2Q2OA

Crystal structure of h183c bacillus subtilis ferrochelatase in complex with deuteroporphyrin ix 2,4-disulfonic acid dihydrochloride
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
307
structure length
307
Chain Sequence
b'KKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSACSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase
molecule tags Lyase
source organism Bacillus subtilis
publication title Porphyrin binding and distortion and substrate specificity in the ferrochelatase reaction: the role of active site residues
pubmed doi rcsb
total genus 116
structure length 307
sequence length 307
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q2oA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q2oA02
2H1WA 2XWSA 1AK1A 2HK6A 4CCSA 1C1HA 1LD3A 1N0IA 2PNJA 2QD5A 2AC4A 4MK4A 2Q2OA 4KLAA 3HCNA 1L8XA 2XVXA 1HRKA 2QD3A 2C8JA 4KMMA 2HREA 2Q3JA 1C9EA 1TJNA 2XWQA 3HCOA 3AQIA 4KLRA 2PO7A 3HCPA 2XVZA 3W1WA 2QD1A 2XVYA 4KLCA 2H1VA 2AC2A 4F4DA 3LYHA 2Q2NA 2QD4A 2XWPA 2PO5A 1DOZA 1LBQA 2DJ5A 3GOQA 3HCRA 1QGOA 2HRCA 2JH3A 2QD2A 3M4ZA
chains in the Genus database with same CATH superfamily
3LD9A 3BEOA 4K9DA 1U7TA 1SG9A 3S27A 3RQSA 4BNFA 4LF8B 3SFZA 2GK7A 1V35A 1WV0A 2B30A 4DAOA 4QG3A 5C7IO 5HZKA 4LKOA 5L3VA 4CM8A 4G23A 4Z9FA 3I05A 3F96A 1RVDA 3B1FA 3NTQA 3VPHA 4AUKA 5DXJA 3O8QB 2IS1A 3R6DA 3WWDA 521PA 1CIJA 4Y1FA 2CMFA 3B3AA 5L6MB 2D06A 1NV9A 2FFBA 2ZVJA 3EH2A 4TLCA 1YUMA 1PL6A 4ARSA 1KTIA 4RTQA 1N2JA 3HA2A 4JS0A 2WJJA 4MVJP 2BP7B 2W22A 1O95A 2HLHA 3D7RA 1XA4A 4UAVA 3STVA 1YQEA 2Y05A 3ZCSA 5LOVF 4FDLA 1ENYA 4O25A 4D9BA 2R6ZA 2ZB2A 1GGKA 3GFQA 4L76A 4XAQA 1AKYA 1CX9B 1YXMA 5J1TB 1WAMA 1Y9EA 4KFUA 2QR2A 3JZDA 4K6CA 2RHTA 3JQRA 3PDCA 5E8RA 3WKBA 1BN7A 1QOQB 4H6PA 4MWOA 3HG7A 4WZBB 2VUUA 1E9VA 2VHJA 4TWJA 4ITVA 3P26A 1RFGE 4E32A 1IIRA 2GB4A 2VNJA 3AI2A 3ESYA 3QVWA 2ZB7A 2OBFA 2QNIA 1XNHA 2XTAA 3OU2A 3RKUA 3M34A 2HNKA 4TMFA 5K8LA 3QPDA 5DV9A 2AC2A 4E5PA 2P5SA 3SHQA 2QGFA 2XE4A 4H1HA 2PKEA 2RH9B 1E3EA 3DE0X 1OZHA 1P19A 1XZKA 2ZI4A 4G81A 4HDMB 4OQYA 3RFVA 4X63A 3RDPA 2UYQA 3FDZA 4BFLA 4A10A 2AK2A 4ENVA 1DJNA 2I7XA 3GGOA 4YACA 4HAUA 3QPWA 4F9TA 5KTPA 1QIDA 1P62B 1IMOA 4UHJA 5BV1A 2NYRA 1JAHA 2EG9A 2L82A 5BW4A 2X9VA 2PMCA 2POCA 4GBED 1LTHR 1HORA 3PEYA 1USIA 2PUGA 3KOWA 3A1UA 4FNOA 1HG1A 2CUKA 4K81B 4HBZA 3P2IA 1ZQ9A 3UWKA 1RWQA 4AJLA 1BWRA 4LRQA 1Z4LA 2RGNC 5E7QA 4R6XA 3SI7A 5JRZA 2OCLA 1GFSA 1PP4A 4KYIB 4TMKA 1RXYA 5TRTA 1U11A 2JS7A 3AW9A 4D0NA 5JR3A 1F0YA 4HAVA 1TMYA 1YFZA 3DWFA 3H4IA 3H5LA 3O0DA 2WKWA 1ODTC 1EX6A 4DB4A 4KNYA 1O8CA 3AJAA 5CW1A 3Q98A 1WWKA 4RWZA 4WV3A 1DI0A 3QOYA 4WXPA 4NY1A 4E09A 2ZAYA 5JAPA 3C3DA 5A06A 2G4CA 3QLVC 2VH5R 3DKIA 4N0DA 3SCZA 1ZG3A 2BFBB 1E69A 3DUWA 3JD0A 4DLVA 2AKYA 3HACA 5ECDA 5I7VA 1F2TA 4BAUA 3G5AA 3RABA 2G71A 1MEOA 2BJHA 5G53C 5EI5A 5JCJD 4PW0A 4TL7A 4BUZA 3IHLA 3I61A 2OWEA 1NUHA 3V2GA 1ZCJA 5K01A 3AR7A 3W3ZB 1FDSA 1YOBA 2W0SA 1NQAO 1UKEA 4GPIB 2HOQA 3HV0A 4QLBA 1KSJA 3UJ8A 1J0BA 4YCBA 5LLTA 2WVGA 4HAOA 3G0DA 5LLDA 2FP4A 4LRYA 1KVSA 1DBIA 1C7ZA 1GD1O 2PEYA 2YFQA 3MTAA 3DTVA 2NTJA 2EFCB 3PXCX 4I9UA 4BMOB 5L51A 4W5NA 1QAOA 1I13A 3OOYA 5INTA 2YINC 5I01A 1N7JA 1Z18A 3I30X 1EXVA 4TTAA 2WU0A 1E6EA 1TA0A 1M1YA 3HZRA 3QVLA 1P3JA 3HPQA 3NNDA 4U4AA 2MSNA 4POOA 1YRYE 3PBKA 4MYSA 1L4HA 5IFKA 4RIIA 2GO7A 3QJYA 3SNHA 3U26A 3IOCA 2GJ8A 4JEUA 4KO1S 1BTOA 1LW7A 3KHKA 1NNUA 3L1KA 3R3HA 4EB0A 1ST2A 2YV5A 3CWQA 1BDHA 1X80A 4D0GA 2PN1A 1EUZA 2AS0A 5MDHA 3HGMA 1ZWLA 2R65A 5K6AC 1TEVA 1KQFA 2VF2A 2NP7A 2R66A 3A3NA 3HKCA 1ZXBA 1AOXA 4CDMA 5K8CA 1QJCA 3DMYA 1VSUA 4EJ0A 4Q4JA 2QJWA 1W4LA 4R2IA 5D5PA 4UD2A 5DHUA 5E0OA 4DT1A 2V6BA 1NMEA 1IAQA 4RPKA 1Y3BE 2G70A 3A9UA 3DDHA 3SHFA 3WQQA 1E2EA 3PF9A 2AKAB 2WDZA 1U2RA 1V1MB 1E1CA 3RO7A 5BMVF 1NXQA 3JPWA 1V5WA 3Q6NA 5CPFA 5ESRA 1IG3A 3VNBA 1I4WA 3F6YA 5F3RA 1LNSA 1JU3A 2ENWA 3ND5A 4G4GA 4JSTA 3KWJA 1JEOA 1U8YA 4J3FA 4F6RA 2EQAA 4CV2A 3QKSB 5FA5A 5B64A 1XEWX 3DZFA 1ZIPA 2BGTA 1CNEA 3IEXA 5D6OA 3WYDA 1BFUA 4GZLA 1Z8DA 4KAJA 4KC0A 1AKRA 4INJA 4HYTA 5F78A 4C7JA 3DNPA 5CCBA 3CZCA 2E85A 3NLLA 3V1MA 2XNSA 4F97A 2IP4A 4CEIB 2BMEA 3UWOA 5EQDA 2OHHA 5HBGA 3VUFA 1BA3A 5DTJA 1T26A 3AY0A 1JPNA 2JLQA 2QGNA 1V6SA 3A2LA 4JP3A 3W1WA 1WDWB 5IX8A 1OWPA 1QE3A 1ZCAA 1ZJZA 4HATA 1ORIA 1RI1A 5HK8A 5D5HA 1G63A 1V1MA 1F6WA 2Y93A 2Q50A 2MYPA 5EOVA 5EKUA 1FYFA 3N2YA 3ZEIA 4QDZA 4M1YA 1WLYA 2H4ZA 2QI9C 3DUFB 3HKEA 4RH0A 1UDCA 2NACA 5KTTA 4UHKA 1T91A 1NDUA 1VPTA 3GPCA 1I3LA 4RQBA 4TV8F 5BOVA 3VOTA 5EE3A 1R5NA 3OHPA 5L45A 5EJ7A 3N7AA 3RKRA 4LZAA 5H1YA 1PZNA 3WRXC 3QY9A 3CPHA 4Q9AA 3RYIA 3AJRA 3VZBA 4A0FA 4L0QA 1P4HA 1AQJA 1E3MA 1G21E 5ITZA 5LDHA 1YQGA 4K40A 1HOTA 4K46A 3AERB 1J8FA 2B7LA 1D9ZA 2O19A 3HCPA 3ONEA 4IZOA 5BUCA 5J58A 4KYUA 3A2KA 4IQFA 4BVFA 1E9AA 2ZIXB 4FGKA 3S55A 3NHWA 4LK3A 1EA7A 1WZUA 3PFGA 5B3KA 2OCGA 5KX5B 3GT4A 4CIYA 1DHRA 4MW4A 2HLDA 4H4DA 1PZHA 1RXEA 5TS3A 4IIJB 3B6ZA 1KP9A 4B82A 2GBLA 3KB6A 1QHGA 4FOPA 4DQKA 1E2KA 3ZDCA 3UTCA 1E4VA 3I3SR 2Y1LA 1P4JA 2R1TA 4GPZA 4V0ME 2BMWA 5DN6A 3WLHA 1T0PA 3TUIC 5KOJB 3GJ7A 2IHZA 5FB3A 3D4BA 4CFYA 3NVKI 1CY0A 1EHCA 1NTRA 4UU8A 1K4YA 1CUVA 1D2CA 2N0SA 4XUEA 2QAIA 5CYOA 1OI7A 1JSLA 2DQZA 3I2KA 4R1SA 1L7AA 4B09A 3CIOA 1QFZA 2CLSA 2QXUA 2VZLA 2FUNB 1IUKA 2E4UA 1VE5A 5DHRA 5TT0A 4CNBA 1K92A 4MWDA 1A4UA 4OBXA 5EIOA 4AQDA 1ZVQA 1IVYA 3SS8A 5KNBD 2ZZNA 3DAGA 2C83A 3BE6A 3AM3A 1P44A 1YACA 5FWYA 4KQMA 4PYMA 1LDYA 1QIJA 3ZZTA 1N8TA 3DV2A 4H0NA 3ONDA 3TW0A 2VBIA 2FW8A 5ICFA 2JGDA 5EXXA 2GPYA 2IOQA 4IG4A 4MVJD 2ST1A 4G0QA 5ELXA 4DILA 4G86A 2VQ6A 1P5HA 5AWFC 5SZJA 4HGPA 4BVEA 3OQPA 5LBTA 2REOA 3MWJA 2HHHB 5AM4A 1BS2A 3RS4A 2MYUA 1LBIA 3QX9A 2J08A 1JHVA 1H5UA 3BF8A 3BFKA 3FVTA 1Y6JA 4XUGB 5E9WA 3RC9A 3ZDQA 1LU9A 1A96A 2EERA 4H3VA 3OKPA 4KO8A 1XKTA 1QFYA 4NK4A 421PA 1PLKA 5HKLA 4YAIA 3TJRA 1EP3B 3GNQA 1N3IA 5G3ZA 2FKAA 4BKRA 3J81k 5A6SB 1XMJA 3ZZUA 1FLDA 5JJKA 4ER7A 4I5DA 1F4LA 1Z13A 5ILGA 5F9FA 3JQPA 3QJGA 1ESEA 1YJ8A 2AIRA 1VIDA 3HXMA 4YCCA 1C1HA 1W44A 3WRYC 1NI3A 2QN8A 4HLCA 3S29A 2CL0X 3VSBA 4L5JA 2JJYA 1VG0B 2DFDA 1NIPA 3L1VA 4IRXA 4REQA 3KD3A 2DPXA 3OLXA 3ZD8A 5LQJA 1MOSA 2GBIA 5JTTA 4B45A 4JEMA 2X5XA 4NS1A 3NAGA 1DUVG 1MENA 2D8MA 3TDKA 4R1TA 1AS3A 3M2PA 3UAXA 3UMRA 3ZHSA 5HM8A 5SZKB 3G17A 1A1SA 2FETA 4ZOLB 2DWOA 2C4UA 1S4MA 4E08A 3EWIA 2DZDA 3QU9A 4YLYA 1IY8A 1VGRA 4RS4A 3U60B 4HNHA 1XZEA 3ZCTA 2P9FA 4EY6A 2AEFA 2FW1A 3PRHA 3M6AA 4OK3A 3HI6A 4JT2A 1M0EA 2N3ZA 2O0MA 1RQLA 4RDCA 1W49A 1BC5A 5AVRA 3NFRA 1P4SA 2VCHA 1F3LA 3OZVA 2Y1OA 4UEOA 3L3BA 4PLWA 1KZ4A 5J1SB 2H2FA 2C9ZA 1YRQA 3Q0IA 2RGUA 3GJSA 2P9HA 3ZDDA 4BRWA 2BUAA 2ILVA 3HLTA 4IDBA 2JI7A 1E2PA 4AAYA 1E3QA 1XWWA 1CQIA 1Y7LA 1A04A 1PJ8A 5KUTA 3SYKA 4P31A 1AK2A 2YVUA 5G0UA 3SC2B 4LTNA 1NR5A 2P9QA 2IVFA 4ZU3A 2DR0A 3N2KA 2H0QA 2AMVA 4PPYA 4YC7A 5IULC 1Y37A 5ARDA 2YVLA 4G0PA 3UH0A 1U8AA 1X87A 3PC8C 1ZL0A 2FN3A 1SCQA 2OE2A 4AZ3B 2SCUB 4LXYA 2FW0A 2R60A 3FWKA 4FBGA 4BEWA 4OGKA 3BSWA 1RMTA 2BKUA 1A50B 4R41A 3UCEA 2CDNA 3T94A 4MOWA 5KEIA 3PQ6A 4RKEA 4JP1A 4HEQA 1U5BA 2GPBA 2NADA 4H6XA 3HN2A 1AS2A 3DEFA 5C35A 4MVJI 4OUDB 2XMQA 3SJ7A 5FLXA 3Q1KA 1CVLA 2BFMA 1TW2A 2CE2X 3HUUA 4QEZA 3OPYB 1KY5A 4CVNA 3HTXA 4ZQBA 4RO0A 3KOUA 3UWSA 4ZI5A 1WCIA 2H2DA 1DC3A 2EVWX 2Q3FA 3BXHA 2CL5A 3KPUA 5HCUA 2OBMA 5IW8A 4N8SA 1CUJA 5EC8A 5LJIA 1ULHA 4NAHA 3LDAA 2V74B 4YQFA 4GIBA 2GN4A 2OV8A 4MLDA 4W1QA 5JQGA 1E66A 3B1XA 4GOND 1G5HA 4UREA 4C2AA 2Q27A 3WV4A 3W5CA 1KRXA 3K72B 2OSBA 1YZUA 3I58A 2ACWA 2W4QA 1G5RA 1OPXA 1COWD 5CNKA 2MMGA 2IQIA 2O6HA 3KDPA 4RF3A 3IR6A 4I0WB 4BZQA 4E4YA 1XDDA 3HJNA 1KA9H 4ALNA 4Q05A 4EEXA 1ZN7A 2H0AA 3EXHA 2CCKA 2CLKB 3I2IA 2KQUA 4QOSA 4B76A 1CQJB 3BTUA 4B34A 4PZEA 3MXTA 4G8BA 3F1LA 2ZWMA 1H9CA 4PRYA 3RC7A 2CFIA 3KYBA 4OK6A 4HQFA 4K6MA 2PX8A 1HK7A 4GH5A 4PAWA 4UM9D 2Y92A 5AH0A 5DH9A 3U3MA 2O3RA 5FYDA 4D6YA 5KNDD 3D0RA 4JUBA 1QH0A 3FYUA 1UQTA 5BY2A 1NBIA 3EGXA 2ZPAA 4RW0A 1O77A 5EPEA 4YMSA 3VVBA 4BKOA 2GHTA 3GCDA 1U3CA 5FA8A 3E3LA 3EXG1 3H0KA 5IU6A 1R7RA 2DECA 2E3JA 2TYSB 3QENA 1W25A 2PSHA 4RDHA 3ZDEA 3Q7TA 1PL7A 3C3CA 1QX3A 2VTBB 4IIHA 4HLDA 1ZJ4A 5KC9A 1E62A 1US8A 1QHXA 3LLCA 1H2EA 1I9CA 2W2KA 4OBEA 2HF8A 4TS3A 5I8PA 5GJBA 3LI2A 5KMGA 4M83A 1YR8A 1R0LA 2G88A 2P41A 2V7XA 3EXFB 3MUEA 3G2KA 2QYOA 2XJ4A 4C7MA 1YWGO 3SP1A 3WTCA 2XX3A 2Z3VA 4PC1A 1FMLA 3EW9A 4KMSA 2DFKB 4KVZA 3IP3A 2NVUB 1R0ZA 3HE3A 1V7CA 3ZNNA 2W6CX 2C3YA 4JHLA 2HU7A 5BT8A 3JASB 4E70A 1FJGB 3K09A 2KS6A 2QT1A 3OPQA 2R85A 5CDYA 4KNVA 4EJSC 1ACLA 2RB5A 3TECE 4Z4EA 4FWTA 2SECE 3COYA 4QU8A 4DMGA 4AO7A 2NGRA 2J0UA 4IFIA 3DQQA 1F8UA 1BMFA 2H07A 1UMBB 2Z95A 3G0IA 2SICE 1USUA 1UZNA 5A5VA 4F8EA 4YJ2B 4KYTA 4QPPA 4EL0A 5GJCA 5A7HA 3EVBA 4AP6A 3CSDA 1J5EB 3ZHOA 4IZ6A 3PWKA 4M0MA 1MTOA 3JWIA 3USCS 3AO0B 5KMGB 2G25A 2XR1A 4MVJG 4BCDA 1YQXA 1ILEA 5A0VA 2ZRBA 5IN4A 1B00A 3FPKA 3TBHA 5KHOC 1Y4SA 1SCUB 1D1PA 2QSJA 1SKQA 5CLGA 5AQ1A 5CB4F 1CZOA 2A59A 1S96A 1OA1A 2OWDA 3L7CA 3LQ2A 2DG2A 4BO5A 3PUVA 4S1VA 5AK5A 3U9SA 4OX9Y 3ORSA 1PNQA 1NBHA 1QJ4A 1YCFA 4JXJA 2XNDD 3C5WP 5J2TF 1BMDA 1D2NA 2GYWA 2RCYA 3ZD6A 5HCIA 4HWGA 3W2EA 3MWGA 3ZYCA 1TPYA 2QUJA 1FS5A 2CUZA 1E1DA 5B1YA 3KSBC 1IM2A 5D3MA 4F3NA 4EG1A 3N9IA 2B83A 4WXEA 2JGKA 1XYGA 4JP2A 1KI7A 1IXKA 2AD5A 2QQ0A 3NEPX 4LY9A 3WHKA 1Q0LA 5B4VA 4DAEA 1K8ZB 2WABA 5J5CA 5T6MA 1RYNA 3P4YA 3OPXA 4QG7A 4UDYX 3T9FA 1EUCB 4FSHA 4EG5A 2CLCX 1MC1A 1FXSA 3OIFA 3STXA 4F8JA 1FVXA 1XRJA 1P2UA 4FCTA 1FP4A 4C4SA 2A0KA 1U3UA 4WESB 2I6FA 4LDZA 1P0IA 3LGSA 2DKFA 2NOAA 2R8XA 3GELA 1E2HA 2ZDHA 3I2FA 1VI6A 3FSEA 1JWLA 3X1YA 3GUHA 3FZEA 3LPNA 1L4FA 1Y3FE 3M9WA 2ZB3A 4J4TA 2B94A 2XYRA 5EUCA 3T34A 4FEGA 2O8FA 5KHAA 4D9EA 3PRKE 4HZGA 5K0SA 4HSEA 1XMSA 1UKAA 1ZKDA 3DZKA 3MTIA 1OT5A 3D7KA 3LUPA 3IEKA 2X14A 4P22A 4YECA 1ZW6A 1ZRHA 3UT5A 3VO1A 3PXXA 1JFVA 2PTGA 4AFNA 5SYAA 1PQ4A 4FONA 3NIDB 4JLOA 3RAFC 5CNIA 3T52A 5HKOA 4HDSA 1AX9A 4IS2A 3WWEA 2JK0A 3NJ4A 5DM4A 3MWEB 3O8NA 3QVOA 4S1PA 1DMRA 4L2IA 1Q1GA 4XSVA 2FWBA 1EXMA 1C3OA 1GVNB 2MU1A 3TNLA 5KNCH 4AN4A 5JS2A 1Z75A 2HA5A 4JQOA 3EJ6A 5CIWA 2MR5A 4MA5A 3W06A 1ZJJA 1U2TA 2WHRA 2XQFA 2WA2A 3DWGA 2R7NA 3OQVA 1LSSA 2QK4A 2RKWA 1QBGA 4QQKA 2GCEA 2A7QA 2ZEJA 4XPZA 4E07A 3RRFA 2CL6X 2CNWD 3T3PB 3EUAA 4AW9A 1QDLB 1E2GA 1ND6A 2ZU6A 1KR2A 1A9QA 3H8VA 3ZD9A 4GMXA 2VF4X 2Z9BA 3SF8A 1IN7A 3DA8A 1N9GA 3ZVRA 4M1TA 2I2BA 5DNUA 5JT1A 5FWXA 4I6GA 1A95A 2D8AA 2XZDA 4DR5B 1Z9BA 5LBIA 4E0BA 2IEIA 1IHUA 3KVYA 3PD7A 2B9EA 3FLEA 3LUKA 1CBUA 1FFHA 3INYA 1Y8QB 4RPCA 3ZHBA 4NXNB 1SG6A 1KYIA 1TZKA 1KTVA 3UA4A 3VR4H 1TCBA 2C2HA 1Z2DA 2ZWVA 3JZMA 2UYHA 3TQQA 1EK6A 2I54A 2UZ0A 1XO1A 3NIGB 1T3ZA 2ZITA 3V9AA 3KQUA 1UAAA 5AVJA 3K1TA 1SCJA 3IS3A 3JQBA 4IIUA 4GOJA 2IF0A 2CSUA 4Q3CA 4Q0MA 4YWHA 5KB3A 2RHDA 2Q3CA 1LF0A 2O7NA 3E1GA 3ZE9A 2IY7A 1U4OA 2D2IA 4HOYA 3T95A 3OIVA 1OXKB 1TQHA 3WK5A 4MQ4A 4D3SA 1S0UA 1VOTA 1W581 4PFKA 4V2UA 1NVVR 3EF1A 1CR0A 3L0PA 3L0DA 4P33A 3SIRA 3U56A 2X0KA 2JFGA 3I32A 4G5QA 1C7EA 1Z38A 3VRHA 1TRKA 3IQFA 5DHFA 2Q3HA 4CIVA 5CTJA 1XPJA 1CHDA 4TYWA 3FYCA 1KNXA 4Q1EA 1E94E 2CHFA 2EKBA 2H8GA 2HV9A 3EIFA 2C8KA 3RYIB 4GSLA 2GVDC 4FEAA 3LK6A 1ICIA 5EJMA 4MVYA 5JWRA 1FP7A 2C59A 5HVNA 3I5XA 3U4QB 2QTTA 4GBJA 3EIHA 3KU4A 4L4YA 4UAGA 3EFOA 3ZNPA 3LUHA 5JNWA 4BU1A 3QZUA 4MQLA 1YRAA 1UWCA 1YDHA 4I6JA 1N9ZA 3WJAA 4DLPA 3R23A 1W47A 4ICIA 3PTLA 1U3FA 3UHOA 3GWZA 4D6PA 2J5RA 1AA6A 3VVMA 3DBRA 1N1MA 1VLLA 1W52X 1NV8A 4DL9A 1XL1A 1MDBA 3RVKA 4EOGA 3DBHA 2DCUA 2XUZA 5JS1A 4U5XA 3FR7A 3SZLA 1OXBB 4F6RB 1MC5A 1XQWA 5FL3A 3ZDXB 3FKJA 4CEHA 4GXQA 4IV8A 4W5HA 5JFTA 5EP4A 1GTL1 2H57A 1G18A 3ZJTA 4FDMA 2NZVG 3ACDA 2QU7A 4RSMA 1H4VB 1EVYA 2V7VA 3PTZA 2BBWA 3PXBA 3QFTA 4PXSA 4RPHA 1SIBE 2P2SA 4Q93A 2GEJA 4M55A 3DDUA 4Q82A 1NP7A 3DB2A 3URKA 4UU7A 1JB9A 2OB1A 2Y0EA 5LR6A 1BXZA 4K6HA 5HJEA 3RSZA 3I12A 1BKDR 2BCGY 4NNPA 1SU7A 5JNLA 2VJPA 4XKJA 2B8NA 4D82A 1EP9A 3PUWA 4NBVA 5DGTA 1ZXXA 5HEKA 4JBIA 4OXQA 4WX2B 3G2HA 3DHWC 4PR3A 3ZVLA 3ZW7A 3AW8A 1XVAA 2PZLA 3RUAA 5JNSA 4LE1A 5EZ5A 1UM8A 4OV6B 2R751 5DBOA 3PFHA 4ALLA 5HIJA 1Z7WA 4QTTB 3O4RA 1FXUA 1EHIA 1KOFA 4J76A 3NBFA 4NIMA 1NHGA 1P5JA 1Y4UA 5C0OE 4AWXA 4TPKA 3VISA 3NHKA 5KDOA 1F5SA 3AUXA 1EXWA 4JYBA 4O4HF 1V71A 1C9YA 3ROMA 1U28A 2RK4A 5JQWA 3DP9A 4OB8A 4PGAA 1YA8A 1P0MA 1P5RA 1ZRNA 4ZQHA 5TPZD 2VA9A 1Q21A 4OM7A 4RA6A 5A3SA 2IHVA 4RGQA 4P36A 4BBJA 2GAFA 1W76A 3U3ZA 4I1PA 5T41A 2XDYA 1F4PA 1V2GA 2YXNA 1VIVA 1ZOIA 1X1EA 5E2AA 3VDMA 4D5EA 5JAHA 1QH1A 1W5FA 2W2XA 3CINA 2C7OA 3VNSA 1B3RA 5E1MA 1TYDE 5FPYA 4N8EA 3T9BA 3CPJB 4YRGA 4N76A 4PG4A 5A5EA 1KDRA 3UMJA 4N6GA 1HGXA 3B2QA 2DWUA 2FGJA 1ZLXA 2JBAA 2AJCA 2PQ0A 2I33A 3CN9A 3I53A 1U7WA 1XTPA 5A4FS 1NN0A 5IAKA 1V6CA 4G65A 2MDTA 4OQDA 2P90A 1UQRA 5CDUA 3H17A 5B4TA 3L92A 2PWAA 5AJZA 1FNSA 1V11B 1FTWA 2ZZKA 3QYAA 1EUDA 1GKLA 2W6MA 1Z07A 3KOYA 3KKLA 1PJQA 3MIIA 1R4MB 2ZM6B 4ENWA 3E3OA 4JXKA 4LGMA 4ZHQF 5B4UA 1MVLA 4M6WA 4OGFA 5D87A 1G1MA 3PUJA 4EUKA 5JSZB 2W2NA 4IHJF 2GF2A 2JLRA 2W48A 3O7MA 3ZHQA 1GKIA 1C0PA 1PTKA 2R1TB 1CJKC 1QG6A 3COWA 3NRJA 3D3NA 1K08A 1V4NA 1E1MA 2NTEA 1NFFA 3M6VA 3LXUX 3NGMA 4NARA 5KYVA 3T1OA 3TVYA 2ZUBA 4BLPA 1NWCA 5BRJA 3K70D 5A04A 3TXAA 3GN2A 2A30A 4YUYA 4R5MA 8ADHA 5ESXA 1NXSA 1NJSA 5CH5A 3TFQA 1NSTA 2EYUA 1BDIA 2GM3A 3NCHA 3KJXA 3B53X 4QPNA 4RLFA 5DLQC 3WIDA 2OCYC 5E9JA 1LQUA 2ZSHA 4CG3A 3H4TA 2VDUE 3C5VA 3LCCA 1EJ6A 2D0DA 2UVQA 1BDJA 1Z88A 2WWFA 5J5AA 3GLHE 3TW4A 4YHHB 3BG5A 1PGJA 3EZ7A 3ZGVA 4ZJPA 4NCXA 2JLBA 2D1QA 5LXTB 3HYTA 3IBFA 3H7IA 5DBHX 2AL7A 2FOIA 2W2MA 1MKYA 2QD1A 1BHQ1 2YOFA 5BN5B 3BX1A 1MQ8B 4QA9A 4WFJA 4PNEA 2BGWA 3GFVA 3PPVA 1V48A 1V7ZA 1M0TA 3DOFA 4Q1AA 4TRJA 4BVLA 1OWNA 3H0CA 3OI7A 3G9QA 2EZUA 1X19A 4OMUA 4YUZA 3ICWA 5ADVA 2QJOA 1IHPA 1LXCA 2RH8A 1SUCA 2ZTHA 2YIMA 1YRBA 1TNDA 2CFOA 1SVOA 3IAFA 4RF5A 5TEVA 3TDMA 4GPAA 2ZK7A 4G63A 4U5QA 3ZEAA 3F0TA 3VNQA 3LECA 4PRKA 3OM8A 1M8JA 3L4SO 3ETEA 3U40A 1M2VA 2QM0A 2R4QA 5BQ5A 3CVOA 5KQGA 1RJ9B 1T34A 2CJWB 3KDSE 4KTVE 1E6LA 4HVAA 2BI7A 1WMBA 2GEFA 3CF6R 7MDHA 2GZ1A 1Q2UA 1GZ5A 1L5MA 1ORTA 1ULSA 1MAAA 4GL2A 1YCGA 4MWCA 2FH5B 1A7KA 1QM5A 2NW6A 5IJZA 2XITA 1V16B 4X6YA 1GPDG 2FA9A 5JAIA 5KWIA 5CJJA 3RYCB 1BD3A 2UVDA 4E2ZA 2DB3A 1ECPA 4R84A 3W6ZA 2H0RA 1HXHA 3DLCA 3ZE7A 3MJFA 1DX6A 2E49A 1JTVA 2I76A 3ZI4A 2JIRA 4PGFA 2DQ4A 3VH1A 1QGED 2WYUA 1NX6A 4DIUA 4ZYXA 1GQSA 1HL3A 4QT0A 4C78A 4D8XA 2WIBA 4WNYA 1UPAA 4X92A 3A1FA 1K2WA 1WF6A 3PT5A 4C08A 3ND9A 1SBCA 2VF5X 3G9UA 4DQUA 1RJ9A 3D6HA 3F4LA 2VK1A 5FR1A 4ZZ1A 1SKAA 2RI6A 4QHSA 2DBRA 4YJ3A 5AVOA 1QONA 1AQIA 4ZDJA 1GCAA 1LH0A 4ZVQA 3T5TA 1W2WB 3NYWA 3D81A 4RJTA 2QD2A 5E2BA 1IATA 2FPIB 4LJ8A 1G8HA 3OTQA 4IKPA 4RMGA 4UEWA 1OHHD 5HQ3B 1A5BB 1G41A 4TWIA 4FIDA 2AMYA 4AC9A 1IL0A 2PUTA 4LX8A 3WNCA 1XAJA 4RSGA 1O9HA 2J5BA 1YZLA 1ZONA 3OESA 3FZGA 5H59A 1J2EA 3QWFA 1B3BA 3TIIA 1RRVA 4EIWA 1LS1A 2D2EA 4LBYA 4G24A 1JN0A 3K9WA 4M8NE 4TTPA 3WBBA 1BZYA 2JGMA 3ZI7A 5KCMA 1NYRA 1F12A 2HZBA 5CHEA 1ENOA 5FOVA 2NXNA 3RI3A 4BKPA 2ZI7A 1YE3A 2HIHA 5E4YA 1GG8A 3KWMA 3HA7A 1IH8A 5AJHA 2X0IA 1PUXA 1WDTA 2XZOA 2FE4A 4PO1A 1P60A 3GFOA 5FL7A 1LK5A 1K7FB 3K05A 1NU6A 3RSOA 3ESAA 1NMZA 3DFKA 4DVGA 3GLFB 2L42A 2DULA 1W5AA 2XUQA 3C7DB 4W63A 3CZRA 3GLGB 1VBMA 3MMZA 2P9GA 5ALUA 1KZHA 3HXKA 3DEAA 5KOHA 1O0SA 3ONNA 1K7XB 1RWXA 1XNJA 2VRBA 3WK4A 5BOSB 1VIAA 1XCBA 4MUKA 3RRZA 3E3MA 1PQPA 1OAOA 1Z15A 5BVHA 2B6NA 3VC1A 5DHTA 3WLFA 2QTVA 1W4CA 3I01A 2J46A 3G59A 4ZQCB 4IF4A 3UT0A 2EX0A 1DVRA 3REQA 1L4BA 2CY0A 3DE1X 4RH1A 4URFA 1A9YA 1VPLA 2E48A 3KLPX 4NULA 1AZWA 2C04A 1SUFA 1TF7A 3TDNA 4UKDA 2R96A 3H5RA 3T1NA 4P3KA 4WNAA 2GN0A 4C87A 1U4SA 3CV3A 4ZO4A 4TN5A 2GPTA 4N5LA 2ORWA 3I8OA 3IBCA 3NEYA 3O8BA 4Y2PA 3RFCA 3V48A 4NPHA 3ZTYA 4F3RA 5C2JB 4PINA 2GT1A 3CF0A 3GQBA 1E9DA 3TW6A 1ZVJA 1QZTA 1I4DD 2D5BA 3AUUA 1RZRD 1KOGA 5AHRA 1GP2A 1ZMRA 3PF8A 3PVCA 3TZ6A 1HFKA 3G7SA 3WOHA 4A0GA 2QTFA 1DKMA 2QJRA 4NYIQ 1C3VA 4OU4A 3D4NA 4CTOA 5IWCA 5IWAB 5L3SB 1NC1A 1I7DA 5FEUA 1G20A 3IOYA 1E3WA 2FXIA 2Q9AA 3OP1A 2O8DA 3CRZA 4IBOA 2BUCA 2J7PA 3PQ3A 2A86A 4EEZA 3UCXA 2BH2A 1BS9A 3GEHA 3JAWB 4KFRA 3N5KA 4BBZA 5JXGA 3JD3A 4I4IA 1DCFA 3VTZA 4CU5A 2D6FA 3CR7A 2G9ZA 3DXYA 2H08A 4GUDA 3UMCA 1O5OA 3BERA 4CM6A 2A88A 2O7SA 3QPAA 2NAPA 4FYVA 4CI0B 3OHSX 1BU5A 1JFFA 2ZI6A 1S8AA 2X0RA 4JT9A 4QUAA 4TTQA 3V33A 2NO6A 2E82A 4E7OA 3IBYA 1B8OA 4FBMA 1QKKA 1RM0A 2YMLA 1KMNA 4LCJA 1KOLA 3M2TA 5AW5A 4NU5A 3UJ7A 3DF7A 4IL5A 1KC3A 2PZMA 1R9GA 1Z6ZA 1QHYA 3M0EA 4J91A 1T2NA 3HRIA 3OJLA 3T5GA 3FR8A 5JZMA 5JVDA 4RF2A 1ZIYA 4KWEA 1NASA 2VBCA 1KVRA 3ILXA 3TJZA 4M88A 2AH5A 1CRZA 2QF7A 4LSGA 2AI1A 2ICAA 3TLEA 1ZPDA 5C7LO 2GPAA 3BD9A 1H23A 4IJ6A 3PEFA 3WGIA 4OKIA 4QGFA 4GWLA 5FJIA 2PMFA 2ZRKA 4W5OA 3LW8A 1Q19A 1NI4A 3HDJA 4YV0A 2ZUCA 1JFFB 4R0NA 1OU0A 4TTSA 3ZGXA 2WFLA 3AL3A 2BMFA 3A32A 5A9SB 3HADA 4CIAA 2Q0SA 3IT2A 4X1YA 4ZVMA 2DETA 3M6LA 4LYEA 1H3EA 3R3SA 1NM5A 5DTRA 4LXXA 1KARA 2ZSDA 3P0JA 4DPKA 4DQ0A 7ADHA 3VOSA 1ZM3A 2PZFA 5ALNA 1F2UA 1K6EA 1QANA 3ETNA 4LJLA 4R40A 4KPGA 1I2DA 1E3LA 5H16A 4DPLA 1NULA 4GVPA 5HBRA 2VZ0A 3GDOA 1W4RA 4IUYA 5FADA 3TAHA 3WLLA 4WCFB 1UP7A 5AUPB 1FRNA 2R7KA 3AYXB 2JLWA 4RPLA 4JXXA 4LCEA 3HXOA 3GGJA 4NEQA 3DV9A 2WE7A 1PJLA 4C4XA 1GITA 1MO6A 4Y2JA 3RU3A 3OM1A 1E5QA 3F4BA 1Q0TA 4EI2A 4AZ0B 1OSNA 1PDWA 1Y9JA 4OYHA 4TSFA 4JA2A 2DFTA 1TLFA 5BNZA 3FN4A 5CT4A 3Q3HA 5GZ3A 4Z1MA 3U3OA 2C5LA 4Y6PA 2ZDGA 3D1LA 4K9MA 5FQNA 4BP1A 4DLBA 3DCJA 1E4EA 1MH1A 1EVEA 2AC4A 5DISB 1EIWA 4WKOA 1R5BA 1T4CB 3P8ZA 1Y1LA 2OECA 4K6GA 1LVUA 3CKKA 3OE7D 3IIEA 5AHOA 1H65A 1ZWKA 2A0FA 3H3FA 1HI9A 4HNRA 5TB5A 1ZYUA 1VHWA 4XFDA 4F06A 2AN4A 2JW5A 5E38A 2IU0A 4IDDA 2CE7A 2JHFA 2OCDA 4JC4A 1T29A 4HRAA 5BORA 1WBDA 9ABPA 3TPZA 5JYDA 1GAWA 2E37A 1JVBA 2XBLA 2VP9A 4DLLA 3KR1A 4NZNA 2ZYAA 4FOOA 4F96A 1IAVA 1UT6A 1PR5A 3PHBE 4MMXB 4DJJA 1UBEA 4FHDA 4RAQA 5HNKA 2ZZMA 5B58C 2GCIA 4BQNA 1FFSA 3C6ZA 1SUPA 3N8HA 4HH4A 4RFSA 2F9FA 3W0LB 4MMZB 4CLHA 5JRJA 5DW0A 4P8RA 2JFVA 1FE8A 3THYA 2X9NA 1ZAYA 2VNIA 2QNBA 5U1PA 4MP3A 3CCCA 1AVTA 2HBZA 2NSLA 1UEJA 4MGKR 1Y9ZA 1WKBA 4TLEA 4TTIA 1JYSA 1M9NA 3HYRA 1P9NA 2G4VA 2MWMA 3CE9A 3NHPA 5TR9A 4EF4A 4CQMD 4CMKA 4S1NA 4OQZA 5K0NA 4ND3A 3DC7A 5AK6A 1HWYA 2JFZA 3HNPA 4OHFA 1QIFA 3VSEA 1ZNWA 1NQ5A 2A4KA 4Z7QB 2Z1MA 3IESA 1E96A 1VLQA 4MW1A 3SX0A 4XJVA 1M75A 4Z3DA 3EGDA 2HYIC 3A9TA 4ZEXA 4B3SB 2R9VA 2VDVE 3PQ7A 2PGJA 4KLAA 5AICA 2L17A 5FNVA 1SD1A 4HWRA 1II8A 2ZIAA 3LVBA 1PV1A 5IJXA 1NSYA 4DLRA 2J3JA 1QLJA 3VYRB 2IPOA 2VATA 1JBEA 1JHQA 1X1RA 1MABB 4I50A 1MVNA 5EE9A 3ICEA 2CLOB 5JWHA 2NO0A 3OCVA 4J7UA 1TADA 2G82A 1FFBA 2YFYA 3EZFA 4MGYR 1UKCA 4PSCA 4UC0A 4GYKA 3RVMA 1UPFA 4IH9A 3WKAA 3WWZA 5AKXA 2ZRIA 4B8YA 2HMWA 4EW2A 1I2ZA 1N6IA 1YZNA 2XUOA 3GEPA 2VXOA 2MINA 4KK3A 3O4JA 3GF4A 1FUEA 2AMFA 2XA2A 2D4AA 3OLYA 3PP8A 2PANA 4ZV7A 5B1DA 5ES4B 5IVKA 1C7FA 5FWYB 3LPLA 2AXEA 1IFXA 4HNGA 3K9BA 4KMRA 3BKXA 4OLHA 2Y1DA 3D5QA 4GZ3A 4YQYA 4ZCLA 4IQ8A 5IC5A 3ZJ4A 3O1IC 4WK2B 3W2HA 5D3KA 4B5KA 2B98A 2FUEA 4M86A 3OTWA 1SCDA 2GSWA 1RJFA 2AW3A 1CQPA 1OXVA 2Y2UA 4KI0A 1NVAA 4JN6B 5CFLA 1AMNA 1H2AS 4Z9AA 2OHFA 2GBLC 1FTYA 2PRZA 3DVAA 1NVTA 3WGGA 2XHZA 4MEBA 5AD1A 1R0BA 1Q6ZA 2WWYA 2I2XB 4RVCA 1M1ZA 1W2HA 4PO3X 1GPMA 1RQPA 3PFBA 1KS9A 2C0PA 4HQRA 4KIJA 2FDXA 4KXYA 1D6NA 4Y2QA 3SQNA 3IAAA 3MRXA 3TBKA 1ZC3A 3WE7A 4AN1A 4EQ6B 2XT6A 1HT3A 4OB7A 4TV9F 1E7WA 4M53A 4MQEA 3S68A 5CX4A 1L5QA 1RP7A 3QLTA 2QG6A 4FZ5A 2FCAA 3BGSA 2ECKA 2QLBA 3IUJA 4HDRB 3DMNA 3K2QA 4WBSA 5EZYB 1G7RA 3U7RA 1R1DA 2GRAA 1GKYA 1RHRA 4Q7JB 2DT8A 3AZPA 4JVNA 5GY7A 1L8LA 2B7BA 3MPUA 3UT6A 1USWA 1KH2A 3WDSA 5SZHB 4ZK6A 5BSTA 4DYDA 1AGNA 3AERA 3CW2A 3F5QA 3GH3A 4RIFA 2YYAA 1RAFA 4O5OA 3WFZA 3OOHA 4I4TF 1TK3A 2B1GA 4LHYA 2Q1UA 4Z5XA 2XV1A 2VBGA 5CT8A 3O3CA 4L8YA 1DAHA 5EE1A 3R0IA 2FV8A 2WM9B 3E84A 1J22A 4LAFA 4JK3A 2Z6AA 2A5LA 3R44A 5ECYA 4ESVA 3FJYA 5AI9A 2F8MA 2F43A 3FIJA 2GKGA 2INGX 1JYEA 4P35A 5DI3A 3V1YA 3WQSB 4ZVUA 3IXMA 4R9NA 4YT4A 1G2OA 1NJ6A 3NH9A 4PZYA 3DQZA 2PH3A 2FB9A 2XYHA 4IZIA 3E27A 5FUYA 3P2YA 2AE2A 2FW9A 2J09A 4CEIA 3O4VA 4KU4A 1FF9A 4BB9A 1GCIA 4YRKA 3K6SA 2MOKA 3B6KA 2AC7A 5JD4A 4GQBA 3M4JA 1GRRA 5H0IA 4HAWA 4ND8A 5KPJA 5IYZF 3I8XA 4M22A 3URMA 4DR7B 4G5SA 4C89A 1I6WA 4EPWA 4N03A 2IXBA 4EM6A 1DWUA 2KWIA 4ON9A 3BWYA 3WLPA 2CUNA 2GH1A 2O54A 1BJRE 3PL5A 3CTMA 4M1ZA 1DT3A 2WAAA 3T3GA 2QRVB 4QM7A 1L5HB 4KR6A 2PL9A 3GP5A 4ER6A 4WOKA 4OYLA 3CMMA 3BIXA 3ETDA 3ZGNA 3PUKA 1XEWY 1Q1AA 5JCOC 4HPJB 1NE2A 4W6QA 1KIFA 2P6NA 1KYYA 4BMYA 2JASA 1B0ZA 3K9CA 5I7WA 1WD5A 1ZIOA 1QFJA 3HLKA 3N87A 1J24A 1KZ1A 2H7VA 3HJRA 3SNKA 1ZUNA 4KLNA 3ZX4A 3ZVKA 4CQNA 2XUKA 1OFUX 3AF3A 1SVIA 3R0JA 3UB3A 1KAEA 4NH4A 2ILTA 1N0UA 1YZGA 3SX4A 3EDMA 2H06A 4HDKA 2QAJA 4M1OA 1CJTC 4MQFB 3A9RA 4BNUA 1SK8A 4IX1A 3FE2A 1MO3A 5L53A 1X80B 1G5PA 5ES3A 4G25A 4TMXA 2R8EA 5DN9A 1L9KA 1QGOA 2OZEA 3KZXA 1JHXA 3B9PA 2GNPA 2PLAA 3BIOA 2WV7A 3PA6A 4MNTA 2HTEA 3LLUA 4YP7A 2RGEA 3IPCA 4TWRA 2ZJBA 4JC0A 4FFNA 3K2EA 1EX9A 4N40A 5AJXA 4KR3A 4MULA 2WTBA 4PIMA 3RLFA 3ZW8A 1OBFO 2G8LA 5TQ0B 1D07A 1XI2A 4J0FA 4B4KA 4U8HA 1IHYA 2HSDA 1V8BA 3HHPA 3M6MD 5LQSA 1WP9A 4C0XA 1H3NA 4TYPA 3OX1A 4XXHA 5L8VA 1B74A 3VR2D 3D2LA 3T7SA 2GEVA 4ZEVA 2FUKA 4ZT3A 1JGTA 1LZLA 1OH7A 4IUCS 3DB1A 2XMZA 3BQNB 2R62A 4N49A 5E1DA 4M36A 3ZJYA 3WAJA 5FORA 1GEEA 2NU7A 1KO7A 3QK7A 5BV0A 4KLZA 1F1BA 5IAEA 2ATEA 3QEKA 1IRXA 3IXLA 3CRVA 2I6GA 4QDKA 5FWDA 2FX3A 1X42A 5CA0F 2V1UA 3LBHA 2HIGA 5DBIA 3TNJA 4YAOA 3FNBA 2R8RA 4QOGA 1W8DA 2B2XA 4QXQA 4CEJB 1K6IA 1TQ2A 5IXYA 4PWZA 3RS7A 1X70A 1BCRB 4JEHA 1C7QA 1N3YA 2KI5A 2WUDA 1EIZA 2O06A 2X2OA 2Z8YA 5EHNA 3NUZA 3W1EA 3H6GA 4BRSA 2HJHA 1OYOA 2Z2IA 2OGUA 3MJDA 4K3UA 2FX5A 4AJNA 4E46A 3UWDA 1XX6A 2C61A 1OLSA 3VFDA 1TIPA 1DJLA 4KUGA 4KL8S 4LBVA 3IEMA 1HPLA 1RWBA 3D8RA 4O2BB 4DNXA 1OBOA 4EYEA 5A3JA 2HLPA 1ST3A 3JAMA 2I2DA 1N57A 3Q3CA 4XWKA 4GLFA 4L5YA 1P1RA 3WX0A 1T13A 2DQSA 2FVXA 4XGKA 5EWMA 4RY9A 1TVCA 1BYIA 1KEEA 4HLUC 1KS2A 3VDRA 2IKSA 1SA0A 1GLNA 2BR5A 4XDYA 4BN4A 3TCNA 5GGXA 1QF6A 2II6A 2VAXA 4LQDA 3GLIA 3P1JA 2WMYA 3BQ9A 2JGNA 4BNHA 1QHNA 3H05A 5KX5A 4DPMA 1SVNA 5GONF 4RKWA 1IXYA 2Z8XA 1ZGCA 2YVKA 3U4MA 3E6AA 3GFFA 4IGKA 1F8YA 3OUTA 3NEJA 1AH2A 1HZZA 2XXAB 2A67A 1B1AA 1Y4AE 5CUQA 3UJ3X 3WK8A 3WGOA 2A1UA 4CIXA 5EMMA 1C8LA 5HKKD 3UXHA 4LC9A 2ZM5A 1LDBA 3E9MA 4WOPA 2XMRA 4POAA 1ISFA 1CTQA 3CNBA 3HVUA 3EEFA 4MEAA 5ALDA 2ATXA 3TMYA 4J4HA 1XYYA 4GPD1 2PUVA 3I4FA 3WG9A 2E6KA 2E5WA 3MFYA 5C81A 4D7AA 1DARA 2F4VB 1P2FA 4WJKB 4FFRA 1S8FA 4HDNB 1JAZA 3GRCA 4ZMBA 1L3CA 3I6QA 3SEQA 1VM6A 3TLGB 2Y6UA 4HUJA 4M1EA 3RV3A 2ZWIA 3NDPA 3TRIA 4Q3NA 2IYRA 3V2UA 1JECA 5HFAA 1F5NA 3T9DA 1WX1A 1K4MA 2HJRA 2PX0A 3K6KA 3KL2A 3M1AA 4NH0A 4ZO7A 1TYCA 3TZLA 3K2BA 1WU8A 3PUXA 3JQ9A 2LCQA 1Z4IA 5IDXA 2QM8A 3K0FA 3I34X 4HH0A 1DFGA 2YNMD 2QPTA 3R3ZA 3IALA 3Q8WA 4H3HB 4GNRA 3AVQA 1JIJA 4O4JB 4Y9DA 3WZLA 4ATNA 2BEUB 5GONB 5T4EA 1J0DA 1CG6A 3IV7A 1YDGA 4JJZA 4L6AA 4MVJH 4AF7A 4D99A 4H3KB 4A5OA 5KTOA 1OFTA 5JXIA 3KXPA 4RTMA 4IW3B 2PFGA 4NOKA 2QRHA 5LYYA 5CM8B 5AIBA 1EWTA 1AY0A 4YQZA 4C7BA 2RGDA 5DBFA 1LJLA 3JATB 2RGCA 3FCEA 2JA2A 3G7NA 3H2JA 3QMWA 4KQ1A 4YYZA 1RQ2A 1P9WA 2VDJA 4IIBA 3PV0A 3UBMA 3EFEA 4K9OA 4GS5A 1MAWA 3B12A 3C0KA 1ECLA 1XMVA 3E2PA 2F3RA 3R3UA 1O87A 2G6TA 1P7PA 4KI7A 5D1HA 3EVFA 4ZD6A 5JHGB 1B26A 5JDIC 4KLRA 5LP6B 4HZIA 2VJLA 3DZCA 2PFSA 1ZEJA 2QTGA 2JD0A 2QV0A 2JJ2A 2R44A 3SSAA 3HYLA 4M9SA 4OJTA 3N2IA 4RY0A 1P4AA 1NNLA 1PD1A 4R0MA 2OK8A 3BMQA 3Q15C 3N39C 1T9DA 2CDCA 2OC9A 3I6YA 3LG2A 2JVIA 4EITA 3QELA 2VYVA 3SQOA 1SUEA 2J3DA 3K9LA 1ZH4A 1C0LA 1M0WA 4RPJA 1EZ1A 1ONOA 3QXCA 4R3UC 1FDRA 4E4TA 1P1IA 3DXFA 1KYVA 821PA 3TSAA 1HSOA 3ASZA 4YT8A 3ZQKA 1UANA 4UHCA 1X7WA 4H77A 4L4XA 3BOSA 5JPCA 1Z8NA 2IYSA 1TM5E 4F9FA 1ZN9A 2BOVA 3BN3A 2GD1O 4X6UA 2Y68A 1SXJD 3UN1A 3ORQA 4F4HA 4XPIA 1I3MA 4GEGA 4C4RA 3RD5A 4CT4B 3CURA 4H0FA 1ODSA 4M9XA 1YDFA 4Q37A 2JLCA 4YO7A 1N1DA 4CF6A 4UBMA 2ZSEA 3P20A 1HFWA 4CYMA 1UC8A 3I5MA 1PNRA 3E18A 4R51A 4B3MB 3GGDA 4MUJA 2PMEA 2GJ9A 2PEZA 1XTKA 1IZ8A 3LUGA 3CLHA 3F8WA 1EU1A 5CGQB 2HDNB 1I4TD 4S1TA 1YH3A 4X41A 3LUBA 5IM4A 4PYLA 1UPUA 3N2GB 4KRYA 4B8WA 1AM4D 1G4UR 1K7EB 4FT2A 1TCCA 3RC3A 3Q7RA 4G36A 1RS0A 5CURA 1N4DA 1RM3A 1ZBDA 4JUFA 1P0PA 4KXFB 3CJRA 1T35A 1BOOA 2QE7D 4Q16A 3EARA 4WKNA 3V7FA 3G23A 5D86A 3VHLB 2O8BB 4FYYA 2EFJA 4MRAA 1CR6A 3LTEA 3DYIA 3UJ6A 5ALZA 3BMNB 1E1NA 5HOEA 3MT8A 4DVJA 2HFJA 3COSA 3V4PB 3QP9A 1LLFA 4PYKA 1SY7A 2PO5A 3W5VA 1RWNA 3HDYA 1HFJA 1MUUA 1SQ6A 3GZNB 3JD4A 3OFJA 4GT1A 5FKJA 1NBOA 2FSPA 3G0BA 3MCVA 3OZXA 5A02A 2GMWA 1R10A 4NZMA 1IXZA 5DX1A 4EUHA 3FMPB 3FGPA 4NZPA 3FHCB 2NV2B 3HN7A 3RK4A 1FTSA 4X97A 3GAFA 3W5HA 4J43A 1IOVA 3NBQA 3OFNA 4PC6A 3ONFA 4ENSA 4QBHA 3KQLA 4YDRA 1XTTA 3IQIX 2AYYA 1Z5PA 4K88A 1Y80A 2PXAA 2ZUDA 5ILQA 3TCKA 3U1BA 3U7GA 1XB2A 1YFKA 1GNLA 2O2SA 4NPAA 4AO6A 4E13A 4IFEA 4EJ2A 1JF8A 3DLPX 1CUBA 5MN5A 4EO4A 1UZUA 3UTDA 1WF3A 1GFWA 5EJ2A 2XAUA 5FOTA 4AG3A 3CEJA 2ZBFA 1ECCA 3B89A 2WIKA 2P0EA 3GA7A 1DFHA 1GV0A 2IT1A 3VVLA 1W19A 1FLAA 2YFHA 1EUYA 2WD7B 3COVA 2XE7A 1GG5A 2IHYA 2VWGA 2YWFA 2WB4A 3RIHA 4FFBA 4F91B 2UUCB 4OG2A 5CXUA 5HJ5A 3OUUA 1YE8A 3THXA 5KIAA 1DC7A 1KO4A 5FI3A 2ZWPA 4JJGA 5REQA 1O97C 3SHOA 3UGQA 2BR3A 2QN1A 1I5EA 2P67A 2YYSA 2CLFB 1GCUA 2D00A 2ZTLA 2IDJA 5CHYA 4AY5A 5CFPA 3C5CA 4J0HA 4LHVA 3S2YA 5J4KA 1AQUA 5EKXA 4HH1A 2FG5A 3OCYA 1BXGA 2I7CA 1CE8B 4KDRA 4NMHA 2AZTA 1TU0A 4MKFA 1N7HA 3L40A 3CCFA 1W6RA 1SXJC 1E2DA 2IYPA 3C8DA 2F1RA 1G64A 1F8FA 4U2EA 4NCJA 1R8QA 4QU0A 2YASA 4KDCA 1Q3HA 2N47A 3X1XA 4ZHQA 3T7DA 5F4ZA 1J1ZA 3A3YA 3VTAA 1RC0A 1LBTA 4WLFA 3D3WA 1V37A 1G3UA 3DPIA 5DEIA 3L7DA 3N1UA 3IHKA 4Y18A 3YASA 2Q4RA 3NVMB 1IBMB 5EESA 3PQCA 4B48A 2DERA 4M9RA 5FTJA 3KYDB 4ARIA 1C3OB 2PV7A 2WPNA 1RT9A 4LYDA 1KYTA 1J49A 1Z62A 5HP4A 1QK3A 1QRTA 3NZEA 3HCEA 1YJQA 1X15A 1Z3CA 5ALFA 5KJFA 1A69A 4FYHA 4M21A 1O6FA 1JQLB 1JR3E 2JEOA 1GL6A 1QNLA 1P6XA 5K8VA 2RJNA 2VDWA 3EXIA 4YRNA 4B6QA 2C54A 1ISSA 2WIDA 5AVWA 4OJKA 1NLYA 1J6UA 4PVCA 2F8TA 1TUBB 3NHMA 4AMGA 2PWYA 5BSKA 1FDUA 1KK2A 2K87A 2ZDQA 1WABA 4UU1A 1KQNA 4JLJA 1ISPA 4MKIA 1AURA 1K27A 3AB8A 3WBKA 1LBSA 2V6MA 3IUSA 4PGHA 4RWEA 3VU3A 1N5RA 1WEHA 1DTWA 2NXJA 1ZJWA 4WCFC 3HMKA 3Q5EA 3UFBA 2OUIA 3CNNA 2O7QA 4RVFA 2Q5CA 3CEMA 2PJZA 3R6GA 4Z1MD 5K0BA 3C4QA 4LEIA 1VZ2A 4YRFA 1AJEA 3DNFA 2ZJ6A 3TAXA 2IXGA 1L5FA 1DQPA 4MB6A 2QAGA 4MV6A 5C5IA 1OIVA 5IM5A 2NUAB 3LZDA 1X0VA 2ZJ4A 1VZ3A 3R5SA 2NSDA 3K9GA 3L7BA 4NG4A 2J9GA 5BVGB 4MJ7A 2VT6A 5C1BA 1QRSA 1U0JA 3DDSA 2HT6A 4LCBA 4TSFD 1ISHA 3U1TA 1L5ZA 1F8XA 1EINA 2IF2A 3H2BA 4CNQA 4DCNA 1JG4A 2WLSA 3RUIA 2E89A 4PRZA 2C42A 3LUFA 1V6AA 3ICQB 1HQKA 4EGFA 4JI2B 4J0CA 2FPUA 5A9RA 4YBZA 1JA1A 3FOWA 2VXYA 4LSZA 5F76A 1IZYA 4KCGA 4OEHA 5KOJA 5CR9A 3LUDA 5BR7A 1YOVA 2QRPA 5ALHA 3TJMA 4C2TA 5I9LA 4UM8B 4B46A 4WVFA 1C81A 4RM2A 5B57C 4IOLA 4OSPA 4YJHA 1Z73A 1NMYA 1R8SA 4YXWA 4LJ6A 1M8FA 2B1IA 3KUXA 5EEHA 5THKA 4KPFC 4EJFA 3WGJA 5EEGA 3LP5A 3SM9A 2QPAA 3G89A 4P58A 5DM70 1BGVA 1T9ZA 3PHCA 2GF9A 1OKKA 2Z0MA 3EIOA 1UK8A 3S2FA 1YGYA 3AY3A 3FOZA 1O9GA 3FLBA 5HF6A 3M5DA 2XBMA 5EAIA 1LV8A 3GLHA 4AVYA 1WJGA 4YRLA 2AYXA 1VB5A 3OT1A 1II8B 1H3FA 1T5LA 4EYGA 3ZWYA 1H93A 2ZREA 1J21A 1E2NA 1MAHA 2J1LA 2ZQZA 5LA6A 3F4KA 2QRKA 2B0JA 2IPNA 1XNGA 5A71A 2JANA 3LTNC 1O96A 1J1IA 1K98A 3EIEA 4IHAA 2EIHA 4M89A 3BHIA 3KUCA 2VYND 5KQSA 1OBCA 2R6HA 2VRWA 4QT4A 4MS4A 1DKLA 1Y8QA 1B2LA 3FYUC 2ZI5A 3I3OA 3KM0A 4GXRA 3TUZC 3D5EA 3UVEA 2ZIFA 3GLQA 3JARB 2FR1A 1MZPA 1CJBA 2ZE5A 4QIHA 3EJWA 3RUCA 3JQGA 1VSTA 4G1FA 4KSYA 3T4UA 2EP5A 2VP3A 1TZ2A 4TS1A 1SM4A 2WHEA 1NNEA 2VBFA 4NFSA 1I30A 4BFSA 5E1BA 4UATA 3QIVA 3UHJA 4GRDA 1Y3HA 1XZIA 4DY6A 3KXLA 3OZUA 1D6SA 1Y6RA 1ZN2A 5IJ0B 4HV4A 3HN6A 1JV2B 3GEMA 4GP9A 4MV9A 1DSSG 4Q9IA 1YRHA 2J9XB 4DEVA 4CQLB 1G3RA 1L8XA 4EBFA 3SKXA 4AU1A 1Z45A 1KYWA 2IBMA 4EQ6A 1NTOA 3WO0A 4EDFA 3DE4X 3RRYA 4N5IX 5DX8A 2VNAA 2X19A 2NT4A 2QQEA 4IJUA 2AN3A 4L8FA 3CKLA 5BN3B 3FZNA 4RA6B 3SLKA 5K6RA 4BKQA 2YZ7A 5DGCA 4YIHA 3LXRA 2I4LA 3H11A 5C8ZA 1SB9A 1GUAA 1YR7A 3CR8A 3LQ4A 3GHHA 4PQRA 3CB4A 3MMSA 4UDNA 4NESA 3ZXSA 2JLSA 2W8BB 3VPXA 3I9V1 2VDRB 4EY3A 3VHQA 1C0EA 3F9CA 3K0EA 5FA6A 1DAIA 2PK3A 1HZJA 1OX4A 2PKYX 5GV8A 3MXOA 1IUNA 1YVEI 1NXVA 1T2UA 2QR5A 2REQA 4A82A 3IKJA 2ZYUX 4JC8A 4HP8A 5E6RB 2SNIE 5HGJA 3RF7A 4KW7A 3U7IA 4LMRA 4A0RA 4E5DA 2D1TA 1HETA 4TUYA 2VN8A 2P9YA 2YN4A 4KV7A 4DDKA 2CBGA 2UZAA 3ECCA 1TJ3A 5ALQA 3VYVA 1W1UA 5HQTA 1MP0A 4RZUA 3H9UA 1IUPA 4F0JA 2W7TA 5DRTA 1I6MA 5H9WA 3OE4A 3EEQA 3KSMA 3LU1A 4PPQA 2NP6A 1GPNA 4M0DA 1TF5A 3V1LA 4KKVA 1ZM4A 1ZD8A 3ZY4A 3KALA 3ZH9B 4ACBA 3IP1A 1UIRA 1BXKA 3HNRA 4W9MC 3ADDA 2ZTSA 3C7CB 3C97A 4PS1A 2B35A 4JFAA 4LY6A 2FKNA 1G3MA 2AQKA 3O83A 2Y1GA 4MW6A 5KYNA 4N0MA 2HN9A 3OZSA 3RCBA 3STYA 3C24A 4J9UE 5FUBA 3QMPA 5JW6A 1SBIA 3PWZA 4QSMA 5H81A 3INNA 1E7RA 3IKVA 3UHAA 2JLVA 3EZ9A 5K9ZA 2DC1A 3I9V6 2ZRNA 3RTAA 4CKXA 3MJEA 3VPAA 1HDIA 1EJBA 2VHXA 1RAEA 1SOAA 2ZBRA 5IXSA 3R8FA 4Z53A 3V1NA 2ZG6A 3T7EA 3HCBA 4AIRA 2QN6A 4RXUA 4NBNA 4ZO6A 2R79A 4HWPA 4UUMA 2PMKA 2D7DA 3KWFA 4A03A 1PDOA 1E9CA 4I4CA 2VHYA 3OQ1A 3D31A 4J7XA 2J31A 2YYZA 1Z12A 4C14A 4E2FA 2FMIA 1HKUA 1J07A 3QMVA 2IHUA 4IYRA 1FIUA 3ZDRA 3CSSA 2OLKA 3ZKWA 5KSWB 4FVTA 1ORDA 3DMHA 3UXMA 5KTYA 3PGXA 2BIFA 1KKLA 2X5JO 1NKSA 2DVMA 3L04A 2O2DA 1DBPA 3EFBA 4R9SA 5F1PA 3B7WA 4BFWA 3D7NA 2UXCB 4PTZA 5EINA 1URPA 2HIAA 1VLJA 3SWWA 5FUWA 1DEKA 3OCUA 3CX3A 5B2ZA 3SDSA 3WAKA 3UQZA 4DUPA 1YFJA 2W58A 1SVMA 4YX9A 2DKNA 2N1BA 3OO1A 3P71T 4GWKA 1XTUA 2R84A 4NABA 1OXTA 4I1UA 2GN6A 1BFDA 2HMYB 2W6IA 4RCZA 9GPBA 5IANA 4HEA1 2O0HA 4DIFA 2E4WA 5EIXA 4LDPA 4KFCA 4V0RA 5AW2A 1U9IC 1N2ZA 4PLHA 2FHSA 2YJ5A 1JKFA 1OLXB 1X38A 4PG5A 3I1JA 1YKFA 2B82A 1NLUA 2XB2A 3S28A 3TPCA 2EGHA 3A6DA 3TTYA 1EVLA 1C9DB 3B3QA 2XYQA 3TKYA 4W8OA 5AJTA 3N6XA 5D7NA 3SSNA 1TU4A 3G2MA 4WZAE 2Q4DA 5AXBA 1O7JA 1QC5A 4EARA 4K26A 3J7TA 1YB6A 5CFZA 3SJCA 1Z4PX 1VA5A 1ORRA 2PVSA 4QOJA 4B75A 3SQWA 1SXPA 2DXIA 5ALKA 1ADFA 4LVCA 3ROFA 3E5MA 4YT5A 1XK6A 2ZXEA 3K94A 4FFVA 3V7NA 1YQ9A 2ASEA 2CHGA 3K0CA 3FVWA 3AT1A 1IRIA 2AN5A 2AR7A 2PCLA 1B43A 2VWHA 4FSDA 4GR9A 3PFNA 3FPGA 4JDPA 2BEUA 5U4QA 3VJLA 3SHVA 4CE6A 1VRVA 1CQJA 1Y3AA 4ZYVA 1M67A 1TYEB 5IJAA 1I80A 3HCNA 3K0HA 2WAXA 3RGWS 4UTRA 1JZSA 3TTUA 1XQXA 3KCQA 2G1KA 3ZWAA 4YUWA 1AMUA 3FROA 5AXAA 4B3RB 1NMSA 2CDRA 4C3OB 4FGZA 1SBQA 4N9QA 3U16A 1CKEA 3KP1A 3I9OA 2V3WA 3H97A 2Q4EA 4LRWA 1QZ3A 1ULZA 5AI4A 4FR5A 1GNVA 1LQTA 1KBOA 3BD8A 4R0VA 1WCWA 2CXQA 1MO2A 2LP4Y 4J1TA 4BMXA 1B0AA 4RANA 4JHXA 1GG2A 4IVQA 4O2LA 2G67A 5T8KA 2B5WA 4FLEA 3NHFA 1DMSA 4EP1A 5A5GA 3PGVA 2XXBA 2J45A 5FO1A 1U7HA 2O1EA 1M6NA 1YD7A 2ZJ7A 4PZDA 4W9NC 1FU4A 4H60A 3FFAA 5B3AA 1J7KA 1HA3A 3AL2A 2O57A 3ANYB 3F8TA 3OTHA 4XDHA 1JTFA 3RG2A 1NY5A 1Z7YA 4Y6LA 3BHNA 3KELA 1I7SB 3E7WA 4BPRA 4PYIA 1E1LA 1A2QA 2C5FA 3NDRA 2CD9A 3CONA 4L50A 1AF7A 3F2IA 4MX8A 5KU1A 3IMFA 4G6ZA 1CERA 3QVSA 1JIKA 1H22A 1LWOA 3IPRA 1PU2A 3AEUA 4IINA 4TRMA 5FD8A 5GJVC 3WNZA 4B9EA 2A1UB 4QODA 1H6BA 5CYGA 4JQCA 2GYVA 4Y6RA 1JRLA 1A7JA 5E0KB 2OY0A 4PGGA 3S3TA 3DM5A 4ZC1A 5LUAA 1PFWA 3RHSA 3SY8A 5DM60 2W90A 4JI4B 1R0RE 1V5IA 3KQHA 1SKMA 3OTOB 1DKPA 1UODA 5EXPA 1NU8A 1QK4A 4LHEA 1SU6A 4NATA 4QQFA 3ZKWB 5IJ9A 2QRQA 4OFBA 4BWVA 1SC3A 2P1ZA 4H7JA 3MELA 1R0WA 2P91A 2J3LA 4LE2A 1AN9A 5CVEA 4PNHA 2NLOA 4PQFA 3EG9A 3EULA 4BEBA 1WXFA 3CVWA 3NJ8A 1ZM7A 5KJEA 3UXEA 2I3ZA 3BB1A 2O3SA 4NDZA 3A2NA 3NPMA 3OF2A 1GGVA 5KJ1A 1OI2A 2NXCA 3LHKA 1CK4A 4AYWA 4FD3A 5I9BA 1PV2A 1GNRA 1GN8A 1QV9A 5EXTA 5IT9A 1OW3B 1W93A 4UM5A 4QGBA 2ZSBA 2MT9A 1NXXA 3ZHXA 1U7DA 3WKCA 3ZS9A 2JLXA 2UUOA 3VKUA 4RACA 2BMDA 4KIGA 4JJ8A 2R7LA 1H9AA 3RVSA 3ZUGA 1Z36A 4I3HA 1NP3A 3EZLA 3H5OA 2XMPA 3JAWA 1STOA 2WJVA 4Q12A 2C7QA 4FNGA 1PN3A 1FMCA 3IIIA 4U6SA 3T61A 1XQ1A 2BLNA 4A8TA 4TMVA 1W36C 1UBOS 3KVOA 1PGQA 4BNNA 1MPXA 5ALLA 3RC1A 4ZK2A 4NU0A 4YRRA 2OD2A 5AIAA 4JYZA 5LMUB 1JHPA 1XAGA 3W7AA 4N7JA 1AZTA 4YCLA 2QRZA 4TGLA 4MVJE 3F6CA 3CVVA 1EJ0A 2ZW9A 5IHXA 4KNWA 1A9RA 1OASA 1UR5A 5ALWA 3AIIA 1Z0SA 2IEGA 4HWSA 3IE0A 4HEJA 3OAAD 4YJ3F 3SJAA 5BR4A 3A3OA 3DT6A 1CS4C 1VKOA 1GZ7A 1H6CA 5D8DA 4EB6B 2DY1A 3FM9A 3KBBA 1AKEA 4RD3A 1W7AA 1P7WA 3F7MA 1GYQA 1ABEA 2BHLA 3HZOA 1G7SA 2ZTMA 4ZQFA 1QQ5A 2IXEA 5FIUA 3V3KA 4IDCA 4PLFA 3ORYA 3EQ8A 1IIBA 4RVGA 1X2EA 2XCQA 1E9SA 4A7PA 2QJFA 4ZCPA 4YMHA 2E5FA 1PR1A 5BVHB 1XLTC 1B0UA 1JJVA 4GO1A 4CLRA 5JNTA 4LJKA 1H42A 5E6UA 2GPNA 1CU1A 3GV0A 5AKZA 5E4TA 1EFVA 2VP4A 5A5FA 2DUMA 2R48A 4B3BA 4P4TA 4P4GA 1PRYA 2OV4A 1NNI1 5EE0A 2IYOA 1TJ4A 4ZICA 1Y9AA 1DAGA 1G2IA 4OO3A 4R2XA 4CKBB 2GQ0A 4MB0A 3M1YA 2JVJA 2EJUA 4FXOA 1U9YA 4K6KA 2FSGA 3IXQA 5IUKC 2XADA 1FRZA 2RKOA 1F2TB 3ZN2A 2X8AA 1FFXB 2PLWA 2GILA 3LHDA 1BWPA 4LOLA 3SF8B 5CBPA 1TFRA 1L7MA 2XZPA 3B36A 5D2CA 1PVVA 1U04A 2HHJA 3AEKA 2E4YA 5J47A 4PWYA 4E33A 3MTBA 3R7LA 2XGJA 2XGOA 4OCZA 4F72A 5AP9A 2E5LB 3QHPA 4NNOA 4NMLA 3H1BA 4H35A 4LNUB 2BSQA 2AEEA 1KYXA 3FSRA 5I9MA 3AHCA 4RD6A 2AHRA 4GR4A 1L7DA 4WN3A 3LPAA 3LS2A 2QLTA 1PWHA 2B4QA 1ZK3A 2Z6VA 3VTKA 1WMDA 4NCIA 5EGNA 3H5IA 4Q6BA 4QQNA 3PVSA 4A0HA 3WGYA 3S5JA 3HHEA 2C95A 3N0WA 5AO9A 4N5HX 1XMPA 3INTA 3AG5A 1WSBA 3M6UA 4NI5A 4ZANA 3A6PC 1IQRA 1SZJG 2XTMA 4Z0NA 1IULA 1UFKA 3WGUA 1A9PA 3ESBA 1T25A 1L8OA 3HKCB 1IHOA 4YMTA 2OYRA 1JPJA 1A98A 3AY7A 3GLHB 1DQZA 4DLTA 2YDXA 1NVUQ 3BFXA 3FWZA 4QJ3A 2IH4A 1JLLA 3GNTA 2JF0A 5FCDA 3C3XA 4HRVA 4UXIA 2G7MC 2B8EA 1GGMA 2QW0X 1KEPA 3GK3A 4I81A 4JL8A 5DF1A 4EKNB 1GU0A 3S1AB 2W43A 3NETA 3LPDA 1EDZA 1X7XB 4I08A 3CJQA 4EHJA 1VG1A 3CEHA 3S8EA 1MIOB 2R2AA 3BVPA 2PUHA 3LQKA 1BJKA 2RHBA 3VU8A 4TL6A 2OZKA 3FWNA 6PFKA 4BC0A 2QZJA 4GOLD 3KT6A 3QTBA 1W88A 2P4QA 1EJ2A 3WB9A 3W05A 10MHA 1EWQA 2PKCA 2QTLA 2HU8A 4UM9B 2B99A 5DCWA 2FJUA 3CIFA 5HIKA 3H42B 1CEQA 3NHJA 4LZPA 4B85A 1CUDA 1WPGA 1ULAA 4Q9NA 3RT9A 1E2MA 1XRPA 2D5CA 3P9RA 4RVHA 5J2UB 1CETA 2O2ZA 4ZAXA 1FX1A 1UFRA 1K0UA 1HQCA 3ZK8A 5BVGA 2XMSA 4D45A 1M8PA 1I4LD 3BWEA 4IGIA 3TLYA 1DINA 1E2LA 2IUFA 2ZUWA 3IVAA 4EELA 3B1JA 1X1DA 3J81A 3DHNA 1ZVVA 2ZBUA 3ZDFA 3VDQA 3E35A 1PK8A 2GFHA 3E4CA 1CFZA 3CHYA 2CC2A 1SCKA 4XB2A 1W88B 3HXPA 2O20A 3PGMA 2WG1A 3BMXA 1UJ6A 2WWVD 3K1JA 1T3SA 1N0VC 3E5HA 4CZ2A 1XD9A 3IEPA 4RK1A 3HB7A 4DA6A 2V65A 1QTRA 3DOOA 4ZP1A 4B81A 2ZB4A 2B25A 2BFDA 4CN9A 2P6UA 2O2EA 4O6VA 4Q21A 4F21A 1BHJA 3SS9X 3B38A 3ZCPA 3MJCA 4MLPA 1JEYB 3QVJA 4R83A 5T64A 2OMEA 1TUBA 2A92A 2ANBA 2W2VA 3KPJA 4R9RA 5FBZA 1D3AA 2Q5IA 3PXUA 3K9QO 3NHAA 5EIWA 1JDJA 1ATIA 2HMVA 2P9ZA 2VQSA 3BGWA 5JXWA 1NXTA 3D2BA 2I3BA 3RUHA 3GO4A 4EDHA 1UM9A 1R6XA 3LOUA 3CA8A 1ZMOA 2AXNA 1BMFD 4KQ6A 3DZDA 1TFUA 3AVVA 4LJYA 3CGGA 3ROTA 4BS9A 4KQWA 4HGNA 4WY2A 1E1KA 4HVLA 2O0KA 1K0FA 2A94A 2B69A 1TCVA 4PCLA 5DKFA 2FEMA 1ZESA 1LC3A 2FZVA 3I0NA 4KYVA 3GCZA 4DWOA 4AI6A 4FZJA 3MS2A 3WDLA 4C0AC 3CUTA 1PSZA 1XXHA 2B2NA 2IELA 1Y6FA 3QTLA 3PQ8A 2BEWA 3U49A 4BJ3A 4EMSA 1SCAA 2YIJA 1N78A 5IKPA 1A8PA 4MQFA 5LSAA 3WLRA 1JAYA 1G9TA 2BTEA 2YTZA 2R7MA 3NB0A 3V4OA 3FTDA 1V95A 3CTPA 1XVTA 1CP2A 4JCOA 1W35A 1L8QA 2IYUA 3VPBA 5J23A 3AL0C 4PONA 3A0RB 3LFHA 4UBIA 3AC0A 4DV1B 1A9SA 1CY1A 1VBFA 2JZNA 3MCAA 2Y4OA 4DR3B 1QYWA 1MNQA 3K6RA 3PCRB 4QASA 2OOSA 3OFND 4YRJA 2J5XA 2LTAA 1GR0A 1V25A 2H4XA 3BFPA 3O03A 1EFPB 4PG6A 1EFRD 4GX0A 4KQEA 2JCVA 3L07A 3NR2A 3N2EA 4MIOA 4MR8B 1ML4A 1S2NA 4FQ5A 5K51A 3WZ2A 2WIFA 2XMCA 3FB1A 1QWOA 2I1WA 3BWDD 2FZ5A 1WQ4A 3I2GA 3Q7QA 3HR4A 1QTQA 2M6RA 4PQGA 4R8KA 3SVLA 1ZVKA 4L15A 3UAZA 2FZCA 2NZ8A 1XRQA 1XZDA 2BI8A 2BH9A 4L28A 3OX4A 4MWEA 2X7JA 4PHGA 2W6QA 4MRSA 3UUEA 1D4AA 1XMOB 3T3OA 4P4SB 2YWHA 3H1FA 2IBTA 2FPGA 5CT6A 3PXDA 3TUJC 4QXOA 1L4NA 1ZUIA 4INZA 4W1RA 3RUDA 1J33A 3S40A 3TFWA 1SUDA 3MCUA 3CLTC 3UJBA 3TAUA 3T4XA 4DNQA 2ID8A 4AO8A 3H13A 4L95C 4RVUA 4D42A 5C18A 1CVRA 1FP6A 1Q1QA 2IUYA 3OKAA 5AI5A 3N05A 3AF2A 3EK2A 2D1FA 3HFGA 5K2MA 2H52A 3W6PA 2WM3A 1JL3A 1EWRA 2X0EA 4R7GA 1WHTB 1XOIA 3Q6IA 4HSGA 3RREA 1AUXA 4NZ9A 2I4RA 4KAAA 1AKWA 3UV3A 4RK7A 5AUNB 1PT6A 2J3MA 3NRBA 1XEFA 2AZXA 4DCCA 5DXFA 1XDUA 1R3DA 1MG5A 3D2AA 4ISCA 4OY3A 4X1OA 3DZHA 2ZUEA 5IMBA 5EZYA 4O1MA 5KHLB 3D9QX 2YC4C 4L6IA 4P81A 3UKJA 3ZZ0A 2V54A 4JOQA 2PWPA 3DMGA 1IJBA 1OZFA 2WKSA 3HA3A 4ZCQA 3VZSA 2D1RA 4D4LA 4DLNA 3M83A 1CUIA 3OICA 4HUQA 2HYDA 4C6TA 4YJGB 4DNFA 2YOGA 1QPBA 1GTJ1 4JBLA 4PNPA 1FYWA 3TLJA 3ZHYA 5B2EA 2Q99A 3PE6A 1C30B 4CQLA 2H7CA 2Z4RA 4UUPA 4YTEA 5IM4F 4YRDA 4OMDA 1QP0A 4M7RA 5KYYA 3PFCA 4LZJA 2VSFA 4BRZA 1VL6A 1O89A 4F86A 1XAHA 1BAPA 5YASA 2B0CA 1R2QA 5DU2A 3UPDA 4IR7A 3L7KA 2RH5A 1NE7A 1Z6TA 1R6VA 1RHKA 2ATIA 1A77A 2DP4E 2HK7A 3LX6A 4Y9UA 3DOHA 3TI7A 3UW3A 1UM9B 1BQ3A 4TQUS 4V0OA 4AJEA 1LSJA 4QREA 5IVHA 4RJJA 4BXOA 1X8JA 3G8YA 1FVHA 1DOHA 3KAJA 4RDIA 3IJEB 1XMQB 1X74A 3MWDB 2DBZA 4EG3A 1Y1RA 4UQPA 3I6BA 3V4RA 4GRIA 1MD9A 2Z3ZA 3B52X 4EKIA 4MCIA 3O31A 4U1RA 1NF2A 3BUSA 3H4VA 4RZIA 1OY1A 2I6SA 3MPOA 1Z74A 3K1AB 4PM4A 4XIJA 4MGZR 4XJXA 3AVXA 4KXVA 1JPUA 5P8WA 2SBTA 3P2KA 2B34A 3MTEA 1Q22A 3NKFA 2NXEA 2O4UX 3HUFA 2NZYA 3STWA 5IT4A 3K5PA 1GIAA 1T5SA 1IQUA 2QVBA 3AM4A 3CUEF 1X7ZA 3PS9A 5EIAA 2RAPA 2FWRA 3UY4A 3OWXA 5B55A 2V7EA 5AJYA 3DDNA 1U0SY 3B6EA 1X8KA 3FW1A 4CDNA 3ZBQA 2I22A 4YJ3B 3WBFA 2IOFA 4J16C 2PL5A 1LLQA 1Q83A 2WT8A 3WTBA 5CB0A 4UE3S 2I80A 4C4AA 2ZIEA 5ICSA 3A4NA 2NNLD 1ENZA 1I9GA 1IHXA 2GN9A 2VJQA 4GX2A 4MPRA 3A1NA 2AN9A 1LGYA 3C45A 1L2TA 3E70C 2YS6A 4HTAA 2Z9CA 3H87A 1OB5A 2HAEA 4NU6A 4OVKA 5K2OA 4K2AA 5TIIA 4DLSA 3FJ1A 3PPYA 3EGXB 3H2HA 2IKQA 4EEKA 1X7YA 1VFNA 5BYJA 2I8CA 4YUXA 4A2CA 2ACEA 3FF1A 3OBIA 5MF6A 4BE9A 1Y7TA 2LDBA 1VJCA 4AY3A 1QG4A 2EL9A 2FPXA 5TT1A 3CT6A 3LMKA 2I65A 4QUBA 3OSUA 2R00A 4HYEA 2C7VA 4CR8A 1Q0RA 3FNQA 1YI0A 1I3CA 4R5HA 3G9XA 1DKOA 4L85A 4D79A 1V1RB 1VRWA 2GA8A 4Y6QA 1SXJB 1INLA 5KYUA 4MW7A 1DIGA 4YPVA 3PRJA 2YJ4A 4AJJA 3CMCO 2WHQA 3IT1A 1VXOA 4ERNA 1FK8A 2Q5QA 2DLCX 1FNCA 4QTYA 4UMFA 3IP6A 3II6X 1S6YA 1ECBA 2V58A 3L0IB 3LCUA 4CG1A 4D56A 2IWHA 2BDTA 2PQMA 4DUGA 5LQKA 1Y42X 2XF8A 2OCPA 1DL5A 1UP4A 3VAAA 1JHAA 1H2WA 2BTQA 2GBGA 4G26A 1AGXA 4CCWA 1E7QA 4DM4A 4UMVA 5TF4A 4AZSA 4D4IA 2BHTA 3DEJA 2XBUA 2GK3A 3I39X 4M4SA 2WBLC 2OKGA 1WULS 2JBWA 2XF2A 4FP9A 4EUNA 2PY6A 3BREA 3W2TA 1G9XA 1N2CA 2XE6A 3R0ZA 3LFUA 4D98A 3ADOA 1K97A 1JJ7A 1FP1D 4F60A 3WRVA 4YR7A 3NT4A 4OBWA 4DLAA 1TM2A 3ELBA 2C57A 4Y1EA 1WZIA 4FYJA 3GD7A 3QYFA 3FKSA 4MMYB 2ZJ1A 4IGFA 1KJIA 1Y3DE 2QDKA 2CEKA 4RZXA 2IYAA 1A7UA 1KVUA 3HVIA 1U2QA 2UUBB 1Y98A 2W2LD 2ZI3A 5DJ5A 4B3CA 3NMUF 2ZYGA 3BXPA 4MLCA 1NL3A 3BIFA 1RI5A 4S1WA 3KKPA 4B5LA 2F1JA 3V7UA 2HHCA 2GWHA 3JQEA 2PX4A 2PTHA 5TF0A 2OGTA 4DV3B 1M73E 1GL7A 3NIBA 1ZUHA 1ECGA 4XM2A 3SBDA 1DKQA 3ZUPA 4CWAA 1IVSA 1JR6A 1NG1A 2VUSA 2O8CB 3NGLA 1GV1A 3M5CA 4PSDA 3AFIA 3GJZA 3LY9A 4XLZA 1YQQA 4F3TA 4DQVA 4ITUA 1H94A 2NV6A 4ZMSA 5LQRA 1DNPA 2XB9A 4QO7A 3Q5DA 5L3QA 4Q6WA 2G08A 1G1AA 3DEKA 3P0RA 1Q0UA 1TT7A 3EODA 4KGXA 4Q3EA 5E9QA 3RSQA 1DIBA 1R6TA 1FFXA 1OMOA 4I8XA 1T8WA 1U7XA 3GBVA 3VOAA 3LBNA 3AHDA 2Q2QA 4O33A 1N6OA 5IS2A 4OOFA 3VAZA 4P5DA 3RUPA 4AN0A 2OP1A 1ZY2A 3QX7A 4QGHA 3BORA 4ZOAA 3JAKA 2OHVA 2PX6A 3NX4A 4E14A 2GS9A 1ZA2A 3DEYX 2ZYVX 3VR2A 2PU7A 4CTJA 3ET4A 1N2HA 5JPIA 4ZYUA 1NF8A 1XV5A 1QGZA 3KZNA 3LE8A 3PNPA 5GVSA 3FCCA 2I4TA 1V47A 2QGZA 4QU5A 4EUSA 5KVAA 3M6XA 1JHMA 2ZSKA 2AW5A 4GMKA 1HDZA 3USES 2AUNA 1G55A 1R9JA 2NYAA 2JFQA 4KPYA 1XLVA 3DYVA 3ROKA 4LFAB 4OD0A 4NBRA 4WASA 4CFSA 1M34B 2PZ8A 3AHFA 3NXSA 4YLEA 1G8PA 3GLTA 2JKVA 1UKVY 4WLOA 1K6MA 4J03A 1EVIA 2NMVA 4KR0A 3F1KA 4ENQA 3MUOA 3P9NA 4V38A 3Q72A 1W96A 2XRMA 3FMVA 1G16A 4IXWA 1G5QA 2IA5A 2BJWA 4LGCA 4LYGA 3I1FA 4NENA 1T5HX 3QOFA 4KREA 1XTRA 3I76A 3HDVA 2BFOA 5EJAA 3ZHZA 4I7EA 4RQTA 1DKNA 1KZ9A 1KY4A 1Y81A 4D02A 1KP3A 4B73A 1V1RA 1EZZA 3HZHA 1L1EA 3VI3B 2YHBA 2BV3A 1E5TA 4L0DA 5BR8B 4ZREA 3RJTA 1G59A 3W9YA 3HA5A 5ED0A 5G1PA 2G5CA 3ESRA 1TM1E 1H2FA 4CXMA 3LBAA 4U0KA 2IW3A 2ODEA 2WC1A 3AEQA 4G0ZA 3FXAA 3KQPA 4KVFA 4NX2A 2OXIA 4G0UA 1L5LA 1JZTA 4BJHB 4EX7A 1HH4A 2TMKA 1VMDA 1N2EA 2DWQA 3MYYA 1TM4E 1AHHA 4AXXA 1RI3A 1U2GA 2X41A 4G85A 1JHUA 3EUWA 1NBMA 2FVYA 3X2FA 1RRFA 2JEYA 3I5UA 4RIGA 2Q3DA 2HQSA 1H9BA 1B76A 3HL0A 3W4IA 2XB6A 3K20A 1B6GA 4WLUA 3NDIA 5TMPA 2BGJA 2PT9A 3IEVA 3O4FA 1NVKA 4GECA 3HVHA 4UE6A 2ZXUA 3UK0A 3QKUA 4CMGA 4Z3KA 3NCTA 4JH0A 1BEUB 2OORC 4LC1A 1L7NA 3A70A 4XSGA 4MCJA 4MAFA 1G38A 4EI8A 3WGQA 2EGUA 2P75A 5FV4A 2ZTUA 5T6BA 2FPLA 1FSPA 2FFAA 2JB9A 4N48A 4IGAA 2Z04A 3RS9A 1OCEA 5F5XA 3IBTA 2I7VA 1P1CA 3IVRA 5JATA 1YZVA 2GCOB 3MGGA 5KI6A 3DMPA 3SBOA 1JQ5A 4NP6A 5FJJA 5BV8A 3JQBC 5F7ZA 4EHAA 2CNOA 5C8VA 1C14A 3KQYA 5FULA 2LZ0A 4EZBA 5JDCC 3HJBA 5JYBA 4R16A 1SJ9A 3GA5A 5LYJF 2PZKA 3HM9A 3GEGA 5BSHA 4L74A 4IO1A 3ZE2B 3QHQA 1C7JA 3ZV6A 1RLJA 2HJGA 3QNUA 5DZSA 1LTKA 2QRMA 4OH1A 4GYYA 5DHAA 1CFJA 4JQYA 5JWOA 4MV3A 5FOXA 1CIVA 2WP8J 1LFDB 1QU3A 1ULTA 3IAUA 2H7YA 4EFKA 3NTXA 3ZIDA 4N0QA 4FE4A 4L07A 1PSWA 1ZUD1 1U98A 3HBNA 1TQDA 2WHPB 3G2JA 2Z9DA 4A16A 4GZ5A 3W9SA 5I5EA 3MEQA 3PB3A 3HGQA 4B7AA 4N7RA 2CHEA 2A5GA 2Q0QA 3EMKA 1P6QA 3OPMA 4XD7D 4AB1A 3W5AA 1W48