3UAOA

Structure and catalytic mechanism of the vitamin b3 degradative enzyme maleamate amidohydrolase from bordetalla bronchiseptica rb50
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
200
structure length
199
Chain Sequence
b'DLGSYERQGFGAALPLKAPYGLLIVDFVNGFADPAQFGGGNIAAAIETTRTVLAAARERGWAVAHSRIVYADDDADGNIFSIKVPGMLTLKEHAPASAIVPQLAPQAGEYVVRKSTPSAFYGTMLAAWLAQRGVQTLLVAGATTSGVRASVVDAMSAGFRPLVLSDCVGDRALGPHEANLFDMRQKYAAVMTHDEALAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative isochorismatase
molecule tags Hydrolase
source organism Bordetella bronchiseptica
publication title Structure and Catalytic Mechanism of Nicotinate (Vitamin B(3)) Degradative Enzyme Maleamate Amidohydrolase from Bordetella bronchiseptica RB50.
pubmed doi rcsb
total genus 66
structure length 199
sequence length 200
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.1.107: Maleamate amidohydrolase.
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3uaoA00
3TXYA 1X9GA 3V8EA 1NF9A 3LQYA 3S2SA 3TB4A 1XN4A 3HU5A 3UAOA 2B34A 1YZVA 3R77A 3PL1A 3O93A 4L08A 2FQ1A 3O94A 3O92A 3HB7A 2WTAA 4WH0A 3TG2A 3OT4A 1NBAA 4WGFA 1J2RA 3O90A 3EEFA 4L07A 2A67A 3MCWA 3IRVA 3R2JA 1ILWA 3O91A 1NF8A 2H0RA 2WT9A 1YACA 3OQPA 3KL2A 1IM5A 4H17A
chains in the Genus database with same CATH superfamily
4BGIA 3BL8A 4O4JF 1ONNA 2MCFA 2EKBA 4OPMA 2RK3A 1THGA 2CYCA 1K06A 2QJOA 2YZ2A 3T7EA 2PUTA 2Z3ZA 3OECA 1ODJA 2WVGA 4UNNA 4I1IA 3UMVA 3V9PA 4A9AA 4XFDA 1WXIA 2VDLB 4RD4A 4DG9A 4S0ZA 2UUCB 1WVMA 1E20A 2Q3DA 2QLNA 2RCYA 2ZREA 3GT0A 4HUQA 4KXMA 2F6RA 1CULC 4LQCA 5E6SB 2ORYA 4I2NA 2ZI7A 1I32A 3NM4A 1UM8A 1HV8A 4PSCA 1L5GB 2DBYA 3OE1A 3IEKA 1DXYA 5ALWA 3NLLA 5EZQA 3G2KA 1FL9A 3ODGA 5IP5A 1XHEA 2GHIA 3EDQA 1C1DA 1N8SA 1ZFNA 2WYOA 1XP8A 1E92A 2Y2VA 5DBGA 1LS1A 3N6VA 4BZWA 5G0UA 4AF8A 1XCGB 3DW3X 4R2MA 3WSVA 5CFLA 1H2ZA 2NAPA 2PD4A 4AQ7A 1XTJA 4LFCB 4CUKA 4ZOCA 2AR9A 4EQZA 4YA6A 1Y80A 2F00A 4CIYA 4HH1A 4IIVA 4P3OA 1W0KA 4H7HA 1PL6A 4E03A 5IYZB 1TUEA 2ZGVA 3ORYA 3VNRA 2PH1A 3O8LA 1FY2A 5KVVA 4JODA 2FVYA 4GUDA 2D4AA 1G1MA 2REQB 1ZD2P 3HA3A 1TZKA 3HB1A 4LXHA 4C06A 2NP7A 3KTAB 2BEVA 4ARUA 1IULA 4IUYA 1PEAA 4AJ2A 4EB6B 3QUQA 4ILKA 3L9WA 1K3FA 3DLHA 1SXHA 3NZEA 4AZWA 3URKA 4LYYA 4BGUA 5I51A 1IATA 1E9RA 1KEPA 1X1TA 2RDMA 3E22B 4MR7B 4NX2A 4WUVA 3UMJA 5LR6A 1U7OA 1U04A 1XZGA 2QJWA 1SVNA 3TTVA 3PEWA 5DMHA 3IPLA 4DIOA 5LD2C 1ONBA 2BPOA 3WRYA 4ED9A 1IXRC 2AN9A 4RKYA 2V5UA 3Q8WA 3UMFA 4M55A 3L7BA 1C4OA 3TE7A 4P0PB 2KLBA 3BB1A 3W9UA 2AXPA 1L1EA 2COKA 3HJRA 4HN4B 4UAVA 4UFOA 2LCQA 1VMAA 4ZKEA 3RW9A 3SZUA 1IHDA 2O3JA 2JJ8A 2ZLBA 2VJNA 3AP1A 4LCEA 5CK4A 3UV7A 5ICSA 5KQSA 2NNWB 4EBBA 3MF4A 3D5EA 1A8SA 2C94A 1GQSA 1P4GA 2IEGA 3FF4A 3PK0A 5CIWA 2CKDA 5ULLA 3AEKA 3M83A 3DGEC 3QENA 2QTVB 1E3LA 1COWD 4OXIA 4Z9XA 5K3BA 1OIVA 4S1TA 3C98A 3SXJA 5K9ZA 3GEPA 3S4YA 3SNKA 1VM6A 4GKAA 1KTIA 1X7XB 3FF1A 5JCJD 3RRYA 2CL7X 4HQOA 3ICQB 3CCFA 3GFVA 4GD3Q 3LT2A 4LOLA 1YJ8A 5ENZA 3N76A 2IEYA 3L04A 4G1UC 2VK2A 1ZL2A 3BJIC 2BM1A 3RHZA 2WTAA 4ZAVA 2E89A 4MYCA 3CRMA 3NHLA 5ALFA 5EHXA 2QZPA 3M3DA 5IUKC 3DE1X 2Y3IA 3F78A 1M34A 4AMVA 4DLVA 2YX1A 4EY8A 4Z4HA 2FF5A 3S40A 3VYVA 4QM7A 1NQUA 4HWKA 2ECQA 5FFFA 2X8LA 2AX4A 5EJ6A 2B4YA 3AXSA 1KE2A 1YH3A 3SHOA 3T12A 1YRYE 1IB6A 4WCDA 3H2GA 2FEAA 3ZK8A 4B31A 4HZUA 1L7XA 1JQ3A 3ILYA 3L0BA 5F5XA 4E70A 1CUIA 4UPDA 2IW1A 4K05A 3KEMA 3LQYA 3VO2A 3OCWA 4BQPA 2X9VA 4RHCA 5LXTF 4AKEA 2FU5C 2JASA 3WBFA 1E5DA 3TX2A 5IULC 4LFBB 3CUEF 1L5OA 4OX9B 1Y4ZA 2EZ9A 4IILA 1I2AA 3VOTA 3ILVA 1PNRA 4R81A 1L4FA 4QX6A 4GQAA 4MUXA 4HRVA 1EFPB 1YHNA 4Z2YA 5G0WA 4BFWA 1YASA 3JYLA 3OJWA 1NRIA 1SXIA 2P40A 3EVDA 3UJ7A 3FDXA 1WY5A 3OOEA 4NYJQ 1U2ZA 1U5CA 3HKDB 2C5HA 3N6RA 4PZZA 2GHTA 2GPWA 2XNHA 1O6FA 5C8YA 5AI9A 3G49A 1QK4A 2AXNA 4DT1A 4FGZA 5KQGA 4IWYA 1E1NA 4X3CA 5E3HA 1ZJ6A 3OZDA 5LLSA 2JANA 3N53A 1C3VA 4NS4A 2VUUA 2BBWA 4KYVA 3TCXB 3FIUA 2QP3A 3EZFA 1UWKA 4R0NA 1FRQA 2GPTA 4AIRA 4CCWA 4DMGA 5C2JB 4LF7B 3PRJA 2IHYA 3KAPA 2WHPA 3FTCA 4AY2A 2I4IA 2LIPA 5G53C 3RWMB 5AK5A 4OQYA 5AHXA 4ADSG 5CBKA 4RTMA 3KD2A 2EJCA 5ERGB 3LBHA 4LJ5A 3DOHA 3OQHA 4Y9TA 2UXBB 4BO0A 1FC0A 3CZ9A 3K9NA 4BN0A 4QHTA 3VO1A 1ZH2A 2Q8NA 3O2SB 4H17A 1NVVR 3U7FB 1JAZA 2F3SA 1G63A 5BVHA 2PZAA 3O75A 2DFVA 3U44B 5TJHA 1P1KA 2I1QA 2R11A 2YNMD 5I8ZA 3GCXA 4TLBA 1SXPA 2EGUA 5JI2E 3WK5A 3UWMA 3QWIA 4J0CA 2HO5A 4MINA 3EXHC 4GIBA 1QRTA 2W6MA 3BBLA 4CV2A 1DAKA 2XCLA 1RT9A 3FKQA 1W29A 5AQ1A 1G6KA 4EL0A 1E2UA 1SCDA 1HZJA 4QT4A 1KVUA 3CRNA 1HA3A 4X90A 1UM9B 1P44A 2QN3A 1QH9A 5LVAA 2SKCA 1LJUA 1DRJA 1J1IA 3BWYA 3IURA 4WZAE 4TM8A 3R0JA 3EZ2A 3T61A 5A3VA 2PS1A 4H7JA 4RE5A 1X1QA 3WAGA 3W1VA 4J0JA 4ZOBA 3MHPA 3NTQA 3JASB 4CM8A 3ZD8A 1WPRA 1J2UA 4IZIA 3UUEA 2WJPA 5I7WA 3IP5A 3P0RA 3OFSA 4DYVA 3ZWVA 4MQEA 4NIMA 3L7NA 4ZV9A 1BN6A 4KRXA 3QPAA 5IANA 1GPJA 3KVVA 2QIPA 2ZSFA 5ICFA 1RE1A 4B7ZA 2WTUA 1PR1A 2H1OA 3JR3A 4QE3A 4WZAB 3U26A 1YR2A 1U4OA 4LRQA 4H18A 1T1SA 1F8XA 4ALLA 1CIJA 1DTSA 1G9TA 2ZYDA 3IDQA 1N7GA 1REQA 1U0NA 2RARA 3O8OB 3RSOA 4BO5A 5CG2A 2NZUG 2JLXA 3OKFA 2CGEA 1AQUA 2I7XA 3AVXA 4C7OA 5KNLA 5BR8B 3WKBA 3CWCA 1QF9A 1ZWLA 1E9BA 4MYHA 3RU7A 4CFYA 4HDMA 2IZ5A 1VJ5A 1WD5A 5U4QA 5CUQA 3I8OA 2PGIA 1CUBA 2B4AA 3QKRB 4J2TA 4A5SA 2FA9A 4ZEMA 2JA1A 5IABA 2ZTMA 5TJ9A 1N9KA 2B1QA 3L4KA 4R83A 1MKYA 1V5EA 5T67A 1GVHA 1NN0A 3PL1A 1ENPA 1RKVA 3ED5A 3N6XA 3NBMA 4OBEA 3MVEA 4ZCSA 5HRUA 2NO9A 1UCFA 5E9JA 3MWDA 5F1OA 3I61A 2E87A 2XD4A 3GRRA 2OKCA 1G3MA 3EA4A 4MWDA 3RVRA 3OSUA 2C07A 1WSAA 1OXSC 2SICE 4KTVE 1HDIA 1XVAA 3OZFA 2XYVA 4DMUB 4EZEA 3BILA 4MUEA 2P69A 1OIWA 3WGJA 1TQ2A 1UEXC 3A28A 1KRHA 3ZWCA 4E0BA 4A0SA 5IVPA 5KWEA 3RBZA 3V2UA 2EV9A 3E2MA 1U4SA 3MG9A 2IPLA 3JATA 4V0NA 5JD3A 3MAGA 1KEZA 4TRNA 3N3BC 1IY0A 4EH1A 1L3CA 1M83A 3RS5A 4DLZA 5DHSA 4AS2A 1TCAA 2D1QA 2LR0A 4EBFA 3P2KA 4PLHA 2ZPAA 3IE1A 1RDFA 4OGKA 4OM7A 4KU4A 4R7GA 5FWNA 9LDBA 1ZINA 1NLZA 1DSSG 1OWPA 5JAIA 2RHOA 3DMTA 3H6HA 3PNVA 1SUEA 3R3ZA 1XA0A 3WGZA 4E1BA 4JJ8A 5A5EA 4AJEA 1VG0B 2C57A 3LDHA 3QOWA 3LP8A 1YRWA 3AJEA 4CKCA 1A27A 4FJ2A 4HNVA 1GRVA 1CJKC 1Q92A 4JX9A 4ATNA 3F1LA 2HHAA 3JYHA 3HJGA 1KZGB 2PQMA 1IH8A 3OOSA 2PM8A 4OFZA 3LUJA 1W87A 2X7JA 5FH9A 3CF4A 1PX0A 4BU1A 5IDVA 3ZS9A 3GL9A 3G59A 2XJ9A 4GVPA 3CYFA 3DXFA 4FGUA 3T1QA 5DM1A 1N6PA 1X1SA 1J8FA 4BB6A 3UMSA 4A8JA 1YR8A 5T4HA 3ZQKA 4Z4QA 2QG4A 2JBWA 4PRKA 3SLRA 4DABA 4CE6A 3A11A 3ACDA 3KK0A 2NNLD 3W06A 2FWJA 1RXEA 4QARA 5G1NA 2QZZA 4BS9A 1U3DA 1Z37A 2RMKA 3JSXA 3GAAA 4EWLA 1MIOA 1EDEA 1RC1A 4ZVMA 4QVKA 1X8JA 1A04A 3AOEA 3ZE7A 1M54A 3P0FA 2HF7A 2ZJ3A 1H42A 1BEZA 5LN1A 2C4MA 3G82C 2DKOA 2XA2A 4P22A 4TQ9A 1QNFA 2EZUA 4D9FA 2E21A 4ARZA 1ISJA 1UPAA 4BRZA 5BSVA 4OHYA 4EMTA 3JD0A 2ZYAA 3FLBA 4B3JA 5ALKA 1MRSA 1PQPA 3H97A 2V0NA 1IG0A 3E61A 5AIBA 1EUDB 1APBA 3TRFA 2E85A 4Q6BA 4C4RA 3G5TA 3HJAA 5ALNA 1FDRA 1SXQA 1SG6A 4MRVA 3W8RA 1AQYA 1UPFA 1QH1A 1GHTA 5HUQA 1IBLB 2ZRAA 4OM8A 5TXGA 2IELA 2NO6A 2J9ZB 2MSDB 2YVLA 1RXUA 1UBCA 4ZDWA 4U7PB 3DOJA 4XRGA 4JNCA 3ZDQA 1FZQA 4B4UA 4RABA 1Q7EA 4DLWA 5J2TB 2NAFA 1I4OA 4OA8A 2O54A 3UZUA 1D5WA 1G7TA 3PEVA 2LNDA 4BECA 1WF3A 5CDHA 1WW2A 2ZROA 3QWAA 1DX4A 1O5TA 1V7ZA 1ZUNB 2A1UB 2Z09A 4ZQBA 1OWMA 1JH8A 4JVNA 1Z82A 5DP1A 5DYYA 2R96A 4LC1A 1P1BA 2QD5A 3PC8A 1VPEA 1ODLA 3AJ9A 2Y0DA 2VCYA 4E11A 2WD8A 1L5QA 2BKEA 4KQ9A 1OFUX 1C3JA 3AR2A 1QIFA 3SC3A 5HQ3B 1U63A 3DMHA 4D0SA 4Y2VA 1VHJA 3PUIA 1M6VB 4UAGA 3VNBA 3R1IA 1DEKA 1E7RA 1E1QD 4G1EB 2CCKA 1VKHA 1JU4A 2FWNA 1NXXA 5IXYA 4M1OA 5ADWA 4Z9YA 2CWDA 2W93A 3OJFA 5IM4F 2BEUA 4EP1A 5PNTA 4REQA 1TQ4A 5KNCD 4Z54A 1DFGA 3KHKA 1E6CA 4WVLA 5F4BA 1CQJB 4B2IA 1IZ7A 5LDHA 2EAUA 3HB7A 3TQRA 1NC1A 1U7DA 3YASA 1OBOA 2Y1XA 1DC5A 4RH1A 4CTOA 5JSZA 2JLQA 4V0MA 4CQMD 1Z8FA 3RARA 4AJ4A 4B7CA 3T9EA 3NHKA 1RFGE 2QM3A 2PGOA 2CLDX 2FUCA 3AHDA 3DEHA 3IDFA 3QFRA 4H31A 2EEZA 4H7DA 3OUUA 4Q5IA 2OAQ1 4RGVA 3ONNA 3VR0A 1T5TA 1FQOA 4X6LA 2EFCB 4AZTA 3LO5A 1OROA 1XC7A 2I6UA 3C7DB 1FDVA 4XJSA 4XEUA 5EP4A 2GVDC 1I6LA 3OAAA 4D6XA 4EEXA 2DEUA 2PKWA 3FYSA 1OOEA 2Z5VA 4HCJA 3LOUA 1E5QA 5F64A 2D2VA 2D13A 3NATA 4ND5A 3S8YA 4P0TA 2YVUA 3QYAA 1VJ0A 2ZRHA 1EK6A 2AJLI 4TZ0A 2P6RA 3EWAA 4KLZA 4BNZA 3U3ZA 1N0WA 3BDAA 1A88A 3HSSA 4FWBA 3ZG6A 1R6AA 4V1CB 5IDXA 4ITVA 1IN7A 2I8CA 5C9ZA 5AVTA 1Z4LA 4JEMA 3O2JA 2E3JA 3KZCA 2BTQA 4WAUA 4BZZA 5JAOA 3EXG1 2DUNA 6PFKA 3GVHA 3LA6A 1ARZA 3FLMA 3MK31 4UEOA 3A0RB 3RLIA 4LRTB 4YONB 3I5AA 1XFAA 1SQFA 2JH9A 4MA4A 2C7QA 2RGAA 3QBEA 2M1ZA 2ZJ7A 4P84A 2JLCA 2X2PA 1OWLA 2GCPA 4TSFA 2X1MA 3P2JA 1QTQA 2GNAA 2QTTA 1EZ1A 4C6RA 1FXSA 3BJZA 2SKDA 2Q3HA 4IPTA 4DQLA 4CG3A 3MTAA 1VLZA 2WK1A 3CB4A 2XUIA 3UJ6A 3VDXA 3W2EA 4MWSA 2HGSA 3Q9LA 1HT1E 4F7WA 4OLBA 3CX8A 4M9ZA 3TZ6A 3Q3GE 1W581 4TWAA 4LMPA 5I7HA 4J49A 1YK1A 5A9TA 3I3SR 4DAOA 3K1YA 4WFJA 3V55A 4JBXA 2JJ2D 4EW2A 3GLIE 4KPYA 1PQYA 4U8GA 2UUOA 2JEZA 4QJ5A 1K8YB 4P4TA 5EEGA 2P3QA 4OHOA 3U31A 3EA0A 2FWIA 4TZ6A 2O2HA 3ID6C 3HM9A 2QMYA 4RZQA 3ZGYA 2ZUFA 4KE7A 4HEA6 1G8JA 2PU5A 4C6SA 2FVXA 1W4ZA 2JFPA 5EJAA 4R1NA 2VYND 3R5TA 3V33A 1SY7A 2GZSA 5CLIA 4G4JA 2HGZA 2UV8A 3O9MA 1TAHA 1PJBA 2ZU6A 4BNVA 2I9PA 4EAQA 3M5DA 5B1YA 4PNZA 4X7BA 1WE2A 1VGQA 3C6QA 2GEJA 1S2GA 1NYQA 3R9XA 4FCWA 2RK4A 3OZ7A 5G2OA 4BEVA 4HQ0A 2P35A 4AUMA 2J5RA 4XWGA 1T3SA 4PLTA 5KYXA 2O6LA 1EE1A 4G1FA 3EGDA 4JDPA 3LWDA 4JZYA 4KO1S 4LUCA 5A71A 5CCDA 3NETA 1QU3A 3A2LA 1Y8AA 4RETA 3IP6A 3IAM1 2A88A 3W9SA 1JMKC 2AA3A 2DBZA 2P3LA 1AMOA 3VH1A 3RSZA 4OXRA 1JB9A 5EP2A 2FJ0A 3EJ6A 1V6AA 5FI3A 4X24A 1GG8A 1GZ7A 3RT7A 2AJDA 1G291 1DDIA 5FFMA 3ROGA 3S7ZA 1WV1A 3CVUA 3OTWA 1LLCA 2IP4A 3QNWA 1GDTA 2O8DB 1MTZA 1MB4A 4HWRA 2EL7A 4G4SP 1P0MA 1X1EA 1QE3A 1EBUA 2AOWA 4OV6B 1A7UA 3P2YA 5I9MA 1VHQA 2VTEA 3G68A 3M1YA 3QVGB 3PFGA 4IQ0A 4OQDA 1DZIA 4O4IA 3VI4B 1WEHA 3VVBA 1S4MA 4DANA 5B1DA 4R98A 2VFAA 3TSOA 2ZBEA 1W7AA 1P6UA 2BF4A 5C7YA 3M82A 1DOHA 7ADHA 1QPZA 4RHFA 3QUSA 1IK4A 4ZVKA 4MO2A 4I50A 4JJAA 1P3DA 4P5PA 3A3OA 3UFBA 3OAAD 4MVJI 5LYJA 3WB2A 4D9EA 1QHNA 4HI0E 2ZYSA 3GFTA 1S4QA 3NJ8A 4IKPA 1TJNA 4WNIA 1E1RD 3HL4A 2WJGA 3DCIA 4H77A 4JI2B 5BSGA 1NDUA 3RBAA 3DWGA 5K8LA 1K0FA 2XV1A 3BQNB 3AVTA 5I47A 3IMCA 5JTTA 4LRWA 1PGPA 1CRZA 2BFFB 1KFKB 1RRVA 3OIFA 3VHRA 4FC7A 5J5AA 1V47A 1XU7A 3HGTA 3CIFA 3LRPA 3V1YA 3W2FA 3SSOA 3MEQA 2FPRA 4XTRA 2ZB2A 5AVKA 4JBGA 3ZWYA 3E2PA 5COQA 3WSWA 4MDFA 1M2FA 3HB4X 4LSMA 1Z5NA 3OUZA 4MS1B 5EY5B 4BHTA 1KGSA 1ZUIA 4IS3A 1B73A 4ZYYA 3ON5A 3MCTA 4DBLE 2E4VA 3OTHA 4Q4AA 1U8FO 2HLDD 2Q2WA 2RGWA 3EH2A 2VPWA 3MB5A 4KW7A 4L6IA 3G5MA 4DC1A 3GELA 3WLNA 3A9VA 4P32A 3I42A 3K2BA 4UVGA 2QMUA 2HRCA 3WLEA 5IXJA 4GSKA 4HB2A 3F5DA 4IJUA 4MA0A 3KPWA 2K2QB 1Q1ZA 3PJGA 1MZVA 1WZCA 1SK8A 2X0IA 4PYOA 2PK3A 2YY5A 3KB1A 2BEUB 4TMVA 4ZEOA 3IOBA 2DUWA 1KOJA 1QM5A 3GLHB 4RV5A 5ERYA 2E1RA 4JGBA 3T8YA 5EZYF 3NS7A 1SKBA 3RTEA 5IC6A 1YB4A 1N5JA 2PL3A 1TT5B 1UP4A 4R40A 4JI5B 2VWQA 3RADC 2ODNA 2XUHA 4ZCQA 1HMPA 1AUXA 5A1TA 3N2ZB 5LZ7A 1SCIA 2JGDB 2NVUB 3IQEA 4IGEA 4R3UC 2FQWA 2Q3EA 3U80A 2G7ZA 1Y6RA 2AQKA 2O7RA 1PEDA 4I66A 4O1HA 4ZAWA 1DG1G 3O8QA 4E2YA 4PZLA 1YIDA 4ZK6A 4MQ5A 2QTGA 2QSUA 1W1IA 1LX7A 3O73A 3CEJA 1JTVA 1X7DA 5BWBA 2QT1A 5HZGA 1CUUA 1FFBA 2FRDC 1X92A 4G23A 5CDFE 3SMVA 2X5XA 5E8RA 3U13A 2QZ4A 5C1OA 1AZTA 2XXAA 1BGXT 3IP1A 2ZBVA 4JP8A 4EVQA 5KKCA 4ZOLA 3MGGA 3ND6A 4J4TA 3QMMA 4FMDB 1ABFA 3LECA 1CU1A 4NHEA 1QO9A 1N2CE 1VOTA 1TZMA 5IW8A 4YRSA 2D0OB 1TAUA 1IQPA 3GJ0A 1ATZA 4Y0AA 3ZDZB 1KEKA 5JECA 4LVCA 3EXHB 5DBHX 2YHIB 2I4LA 4JBYA 2A6PA 4EK9A 1HDZA 3UJCA 1DXHA 4PNPA 4ESOA 3B1WA 1DG9A 3PD7A 3GHYA 4WI1A 1NZDA 3RJTA 1E2EA 1EXDA 1J2EA 5DYGA 4QBIA 2WSMA 1I4LD 5KNBA 5JD4A 4QPZA 4CMIB 1L7VC 2I2CA 2O2IA 1O03A 1T0HB 3IDOA 4LJYA 3AI7A 4TUYF 5SYNA 2EBUA 2OZLA 2XKAA 2ZSKA 3K8OE 3OZRA 4TTPA 3S70A 5ILOA 4M1EA 3HCEA 1ZGBA 4PPQA 4LZPA 4DDWA 3WQQA 4KO3S 1CY8A 3D2CA 2D06A 3T54A 4F4HA 3FOBA 2XMSA 5DEOA 5ALDA 4H4DA 3TIFA 1CR1A 3JTMA 1A2QA 1A9OA 3F6YA 4HRXA 4G5GA 3RK4A 3BSWA 3RWBA 3TK1A 3TG8A 6REQB 2ZU0C 3C74A 4OHKA 4PC1A 5IS2A 4MS4A 2JJ2A 4AZVA 4EFMA 4N5HX 3FUCA 4MV5A 4JI1B 1ZBDA 2BEVB 3GXOA 4AMBA 2GKSA 2GN2A 4EY4A 1ZUHA 5KNBD 3W5BA 2X8BA 3IO3A 3B9PA 4M1TA 2IQ5A 2VF5X 2J9FB 1EFAA 2JFZA 1M7GA 5B3JA 2DE0X 2JZOA 4YMVA 4G0NA 1BE0A 1N9GA 1PDWA 1QZ3A 3HCWA 1SKYE 1Z3CA 2JGKA 5BNFA 1J8MF 1WA5A 2LPMA 3BH6A 3MOSA 4I9NA 1NP6A 3QYPA 4RMIA 5GONA 2OC9A 4DUYB 5GGXA 4Z51A 1ULZA 3X1XA 4KMSA 1DEXA 2JFVA 3VJKA 3PHBE 5EJ8A 4MIEA 1X7YA 2XECA 1WLSA 1EVQA 2PWAA 3EIEA 4N5IX 5FNVB 3ASYA 1Y3HA 1WL8A 1DHTA 1PGJA 3TJRA 1JG3A 3HXPA 1QTNA 4CTNA 4Q47A 2JGMA 2EBWA 3LYAA 2ZWMA 4HVTA 4XIGS 4QICA 3QVWA 4ZZ2A 3NG1A 4CMGA 2H1WA 3CZCA 3BG5A 1DUSA 3FTPA 1ECJA 4CUJA 2HO4A 3OICA 3ZIAA 1VA4A 3SX2A 4FYYA 4X92A 5BR1A 4JJ6A 1YC5A 4F3YA 1U94A 4GNRA 4KCGA 2J3LA 1D0SA 2JD0A 3HYTA 4ETNA 4S1VA 3AP3A 3HR7A 3M4NA 1MNQA 3MGAA 1P7WA 2FOXA 4YCLA 1JZQA 3WB0A 3NQ41 1CNEA 1EM6A 4IG4A 2ETVA 2O2XA 1DIAA 1TTHA 4JJEA 4TQGA 2X4LA 1F4PA 4K9OA 1V2HE 4BFVA 3DZCA 4PEVA 4DN6A 1HMYA 5LB4A 4R5MA 4C0QC 1CYEA 3R0XA 3KXKA 2XB9A 1UMCA 2D8AA 4BN4A 4JJIA 1QYCA 1BVRA 3MWLA 4IVQA 3UJDA 1TLLA 3ZHSA 3SKXA 5AUNB 2ZRCA 3QX3A 5AKZA 3RAEC 1U28C 2MINB 5THKA 1KP2A 1GN8A 4RU1A 4LV8B 2AFHA 1R27A 3TQOA 4R5HA 3DJYA 3D4PA 2WHQA 3ZNOA 5EWJB 1GGNA 4K9QA 3LXRA 4ZCRA 3GZNB 3A58B 4G3XA 1HPLA 3PNLA 3OMWA 4AMZA 3DZ8A 4HX5A 3D7SA 1NVMB 2HQ1A 4FYPA 4WUTA 3ETHA 2X2EA 2FN8A 1NVBA 1XO1A 3IRVA 4MYTA 2YYAA 4C2AA 2WT4A 1KWGA 2JHCA 1KTVA 1E1RA 4A0FA 1M1NA 3P9IA 1QO0D 2AC7A 3DBRB 4X54A 5BV0A 3HNPA 3TAUA 2G77B 2BZSA 3WA6A 2QD3A 1X38A 1FDIA 2V7WA 4HAZA 4O4HF 5AICA 4EJ0A 3ZTTA 5C5CA 3JZFA 1WSWA 4KO8A 5KKAA 1L4MA 1NQTA 4TS4A 4TKUB 3HBMA 1TFUA 1Z88A 1U0EA 2TMDA 1IY1A 1NC3A 2ODWA 3KQPA 1JFFA 1EX9A 4ZOEA 1KO8A 4LGVA 5FL3A 3NWPA 3R09A 1RYZA 5J63A 1QCDA 4LRSB 2VNKA 4I4IA 1JHRA 5AOCA 2PN1A 1QTIA 2HU7A 2Q5EA 2Q46A 4PLVA 1F38A 5HF6A 4JV5B 1FP6A 2X9LA 4JSRA 2JLWA 1Z2DA 2NACA 3DFKA 5FLKA 3HZHA 4QTTB 3EASA 3UJ9A 4NNPA 1DJMA 1KMHB 2IOQA 1SVKA 1OU4A 3QLEA 3RUIA 3V46A 1FS5A 2B5WA 3OPYI 4N5LA 3R8XA 2NSDA 4TV8B 3R77A 4GWKA 4ROSA 3RROA 4ZA2A 2FW1A 4Z7OB 5BVGB 1DARA 4UEKA 3FCOA 1Q1BA 3HFSA 3VO8A 1RAEA 4RIEA 1PEYA 1W59A 5L4NA 2EGHA 1NYLA 2A3NA 2R8XA 5H5JA 4BP3A 1A2BA 3KQUA 1V8FA 3S2IA 1K08A 5DGCA 1AB5A 5F9HA 3P96A 2FR0A 2MT9A 5TMBA 4ITRC 3KR9A 4WESB 1LSSA 1HC7A 3ZUPA 2HMYB 4OP1A 3CMMA 1MFPA 1Z0JA 1E9EA 2EX0A 2CLFB 4OIFA 1CR0A 4JNKA 2IYRA 4UJ3A 1WB9A 4NXNB 1J8VA 1FMLA 2M32A 3CLSC 3QELB 1UIMA 4GHWA 4ZO4A 5JLAA 4AJHA 4C7JA 1FXUA 3P7MA 3ESYA 2F55A 1NW7A 3WNDA 2ZYUX 1IBRA 5CA1A 1YZGA 2JI6A 2PUGA 4Z53A 2V59A 3ZLUA 4YROA 4HSGA 4HZIA 2YWHA 3N2IA 4GX5A 4XOIA 4R9NA 1N7HA 3F3KA 2AW5A 3HLTA 1PYGA 5IBPA 5IASA 3K9GA 2FPPB 3UGQA 4RYLA 1BXKA 1K66A 4X9XA 4Q1AA 4YAKA 3NB0A 4X95A 4IGAA 2HJSA 1O58A 1WZUA 2VSNA 4HSEA 1I24A 1Y37A 1Z0DA 4YJ3A 3A3PA 4DMMA 1GU7A 2G5PA 4JQCA 1X9HA 4UNRA 3A6EA 3BZUA 1U28A 2DJ5A 3ONFA 2K87A 4HQFA 1X7WA 2L19A 4CXMA 3HDTA 3DZBA 3PIIA 1I01A 4BQQA 3FFTA 4YREA 4B6JA 3G0DA 4JP2A 1FNBA 4R05A 2H92A 4B3HA 4B17A 2QN8A 3NM6B 4B3IA 3CVVA 3REGA 4DWJA 5AKGA 4EG4A 4J94A 4KPUB 2PRZA 1OFHA 1P77A 4KXFB 1SU7A 3O93A 1SCNE 3IMKA 4O8CA 3GARA 2XWBF 4UOQA 4PPGA 2OQ2A 4E5NA 1W94A 2FZ4A 3PCRB 2A2ZA 3DTVB 3L0DA 3M0EA 4LSZA 1D4OA 1U80A 1XZBA 2DXIA 4BYMA 3U2QA 4WKCA 1H3EA 1C29B 2E55A 2VI5A 4O2BA 3RDPA 5CXQA 7MHTA 3UMCA 2H4HA 1SN7A 1LY1A 1SPBS 2PUVA 4PY2A 3K05A 4I4NA 2C8JA 4N8EA 4BPBA 4M0MA 4AZ3A 4R31A 2VDOB 2JGRA 1J23A 4P7FA 2JA2A 3G1WA 1ZOLA 1ZIXA 1SR8A 3PDJA 5ALQA 1Y1TA 3VR4D 1XF9A 3QA3E 5FA8A 4X1YA 1GTSA 2X40A 5CVDA 2I4TA 4OSEA 3VM6A 3AZOA 3BL5A 4XJVA 4PN7A 5IXSA 4NJMA 1BVUA 2CHGA 3MWYW 3PUVA 2QD2A 5K6RA 1OLSB 4KE6A 1GY8A 3ZWDA 1TECE 5LOVB 5DXAA 3WY9A 3TAXA 1CUYA 1HFWA 4W63A 3K0EA 3E3NA 3ETNA 1DJLA 4KXWA 4LHWA 5GMOA 1MA3A 1XZHA 3DT9A 5FA5A 4QJ4A 1OX4A 5GOTA 4JP5A 2DU8A 3G8CA 1L5RA 3VR2D 1UF9A 1N57A 2E2WA 1LTHR 2G7MC 2R00A 3TXYA 4PTZA 5I48A 3W6NA 2C7RA 1YDWA 1YQXA 4NZ9A 4L8YA 4DQKA 4C76A 2OV6A 3W5DA 1PFWA 1YB5A 2H7VA 2O6HA 4FDMA 4JMPA 5EUQB 5REQA 2E9SA 2KE5A 4KOAA 3H2SA 1SFRA 1B43A 3AB7A 1TNDA 2PKEA 3FFAA 3Q7EA 2DT5A 2N1BA 4C0XA 4GKJB 1M1YB 4GMXA 4C87A 2QLLA 1H2AS 4MIYA 1UK8A 4BMSA 1G5TA 4O08A 4D98A 4ME6A 1RVV1 2A3RA 1H6BA 2A67A 3ROQA 4IQ8A 4DSAA 3CPEA 4HKTA 3BTVA 1PFGA 4YB8A 1UDBA 2O2YA 1NXTA 4LVUA 3F5MA 1Q3HA 3NHZA 3R0IA 2V54A 3DKPA 5KTOA 3AM5A 3LPDA 2C42A 1T9DA 4RW0A 2GAAA 4GICA 1UP6A 5A5VA 3G2LA 5TRTA 4OHMA 3U3KA 3O4JA 2DWCA 4KPEC 3VKFA 2FPGB 2QRNA 3D3JA 3GK3A 3KM0A 4DUGA 5JYBA 1UXOA 2FN7A 3R44A 2OBYA 4HNAB 1YD7A 4YMTA 3RREA 3OQIA 3CU5A 1XI2A 4QO8A 3QBJA 2XQGA 5HOEA 2A57A 1O0SA 1GGJA 3VJLA 3K32A 5D3MA 2ST1A 5IMBA 5E2IA 3KXLA 1DVRA 2D59A 2XMGA 2P6UA 5C37A 2ZOSA 3ECSA 1E3DA 3QVTA 4NJEB 1LI4A 1KDPA 4LJ8A 1LXCA 2DMRA 4L2IA 2FPLA 1K86A 2G76A 3ZK9A 5BW4A 2FMTA 4A23A 4RQUA 4MR8B 2ACEA 4LE2A 2EF1A 2G0NA 1R50A 2QTZA 4FI3F 1UC5B 2AMJA 3K9LA 2XQIA 4V0LA 2R44A 1F1BA 5KYWB 4QTUB 5DSZA 4IINA 1U7PA 1BS1A 5DTMA 4GQBA 3TGPA 5DW3A 4D9JA 1G6OA 1YRLA 5A4DA 4O4LF 4Y7DA 2HPZA 4A8PA 2WFAA 2FPSA 2QGFA 1L8QA 1QFYA 4PICA 5KVCA 2O07A 2CUNA 5EHGA 4QYXA 1N0IA 3IXLA 4LJRA 1C4WA 1R12A 1RLUA 3WK8A 2PXHA 4HD8A 3SM3A 1E6EA 3VDRA 5FPQA 2A92A 3BK1A 5T41A 1OZHA 4E08A 7ABPA 3J7TA 1JILA 4G8DA 2FPUA 5BV2P 1YACA 2ZJ2A 3WK7A 4ZO7A 5H81A 4Y30A 3SS8A 4E5YA 2WFLA 5FTNA 4HGZA 1NURA 3GCDA 1ES9A 2B9VA 2G72A 3VU3A 3ZGOA 4BZQA 1WR8A 2PXCA 1ZKMA 2WVJA 2HJRA 4QU8A 4YJFB 5CITA 2FW6A 5AM1A 1OWOA 4J03A 1W2HA 4BKPA 4HBGA 1W5EA 2IHTA 2WWIA 2VAPA 1P8AA 1I2ZA 3E27A 4AY5A 2DY0A 1MO5A 4CHGA 4Q3OA 2YC4C 2V7GA 4PFJA 2QUHA 5JFOA 4MVJE 1KNXA 3L8EA 3VX4A 2OESA 4RS3A 5KO2A 3ZQUA 4KDEA 1Y3IA 1OPRA 1R74A 4Q4JB 5ELLA 2A7QA 3NBUA 4RD1A 5HGXA 4NYMQ 2Q6OA 3HUEA 1S96A 2D5LA 3ODPA 1XRMA 1TK9A 1KSFX 4PZYA 1T9AA 3NUQA 2ZSBA 4TWIA 4UOZA 5CDYA 5I5EA 4KLNA 3ELDA 2B8NA 5FV7A 1H5QA 3I1FA 1EGHA 4PLZA 2PL9A 2QI9F 2GLUA 4UW9A 3K5IA 1K98A 4JR0A 4OMDA 2JJYA 4OB6A 2VJYA 4BWFB 1AKNA 5G4KB 2AOXA 3C6BA 1CZUA 5PGMA 1VFPA 3PPYA 4O2AA 4WK0B 4ZGBA 4QIHA 3HJFA 4KWCA 4FONA 3FPJA 3IBSA 4X1KB 3IC5A 4P2GA 4AXXA 3QTTA 5KYYA 4AS1A 2YIJA 5C1PA 3WYEA 4DR6B 2Q1WA 2VATA 4TZKA 1N0VC 1NV9A 1QC5B 3AFIA 4DADA 2OFFA 1RKUA 2H5IA 4QU5A 3OPVA 1CS0B 1Q11A 1JDBC 1UDRA 2OM2A 4XGIA 2G1AA 3ELYA 5THXA 1IG3A 5JNLA 1SKYB 2BMDA 1JKFA 2Q1TA 3I0ZA 4C6TB 5JJIA 3RKRA 2GEKA 1Z74A 5E7MA 4ZV7A 2XZOA 2Q50A 1LEHA 4D4LA 1BSVA 2UYYA 4FFBB 1QS0A 1TKBA 2OCKA 3GJYA 5IC4A 3ZCPA 2W43A 4M22A 4DYDA 1I6WA 2BGLA 3GLRA 4I5GA 4LIPD 1TU4A 2FH5B 2G1KA 2BFMA 3C45A 3UT6A 2MJLA 2NSHA 1C1YA 2J0EA 2ZBDA 1UT5A 3H5OA 1I5RA 2R7KA 3BVPA 2WM8A 2DKFA 4GSYA 8ADHA 1TU0A 1W0CA 1LCIA 1T5SA 4HVAA 4XGNA 1X7GA 4BOYA 3VMFA 4CR8A 5AVXA 3BRQA 4C7KA 1DBRA 1XEXB 3COPA 2C58A 3NTUA 1NXSA 4J16A 4D56A 4RTOA 3COZA 3Q7RA 4C22A 3X1KA 3DMDA 3PJFA 5AHOA 1V48A 5HMLA 4F45A 4DV3B 1NMEA 2G08A 5KVQA 5DYWA 2P27A 4B46A 3DUWA 1H69A 3E0QA 4R9RA 1TLFA 3ZW8A 4ZVQA 1CRWG 1USGA 2I3GA 3C6KA 3PYMA 4YRRA 4Q4CA 5A9RA 1ZXXA 5KDOA 1TYBE 4AW9A 5CDUA 5JXIA 2IKQA 1MAHA 2FUNB 4GBGA 2YXPX 3MS2A 4BLUA 5KCZA 3NIGB 3JD2A 3HCRA 1AUOA 1WDTA 2I54A 1J9ZA 4LE0A 3EZNA 5FWAA 2AT1A 4DJFC 4GKKB 1HM5A 4AMYA 5KWIA 4D82A 3DKIA 2AKEA 3B3QA 3VHLB 2BM8A 4I9GA 5DGIA 3GFPA 3KOMA 1DEAA 2IE0A 2GD0A 2JK0A 3HMKA 4WJZA 1ZJYA 2VHVA 1T9HA 1LWOA 4MVYA 4Q16A 4R2IA 3AUFA 3HDGA 4REOA 5D84A 3WLMA 4AC9A 4EY5A 5KOIA 4MP6A 4FDVA 2L18A 1BMTA 1REQB 2FEPA 4EYEA 4L8GA 3D43A 3GAMA 5T4BA 3IIMA 3GGPA 3KFXA 3QUTA 1KQGA 3UT0A 3OC6A 1MOSA 1JHDA 4KAJA 1IN6A 2AG0A 3OJOA 4Q66C 1GARA 3CPHA 3X3HA 1GSAA 2YMMA 3CPJB 4UUBA 5FOXA 5BWCA 2C4TA 1TADA 2BEKA 2HJWA 1L5HA 5LUAA 4BC1A 3OO1A 1CR4A 4GOMD 4BNLA 1FFEA 1A8UA 4H1HA 1P2GA 1NF8A 3NBAA 3OA2A 4H3HB 4NPAA 4S1OA 1L5NA 3RFTA 4TMWA 4YIKA 8ATCA 2X14A 3GEBA 5IZ4A 4AG5A 1JG7A 4V1CI 1BMFD 1JLSA 2RG7A 3ZCUA 1BC5A 1TVKA 1VHWA 2F3UA 2ZYGA 1XQXA 2X8JA 3H4MA 1EX6A 2Q1UA 4JLNA 4ARSA 4EPVA 5EPOA 1YUNA 3ET4A 1CY1A 1QTRA 3G0CA 5KWJA 5GOZA 1RBMA 3D6TB 1RWKA 4RTJA 2PS3A 2WJYA 4ZMBA 3FOEC 1LA2A 4ZO9A 3U44A 2VXOA 1OV4A 4LZWA 4EKEA 3ZHUA 4Z7QB 1E9SA 1YMVA 2VYCA 4U9IS 3PDIA 1PJ2A 1TZJA 4G0MA 3BMOA 3AIIA 4F38A 2YJ4A 3U7JA 2UZ1A 3VPBA 3HWX1 1P80A 2ONYA 2VJMB 3HV2A 4WD3A 1EP1B 5LDGA 5DTJA 2ECFA 1E2HA 1QVVA 2V1XA 3BORA 4P38A 3AR8A 4A1OA 1XHFA 4L75A 2WWFA 3L7YA 1H2RS 1KDTA 5TGTA 5LPNA 4OBBA 1FMFA 3P8ZA 2DUJA 5BN4B 1HLPA 3DEYX 5IKXA 3NGLA 5FHRA 1JJAA 1NVFA 2Q2QA 3P4YA 4W7SA 2OP1A 4YUVA 4LRXA 4FS8A 2A9PA 4PS0A 3W2GA 3WL5A 4D79A 1JHPA 2WAMA 5JY6A 2BISA 2OUIA 3FPAA 5E6UA 2JDIA 2YJZA 3WL8A 3ZU4A 1U7UA 1G2IA 1R88A 2LGJA 3CY6A 3VTFA 2OO3A 2GT1A 2ZDHA 4KFUA 3ISJA 2PVPA 3H5LA 4GSLA 5KJ6A 4ND6A 1NNEA 3A14A 5J2TF 4OHPA 3V8BA 2BFPA 4FKMA 4P81A 1I9GA 3HWWA 4UHHA 5KSZA 1XSEA 2BFEA 4BCCA 2ZJ8A 3HI4A 3TIXB 1HE4A 3IEMA 1A82A 1IXYA 1I10A 3IIJA 1KJQA 3MBOA 3OT5A 4GXTA 3RBXA 4KREA 1W88B 1QB8A 4JI3B 5B1SA 2IDZA 3ITKA 4JLMA 3S29A 3WDSA 1XRJA 3QKSB 4FFRA 2ZR9A 3TI7A 4I2VA 2I22A 3G7NA 4KV7A 5ALLA 1T5DX 2JHGA 2FHPA 2P2NA 4IRMA 5CP8A 1CQXA 2WNHA 3C5HA 2UZ4A 3S2UA 1Y6JA 3T4EA 3W5JA 1W96A 3PS9A 2BIFA 1SHKA 1Y4SA 3KTOA 3P5SA 4X61A 4CV0A 3AVUA 4TL8A 4JYAB 1RCUA 4DA9A 4G0PA 1DPGA 4CTKA 3SHVA 2RJ3A 3HUDA 2Q1YA 2J5KA 1MHTA 4L8VA 4CQLB 1ICIA 4N54A 3UBMA 4IX1A 5JNTA 1U3TA 4IDOA 1RAIA 1NN1A 1P1FA 4RZUA 3OMLA 1ZA2A 5GY7A 4D5EA 2R8BA 4NYMR 4BQNA 2RCNA 3VZCA 1L7NA 1CF2O 2J3DA 2C7OA 4ZD6A 3SQXA 5FPKA 1Z7WA 5MDHA 1ZJWA 2B8EA 1JFSA 3K0HA 3P9CA 4AAYA 2PZFA 5DCWA 1IDOA 4OP2A 5JCPA 2WWHA 1CUSA 5TV2A 4RZIA 3QEMB 4KPGA 3C85A 4YH1A 5JNRA 1OZAA 4LK3A 2QVCA 5E9QA 4CMIA 3I9MA 1KC3A 1PFVA 2XYGA 3WGGA 2GPNA 3JQPA 1E1CB 4YAJA 4KNYA 4R1QA 2EFDB 3WZLA 2DFTA 3FMGA 3P4XA 1QIKA 4BVHA 2ZPTX 3UPTA 3A32A 4FE4A 2Z4SA 4KQMA 4N8DA 1NBME 3MCAA 1PBNA 1GZ5A 1E7MA 2CDNA 5FYQA 3W0LB 3N9IA 1ZU5A 2XNDA 4TKVB 4C2BA 1R4MB 5JW6A 2ODTX 1II9A 1ZLXA 5F2OA 2OLJA 2PT5A 2Z5GA 5AR1A 1KYVA 2VOJA 3LBFA 3QMWA 3HCAA 4U7DA 2JW5A 4MUHA 5EKDA 1PJLA 3QHQA 4RD3A 2NPIA 3GJZA 2IRWA 4F9FA 2O3UA 3N8KA 2OK7A 2O0KA 4N6NA 2F1OA 2QLJA 1DXQA 3AEQA 1V0JA 4GZMA 4QXMA 4UBJA 3U9SA 1OFUA 2Q8QA 1L5MA 4YMIA 1F8FA 1L5SA 3MGKA 3GGGA 4URYR 2CF5A 2UZAA 1MJ5A 3BHNA 1SA0B 5K0BA 2QTNA 3FPCA 4P8RA 1B15A 3G2JA 2JIMA 3B1KA 3TIVA 4DEXA 1FTNA 3TZKA 2ZI4A 1DQZA 3WK4A 1H2XA 1JXQA 1T6ZA 3OIUA 1MXFA 4M99A 2XTAA 1SRRA 3E6AA 1NVTA 4PPFA 4X7PA 1Z7YA 1Z45A 1DELA 4WADA 2CJWA 5LQDA 4CN8A 1YFLA 3AF3A 4NCAA 5GPBA 4S3MA 4TLLB 4YO8A 2RFLA 4JT9A 4A0HA 2V5AA 5D00A 1J8YF 4G89A 1QK3A 4W5TA 2H57A 2J31A 1R9NA 4GPIB 4QUHA 3EVNA 3JQQA 1QFSA 4G6ZA 4R7ZA 4GFDA 4LZJA 5JPIA 3STYA 2CBZA 3T06B 1JEAA 1N5OX 2HUNA 4P3YA 4B6PA 3IR7A 1K3TA 1COZA 3EUWA 3EBOA 1NAHA 4X0EA 5KJ1A 2GRUA 3EBLA 5ALUA 1OXVA 3B36A 3CC8A 2CJPA 4LXIA 1T8WA 1VSBA 2C1ZA 4CLRB 1KIAA 1N2BA 4EATA 1IZYA 1B8OA 5F51A 4F5ZA 1UBEA 5CIQA 1ZAYA 3V1MA 2AQ8A 2V6JA 1RZUA 1VIMA 4O2BF 4UUAA 3WNCA 2FSGA 3ZY4A 5ALHA 8ABPA 4TWJA 1T5IA 3OEWA 4MHSA 4RKEA 1VHTA 1NG9A 1X1RA 3SBOA 3AEUB 3ZGLA 4B0PA 4IR7A 1YFZA 2FK8A 3I92A 3M4JA 6GPBA 2XCSB 3GEGA 3H5IA 2WAOA 1MFZA 3TUJC 4XVHA 2ERXA 1FVOA 3SZGA 1UT8A 2OK8A 2QRVB 5KREA 1KO4A 4REQB 2OZPA 3R74A 4L4XA 1UJ2A 2GZ1A 4PLGA 3I4FA 4NEQA 2Z1NA 1ZH6A 2QRJA 3G2QA 5J4LA 2PJRA 3AJDA 2OCBA 2D1FA 3ITDA 2OZEA 1XLUA 1B1AA 4X8LA 1I33A 1F9EA 4KI7A 3HY4A 1M5RA 1L4NA 3FPFA 1C0EA 1PT6A 1AF4A 3G5LA 1OXKB 3DF7A 3H87A 4BFSA 3LW7A 4DR7B 3N3AC 1R8JA 3STTA 1VGVA 4NOJA 2DSTA 1YVDA 3T0IA 4CM3A 4QYIA 3LYUA 2DC1A 1CJUC 1ZD8A 2W6IA 3B2EA 4JENA 4LYAA 4PC3A 4OGLA 6YASA 3PRKE 1SIBE 3L18A 5HFNA 1JWBB 5EC8A 3KYCA 3LC7O 4J0KA 2HCJB 1GT6A 1W4RA 2X41A 1JALA 2EFEB 1PVDA 2Z2ZA 2QPOA 3BFPA 2IYVA 2XNDD 3CG0A 1L6RA 3DDCA 1ISHA 4JYZA 3ZDCA 2NYAA 2J6BA 2AI1A 2LV8A 3QX7A 3RS9A 1NSTA 3MAJA 4B4DA 1LGYA 3E15A 3KJZA 3OSZA 3O3NB 3IIEA 5KB3A 1H1TA 3TAHA 1AV6A 4FR5A 2BHLA 2HCFA 2EOAA 2GF2A 3K20A 2J0QA 1DKPA 4N5DA 4EW1A 5JALA 4UMVA 4Z7JA 3THYA 3DR5A 3R7FA 2Q45A 1KSGA 1KMMA 2OGUA 2BKXA 3ISTA 2P77A 4G5QA 3GDFA 4Z86A 1V6SA 1SZPA 1ZSNA 2OHIA 3QLVC 1QFZA 4IIUA 1RQLA 2P5UA 4WJKB 2O7SA 3H0CA 4M4SA 3GEIA 3E58A 1XZDA 1OASA 4PYIA 4CQLA 2VHYA 3MMSA 4RKQA 5CYPA 2F3PA 3ZY2A 1AN0A 1FVHA 3V1TC 5CGZA 2XRYA 3CLVA 2II6A 3EDMA 3GUVA 2EJTA 2H2DA 2ONJA 3WIOA 4DR5B 4Q7QA 4LWQA 4LV5B 5DHRA 4UCWA 1QH8B 3MXTA 1ETHA 1GSOA 2F67A 2W6OA 3VV3A 3N28A 1B6RA 4BL5A 5L3SA 2V97A 1EWKA 1N6NA 1ZNXA 3MLBA 2YWCA 1T3HA 2IYWA 3V3KA 5BWLA 1AK2A 4FQ7A 3TLXA 1Q2XA 4NFSA 4UD6A 4IO1A 4RX1A 3FKSA 3U4IA 4OA5A 4HDNA 2YXNA 1SRQA 1N2GA 4BVAA 5JFTA 1PWEA 3FSGA 2XCTB 3BE6A 3NWBA 1O9HA 5ALSA 1U7XA 4HAIA 4KWHA 4WNYA 2QG6A 4LBZA 1LPPA 4BV3A 5CFRA 2Z3WA 4U63A 5KDLA 2F8LA 5EWMA 1WXDA 3IXQA 2DPLA 1U81A 1RU3A 2XYRA 1A4UA 2ENUA 4IXTA 3WB9A 4CMBA 3LE8A 2QP9X 3WNVA 1E2FA 3MM4A 1CR6A 3IQFA 4LTDA 1UXGA 4RAOA 4R0MA 4W9MC 4KN5A 3QX9A 1NSYA 1A1SA 1XNQB 2H07A 2JLUA 3OE4A 2QQ0A 1EUDA 1KRWA 1YVEI 1T5LA 2G25A 4ZTUB 2NTJA 2XE6A 5EXPA 10MHA 1SCJA 1ODCA 1YZYA 1PG2A 4TUYA 3LBIA 3NEPX 3W6PA 1AA9A 3D3NA 3S2YA 1H9CA 2I65A 2EWMA 3LBAA 4HR7A 2DFLA 4BNUA 4YRZA 1JLRA 4A91A 3R9WA 4D99A 2R7LA 3G85A 1S2IA 4U4AA 2W8ZA 4J0QA 1JI0A 2LWIA 1GIAA 2VQFB 2XJ4A 3P71T 2UXDB 5BXQC 1GKYA 1N5KA 2FMIA 1XDDA 2IIVA 1WM1A 2M1XA 3Q6MA 4JT4A 4PCVA 2Q3BA 3TB4A 3A27A 2IIPA 1QGOA 1TEZA 3OTGA 4B6SA 2EFYA 1BHJA 3MRSA 5FYDA 1ML4A 4Y6SA 1U3VA 2C5AA 3GIDA 1ZICA 5DTQA 4P4LA 5LXTB 3N07A 3ZH9B 4ZCPA 1TA4A 2NZYA 4WERA 3VDNB 2ZIXA 2OAGA 2KX7A 3T52A 5JV5A 3H6GA 3THSA 3N59A 2XXAB 5F4ZA 5GV8A 4AZ0B 3O8DA 3EAQA 2C0CA 4FN5A 4UDOA 5ER6A 3L4JA 4HB3A 3SKYA 3GXBA 3MTIA 4MPTA 3P0IA 4OQPA 4BFUA 1IN8A 1UBKS 5GONF 2R7NA 2GJ9A 3LNTA 4U2GA 1KAHA 2P2GA 1X80A 2HPVA 1T8YA 2Q3LA 2REOA 1DI0A 3GD7A 4LAFA 4U7GA 2B69A 5GVRA 3ZJUA 1I7QB 4CMHA 1USVA 1JHYA 2HRZA 3JASA 3VQTA 2J46A 1P72A 1BX0A 3QUAA 3GY0A 2FMUA 4YCAA 4QULA 1P18A 2MSEB 1VJTA 1Z0IA 1HDRA 1J56A 2GJ4A 3CE6A 3JW8A 3M1LA 4YAEA 3FOFC 2G04A 2I3BA 4R16A 5J40A 1TKRA 1PN3A 3ZTYA 3QF7A 4CIAA 4IKEA 2LIVA 2WG2A 3DHVA 4WZAA 1GPNA 3AM3A 1K0UA 1HFJA 4YMHA 1NL3A 3KWFA 4MUFA 3UUGA 3CF6R 4OG2A 4HWGA 4YP9A 1ZI6A 3CJQA 5EMJA 1L5LA 3EVZA 4QEZA 2X0JA 4WCVA 1TRKA 2BONA 3SAJA 3V8MA 4ZJYA 1KQFA 1X1BA 1M5UA 2VDMB 1JA9A 3M70A 1B8UA 2W4QA 4XUDA 2OO5C 4Y2YA 2G9VA 1WMSA 5EPUA 2ZRMA 4FX2A 4UHCA 4PN3A 1I3LA 2HLDA 3AZPA 4D4JA 3ELBA 3NO4A 3C3BA 4LYEA 1O8CA 1TF5A 3VC3A 1LBQA 5I9SA 1ZY2A 2OORA 4UCXA 4YI5A 3O31A 5K09A 1E99A 3HS3A 1F8GA 1XTIA 3TKAA 3PL5A 5HF5A 4BFYA 2Y1DA 2M2IA 4WVFA 1ZOSA 1ZISA 5JZBA 1HZZC 3MWDB 3QJGA 4WK2B 5DDIP 2C2GA 3WNBA 3ZHYA 4EEKA 4N49A 5HIKA 4MR9B 2WZDA 1PGNA 1JVBA 1VCMA 3JQAD 2QTLA 3ZXUB 5TMDA 2GO7A 2Q28A 2VP2A 4MKRA 5FQNA 1RI5A 4Q48A 2D0PB 3FKSD 2QTVA 3H2KA 2PX8A 1L7BA 4H0FA 1GLNA 2BKAA 3PZRA 5K3EA 4FFMA 5KYVA 1P29A 1TD1A 4PAGA 2W98A 2ZVDA 3WGKA 4EKNB 1B6GA 2G28A 2VP0A 2Z8ZA 1WWKA 1XJQA 4CGYA 2QT9A 3TFOA 3I9V6 5DNWA 4N7MA 2J6IA 2G1JA 3UWPA 1L4BA 1XZJA 2EJWA 4ND8A 3PT5A 3AY0A 4FLEA 4NU6A 3RGWS 4FOTA 1GZ4A 1KK2A 1HL7A 4TS1A 1XE3A 1Z6ZA 1T3GA 2H2WA 1LI5A 5F7JA 3WYDA 3UOGA 4DJTA 3FH0A 1SVUA 3D4OA 3DCJA 3KUXA 5FOWA 3B5JA 5COBA 5BY2A 4D74A 4BP1A 1XGKA 3FZEA 4FIDA 4LJAA 1GTVA 2PWPA 2VJBA 1YS7A 5C81A 2VP6A 1T4CA 3EN0A 1VI6A 1QP8A 3PDHA 3AYZB 1RXSA 4YHHB 2CNKA 4K1XA 3S5JA 4LJ9A 1WSDA 1J42A 3CLUC 3FLEA 4TTTS 2X2OA 4J0FA 4G86A 4JQZA 4CG0A 2AFIB 5AW3A 2MWMA 2XNKA 5EXTA 1C7IA 3B78A 4CEHB 3A7EA 5JDCC 3T95A 1N1DA 5EXXA 5C46F 1V3QE 2C2YA 2C95A 2A9QA 1COWA 3ZXYA 4Q3AA 4DLKA 5BQ3A 1JJVA 1A8IA 4URWR 1ZIDA 1WD7A 4AIIA 1Q0PA 3P9XA 3ZBUA 2AIRA 3M9LA 1ZW6A 4L07A 2ID9A 5JH7B 2G17A 4K5QA 4NBNA 5AQEA 2YRWA 1SKUA 1XMIA 4G41A 4H3KB 5I01A 3KJFA 5KTTA 3NMUF 5F9FA 2GYWA 4HDKB 1AY0A 4G1CA 5DWQA 4E7OA 1IL0A 1UZMA 3FYDA 3P2MA 1OVGA 1Y89A 1XPUA 2YY6A 1KY4A 2GH1A 1NX6A 1BJRE 1E62A 1WU7A 2WUGA 3PPWA 4KSYA 4MS4B 3AHEA 1E2QA 1RAGA 4XDGA 5DHFA 2KJQA 2X3FA 4I3HA 2P6MA 3OKPA 3WIVA 4YJ2B 4RKFA 5J47A 3ZJ4A 4F8YA 2VA8A 1KYQA 4WKPA 5FFNA 4AL4A 5DM70 3X44A 1BMQA 1YKGA 3RSFA 3BMCA 4XXHA 1I3CA 1MENA 3I37X 1YDHA 1M1NB 2XRMA 3PI7A 4RFLA 4B35A 1R10A 4YPVA 2GN4A 2HWUA 5L3SB 4M7RA 1L8OA 3SXUB 4F06A 3P2IA 2UUBB 3IIKA 3HUTA 5LWHA 4AF6A 4NG4A 3ACBA 4EA7A 3WQSB 4QFDA 2HXYA 2BAGA 4TKUA 4AO7A 2C84A 4EO7A 4YT4A 4FHGA 1C8KA 2PKXA 3LP5A 5B37A 3EOZA 2VPZA 3IJPA 4TVKA 3V4ZA 2GLTA 1OAOC 2ZRBA 2ZRKA 4DNOA 4C6TA 2HBRA 1OU0A 4UQLA 1CF9A 2Q9CA 4OKSA 4QUGA 5L45A 2DR2A 2FUG1 3E9QA 1NXVA 2P2LA 4R9UC 4RTPA 1DRWA 2R8RA 3MJSA 2I6SA 2ZJZA 3MJVA 2GJAA 3IOMA 3PA6A 3H2HA 3E8MA 1KDOA 2J0UA 5KNDA 2VF7A 1ST3A 4RGBA 3PC7A 3PF8A 4ERXA 1TVMA 3KC2A 2OO7A 4TSFD 3DOEA 5KTKA 3ABRB 1XCOA 1HKUA 3L1IA 3Q3HA 3A6FA 3IUSA 1EGMB 2X7XA 1VBKA 4LYJA 2TSYB 4MV1A 3UYLA 2JH3A 2LZ0A 1JSXA 3KNZA 3SOPA 1M2GA 3GYGA 1H22A 3DXZA 1RAAA 1HFKA 1O94C 5H82A 3TD6A 3MIIA 4G63A 2I87A 2RAFA 1EK5A 3JQFA 5DYTA 1ECFA 2PU7A 1GNRA 3TLZA 5HILA 1MG5A 3GVXA 3OHPA 4D8VA 5EIHA 4CI9A 1PLLA 3EUFA 4LS3A 1DAHA 3FYUA 2W2QA 1ZR2A 2EHJA 4OK6A 1U8YA 4Y2PA 5IAAA 1PUXA 4EIWA 4RFSA 1M6WA 4QBTA 4BP9A 2QYOA 4LVOA 1ZZGA 4YT5A 2BBTA 3DLPX 4H08A 3GLGE 1R0RE 3B5EA 3U81A 3WKDA 5KKNB 1YRQA 3OQMA 3EEOA 1K7CA 1KR5A 2YWXA 4J2OA 5BMVA 1H0SA 1TAQA 1S01A 2MR6A 1R8QA 2W2OA 3NHJA 4L5IA 2VA9A 4LHEA 1OV6A 3BAZA 3GPIA 4M9XA 2WICA 3SE7A 1FXWF 1H2HA 1K75A 3GD5A 5FQOA 1PFKA 3GDHA 1Y6GA 1OA1A 1WCIA 1C7JA 3FNQA 3SCZA 2ZQYA 2RD2A 2AW3A 1A5SB 3I58A 3QW2A 1NW4A 2AQIA 1IXKA 2XKJE 5EESA 1UMDB 5FUVA 4EI8A 3GFBA 3NIFB 1KJNA 1R5NA 3V9AA 4F4CA 1J9GA 1GV1A 4IDFA 4M98A 1YI1A 2AG5A 4RNCA 1Z6TA 1DV2A 1U2QA 5B4VA 5JJCA 5MN6A 1QYWA 5K3AA 1KWKA 2H1HA 3QE9Y 4Y98A 2IU0A 4G0YA 4I50F 1KI6A 3Q6NA 1P7CA 3OG9A 4Q9KA 2QZ9A 3E35A 4QU0A 2MSCB 5F1YA 3WZ2A 2R00C 3OWOA 4NPCA 1BN7A 1GN9A 3KKOA 2PBZA 2ZUCA 3LMKA 3B51X 2GKOA 3CLTC 2RI1A 4OQNA 4QOGA 1CUAA 1EM8B 1SPXA 2OBMA 5KIAA 1JB1A 3P9ZA 2RE8A 4U2DA 4XASA 1NLMA 3S0JA 4E2FA 3LSYA 5DI3A 3BJRA 3G0GA 5CH8A 1MB0A 2QRKA 5IJ0B 2WJWA 1UBFA 1N6HA 2CK3A 2H1CA 1AHPA 3VKVA 4W5RA 3SLGA 1UQTA 5CVCA 3X1WA 5FL7A 2EYUA 3D6HA 1C30A 2XEXA 4RGYA 1UKCA 2HL6A 4B7XA 4TYMA 1JHAA 2F1IA 2H8KA 4GT1A 3WMWA 1SEVA 2B2CA 1BKSB 1F0YA 2YVQA 2OXTA 3ESCA 1UBNA 1U3FA 4HMQA 4HQ6A 3KJXA 1FB5A 4N6GA 2BGRA 3VH2A 5EYPA 2O8EB 3L4SO 4B4VA 1UR5A 2CYBA 4TYYA 3B1JA 3Q7SA 4CODB 1MLDA 1T6BY 3F6EX 1XTTA 2ZSAA 4RQAA 1EVJA 3PR1A 5GM2A 1EX7A 4OLFA 2WFMA 3PFBA 4IDQA 1UEIA 3L0YA 4FHDA 4L3VA 4MDEA 3D2BA 1HTWA 1A9ZA 1D0VA 2XCQA 3PD0A 3QV1A 2GKGA 3C3CA 3PGXA 5J4HA 5A5FA 3TW8B 4FJ0A 3QG1A 1SMKA 1E79A 2EQAA 4MW9A 4ROTA 9ATCA 5DHAA 4BVLA 4JP1A 3CUUA 3R23A 2GBCA 3TNJA 1EJ2A 4DRXB 1RZRD 3TVYA 3J7AC 4N5MA 1MT3A 4MEJA 4JGGA 3N75A 1KPIA 3RUEA 5BOSB 3K7EA 4DCOA 3FTFA 3OPNA 3T5TA 4JHLA 5FTJA 4N3BA 2W2LD 5CHYA 2YFKA 4F6RA 4QYMA 1WCWA 4JXZA 1EEHA 2WWRA 5KC8A 2PR2A 5FCDA 2JLSA 1F4VA 2VPXA 4GM0A 5A5DA 3PHJA 2VH5R 1Z17A 4CMCA 1U8UA 1C8LA 1AHNA 3TUIC 3BHJA 4DCJA 3LVRE 4AO8A 3OZTA 5I9NA 1Y7LA 3IB6A 4W9NC 1EFCA 2ZR0A 1R9JA 4IQFA 2YC2C 3EY4A 2BKLA 1SCBA 3S28A 4A8TA 2WUEA 1ZN7A 3Q2OA 3EMVA 2HWXA 4PO1A 3KCQA 4HLNA 4K1LA 3JQ6A 1WXHA 3NV7A 2HA7A 2JI7A 4S1PA 4AKTA 1N0HA 2PBFA 1CNMA 1MV5A 2XR1A 3JARA 3CX3A 3K31A 4YJHA 3SFTA 2WHXA 2E4XA 3OVMA 4MPRA 4MGYR 2HF9A 5H4GA 1WDLA 2P91A 2AMFA 5ENDA 3RAGA 2RIRA 3CLRC 2YYSA 1MP0A 2C00A 2NO0A 3BPSA 4IVPA 1XJWA 1HQKA 2R7AA 2VDQB 3T4UA 1GAQA 2VAVA 1ZM4A 2GUWA 2Z30A 2ZR8A 4GOOD 1JNXX 2NADA 1FFXB 3KTFA 1JIIA 2WAYA 1C1DB 2XXBA 2PUEA 4JR2A 2AF4C 2ZTHA 1JHUA 3SSNA 1EJ0A 2HA0A 2VC2B 3GVPA 2IPAB 4V0OA 4GMHA 3LK6A 4Z1MA 3KHTA 1QVZA 3DZJA 3A70A 4PINA 5CTAA 1LPNA 4L4ZA 5LA6B 1FTWA 3WLIA 4PAOA 3HV0A 3IVGA 2QB5A 3FDIA 3ABZA 2BFFA 3S2ZA 2GHQA 4ZN6A 1Q0TA 1WDWB 4KXXA 1U8ZA 2C0PA 3OEED 4F60A 3EPLA 3HL0A 4Q05A 1FYVA 1RTKA 5MF6A 5DIZA 1U1FA 3DAGA 1Y7PA 2YYYA 4RVUA 3RSSA 3GP3A 4TSRA 1ZEJA 1AE1A 5JS1A 1TLTA 5EP3A 4AG3A 2LCIA 3RJMA 1AKWA 2W2XA 3K70B 3WGOA 3CEHA 4Q02A 3G2HA 4M86A 1H05A 5K6AC 3X1DA 4UHBA 3EHDA 2ODAA 1Y1SA 2ID4A 4B71A 2O5VA 1DUIA 2JFQA 4Q1EA 2DOKA 4Y2JA 3EOAI 3LUPA 2WM9B 4CF5A 4QUKA 4EY7A 4ZCTA 1EWQA 1DMRA 2V3CC 2PV7A 2XUDA 4DMFA 5ECDA 1N2EA 5CR9A 1HQYE 4P82A 5LU9A 2N0SA 1YDFA 5D3KA 1BKDR 5C3UA 4EGAA 4IV5A 2I8LA 1EEXB 5C8DA 2NUTB 3WISA 3FYUB 3AP2A 2R6CA 4I8DA 1VSVA 1M1ZA 3UK7A 3VZPA 4UU8A 4FQ5A 4QLAA 1H2YA 4MDHA 5KSYA 3WYCA 1HFEL 1SOWA 2ECPA 1OH6A 4Q1DA 4GZ3A 5KAMA 4DA6A 1Q21A 3F1KA 3RHTA 3AMVA 3BSFA 1D6JA 4M7WA 4Z1OA 4G5XA 2D2IA 5AJZA 2VRBA 5FUBA 1GUYA 1GITA 2BHSA 3UMYA 1UFOA 5BUSA 3KUCA 4QEDA 3ZWXA 1TYCA 2QXUA 4LQDA 3O1LA 3LKZA 1XX6A 1MX3A 3QPVA 5AKJA 2OA0A 4EZBA 4OQFA 1PK7A 3WV4A 1US8A 2P67A 3PV0A 1SBNE 1WUYA 4D4IA 4TV8A 2XQJA 3M6WA 1UBGA 3FRHA 3THOA 5DNCA 1H0KA 4ZOLB 1XYVA 4FZRA 3GN2A 2WQZA 3Q88A 5GADl 5KYYB 3BT7A 1RWQA 3E7XA 2FPKA 4BQOA 1CZLA 3OY2A 1N3LA 2CXTA 2FW9A 3AVPA 2YV2A 5JTUA 2RBEA 4FDTA 4TV9B 1DAFA 3A9TA 1O95C 1XVVA 3NDRA 2P7IA 3OPYB 5DRTA 3KQLA 1LI7A 1CQPA 2C82A 2WF8A 2IU4A 5IBRA 5BUCA 3EXFA 4OL0A 1ONPA 4FHFA 3TTUA 1FPQA 4XVRA 1QORA 2O8FB 2EP8A 3LYLA 4BJ3A 4ECAA 5JANA 2R68A 3JQCA 3HCFA 3CVWA 2KPOA 3QSGA 1AKUA 4YRQA 1Z39A 2FDXA 1ZK0A 1MH9A 4TTSA 4GL2A 1MO2A 1Z6YA 3CW2A 3RIMA 2ZM6B 2XB2A 1CSEE 3G9TA 1UBLS 4LOIA 4N4AA 4MDYA 2OYCA 5LKRA 2HK7A 4ZZIA 4BRSA 2NTVA 3AIKA 3G0IA 4DB4A 3WYBA 1ZM9A 1P39A 4OMCA 3J81k 4D9MA 4UKDA 2VCEA 4AJJA 3N0XA 5CVTA 2F9MA 4E5KA 4GG1A 5AKIA 2NM0A 3L7DA 3QW4B 1OXTA 3GFRA 1QG0A 5DASA 4DY4A 4IDGA 3I2GA 3LQRA 1ZZEA 3TPZA 3L6RA 4DQ0A 2YW2A 2HJHA 1L7PA 4KSCA 4I4TA 3TM4A 4P54A 2Y27A 4MRRA 2OEPA 3ZDFA 4Q3LA 3N2LA 2XADA 4H7IA 2J5BA 3VYWA 4ALMA 3OX3A 4KC0A 5B6JA 2RONA 4I99A 2ANBA 4IV8A 4OUDA 4ZU1X 1E7SA 2XCRB 2FQYA 4YP1A 3MMPA 2JFBA 3LKBA 3M6IA 3LBNA 4PAQA 2ZP1A 2ERCA 3KYDA 3TLGB 2QD4A 4JUDX 4UTOA 3T5MA 4CLOA 2ORWA 2RHLA 4HFNA 3S1LA 4YV7A 1NXOA 2B82A 4IMIB 5IEBA 5F52A 3DTVD 721PA 4CQNA 3I6MA 4F9TA 2R97A 1C41A 1ESDA 3O92A 2BMEA 4RZSA 3VSCA 4A16A 1EWRA 4UZSA 1E5VA 3G6WA 2AN5A 3OETA 1T0IA 1YS1X 2HB6A 2Z2IA 4IJ6A 3LCRA 3OLXA 1IK6A 4R8MA 3GJ5A 4RK6A 5HCUA 3T3EA 3SY8A 4ZJPA 1I80A 2GD2A 2OM6A 1IZZA 1CVLA 3HYNA 3IV7A 3O38A 3FZGA 3Q3CA 1Z7BA 3RRNA 1JI3A 3JU3A 1KFBB 4GDFA 3CV3A 1LV8A 2IXGA 3DULA 3KKQA 4FQ8A 2OHHA 1XTUA 4RSHA 5BRAA 5HKKA 2QN1A 1GQ2A 2WR8A 4P5DA 1GTL1 3ZVRA 3DONA 3H13A 3FM9A 3QITA 4GYYA 4HNHA 2Q6KA 3ENQA 1N3YA 3SLKA 2F3TA 3ZDYB 1OTYA 1ULUA 2O06A 1RS0A 2Q3FA 5A03A 1DJNA 2PKYX 5I7OA 2QTWB 1KDZA 5I4BA 3KDPA 3Q72A 3L6OO 3WC4A 1EG2A 1TD9A 3D7KA 1MOPA 2Q3JA 4UZFA 3ECCA 2DUMA 4F3CA 1JKJB 3JQGB 1M0WA 2CNNA 2RH9B 5AI8A 5EKXA 5JCJA 2VJCA 3SG0A 3MS7A 3QXCA 1ZHOA 2GPSA 3QPUA 1BMFA 2YFHA 4QDKA 4RIIA 2HAEA 4EG8A 2GFIA 1PCXA 3L6BA 4WXPA 1QHGA 1RHKA 1GSIA 3EVFA 3N1UA 1FDUA 3K4PA 1JU9A 3SQOA 2CMGA 4FYKA 3IE2A 1J90A 2BN4A 5A7FA 1SG9A 1Q1NA 4V0KA 4DJJA 3NHMA 2X86A 3WHIA 4E2WA 4FB4A 1JG4A 3SJZA 1M1YA 5BQFA 3AF1A 5FTKA 5GIOE 4PQRA 3PX3A 4YCSA 1FJGB 3RVJA 4BFXA 4DPMA 3BD7A 3D1JA 1GR0A 2G0AA 2D3TA 1IBMB 2VSFA 4AMGA 4PC6A 2QMZA 4CZ2A 3TZLA 5KINB 8AT1A 4MUNA 3JD1A 2CLSA 2GO1A 2AL7A 1NY6A 5IJAA 2A5YB 2ZJAA 2NTYC 2PRSA 5EN4A 1QDEA 4P93A 4XCXA 1Y34E 1OYOA 5TSDA 1XPJA 3S7TA 5ISMA 3CUVA 4P4NA 2OCIA 2BI8A 3K92A 2OHJA 4NLLA 1V1JA 3RSQA 1IEVA 4G9EA 1XQ6A 3WGMA 5B36A 5JZVA 1JDSA 1Z4JA 4W5HA 4EHDA 4LF4B 2JCGA 4W8OA 4ALJA 3IXMA 1DLIA 1JDVA 3KZ1E 2BTEA 2DTXA 2VG8A 1NNUA 1R6BX 2HJGA 1JR6A 1T8TA 3CR8A 1Q74A 3GG9A 5CNJA 4BQSA 2ZBFA 1F2UB 2BSAA 3GCZA 1ZQ1A 1LRLA 1Y3CE 1RAHA 3BQ9A 1UOQA 3BM5A 3C0KA 3DEKA 4I36A 4IXDA 1KJIA 3NDIA 2L42A 4MYDA 4TLAA 5IK2D 1Y5RA 1YQDA 3R8CA 1PVVA 1HDCA 5ELMA 4YFVA 1JHOA 2QYTA 1S5PA 2I66A 3KFLA 1X3SA 1XK7A 3OQ6A 1NU8A 2NUPA 5A0TA 2NSYA 3K0BA 1VSUA 4QPCA 5AJTA 2C9MA 1XRSB 1T25A 2VUIB 4HTFA 4ZKDA 1J8QA 1UC4B 3ONDA 3WGNA 5LQUA 1K63A 4IM7A 1VYHA 3AH8A 2AFIE 3ONEA 4IOKA 5LNK6 3NTVA 3VU8A 4OQXA 3O21A 2IWHA 5LP6A 1GL7A 3AKCA 3PC6A 4URVR 1ONOA 4NMXB 3AJAA 5M5BA 2Q27A 4KFTA 3REOA 2HIAA 2XD9A 1P2DA 2G6TA 1FTQA 4TQUS 3T9DA 4EHJA 5JG7A 3EFOA 3TH5A 5IKEA 3I64A 1Q3TA 4GI1A 3LQFA 4XTCS 1NOJA 3ZK7A 3NRBA 3KPUA 3IE0A 5CVVA 5BSWA 2I9KA 3NHWA 1Z28A 4YCBA 1XCJA 1Z16A 3BMQA 3OQ1A 4M7OA 4G26A 5EG5A 3C14C 4I8XA 4DBVO 4PZUA 1N2HA 4V2IA 3LC1O 1U6KA 2G9NA 4DJDC 2WOJA 2LRHA 4MHTA 1ORIA 3OPYA 4JBWA 4O8ZA 4Q00A 1AQIA 1TGVA 1TM1E 1GGFA 1ZHHA 2GWHA 4P4GA 4B45A 4ECEA 4LDNA 3UK2A 2C88A 3EISA 1SGWA 2RC5A 2J9GA 4ZAYA 4FC6A 3V34A 1RWMA 5F23A 1JIQA 2WE8A 4K6CA 2H2HA 3HACA 3TZBA 4N3GA 1V9CA 4RK0A 4QOJA 2MSLA 4NMHA 4FEAA 2IYNA 1MG0A 2VJMA 2J67A 2ZB8A 4D97A 1Q1AA 1MJNA 3VR6H 4NE7A 1SC6A 3E23A 3LCCA 5ANRB 1YE3A 1XQVA 2Q41A 2LUOA 1NI4A 1HEYA 1OLUB 4EF5A 1M6HA 1QHYA 3CLSD 3PVCA 5AWFC 2GZRA 3PX7A 1Z0UA 3LX5A 1Y4AE 3EIOA 1NUTA 1PSDA 1AV7A 1OXBB 4FOPA 4EOGA 2P78A 2W2VA 4ZEWA 2I6TA 3LGSA 4X71A 5E0KB 2HUPA 4PR3A 5ALMA 4AK9A 4EA9A 5TQ2B 4ZI7A 1H3NA 2VYNA 3JQ8A 3QY0A 3R5FA 2IXTA 1MQSA 3FCCA 4LEIA 5BOVA 2WKSA 3F90A 3RU9A 2UDPA 3KEGA 4LMAA 4F6CA 3DTYA 3I73A 5G3ZA 5DM0A 2FZWA 4Q9DA 5AVRA 3HY3A 3RYTC 4F12A 5IHPA 4H59A 2G1PA 4Z7NB 1K7YA 1ZN8A 1AO0A 2Z5FA 5IKPA 3ETGA 1R0BA 3FMVA 4OUDB 2ZT7A 1XEWX 1Z5UA 2WPDD 2L17A 1CUJA 4PU0A 4RV4A 1QF6A 2CXSA 3V1UA 4AULA 2P0YA 3DDWA 2TECE 2BGJA 5K0GA 3A2KA 3EUAA 4YCJA 2JIRA 2NXNA 4OH7A 1SOAA 4IHQA 1JV2B 2CK3D 3LQ4A 1Q7CA 1OJLA 3Q3JB 4F4UA 3FGPA 5KTSA 3B9RA 1G6HA 3ZQ4A 1T9GR 2C5BA 1X70A 3FVWA 1P7ZA 5JXGA 5JSKA 2ZZNA 3C16C 1VJDA 1RJGA 3QVGA 1KJZA 1TM3E 4MV7A 4R0VA 1Z15A 3UJNA 5CPBA 4DLYA 2H7CA 1TQHA 2HMTA 1HTBA 3IKJA 4EMUA 4DGSA 4UTPA 1U0GA 4O4IF 5AHWA 2CLCX 4NK5A 1ZMOA 3B53X 4PVDA 4MZXA 1GYQA 1BHSA 3P2OA 3VJRA 5LA6F 3RYHB 1Y8RA 4ZDKA 2FQXA 1KY2A 2O8CB 2R3SA 5KOHA 3L8GA 2HNKA 3ZHQA 2YRFA 2Q9UA 2C3YA 3PUKA 4Q93A 1C4XA 5FIUA 2ORVA 5EJMA 4YWJA 3UWOA 1JMYA 5JY1A 1TB4A 1Z2OX 2DT8A 4M8SA 2JI8A 1EWVA 5DM4A 3VXKA 3DL2A 1B41A 2AFHB 3SXPA 2M9MA 2VZEA 2RGBA 3WBBA 1O6ZA 4KRGA 4PG4A 1M7BA 2DHCA 2F7SA 4R41A 2ZJYA 4CKEB 2XOKD 3GJXC 2DHQA 2H18A 5FOQA 1GQRA 3TNFA 4IKOA 3LQKA 4E15A 3TCNA 5LZ8A 5H3HA 1O6GA 2PGNA 5IX8A 2YBDA 4HMPA 1DKRA 2OD9A 4ENWA 1FRNA 3QOFA 3GEHA 1PW7A 3C7KA 4GM1A 5FWYB 4V2UA 4TM7A 2J8ZA 5DEIA 3GAZA 2DFDA 1D4AA 2AOUB 2ZETA 3IUNA 3M6XA 4R69A 4XJTA 3LWNA 3E22A 3IPAA 1R4MA 4L3OA 3O0TA 4K2AA 5AVOA 3ZHZA 4EGSA 4IFTA 1XZNA 1ZK4A 5MN5A 2V4UA 1AIPA 2BCJQ 2OVBA 3AERB 2I6FA 3I9FA 3JWHA 3LUFA 3S6JA 4G0OA 4R84A 4PC7A 5DNEA 4CYMA 3FNEA 3L77A 4O6VA 2C0QA 5DX8A 1N5MA 4PQEA 1TU3A 1NN3A 4KXUA 4PXAA 4UQOA 1L4YA 3CH7A 1B14A 2YQ4A 3K0SA 1NRWA 3PQ2A 5JADA 1GPWB 1HTTA 2NV2B 4GPD1 5DCYA 4ENVA 1GNTA 3PQEA 4DV6B 1C80A 5D5HA 2Y67A 3IJEB 2I2WA 2RJOA 4W5QA 1GGVA 2A58A 1WHTB 2AEFA 2R2AA 1U0BB 1MZPA 4FJ1A 2FJUA 5GAJA 1X8LA 1OMOA 2JZCA 3DG9A 5TPZA 4KBGA 4INZA 2PIDA 5EZSA 1VPVA 4RVHA 4KITB 5A4FS 1NT4A 4TLCA 2V0GA 5B3JC 3AWDA 4A6DA 5J5VA 1L8XA 2Y1FA 2QTCA 1TTTA 2C2OA 1Y9DA 3BMOB 5I9BA 3T6KA 2LXNA 3NHBA 4LDAA 4Q1FA 2WD7A 5EQFA 1ZMXA 1E8NA 3RRXA 1AXEA 1U2DA 2FETA 3TEMA 3VU0A 2E1PA 4JX8A 1DX6A 3GIWA 5GZ1A 2F8TA 4WDQA 4ZT4A 1W4BA 1BWSA 1P0QA 1YI8A 1E7WA 5KTMA 3X2SA 4CG2A 3TTTA 1V95A 4WY5A 2FZCA 3D2LA 4PQYA 3T4PA 5KAPA 3CSSA 4D5GA 4XE5A 5DBIA 4NWIA 9LDTA 1FFSA 2QLFA 4B33A 3JVEA 3V6MA 1JDUA 2H1RA 3TYXA 3ZVNA 1UOEA 3QQ5A 4B44A 1W6UA 1YQUA 2BR4A 3IAXA 4AJKA 1WRBA 4J7UA 1NFFA 2AFRA 1OLXB 2XWJI 3GN1A 2AR0A 3MSCA 3X2FA 5HIAA 4LOHA 1C81A 3S8EA 2XZLA 2QL6A 1DLJA 4KQGA 5TIIA 2ZIEA 5GM1A 1G20B 1HWYA 1T13A 1O97D 4JXXA 3W2IA 4NRDA 4H3VA 2DBRA 3AUKA 5BW5A 2QRGA 3AL3A 1KK3A 3D02A 2VHQA 4J91A 2P11A 1Q0UA 4Q4JA 3ROZA 3FTDA 4OXNA 4F71A 1R9GA 1TGYA 1NNSA 3CNQS 3I45A 4HQNA 3EPKA 5BSMA 2IEZA 1UBOS 2C7PA 4QWMA 1QIGA 4GDMA 1CRQA 2YOGA 1GDHA 1JSZA 1V5IA 1ZO8A 4MCAA 4XWYA 2QRVA 3VZQA 4IIJF 3WMGA 3H5VA 3THWA 1WXFA 4RPKA 3SQLA 4ASUA 4DLLA 1MA0A 4MKXA 3WGYA 4WOKA 1D6MA 5SV2A 4EITA 2REXB 4BKUA 1V11B 3FKJA 3EZLA 1NBIA 5CLQA 2J5QA 4ZZ0A 5H83A 4X00A 5HS4A 1SHJA 3NUGA 2ZJOA 4LX0A 2H1SA 1MJGA 4ID3A 3KDSE 4LF8B 2PGLA 2WMYA 3UAZA 4L73A 1KZYC 3M9XA 4O33A 1W8DA 4ZEXA 3RFCA 2JGNA 4RQBA 1K4YA 4NV3A 5CJPA 2VYQA 2QT0A 2X9NA 4IHKA 1PV2A 4JLKA 4PANA 2NSJA 3DVRX 1J0EA 3F8TA 1A5TA 3VYUB 1U8XX 3GPCA 2O19A 4EGCB 1E5XA 4DSTA 3KV3O 2P5SA 5CH5A 4ZVLA 3DMTC 3WLKX 3VOSA 4BRWA 4K03A 2JLBA 1IEXA 4KDFA 1EU1A 4QSHA 2NVBA 3D6MA 4JL5A 1KMQA 4ND4A 5FOVA 5H7XA 1RC8A 1A5ZA 2CDBA 1U6IA 4ZAXA 3IDAA 5LOVA 2AXEA 2PSEA 3PIDA 4NABA 3E05A 3RYCB 4V3BA 4A6EA 3L1KA 1JKIA 1N0UA 2GESA 5AUOB 5AOVA 3THYB 5LXTA 1JQ5A 3PFNA 1U2PA 3W2TA 2VDJA 1KFJB 4ARCA 3LT0A 1EUCB 1BA2A 4MCIA 3EFHA 3KEOA 1G3UA 5B7GA 3W1EA 4PM4A 3NYRA 1VL2A 3M49A 3HK2A 2W2MA 2WLSA 4UPVA 3H8SA 1NXQA 4HDSA 5JVDA 3S2SA 3IQWA 2RKWA 1N2XA 4NOMA 1A0OA 3ORHA 1QG6A 1SUAA 4XKJA 5AK4A 3SJAA 4BZPA 5JMTA 1QIIA 1GEGA 2A94A 2OR3A 3NWJA 1XDWA 1IMJA 1O94A 4PHTA 3MJDA 3LY8A 4XW2A 2IQIA 4G09A 1JJBA 1NMQA 2ERYA 3I6ZA 3O8CA 4Y18A 4I5EA 1BE6A 4WNCA 2VNIA 1DIOB 4G5SA 4JQOA 4ON9A 2HY7A 2CFOA 4Y6OA 3EY9A 1U3UA 1RYHA 3ROEA 4P1ZA 3CF2A 1RSZA 3J81A 1O89A 4JLWA 4UM5A 3TRHA 3Q1LA 3GZNA 4PC2A 5HOQA 1JLKA 3K3PA 4K6GA 1W0JA 2H9YA 3BZWA 1O5IA 4P4UA 1YRBA 5F5LA 3RU3A 1WO8A 3WRXC 2Y1LA 3SEAA 4XD2A 3LY9A 5G40A 2VJAA 3IQGX 1SU6A 4A5OA 3UENA 3L8MA 3V8QA 1SCKA 2EIXA 3ZDRA 2W22A 2OXIA 4RTQA 2CJWB 5D3MB 2WY2D 3UUFA 1J39A 3IALA 1TIPA 2PO7A 1WAMA 1D2NA 3N8NA 4NDAA 1N78A 3T3OA 2QM0A 1GAJA 2G71A 1NLFA 2HSDA 4J3NA 1M0SA 1NDQA 1V45E 4EYSA 1SVLA 3A4MA 4PBTA 3O1JC 3F4KA 3GHHA 5GVSA 1RJFA 1ITZA 3FIJA 2PMDA 5D7NA 1SVOA 3CJTA 5DGXA 4CKWB 2ZJ5A 4NHOA 1CV2A 3BTSA 3K09A 2GN1A 3Q7TA 3KYIB 3OF2A 4US2R 1QHFA 2ZIWB 1M2KA 1E6UA 1GQYA 1PR0A 3U3XA 1MABB 1KPGA 4NEHB 3JYQA 4HX2A 2EKPA 1CBUA 3E81A 2NTNA 2Y93A 3TKYA 4EJSC 4F4IA 1CETA 2ZSUA 3EAFA 2C4KA 3ABQB 1RIIA 4KFRA 4WBNF 2HMSA 3ADDA 1VIAA 1YQTA 3FOCA 4P58A 5DT2A 5KPDA 1ZNQO 3FDJA 1K97A 2BCEA 4YX9A 4H1WA 1H93A 4DUGD 5KMGA 2WWVD