3RVNA

Structure of the chey-bef3 complex with substitutions at 59 and 89: n59d and e89y
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
130
structure length
130
Chain Sequence
HMADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWDMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing Mechanistic Similarities between Response Regulator Signaling Proteins and Haloacid Dehalogenase Phosphatases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Chemotaxis protein CheY
total genus 44
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rvnA00
4Y9TA 3LKVA 5E3JA 5TQ0A 3TO5A 3MIZA 2PUEA 4ML3A 3HCWA 3H5VA 2GWRA 3T6KA 3I45A 1TJYA 2P4UA 3C3WA 4EGSA 1C4WA 5EWLB 5IULC 2LIVA 2NT3A 4RXUA 3NBMA 4MRMB 2JBAA 5JNUA 1RXEA 3EQZA 4KFCA 4EYQA 1P2FA 1FQWA 2QW1A 3H1EA 2QU7A 3OLXA 2VK2A 1RZRA 1QP0A 4QICA 3MF4A 1H9CA 4S05A 4TLLB 5IEBA 1M2EA 1J56A 4EY3A 1CYEA 1URPA 4KV7A 4F11A 1LK0A 3KSMA 2B1JA 4MR9B 2HQRA 4RKRA 1RNLA 1U0SY 4W5OA 5D2CA 1P6UA 2MYUA 3GV0A 3KG2A 5EWMB 4CBVA 3C3KA 7ABPA 1EAYA 5EWJB 3ROFA 4KNYA 1JYFA 1ZY2A 4G0OA 4LE2A 4OLBA 2IPLA 3SM9A 1VPWA 4FE4A 3QELB 4L85A 3TX6A 3H5WA 5F64A 4MR8B 1QMPA 2FEPA 1A04A 4JAVC 1D4ZA 4P1ZA 3OQOA 4N47A 2E4WA 1JFTA 4PEVA 5TE9A 3O2QB 4KVFA 1KMIY 1ZESA 3QK7A 2L18A 4G0XA 3MM4A 4Q7EA 3C3MA 3F6PA 4Z4HA 3MMNA 1QP4A 1NY5A 4Z0NA 1PEAA 2FMKA 4TMYA 3D02A 3IPAA 3RVOA 4DADA 3CTPA 5B3JA 4RS3A 4G86A 1IIBA 1NXVA 3O21A 5JNVA 3I42A 3GRCA 2A9PA 1WETA 4XLTA 2IKSA 4KK3A 2PL1A 5HSGA 3KYIB 3T8YA 1YIOA 2JVIA 5JNTA 1JBEA 1Z15A 3SY8A 2PAFA 3CFYA 5TPWB 2ZAYA 2TMYA 3BRSA 1FFGA 3HV2A 2VYCA 2IDMA 2BGGA 3LOPA 5TPZA 4XFKA 4JASB 4MQEB 4MQFB 3OLZA 1QO0A 2RJNA 4YO7A 3RVSA 2H0AA 2JBAB 3LMKA 1AB6A 5CNIA 1Z26A 4G97A 3JPYA 1M5TA 4P98A 4NQRA 1PNRA 2PLNA 5KWSA 1BDJA 2J48A 1RPJA 3NHZA 2E4UA 1YMUA 3O1HB 3HZHA 2E4VA 1E6LA 1ABEA 3P9YA 2OENG 3Q7TA 2FQWA 2PUDA 1OXBB 3N75A 1NATA 4N0PA 1E6MA 3RVQA 2MSLA 3DGEC 3FDFA 4QPJC 4TN5A 4N41A 3FMVA 4LE0A 1BDHA 2L17A 2N9UA 2LPMA 4N03A 1JFSA 2HPHA 3MYYA 1ABFA 4YCSA 2WJAA 3GWGA 2FQYA 4OG2A 4ETNA 3OLWA 5IEJA 2CHFA 3O74A 4Z4EA 1DP4A 3O1IC 1LJLA 3NNNA 3M9XA 3QEKA 1ZGZA 3H1GA 5KQMA 2E4YA 3SG0A 3CG0A 3E61A 1I3CA 5CNMA 3CKMA 3G1WA 1YK1A 2PE5A 4OATA 5KQGA 2FXIA 1EWKA 2PJUA 1ZITA 1YS7A 4IGAA 3QX9A 3DGFC 4MS3B 5GOTA 4MS1A 2V0NA 2JVJA 3IP7A 2R48A 4KREA 5KQLA 3KLNA 4MR7A 5DTEA 5TPZD 2FTKE 4ZMSA 4H3KB 4Z9AA 1RZRD 4EYOA 3HDGA 3H5TA 2F8TA 1JDNA 4WUTA 1K66A 1QP7A 3RVRA 3KKEA 4N0QA 1Z17A 5FBKA 2YHAA 5GQSA 1AB5A 3OO1A 4RZSA 1PHRA 5EWLA 4W5NA 3EAFA 4MQEA 1QKKA 5DGCA 4JB0A 5HM6A 5BRAA 4KPYA 3EDCA 1BVHA 4Z4IA 2ZWMA 3LUHA 2A9QA 3IP5A 5JS2A 4D6XA 3DLBA 5TQ0B 4HNSA 1LJUA 2E4ZA 2FW0A 3HUUA 3F7NA 1T34A 1NXOA 4NV3A 4YV7A 3GA5A 3K4HA 4O1IA 1NXPA 2YHBA 3S99A 4F06A 4N76A 1SD5A 1ZDMA 2JCGA 4Q6WA 3I5AA 1P6QA 5FWXB 4DQDA 5DLEA 5IX8A 1GLGA 4QYWA 4EVSA 1ZH4A 3QX8A 3TB6A 2FEKA 5JNWA 3ROTA 2PUFA 1MIHA 2F8SA 1APBA 4G0ZA 4E7OA 4PZ0A 1EWVA 5CHYA 3MQ4A 4MS4B 5C5CA 5T3YA 5T7BA 2E4XA 4IILA 3L6UA 3GYBA 4YWHA 2CD7A 3BBLA 4YR7A 4JOQA 4HNQA 3N53A 2PL9A 2WRZA 6CHYA 1MVOA 3GBVA 1Z12A 4WXEA 4D74A 4G0MA 4G0PA 3OQNA 3H5LA 1BA2A 3QLTA 4E7PA 4H60A 1B00A 3A10A 5FWYA 2JK1A 2WMYA 1VRVA 3E3MA 3F6CA 1DBPA 2GBPA 2WB4A 3OM0A 4XXHA 5ABPA 2P9HA 4RK6A 1YMVA 2A9OA 4RY9A 5IBQA 4MYRA 4MPTA 4FB4A 2HQOA 3B2NA 4ETIA 5JNSA 5KC9A 1D1PA 1ZH2A 1USIA 1M5UA 3QEMB 1GUDA 4MR7B 3H5OA 4IMJB 2PUAA 3HSYA 4RV5A 2O20A 3MA0A 4LRQA 2JB9A 1DG9A 3KHTA 3VNAA 1KRXA 2PUGA 5IUKC 1XHFA 3T95A 3DZDA 3N8IA 3O1JC 4GNRA 5PNTA 3W9SA 4F12A 1U8TA 4MGEA 2PMCA 4RXMA 4RK0A 1YVUA 2HJ9A 3I09A 3N0RA 1JDPA 3QELA 3QEMA 2FMIA 5HKOA 3FFXA 1EHCA 4S04A 5BQ3A 3OLVA 1NXSA 5IC5A 3TMYA 3IP9A 5EWJA 5TQJA 2PUBA 2FN9A 3BREA 2A9RA 4JB2A 1PNTA 3HVRA 1TVMA 1L5ZA 3NNSA 2FN8A 4RK4A 5TQ2B 3D8UA 3T38A 3VNBA 4MLCA 4QYMA 4EVQA 1VLZA 3LUJA 1JF8A 1SXGA 3O2SB 4RSMA 3OQMA 4B09A 4EYGA 3GBPA 2L2QA 2HQBA 4G0YA 4Z4GA 3UUGA 1ZN2A 1C0EA 3FGZA 2AYZA 2ID7A 1DBWA 3M9WA 4IF4A 5BRJA 3HK2A 3JVDA 2HSGA 3KJXA 3NNDA 4MQFA 3H5IA 2MYNA 4RXTA 3OM1A 1DRJA 3Q9SA 2FLWA 4PYRA 4WT7A 2XDYA 3CRNA 1YS6A 4IRXA 4YGXB 4YS6A 4HNRA 4Z4FA 1CEYA 3KTOA 4RU1A 2W42A 2VUHB 3Q7SA 2FKAA 3KLOA 6ABPA 3QLUC 3JS5A 5KQPA 3CS3A 3QLVA 4OLAA 4HYEA 2X7XA 3HUTA 3LUFA 4WZZA 1DCFA 2QSJA 3OMWA 4W5QA 1QQBA 1Z13A 2AYXA 2QV0A 2WWVD 1HEYA 1EFAA 3RVKA 1ISRA 1XHEA 2QXYA 1TLFA 3CU5A 4F3TA 1FFSA 3HO1A 3EGCA 5DKFA 4NICA 2GKGA 4Z4CA 4MAAA 4WXMA 2RDMA 4NCBA 4ETMA 4NCAA 3A0UA 3GT7A 3A3KA 4JP1A 3CHYA 3H6GA 4MS3A 1SXIA 1BDIA 1BAPA 5CNJA 3C97A 3A0RB 3N0XA 3LUDA 4MS1B 4D6YA 5CNKA 5DCLA 4LE1A 1GCGA 1W25A 3QLVC 1DJMA 4IMIB 3SAJA 3JY6A 5TQ2A 5HQJA 4LDZA 5I4CA 4GPAA 4MR8A 1ZGGA 5B3JC 3BRQA 4OBBA 1D1QA 3L49A 1Y1LA 2FQXA 2GI4A 4KMRA 1PEYA 2M1ZA 1D2AA 1Z18A 4KQ9A 1XWWA 2CWDA 5EWMA 2QR3A 3URMA 4G0QA 2M98A 2RGYA 3UKJA 3OLYA 1JH9A 3UK0A 2PKXA 1KRWA 4KQCA 2FLKA 4Q6BA 4KRFA 1DBQA 2Q5CA 3RVLA 3R0JA 1QQAA 1FSPA 2IOYA 3HDVA 1TM2A 9ABPA 5ED4A 2IPNA 3LKBA 4PE5B 3EULA 1NXTA 4MS4A 3Q15C 1Z2DA 2WY2D 4F8JA 1USKA 2IYNA 1D5WA 4OTZA 1DC8A 2ID9A 3FFTA 4RY8A 3N6VA 3F73A 3IDOA 4RK5A 3DLHA 3CNBA 3HEBA 1ZHHA 1PUXA 3NHMA 1USGA 4EYKA 3C6QA 5FWXA 2FSPA 1DZ3A 3IP6A 1JX6A 2CHEA 2MSWA 3H6HA 3TD9A 1GCAA 4PICA 2PUCA 1JYEA 1JL3A 1TMYA 1JWLA 2H3HA 4FE7A 3GL9A 3RVMA 1JHZA 3OO0A 4H3HB 4EVRA 1NXXA 3HJFA 2JVKA 3RQIA 4EUKA 2R25B 1A0OA 1Z16A 4LZLA 1EWTA 4XASA 2IPMA 2OQRA 4ZPJA 1W9HA 2NT4A 2NUBA 1ZAYA 1YK0A 1MB3A 1K68A 1P8AA 3G85A 3O75A 3JTEA 1L5YA 1NTRA 1QPZA 4YRZA 4UHKA 3LFTA 1JLKA 1Z25A 3RH0A 4YLEA 1JFVA 1SRRA 4TLMB 2LP4Y 1E6KA 2B4AA 2QZJA 4DN6A 4ZJPA 5C5EA 3KYJB 1A2OA 1FFWA 1R8JA 3CLKA 4W5TA 1ISSA 1QO0D 3EQ2A 3O2JA 4ZYLA 3RVPA 4XARA 4WWHA 3EJWA 3FFWA 1E2BA 3N0WA 2FEWB 4L4UA 4MRMA 1MAVA 1F51E 1U04A 2KYRA 1CHNA 1U2QA 2MSKA 2FVYA 2JRLA 5FWYB 3HXMA 8ABPA 2RJOA 3HM9A 2MYTA 5JS1A 3BILA 4MLDA 5JNRA 5TPWA 1RXIA 4MR9A 3KS9A 4RDCA 5FBHA 3SNKA 1SXHA 2IPAB 2FMFA 3CZCA 3H75A 2LUOA 4RK7A 3LUAA 3LUGA 1ZVVA 1M2FA 1UDRA 4RWEA 2DRIA 2GX6A 1LBHA 3CZ5A 3LUCA 1F4VA 4LX8A 1NXWA 1Z2EA 2NZUG 3K9CA 3LTEA 1QNLA 3IPCA 4YP9A 1U2PA 3Q41A 1YTUA 4O1HA 2VUIB 1DC7A 4XAQA 4W5RA 2I6FA 5KC8A 3JPWA 2FMHA 2L19A 3M6MD 3SQNA 3Q7RA 4RY0A 4Z99A 1VKRA 1KGSA 3EODA 4KK4A 2QVCA 3RVJA 3KCNA 2QVGA 3LUKA 4KZKA 5KI6A 2WJWA 4RKQA 3ILHA 1MB0A 4UHJA 2LBPA 2NZVG 1DRKA 3ILYA 3H1FA 2R4QA 5BR1A 1DCMA 1LBIA 5IUJC 4RK1A 4O5AA 3DBIA 3JVIA 1S8NA 5IUNC 3HS3A 3OMXA 3QLUA 1OXKB 4JA2A 3RVNA 4ZMRA 1DCKA 1GUBA 2R47A 4Z9BA 2MYPA 4LDAA 3CG4A 4M88A
chains in the Genus database with same CATH superfamily
3C3AA 5CIQA 4Y9TA 5E3JA 5B3KA 4MRNA 2YX1A 3DEYX 2FFQA 3NIFB 2PUEA 4UQLA 4B74A 2IXTA 1SNYA 1ZJZA 3LT0A 1KERA 4ARZB 4G07A 1HQCA 2VF7A 4KYUA 4PZZA 4C14A 4EPTA 2NZWA 4UMVA 2P4UA 1GKKA 4F21A 2M6LA 5IULC 3C1TA 3KPVA 4DA0A 3U7GA 1JA1A 2IF0A 4FFOA 5E6UB 3UOAB 3FJYA 4E1AA 1QYVA 1N2OA 3I01M 3BM5A 1RZRA 3PC4A 1PJ3A 1SUPA 2IYVA 2XCQA 3HRIA 3MYRA 3PQ7A 2RH5A 2VJQA 2BT4A 3D3WA 3FCXA 4OQ4A 5EZYF 4AI6A 1SU6A 1URPA 4O4JF 3C6YA 3T3MB 1OCEA 4ER3A 5DRYA 3CR8A 4EA9A 2X1MA 3IEUA 1NBME 4ZYWA 4BFWA 1JIKA 5CX1A 3ASUA 3F9IA 4N3GA 2D00A 3LO8A 2O1XA 2UZAA 1E1MA 1S0UA 4LRSB 5DM1A 2GZSA 1TUBB 4URZR 5EWJB 3C8UA 2NNWB 1H2YA 4Y7CA 4A8PA 1U2ZA 4LK3A 5BWBA 1NE7A 3DOCA 3UGKA 2JFNA 2V6GA 2YNMD 4FIZA 5LOVA 5J59A 3IEXA 5KDLA 1HOTA 2G04A 1MX9A 2ZSAA 2OFPA 1Q1BA 1QIJA 4YDRA 4BO4A 1A1SA 5F64A 3ZGXA 3J81k 3KB1A 1XX6A 4H7DA 4L95C 4NWIA 3GLIE 2A1IA 2JJ2D 1HRKA 2WI8A 4YUXA 3DV0A 2IUFA 3GDWA 3QM1A 5THKA 4N47A 2ZWIA 3GJ8A 4LDQA 3HZOA 4LOJA 3L0PA 4LV5B 2ASEA 1VHTA 1P62B 4OM8A 2IIVA 3OJ0A 4DY6A 4PG8A 1RXWA 3BN3A 3RUAA 3T5TA 2QX9A 1E2PA 4I9GA 1N1EA 5FTWA 3D2LA 4WY8A 4MCHA 3S2GA 2C2MA 2GEJA 4FYMA 4QELA 1KY5A 1XVIA 3JU3A 2Y71A 4IEFB 4JJ6A 4JUFA 1O5OA 1WWKA 2EGUA 1ZM3A 1RI5A 2HLPA 3SXPA 3GAZA 1I2MA 4B5KA 3Q1LA 2NU8B 2FF7A 2O1WA 5TMEA 1NXVA 1E62A 2NYRA 3BICA 5K0EA 1A2BA 3A28A 4DWVA 3EUEA 4HVCA 3FLBA 2IKSA 1F2UA 3AY3A 1JXAA 1ZA2A 4H1HA 1Z15A 4ALLA 4B9EA 4L8FA 1EKXA 1M8PA 2AG5A 2C4VA 4LJ4A 3V8EA 4ZAGA 3LP5A 3UV7A 1Q2UA 4FILA 3ZEAA 1LF5A 3PNYA 4ND7A 5JARA 4LPKA 1G17A 1BZYA 1H69A 3E7XA 4MUAA 4AXXA 1VCMA 3GP5A 2WSSA 5H16A 4YMTA 3OLZA 2WFZA 2OBXA 5EN4A 2B8NA 1WF3A 4FWTA 3JWEA 5LYJB 3EVTA 5J4HA 1LK5A 1QZ3A 4Y2PA 2VG8A 3LQ1A 1AKRA 1KSHA 1H2RS 1SVUA 3KZMA 3ROPA 1RC8A 3PSHA 4N6NA 1KU0A 3HLTA 1OE0A 4MVJH 3TW4A 3U31A 2CJWB 4DBLC 4X20A 1COWA 3SVZA 3HYCA 3I2YX 4DEXA 5CLFA 3ICVA 4GKBA 3O1HB 3FFBA 3HZHA 4H27A 4IVPA 3UMBA 5HCNA 3ZVMA 3IT2A 5FBRB 3RS9A 3VOBA 4BCDA 1JW9B 1BD4A 2IYLD 3RVQA 3DGEC 4LE0A 1E1YA 1W4BA 5ENZA 4HQFA 4C2AA 1NYTA 3SDBA 3WGUA 5AVTA 1JFSA 2YDXA 3ZI7A 3RBVA 3P9ZA 1FFXA 2WWHA 4OG2A 1XLVA 1WY7A 1F6DA 1H8ED 1IEWA 1KI1A 1UPUA 2O2GA 1R4MB 2F3TA 2JEOA 2ZYVX 3OEHA 3TZEA 3TTXA 4LF9B 3B8EA 1PFVA 5BW8A 1II8A 3I3OA 3S7ZA 4CMEC 4DOMA 1NBHA 3ORHA 3VA7A 1Y4DE 1UDAA 3INRA 5JD6A 4K6OA 1PT7A 2AI1A 2DPMA 4HAUA 4RMJA 1M2VB 4MAMA 4QUGA 1KJ9A 1JHQA 4I19A 2PE5A 4NEGA 4I50F 4JCCA 2C7OA 1DLJA 4B6OA 1PV4A 3R3YA 2GH1A 5JC8A 1UANA 3MT8A 2JFFA 3WGLA 2I6GA 2HJGA 4C0QC 4YRLA 3DOEA 3B1YA 3GPIA 4E2ZA 4ZK6A 2PRYA 4BGDA 3NC4A 1UBUS 3BTUA 1QG6A 3OJOA 3U44B 1Y1QA 4BLSA 2QD3A 4Q4DA 4YREA 1BYUA 2C3MA 2D2EA 3AT1A 3DM5A 1PV1A 3K9WA 2QS9A 3LG2A 4ARSA 3BB3A 5FBKA 1AB5A 1C1DB 1MZVA 2OGWA 3PJGA 4K9PA 4UUBA 2X0JA 5DW0A 4OHBA 1E9FA 4PZUA 5SZJA 3DLCA 4LY9A 5I7EA 4G85A 2B0JA 4JELA 4L5IA 3W79A 1N5JA 3UYKA 4DB4A 1L8XA 4JBXA 2BM1A 1VBFA 1ZJ6A 1L8OA 3I5MA 1T34A 3B85A 1U6JA 1D1SA 3V1TC 2UVPA 4LA4A 3B3QA 1H2AS 2YHBA 3ZE0B 2WD7B 4C29A 5KDDA 4LF6B 5F4BA 3TL6A 4EL5A 1WSDA 4FWBA 1U7PA 4HAOA 5KJ1A 3KQNA 1JSRA 3IE1A 2I3GA 2AFIE 1WNTA 5IDWA 4IX1A 1Y89A 3PQCA 1AS2A 4K9SA 2Q41A 3WLSA 2H4FA 1EIZA 3AF2A 3H2SA 4UDOA 4X3OA 3WL6A 3QI7A 3EPKA 1SU7A 4RA6B 4E7OA 3GP3A 3DVQX 4J3FA 5L3ZA 821PA 3AY7A 3K32A 4IQ8A 1OAOC 3KD2A 3S2SA 3AR4A 1JG3A 4R1TA 4EB6A 1YQ9A 2FSGA 3P2JA 5CLJA 4XDHA 5THXA 2F55A 5AJZA 3DHEA 5LDGA 4MPJA 2RSLA 3ABZA 3KVNA 4L7QA 1N7IA 4IIYA 4PIVA 3STTA 3K6KA 5AW0A 1MVNA 3DCIA 2JGLA 3QUAA 1Z12A 2J08A 2V58A 3A9CA 4KUEA 3PYXA 4EL0A 2Q6LA 3URKA 4LJRA 3PEYA 3G02A 3UG6A 1AGXA 2EATA 4QDOA 3TCNA 2R60A 5JD5A 4HB4A 5HIMA 1DQSA 5ABPA 3DFKA 4TLEA 1OX4A 3HDJA 3D9QX 3IO5A 3FFAA 4TM7A 4ALMA 3BFXA 3ZZ1A 3ENKA 3D0RA 1USIA 3CRZA 3QEMB 4BV2A 5C81A 3AL3A 3H5OA 1P19A 1SD2A 5CA1B 1X8XA 3TVYA 3SIPA 3Q5EA 1VL8A 2FZGA 2SECE 2Y8EA 2ZRIA 3KHTA 4GX2A 4O2AF 1JV2B 1L4EA 2PUGA 2OK8A 5AKIA 5IUKC 2ZI5A 3DLPX 4PNZA 4E51A 2RI6A 4TWBA 2ACWA 2GXUA 3D64A 4F5WA 1Q6YA 4CM8A 1O03A 4CN9A 4KN9S 1HFWA 4JEHA 1FEZA 1R0KA 5G0TA 2ZAIA 2ZGVA 1K6IA 3EDRA 1YE3A 2ODTX 1Z2CA 2B4KA 1KPGA 2Q5IA 3I9V1 3PYLA 4MCAA 4RX1A 4U2DA 4BGVA 5JH7F 4L9SA 3EGEA 5BQ3A 5HZGA 4L76A 3IUMA 3DXXA 4OP3A 1SD1A 3SX2A 1UBRS 1SH7A 1YU9A 1NT2A 3EC7A 5FL3A 2P77A 2WWFA 2IHNA 1ESMA 2AQKA 4AY6A 1I6WA 2R1TB 4WDQA 1XNJA 3RYFB 1W1IA 5JVDB 5JCZA 4DKJA 2HV8A 9LDTA 2OL4A 3GJYA 1X38A 3SHWA 3LUJA 4BN4A 3OQMA 3GG2A 1CZKA 3I83A 1BXRA 3KAQA 1CVIA 3OF2A 2G5TA 4MUIA 5E4YA 5A5GA 4I4TB 3O47A 2CE2X 2H4HA 3BHMA 1O54A 3HPQA 4Y30A 2EW1A 2REQB 4YMWA 5SZHB 4MQFA 3GA7A 3K92A 3DHWC 1JR6A 1OBHA 3U4HA 2DB3A 2VOEA 4PLPA 5EIAA 3ZZ0A 1KF0A 3U40A 1YS6A 4I1YA 1SM4A 2FE1A 4F84A 1AO3A 4JIGA 3V8MA 2HK6A 2NQ8A 2JIQA 3CJRA 4N5NA 3EE6A 4MV3A 1C0IA 4TLBA 2O7QA 3H2IA 4LYGA 5P21A 1UBCA 4Z51A 3JS5A 4BIMA 2BGUA 4E5SA 5JI2E 3UBMA 2HXYA 1Y6RA 2X7XA 5TRTA 4H6PA 2IYUA 2AQIA 4JMLA 1K8ZB 1N0IA 1PEKE 2JASA 3FCUB 4FYWA 3W7VA 1U7HA 4RPJA 3ZZMA 1SC6A 2ZVDA 4KODA 3T7JA 2P41A 5KYWB 4EPRA 3EEIA 4MKXA 4D4JA 3N0VA 1IAVA 1MPTA 2VNJA 4BFUA 3EGCA 1KXJA 1WMSA 1Y9JA 2RHLA 4M49A 4MH0R 4Q01A 3QU9A 3C15C 2G0NA 1UOEA 1QAOA 2ZBUA 4M8NE 1D2CA 3N2ZB 3AFHA 4TYYA 1Y8QA 3QYJA 1IULA 2Q3CA 2FZWA 3A0UA 2WU8A 3KQWA 5JXIA 2R79A 1RM5A 2HHHB 1SXIA 2WJHA 4PX9A 4RTPA 1RZUA 1E3DA 2PGNA 3UY4A 1QQ6A 3AJEA 5H80A 4EEZA 1BDIA 4EG8A 1C4XA 1I0IA 3DYBA 4OXNA 3RKSA 4J7UA 4JR0A 1KQNA 4DLSA 2BF7A 4PHGA 1YD7A 2OR3A 4UTVA 1IOWA 2WKQA 2YN4A 1GZDA 1NOJA 2NSJA 4KGXA 4PLYA 4KAXA 4ZCSA 3ZTTA 2JATA 1QHNA 3M8KA 5CT8A 3RFTA 5EZQA 3JXEA 3VU9B 2OP1A 1XXHE 1MC5A 3NWBA 1D1QA 2ZSUA 2YFQA 4MWGA 3L49A 4I99A 1S8OA 4DBVO 4LNAA 1D2AA 3OI7A 3ZZNA 2V9ZA 4NNPA 1DUSA 1N77A 1GPDG 4WZ6A 3EZ2A 4MVXA 4X6YA 3V4SA 1D07A 2A2ZA 3GJ3A 2B61A 3NJRA 5EJ4A 3IUYA 5C46F 2XWPA 4FCWA 4L4RA 5DI3B 1D0SA 1U7OA 2X0NA 3CM0A 3IGFA 4J07A 4WESB 5J43A 5ECWA 3TCXB 2IOHA 2W6NA 4B43A 2AKYA 4A2PA 1T2EA 4ZVLA 3CJTA 3H8VA 4PG4A 1GKIA 4QYTA 3E3OA 2RHJA 1MCZA 4A6DA 1Q0UA 1XZLA 2Z43A 2QF7A 2H5IA 5ICMA 1GNPA 1A5BB 2QDXA 1J0XO 2RC5A 3C6KA 2JIPA 3EK2A 3PNQA 1KDOA 1RKBA 4D45A 2H1VA 5K3FB 2L69A 1AQYA 1O94A 4X62B 1GJRA 3L7CA 3HO6A 4IUCS 3SZUA 4HMQA 4ZHSA 1KQGA 1DTEA 1XN4A 1AK2A 3EX7C 1RVV1 2WM2A 3D0KA 3PB3A 3HB5X 2NX2A 1T5IA 4Q02A 3TH5A 3UF0A 3V1LA 3WICA 1PN3A 1YS4A 4EK9A 4NKRA 1LUAA 5KWEA 5B2FA 1G7SA 2MSWA 2OLKA 3H2KA 3IE2A 3TG2A 5A0TA 4WCFB 5FO1A 4LDJA 2VAMA 3MAAC 4BQEA 5JQGA 1T9KA 3K72B 4B7XA 3ORYA 3UWPA 1GPMA 1ZK1A 4MA4A 4YJDA 5EIWA 3TWOA 2P9ZA 2HHLA 5DBGA 2WIGA 1KMQA 3KVYA 3MXTA 1GNSA 1TRKA 4PFKA 5B7NA 1NMSA 2I03A 4G56A 3CUSA 3MUNA 3NFYA 5IJ9B 1KORA 4RIGA 1JQKA 3DE6X 1VLHA 3DBHB 2ZDHA 4KXYA 2JAXA 3QHAA 4FGZA 1Q20A 1LNSA 3DQQA 3UANA 3FMGA 1QMGA 1XNGA 5I3ZA 3RH0A 4Q1BA 5F3WB 4HTFA 2PCLA 3DV0B 3O4VA 4MICA 4R0MA 1VKJA 4M9XA 1G8YA 1OB5A 1QIGA 2WSSD 1I2BA 4TMTA 4B3JA 2NO4A 1FMJA 1G66A 4JUBA 1HZZC 5EMJA 3KEFA 2VHYA 2FR1A 1SU4A 3OOSA 1Z6XA 2WU1A 3HJTA 4QGAA 4BBPA 3OIFA 4ZOLA 4DPMA 4E5UA 2JH9A 4RTMA 3O4JA 1MAVA 2XDQB 4DEYA 3PUXA 2PR7A 3SHOA 2BHLA 4RCZA 1GLNA 1EP2B 2EC5A 2V7QD 1U0LA 3BSSA 3H2GA 3QITA 4FD3A 4W63A 3VJMA 5FFMA 4R2XA 2YWGA 4Z7QB 1MO3A 4L72A 3R40A 3OEED 4JC8A 4WEOA 3HRKA 4GC5A 1IN5A 1OOEA 4QHYA 3RIXA 4KR2A 2W70A 4X65B 5JU6A 2DY1A 4P82A 3CUUA 2NW6A 4HB3A 4TSFA 1AN9A 4D0GA 3NXSA 3GX1A 2XUPA 1WPGA 3DDSA 2VBFA 5KMGB 5HYVA 3U13A 3IDSA 1B0AA 2WF8A 2ET6A 1LV7A 5IT9A 4WL0A 3VKVA 1QIEA 4BVBA 1DC7A 3OD5A 2I6FA 1VPVA 3FNGA 1VYTA 1XTUA 1HE3A 3LWZA 4ZT6A 3I0ZA 2R86A 1L5HA 1ICIA 4ER6A 3TK1A 5HM8A 3CO0S 2P8SA 5J1TB 2QVCA 2JPDA 4N82A 4I50A 1YAJA 1YKSA 4EW1A 2R4QA 4KIJA 5BR1A 1J8DA 3GARA 3TSWA 4OI1A 2FOIA 3AQ4A 5A06A 4W7SA 2EZTA 3JQ9A 3JAMA 4Z9BA 1KEWA 3F8TA 3CXUA 3GMIA 4QBKA 5JC1A 2GSWA 3H84A 1KZ7B 2PHZA 2QX6A 3E3AA 2CYCA 5IAJA 1R16A 3BGDA 4FGWA 4HGNA 4B17A 4Y0NA 1FK8A 2VHXA 2FETA 4JQOA 2GHRA 2IZ7A 4CL3A 2GWRA 4OMDA 2P65A 1E79D 1PG5A 3V8PA 1HT1E 1GKYA 4CRWB 4I50B 1JS1X 1X74A 2I1WA 2PQ2A 1XK6A 3F5QA 1QRDA 3KYDA 5K6TA 3GMSA 4JLAA 2PX5A 2JBAA 4L0QA 2O23A 4LBZA 4LI0A 5JNUA 1SKMA 4U00A 4S35A 1R66A 2BMVA 1BEZA 5D8DA 3EHDA 2PT5A 3WLNA 1L4UA 2WHXA 1X7ZB 3KQHA 2QU7A 2VK2A 4QOSA 2HMWA 3LW7A 2LDXA 2VHZA 4LYAA 2EHJA 4DGSA 1NN3A 4ZYYA 1V6AA 4IDEA 1LK0A 2AI3A 2PKYX 2R8XA 4M0LA 3SFZA 5EJEA 1Q21A 4HLUC 1C0LA 2HQRA 4DCJA 2J0UB 1NIPA 1MG0A 3L06A 1UXKA 1RHRA 4NYIR 2C7VA 3KEMA 4L6AA 4FONA 5BY2A 3KG2A 3S6JA 1NDUA 1Y4SA 1MPXA 5ILGA 6GPBA 2QTBA 3OCJA 4CBVA 7ABPA 1CULC 1EAYA 2NXWA 4HNHA 1OYYA 1V1MA 1UM8A 1MZPA 1SKYE 4JC4A 3PHJA 1WO8A 3KEGA 3SC3A 5JEEA 3OT5A 1CJUC 2A58A 3D4NA 1K5HA 4NZOA 2IZ6A 5EZ6B 3TTYA 4BKRA 2O8DA 3KKOA 2EFJA 2VPQA 2HK9A 1Z2NX 1F0KA 2PLAA 2QN7A 4YJ2A 1U3VA 3MUEA 4DNXA 2B5OA 4BWFB 1OIXA 4Q7LA 4KQ1A 2ZYWX 4QAJA 5U1PA 3VKFA 2PKQO 2NU6A 4BFVA 2HA6A 4Y18A 3D5TA 3GZNA 5FV7A 1LZKA 3LUPA 5DYGA 3ZX5A 2ATXA 3CR7A 1PG2A 3E15A 4B84A 2VDLB 5C5IA 2PEYA 4N7JA 3MWYW 4AD8A 3RF7A 5IH3A 2XQFA 4UVGA 4I4IA 5ARCA 3UAVA 1QIFA 4KO4S 1EH5A 2BP7B 3CTPA 4C2UA 3K2EA 3VYTB 1K6MA 1WHSA 2P4SA 4GOXA 1RKXA 2QR5A 4XEHA 3MCWA 3A4IA 4J0DA 1IIBA 2E3JA 5BV7A 1U8EA 3P45A 2BVNA 2P75A 3ENWA 5JJ5A 5FLKA 1IJBA 3QKRB 2UYHA 1GTL1 3QP9A 3QWHA 1N78A 2JGDA 4O2BF 5KSZA 2O2HA 1RC1A 1BCRB 5AJWA 1N2HA 4F2PA 2XODA 3KX2A 3CBQA 4RD3A 1FLNA 2PY6A 2XZPA 1OI3A 1JTEA 3A1SA 1TPZA 3AFOA 3LLMA 4IHAA 2YWBA 4BNJA 3AM1A 5A05A 2G4CA 2OBFA 4MWBA 3MWLA 4GUDA 2MSNA 2OAEA 9LDBA 2ZCJA 1H6BA 4PFSA 5FF9A 1V1RA 3P97A 2GBLC 1H3FA 2F2TA 1T1GA 3RYIB 2HA4A 1GTRA 5C8VA 5BN5B 4AJKA 1YBVA 4D9EA 1A97A 3FRIA 4OAOA 2W6PA 1FCJA 1ZYUA 2O8CA 2CNNA 1E2FA 4G5HA 4M0FA 5CA0A 1WXFA 2Q6TA 2VJLA 3UOWA 1RM0A 3WQQA 5HUJA 1AY0A 2I6UA 2FG5A 3C8MA 4KSYA 1C81A 1JJ7A 2OHGA 2PH1A 2VWPA 1BQ4A 5HR5A 1FF9A 1VG1A 1AKTA 3DF9A 5BW6B 4DZRA 5I4IA 2ZBVA 5IVPA 5LKAA 3H19A 3KB2A 1IVYA 2I6QA 2QGFA 2ZRQA 5IJ0A 1AA6A 3E4CA 2FW7A 4O02B 3KV1A 3UN1A 3HG7A 4TQGA 1K3TA 3ZWOA 4DIDA 5JS7A 2E37A 1O0SA 2OESA 3CG0A 1T91A 2F90A 2B69A 1JAXA 2HAEA 4E5NA 1XTBA 3ZE8A 3O73A 2C1XA 4ZO7A 2F64A 3EH2A 1QDUA 1PR0A 3IEPA 1LNQA 1QE0A 3NVKI 4MS1A 1YDMA 3BWDD 4RZHA 4G8BA 2PUWA 4V0QA 3NBUA 2NTJA 2VEOA 3RUHA 5KQLA 1DDGA 3LL4A 4NYIQ 5TPZD 1FMFA 1QG4A 4ZCLA 2AL7A 2P91A 3HJHA 3GAAA 2CXSA 2NAFA 3H0KA 3E70C 1I9CA 4C1BA 2F8TA 1N6IA 3ETJA 5D84A 3UW1A 3ZDBA 5ALYA 3G9QA 2QTVB 2FUG1 3D4PA 3H1TA 2CCGA 4F2DA 1FLDA 2WIKA 2Q9BA 2R6CA 2ZWMA 1AZWA 2J0SA 4UHDA 2O3JA 4M9RA 3H5NA 1YR9A 3WS7A 4W9NA 4YV7A 4MKFA 4F60A 4HDNB 3TGPA 1O95C 4NCNA 4RA9B 3BKXA 4OSPA 3MC1A 2GPTA 2V5UA 4O1IA 4BLOA 5CU7A 1YZVA 3D8SA 1VGQA 4YWJA 4EI2A 3SQWA 1I4EB 1SB9A 4L16A 1K7FB 4INPA 4KQ6A 2J45A 4M1KA 3RRYA 4CODB 5EJ6A 3ZWNA 4U0KA 1ADYA 2DTDA 2PMKA 3WDKA 1IXYA 2HDWA 1K0FA 2J67A 1K7XB 2YS6A 2ZG6A 3W6PA 1EBUA 1YOVA 1DCTA 5JAZA 4WCVA 3EXAA 3PRHA 3VVCA 1DBIA 5IKXA 2ZP1A 1IWOA 5E38A 1JA9A 4GPIB 1BHSA 4I2VA 1J90A 4IYJA 3TRFA 5K8LA 3OAAA 3T1HB 3LX5A 2F1KA 1LQUA 4CQLB 3OWHA 3F97A 4IV8A 3RBAA 4C3ZA 4DDVA 1TK2A 3RJMA 4AIRA 3RG8A 1F17A 2QZPA 3GRFA 4U8GA 3DZBA 1L5KA 4IUYA 3RUPA 3KP1A 4BJ1A 4W5WA 3GVHA 1GVNB 1BXGB 3OLQA 4C4PA 2QUHA 4HGRA 3VR3D 1UBEA 2Q5QA 3H5LA 3QLTA 2ZFUA 3G8YA 4KB5A 5CMLA 4ZQCB 3A05A 3TLEA 1WCIB 3JALB 4XLLA 3OPYA 1O9HA 3JQ9C 1J2RA 3RODA 5JZMA 5LPNA 1WIWA 2HLHA 3QJYA 4R2JA 3K9FC 4QPDA 4MYRA 2FUKA 3SQOA 2R8ZA 3CUTA 3KXLA 4DRXB 3LKZA 3B3AA 1J0BA 3VPHA 5JNSA 3G8CA 4OM7A 4WJZA 4B31A 1VB5A 1GFZA 3DAHA 5BN4B 5C53B 3H4VA 1C3LA 1B26A 1GN9A 2AOTA 4RH1A 4TXJA 5EKUA 3MA0A 4Q7MB 3IXMA 4KPUB 4WBXC 4DT1A 5BV0A 1IXSB 2L0XA 5CYPA 3V9PA 1C9JA 4B82A 2ECPA 3F78A 4KXVA 4YRBA 3T95A 4MROA 3UAYA 3ZS9A 2XOKA 3T7AA 8MHTA 1SIBE 4UREA 1CU1A 1EWRA 2IFTA 2UYGA 4RXMA 1RAAA 1Y7LA 2HA5A 4YJGA 5A71A 3IMEA 1AKVA 1CJSA 2FMIA 3B1ZA 4GVXA 1BX1A 5AICA 4CF7A 4WJLA 4IDNA 2IOQA 4KOAA 1DFGA 1PP4A 4LPSA 5EWJA 1L1RA 1W88A 2HSDA 4QA9A 5KX5F 3ZYCA 1GTJ1 2G80A 1Z5OA 2C07A 3DPSA 3KAJA 3FM9A 5LQDA 1KI4A 4PG6A 4DDHA 1Q0PA 1E4EA 4XX1A 1NUSA 1LLFA 4JI1B 3UA4A 1JF8A 3ZW7A 4ZI3A 2R8BA 2OBYA 5H59A 4MWZA 2FZ4A 1KK2A 2AX3A 2BCJQ 4NL4H 1U63A 3C39A 3PEVA 4RENA 4XR9A 5CBPB 3FGZA 1YC2A 1KJ8A 1Q7EA 1PUJA 1ZK0A 4M87A 4OV6B 5FI0B 2HBYA 1Y1PA 3WB9A 4QT4A 3PUJA 3WGZA 1CY7A 1WD5A 3EVDA 3G0GA 3VNSA 5C7OO 4WT7A 2QG4A 3FETA 3PP8A 4HNRA 3PC8A 2VT7A 4CLEA 1CEYA 1UINA 1UZNA 1EVYA 2LCFA 4QOEA 5H4GA 1O97D 2E0IA 4YPFA 4HLQB 4WK4B 2HCJB 4DQ0A 3E3LA 3GZ4A 4HXYA 1ESDA 1SCJA 4NOKA 5JOQA 2C99A 1Z2OX 1BOFA 1OGJA 2GZDA 2P3SA 1KI7A 4IOJA 1JPJA 2EGGA 1J0EA 4CTKA 3ND6A 5A02A 5I45A 4EATA 1EAMA 1QQBA 2Q2OA 2ZXFA 1OC4A 2EEPA 4MV5A 2JHGA 1E60A 5DV9A 5E0KB 3UQYS 1G7CA 4OFXA 2INGX 3PUHA 3TTTA 2VYNA 4P81A 3COJA 3LT2A 1M2NA 1P7PA 2QTWB 5K4GA 5KOJA 5L3SB 1DKMA 1KFCB 1WSAA 4DM3A 2QYSA 2H06A 5A62A 3PFBA 3JQ6A 1GPJA 5F2EA 4A0FA 1IONA 1I30A 1A76A 1MA0A 2GRJA 5FEUA 4WZAB 1M8JA 1Q7TA 5I9SA 3OZUA 3EUFA 1JTVA 4MW2A 4R9NA 4PNEA 4UAGA 2BRUC 1C7EA 3EIWA 4E33A 3RC1A 4ZREA 3Q3HA 5WRFA 1FX0B 1PFWA 3T0FA 4EF5A 2OGSA 4OBWA 3SOZA 3LA6A 4KHPB 3GUZA 3WBJA 4EYSA 4WBNB 4LTNA 3HA7A 4O4JA 1O08A 1WSBA 2DG2A 2Q3BA 2XTZA 4X44A 5JATA 2YHUA 3TUZC 2FQXA 1KR2A 1TMOA 2GCEA 2VH1A 4JX9A 2WBLC 2H65A 4TYPA 4UVIA 2GN0A 1CF2O 1KZGB 1CNEA 4X1KB 3U4QB 1TJNA 2YXEA 1IE3A 3NTUA 3PITA 3D8TA 2R97A 2DKFA 3D3QA 4HSGA 4OJTA 4KQCA 4TMVA 4IUBS 4Q9JA 3SS9X 4C30A 2FFAA 3V1MA 1ZH0A 1DBQA 1H9AA 1RI1A 2JA1A 1TK9A 2C5AA 1L8AA 1UBNA 3K53A 1LX6A 3ZGYA 3FSEA 1E2EA 1QFZA 3ICEA 4G5RA 1FMLA 3LUBA 3A26A 2VDKB 3U4GA 1I1HA 4QASA 1SCAA 4BC0A 4RESA 2A30A 3PQDA 3DT8A 1S3FA 4DMKA 1AG9A 4RJ2A 1IN7A 1NW9B 1QE5A 1L6IA 3E05A 3I9V6 3RT1A 3LBNA 3S2FA 4IJWA 4RFSB 4XTRA 1ZS9A 1IN6A 3K0SA 3NHWA 2EFHB 2ID9A 3KPWA 4OB8A 1KYIA 1ETUA 4MVJD 4RK5A 5CLIA 3HFRA 3GNSA 3TI9A 4CNQA 1OGIA 4B6SA 2Q7DA 3VZSA 4EYKA 5FWXA 3GRRA 3NOXA 2A67A 3PFIA 4E3WA 4PHCA 1BMQA 1LRKA 4I1VA 5BR7A 5A0FA 1ZD5A 2IE0A 2JZOA 4FB5A 1LW6E 1G55A 1N0HA 1X13A 1L5RA 3NIGB 3QFTA 4R8SA 2IV3A 2HLDD 2W6MA 3DVSX 1BS9A 3R7NA 2NYAA 4EZEA 4GYYA 3PR1A 4EUKA 4Y6GB 1TEHA 1LDGA 3QW4B 4K03A 2AOWA 4P0PB 1KA9H 2RBEA 3BTOA 4DVJA 1C3EA 1ZPDA 1NUTA 1XLTA 1Y1SA 4DV2B 1J70A 1NFQA 5T41A 2BKEA 3IIKA 1XEAA 3ELDA 3NKFA 3NDBB 1FNSA 3EMBA 1Y1KE 4J2OA 4KNWA 2I4OA 2BEWA 4NABA 5JXHA 2QL5A 3PUVA 1QPZA 3JQEA 1JH8A 2H2WA 4KX3A 4FOPA 1TX4B 2VPYA 5DHFA 4I8IA 4BTLA 4CLOA 1E6KA 4WA8A 5CFOA 4Z4QA 4KL8S 3AHGA 1N1MA 4ALKA 4BUCA 1RRVA 3INGA 1PJ2A 4FFWA 3RC9A 1SXQA 2EWVA 1ZNWA 4WIAA 1R9NA 4JUIA 5AJVB 5E8RA 1E2BA 2H17A 1NNUA 3RUCA 4NLLA 3VO9A 2VP4A 2OA0A 1NI3A 3I23A 5TEVA 5IYZA 2C42A 1ARZA 4JEIA 4ER5A 4UEKA 2Q7OE 3BQMB 2WHEA 1QAMA 2RJOA 2JIRA 1ECJA 2PMBA 1XJ0A 4MYDA 5B5SA 2ZJZA 2RB4A 3U3XA 1G7TA 4GT1A 4PM4A 1CE8B 2PR2A 2Z98A 4BHTA 3KS9A 4RDCA 3ZDDA 2G9QA 4LRWA 4OGWA 2J87A 1F20A 2FMFA 5IW8A 3RS5A 2C57A 1BXZA 1I7PA 2AH5A 2LUOA 5JDCC 4PG5A 4CM7A 2WILA 2ZRPA 1LBHA 2GEFA 1DAMA 3LCUA 4FMCF 1XNQB 3HMKA 1AQNA 3LTNC 2BFNA 5HZHA 1YFJA 2HCRA 2JH3A 1ECCA 2RKBA 1VJ5A 4K1LA 4L7VA 2V97A 4DNPA 5IH7A 3VNVA 4Y2JA 4W5RA 3A04A 1X6VA 1YQEA 1EEHA 3WV4A 4OUDB 1PWZA 4LHWA 4HEA6 4KSCA 4JI4B 4KK4A 2ZATA 1BVRA 2WWRA 1Y8RB 2C92A 3Q87B 2FPIA 4QNRA 3D6NB 4UCQA 3W04A 4Q1DA 1YR1A 4HZIA 5LR6A 2OXRA 3IBFA 3OCZA 2YXBA 1CK4A 4XCVA 2WJIA 1L1FA 1TEXA 2GTIA 3CUKA 1EJ2A 3OX4A 4URUR 2WA2A 5AJXA 3CWQA 4QBHA 4V3BA 1NM5A 4AG6A 4Q7QA 1TT5A 4R2HA 3ROXA 4UNQA 2H1WA 3I9FA 4LV8B 3LRXA 2QDKA 5FH9A 2WKPA 3FE2A 3GPBA 4WK0B 2C1EA 1SXJE 1DEHA 2C88A 3EOBI 3PZRA 4AQDA 5JVDA 1N5IA 4HGZA 3HCWA 2PS1A 4R5HA 4JSYA 1VOTA 2QN2A 1DOHA 3C0KA 2DUUA 4IQGA 4IRMA 2VUUA 3ELWA 4MYHA 1PSDA 3E9DA 1ULSA 4FYVA 4JFRA 5KYUB 3IT3A 1RQXA 1KEUA 2P90A 2NADA 1QHIA 2GAJA 1Z4OA 2LIVA 3KUUA 4R8KA 1TO6A 4AY2A 5HW0A 4RW0A 3LZDA 4JT4A 4LJKA 3RV4A 2B21A 5L3RA 3G5TA 5E3HA 2AXPA 5KMGA 1XEWY 4JODA 4V0SA 4MUHA 4AICA 1SKBA 4F7DA 1F4PA 3O38A 3ZHBA 4ESOA 3OKAA 3IEKA 4K9NA 3IPYA 5FX2A 2I8AA 4MW9A 5T6BA 1PWEA 4U2BA 3MQ2A 2CCKA 3HY6A 3BSYA 5DM0A 2LCIA 1LVHA 2D7DA 2A92A 4L75A 3GEEA 3VH1A 3GPDG 3FKSD 1P1JA 3TZHA 5JD3A 1OXMA 4RF3A 4NZNA 4QBGB 5JMTA 1ZY2A 3EC1A 2BFCB 4PAWA 2QJFA 1TM3E 3QE2A 5AXCA 4BASA 5ER9A 4DIFA 1I4WA 4DDTA 1BFUA 4MDHA 4DUGA 4U2GA 3A6ZA 2IT1A 4RJKA 4KR9A 4O4JB 1BNCA 4L57A 3EVNA 2WUDA 4O4HB 1V37A 3N58A 4NE9A 4JLOA 3SBDA 4LOAA 1EBFA 5PGMA 3FVTA 1B8NA 1GQFA 1IHYA 1US8B 2O7SA 4K7JA 3CNOA 4HAZA 5CEEA 1THZA 5AJHA 3AOEA 4KVFA 3BH7A 5FPQA 3NP9A 3LCVB 2FG7C 1G20A 3K0AB 1LQ2A 3DBRB 3VDNB 1HQKA 1MIOB 1JDSA 1OYWA 2WINI 3GN2A 4Q4HA 1E5LA 4YCLA 4OD0A 5AW5A 4L3VA 2BGRA 4X95A 1XF1A 2R7MA 1UL1X 1QP8A 2IODA 4HNAB 5M04A 4KFTA 1E2NA 1HPLA 5KTKA 1TXGA 4O4LF 1OYVA 1JU9A 3MPUA 3X0DA 5AM3A 4DPKA 1T0BA 4UFNA 4X85A 2XWJI 4MQ5A 1JU3A 4FGKA 1G8GA 2VT2A 3E48A 3GRCA 4BLTA 4EGFA 3EIOA 2ATEA 3QOYA 4AFNA 1COWD 4MEBA 3F67A 3FZGA 1I2AA 1XV5A 3PPVA 4X7BA 1U7ZA 3V7FA 3N8HA 2WJVA 3BUSA 3HV2A 5H8WA 4TOIA 3ZUPA 2VNSA 1CUGA 1YE8A 4HWSA 1YVEI 1XDZA 2F8MA 4I4LA 4KR0A 1DKNA 4OREX 4P31A 5CVCA 4JBWA 3HXTA 4PLVA 4GPTA 3FOBA 4UE3S 2W2KA 5FQNA 2ISQA 2QAGA 3DLAA 3L7DA 4RTOA 3BXEA 4J0QA 1Z4QA 4DFDA 1P5ZB 3MTAA 5LP6B 2V7QA 3VM6A 3RIHA 4RFSA 5FOXA 3VR4A 1KZ6A 3A1WA 3AVOA 3U26A 1HE5A 4PO1A 3NUZA 4MNTA 1NAHA 3AH8A 4GXQA 5DT9A 1DAGA 1FTNA 1XZIA 1CEXA 4S0ZA 3A3YA 3HZRA 4C1NA 1EFVB 2RGXA 3R74A 1U2TA 2PKEA 2NU7A 3NHKA 4MO9A 3P9YA 2EJUA 1A95A 3DAOA 3Q7TA 3O9VA 1OXBB 3N75A 3WWOA 5AW7A 3ACDA 3FMVA 4IGFA 4RVSA 2CL0X 4MWSA 4WINA 1YBMA 3B5EA 3JQBC 1WHSB 2G3YA 4NBTA 3BAFA 4RJJA 2ZUFA 5EQDA 2I54A 1PR4A 2YVLA 2VHWA 3ZHRA 3TIFA 2CF5A 2CHFA 4C4SA 2RHDA 2IWRA 3KD3A 1IIRA 1TUBA 1RI3A 2NZ8A 2W2QA 1VI2A 1NW6A 3TIXB 5IRCD 3U3MA 1W73A 4GYJA 2ERXA 3V4RA 3JSAA 1IC6A 3C3DA 3I04A 1EX7A 1PGOA 4FZRA 1ZNYA 1E6WA 3BYZA 4Q3BA 4YLYA 1EWKA 3CB2A 1MABB 1WU7A 1C3JA 3HY3A 4AP9A 2I65A 1PJQA 1C80A 4ZGWA 3EDMA 4YYEA 1XEXA 3ZCRA 3K73O 3HO8A 2ODBA 3IP7A 3FNRA 1I1NA 1DPGA 2D1SA 1NVUQ 4OMCA 4KREA 1O95D 3PX2A 2JJ8A 3DOIA 4HAVA 1T8WA 4FT2A 3HSSA 2FTKE 1V6SA 3DCJA 3TLGA 2ZJ1A 3X2EA 4ZMSA 2DAPA 1MGPA 4M99A 1N5RA 5HFNA 1QP7A 1OV6A 5HMLA 3KTAB 5AVVA 1Z17A 4I6EA 5GQSA 5BUQA 3QWFA 1KEEA 1SCBA 1PHRA 1T2DA 1W5SA 2IHKA 3NVDA 4FFBA 4QJ4A 5LB2A 5IKOA 1YZHA 1EK6A 2DQ4A 3VTFA 4XWKA 2B83A 2EAUA 1TAGA 3OZSA 3O7MA 1Q7GA 2OECA 2PG3A 2JFZA 4H7IA 1UT6A 4MTLA 2OVBA 2A1TS 4Y1RA 2ZQZA 1XNHA 2N46A 4WE3A 1GFSA 2GNPA 3P32A 4P3YA 4DV4B 4N39A 4XWYA 4DG9A 4YIHA 2GT1A 2PTHA 2JGKA 1QIKA 3I72A 1FU7A 2YMPA 1T0PA 3PR2B 4XWWA 1S3GA 2VFAA 2ZI6A 3Q0EA 1GGJA 4TQUS 4QYWA 1AH2A 1KH3A 3WL5A 1IHPA 4FUQA 5IVKA 3IAXA 2CLSA 1CUFA 1SCUA 4KVGA 5CXQA 5LA6F 4AF8A 1MIHA 1X1TA 3E18A 1BHQ1 1TPYA 2J6CA 2XY4A 3M6XA 1L6RA 1EDEA 4KO8A 4LIPD 2R85A 4WOPA 3EBLA 5E2BA 3W5IA 4BFZA 5KNBD 1ILEA 5LNK1 1VDZA 2HU5A 4FC6A 3ZPXA 4XQCA 2E4XA 3DL7A 1P2GA 4A82A 5BNWA 4PGAA 1QCDA 3KNZA 4CL2A 2WJ4A 1LRJA 2I4MA 4JLVA 3WX0A 3PT9A 2A7XA 4MMYB 2P3LA 1RIFA 1AKMA 2CMKA 1CZUA 4FC7A 3VTKA 3ZN2A 2XKAA 5DU2A 1XCJA 4Q4AA 1ZICA 3MJVA 4WXEA 4G0MA 4DL9A 3NT5A 1E2HA 2UAGA 1EVEA 4FLEA 5LZ8A 2YYSA 1KO1A 3DCYA 4R81A 1QU3A 3ZGNA 4QWWA 1I7DA 2XADA 4LGMA 2V45A 1JNYA 1DBPA 3GLGA 4RK6A 2QGNA 3GLVA 2R0QC 1RAFA 4MPTA 1ONNA 4NP6A 2FCAA 1H8HD 3MWDB 5EJAA 1PFYA 3MW8A 2AFIA 5EZYA 2X4IA 3OFNA 4JVOA 3LP8A 2GUGA 2A0XA 2BE9A 3HU1A 3FSGD 4NCJA 3WLLA 4DWWA 4MIYA 2CSXA 2C29D 3BJRA 3RAPR 5FRDA 3WRYC 3COVA 3OVMA 4WLFA 5ALMA 3FCYA 1C5KA 1JR4A 1I7NA 2P6MA 3ANTA 3DZDA 3N8IA 4EGJA 1B2RA 3WMWA 2HRCA 2XUJA 3HVJA 1RKVA 3HU5A 1FIUA 2B4TO 1WPQA 3A7EA 1X7YB 4J0IA 3V6MA 5IS2A 3I58A 4NX2A 1RRKA 1VE3A 3P9KA 3QELA 2ZIEA 4AJ1A 4B32A 5A3JA 3U7HB 2AFVA 3LX6A 3H1AA 1YBHA 2EJVA 3QXCA 1DVRA 4M60A 4TVKA 1ZU5A 4BVKA 3BX1A 4TT3D 1FQKA 2C78A 3P9CA 1JEDA 4KXQA 3LLUA 4C04A 3TMYA 1YZUA 1EP1B 4JOSA 3SYRA 4BYGA 4HB2A 2G06A 1NVGA 1L5MA 5L7YA 1NR1A 5H5JA 3W78A 1ZXXA 4DCUA 4DLUA 3I2JA 3HVRA 4LXXA 4ERXA 2EFEB 4HN4B 4B44A 4FJ0A 3AW8A 2IQIA 5FJIA 4GRIA 1K06A 3KL4A 1OBFO 3SWWA 1J99A 2ORVA 3LZ6A 5EEGA 2G25A 2FK8A 3K16A 3KVOA 4UTPA 1VPTA 3ER8A 2AB0A 3IAS6 3A31A 1BMDA 1PJRA 1SXJD 3M3HA 4UFPA 2AXNA 1ACJA 2FI1A 2PZGA 2WYOA 5JR3A 1JHOA 4QRHA 3GDFA 3E5RA 1QWOA 3KYDB 4J75A 5EKSA 3WOHA 1GU7A 1MD9A 2AT1A 1EE2A 1NP3A 4FOOA 4KJXA 3STXA 2F3UA 3ZVKA 2VL7A 3NBXX 2HRQA 3O3OB 3TL2A 4CF6A 1KMNA 2BFFB 1CRWG 3SKVA 4QUKA 3REOA 1T3ZA 2QQ5A 2JJ1A 3NGXA 4FGLA 4EX7A 4AKHA 2P9QA 2V65A 4GR5A 3B78A 4E46A 4BBJA 3D6HA 4X1YB 2QSJA 3IA7A 4ZIRB 4QFDA 1YA8A 4GD3Q 5ILOA 4JZYA 2QV0A 1GTMA 2Z4TA 4MP6A 4PYKA 3OZTA 5G1PA 1XHEA 3NRBA 4NMWA 3KSRA 4P93A 4A8JC 1R5JA 1W88B 1VSTA 3JALA 1L7AA 4FHGA 1V9SA 5LP6F 4ZU3A 2D5LA 5CVEA 4JP1A 1MFPA 4CEIB 2RMKA 5C8YF 1BAPA 1QS0A 3CX4A 2XQJA 1SVIA 3LYAA 5SV2A 5A3QA 1MFZA 2AKAB 3A0RB 1PE0A 3NT2A 1YIDA 2BN4A 2C20A 5G4LA 1RDFA 2C5FA 1YCFA 2IQ5A 1FL9A 1ZI9A 2JLQA 1SHZA 3AR6A 1O77A 2BGKA 2QXTA 4B73A 5FORA 5IM5A 3BCSA 5JI3E 4BN0A 2PEZA 4WEQA 2GJAA 3IAAA 4MR8A 1XTKA 3ESAA 3L1IA 3Q85A 5AM1A 5B3AA 3UAWA 4M9SA 1ZK4A 3VAYA 3AL2A 4OBBA 4Y1FA 2P8JA 3LCCA 4FSHA 3AERB 4Z9XA 3WJ1A 1AK9A 1NQUA 5IAKA 1V8ZA 4LTDA 4BNIA 1T6XA 4CDMA 3F3MA 2QRKA 4DUPA 4G8CA 4M9UA 4NHOA 1J2JA 2HIMA 4BNKA 4OL9A 3ZDAA 1L4HA 3VKUA 4ECEA 4MRRA 4CQMD 3CVJA 1GGFA 4UNRA 1JLSA 3AXTA 1ZRNA 4NBKA 2WAOA 3AESB 1SZPA 1T5OA 3DKKA 3OX3A 4U7HA 2WUFA 4N6OA 1D9ZA 2GSDA 3FBWA 2FSUA 4GAEA 1YA6A 2ZI4A 3H99A 5KCZA 1XVTA 4F45A 5I7FA 1Z56C 4RA6A 2X19A 3H9EO 1TYDE 2Q1WA 4YP7A 2DLDA 3TRDA 3OC0A 4Q7KA 3EISA 2JGMA 3DDWA 3UFXA 3Q15C 1Q1ZA 3RTEA 3ZJYA 3N2EA 1VBNA 2YZ7A 1V9LA 2QY9A 3LY7A 3SJCA 1EJ6A 2ZJ8A 5FBLB 3G23A 1GNQA 1TQ4A 3TUIC 1Y8AA 3HJBA 3MTBA 4KE6A 5LD2C 3OEYA 2AMVA 3KOYA 5DRTA 2VSFA 5UKDA 3BL5A 3LRTA 3C3YA 2XIJA 1QK4A 3KEQA 3VDQA 1ZI8A 1IQPA 1VMIA 2PT6A 3BZUA 3OT1A 1VE9A 3GNLA 4KAAA 4LGCA 3HNOA 2MCFA 1R6DA 4QRDA 3VO2A 1YS9A 4FP9A 5CVVA 5KJ6A 4Z3OA 1NYQA 1WNFA 4KLAA 2HPAA 5F9FA 1C7RA 1KHHA 2JVKA 1YCHA 1HV8A 5CT5A 1EUYA 1A0OA 1V5EA 2HB6A 2W6IA 1BS1A 4MJLA 4W8GA 4HDRA 4X1KA 4CIXA 3IAS1 2CLIB 2Z57A 3P94A 3HCFA 1G9TA 1G20B 1ZINA 2G1UA 5AOCA 4QYIB 1P8AA 2J59A 1YQXA 3AWIA 3B1XA 3N74A 1L5YA 1NTRA 5KVQA 1XEWX 2FWBA 3PXXA 4F04A 5AJYA 3U17A 2DM6A 3V34A 1MENA 2D74A 3TCKA 1Z5NA 4QEKA 4KU4A 2LP4Y 2HXSA 4YFYA 4EKYA 3GVXA 3IBTA 1XYYA 2NG1A 2B4QA 2XBUA 1KC3A 4YEDA 3BULA 3KR9A 5CPBA 1KSGA 3O2JA 3WGJA 1QO9A 5JSUA 3JARB 1DNPA 1Y6ZA 2R8PA 1E2LA 1IBRA 3GJTA 4KWIA 4PRKA 1JWAB 2R5WA 3HXPA 4GZ6A 4ENVA 1HLPA 4JXZA 1G3QA 4P4NA 2YJ3A 4LYHA 2XB6A 4M8KA 2Z8XA 1CHNA 4BNYA 1T3GA 3ND8A 4QBTA 4V0OA 1GQ2A 4D80A 5I7HA 3SVTA 3HXMA 2DERA 1SURA 1VM6A 4NMXB 3EPPA 3MZ0A 3FOWA 5D87A 4ZAWA 2WW8A 3BF8A 3RVBA 3KALA 5BWLA 5EAIA 3OCXA 2C96A 1XVUA 4FOSA 1J5XA 1T2CA 1SIWA 2JF0A 1JALA 1Q1EA 2IDJA 2QE6A 3AI2A 5FBHA 4KFUA 3AVVA 3R7WB 4B0PA 4M54A 1ICEA 3TXXA 4RWZA 3H4TA 4UTZA 1RYYA 3RS3A 4BECA 2WNHA 4FR5A 3CV3A 4AZTA 2PQ0A 3H04A 2OUKA 3Q3VA 5EMKA 5H0IA 1F1JA 3MUOA 2O14A 1DXYA 1UFVA 1F4VA 1IM2A 5EOVA 1GEGA 3SMVA 3RM3A 1Q22A 3VAAA 2Y93A 4HZGA 4N3AA 1GO2A 1LFDB 3I30X 3EN0A 3O4GA 4QAQA 4OMUA 5LQCA 1NJSA 2A7QA 3BG5A 1W7AA 2FMHA 3M6MD 3TQHA 1MJHA 3T12A 2EW8A 5EMHA 4OL0A 3R3JA 1RCTE 5TGDA 3SS8A 3KUDA 5F51A 3HH8A 7REQA 4U9UA 3GUVA 3GLFA 4PLFA 2VEDA 1LX7A 1QQTA 2NZVG 2WF7A 1KP9A 3M5WA 5IDYA 4L51A 1Z5WA 3IEIA 3WY9A 3RC8A 2P6OA 5LKRA 1TA0A 3DDOA 4HQKA 2WUWE 3CG4A 4QODA 2B1QA 2QRUA 1ORRA 3UVEA 4HEJA 2D0OB 2LRHA 4X8HA 1N2JA 1NQWA 1R4ZA 1VZ3A 1C50A 3UAZA 2IXFA 3E9EA 2XYRA 1J6UA 3HDHA 4A0GA 1DMRA 4AECA 5E9AA 1A71A 1XCLA 3JRNA 1IXZA 2GVNA 4MVJA 2R87A 1DJOA 1P1RA 5EGNA 3E82A 4ZV7A 1QHYA 1KPHA 4M7PA 5ICGA 4H3SA 5CM9C 5BSKA 2XKKA 4DR3B 2WTBA 3UK2A 1JKJA 1P75A 3JASA 4NCIA 5B64A 3QRWA 5GM1A 4P3NA 4XVCA 3OIWA 3M82A 3KE8A 4C4YA 3L0YA 5DLPA 1UF9A 1SBIA 4FEAA 3IHTA 3LPMA 1TZKA 3MINB 2FWNA 4OA5A 2G72A 2G9RA 2YDYA 2Q1UA 3DTVD 4X8OA 3C7TA 5EJGA 5A9SA 2ZT8A 2Z56A 2X3FA 1L7QA 3GBSA 1M7BA 1G9XA 1V9CA 1EUCA 5CK4A 3O3MB 1XZ8A 5DCUA 1DQNA 1LFAA 3AUKA 3DMPA 3C3KA 3IOBA 4LGVA 3QE9Y 1R9JA 2GZ1A 1HDIA 1G64A 2BBOA 2ORYA 3AJAA 3R0ZA 2FKNA 1OLSA 1T10A 2Z5FA 3HEAA 4S12A 4CMIB 2BCGY 2WVJA 2FPKA 1D1TA 3M6LA 2RGDA 1EP9A 3KJHA 4R69A 3CCCA 4A8JA 1CUBA 4LZAA 4MR8B 2L42A 4IIXA 2CXOA 4DDMA 2HF8A 2JJ2A 1D4ZA 5M5BA 4K40A 3OQOA 3ZNOA 1XDUA 4HQNA 5CAEA 5DBIA 1KMIY 2FU5C 2ZVPX 3E4DA 2Z2YA 3QK7A 2XITA 1ZD2P 2W6ZA 4MQBA 4NYJQ 1YDFA 1P44A 3IV9A 2G76A 2Z83A 3BDIA 3JQ8B 5JZ9A 4C20A 4B4VA 4ENRA 2HZBA 1NFRA 4MQ6A 4WXRA 3R6GA 2FDRA 4HADA 2B82A 1TB4A 1Q5PA 4RD4A 1OASA 1T2VA 2JFUA 3VNQA 3AFNA 3DE2X 2XYPA 2VTBB 3AUTA 3G5MA 3P26A 5BP7A 4XLTA 3ZY5A 1Z0AA 4K0RA 4M1SA 3ZG6A 4EW6A 4C89A 3PLAE 2IY8A 2EDCA 5FA6A 3WK8A 1JBEA 3H2HA 2WFLB 1DHRA 2EG9A 1HZJA 3EQ6A 3OU2A 4M1QA 1XTIA 4YJHA 2XB4A 3LOPA 5CA0F 3ZE1B 5DYIA 4OSEA 5CTJA 3ZWVA 2PZEA 3NEAA 4FMBB 1JPVA 3IOYA 5FPPA 4YCAA 5IBCA 2EIHA 2D8MA 3F6YA 2X1LA 3LMKA 5TQVA 3GD5A 3DFIA 1JTFA 4OLFA 3NONA 3W7BA 4KQEA 4Q7JB 3NR2A 4KO1S 3X1ZA 3QFRA 4J4TA 2IUUA 1QTQA 1L7PA 5JADA 1HG1A 5TLSA 2QUZA 4JXXA 2YS7A 2RHCA 1CDZA 1UBHS 3NU1A 4D02A 3ER9A 5BSMA 3WAKA 1FA9A 3GGSA 3LWBA 3A2KA 3B9RA 3G7UA 3L01A 4J9VA 1YMUA 2W5UA 1F2UB 1RLOA 4WASA 4IIDA 3T1NA 1ABEA 5BMVA 3KB6A 2GLUA 4LY6A 1B0UA 2CXXA 4HQ0A 4L3OA 3TBHA 2HT1A 1E99A 1P2UA 1P1HA 2ZK7A 4NOJA 3GXOA 1Y8QB 1X7XA 3WE7A 2OZLA 4QIHA 1YVRA 2GO1A 4B83A 3K8QA 5G0SA 3AONB 4QNNA 1IPHA 4HP8A 4N03A 4YT5A 4DIMA 2GAAA 1DT3A 2B2CA 4RTNA 3Q9UA 4UULA 4AULA 2OPHA 2ZB2A 1BGWA 2IYXA 2VJOA 3DO6A 2Y1GA 4UNSA 4AZ0B 1UZMA 4Z4EA 2HL6A 1SKUA 3MAGA 5B30A 4HI0E 1YC5A 1ORWA 4HN2A 1UT5A 5GZ3A 1YK1A 2VF4X 3RLIA 2R8RA 3H1PA 4DAOA 4D7AA 4EUEA 2IYYA 3IO3A 5MN6A 4DV6B 1VG8A 3KL2A 4PPGA 2C2OA 4O4HA 4ZC1A 3UXYA 1ISIA 3DBOB 3KKQA 3ROMA 2VDRB 3NM6B 4BQPA 5LP6A 1T15A 3EXEB 2OBMA 2PD4A 1E96A 1DIOB 1G1MA 2R7KA 3NCTA 4JBHA 5EZYB 1GSOA 1U80A 2YHIA 1EXDA 2MTBA 2KPOA 1RQGA 3ABQB 2JJQA 3OKFA 5GVRA 3L8ZA 3AXSA 2CVFA 1K63A 1WAMA 3IHKA 1BE1A 4MQEA 3V8RA 4EWLA 4M9ZA 1ZNXA 3K6RA 3AF4A 3Q88A 1RYDA 4LX0A 1TJ3A 2G9ZA 1LC0A 4H18A 4JK3A 3AP3A 3U4DA 2QG9A 3RR2A 5JS2A 5LOVF 1WPRA 3DLBA 1M6WA 5TQ0B 1W4RA 1E1DA 2E4ZA 5GWXA 2AMLA 2E18A 3ERCA 1YUBA 1RYHA 5ENDA 3KQSA 1N8TA 1XCBA 3ZVNA 4BYMA 3ZBQA 3I32A 1WUYA 3IE0A 3QGMA 1RYEA 1E3LA 1Z34A 4A5SA 5G4KA 2VQSA 3SEZA 4JVSB 2PCJA 3LF1A 2DBRA 4MJ3A 3NTRA 3ZHCA 2Z09A 3V1KA 1XE3A 1JT2A 3A14A 4GL4A 4V0RA 3V42A 3P0RA 4KRYA 4WOKA 2GYWA 5EJIA 3F8WA 3R4CA 1UXJA 3QF4A 1CZNA 1OWNA 2GJSA 4NK5A 2ZBGA 4LNUB 4RMIA 1XZEA 1VIYA 1T2NA 3FMOB 4ZV9A 2AYYA 3M2PA 4EFLA 1C30A 5JUWA 2K5UA 5JS6A 4YROA 5H68A 5HNKA 1ECPA 1GN8A 5T8KA 4QUIA 4UUQA 1PDWA 4FI3C 1PVVA 1XA3A 4WESA 2I2AA 5FUVA 2CXTA 5EXEA 1I3MA 4UU7A 1HR0B 1G9SA 1CY1A 1DDIA 1PLKA 5AW8A 1LY1A 1RHUA 1UXGA 2AFHA 2NOAA 3GFBA 4A7PA 2WQ7A 4H60A 5IHPA 2YYZA 1N33B 4WLOA 2J4DA 2GDZA 2XKJE 3NEPX 1VRVA 2WTMA 1T3SA 3DFZA 3OM0A 2XEXA 1POXA 4PIMA 5JZBA 3PGXA 2QP3A 1RQLA 1ZH2A 4E6EA 1M5UA 4AWXA 1E18A 1FNMA 1XZQA 1A96A 4IMJB 1XPOA 5K3DA 4LHYA 5JECA 4S0XA 4C2TA 2X8AA 3OTOB 2BMJA 4J29A 4J1TC 4BY9E 1DC4A 3PL1A 3DVLA 3FR8A 4HR7A 1JMKC 4UQOA 2X13A 4MDYA 1LDYA 4QU0A 3B36A 4JKIA 1NI4B 1DJNA 3GLHB 3PCRB 4KGZA 5FPYA 3SQDA 2I3DA 4ERNA 3N0RA 5AI4A 2G82A 3GC6A 5F21A 3QEMA 2FDXA 2ZB7A 4ZCRA 4Y2YA 3OIYA 2X6TA 5DWVA 4OI4A 1LPAB 3IIEA 2GPAA 3VGJA 3OLVA 1LEHA 5EHZA 3GIWA 3IJEB 4QUHA 1JSZA 1N2BA 1QORA 3CB4A 3W6UA 4DMGA 4M8IA 1O0BA 4EW3A 4ENPA 5LIPA 1TTTA 1EESA 1UEIA 4FFNA 2VH5R 4O5OA 1CW2B 1PNTA 3ZXUB 1N6RA 1L5ZA 4MW7A 3NAZA 4EBFA 4J7CA 3WC4A 4R7GA 1JQBA 1TIBA 1LI4A 4MLCA 4FDLA 5A7HA 3O2SB 1BG6A 1SXGA 3LF2A 3NH9A 5FFNA 1UOQA 1ZL2A 2XMBA 4EYGA 4RE5A 3JQCA 5DTIA 3ENNA 4HVLA 4R0NA 1EE9A 2W2TA 1J9EA 1OVGA 1ZN2A 3JAWA 5FOSA 1QV9A 4OYLA 3CZRA 3ZTYA 1ZMTA 4GWLA 2P2ZA 3AO0B 4C7OB 1GEEA 5D5PA 2ZAOA 3V4PB 3BMCB 1DRJA 1JDJA 4IQFA 1XMPA 1J8VA 4IICA 2BAGA 1NR5A 4CCSA 1M0SA 3R3ZA 1Z5ZA 4IHQA 1J23A 1XN1A 3OURA 4JROA 4U6SA 1KWKA 5K01A 1CETA 4I5GA 4QEDA 3J7AC 1WQ3A 4UVHA 2H0QA 4CG0A 5JJLA 5T6MA 1RFLA 3H17A 2WM3A 4UNIA 3RANA 3TOXA 3Q8XB 2V59A 5I7RA 2I34A 4OA8A 1GNLA 3BQ9A 4DGQA 3E0XA 3HGTA 3VX3A 3PKZA 4R05A 5EIHA 2AYXA 1C1XA 1Q1GA 1UBSB 4JX8A 2WWVD 4B35A 4EX6A 3I05A 3HVKA 3REFA 1ISRA 2P69A 4B4UA 4RJIA 3PFCA 2ZZNA 4UVDA 3M5CA 2DHQA 2GKGA 1Q17A 2P2LA 4QL3A 4Z4CA 1EFPB 4C6SA 1U0EA 3KZVA 3N7UA 8GPBA 3EBPA 2QRQA 4EF4A 1NF2A 2W7TA 3TTSA 1G0NA 1ZD9A 2ZIVB 3AI7A 2PRSA 5A0VA 1SCNE 2NWQA 4N5DA 5EEHA 3OU7A 2K4MA 1N6PA 1ZIOA 4LOIA 4FD2A 1N0VC 2FPMA 3SF0A 5JYCA 3WIVA 3BCRA 3TSYA 4YN3A 3WKBA 1AKQA 3QMMA 3R3XA 3QLVC 5D6NA 2QNIA 3JY6A 1R3DA 3NFRA 3MRXA 5TQ2A 8ADHA 4DA4A 3G7NA 4DCCA 2J9ZB 2YVKA 4BIIA 4AUNA 1OZFA 2OO5A 5B7QA 2LTAA 2JEYA 2Y4NA 3FWHA 5K3CA 4LGYA 2ZRNA 2XZDA 3B53X 4PVCA 5KSPA 2XKBA 3SEAA 3T4PA 1W87A 2V4ZA 2YMQA 3DH0A 1JEAA 4RD6A 1IB6A 2QE7A 3SK0A 4NQZA 5BV1A 2A84A 3H3XA 3FBTA 4MIEA 4IGKA 4BX0A 2J0VA 4BN5A 4DLXA 4KQXA 2UVPB 1KRWA 1F4LA 2H4WA 7GPBA 3K96A 1CLUA 5FR1A 3GLRA 3NT4A 3CMMA 3MJSA 1P45A 3HDVA 2XHEA 3K5PA 5AW6A 4CKWA 1WDKA 4ZVPA 1O89A 4LZWA 2ZTVA 2EX1A 4G5YA 3S2IA 1INLA 4HT3B 5JAIA 5JZOA 3ETDA 4BBAA 3QKTA 3H1BA 3HBAA 3WWCA 2IEBA 1RFGE 1IBLB 1A5TA 2KI5A 1WHTB 2VRCD 2ZJYA 3LGSA 4LNHA 4MS4A 3ZHSA 1CG6A 4QGHA 3U60B 4FS3A 1AQJA 1XKTA 4EBBA 2PFSA 3CUYA 2WSYB 3L2OB 3Q0IA 2A5DA 4OGFA 3AOGA 3N6VA 4C4OA 3ADBA 4LHEA 1F2VA 1GRNA 1PZNA 1ZHHA 1OU4A 1NN1A 3IQZA 3M33A 1Q7CA 4N3BA 3S68A 1B0ZA 3QKRA 4CCAA 1EP3B 1U5AA 3ID6C 4PXSA 2GCPA 4BFTA 1N4DA 3IUSA 4U6QA 2D2VA 3ROGA 2CHEA 3I2KA 2Q6VA 4YAUA 3NZEA 3T3EA 3ZW8A 4EMBA 2PWPA 5A1TA 2VA8A 2BJWA 1HNXB 3KSUA 4H6WA 4ZT5A 3LLSA 1Y9DA 2XXBA 1RPNA 3BE5A 2FPPB 4FX5A 5EPEA 3TLMA 5L3VA 4F4UA 4V2IA 2HC9A 3TMKA 2PUHA 3IIMA 4BQIA 4NCKA 4CKBA 4EZIA 4BXOB 4P32A 4HDKA 2XMQA 2XUGA 2X4DA 4IXNA 1YQUA 5I9MA 2ZIAA 1B43A 3A58B 2DF8A 4C0BA 4TKUB 1NF8A 3U7QB 2G40A 3WKEA 1N2ZA 3EZYA 1J2YA 1GCOA 1M8GA 3CNQS 2HJWA 2W0MA 2ZE6A 3KHKA 1QGZA 2FQ1A 3Q40A 3MCAA 5EMMA 3N39C 3AR2A 4RELA 3VPBA 2RH9B 4YMUA 3L4BC 3I6MA 2BUBA 3WHPA 2D3TA 1B8PA 5HGJA 5A7GA 1CQIA 1C0KA 3CTMA 5FD8A 3QUSA 4DQUA 2F9MA 2XOKD 3ZX4A 3QPDA 4TLCA 2QX4A 4WFKA 3JQBA 1ZW6A 1XWIA 2WZQA 3FWPA 2EBUA 3U61B 2JARA 4LF8B 1OTHA 4UEOA 3EXIB 1FZQA 3H3FA 5FULA 2H51A 3AYZB 1H6AA 3WDMA 3KXKA 3CH5A 2DQYA 3SZOA 5HMMA 3BILA 3O95A 5LSAA 1CNMA 2NZJA 1XFDA 1X0VA 4RPLA 4D25A 1GUAA 3L7MA 2GEKA 3LUAA 4CUKA 2ZUVA 3DPUA 4DSOA 2O0MA 2VCHA 1MOSA 4J94A 2GFQA 4FNMA 3LUCA 4AG3A 1UKZA 2PH3A 5BN5A 3UHOA 1Z2EA 2NZUG 3JSXA 3GGDA 1NXQA 1RJWA 1UC5B 5B36A 3WYEA 5ADHA 1T0HB 2I33A 2ORWA 1CZLA 2I7VA 4PSAA 4HDSB 1U9CA 5KKAA 4PRYA 1RS0A 2JKVA 2OOKA 1IY8A 1KGSA 3VR2D 1J1UA 1UKBA 4XYBA 5D6OA 3D6TB 1SWVA 1ATZA 2WVGA 3HCOA 3HBJA 2ANBA 3L6RA 1AD2A 1P4RA 1U3WA 3RFVA 1V3TA 5JH7A 3DR5A 4TRJA 2VWGA 4OB7A 4XB2A 4U7PB 2R62A 2FYTA 2QT0A 3I0MA 3P0EA 3DBIA 4Z9YA 3C5CA 3UJCA 5HF5A 4WBNF 3E1KA 5JLAA 3VVLA 4DYDA 4ZMRA 2WYIA 1NW8A 3KBOA 3FVVA 4LDAA 4RV4A 1QPBA 5ENVA 4YAOA 3NVMB 2JFWA 4JBIA 2RAUA 1CQWA 4EJSC 1KI3A 1B8UA 3GT3A 5CDSA 3N6RA 3I45A 3QA3E 5EHNA 2C7QA 2UVQA 4KMMA 4XX0A 1U2DC 1N0WA 3F9CA 2GK6A 4IEEA 3E9NA 3HP7A 1UIMA 3BMCA 4JHLA 4NYJR 1K9SA 3UFBA 1JE1A 4Q4HB 4O63O 5LA6A 4PN7A 1M0EA 2HR1A 3ED1A 3LQYA 2IYEA 2FPWA 2ZRFA 1SUBA 5DH9A 3V8QA 4GKJB 3LCMA 4BO9A 5AOVA 1P91A 4K8RB 4Z53A 3BXHA 5EKXA 1ZGCA 2O8FA 2B4YA 1A9ZA 1JLLA 1KBQA 4I0WB 3DM9B 4J6EA 5J4LA 3GUYA 4XOIA 1O4WA 2HA7A 1GARA 5D5HA 1MJGA 3A9WA 2WJYA 4UQPA 3H13A 3NDRA 4PZYA 2IELA 3GV0A 2F8SA 3IQWA 1UJ5A 3MILA 1PK8A 1YS2X 4LRXA 3BXGA 2OXIA 3TOZA 1PO7A 1I5OA 1WVMA 1YGPA 1G3UA 3ILXA 4UCWA 3ROFA 3TQFA 2WQZA 5G0WA 4PAQA 4RV9A 4RPCA 1CRQA 3RKUA 1F14A 1JYFA 2H9YA 3C1UA 4NZYA 5DIFA 3MELA 4OLBA 1PTKA 4E12A 3G0CA 2HJHA 1IPFA 2A78A 1W5BA 2OORC 5EE1A 1GTVA 4RBNA 5HJ2A 4ZTBA 1A1VA 1PZGA 2Q2NA 3AEXA 3W5JA 3GZJA 2FEPA 5TB5A 1IOLA 2XB8A 2GVDC 1P7CA 1AZTA 1WXXA 3OLCX 1QS0B 4LBVA 3TX2A 4LNUA 4DS3A 3DXZA 5A9TA 1VTKA 1ZGAA 4CIWA 3THYA 1FPMA 2VPPA 4CQLA 2IZ1A 5LQKA 2ZPAA 4WNYA 2QMHA 3GELA 1C3XA 3MM4A 1BX3A 4NENA 4BVJA 1NZFA 4F2WA 1DWQA 3Q8LA 1H0SA 3W2TA 1Q7BA 1QP4A 3G0HA 3WJ7A 3UXEA 2EZ4A 2VR1A 1I2DA 1N6LA 2YBEA 1BOOA 4WOJA 5BQOA 1FVXA 5B1SA 2QL6A 2ECQA 3UXMA 1XYGA 1SUSA 3NATA 4CFZA 1R6TA 1GNRA 4P2BA 2GHTA 2HIHA 3PHBE 3WYCA 5JSHA 2XUHA 1WDMA 4UHBA 4MUEA 3RRFA 4ZIRA 4OMFG 1G8SA 4J9UE 1BGVA 1HTTA 4L5AA 4U63A 5FL7A 4PCLA 5SZKB 4G0NA 1KO5A 1SZDA 1U98A 4MGKR 3SBEA 1ZOLA 4JJFA 3A27A 2FX2A 3F6SA 1VCHA 2VJNA 2R6FA 5JNTA 1FB5A 2DVMA 5LQRA 2EKZA 3KAPA 4PV7A 3EGXA 1HFKA 5FOQA 1OY1A 3BRSA 2LD4A 3V8NA 4XFJA 2ZSEA 3ZDRA 3KSAC 3GHHA 2ZW9A 4MV7A 1CUIA 3ETGA 3QH4A 1BFDA 3OPQA 2GEBA 4EEKA 1GT91 1RJFA 3IIIA 4FQ5A 1QM5A 4MV6A 4YO7A 4YQYA 3RVSA 4YRMA 1EDBA 4MUKA 1Y9ZA 1G41A 1E9BA 2P9FA 1AB6A 3O93A 4KLCA 3OZXA 3OTWA 2A4MA 2A0YA 1PLJA 3HJAA 4M0DA 1U4SA 1KJYA 4MVCA 4A91A 1LU9A 4R2LA 4ZYUA 3C74A 2JFHA 2X5OA 5FBZA 5BWMA 2PLNA 3QX3A 3CSUA 1ACMA 2JFGA 3WXMA 5G4KB 3AM3A 2P9GA 3T99A 4CKYA 4KCGA 1TF2A 4URYR 3FOCA 2YXNA 4XM1A 5DGHA 1A9XA 1NG9A 4IHJF 3M6WA 4ARVA 4GLFA 1A8UA 2NQTA 1LK7A 2QRHA 5K4HA 2JIMA 1NATA 2EW2A 4K9KA 1U9JA 2MSLA 4QPJC 2FFJA 2NUPA 5EE0A 5JHGB 4Q34A 2MINB 1ZQ9A 1UAGA 4RTSA 1TK3A 1Z9BA 4WKGA 3ABOB 1NC1A 3BK7A 4WXPA 1PR1A 4JJ4A 5GJVC 4ASUD 3CLVA 3IR5A 2XT0A 1GPNA 4R2WA 4RJLA 1M1NA 5L40A 2IX9A 3H9QA 4MWEA 1ZGZA 1EGMB 4BO2A 2AQHA 1WBBA 2WYVA 4WY2A 2PIDA 3ANSA 4NYMR 4WZBE 4CNBA 4K9QA 3K9BA 5KQSA 3PNVA 5AKJA 4MB0A 2ZJOA 5AK3A 4N49A 3DGFC 5GOTA 3N9IA 5IAAA 1F3OA 4AJLA 5DX1A 3B6JA 2HW8A 1QQ7A 2A4KA 1IZ9A 1F8GA 3ZJUA 3G2MA 2A0WA 5C51B 3L4BA 5GPBA 4HGOA 421PA 2XUAA 2I71A 4LUCA 4WUTA 3Q5GA 2XT9A 3VHRA 2IBSA 1Q12A 1RWXA 1T3HA 3KKEA 3LPAA 4QO7A 3W2IA 3GGOA 4ONEA 5ESDA 1TW3A 1GG8A 4AX8A 4EHFA 1U4NA 2JHPA 1PD0A 2QV7A 3YASA 4CTOA 2D1TA 3QV2A 1P1FA 4D82A 3UO8B 3KQVA 2C7GA 1G6HA 5HZMA 4J8PA 1CKEA 4GLOA 2IXEA 1A4XA 3CRQA 3EDCA 4GBJA 3O84A 3D6VA 4IXDA 5IKEA 2A9QA 3CE9A 4R1MA 4GBMA 3IBCA 3T7KA 1XMOB 4ZYTA 1U5BB 3B9BA 3VUFA 1CUCA 2C2HA 2R7NA 1IHXA 3I34X 3PF9A 1SD5A 1UC4B 3AV0B 3BIXA 4I6GA 4PC2A 3F3YA 4QQNA 3KJNA 3W0LB 3C43A 1Y8CA 1JSLA 4CN8A 2AFRA 1JE0A 4X66B 3OD1A 2BFBB 1SY7A 5DTRA 1L5LA 2YHIB 5JH7B 2WWYA 2GD2A 1RYNA 3JVEA 4H35A 4UARA 4D8UA 1DFHA 2FW6A 3R5XA 4XUGB 3RYHB 4CKXA 3UJ9A 5GGXA 2HCFA 4IDOA 2X3UA 3B9QA 2FN4A 3OESA 4IZIA 4PZCA 3OUZA 4WGFA 3GN1A 5LMUB 1GA1A 1TC2A 2NVOA 3B2QA 3VR5H 4AZSA 1NF3A 5CHYA 4XQ9A 2I87A 3DO8A 4CW7A 2P6RA 3STHA 1L7EA 1U5BA 1M8FA 2QQGA 2FG6C 2FV8A 2YCLA 4GX1A 2OQVA 5GADl 4NXNB 4QJ5A 1KL7A 3UJ8A 4J4HA 1CUDA 3HWSA 4PSDA 1P0QA 4CTMA 4H1WA 1O1YA 1T8RA 1EBBA 2H1IA 1XP5A 3W3AA 4GM1A 3WQHA 5AVOA 5JMPA 3VO1A 2VYQA 3BHJA 4GOKA 1E9VA 1ELOA 1KK1A 2Y1FA 1C8VB 1G4AE 2ODNA 1BW9A 2QMQA 2OD9A 3BIWA 3DLIA 1A9TA 3LHKA 2XPCA 3R0IA 2WTNA 4FYJA 1YMVA 2A9OA 1QFSA 4JA0A 4XM0A 5IBQA 1EWYA 3T4EA 4DSNA 1I3KA 4FB4A 3OZAA 1XRQA 1MJNA 2R11A 1Z0IA 2GJ4A 3A1CA 1D7AA 1ILWA 3IUEA 3PRYA 4RADA 4Z8YA 4MR7B 5F7JA 4EB0A 3QMPA 2Z3ZA 1JEQB 1TUIA 1T9AA 3ANYB 4QD3A 4DLYA 4EY5A 4LRQA 2H7YA 3RU2A 1HURA 1U2RA 2VJDA 2ONJA 2VJPA 3HB1A 1I4OA 3NAGA 2DPLA 3UTCA 4MV9A 2QY6A 2Z8YA 2A86