2Q2OA

Crystal structure of h183c bacillus subtilis ferrochelatase in complex with deuteroporphyrin ix 2,4-disulfonic acid dihydrochloride
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
307
structure length
307
Chain Sequence
KKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSACSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porphyrin binding and distortion and substrate specificity in the ferrochelatase reaction: the role of active site residues
pubmed doi rcsb
molecule keywords Ferrochelatase
source organism Bacillus subtilis
molecule tags Lyase
total genus 116
structure length 307
sequence length 307
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q2oA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q2oA02
1DOZA 1HRKA 4F4DA 2XVZA 3LYHA 4CCSA 2PO5A 3HCOA 3HCRA 3AQIA 4KLRA 1QGOA 2QD4A 4KLAA 2QD2A 3HCNA 2HREA 2HRCA 2XWPA 1L8XA 1LBQA 2AC2A 2JH3A 1AK1A 4MK4A 1C1HA 2C8JA 2QD5A 2Q3JA 2XWQA 3HCPA 2PNJA 3M4ZA 4KMMA 3GOQA 2Q2NA 2Q2OA 2PO7A 2QD1A 1TJNA 2XVXA 2HK6A 3W1WA 4KLCA 2XVYA 1LD3A 1C9EA 2H1VA 2DJ5A 2QD3A 2H1WA 2AC4A 1N0IA 2XWSA
chains in the Genus database with same CATH superfamily
1IYZA 2YRWA 3OZCA 4KXWA 4WBSA 2UYQA 2PJDA 3AXTA 4ISBA 1JFTA 1ADGA 2C57A 2C9CA 1KC3A 3I9LA 2VBFA 3C5VA 1R8JA 1UKYA 3IO5A 5JO9A 4BUJA 5JASA 4RMGA 5JY6A 1NF8A 4EMUA 5A0TA 3PFNA 1VPEA 1B4DA 4KH0A 1WVGA 1HF3A 4JI1B 3E58A 5TJ9A 1D0IA 2WE8A 3ZWNA 1LTKA 4JR1A 4ZAFA 4R9UC 1QGUA 2Q9UA 3VAAA 4C4TA 2NSYA 5JH7A 1RYBA 1U80A 1ZEJA 4J0IA 1RYZA 3PIDA 4Q3KA 3UMVA 1ZSNA 3SY8A 4ZZIA 5CBPA 2R8OA 3UK6A 4REMA 5E1MA 2QG9A 4K9KA 4XFKA 1F5SA 2BFBA 3P32A 1WY7A 1A0OA 1OXBB 4KRXA 3NUZA 4WIAA 1P17A 1Z26A 2O2HA 4KO4S 2FE4A 2VUUA 5A5GA 2Q7XA 1J09A 1MMFB 3ROPA 3UV7A 3VNQA 3ZKAA 5A4FS 3H11B 1O3YA 1J9EA 3PD7A 4X8MA 4YRJA 1JSLA 3DAYA 1VL0A 3WHIA 2CBZA 4Q3DA 2EBUA 2QRLA 3L4BA 4GLBA 4JKIA 2LGJA 5LLDA 4FBMA 1KQOA 1I6KA 3QW4B 3PTLA 8GPBA 1H8HA 2JHAA 2PZMA 3HJUA 3SE7A 4ND6A 2H1SA 5FLXA 3VSAA 1ST3A 1EP9A 1RJDA 2IUYA 4PIVA 4DQDA 1H5QA 3C1OA 4ZK6A 4RK5A 2KQUA 4J1SA 4FN4A 1ORDA 1TLTA 3ZY5A 1BXRA 5BXYA 3KKZA 4K6KA 2HCBA 3QPAA 4LBWA 1KVRA 4N47A 1LPOA 4BQPA 3RKSA 1BMFD 2ZAGA 2NSLA 1GOTA 2Q4DA 3AQIA 3W04A 1PWEA 4L08A 3OU2A 1KJJA 2HMSA 2B83A 2NO6A 3J81A 3RVKA 2AEJA 2ZZNA 1CLUA 4DJEC 1S5PA 3MTBA 3ENZA 4X1IA 2WPDD 3ZCSA 1V7QA 4L2IB 1RZVA 4UZSA 4M9CA 3LCUA 4GXQA 2AG6A 1XCMA 1Z4QA 4BB5A 4G1BA 1K6XA 1E6CA 2AS0A 2PO7A 1JR2A 4YJHA 1YUBA 5DCWA 1ILEA 1ZONA 1IHXA 4NZ9A 5T64A 1LRJA 4PLYA 3SC2A 2I2FA 3ZZTA 3BDVA 5HW0A 1SULA 1NG1A 4PFSA 2Y3IA 5IVHA 3FNFA 2YYAA 1A5ZA 1K2WA 3G8BA 2XRYA 4JC0A 4E09A 3HRIA 4E94A 4CETA 1A2OA 4KQCA 4O2AB 4EHDA 3DCYA 4KSBA 1OY1A 4A1FA 2O0KA 1TF2A 4UASA 4DPKA 4AF8A 4MRMA 4OQMA 4OGGA 4OYHA 5HE8A 3W9SA 4DSTA 2B7BA 2GLTA 3NHYA 4G4SO 5GWXA 2C31A 5IKPA 1ZD5A 2DE0X 2RKWA 3DL0A 1GQ2A 2PRYA 5TQ0A 1SCNE 1TJPB 1I7LA 4FGZA 3EQ7A 3WNBA 3X1ZA 4AICA 1QZTA 4BVHA 2J0EA 2JFGA 2JFUA 4QDXA 4AIRA 2H16A 2O2EA 3L49A 1YJBA 2YASA 2AGVA 3AK4A 4JLKA 5ALYA 5FR1A 5FOSA 3G8CA 4U5QA 5DO9A 2IUFA 3I04M 3LVBA 3VYUB 4OUDA 2WMDA 4Q1FA 4RF2A 2YHAA 5HF9A 4A8JC 4M36A 3MMSA 3W4KA 5KQRA 3HCOA 1DOAA 1NKTA 1HDCA 2O8CB 1NFQA 2QZ4A 1D4AA 4TQGA 2MWMA 5FTMA 4YPOA 1EESA 1Q44A 3GLTA 1NV9A 4E07A 3CZ5A 1NVFA 3CUYA 3PQEA 1OMOA 3FPBA 3JQAB 3KKPA 1X94A 4C6RA 3A28A 4ENWA 4DIBA 4FS3A 5LJIA 2WM2A 2WF6A 4HFMA 3KKMA 1T91A 3KRTA 4HWSA 2KWIA 3TKYA 3K1AA 4GNRA 4POAA 1IJEA 4DMHA 4RY8A 1IM5A 4G1MB 1DJOA 1QIKA 2G0TA 2Q5HA 1QKKA 3BXFA 3F8TA 3G9ZA 2D5CA 2MYNA 3QKTA 4S1OA 1JT2A 4KG7A 1E7RA 1QQ5A 3NEPX 4KVAA 4G9EA 1FDIA 1HXHA 3G89A 2VYCA 3R8CA 2JFYA 2X7HA 3ZWCA 1KMQA 1ZM4A 2ZJYA 3VV3A 4ZQEA 1TMKA 3CXUA 1J0CA 2BZSA 4FEYA 4GRDA 3WYGA 4UOEA 5JHHB 3CR7A 3A1VA 1G20B 1HSOA 3V3TA 1BFDA 2X9NA 2RAPA 3FFWA 4G8BA 4M89A 5COBA 4RWZA 3KZKA 5B12A 1RXVA 2WMNB 3SJAA 3H2GA 2OD7A 4CLRA 2QRNA 2VJYA 2VTVA 1EI9A 5DJ5A 4GM4A 4E13A 2QRKA 4YLYA 3FZGA 4CKCB 4CMCA 1QG4A 4XWKA 5EJGA 1AGYA 1YU9A 5EAIA 4BO2A 5L6MB 1BE6A 1LV8A 2HRDA 2O20A 4FFRA 4LRSB 4XVQA 3H7IA 2HF9A 4TQ9A 4DIKA 5AUNB 3L92A 4QU9A 1NV8A 4HAZA 1JAIA 2CNLA 4O4JA 4IIXA 2GCOB 3HWWA 5CVUA 3L1IA 4RZUA 3RF7A 4MVJA 3ZHQA 5EJEA 8AT1A 1AMNA 4DJAA 4HWKA 3OF5A 2WG2A 2P3QA 3KKQA 3ESYA 3JPYA 4I5EA 5AP9A 4Y0VA 5D85A 5SY9A 1N4DA 4OQYA 1ZOLA 4ZAYA 1UM9B 1E9VA 3KDSE 3WMEA 4YX9A 5I4BA 1KDVA 4Y6QA 1NXPA 1AQUA 4AP6A 3HTXA 4KYUA 4MQUA 4NEQA 3CX3A 5FOXA 1WCIB 1EQ2A 4O4HF 1A3CA 2A0XA 3HY3A 1YR2A 4AJ9A 4B3HA 4EO9A 1YACA 5LNK1 1S01A 4BV2A 1G66A 3H5LA 1AIPA 1UOQA 3LF2A 2YFKA 1ZP6A 4B4DA 1APBA 3CVXA 4JELA 5FUWA 3U0BA 2GF9A 2WD7B 1RHJA 1Y1SA 3H2HA 1UWKA 3O9MA 1ILWA 3AFIA 4C0LA 1ODSA 2E7ZA 2VH2A 1I5RA 2VHCA 3AGQA 4NOJA 1LLDA 3OFJA 3RV3A 3UH0A 3VQTA 4CHTA 5B55A 5HYVA 4DR5B 1E7YA 2BM8A 2PWYA 2FZVA 3BL6A 2AJ8A 1W48A 4J2TA 4TWJA 2CLKB 3TB6A 2WDPA 3LGSA 3IT3A 5GJCA 1Z8DA 4L78A 1CR1A 1FRNA 5TB5A 2WU8A 5K3AA 5SICE 3O7MA 2ZS9A 4PR3A 2EJCA 2CLFB 2K2QB 1ZEMA 1TEVA 2PD6A 3PC8C 3TD2A 5KPJA 1X2EA 1ZK0A 2ZIGA 5FR2A 3I1YA 2XMDA 3I4LA 3QVSA 2HF7A 4PG5A 5ADUS 2V98A 4LXYA 1HQKA 4QYWA 2XYVA 4NJOA 5HXAA 2Y2VA 2AX3A 1R3DA 5IT5A 1JR6A 4R1MA 1G6OA 1XT6A 3DDUA 5D6NA 4M1SA 5BVHA 3MJDA 2IE0A 2B4QA 1Q6ZA 3ZGLA 3CF0A 1C9DB 3T7RA 1C3XA 2GCIA 1D09A 3D9QX 3GMTA 1W44A 2YXDA 4GZ3A 5A06A 2V6MA 3MFYA 3L8DA 4YAWA 5REQB 4P22A 4TKLA 4EGCB 3LKVA 1UOOA 2C0QA 2FFRA 1N2EA 1NBMA 3EA5A 3R3SA 4US0R 4WXHA 5BMOA 5A4JA 3G8AA 4GLLA 2IYQA 3DDNA 5C1BA 1AKNA 3CF4G 3KKNA 1NVWQ 1W30A 1XTUA 4Y0AA 1D8AA 2E3JA 2YN0A 2XNKA 2PZKA 1EINA 1NVBA 1TTPB 2AWOA 2QOEA 3LT4A 3A4NA 3OZIA 3ELDA 4K1LA 4OJNA 5DOVA 3RS9A 3K94A 1CZRA 1J4AA 1PFKA 2N42A 3JVDA 1FP6A 4BNTA 3EVFA 4YRIA 1QCZA 4AUKA 1I80A 1XNJA 3D6FA 2XYRA 1JH8A 3EGOA 4G89A 5MGNA 5ULLA 4OKNA 1S9DA 1R50A 3KYJB 2EEZA 3Q7TA 2AFHB 2DR0A 3HSKA 4TYMA 4UU8A 5JRDS 5K05A 4BKMA 3CVWA 3Q8KA 2YNMD 2B6HA 4IQ4A 5CLHA 5EP4A 3TW6A 5EG5A 4ER6A 1K2VN 4EATA 2G82A 5LWQA 1Z4IA 4DIDA 5JSFA 3AEKA 3L7NA 3ET5A 5ED0A 1UT6A 4EG7A 2PX5A 2WG1A 4RK0A 1PGQA 3C6BA 3IV7A 3NBFA 3ROXA 1U11A 5FEUA 2HEIA 4LOJA 4XPIA 4TS1A 3OQVA 4ZQCB 4C88A 1P0QA 1XA0A 1CEEA 1AT1A 4PE5B 4CDMA 1QE5A 5KTMA 2Q45A 1GPNA 3LPAA 3DBIA 3QKSB 3I1IA 4RVGA 4NC9A 1B7GO 3ZV7A 4E1AA 2BGKA 2KLBA 3PGKA 1U6IA 2AN1A 6ADHA 2Y68A 3RAFC 3HK2A 5LQNA 3THWA 2A92A 3CVUA 1Z5VA 5LZ5A 1VXOA 4LVUA 2V9ZA 1BOOA 1NBMD 2E48A 4PS1A 1SBYA 3L18A 5KWJA 3T9FA 1ORIA 2P5YA 1EHYA 4DJJA 4BRWA 4QUKA 3A3KA 3MD9A 4ZAGA 3A4IA 1E61A 4RHYA 1KU6A 3RUPA 2VYVA 2DQKA 1XAGA 4G4JA 4BE7B 4EJSA 5A3JA 1OC4A 2P9QA 3UV6A 4L5AA 3WBFA 3AF1A 3D4IA 3ZWKA 4DSAA 1L4NA 4AX4A 3I9NA 1IAVA 3R4VA 3H0CA 4IHJF 1IJKA 2DTXA 4CIVA 4IJUA 3BGIA 1OIWA 4PG6A 1OZFA 1ZGJA 4IDNA 3KIPA 4D0LB 5LA6A 4YB8A 3ZX5A 3KJFA 4E2YA 3G88A 4CIXA 4F2HA 4EELA 5CXUA 2HUPA 3L1KA 6GPBA 3TDNA 1RQPA 3HDTA 1DRKA 3FETA 1YV9A 5AKYA 2ZUBA 3KLPX 1P4JA 1QHHB 4FDLA 1B93A 4W6QA 3LSYA 4M55A 3S1AB 5L3VA 3UJNA 4HAXA 2FP4B 3KETA 4UE3S 3NXKA 4Y18A 2ZAOA 1UPFA 2RH5A 5EPEA 3DEIA 5B53A 3V2UA 5ALQA 2BWJA 2IY9A 3GJYA 3LKBA 4HPJB 2K87A 3P7MA 1V96A 3NBUA 3WRYA 3AJAA 2QZPA 5IZCA 2QQGA 3RUIA 1FJ2A 2QPOA 3EPHA 2FPGA 3EXHC 1PSZA 4PZEA 3OCVA 3FI9A 4V2IA 1FQOA 1T3ZA 2C4VA 4JFRA 4OIFA 1KFKB 5JAQA 2GVZC 4RTQA 3UV3A 1LK7A 5JCJD 2PN1A 2N9UA 5EHQA 1O6ZA 1C2TA 5EWLA 2B35A 4JOCA 1W29A 2XUIA 2V65A 3QVGA 5ERGB 4FFOA 3FCEA 1DQNA 1NN0A 2B1JA 3RROA 2HA7A 2P9GA 4DREA 3I5YA 1PKEA 2WF9A 3UPTA 5JZVA 2O7RA 4EAQA 4YR9A 1WXHA 5A9SB 1UDRA 2YY6A 4DGQA 2A0FA 5G02A 1WOYA 3PPWA 1HX7A 5LMZA 1QO9A 3ON5A 2O07A 2Y67A 2QNBA 4OI0A 1FU8A 3F0TA 3ZHYA 1GRNA 4HZUB 3RAGA 3EXIB 3RG2A 2DPHA 3IPCA 3KPYA 3KOYA 5DXJA 4U7JA 5DNUA 1S3SA 1KYTA 3O1IC 3A26A 4FCWA 4K3VA 4O6VA 2P75A 3EWIA 4PN7A 5C8YF 5DN9A 1Q19A 3FJ1A 3EY9A 3W90A 1HR0B 3H65A 1S6YA 4WCDA 1BRMA 1K6IA 3A37A 4QBHA 1Z35A 3H11A 1Y63A 3TOVA 4ZV4A 5AM2A 1QE3A 1R2QA 4A8JB 1VKNA 2QK4A 4IVNA 4Q4JB 3Q0TA 4Z4HA 4R54A 2IYTA 3N2YA 4Q39A 1U0SY 3PZRA 3V4FA 1E2KA 3S5JA 3ZOZA 1ZW1A 2H7YA 2P27A 5JPIA 5GGYA 4PZPA 5JOQA 3CLHA 1S2DA 4PG8A 3DSRA 5DGTA 4R98A 1YFLA 1U1DA 3D59A 1T6ZA 2OHVA 3OZ7A 4M98A 3H5WA 3HJBA 2OXTA 3BBPA 4KQ2A 3VR5D 4M1MA 2HJVA 1VA5A 3GELA 3U1VA 4BN4A 5K1ZA 4HX9A 3VVCA 4DNXA 1P9RA 5L9AA 2CLMB 4MA5A 4UBMA 1Z34A 3R5XA 1XRMA 4FMDF 2PSFA 2BC9A 4MP6A 1VHQA 3Q9NA 1EQUA 1QRTA 2D0IA 2YWFA 1CXZA 1IH8A 1NDQA 3NMUF 3KZCA 4NFLA 2GK7A 3EF1A 2LKDA 1V7CA 2DBVO 1I9GA 2GXSA 3MTIA 4V3BA 2LDBA 4N6NA 4GUDA 1M6HA 2GTPA 1P62B 4L2IA 5ADVA 4CT0A 1I7DA 2NNWB 1U28C 3I4CA 3L7AA 5JANA 2XCTB 1G21B 1AKQA 2FEOA 2XLBA 5BWLA 3WJAA 3K2BA 5JPCA 4UULA 1N2JA 1UPCA 2OZLA 1NBWB 2Z3VA 3D3JA 3R40A 4OM7A 1IQPA 4DUGA 1PHRA 1M76A 4PGAA 5ADHA 3N8KA 4LS3A 2MSDB 1Z22A 2BJHA 1M1NB 2HF8A 2VJLA 2C9MA 3EVGA 3L6BA 4A26A 4ZVMA 1AKRA 4CCSA 3PRHA 4IJQA 4N5MA 1EBFA 1BVYF 3MRSA 3SVZA 5IFLA 1ZI9A 2OXRA 3U16A 4K40A 3RC9A 3AB7A 3QW2A 4I3GA 4O2AA 5EL0A 1YDFA 1XRRA 2A14A 3RVPA 4B7UA 2WQ7A 3ORRA 3B1KA 4K81B 1XTKA 2F67A 2J0UB 4MI9A 3GP8A 4NXMB 1D9ZA 4RZXA 3WKAA 4JKYA 5GOZA 1FJGB 1DCTA 3F4BA 2BW0A 5I9BA 4OD0A 4QPDA 3EZNA 4MVJG 3RS8A 4KQWA 4AJIA 1Z0JA 2A7XA 3D3WB 1Q0PA 5CB6A 4LYHA 2BGLA 2G40A 2QW1A 1A50B 1IUNA 3GAFA 1CUJA 1ZM7A 1NVVQ 2P35A 3IHWA 1KVSA 4N3CA 4OYRA 2H57A 4TMZA 3ZBPA 4RULA 2WABA 1YUNA 2X1VA 4F9GA 5EIBC 2Q50A 4NARA 1I2DA 4PWZA 1GL3A 3B6KA 1HPLA 3WLSA 4NZYA 5FQNA 5I8WA 3DV2A 4OQFA 4ZOCA 1PF7E 1E3EA 1OU0A 2R5FA 3ZV6A 4TYQA 4FEAA 1NI3A 4AO8A 2RE8A 1TC2A 4WOCA 2RAUA 4ZU6X 1IOZA 3KHUA 3LFTA 1LPBB 2O8CA 5B30A 2FU5C 4RL4A 2OO5A 3DAPA 3TB4A 3OY7A 4URUR 1IXKA 3PF9A 3JYLA 1UWCA 1JNYA 4EM6A 2ZYSA 3IQFA 2RK3A 3JQAA 1Q7EA 3DXFA 1TECE 1J0BA 1U8CB 2Q6VA 4G0VA 1EAMA 3L8YA 4B48A 3ZNOA 3BWBA 4Q47A 1GU7A 3K0AB 2WUFA 3ODGA 1Q0ZA 1NYTA 3KZMA 4UCQA 2QYOA 5FNVA 5IXSA 4OX9B 3CSSA 1BWSA 1GT91 4WRRA 2D5AA 2QYHA 1GVHA 2CSXA 2ZRDA 5MFZA 1E1MA 1VJDA 4R41A 4RK4A 1QHYA 7ABPA 3L1VA 1LF0A 3P0JA 4N1AA 3WQBA 1U1EA 4IIUA 1GP2A 4NIMA 4LYJA 4XX0B 4QHYA 1ENPA 3IESA 4FUQA 1MLDA 1VRVA 4LXUA 4QDTA 1NVAA 1XUOA 2CD9A 2VJCA 2XT6A 3GARA 1JI3A 4OU5A 3JX9A 4KGXA 2BKVA 4L8YA 1SCKA 3QVOA 4JP5A 3DB1A 2C3PA 3P45A 3T15A 4JLNA 4LE1A 4GYYA 1COZA 3NU1A 3LHDA 4M37A 5DCUA 2Q29A 3U3XA 4ZI3A 1F0YA 1MB4A 2G0AA 2G0NA 3R5JA 3K9FC 3SIXA 1T3LA 1AKEA 2GPWA 3SQNA 2JFPA 4WX2B 1Z2DA 4OXRA 4M4SA 4CKCA 4CL0A 2Q0SA 3GRPA 1NR7A 3H05A 1U5AA 5TVGA 4Z99A 1LBSA 2H4XA 2DG2A 1F12A 2AMJA 3RVRA 3COWA 2PXXA 3RKUA 1JLLB 2GYVA 1KFJB 4WW0A 1NVKA 2OHXA 1OXSC 2XLCA 6NULA 3AL0C 1E0DA 1DU4A 1DGQA 3D7RA 3VPCA 1FMFA 3ZWDA 2GCOA 1DAEA 1EK0A 3OKCA 2Y27A 2X1HA 1YQGA 1JDZA 1JWAB 4RA9B 4Z7NB 1S2IA 5HGXA 1USVA 3FLAA 4RD2A 3TX6A 3BA1A 5ED4A 1VHLA 5AO9A 3BD8A 4ER7A 4RVCA 2C88A 2V0CA 1WW8A 4F7WA 1SKMA 1UM9A 3GJRA 1N2CB 2NZ2A 3U4HA 1TM5E 5BN3B 5K3BA 1WCIA 5DEOA 2ET6A 1KMIY 1AHPA 4MUAA 2ZB8A 2Z2IA 3MRTA 2O57A 3Q0EA 1Q14A 4NQRA 4CUZA 1PQWA 1Q5PA 3A7DA 1STOA 2PZLA 3BFKA 3IVGA 3UXMA 1KAEA 1J2JA 2WD7A 4KIUA 4OHZA 2JARA 3LF1A 4QPCA 1UZNA 5KIAA 2UV8A 2EHDA 3GCXA 5I5GA 2XUHA 4AO7A 4CPDA 4EA7A 3E15A 5BR1A 1LLFA 3RJTA 2EBHX 3NONA 3TTUA 3P2EA 4ZREA 4JUIA 1M33A 1P9LA 3AH8A 5EIHA 5JVDB 1E0JA 3KTOA 4PBSA 1P60A 2WTXA 1J20A 4D0GA 4JBNA 4I9HA 1V8FA 2YW2A 1I7PA 1KHTA 2I7VA 4YAJA 2CUNA 3C7DB 2UYYA 1D5WA 2RG1A 1JE0A 4UTRA 3BMQA 3EYAA 3WK4A 1IWPB 4WZZA 5K8TA 3CUVA 1TCAA 3V8EA 5ESRA 4R1SA 1WCYA 4G5HA 3VX3A 1IY1A 4RUKA 3QYFA 5DOZA 4AJOA 4F1WA 4LSWA 3TLEA 3WB2A 3M70A 1EUZA 1C9JA 3R6DA 2HMYB 3D6JA 3R20A 2HAEA 4FMPA 2AVNA 2DRIA 4QUGA 4A6EA 1YA8A 5BQXA 4K9RA 5KC9A 1XMSA 2GCPA 4DMFA 2QYTA 2BAGA 4R5HA 4FDMA 2BLLA 1E5QA 2E4AA 2WB2A 4O5OA 5C81A 4XB2A 2CBXA 2DLNA 1N2BA 2GN1A 2XIJA 3MBIA 4P84A 1YVUA 2WUVA 2OGTA 1SXHA 1ZK3A 1YD7A 3T5BA 4LE0A 1CY6A 4TLBA 1DEAA 2YQ4A 4GBED 2FWRA 2TMYA 3VJMA 2PL9A 2A7QA 3PITA 3C74A 3UMBA 4EL0A 4UCWA 5REQA 1K27A 2O2IA 1DKRA 5NLLA 3UCFA 5BRJA 4LBZA 4NCAA 4JB0A 4MARA 3R7NA 3UGKA 1F6BA 3FUVA 4FHZA 2WWXA 4R83A 4OJKA 4AKEA 1GPWB 5AK5A 2HSDA 2PRKA 1Z6PA 4BVAA 3AR8A 1EVIA 2OQIA 1BXKA 3NBQA 4X6UA 1RD4A 1Y3AA 1SFRA 3PE6A 3PPIA 3QHPA 3VX4A 4OHBA 1LW7A 2VCEA 2WG0A 4JY7A 4XFDA 5IAKA 2Z3ZA 3WWZA 4WLOA 3ZNNA 4NWIA 4ADSG 4GXRA 1I3CA 2Y6UA 1MA0A 3JD4A 3OPMA 4CFZA 1B1CA 5TLSA 5F78A 1JQEA 1FX1A 1Z6GA 5AW7A 2XUDA 4XGQA 1OI3A 2F1JA 2SHKA 1QLWA 2PWBA 3EFBA 3MT9A 4M86A 4S35A 3N0XA 3AWDA 2AFHA 2C5SA 2VJQA 3O82A 4CCYB 4CR6A 3I8XA 3A32A 3JQQA 3MTAA 4AG6A 1QE0A 2IP1A 4KDCA 1UJNA 4OHWA 4WFJA 2CCGA 4WXPA 4Y1RA 3WGGA 1MW8X 3EXHB 5CGQB 4DWOA 2J31A 2QNIA 5T3YA 3O4RA 3LT1A 2I7CA 2CMHA 3EQ2A 2BFFB 1T4CA 1TJ4A 4B3MB 1DJMA 4QARA 1P39A 4EB0A 1QG6A 2P65A 1MKYA 2WTBA 1SUIA 3WLOA 1L4LA 3GP3A 5JU6A 3W78A 1CR0A 2ZK7A 2V8BA 4XQ9A 1P77A 4DYHA 2XBUA 3JU3A 2GF2A 3NKLA 5GADl 1U8EA 1CT9A 2ZJZA 3NVAA 4WKBA 1XIVA 5IDVA 3RQSA 1E5XA 1Z82A 3QKSA 4JU9A 5FBQB 1BE8A 4MCHA 5TEWA 1D2NA 4DR6B 1TQ8A 1GPMA 2IYEA 3CYFA 3OH8A 3AOGA 1M34A 4EI9A 1EG7A 1E9CA 2VF8A 5ALHA 4ALJA 5JNRA 1B8UA 1NI5A 1QK3A 3HYCA 1Z88A 4LRXA 3T9CA 3NDBB 1X1EA 3EZ6A 4CR7A 5K99A 3IA7A 2F8LA 1IUKA 2JASA 1MFZA 3V2GA 4PFQA 3D1JA 3EVDA 2QQEA 2W6OA 3DM5A 3OBBA 1KEPA 2B0CA 4FGUA 4X95A 1CUUA 5IARA 3TR5A 1R5NA 2J45A 1GILA 1C81A 4I2NA 2AEFA 2IVFA 4ERNA 1BROA 1XC7A 4MVJH 1O1YA 1YB4A 1J0EA 1Z29A 4CJXA 3JQDA 2PKRA 1OX4B 4LF8B 2AXPA 2XTNA 1ZD8A 4LY0A 3B7WA 4DUPA 5B37A 1FA9A 3STYA 4IYRA 5F1KA 1NLUA 4XAQA 5B4VA 2ZJ4A 5U4QA 1QYWA 2NUPB 1ZO8A 2CXSA 1PW5A 2AXEA 4JXJA 5B57C 5CD9A 1PG0A 3D8RA 3G8YA 1HKUA 4OJQA 1PG5A 1SWWA 4HVAA 5F33A 4CU2A 3HI4A 4OLBA 3ACBA 2GLUA 3G6WA 3LIIA 4QBFA 3AJRA 3U17A 4KFCA 4B6RA 3WQSB 1W5EA 3LCVB 2IHTA 1NC3A 1YDEA 3E5HA 3QTLA 4P81A 3RJ5A 4DBLC 1EFAA 4EHLA 3BTUA 1QHHA 4K1XA 2VN8A 3IOEA 1V3QE 3VNUA 4IINA 1I4DD 3EGVA 5KINB 2H9IA 2I0FA 1E1CB 4U2CA 4O8ZA 4QODA 1CK4A 1QIFA 3NTQA 3DKKA 3EVNA 3GFQA 2B9VA 4QGGA 4TMYA 4RSHA 2Q49A 4PYKA 4KR2A 1U3CA 3MJ4A 1OV6A 5BNFA 5C2JB 4XWTA 2P68A 4G0MA 2V4UA 1HE4A 4RTJA 2P2DA 5BV2P 4YTEA 4GD3Q 4ZQFA 3N7UA 1E9EA 3PGA1 4EX6A 3H5TA 3ZK7A 5CDGA 3QPWA 4AYWA 1EXMA 3L7BA 4C2AA 2B6NA 2B20A 5ARBA 1TA9A 1HUQA 4R4JA 3AR2A 3WV4A 1P45A 1IHPA 5HNKA 4DY4A 1NUUA 1SKAA 2OP1A 3BAZA 3HZHA 4N0MA 4QULA 5A9SA 1JAHA 4IS2A 4MVXA 5KNLA 5PNTA 3OY2A 4XH9B 4CM6A 5KCZA 1BH6A 3U2QA 3LVQE 2ZRQA 3VZRA 5L7TA 1KZGB 1XFDA 3G0BA 3GYGA 3I1JA 4HPWA 2PVSA 4LWQA 1IG0A 3NIFB 4HZUA 2CFTA 3EXIA 1E3LA 3SU8A 3HUEA 2JLXA 2AG0A 4CM1A 4WSOA 1INLA 3CWZA 2DBRA 2WD9A 5FDFA 3OZWA 1CQXA 1QVZA 3O75A 4BNHA 1PJZA 3RTEA 1ABBA 1UBRS 4BO5A 3SXPA 4HGRA 2OT3B 1U4NA 4F3CA 2E18A 4PC2A 3M4ZA 3EZYA 5K6TA 2ZKLA 3AILA 2IQ5A 4LDPA 4DMKA 4CF6A 1KYQA 2XCOA 1ZJ4A 4A8JA 1E63A 1OE0A 5KJ6A 1IN6A 2GAJA 4Q4JA 1Z62A 5ES3A 5BUCA 3W9UA 2ZB2A 4GYKA 1TCVA 2H59A 4LPKA 3IJPA 1G1AA 2OENG 4WN3A 2H1VA 4TYPA 5DBFA 3FTNA 4MTCA 1B0ZA 3HDGA 1CQPA 2VJPA 4RTLA 4BN5A 5C7OO 4F4DA 2GFQA 3U4GA 1QKIA 4DLBA 1L7AA 1TDJA 4UCFA 1NPTO 3ORFA 4HDQB 3RASA 3TBFA 4LF5B 1KRXA 2Q4BA 4CWAA 1QF6A 3EQZA 1LRKA 3OBIA 2D6FA 2R79A 2WUDA 1MF7A 4O3MA 3GNSA 3FWYA 4O2AF 3K2QA 1AA9A 1CNMA 1M1YB 3DHWC 3QF4B 4M1EA 4BE9A 2ETVA 4JSYA 4K46A 1RC0A 1OGIA 4OF4A 4ZJYA 3G2IA 5JSUA 1L7XA 2ZUVA 4PCUA 1Y89A 2FMKA 2PUFA 4B6EA 2QQ0A 5IKXA 5GIPE 4PLTA 1YR1A 1GR0A 1H42A 3O9VA 4ZXPA 4JVLA 3BBLA 5JAHA 3KVNA 3ZI0A 1WNTA 3C1AA 1BHSA 1G21A 1R0ZA 3EF3A 2HV9A 1F38A 1K8RA 4KW7A 3B38A 3GRCA 1MT3A 2JFBA 3UB2A 3UXHA 1C7RA 4AIIA 5HZMA 3OTWA 3AUYA 1PR0A 2D1FA 3CWQA 3BD9A 2XKJE 2R1TA 2X0IA 2XTAA 1M1NA 2PSEA 4Y3UA 5IUNC 1PV4A 4FZ5A 4UM8B 3O9ZA 4ZQBA 3P2KA 1CKEA 4MYUA 2ZE8A 3P9RA 1GAQA 4ROTA 3S2SA 5HIJA 2SKEA 4HSGA 3CMCO 4CODB 2RBEA 3I76A 4TSFD 3IQDB 3V8NA 1CZHA 2AOTB 3HUUA 4GNKA 2UUBB 3EAFA 1I13A 2Q1UA 2J0UA 3KR1A 3QUQA 2ODWA 1MRZA 1L2TA 2ZIEA 1JMKC 1K63A 4CL2A 1FPQA 5KJ1A 3K6SB 2V03A 3L1HA 4NPHA 2ZVQX 4OH1A 3ZCQA 1RP7A 4IMIB 2NTJA 3RR2A 2P6UA 3E61A 4PNZA 3GB9A 3UJHA 2VPYA 5H80A 1P61B 5HTKA 4DGSA 2PU5A 1YZNA 3ZX4A 2VJDA 3G2PA 1MJGM 4JXKA 5CAEB 4F85A 4Z51A 4ZCIA 1AMOA 3MOSA 5H5JA 2WAYA 3NB0A 4WVFA 2OXEA 3FPSA 3H13A 2YW9A 1UBSB 3QI7A 4KV7A 4XGRA 4A92A 5FORA 1NP3A 2XA2A 4Z8XA 5FUBA 4GDFA 1QLJA 1S3IA 1NMYA 4BBJA 3KUDA 1LVUA 1OD6A 1G5FA 2CD7A 1BHO1 1I2AA 2ONZA 4RPLA 3LNCA 5JDIA 3NWEA 4TKVA 1U1CA 1VE5A 1UMKA 3MB8A 3HJNA 1RWPA 1EM6A 3MXOA 4AN4A 3QVKA 4B4OA 1YB2A 3K0AA 4OSOA 2ZRJA 3CB4A 1LPSA 1QKJA 5DNDA 2Q3MA 5FTNA 3DMFA 5FPSA 1ZAYA 2XB9A 4YCMA 3V80A 2Z57A 2O3QA 2WJGA 4LJ6A 2DY1A 5D51S 3IBSA 4MUBA 4OHXA 5FPTA 2J3EA 5I9TA 5JPDA 5LOVA 1JHVA 4WZAE 3LBHA 1EGMB 3PC8A 3R77A 4TTPA 2EDCA 3PYLA 4P93A 3RHSA 2H4YA 2P4HX 1QANA 1ST2A 4XX0A 3AY3A 5FX2A 2YCLA 2FV8A 3ZEIA 2PBZA 3E4CA 3FMFA 1IOVA 1MIOB 1S0UA 4GWKA 4P3NA 4Q02A 3NJRA 3N2ZB 1JEEA 1U7XA 2XZTA 4FI3C 4OHMA 4Z9YA 1K5HA 4IQFA 2NIPA 5CVDA 1QCCA 2H63A 2E5WA 3H17A 3TR6A 1R0XA 1GGMA 3IAHA 3URMA 4B43A 2C54A 2EP8A 1Y8RB 3UCEA 4GSKA 3WMWA 5LVAA 1JAXA 2JGDA 2LE0A 2VXYA 3IP9A 3VUEA 1LNZA 3ZWXA 5DTIA 1PL7A 4X44A 3OPNA 5FBLB 1Z5NA 1DUVG 2Q46A 5H02A 3MTGA 3Q2KA 3SEFA 3VU0A 2WIGA 5HJEA 1JLLA 4OHKA 1A5AB 1DC3A 1MVOA 1L6RA 2HLHA 3ENVA 2A1UB 4Z9AA 2QYSA 1G38A 3PE4A 5DX0A 1M5TA 1NXVA 1XRLA 1LSOA 1MAVA 2CMFA 3P4UA 1WUTA 4RA9A 3KEOA 4JIGA 4RS3A 4S2EA 3L40A 5DNVA 2VP9A 1CHDA 4KXVA 3A25A 4OI4A 3DTYA 2O5CA 2H8KA 2P4QA 5IDWA 4B7XA 1L4YA 1ETUA 1N2CA 1O9GA 2IGBA 2W2XA 3BA6A 4FJ2A 4KJZA 3QF7A 3CVJA 3FTPA 2VUTA 4BO9A 4WZ6A 4M1KA 5BN3A 5K0TA 3WP1B 2GA8A 3KXPA 2JIMA 2ZUWA 4INOA 5HOQA 3A6PC 1PX0A 1V7ZA 3HLTA 3K05A 1NRJB 3HVIA 5K8CA 1XPUA 4RGQA 4EVIA 1JA0A 2POCA 1H2XA 1SPBS 2N1BA 3A06A 4NLLA 1OTXA 1MFPA 1OX5A 3I5AA 4ZAWA 3AHDA 5C5EA 1DE0A 1NRIA 2PKWA 4ZVPA 3IDSA 3FG9A 3CVVA 3N2GA 1MHPA 2SECE 1KARA 1XK7A 3PFIA 4ZVNA 3R7SA 3LPMA 3OEED 4YAIA 3FZEA 4EKEA 2J9FB 1W1WA 2IIVA 2OAP1 3CN9A 3OT4A 1MEOA 3RO7A 3ZE9A 3FTEA 3GGOA 4M7OA 3IMFA 2ZOSA 4UAGA 1XWIA 2OFOA 1ESMA 1ULSA 3FYCA 2EJWA 4W63A 2IIQA 3OPYB 1DKQA 4XARA 1H23A 4LRTB 1Z5UA 4I4IA 1BVHA 4FLFA 1NXXA 4L4ZA 1P9OA 1Y1QA 3N8DA 3VO1A 2EWWA 5ALSA 2Y1GA 3LOUA 3I0MA 4EI2A 3I01A 2D4AA 5FWNA 3IUMA 4KXMA 3CZRA 3DE0X 4P4NA 4EIWA 2BZ1A 4ZC1A 1QYIA 3IAM6 3KUUA 3LCMA 4GS5A 3ND9A 2YWRA 1NP6A 3L0PA 4NEHB 2KHZA 3PS9A 4J91A 2D5IA 3WL8A 1JBEA 5H8WA 1QPBA 3L7DA 1QH9A 5K0GA 3QVXA 4PNPA 3DHNA 3DYVA 1UBLS 4URYR 4BFYA 3TDMA 1ZRSA 2X4LA 1WMDA 5CX4A 1Q7RA 4JZYA 3J7TA 4DKXA 3I9V1 5DISB 5JEEA 1BG6A 2WAMA 4RSRA 4MUEA 2Q07A 5HGJA 4JVMA 3RWMB 1TA0A 1JXOA 2D4HA 5E0OA 2Q2NA 3PNPA 4MEAA 3I3SR 1IWOA 2VRBA 4QGAA 3C7KA 1FE8A 4KE8A 2GZ3A 1MC5A 2F1RA 4DXAA 5B7QA 1TD9A 4UVEA 3RODA 3RFXA 2IJGX 1YCFA 4UTZA 1UMCB 4EHFA 1L5HB 1JHMA 3H9GA 5LL6P 4C06A 3TL6A 1RRGA 1AZSC 4PPYA 5JH7B 4NS4A 2R6GA 3L41A 4BNUA 4BZQA 1RACA 5KMGB 1SB9A 1P0FA 4NEGA 5BUQA 5GIOE 2PJZA 3PHLA 1G16A 4FKBA 4CCYA 2BCGY 4NX2A 1RPTA 4OLHA 3WFJA 1ECLA 2CMDA 1R00A 2Q1XA 4I1UA 5C32A 3EXHA 5BW4A 4TUYB 3S81A 3EULA 1DJQA 3W0LB 2OCKA 2FZKA 2BFFA 2JIPA 1LBEA 4BFWA 4GR5A 4FYKA 5LXTB 3KJXA 1ELOA 5BSUA 2QX6A 3T0FA 3CLVA 3IPLA 3ZLBA 2WWTA 4U02A 4N12A 3T38A 4GKKB 3N0TA 1PJLA 4UREA 1HLDA 4M0MA 5LB4A 3KSAC 4P80A 3N7TA 3UB4A 4M9QA 3A58B 4M83A 3WHKA 4NH4A 1UFQA 5JECA 2OEPA 2HFKA 2QMHA 2WAXA 3SZGA 1TTHA 3RLFA 3UAZA 4DQ0A 1PL8A 4QXQA 4TWIA 3H9UA 2RHWA 3WK5A 1SC6A 1T9AA 1Y82A 4Y6RA 2BMWA 1XCBA 4YUWA 1TQ6A 5CD1A 4D8WA 1V6AA 2QTGA 4G0QA 1MX9A 3KD2A 3W8NA 2ZBUA 1JH9A 3T1TA 2R6FA 1PV1A 3ZWVA 3I6MA 4JI8B 3BMXA 4DKJA 3DLBA 1ZJJA 4JEIA 2QSJA 2CDNA 2WVAA 1RJ9B 1WUIS 3BSYA 1P0PA 3PR1A 3QU9A 4Y67A 4E46A 5EQDA 1QP4A 1QYCA 2C9YA 1CVIA 2D7JA 3EGXB 5JQWA 3E81A 4U2GA 2XY4A 4QYTA 4DV3B 3H8WA 3UXYA 2ODNA 1M0TA 1ZXLA 3F4KA 1FYDA 1XZDA 2YV3A 3GLHB 2ORIA 3MLEA 3TLMA 1X8KA 3D6TB 3PKIA 4OAQA 1VPLA 1OX4A 4E5KA 3GJXC 2XMPA 1DBWA 1SC4A 1Z4JA 3NBMA 4EKNB 5EJ7A 5CDFE 4DR2B 2OD2A 1W87A 4KN6A 1U4OA 3UN1A 3IR5A 3VYTB 2MOKA 1TIBA 5HFAA 4CIWA 1I4EB 1MX3A 4P0PB 2YRXA 3MWEB 1JKIA 2HU5A 4AKGA 2QG4A 3RVNA 5KYVA 2ZJOA 3S7ZA 4E4YA 4EHHA 4X1KB 1ZHOA 5KQGA 1OYWA 2XECA 4BJ6A 3IVCA 2UZIR 1RIFA 3AYZB 3FI0A 2ACEA 2ZU6A 4ZTUB 5CCXA 1M5UA 1GKIA 1W9HA 3D6AA 1AY0A 3CRW1 2TMGA 5BQPA 3PQDA 1E1CA 3QWBA 1ONNA 4RF5A 2N3ZA 2CZCA 5F7XA 3FNGA 4K0KB 3GYBA 3K30A 2FUG6 2CXHA 1CB0A 2J8ZA 1MZVA 2PD4A 3HZZA 2QL6A 3VZDA 4GPEA 3TL3A 3KE8A 1MVLA 1VKOA 1FMTA 4XDYA 2WJYA 4DZTA 1X7ZB 4L9RA 5CIWA 2A3RA 1RXCA 1MD9A 1U28A 3QBTA 4C7JA 1M8KA 4EA8A 3HS3A 1AUVA 1GN9A 1K4YA 1PNRA 4JQYA 3L8CA 1X9GA 2AG1A 3TSZA 3M1LA 3FDJA 3FPKA 2GZAA 1EFKA 1WIWA 2G06A 2XTZA 1AN0A 3FUUA 3P2YA 1NXTA 3UCXA 5LWHA 1RI4A 3U3OA 3ZV3A 3SS9X 3C3DA 3Q7IA 4QGBA 1GG9A 1LK5A 3Q2OA 4DHEA 5U9CA 4J8PA 3W06A 3GGGA 3BT7A 2QRGA 2WHRA 5DV9A 5SY4A 5B2EA 3FPCA 2B8TA 5MN5A 3AL2A 4R0VA 3U3MA 1C0IA 1H8ED 3RHTA 1N2OA 3TJRA 1N7IA 2DTDA 5DNYB 3OWHA 4HI0E 4Y6LA 1CULC 2I55A 1VIYA 1S8OA 3PR2B 1PR1A 2FLKA 1H2WA 1XX6A 3W77A 1VIAA 1GNLA 3DQQA 5CCEA 1IJBA 3CEJA 3LWBA 4NF2A 4KZPA 5TT0A 1N33B 2BHTA 4AD8A 4B7ZA 1LVHA 4L3VA 3TQFA 2JVJA 3V6LA 3QQPA 1GCUA 1MZPA 4J3FA 1G6Q1 1VRCA 2QVGA 3T61A 3RIHA 3VOAA 3I61A 4IKEA 1EX9A 1T5OA 2C78A 4G2NA 3QFFA 1NBAA 2O52A 4HGNA 4MIYA 1AURA 3FYSA 3NBYC 4EVRA 1GDDA 1TFUA 1BX0A 3EHEA 2QD2A 3ZDEA 1QV6A 1VL6A 1LS1A 4B80A 2VEOA 1MW9X 2VK8A 1PQPA 1RYMA 2ISQA 1DEOA 1KSHA 2WF5A 2Z5FA 3NTXA 3Q9LA 1QG2A 3L7IA 1R3UA 2OFXA 2VT7A 4GOMD 3Q87B 4MPTA 4OHVA 4R84A 1WDWB 4HG2A 1K5GA 1SCIA 3MJCA 2ZSKA 4PYNA 4ZAVA 4DNQA 1D1QA 2FETA 2VNKA 4DC1A 2QIPA 1L8OA 2G5CA 5TS2A 1M1YA 2NMVA 3NM5A 3QF4A 1T6NA 3EZ7A 1KBQA 4GOND 1RQNA 2AG5A 3KBOA 4HXYA 4KH1A 5F1OA 1N2ZA 3E9ZA 2XT9A 4DV4B 1ND5A 1I2BA 1I1NA 4JDPA 2G88A 4Z9BA 1J56A 1FFDA 2EU8A 4IDBA 3DTVB 4FM9A 3R24A 2IF0A 2WK1A 3E8MA 3BJZA 1IOLA 2ZT6A 4PTZA 2DH5A 4K9MA 2ZT5A 4L8WB 4XVHA 4ERXA 3FOBA 5HK9A 3P9PA 2H08A 3I73A 1TRHA 1ZGCA 2OCAA 2X42A 4LOKA 5KU1A 3QX3A 3OLQA 1R12A 5J4YA 2DQ4A 2P62A 3KHTA 4XLZA 5FP0A 3ROZA 3O90A 1BQ3A 3JQBC 2L2QA 1KS9A 4FNAA 1JG3A 1Y9AA 1Z5OA 2BMVA 2AQ8A 1BFKA 2L0XA 1OFHA 2ORVA 1DI0A 4H31A 3RAJA 4UE6A 1EDOA 1O9HA 2AOTA 2FRDC 3TRHA 4XVUA 4L95C 1VYTA 2IPAB 5JWOA 1PGPA 1AGNA 2OP0A 3IV9A 1Z2EA 2N75A 3I9FA 3B9PA 2V8OA 1A7AA 3C3AA 3P71T 4C29A 4LZNA 1ZPDA 3SJUA 3K6SA 3ZY4A 1DDIA 1I24A 3HV2A 4KPUB 1KXZA 5F7OA 3BKWA 4ALIA 4BKRA 1BWRA 3DW1X 4GSYA 5AOVA 1ZUWA 2YKGA 1SVMA 2JEZA 3JQCA 1HEIA 3AEYA 3L8FA 3IMKA 1RWMA 5CHYA 2H1RA 2QUBA 4D3FA 2AEMA 3PZBA 4B3IA 1MR3F 3CEMA 1N6HA 2QVBA 2IYXA 5CAEA 3KPJA 1KJQA 1E2BA 4AKHA 1JALA 1RVDA 1WPRA 3TMAA 2EYQA 3PUZA 5F2EA 1T4MA 4F4IA 4H0FA 3WZ2A 4Q7LA 1EEXB 1V1RB 1W36C 1JU3A 2BGNA 3HZOA 3AF2A 3FKSA 1OAAA 2GZ2A 4KO2S 4KVFA 4B6GA 4MCIA 2EKZA 4ZOBA 1AQ6A 1Y6RA 3ZBUA 2IOQA 5AM3A 3GPLA 3STUA 2OKGA 4CF3A 4FR5A 4OAPA 1QV9A 1RAFA 1XZBA 3N2LA 5ILQA 2JANA 1Y1LA 2YOHA 4UHFA 2CMGA 2DFNA 3CNBA 1KQGA 1CLEA 3LA6A 4G41A 2AR0A 4BQSA 1RWKA 5CNMA 2VWPA 5L3RA 4J7CA 4EI7A 5JSZB 4JLOA 5FTWA 3N07A 2I3DA 5C5CA 2R25B 3A6EA 1L5NA 2CW5A 1OLXB 3HCAA 3ZE6A 4UBIA 3I62A 2WV7A 3MBOA 2XOKD 1YC5A 2GKSA 1E2JA 1E79A 2HU2A 3A6KA 5D7BA 4YVFA 1SWVA 3ULKA 2G9UA 4Z1MD 1TF7A 3M34A 3FPGA 2XMRA 3UK7A 1O94A 4B8ZA 1MIOA 3GMDA 4I1RA 2W2PA 1JDNA 4MKXA 1Z4LA 2P2GA 4QOIA 4TTRA 5THXA 1NRXA 5CM8B 1G8PA 4QFMA 2DTEA 4C1NA 3PF8A 3QU7A 4HEHA 5DSXA 5AVZA 2F9FA 5L95A 3ISVA 2NVBA 4QG7A 1SURA 1GTMA 3PB3A 4DXDA 2VNSA 2BTOA 4GX2A 4MYSA 1Y8RA 2A4KA 2W98A 1D2EA 2G04A 2C1EA 2WT8A 3C1UA 3F96A 3GGPA 4GEGA 2XUKA 3WDLA 4AL4A 1SK9A 3H87A 1AF7A 3FJOA 4EKYA 1NNSA 3V4VB 5KHLB 5HILA 4IEIA 1LC3A 4I08A 1LSSA 2WOJA 3RVBA 3KWMA 1ISIA 2WHXA 5A4IS 1Z7WA 2A1UA 1FTYA 1T1SA 2YIMA 3H5NA 1O95C 1ZJ6A 3VMMA 2YR0A 4BMNA 4YV2A 2ESRA 1RLUA 3K4QA 1KZHA 4AMZA 3H2YA 2CCJA 3QIVA 1E77A 3I30X 2OG1A 4J75A 2C5HA 3VR4H 5JVDF 3F6YA 2J5QA 3K35A 2D1SA 4CF5A 1RI1A 1IXSB 4EYGA 3JZAA 5EYPB 4YY3B 4ZEOA 4TYNA 1KO7A 2GOYA 4UFNA 1DIAA 2XSZD 4L4RA 1D4ZA 5CDUA 1G1MA 3KOWA 2DUUA 5MN4A 1PFVA 4D46A 1LEHA 4UVDA 3LRTA 3OF2A 5FPPA 4RWEA 3O4IA 1W2WB 2QQ5A 4ZOEA 1N2SA 1OWMA 5ALJA 5FI1B 1K0FA 5AH0A 2GZ1A 4YP5A 2HMAA 4FGWA 1J90A 4ESOA 4PLWA 2XMCA 5KWIA 4MDFA 2NPIA 5ICGA 3S0JA 1CD5A 1L5QA 1X15A 2IXAA 3BGVA 3EOBI 4J0JA 3GAMA 5TGZA 4X90A 1RAAA 1E79D 1T26A 1Z0ZA 4IKOA 4PLCA 2NT3A 1TKBA 1XQXA 5LKAA 4HN2A 2W4QA 4B6QA 2VAVA 3X2SA 4KXQA 6REQA 3H9QA 4NNJA 4Y2QA 4YPFA 5TGDA 1O94D 4OGLA 1T0UA 3FSGA 3ZIAD 1TCBA 2V1UA 2RGUA 3OTIA 1O5OA 2CLHB 3TZLA 5HQ3A 1HG0A 3M6WA 4IV5A 1NU6A 2GUWA 1FB5A 2MU1A 2BE9A 4O2BB 2ZYRA 4IJ5A 5IRCD 4OQLA 1Q1BA 3G02A 1G8FA 1KBZA 1F2TB 2OMEA 4EFLA 5A5DA 5D87A 5J58A 3PXDA 1HZZC 2JLSA 2CB0A 5KKAA 2DOKA 4FZRA 1KZ6A 3FDFA 3G0IA 4R8MA 4ZAXA 4EHKA 4WCFC 2XOEA 5DBOA 3JYNA 2FYTA 3I45A 3INTA 2ZR9A 3DCJA 1L8XA 2VNHA 3N9IA 3O8NA 4QIHA 3TSOA 3QMMA 1WQ4A 4P35A 3VVLA 1OXUA 1IB0A 1T1EA 3M83A 1A2QA 1F5NA 5ETJA 1X14A 1KVTA 1E4VA 1REQB 1FYVA 4LSZA 4XQCA 5TF4A 3WGOA 2XF8A 1X7WB 3M6FA 2OFPA 5I9SA 4JUAA 4P8RA 1DMSA 3IELA 3DOJA 3KQPA 4ZZ3A 5LR6A 5B58C 2BFAA 2BJVA 3F3SA 3N6VA 4MYCA 2VQ3A 3ITDA 3DAOA 4B34A 1F8GA 2I34A 4DM4A 4WN9B 3UMGA 3PC3A 3E9QA 1U9ZA 3W5VA 2QM3A 3Q15C 5J2UB 4HRXA 1S2MA 4CKXA 3VVBA 2EX4A 4WACA 1PTJC 4M3NA 3L6DA 3F49S 5CH3A 3FOZA 4RFLA 2AXNA 1NE2A 3DBOB 4TSRA 3ZD6A 3OIYA 1O97C 2HK9A 1BVUA 1XMQB 3G0OA 4N82A 1X13A 4R1LA 1HFKA 1ND6A 4BNKA 3CVYA 1G8HA 1NL3A 3AKCA 1QAQA 1UMCA 4IF6A 4U6SA 4UHHA 1VG9B 2M6LA 5DTJA 1Z6QA 5IYZF 3HGQA 4G8JA 2YXLA 2YL2A 1UK6A 2Z2ZA 1K7FB 1K6MA 1QH8A 3OKPA 4NMWA 4XIJA 2A5FA 1VOTA 3FSGD 4AXXA 4EABA 4IH4A 4MIEA 3V4ZA 4YT2A 1HDIA 3BCHA 4CGZA 1N2HA 1U9IC 3PHBE 3RIMA 3S28A 4B82A 4KYTA 5A4KA 1M5RA 4EHBA 4JNKA 5IM4A 1KP3A 1NW4A 4L15A 1V9LA 4TUYA 3ZU3A 2DFVA 3MGBA 1MJNA 4ZDJA 4ZARA 4B85A 2CHVA 2WIFA 4QUDA 1W5BA 3Q3IA 4KFSA 1K89A 4TMTA 4LZZA 3TXYA 5LXTA 1DAFA 4N0PA 4NZMA 4EF4A 4ESVA 4DBVO 1SPXA 2P6MA 3PD0A 2IXGA 4U9IS 2W5UA 2GNPA 1I5EA 3V4OA 3BYZA 2WWIA 2CYBA 4DDMA 4IUDS 4IR7A 2VJOA 3QVWA 4I50B 1NOJA 5G3ZA 4UQPA 1ZN7A 2B2NA 4NR0A 2FSVA 3UW1A 1RC8A 1X7GA 1LU9A 1JHDA 5LJLA 4X3PA 1JIKA 2FWIA 2CGEA 4MQLA 1VI6A 4OA8A 3UKDA 3C43A 4IDHA 1XKLA 4LWPA 5ALMA 4LNUB 5DULA 3PHHA 3WIOA 4OFWA 5FNZA 3JQRA 1C41A 1HC7A 1RZRD 4YMLA 2FUEA 3R3ZA 3VOBA 1N7HA 1ISSA 5JBNA 3R0IA 1RJ9A 2PQ0A 3X1YA 2GKGA 3UK0A 3RFCA 1Y6ZA 2KM1A 2QMQA 2Q1WA 4YN3A 2B0JA 1TT7A 1Z15A 2V7GA 3EGXA 4G3XA 3GBPA 4S24A 4MWDA 1MEJA 1AHHA 2CJXA 4RMJA 4BP8A 3H8VA 4RQTA 1O87A 3GLHA 3BAFA 1AH2A 2H1FA 4F21A 1EE1A 2Y93A 3VDXA 3Q5EA 4LA4A 1PVVA 3EEQA 3NV7A 4GQIA 4DLPA 3JASB 3UPDA 1U7UA 1O54A 3AR9A 4UBNA 4E6PA 3VH3A 3TSWA 1JQ5A 5CFRA 1N1GA 5SV2A 2DKNA 3GRFA 3EVBA 3MWEA 3AVPA 4S3MA 5MHTA 2DFDA 1YZTA 1L7RA 2ZB4A 4M9ZA 3DEFA 1SVIA 4OG2A 5IJXA 2HK6A 4CR8A 6CHYA 1G19A 3FA2A 3RIEA 1WP9A 3TE6A 1XDZA 4Y1FA 1R6XA 2CJYA 2YXEA 4D96A 2FUCA 1V16B 2ZIAA 3JALB 4FYMA 5BW6B 4Q7EA 5KNDH 3K92A 4WUTA 1SQ0A 2R66A 2HCJB 1BKYA 2V7QA 4M49A 4UBLA 3R9IA 2C29D 2Q4OA 4FFPA 2FW6A 4JGBA 2X2OA 3DDSA 3IA2A 4LMBA 2RGBA 3WK9A 4O2LA 4RADA 5FOQA 3GRZA 5FH9A 1PJCA 5JXJA 3IHLA 4TZ0A 1XRPA 3FGPA 1BVRA 3FRJA 1QCYA 3O8QB 4LK3A 2QY9A 1EXWA 1X7ZA 2QB5A 3B6EA 3E7XA 5B6JA 2NSHA 1W19A 3PQ7A 5CB0A 1BA3A 2YJ6A 3I5MA 4F9TA 1AXRA 3H04A 5JDIC 2ZWOA 5B3KA 1QGYA 3HHPA 3PNBA 3BJEA 2B9EA 1FDUA 4XM1A 4DN6A 1JL3A 1P5RA 1WBDA 1KKUA 2IHKA 1TRKA 2I66A 3OZEA 4I1VA 5LU9A 3K2IA 1BJTA 3ELBA 2BZGA 3HC7A 3C70A 3K1YA 3LO5A 5C35A 2VJAA 3T54A 4BVFA 2Y1KA 2H29A 4DQXA 2Q1YA 5CVJA 1NBIA 1U5CA 4U7GA 3H1AA 3ZW7A 4XWYA 4IPTA 4G63A 4U7FA 4ARZB 2C2YA 1ORRA 2WM9B 3OE7A 1O5IA 1UP6A 1CF9A 3U7HB 1QX3A 1WY5A 3B6JA 1US8B 3KP1A 5K09A 1XVVA 5IVDA 4Z86A 2D2FA 2RSLA 4GBJA 1G2QA 3D5QA 4B44A 1THMA 2GBCA 3PR3A 5EFOA 1YB1A 3IE2A 4WY8A 3TPFA 4BUZA 5AW8A 1UP4A 5KNBA 3WAJA 4BXOB 1AUXA 2RHDA 1H93A 4UEWA 2WKQA 4PYOA 2QVXX 2O1WA 2WW8A 4G65A 3BCUA 4CEJB 1PP4A 3KXIA 3FYHA 1XTBA 1W36B 3UUWA 3BZWA 1NLMA 3CA8A 3PDCA 3ADPA 1DG3A 1DELA 4BMOB 4UEKA 2QAGC 5AVQA 1M7GA 3EUFA 2QN2A 4R31A 3OAAA 4XM0A 3USES 4HDSB 3RRZA 3DFUA 1EGVB 3ANLA 1QFZA 5K3SA 4J76A 1GCIA 1YRAA 3I2IA 5BQOA 3IB6A 2ZTUA 3F46A 4JBGA 4RLQA 5BSFA 1QO0A 2VH5R 2YYZA 1TIKA 3FPFA 3LUKA 4D0NA 3G82C 2Z0MA 3BH6A 4U2DA 1D2RA 2P5SA 5G40A 4B6JA 1SBCA 2AHOA 2WWHA 3TTVA 1DL5A 2R48A 1PL0A 3H18A 4IX9A 3W4IA 4XVCA 1VKZA 3G9QA 1XDDA 3IEKA 3WIVA 2QGNA 1GTG1 3DTVA 5AXAA 3ZTTA 4F1JA 3K96A 5HCIA 4U2EA 4LY6A 4C0JA 5JS1A 3RBAA 2G3YA 2WKSA 3WYAA 2HNKA 4FR0A 1XTRA 5HJ7A 5KDDA 1U1GA 2XBMA 4MKFA 2WSMA 4AYTA 5CDSA 3WGUA 2MSLA 4I7EA 1E3SA 1KH3A 1QDUA 1PHPA 5CEEA 1TYZA 5E4FA 4IZ6A 4J16C 1HGXA 2YZ7A 1GLVA 5JZ9A 3KQNA 2F3UA 3OZUA 4O0MA 1I3MA 3AO0B 4OI1A 3INNA 2CKDA 2A59A 4ETMA 1GTRA 3H1TA 4LJAA 1Z3IX 4I5DA 4PHGA 2C5FA 1MJHA 3EFEA 3NRJA 4KPUA 1CX9B 5IC4A 5D5QA 4MJ3A 3L01A 3N8IA 2CF6A 3HN6A 5FIUA 2GJSA 5JRJA 4PAQA 1OC2A 3RVJA 5I6DA 1T9ZA 3A4TA 4RW0A 2X1LA 5K51A 1YULA 3CTPA 3PIRA 2I71A 1CUBA 2QV7A 3N2IA 3ZLTA 3FOWA 3TZBA 2F3QA 2R68A 1FDRA 2OL4A 3ETJA 3OAAD 3ZUPA 1HL3A 2H0AA 4BPRA 4KXUA 1T29A 3CISA 3WLKX 3LW8A 3WBBA 3TCKA 3BEOA 1ODKA 4IDDA 3UJ7A 4W5OA 2E4WA 1QO0D 1V1RA 5JE8A 1Y7IA 2C95A 4M0KA 4WBNA 2WSSA 3S1SA 2FOIA 1ZMRA 2A88A 3P97A 1K7SN 1C1DB 5IPFA 3OZFA 2NSJA 4V0RA 5L4NA 4UHJA 4FFLA 5CFNA 5IEJA 2Q3JA 2J3QA 1DAPA 1PR4A 3OPVA 4Q9DA 2FSHA 1UKEA 3E6AA 3D1VA 1S2OA 4WLUA 5H82A 1Z38A 4D74A 1K9VF 3X1KA 2QN7A 3RSGA 3TW4A 3KXLA 4DPMA 2RH9B 2C5GA 3HJGA 5AVSA 3FX2A 3PBKA 2ABWA 1C7QA 5FWAA 1HQDA 5DHPA 3UC5A 2YBEA 1OLXA 2J0VA 3M6AA 2FRVA 1KAOA 3Q3HA 1HFJA 1T2EA 1UIRA 3GPBA 1KQFA 1IBMB 3B6IA 4CLHA 2P4UA 2WWWA 5E9AA 3ZQKA 1EFPB 1JJ7A 1D04A 1WEKA 2FKNA 3HDVA 5CT5A 3RT9A 5ALXA 3T3DA 3EY4A 1I7QB 4CEIB 5K2MA 3QLTA 2VJBA 2WSYB 4JI2B 1MRSA 2I4OA 2KE5A 1F2VA 4MYHA 3AY6A 3BX1A 5ALIA 1ES9A 3N8GA 4GIBA 5FBVB 1TB4A 3CZ4A 4ZCSA 1EGHA 1EZZA 1FS6A 1WXWA 1RQLA 2ASEA 2HQOA 2PZEA 3LY7A 4QSMA 3L0CA 5AUPB 4HP8A 3UWPA 4B7CA 2ACWA 2GZDA 4E21A 1QIMA 3ZH2A 4EENA 1OBOA 2EYUA 3NT5A 2H4JA 4JI7B 3R5TA 3C7CB 3P4XA 1RXIA 4B0PA 2R8PA 3ZJUA 2OMKA 1FSSA 3MLBA 3MJTA 3RANA 2AUMA 3WLTA 1Z0SA 4CW7A 5BPHA 3H2SA 2WSSD 4M7PA 5FPQA 4PZZA 2UUPA 1SCQA 4KXNA 3LY8A 4EECA 1DJPA 3FDIA 1KYZA 4Q1DA 4BO1A 1ZWLA 3A8TA 4NFHA 5JYCA 1RRKA 1E3QA 2X3YA 4MJXA 1UXHA 4HZIA 4ZEXA 3T8YA 1EWVA 1SVNA 4QQFA 4K88A 3PRKE 5CT9A 1IPEA 1N0HA 2OOKA 4PC3A 1PSDA 1XVAA 2ARKA 3CX6A 3N39C 1PW7A 1VCOA 2F59A 2XVYA 3AUKA 5HK8A 5K0LA 4I3HA 1IUOA 4YFYA 1FFEA 2B8JA 1WS6A 3C98A 3QMVA 5DZSA 1KDYA 2O4CA 1XRQA 3SHFA 4C4PA 4BWFB 1XZFA 3CVOA 4E22A 1IAQA 1KI2A 4ZI2A 3WHPA 2VDOB 2HC9A 2NZUG 1YMVA 4OGKA 4WFIA 1N77A 2RIPA 4NNPA 4ZN6A 1IPHA 1OIVA 1G64A 2BFPA 2FCAA 3PTZA 4N7JA 5AICA 1H6CA 3MCZA 3G5MA 1DEHA 3N2KA 3NX4A 4PANA 1ZYUA 2Q4RA 1CUAA 3HB5X 3TSCA 3T7SA 1VYUA 2BHLA 2BJWA 2IYLD 3E5MA 3X0DA 4HB3A 4JKOA 3WV5A 4DCCA 5L3ZA 4YRMA 4BGVA 5K8LA 1OLOA 2HT1A 3FW1A 4OU4A 4PICA 4P4TA 5AOAA 1ZD1A 1A9ZA 1F2TA 2GN6A 3AI2A 1QH1B 3KCQA 2RB4A 4FT4A 4G1UC 4L6AA 1BNCA 1NR5A 2IZ1A 1SUDA 2A9JA 4DWJA 5AVVA 4G0ZA 5DBGA 2PX3A 3BERA 4Q12A 4JASB 4GI3A 4BNMA 3LHFA 3WTCA 4YYZA 3CU5A 1RYNA 3A7EA 1A4IA 3K0BA 3NS7A 1MQ8B 5TMEA 3BMNB 3NALA 4BEVA 2HQSA 3ROFA 4DLRA 1U90A 4ENUA 5E4YA 1X7YB 1WU7A 1REQA 3CIFA 3EXAA 2Z6AA 1KH2A 1X7WA 4RU1A 4XGKA 3DBVO 4ZVVA 3RRBA 5JH7F 1KDTA 4I14A 4M7WA 3ZIDA 4PO8A 2QUIA 1YA4A 2C9ZA 4BGUA 5CEFA 2G70A 1T9CA 4G0OA 4NV3A 5AQ1A 5JI3E 4DV7B 3QRWA 4IDQA 5LBTA 3SN6A 3TRIA 3T5GA 3VC7A 5LPNA 4XR4A 2GEDA 3M6UA 3IP8A 4OBEA 2CNKA 4TUYF 2E6UX 3CBGA 3KJGA 1ISGA 3RH0A 3TE7A 1WULS 3BIXA 4B76A 1EVQA 1QP8A 2EOAA 4LC0A 1TM3E 4NZPA 4MI3A 4W5HA 5LXTF 3NOXA 1YASA 2OXIA 3ROMA 1LPMA 4A0RA 5J47A 2JHGA 1NW5A 5FUQA 1G5QA 4H2DA 3M0EA 1G4UR 1JV2B 3BUSA 5LIPA 2FPRA 3EWSA 4EW6A 2YVLA 4OHRA 4LSGA 4MV9A 1N9KA 4ZFNA 1N8TA 3BH0A 3JWEA 5IT9A 3KQUA 4BFZA 1IWBB 2P9BA 4UBOA 1ODTC 1OV4A 4RDXA 1C3VA 1H2AS 3RNLA 1TUEA 4P7JA 2QI9C 1QNLA 5KZMB 4CKBB 3D7KA 1GFIA 3D4LA 2DHEA 4H08A 1WNFA 4RY2A 5ILGA 1RFGE 3PU6A 4YRSA 3SYLA 5J2UA 2O48X 1QVAA 2Q3HA 1CRZA 3DZDA 3ESXA 4IL5A 3STVA 4TVBA 3WL7A 1ZS9A 4K05A 6PFKA 2YFHA 2VATA 4PYQA 3VHRA 2F8TA 2IU6A 5LP6C 2O3TA 1TJ3A 1V37A 5CK4A 2GPNA 3EVZA 3OT1B 1NZFA 1NR1A 1HEYA 1MJGA 3VRHA 2AMVA 2C2KA 3L7CA 3QH4A 2R8BA 3RK0A 3UICA 4C30A 3KQKA 3DLIA 3OOWA 4TV8B 2XZLA 2YHBA 5BVGA 4GX5A 3AR3A 1QQ7A 4GP9A 4N8EA 1R0LA 1WKBA 5EIAA 1UKZA 2D5BA 3RS3A 4I50A 3GEHA 2WPNA 4UD2A 2IXFA 1IIRA 2V3WA 3NGXA 4RPHA 4YAKA 1NMEA 2B61A 1LZKA 2V96A 3W2TA 3INRA 1A1VA 2YVKA 1WHSB 1NJ2A 4DR3B 1U0OC 3NORA 4ZYWA 4LNUA 3C6YA 3VYVA 5BOVA 2AQKA 2P1DA 2FUNB 1OGJA 3O92A 2FZGA 4J0KA 2I8AA 4Q3NA 5CLGA 2GBPA 3JZFA 4F2WA 4ARIA 4ZEVA 1TX4B 1Q0UA 4GYWA 1EYZA 2D2EA 3OZXA 4Q4DA 3ZYCA 3AUTA 2H5LA 3D2BA 1NATA 4FFMA 4R1UA 2V97A 1SUPA 1NMZA 3ZG6A 3HN7A 4X97A 3UHAA 2VK4A 1WCV1 3PK0A 1GYPA 4LUCA 3ONEA 3Q10A 4EMTA 4QLOA 1GPLA 4RHTA 2YINC 3P96A 4P4GA 2BKXA 3JQ8B 5LSAA 5LD2C 5A3QA 3GDFA 3KCNA 5E7QA 4AY4A 3TG2A 5I9LA 3JASA 4JR0A 4CKWB 2FPKA 2P4EA 2NQ8A 2Y1CA 4R2KA 5CXQA 3C7AA 5KYWA 4HDKB 1GGNA 4FJ0A 2QAGB 3O2SB 2Q3FA 4HCJA 4UXIA 1DQSA 4BZWA 4D8VA 3U5ZB 1IXYA 3K8QA 5JAZA 1GAWA 2CEAA 4Z3DA 2R87A 1V16A 3JALA 4URWR 3UC9A 3V00A 2HHAA 2QMOA 3TEMA 2D5LA 4BO8A 3AJ8A 2QM7A 5AI0A 3U7QB 4D9EA 1BW9B 3ZEAA 4D42A 2A9KA 1LB1B 4KQKA 4QDUA 3KM0A 3R7AA 3P2MA 4Y9TA 2IYFA 2L19A 2ZR7A 3L4SO 4HDRB 2C4HA 4PZAA 4BWGA 5MF6A 2XZPA 1O4VA 2VHWA 2GGSA 2PEZA 1TK2A 1NVMB 3LDHA 1NX9A 3O8QA 5FHRA 1W76A 2JD0A 3U7GA 3DHEA 3ED5A 1UUFA 3DV9A 1XCJA 3ISJA 2QLLA 3KYIB 2I4LA 4KGVA 1A4UA 4D9HA 1M83A 5BNIA 4AF6A 4UXHA 3DDHA 2O8DB 3VTFA 4ZYXA 3CO0S 1N5RA 1GSHA 1LLQA 3FLEA 3OZAA 1T8RA 3JY6A 3WNCA 2RGCA 4DY6A 2W6CX 2CC2A 1CDZA 1T3TA 3PWSA 4DPLA 2ZI3A 2IX3A 1T43A 1H4SA 1C8BA 1N8SA 4KACA 2QN9A 2SKDA 1U0BB 4U9UA 3ZVLA 4NICA 5HKKA 3TW0A 4R16A 5BPFA 1AQNA 3AJDA 3OEHA 4QDJA 4R3NA 3UMCA 3OCUA 4IJMA 4XD2A 4ARZA 4BMCA 2QVLA 1PLJA 1I14A 4C0WA 1A4RA 4H18A 2VHZA 1XA3A 2PJRA 1Z4OA 3FIUA 1V71A 2LIVA 2HIAA 2FN8A 2ICAA 1US8A 4WZBE 4ZZ0A 2UZ4A 2HLDD 1V0JA 2OC9A 1UFOA 1BQEA 2YJ4A 3K9BA 1E7QA 3UMMA 1AUOA 1P6XA 3U4DA 4MTLA 2AYZA 1CY1A 3L4EA 2O1SA 3ZU5A 3TLAA 2CLCX 3N05A 2CUKA 4OJMX 1R6UA 4NV1A 1OYOA 5GM2A 4YACA 1GR1A 1HT1E 5HS6A 2CK3A 4DLVA 5I45A 5F2KA 5I5EA 3QMPA 1J0XO 3EOAI 4UUMA 2QTHA 3G13A 4HWRA 4XSGA 1S8AA 5CURA 5EP3A 3SEAA 2RBGA 4PLVA 3F7NA 5HCNA 3C48A 3AF3A 2JG3A 3BPSA 4BEJA 1OXMA 1E2PA 1ONSA 2AJTA 2FX3A 4MA0A 2PU7A 3GH1A 4BVEA 1U9JA 4L9AA 3DMHA 4JA2A 4HDSA 1U0HC 1RMQA 3DVLA 1G18A 1C7FA 2CCKA 1YH3A 1JLRA 2F3RA 3OU7A 1TZMA 1WDTA 2Y1XA 4DV6B 3CS3A 4A7PA 3BWXA 3AINA 4ND7A 4RMHA 2UXCB 1AKUA 3MQ2A 1UPTA 3LPDA 3FRHA 1B0UA 3KJHA 2C2GA 1XMOB 1Z7YA 2FW9A 1ZHFA 2JGKA 4IO1A 2NZ8A 3A6GA 2V74B 4LQCA 3LQQA 1K4MA 5HMMA 2W93A 3DE6X 2BMEA 4U2BA 2VTBB 1OZAA 1P9WA 1QNFA 1PI3A 1QMGA 2QRMA 4F1KA 2AMFA 4RTKA 3TIFA 3VKWA 5J5CA 3SAJA 2IZ7A 4WBXC 4CMIB 5CFMA 4ZT5A 1SUSA 2Y0PA 3RI3A 2DMRA 4IVQA 1SR8A 4YUXA 2G9RA 1Y3BE 2YY7A 1RWWA 4DS3A 1QUFA 1CUHA 1L9KA 2KBEA 3UIEA 5AFSA 5IANA 5K3CA 4BP9A 5KHOC 2EFDB 3M7IA 2XB4A 4QUBA 3JRNA 3VR6D 4IAOA 3R3HA 2PYZA 2X5NA 2R65A 2R6ZA 2W6IA 5C8ZA 1YS4A 4M22A 4MCJA 4QVGA 4JS0A 5FCDA 3OQHA 4FFVA 1Y3CE 2JAUA 2CK3D 3L0IB 2CVHA 4H0CA 2IHZA 4B8YA 2H2AA 4H4EA 2IYSA 2J33A 5KDOA 2Q0QA 1II9A 1O95A 1P73A 4U6NA 5BRAA 3UXEA 1P7YA 1I6WA 4G26A 4J1TA 3P9SA 2VDLB 3P0HA 4RXTA 3NRBA 4MAMA 4RZ2A 1KEWA 3URKA 4BYGA 2BGIA 3DHVA 2WA2A 4ZT4A 3OPYI 3B85A 1L4BA 4F9FA 3L6EA 4AJLA 3WZLA 1BA2A 1J1UA 2GFIA 3ANTA 3D8HA 5D8DA 1WD5A 3NG1A 1SXQA 3ZOKA 1VCIA 3O7WA 4LVCA 3I5UA 2P7HA 3Q8LA 1FNMA 2W2MA 1TZCA 2QLBA 3JWJA 3GDGA 3O2NA 1O0CA 1C1DA 1XRSB 4HD8A 3OJFA 4EJ2A 1E7SA 2H5IA 2KX7A 2WQZA 3CH7A 3GFTA 3NTVA 2NZYA 4KMRA 3IKVA 4FFWA 2XUQA 4BFXA 2ENUA 1NURA 1X87A 3QENA 2IOYA 3JQFC 2O8FB 4EB6B 1URPA 1P1FA 2H3HA 1DB3A 2WP8J 5JNLA 4IDOA 4LF6B 3E23A 4PIPA 3Q7SA 2WJZB 1TD1A 3K3PA 2ZUCA 3MJRA 4A82A 1PZEA 3QSYA 5F4BA 1F48A 4GI7A 3WXMA 3WICA 3OHMA 4RH3A 1XMVA 3E1SA 4IOKA 1GNVA 1OA1A 4KUHA 3KAQA 3MSXA 1NLYA 3ZGXA 4LHYA 2J85A 3RSQA 4ZOLB 5IVKA 2IS1A 4M2LA 5J1TB 3EW7A 4BL5A 1HZZA 2HSJA 2AC2A 1ZM2A 2GO1A 3VXKA 1CC1S 2O3RA 3G49A 3NT4A 4D9FA 1UOPA 4HXEB 2RAVA 5FFFA 2V6IA 1EFPA 3F1LA 3PDHA 1E5LA 5G0UA 2F6RA 1JBQA 2B1GA 1XYVA 8MHTA 1DV1A 1DZ3A 4U7DA 4GI5A 3FCXA 3UYKA 2CVZA 2MYUA 4PSVA 1YGPA 4R68A 1O95D 4G25A 1T2AA 1LDEA 1Y6JA 1GAXA 4AI6A 4OO3A 4MS3B 5B6IA 1XXHE 1XDGA 4UHKA 3AI3A 2HNAA 4EW3A 3T34A 2QMZA 4B3BA 3F74A 3KJZA 3IQXA 1IVYA 4CCAA 4UJ3A 1YCHA 4R0NA 5K2OA 5L7YA 1LGYA 1CUGA 1UINA 3B60A 1G7TA 3OUZA 4JQZA 5KNBH 3AVVA 1M9NA 1Z6TA 4Y6OA 5KOIA 1M1ZA 3QXSA 2BMJA 4FKMA 1EP3B 1PTJA 1FVFA 3H1BA 3KLOA 4LV6A 3FMIA 2L18A 3T3HA 4JVSB 2WFZA 2EIXA 1ZQ9A 3PUYA 3VDQA 4LSMA 2JH8A 4KAAA 4O2BF 3R0XA 3CNLA 1XTTA 3AI7A 4BX8A 4DCOA 1B42A 1BS9A 1BEUB 3E9CA 5DYIA 4ZVLA 2DEUA 3WADA 2GRAA 3R3VA 5BSTA 1ISJA 1E2MA 2EKQA 4RELA 1GPKA 3T35A 4B81A 3ISTA 1A8SA 1U9IA 4NAVA 3TOCA 2BYTA 4OKSA 1WEHA 2GHQA 3EDRA 3F7OA 3HL4A 3VR5H 2YRFA 3BXEA 1NULA 2WSLA 3EUEA 3NHRA 1WZEA 3MGCA 1RZUA 2RB5A 2ZVPX 3FR8A 3H5AA 4UM7A 4YJ3F 3P0FA 4AS3A 4B09A 1ENZA 3C45A 2HYIC 2ZP1A 1WW3A 4ZRNA 5A04A 4CKZA 3N58A 4PZUA 4WOJA 1QIIA 1NPDA 1U9YA 1NXWA 2HJWA 3F6RA 4E4RA 2M2IA 3LUHA 1QR6A 1QK4A 2FDCA 3AM1A 1GRRA 5B2FA 3GGCA 3GWGA 4TXMA 2D1RA 3PICA 3G2OA 1HYQA 3QA3E 1W8DA 2G9ZA 2PT5A 3F98A 4GLOA 5CTAA 1JB9A 5IAOA 1GL9B 4ZQGA 1QH1A 2NWQA 1E1QD 1TKCA 2QT0A 3MTEA 3RHFA 2IX9A 5JMPA 1SUBA 5GOTA 3P9ZA 3GCDA 4MS1B 5TE9A 5IC6A 1IY8A 1JHAA 3LLSA 4HS9A 5LYJB 3ZVKA 5ALPA 3L04A 3U9TA 3GROA 1Q95A 1W8IA 3A05A 5BN4B 3HJRA 3UFBA 5MDHA 1SKYE 3QX9A 2H65A 4HSEA 4CUKA 1G5IA 4YFVA 5LDDC 1U8UA 1FTSA 2X76A 3VKGA 1ZL0A 1X7YA 2FPSA 4M1ZA 2YJ5A 2YZKA 1MPXA 1A7UA 2GMWA 5J2UF 3V97A 2L42A 2MCFA 4OAOA 4AQDA 2BUBA 2O05A 3PC6A 4L28A 3H4IA 3UOWA 1DZIA 1E2HA 1GV1A 3I2YX 1ZFNA 4J4TA 1EJ0A 1EG2A 5LD2B 4HX2A 4UPVA 2RHCA 3GL9A 3L8EA 2A0WA 3R4CA 4FHGA 1O6FA 1J2YA 2RMKA 3AEUB 4HN9A 7AT1A 5F4ZA 3EB9A 1KWGA 3AFOA 4BZPA 3SSNA 4A27A 1TAUA 1T15A 5HM6A 2YS6A 5IWCA 3L0YA 5FJIA 1HMPA 2G9VA 3NAZA 3IIJA 2GN9A 2J09A 3QE2A 3F9IA 4G5YA 1QR2A 4IUBS 1CE8B 4JN6B 2GZHA 4K9PA 1SOUA 5H3CA 5AVXA 5F98A 3RJMA 1JMYA 4CKBA 3D6MA 3M6MD 4JP2A 4RYDA 1LW6E 1PK7A 3KBBA 1R8QA 3FRIA 3R2JA 3ZHBA 1KSFX 4YIKA 3U4QB 4Z53A 4FS8A 4PTYA 5I8ZA 3SVLA 4GBMA 2R11A 3NC0C 4GE0A 4O4LB 4ZRDA 3OT1A 3QITA 3M5DA 2PH7A 1S7CA 2ZZKA 3WRXC 4WWHA 5GJBA 1FTGA 3E8SA 4TV8A 2VP3A 1YU6A 3LE8A 4V03A 4B75A 4BRUA 5JJIA 1SOVA 3LC7O 4FINA 4KR9A 2E6KA 1JTEA 3NC1C 3C4VA 2HXGA 4P2BA 1PQYA 1XVTA 3ZPXA 4MUYA 1MJ5A 4HEJA 1M2HA 1OBVA 1LJLA 3OUUA 4V0ME 4Q5IA 4ENRA 4WBNB 2V59A 2C3OA 2C4MA 2JLYA 4HNAB 4B73A 3ZD9A 4B45A 1Q0TA 1AQLA 3EGIA 2C5EA 1Z8HA 5I4IA 4YI5A 2OBBA 3QOYA 3RFFA 2Q6IA 3ITEA 1SG0A 4J1QA 4BJ3A 2AKEA 3GN1A 4Y2HA 1OHHA 4BCCA 2ZXEA 3I2KA 1TU3A 3D0OA 4ZZ1A 1ID1A 1T0PA 1O6GA 3EWAA 1LTQA 3MELA 4I6JA 3OCCA 1ML3A 1KMHB 2ZCUA 3DDZX 2WZBA 5C1IA 3BICA 3N86A 2C2MA 2BM9A 2DULA 2NXWA 5JATA 3PXXA 1YZVA 1Y7LA 1HYGA 2JA2A 4NP6A 4BTVA 2Y2UA 3LCJA 3MINA 4NHOA 1T4DA 3JQ8A 4YRAA 2MJLA 2HWXA 4J07A 4KQHA 4DIFA 5IMBA 3H42B 4CHGA 4CKWA 4TN5A 4U9HS 2CLLB 1D8TA 2V9CA 2VPPA 1N92A 3KOOA 4MDEA 4RETA 4HWOA 3V8RA 1ZSYA 1HWYA 4PYRA 2QAGA 3B20A 1NT4A 1Z0IA 5DW0A 1HRDA 3WNZA 1C9NA 1MO2A 4EG4A 1CUSA 1WD7A 1AKTA 5CYPA 4RANA 1X39A 1W52X 4GOOD 4FW9A 4U0JA 4Y2PA 3SQOA 3T94A 1DKUA 4M8IA 2XVAA 3OG9A 1MC1A 4RXUA 4MRPA 4HH3C 3BMCB 5EPUA 3VR2D 3FVTA 5BYBA 3WGVA 3KQOA 2NUBA 1P4RA 4H35A 3SNHA 2LD4A 4DLTA 2G9QA 3FNIA 3GZNB 1OAKA 1BWQA 2GN8A 3PNVA 4HDAA 4YWJA 3U7QA 4DRXB 1F7UA 3GJ5A 3VGPA 3WFIA 1ZCJA 3U81A 3ZXUB 4Q9AA 5F5XA 3PWKA 4DA9A 3SLRA 3HP4A 3MUEA 1SCDA 3AUXA 5DHQA 4AMGA 3I9JA 2IODA 1WQ3A 3NHJA 2EFEB 1QZZA 1RXWA 3LBNA 1L7EA 3IIMA 3MS4A 2Q5JA 2V4ZA 4HNUA 2CJPA 2J6BA 3D2AA 5E9WA 2CDRA 3HWRA 2W2TA 3PJEA 1JDJA 2YY5A 3BCSA 5D1HA 5TV2A 4B3FX 3IJRA 3PPXA 3C3MA 3GAZA 3Q6MA 1UDXA 1H2BA 3PD1A 3MWGA 3J81k 2WUGA 3C5WP 3CZAA 4MV4A 4R8LA 4TLLB 2LRHA 1Y7HA 4XPZA 3DE3X 6ABPA 1KJNA 3PG5A 4WY5A 1USUA 4E0BA 1D0SA 4X0EA 4EJ6A 2WA1A 1KI9A 3DAFA 2PK3A 3QYPA 4BNFA 3FFAA 5A7FA 2HBYA 4EJMA 2FE1A 2PTHA 4F04A 1NVVR 3NHSA 9MHTA 4UPEA 5AT1A 4XLLA 3T7JA 3P9CA 1ZKMA 3C15C 4V38A 2O50A 4CLDA 4RC9A 3BH7A 2C7QA 1M6WA 2ZIXB 3MWKA 3ZCVA 2AYYA 3TM4A 4LQDA 3ZDAA 3Q88A 3I6YA 2Z2KA 4PZDA 4IV0A 3ETNA 2QJOA 2YN2A 1Q11A 1XU9A 3G0GA 3FOEC 3NEJA 1HYEA 4L5BA 4PCVA 2VP4A 2DWOA 3O1LA 4NPCA 3UMYA 4Y1EA 3ER8A 1H0HA 4WD3A 1OT5A 5FPYA 2G72A 3BE4A 4EKDA 2TYSB 3QKUA 3GA7A 4MSUA 4IIDA 3TIXB 4UNIA 2FEKA 2PIDA 2YQ5A 3H2KA 4PXAA 5FFNA 2PV7A 3RC2A 1B14A 1KE2A 2CFOA 3P5BA 4E1VA 5KMGA 1XWWA 4XJVA 3CN7A 4WADA 5BORA 2IHVA 1LPNA 4M1YA 4W1SA 3JZDA 4QX6A 2NO1A 5F7ZA 3MJVA 1F8XA 2GQ0A 5JNSA 2VZ9A 1SELA 3A14A 4C0KA 1DTSA 2ZBVA 4YRZA 5B7PA 2BISA 4BQQA 1NZDA 2GBIA 4BX2A 3UH1A 3ET4A 2MIIA 4YMTA 3RW9A 2JFWA 2CZQA 1SBQA 3DXXA 5A3RA 5CLJA 1GVNB 9ATCA 5IDQA 3E2MA 2IPXA 2V6BA 2X5KO 5GJVC 1M74A 3JAMA 2GCGA 2Q3CA 1U81A 1AC5A 2AJCA 3GFPA 1AO0A 2Z9BA 4HKTA 2QHXA 4YP1A 2JB9A 3THRA 5TS3A 3DQZA 3OZSA 2DX7A 4DOMA 1XJQA 3WKEA 2J48A 3UANA 4KQFA 3F3YA 4IEEA 1Q22A 4DLXA 2VTBA 1CRQA 1DFGA 4S1VA 4B4WA 3ADCA 1E69A 1EX1A 2A33A 2I4NA 2W2LD 2JJ2A 3WGYA 3TFWA 4EQZA 2AN9A 4RM2A 1N1MA 4CMIA 2EAUA 4N65A 2FOXA 4AJ2A 4KIJA 5A62A 3KEQA 3I42A 4FMCB 5AHRA 3AL3A 1FQKA 3WSTA 4D3SA 2XHZA 4IVRA 5AK0A 4EX7A 2N47A 1A76A 3HUTA 3EIHA 3AUFA 1M2GA 3M5CA 1ECGA 2E0IA 1DQPA 3AU8A 2AT1A 3GF4A 5DGXA 3IC5A 2ZAIA 3WQRA 3WKDA 1KBOA 4LI3X 4J49A 4U39A 4RVUA 5C4IA 5M3BA 1UCFA 4FP9A 5J3JA 3ORYA 4HAVA 4F06A 2GN4A 2X2EA 4H1VA 3SI7A 4GLJA 4P53A 4QPNA 3LBFA 2Y71A 4D41A 3OLYA 4EG6A 1GUDA 4M1OA 3QY0A 4K03A 4N40A 5FV4A 3AVQA 2C9BA 3EXG2 2Z8YA 4PYLA 3B52X 3DP9A 2DVMA 2OHFA 2R2GA 1YRYE 3QA9A 4W8HA 4CYMA 3I09A 4I66A 1UZLA 4DFDA 4B3TB 5FBKA 4E1BA 5JZBA 2WC1A 5C5IA 1JIIA 4TT3D 4GMXA 3X1JA 2JLQA 2X41A 1UZAA 4ENQA 1EX7A 1XD8A 4L0QA 4K9SA 3OSZA 1M10A 1BD3A 1P8