Y6UA 5ER6A 3U3XA 1XCPA 3CVVA 1G5PA 1S8FA 1GZ5A 2JIPA 1JIXA 1EX9A 3PDUA 4KXFB 4E5DA 3SXUB 3SMQA 4E5YA 4XGIA 5BSWA 2DHRA 4M1OA 5EQFA 2NSLA 1QX4A 4KSBA 2R0QC 2BKUA 3UB4A 2ZRMA 4Q4JB 2PTGA 1ESDA 4UCXA 2V4ZA 2HA0A 5DTQA 4B3RB 3K1ZA 1P0IA 2H2FA 2VHTA 1UJCA 3FUVA 3G79A 4JFAA 4MRSA 4X1IB 5UKDA 2QKYA 2WLTA 4HC4A 4XAQA 4C4OA 3LY7A 5TPZD 2KWIA 5M5BA 1BDIA 3EDOA 3UXMA 2W43A 1FQJA 1Q12A 3ECCA 1J2YA 1ICEA 2YQ4A 5FA6A 5LMCA 3QPDA 3O84A 3NZEA 3IESA 1GTVA 2WSSD 1SB9A 3ESQA 4G5RA 2BP7A 4ZT2A 2ZXFA 3BWMA 2FZLA 4E5UA 1FSSA 1G0NA 1KZ6A 2ZJ4A 5DGDA 4M0DA 5C35A 1V37A 4QLAA 3KYCB 2QRVB 1OPRA 2CYAA 4MRPA 3R8XA 3IR7A 3DWFA 1LY1A 1L7EA 4H31A 1QTNA 2W11A 4JN6B 3EQZA 3CURA 4J1NA 1X87A 4TPKA 3W8RA 5JS8A 3DOCA 1U2RA 3P0RA 2OM6A 3IFSA 1JLLA 1M34E 1VJDA 2FQYA 1GEEA 4BTEA 4DSUA 5ELXA 5BRJA 4ZXFA 3ZWQA 2Q4OA 4M37A 2GK7A 1A4UA 2ZAOA 4NHOA 4J0EA 3IKMB 4G0NA 1G3UA 4QUHA 1MJ5A 4EY4A 5DEIA 3KB2A 4OQEA 4KQJA 3S8MA 1ONBA 4ICIA 4Z0PA 3KTOA 4QD3A 2I76A 4LC9A 3HJTA 2WQ6A 1TAUA 2CLMB 5K4HA 4M9ZA 3UJ9A 3OZEA 1LI4A 4CM5A 3SQMA 5KS2A 1UC4B 4B0OA 1CDOA 3ABQB 1Y5IA 3WLRA 1G60A 1G98A 3NIGB 3A70A 4LRTB 3TUZC 1RP7A 4ZOLB 1RRMA 2QX9A 4LVCA 3H2KA 2BFEA 1L4LA 4FHDA 3ZIDA 3ETJA 2H07A 3OC0A 2K6GA 5BN3A 3CN7A 3IKJA 3OMXA 1KKUA 3LC1O 4DEVA 4GKJB 2CT8A 2BGRA 3GNLA 1SBNE 5ED4A 3ORRA 5LZ7A 1G3QA 3UHAA 2O3RA 3L82B 1Y1KE 1GWNA 4J9VA 3LD9A 4ZQGA 4MS3B 4ZC1A 1SC6A 4CQJA 4DQLA 1TQ4A 3DVAB 1E1KA 4KSCA 3VDNB 1PL8A 1EP2B 1SKMA 2RC6A 5K03A 5KDDA 2O7NA 3H9CA 4WCDA 1E4YA 4Z1MA 1XD2B 5CW2A 4QGHA 3AIOA 1M2EA 1QYRA 1IJFA 1Y0BA 2Q6LA 4BVLA 2FW7A 2GZ3A 3NEYA 4U0KA 5H82A 3L0YA 2CXUA 5KNCD 4C4PA 5HEKA 3V34A 3ENKA 1GV0A 1XDWA 4CR6A 1OXUA 1C9JA 2OZLA 1NXSA 2YUIA 4WQMA 5G0SA 4D92A 3HY6A 4UTOA 1QHIA 2R7AA 5JAZA 1QU3A 4GU5A 1QVVA 3NDIA 3PUKA 3OQMA 1GTJ1 4Z1OA 1NUSA 2BFBB 4J49A 4WRRA 3KUXA 2OCYC 3NB0A 3M49A 1KYXA 3SG0A 2D7DA 3GA5A 3TEFA 1GKUB 2H2WA 1IBSA 4DCTA 4EP1A 2QUZA 3TXYA 2IOHA 4J43A 3QVJA 3VNSA 4B3HA 4HGNA 4CN9A 1XLVA 4UDNA 3COZA 2WJAA 2HHHB 3DXZA 1JIIA 1SIBE 3T7AA 5CK4A 1KEEB 3SZGA 3IMCA 4BASA 2YCBA 5MN6A 2VQSA 3WRYA 5FBVB 1EFVB 1YBMA 2OY0A 1LH0A 1CLEA 1DKOA 2ZT5A 4FC7A 1O1YA 4I50B 4DV6B 2GCGA 4PF1A 2HLPA 2J59A 4AFNA 4MXDA 1UAGA 1MORA 2JGJA 5A3JA 2QU7A 2A1TR 3I1FA 1Q19A 1C3VA 2RIRA 1YU9A 2X2EA 3CG0A 1FEZA 4JP2A 2O1EA 2GVZC 3HCAA 4D81A 2EHDA 1K2VN 4XUDA 3TLAA 1C1YA 2YXLA 1OFGA 3GJ4A 3FZNA 4Q7JB 5AD1A 1YOVA 1EXNA 2IHVA 1TCCA 4FLEA 4L6CA 4OA8A 2GPJA 3SM9A 2MSKA 4BLPA 1DAGA 1JXMA 1CRPA 3ASUA 3ZZMA 1PR2A 4QYTA 4RM2A 4X64B 4X6YA 1ADGA 5G0VA 1E2MA 2B36A 4G26A 3CINA 3K5PA 3CZCA 3P4XA 4RMNA 1J0CA 3MOIA 3KWFA 2ZSIA 1E3JA 2C5EA 2BSAA 4GD3Q 5K0BA 1VKOA 1E8DA 2Q3JA 1FNSA 1M2WA 4X8MA 1NJ8A 3K4QA 3L4BC 2G07A 3RARA 4JI0B 2PBRA 3E0QA 3KAPA 1DDIA 4O2AB 5CDSA 4H17A 4GG1A 3WJ2A 5BN4A 4X7BA 2R2AA 5K3BA 3UYKA 2NSYA 3CVOA 3VAZA 4DXDA 2UUCB 2YR0A 5FO0A 3KTDA 5AP9A 3K6SB 4H7IA 1FFXA 1XVLA 3RVKA 1GNQA 3A9VA 3VJLA 4R1UA 1TMGE 3EXHC 2JCSA 3VR4A 4EKEA 2FHPA 5LJIA 1M10A 5IAKA 3JXEA 4JT9A 2HA7A 2V65A 5DHSA 3H1TA 4C0LA 5B4VA 2P9YA 1YDFA 2VOJA 4R3WA 1JH8A 4CV1A 3DMNA 4Y98A 3OPYA 3DEHA 1E9FA 1R6DA 2X77A 1BJKA 3GB9A 3LYUA 2P7HA 4B46A 1XK7A 3C3WA 5BSTA 2WWGA 1NF8A 5LLDA 4FWBA 2Q0SA 3L8ZA 2VG8A 1EM8A 3D7KA 2NAFA 4DY6A 2QK4A 3MB8A 1ABFA 1BGWA 2QN8A 3LKVA 1KO1A 2FX2A 5BVGB 3H2SA 4L57A 2UVDA 2OCXA 4QGGA 4G5YA 1E2UA 2PZFA 3IEXA 3ZGYA 5L95A 4GSKA 4E07A 2QRJA 2BMWA 2DQ4A 2O2GA 4UCFA 5JAPA 5B12A 2ZPAA 4TLEA 2Q5EA 4Z4QA 1MU0A 4FWIB 5JCOA 4IMJB 2FEMA 5B30A 3HBNA 1NVVQ 4HDNA 5DGIA 1RJ9A 2ZJFA 2IXTA 2QSYA 4MAMA 2XKAA 3D4NA 2ZTUA 2PQ6A 1MKYA 1ESCA 2XMSA 2QRKA 1TX4B 4RA9A 4RQTA 1JBEA 5B2EA 2XQKA 3Q5EA 3V1LA 2B21A 2FPGB 4L4YA 5E9AA 5DTEA 6ABPA 4HFMA 3FOWA 4KLAA 2Q27A 3WJ1A 3S4YA 3ND9A 3QVVA 4QXMA 4D8VA 4LC0A 3OJCA 1MH1A 1JXAA 1T4CA 3TM5A 3ZI0A 1T26A 1D0VA 1VGVA 3DW1X 5AVWA 3SU8A 3ZLTA 4J6FA 5JYEA 2FK7A 1V6AA 2OBFA 1ZM7A 1I0LA 5FBZA 2UVPA 1D1TA 1F7UA 2PRIA 3EHDA 1SVLA 2NO0A 4BLWA 5KNDH 2W8ZA 4JLBA 4M98A 2FV8A 3DWEX 1DEOA 3IEUA 1W4ZA 4E5KA 1Z33A 2GA9A 2JHFA 1JJBA 2ZRJA 1VG9B 3MJCA 5ECYA 3TO5A 2HIGA 4JU9A 3D8UA 4Z7JA 3T3OA 3FTDA 1MX9A 2H31A 3KZNA 3WIUA 5HPYB 1ZL0A 2GFQA 4C0KA 2E4VA 3ROTA 5E6SB 4YR9A 1IY2A 2QAJA 4JBLA 1ULSA 5B6PA 3PC4A 3S44A 1GNRA 1GXSB 5FA5A 1IDOA 1TKBA 3NEJA 3P97A 1WIWA 1AXRA 2HD4A 2DZDA 3JAWA 3EJWA 4K8OA 4KMRA 2YVQA 3IE0A 2FE4A 4PX2A 3W77A 4E88A 3K0CC 3M6WA 1JG2A 1DG9A 1W46A 1KOJA 3G0IA 1V4NA 2DJIA 1XZFA 3FYUB 1VKJA 2E4UA 1UZLA 4KKXB 4BC0A 4NHEA 1WOMA 4G89A 3FPCA 3KJHA 1JEQB 4G9BA 3R7AA 3VPXA 2D4HA 4V39A 3HI4A 1KI3A 3VISA 2ZIGA 2O23A 3C0KA 1YB5A 1NMEA 4PBTA 3D8SA 3DKKA 1HG1A 2YQ5A 3V1KA 1KJNA 4I99A 4UPDA 1JDNA 4ALLA 1P7YA 1SAYA 9ATCA 2DH6A 4B3GA 1HM5A 2CMDA 3PUWA 4YCJA 3DL0A 4B47A 2O3QA 5K20A 3KXIA 4Q3OA 4RHYA 4ARIA 2TRSB 5TNXA 2ZB2A 3DYIA 4RQUA 3VU3A 4AY4A 4F5DA 1CZHA 2B4RO 3ONWA 1K6XA 3RT1A 2ID8A 3L3BA 2Q2WA 1JHRA 4RVNA 5H8WA 2M1XA 4MV7A 3RU7A 4R7ZA 1NNI1 5AVXA 2D2VA 1U9IA 1MDFA 1IJEA 4UM9B 5JNWA 1JQ5A 1TYDE 3TIGA 3RSOA 2D4AA 3H83A 5G53C 2HCFA 4EH1A 4A7PA 4DUPA 3Q5GA 1TJYA 4NJMB 3HE3A 4DSNA 2JGMA 3T0FA 3KLBA 2X3UA 3TW4A 6NULA 1N78A 4NYJR 2BL4A 2ASVA 2GHIA 1PT5A 3V2IA 4FB5A 4J91A 4M1QA 1W581 5JZBA 2MOKA 2TSYB 4LRWA 2XA2A 2LWIA 3WR5A 4JI8B 4Z3KA 2BRUC 1ZCZA 3HZOA 2V6JA 1N9KA 2V74B 4XOIA 1HG0A 2PZMA 2Y2UA 4RHTA 4C5AA 1YHNA 2EU8A 2PKWA 4JIMA 4DSAA 3OPYI 3EWIA 4H7PA 3W5IA 1RNLA 3OP1A 4E11A 2FSSA 2PEYA 2B3TA 1VPVA 2OCGA 4TMWA 4RGVA 3KSAC 4ZT5A 4JX9A 1EUCA 1P0QA 2ACWA 2IXAA 3HO6A 5EJ4A 1CE8A 4NLLA 3DXXA 4HEQA 3BSSA 2A1UB 1L5SA 1J8DA 3ZY6A 3D6TB 1U8XX 1PIWA 3IHKA 1TM4E 1R88A 1MZPA 5BV1A 3I1JA 5D2CA 5LZ4A 3OJOA 1WLYA 2X6RA 3E23A 5MF6A 3ZDRA 1JLHA 1MJNA 4TUYB 3RK4A 3A1UA 4ETMA 4Z4FA 3PFNA 1TM1E 5BYJA 1V1MA 1GG2A 3IVRA 3O8OA 1XJWA 4WTOA 2BCJQ 3GAMA 1OIXA 4ARSA 3T15A 5KWVA 2BUBA 3GGCA 4Y2RA 1B0ZA 5HFAA 2LR0A 4X8OA 4EW6A 4TV9B 2CBGA 4LTDA 3ZHSA 4JOBA 1E0KA 2ZIAA 1USWA 2XCUA 4ASUA 3EQ7A 2QN3A 2RHMA 2FZEA 1NVXQ 5JYBA 1KH1A 5DYNA 5I9TA 3UMRA 1J5XA 1P6QA 4D9HA 1N7HA 2P78A 1GUYA 4V0QA 5TR9A 3BCSA 3CF2A 4GGMX 1EPUA 1VMDA 4GP6A 4U6SA 2ORVA 4J0CA 2PUDA 3HGQA 1BD3A 3DBIA 2H18A 4JXKA 1PEYA 5HGJA 3UWKA 1FDIA 3CWZA 2ZJ5A 3FUWA 4UJ5A 4PHCA 1E2KA 2NU9A 2YTZA 4X7MA 5JD5A 1L8LA 4HRXA 3FFXA 1PJ2A 2VP5A 4G56A 4IG4A 2K4MA 4OUKX 2OCLA 3C8HA 3EQ6A 3GJYA 4CFZA 4DY4A 2PNJA 4C7XA 1Y1QA 1ZRHA 2Z3VA 3NR2A 4J0GA 3QW4B 3E3NA 5FBLB 4OYLA 3UK6A 2QPOA 5LMZA 2XRZA 5A1TA 1O0SA 3C7DB 2H11A 2VP4A 1HQKA 3RREA 1RLJA 4TTTS 1FP2A 4NZOA 5AVOA 1EVIA 4ZYZA 3WLTA 4NBSA 3VR3A 3NKLA 2GWHA 3I76A 1SCAA 5GIPE 2D1SA 3L8DA 1Y8QB 2R8ZA 2WINI 1SXJA 4EJFA 1QHSA 4RLQA 2BEWA 3DOOA 4N0PA 3VPGA 5MHTA 4HZUB 3Q8XB 3ZJUA 1JXQA 1B00A 2FZGA 5CT5A 4KHPB 1LD3A 4XIJA 1FFAA 5SZHB 1G8JA 2RBGA 2APJA 4XJSA 2O8BB 4DYDA 2DY0A 1DIHA 4CCAA 3LS2A 1V95A 2AE1A 2IHUA 2ONKA 2OHXA 2IHNA 2HA6A 1M5UA 2VSXA 3PUVA 4JSRA 3SYNA 2A58A 1YS4A 4IIHA 2H3HA 4XCXA 1A4RA 1OLOA 2FLKA 5B1DA 3WL5A 3T3MB 4KACA 4ZT4A 2G0TA 5BQ3A 5HKLA 3G2OA 2GRAA 3QENA 1I7PA 2P9BA 1T3GA 2OCAA 4X7RA 4GEGA 3BGDA 2DMRA 3NONA 3QFFA 2ZJ6A 3B6MA 4LSZA 1B8PA 1SZCA 3DLAA 2Q3MA 1YZQA 5LZ5A 5K3DA 2ST1A 3G89A 1YJQA 2ILTA 2ZUSA 1Z9BA 4KSYA 3E9YA 3G13A 2WJIA 4A6EA 1FDSA 5KVVA 2DCUA 2AN9A 1IL0A 4LFBB 3N9IA 4FGWA 3NVKI 5K51A 1PJTA 1Z75A 3GJZA 3LW7A 1VECA 4Q4HA 2XVZA 3UK7A 1UIMA 4YJGB 1E6LA 4KLNA 4OU4A 1LS6A 4JFRA 5IUKC 3OFND 2FU5C 2JKVA 3O2NA 3RVOA 1E6KA 4H1HA 3ICPA 5KNCH 5B7QA 2QGNA 4NAVA 2O8DA 2GDJA 3MQ2A 4KBGA 4RV4A 5C32A 5FUXA 5J47A 3GNQA 1PRYA 4PG7A 3T9EA 1Q1AA 2HDOA 1CNMA 1UC5B 1ORWA 5DNDA 3S8YA 2C59A 3V55A 1G21B 3TKYA 4B33A 1SB8A 1OXBB 1MQSA 2RHTA 2VVTA 3GJ3A 2X7XA 4ADSG 5HDBB 1RXEA 4HVAA 1TIPA 4E08A 1E60A 4XPIB 2QG6A 1MHPA 4MA0A 1XKTA 3BMCA 3U4QB 4Q1EA 3E35A 4TWJA 4WA7A 3CUEF 4M55A 2NO1A 1UPUA 1NOJA 1NVDA 2R96A 2JHGA 3NBAA 3FWZA 4UHEA 2DHEA 2QORA 2JDID 2XBUA 1VDZA 4JD5A 4KCGA 3NHSA 2JLXA 5CG1A 2OV2A 4V02A 4YRTA 2GAIA 1R5JA 3PYLA 4ZAGA 3T5CA 5I5EA 3AHGA 2EL9A 1R5BA 3DUFA 3OZCA 2R7LA 3JAKB 3KJFA 4TX1A 4MKXA 1RZ3A 1L1EA 1STOA 1NP7A 1E6EA 2UZ1A 3A9SA 2P11A 2Z2ZA 3LBNA 5NLLA 3CTPA 4YUAA 1AIPA 5KOHB 3OZ7A 3D8HA 2WWTA 4XJTA 5EGNA 3B8HA 1T9KA 3EXG2 4NQZA 4Q9DA 4UJ3A 3WLIA 4B71A 3DO6A 4DG9A 1DFHA 1GM5A 2WHXA 2G9NA 2VQEB 3A9RA 4CQLB 2EFEB 4OPMA 3V7YA 1C7ZA 5HIKA 1G5FA 3DTYA 1W19A 1ORRA 3B38A 3JQEA 4DAEA 1F6WA 3WZMA 2J0UB 3GLHE 1VJTA 4H3SA 4U7HA 2LIVA 4KH1A 2PR2A 5JNVA 1RYEA 2VLBA 3FUUA 3LDUA 4IS3A 1P3JA 2W2PA 3RRXA 2EKLA 3WRXA 4BKQA 4RY9A 2RE8A 4HMPA 3WWPA 4QTYA 1NX6A 1QV7A 4FUTA 3OE4A 1A2QA 1E9VA 1VG1A 1WU7A 3BMNA 4DTIA 1NQWA 4WMLA 3X1XA 3ZD6A 3GJ5A 1DOAA 1G4HA 4RJ2A 2CJYA 4AECA 1NMSA 1TNDA 4HQOA 3N53A 4LJ4A 1RT9A 3MVEA 1Q16A 4GWGA 4ARZA 1SUFA 3IMFA 1U02A 3RS0A 2E5LB 2GK3A 2HMUA 3KR1A 5JASA 3EG9A 3FH0A 3P2JA 4BKMA 1F48A 1WR8A 1RWVA 3H8WA 3HI6A 3AI3A 1OREA 2E37A 3PNMA 2X1HA 1LW6E 1WMAA 1FTQA 2O0LA 2X41A 2H5IA 3M6AA 4YASA 2Q9UA 3VSAA 1TYBE 1WF3A 4JT8A 2BFDA 4KXMA 5AI6A 1QVWA 1U0FA 2REQA 5C3UA 4D3ZA 4Q1BA 1OFVA 3AGQA 3BDVA 2I2DA 4C03A 2Q5HA 4PZ9A 1QIEA 1VYTA 5FPHA 4KVAA 1K7EB 1K75A 2O8NA 3FNIA 2KSQA 1N5IA 2HA3A 3IPYA 3SF0A 2J9GA 4F3TA 3RSCA 3KOYA 1HLFA 3OKCA 4V1CA 3WMWA 2OK7A 4Z9BA 1N3LA 4D56A 2V7GA 2H9AA 4HNSA 5DIFA 4FMCB 3URMA 7REQA 2C29D 4MS1B 2TS1A 3ZBTA 2RGCA 3DAHA 4JQSA 1K3FA 2B6HA 4X71A 3I39X 1W87A 2CHFA 3HCEA 1LUAA 1QJ4A 2FW1A 4KXVA 3T54A 3HFGA 3QKRA 2QTNA 2WHEA 2VTDA 3LBIA 4EL0A 4TVKA 4KBYA 5IBPA 4IIBA 4QOGA 2JAPA 1M67A 3DONA 3LGSA 3N8GA 4CF6A 2CFIA 1ML4A 5D3KA 5C1OA 1MV5A 4XB6B 4PVCA 5K5EA 1IM2A 3ANNA 3R4VA 3T8YA 3JQ9C 4W5QA 3HNRA 1O9GA 2IXBA 2Q5QA 3NCTA 2WE7A 2ZB3A 3B53X 3M6UA 4X8HA 4BQSA 1B6SA 2BJWA 4QGSA 3TD2A 3SVTA 5BNZA 3VR2D 3STXA 4U3JA 5E95A 1GNSA 3QFRA 4X20B 4X93A 2D2IA 3W79A 4KQXA 4NFSA 3BHMA 2OBYA 2VI5A 2VDJA 1RRVA 4G37A 5LU8A 1A8QA 2A9KA 1WD5A 1F12A 2WLSA 3DMRA 4BTVA 4Z49A 3KJNA 1XCJA 2J30A 1ANKA 1T3SA 4KIJA 3TAXA 1T9GS 4OYHA 1XLTC 4QXQA 4UU8A 4ZARA 4NPCA 4Y1RA 4LZJA 1GARA 1JSZA 1UIRA 5B1IA 3QPBA 3ADOA 3KJIA 3N75A 5ICFA 2V0NA 2HF9A 3OQIB 3VBEA 2J7PD 4CLRB 4DJFC 1Q84A 4ALIA 4P4GA 1QF6A 4Z51A 1R0KA 2HPVA 2ZK7A 2V5AA 3QKSB 3U4GA 4R2JA 4RXTA 2GF0A 2BBSA 2YFQA 1BKYA 3AR9A 4CIXA 2NSDA 3NNNA 3RH0A 3I5XA 4LXIA 3FMVA 4AY6A 2HJWA 3D3WA 2WYIA 5CLHA 1HO3A 1EVJA 1WM1A 3VFDA 1XVIA 1TAHA