2Q2OA

Crystal structure of h183c bacillus subtilis ferrochelatase in complex with deuteroporphyrin ix 2,4-disulfonic acid dihydrochloride
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
307
structure length
307
Chain Sequence
KKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSACSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase
publication title Porphyrin binding and distortion and substrate specificity in the ferrochelatase reaction: the role of active site residues
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
total genus 116
structure length 307
sequence length 307
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q2oA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2q2oA02
2PO5A 2XVZA 3HCPA 2H1WA 2QD1A 1DOZA 2PO7A 3HCNA 1L8XA 3GOQA 3HCOA 2XWSA 2XVXA 2Q2OA 2QD3A 2C8JA 1C1HA 1N0IA 4KLRA 2AC2A 4CCSA 1LBQA 1TJNA 2DJ5A 1QGOA 2AC4A 3HCRA 2HK6A 3LYHA 2HRCA 3M4ZA 1AK1A 4KLCA 4KLAA 2Q2NA 2XWQA 3AQIA 1HRKA 2JH3A 2XVYA 2QD2A 4KMMA 2QD5A 4MK4A 2H1VA 2Q3JA 1LD3A 2PNJA 4F4DA 2XWPA 3W1WA 1C9EA 2QD4A 2HREA
chains in the Genus database with same CATH superfamily
2VYQA 1M0EA 1TVEA 1OLXB 1V7ZA 4RVFA 4Y7CA 2HF8A 1FNCA 3VU0A 1K63A 1NJ5A 2PSEA 1ZR2A 1W5SA 1DOHA 4UJ5A 3D7NA 2AK2A 1DX6A 4LRQA 4QC2A 1PJ4A 4UDOA 1IEWA 2GN1A 1U1FA 3QEMA 2DFNA 2PA0A 3O03A 5AUOB 5I51A 4WADA 4WFJA 1GPH1 3LYLA 3THRA 2NO7A 4D6PA 3AM1A 1PS8A 1E94E 1SVMA 3E1KA 3NKVA 4MWDA 1KDYA 1TW3A 2GM4A 3OVMA 4F92B 2WHYA 4B6GA 1Q11A 1NRJB 3L40A 2UUOA 1XB2A 4AMYA 3RIXA 4YHHB 1R8SA 3IIEA 3NHJA 4PU0A 5GJWC 2F1IA 1K4MA 3E18A 2G1JA 1ZJZA 3DO8A 3OZAA 2QLJA 2R6ZA 2CD9A 4IDHA 1HETA 5E3IA 2NU9B 1TX4B 4OXRA 4PX5A 2H3HA 3PENA 4GDMA 2IXEA 4HZUA 2OPBA 2JGLA 2Q21A 2GZHA 3TUZC 3KJNA 2KLBA 3V8EA 2IZ7A 1MFZA 5JXGA 1M8GA 3V34A 1CD5A 3C6MA 4ZZ3A 4QQNA 6REQB 1ZJWA 1S1CA 1FCJA 1P2VA 1Z34A 4K3UA 4MEBA 1PV4A 3B3QA 3DV2A 4TMTA 1V4NA 5KYXA 1XQXA 3DE3X 4LXXA 2R6CA 5B2EA 5L4SA 3I28A 4GPZA 2WKQA 3N2LA 1YJBA 5FTLA 5KTPA 1WM1A 3DYBA 3A4TA 5DN9A 3LQKA 1F6DA 1W46A 3UFXA 4C1BA 1DJLA 3N6RA 4S3MA 4A5OA 2Z2IA 3ZWVA 3AJDA 2QNIA 2FZ4A 1Y0BA 2AIRA 1K8ZB 2AZDA 3K6RA 2QAGB 5EP2A 1U8ZA 1KSFX 2GPNA 3IHKA 3LHKA 3SBEA 2X9LA 4GX2A 3FFWA 3EWNA 3DW3X 1FP1D 5FR1A 2QRHA 5JDCA 3WNCA 5IX8A 4NJEA 1ZCZA 3PGXA 2ZUSA 1XROA 5AI5A 4MINA 4CTNA 1UBGA 5TRTA 5TS3A 1UBUS 1IVSA 2QF7A 4GP7A 3RSGA 2Y71A 1TZ2A 2XT6A 3QBVA 1DLJA 4Q3LA 3IS3A 2HADA 4M6WB 1Y4SA 4ZT4A 1TO6A 3KDPA 1PGNA 1G2IA 4Z2YA 2P78A 4P54A 3U9LA 1Z6YA 2FN9A 4NBVA 5IAKA 1FZQA 5FPTA 1PZMA 3PJEA 1I94B 4M9XA 4GFDA 4BCDA 2AH5A 4DC1A 1P75A 4F1KA 2FRDA 2XVZA 1II8B 3I6MA 3KTAB 4REMA 3TPZA 1AZTA 1I7NA 3QGMA 1BW9A 4FB5A 1L7QA 2A0YA 3CIOA 3W1VA 3A4VA 1UWLA 4EG7A 1IUKA 4Z4CA 4WNYA 4KFTA 1PWEA 1V6SA 4PC1A 1NUAA 2QI9C 4MWCA 3UPUA 3PT9A 2Z1DA 1GYQA 3VYWA 4GICA 1DJNA 3W5CA 2UXCB 4NQRA 1S1MA 5K8TA 1EM8A 5BW5A 4MH0R 1Z3CA 3HRHA 4XXHA 1U3GA 1LJ8A 1Q6YA 2FMIA 3QVKA 4XDHA 5LKAA 5H68A 2L17A 1XXHB 1JAZA 1SUWA 4Z54A 1F17A 5KQPA 2CMGA 5A6SA 5IKXA 1UCFA 3OQHA 2A9PA 3H2GA 3HKBA 3Q2OA 3GGSA 2O07A 3GEBA 1PO7A 5CB6A 2VUSA 1N34B 2GCOB 3PNPA 4MUIA 2BF7A 1K89A 5BMVB 2A1TS 4OKNA 4WCVA 3VO9A 1Z38A 1T9AA 1L8XA 2GD0A 3GUZA 2YZ2A 4IJWA 3IPXA 2ABWA 2H4FA 4M86A 5AYVA 1BVHA 3VKHA 2FUKA 3F8SA 5IM5A 4ENUA 4PAMA 5ES3A 5HA5A 5K01A 1N78A 2YIDA 1XEFA 1Y6JA 1YK0A 3ETCA 3E9CA 1W85A 5EJ7A 2GO1A 3VR5D 1ZESA 1NBIA 1JVNA 2ZJOA 1XI2A 5BSTA 5DWVA 3A26A 3W9UA 1XDWA 1X80B 4XZ3A 4C5BA 3KQKA 2XX3A 4KO3S 4URUR 2W2KB 2XVMA 4R01A 3GJ3A 3UWKA 1G8HA 1A50B 3F2IA 4G0WA 2I3GA 1KZ1A 4D9CA 1JFFB 3NTRA 1GA1A 4X24A 3H2YA 4AIRA 4WACA 3H13A 3JX9A 4L1KA 2R44A 3KO8A 2WDZA 1GWNA 1NPYA 3GFBA 4DCOA 1J7KA 2J6HA 3EVEA 4PXYA 1VDMA 2HSZA 2EF0A 1IIRA 3T3OA 4K6GA 4BKMA 3V4OA 1QZTA 1QRDA 1TZMA 2EFGA 3V4RA 1JKFA 2BJVA 3TK1A 1YL7A 3DXZA 4WEOA 1E3TA 2AFHB 4DV0B 2KMLA 3R7WA 3GYGA 1UXGA 2WJ4A 3TCKA 3CW9A 1T9DA 4Y6PA 3QEMB 3TOZA 2GI4A 3VH4A 1WW8A 4U63A 3PR2B 1XRLA 3THWA 4JP8A 2CZCA 4ZVOA 5DIZA 1I3LA 4QG3A 2VXBA 1YAHA 4P3NA 2YV5A 4EVRA 3GRZA 2YV1A 5INTA 1SOVA 3F7OA 3FUWA 5E3JA 3NWEA 3R6LA 4G5XA 4LJLA 2PD3A 1Z5PA 2O7VA 3P0HA 1Q19A 4IIJF 4MLDA 3FZGA 4D1YA 4JEIA 3W9BA 3AFHA 5LYYA 4Y30A 3BIXA 4HZUB 1G41A 2X0EA 4HGZA 4X64B 2NPIA 1DIGA 4DDWA 4YXWA 1GPAA 4J9UE 2FSGA 3ZWWA 3E5NA 1NYRA 3RODA 3TBKA 3ADCA 2RGWA 4PC2A 1N3BA 1Q1NA 4CMJA 2HBRA 4HDQB 4R2LA 2M6KA 5MN5A 1ZDMA 2HCRA 4MUGA 3PS9A 2J45A 2VWPA 3G1WA 3SDSA 4KIWA 5FLXA 3CE6A 3LM8A 3F74A 4RMHA 5DNVA 4B3BA 4P38A 3H1BA 2J7PA 3FD8A 3W7VA 1CZUA 4U5QA 3O4IA 4ED9A 5BMOA 4QEKA 4IGFA 3FOZA 3G8DA 1Y7IA 3N53A 1GVNB 3TOXA 1FJ2A 2PPVA 3UFXB 3GJ4A 2NXNA 4BNIA 3OIYA 4NYIQ 5CLHA 1MJFA 1P39A 1Q95A 2WUFA 1U2QA 3AEYA 4O63O 1YCHA 2QG9A 1ZGJA 2A78A 1N2SA 3EZ9A 4NZNA 4JI1B 2XUOA 4M60A 3X2FA 3E3OA 1XYYA 1KMNA 1N33B 1C4WA 1CTQA 1M9NA 1TCUA 2I66A 2XUZA 3G02A 3MC1A 4NECA 1JPVA 2W43A 4XJXA 3UMGA 4AJ4A 4QYSA 2QM7A 5K09A 1PLKA 4PLYA 2I87A 5JSUA 4NJEB 1K7YA 4V2IA 4YP0A 5K0BA 2WA1A 2O0KA 3FOCA 2ODPA 3P71T 1ZXLA 2CNWA 4LFBB 2AT1A 2DC1A 5H02A 5IJAA 1NZFA 2ISSD 5LZ7A 5FTJA 2H29A 1KOLA 4PGMA 1MKYA 5DV9A 1XVLA 1Z22A 3EE6A 3L4BA 3Q15C 4AY5A 1NVAA 3HNRA 3ICWA 2DF8A 2VT6A 1YQTA 4P22A 3WKCA 4FCCA 3HJHA 5AM3A 1IBKB 1YR7A 2HDHA 1RRKA 5HQJA 1E9EA 2AMJA 3N9IA 3WB2A 4NAVA 2B1JA 2FMTA 2VF4X 3BQMB 4W8HA 2WF7A 3GGOA 4MIEA 2DQYA 2RGRA 1JW9B 2BFCA 3FVVA 4MI6A 5J5CA 1SXHA 1KU0A 4RBNA 3F7NA 3NC4A 1VPVA 3HA5A 3I34X 1FX0A 4PN7A 1GUZA 3IB3A 5DM4A 2AWNA 5JJKA 1W0JD 3ONNA 1XHEA 3V1TC 3L1IA 1EM8B 4N8SA 1G5IA 3CKLA 4C0QC 1DKMA 2ZPAA 3KWLA 5CA0F 1RNLA 1FTWA 1E7WA 3JS5A 4RE5A 1Y8AA 3C8HA 3Q1LA 4MJ7A 2NV6A 1AGRA 5A6SB 2NMVA 4UHBA 1L5KA 1Z0ZA 1NJFA 3HKBB 3KZNA 5IYZF 1OSNA 1PRYA 2QSJA 2ZR8A 1J8DA 2BGJA 2CLIB 2PZEA 2HM7A 2C5SA 1JHRA 3GEMA 2Z3WA 2FK8A 1J0AA 5J4HA 2CNOA 2OBBA 3GEEA 1DX9A 3MOIA 4EKYA 5HIAA 1LGYA 2ZB7A 1W85B 5BW4A 1PZHA 4Q4AA 2Y2UA 5GQSA 1OB2A 1NXWA 1J2UA 2PZBA 3KXLA 5TVKA 2EBUA 3F4BA 1RXIA 1LXCA 4YT5A 5EP4A 1R15A 1SUPA 1KO8A 4PZ9A 4RUKA 1UP6A 1DUSA 1I80A 2ATIA 1RXYA 3LIIA 4W5JA 4KBYA 4D4GA 1JIKA 3GIDA 2G3YA 2R87A 4HQ6A 2AFRA 5CLGA 2Y76A 3UYKA 1Q1GA 1BMFD 1Z06A 2C3MA 2IUEA 5CDFA 4R1OA 4JYMA 5IJZA 3EGVA 4HNVA 5E4TA 3QY9A 1JMYA 1OBFO 4A2CA 4DRZA 1SNYA 1N9KA 3INYA 4I14A 4IHJB 4ZJUA 2IX3A 3ZTYA 1TE2A 3OOWA 1LPBB 1U6JA 1Y8QA 1T2UA 2OC9A 2VPTA 1RJWA 5HFJA 1IEQA 2JD2A 1UPCA 2AN5A 4FPXA 2K7FA 4B2PA 1CJBA 5JW6A 4P58A 2P7HA 1K98A 4J16A 3WQBA 3BMCB 1G9TA 3L02A 2P90A 4BDTA 4Y9TA 3THWB 3EXIA 3CZAA 4TS1A 2QHXA 1W73A 4OHPA 3VV3A 4ARBA 1TEXA 2ZSDA 5LD2C 4JT8A 4DR5B 3VI3B 3EVCA 4P08A 4EHBA 1G6OA 1E2UA 4Q00A 4JJAA 3PGVA 3S7TA 5CDGA 4IDEA 2ZXUA 1RE0A 2C7QA 4HYEA 4E1BA 3PEFA 1FVHA 5CU7A 4QLAA 1MEEA 4PLTA 3OZTA 2HWKA 1RXCA 3EAGA 2C92A 3WK7A 1TO1E 2VBGA 1NDUA 1KQOA 2PEZA 1ULHA 1JA1A 1AA6A 1A8SA 4QXRA 4GZMA 1T2CA 2EFDB 3WGGA 1SUIA 2YXDA 1J5EB 1JLRA 3UJDA 2R6HA 4LGMA 5KNDD 2RIPA 3JD4A 4Q03A 5ICFA 4XWKA 1MAUA 3PNOA 2N3ZA 5BN4A 3EXHC 3FHLA 2UAGA 2ZBDA 4UULA 5C1DA 1ODKA 3OT1A 2Q1XA 4FEGA 3FVQA 1E0AA 1XQ1A 2VZ9A 1VI5A 2C77A 3M3PA 4P7BA 1IEVA 1XG5A 1LSJA 2HPAA 1EG2A 3EFOA 3LYHA 3MB5A 4N0DA 1UZUA 4YUVA 2YS6A 3VVLA 4CCWA 3DE6X 2QGNA 3L1KA 1YTUA 1JIVA 3DE5X 4LZOA 3O1LA 1VGVA 3I9FA 4RIHA 2ODBA 3AJ9A 5DYYA 1HWYA 4KHPB 2IDKA 4RKYA 1BN6A 3GHYA 3HJTA 1J2YA 3IQIX 1YCFA 3URKA 3TOSA 2G7MC 1WQ3A 3V33A 4IRUB 3UEOA 2GAIA 2EX4A 1L8QA 1EJ2A 2AMLA 2FF7A 1H9AA 3O3OB 3G13A 4ZGGA 1SBNE 4QGAA 3OMXA 1MC8A 1V0JA 2QQ0A 2XDQA 4QODA 2G0NA 4ZIRB 4Z5XA 1FYVA 2H4HA 3DOIA 5H59A 2Q2QA 4WN9A 3E8MA 4IGKA 4QM6A 3DAPA 5AMXA 4YT2A 3U4AA 1DEAA 3FLAA 5KTSA 5F52A 4IV8A 1E58A 1CEQA 2HMYB 3HFRA 4U7FA 3USES 3IDZA 3HPQA 1LQ2A 3M3HA 3TD9A 1KY4A 3W0LB 3T99A 1ZBQA 3KU4A 2NU6B 1V7PC 2BEVA 3I9NA 3HVUA 5ENDA 2UUPA 4B4UA 2X4GA 1E3JA 1FX0B 1O87A 3B3JA 2OV4A 2QRVA 3L0BA 3GNLA 2VRBA 1D03A 3NB0A 1DWOA 4YQYA 4L7QA 3RPEA 3TPCA 1L7BA 4Z7QB 3I5XA 3UXYA 1EAMA 1CVLA 3MQ4A 4P4UA 4IDAA 4XTCS 1UPXA 3RT9A 2ZT8A 4JVSB 5CW1A 2B94A 5GM1A 4EPYA 4G5QA 2PKQO 3WWZA 2IZ1A 3LKVA 1RKXA 2RHLA 1VMDA 3WX0A 3WHKA 5I7WA 1SA0A 2M6LA 3CPEA 1KJ9A 2NSJA 2C29D 4PNPA 4J9VA 1FQWA 3VNRA 3MWLA 4LF6B 4QDJA 3DNFA 4N9WA 1MQAA 1W9HA 3H5TA 5EE9A 3LQ4A 1DFHA 1T6ZA 1TYEB 3E7PA 4EGCB 5A03A 1FDVA 3JAMA 1EM6A 1TCVA 2P9QA 4TT3D 4Q4AB 4CM4B 1B74A 4Q02A 4NENB 5IHPA 5U4XA 2LBPA 3H9BA 3OZXA 4L57A 4XUDA 2FWNA 1JTFA 3KLOA 4Q37A 4NATA 4ZOLA 2XYHA 2ZUDA 3BRQA 4TLBA 2VRWA 4OL9A 1WZNA 2NZVG 2GNAA 3KD3A 4JBGA 1CUUA 3U6KA 4M0DA 4YCNA 3O0DA 2NO4A 1AZSC 4Z7OB 3PJGA 4D0NA 4V1CB 2WSMA 3M1AA 4XIYA 4XKJA 3H1FA 1SRRA 2MOKA 5E6UA 2Q49A 5IASA 3RRYA 4MZXA 2WKWA 4S2UA 5CVTA 1WSBA 4UNPA 2JFWA 1TJYA 3KCQA 4R7TA 2QUAA 5B30A 4BNWA 3LBHA 2FFJA 1UADA 3WLFA 3Q1KA 2D2VA 4S1WA 4ON9A 4XX0B 3U3XA 4D74A 1MV8A 2PANA 4MEAA 4PSAA 4ZQEA 3WGNA 3ENQA 2E4UA 5SYAA 3ZCUA 3G8YA 5ICGA 3AKYA 5DISB 5JC1A 5JJLA 4L6AA 4KXWA 4B34A 3W2HA 1SCIA 3VX3A 4DLPA 5F23A 3DDHA 1USIA 3FMFA 1R8JA 1UKAA 1FMTA 1Y3IA 3AF2A 2WG0A 2OCDA 1B0PA 3LVFO 3LVRE 4NFYA 4NK5A 1NTRA 1ADYA 2GEVA 3VDRA 3R09A 3WLPA 1E6KA 1YS4A 4BAGA 1XJWA 4LWPA 3VZSA 5BXYA 1U02A 1V95A 2CLMB 2CLDX 3NJ8A 4N03A 4PAGA 5JU6A 1T3GA 2C2WA 4J3NA 3O4VA 2FFRA 5H70A 1PE0A 2J5BA 2X6TA 1QNLA 4Y1GA 2WK1A 4RHTA 5DYWA 1H9BA 2YQ5A 1IWBB 4ZOBA 3DDOA 1KK0A 1IC6A 1YJQA 4UBLA 1NY5A 2DEUA 2FSVA 3MT8A 1ZH0A 1GPYA 1T3HA 4EH1A 3B2EA 4MVYA 5EJIA 3DWGA 1OFTA 1OWLA 2ILTA 2PT6A 3K31A 4GW3A 2H8KA 1EK2A 4M9ZA 3WG9A 3CZMA 1JKMA 3A70A 1MF7A 3MJHA 1EDEA 1QAQA 4I8DA 3JQCA 2A86A 2QU7A 4NH4A 5LC1A 3OJWA 2PRJA 1EVZA 2Y1WA 1HQYE 3S5UA 2P27A 1DFGA 1KP9A 1WDWB 3B6IA 2OUKA 3OT1B 2NZJA 1E2JA 3VM6A 3SS8A 1T5TA 2LCQA 4IYRA 2W6JA 4BMCA 2JGRA 3EFOB 3CH5A 3DM9B 2BHRA 3H8SA 2ZJ4A 1RPJA 2EQBA 1UDCA 3G5TA 4TMXA 5EHQA 2JEOA 3U44B 4M7WA 3R8FA 1YBHA 2LZ0A 2QV7A 2Y27A 3DFMA 1OXVA 1G5HA 1E64A 3KXIA 3ZWKA 5C80A 3ZDBA 3UMJA 3OTQA 4FINA 4COKA 1VL6A 3GC6A 4FR2A 4L9SA 2QVLA 1I7PA 1YI8A 4OHOA 2GKGA 2NZ2A 2JFYA 3I8XA 4QOIA 3FW1A 4LQCA 1DIBA 3GAZA 4C6TB 4EITA 4RS4A 1JIIA 1L1QA 1S2MA 2PFGA 2VDJA 4LN1A 4G5SA 4F6CA 1RCUA 4W1RA 1RM4A 3C16C 3PIDA 2PQ0A 5FT9A 2FW1A 5JBQA 5HZKA 4MRPA 4C4SA 5CB0A 5C7LO 2AC4A 1QK3A 5KVQA 3J80A 2V9CA 2VPZA 3KXDA 3HY3A 1XA0A 1KDZA 5LOVB 2JHAA 1QFZA 1CEXA 3TLZA 1Y9ZA 1EK6A 3VYTB 2BEVB 3FBGA 4X93A 4Q05A 2JFOA 2XYVA 2MYNA 2QL6A 4L5YA 3TDMA 4EAAA 1SIWA 4ZI7B 5LR6A 3RTDA 1HFJA 1GT6A 4FU0A 2AQIA 1DQZA 1DBWA 1IEXA 1OF1A 4FKBA 3GR6A 3H04A 4MUXA 2FW8A 2RARA 2O8FA 3I4LA 3QXHA 4NBWA 4CLDA 2I2CA 1RLOA 1URPA 4Q7JB 2Q5OA 2YZ7A 2F9MA 3QYAA 2FZ5A 1OILA 2VDLB 1KJYA 3FF4A 1AGNA 4F96A 1XVTA 4JQYA 1ONPA 3MD9A 3GMIA 3JVUA 3F98A 3L0DA 3T3HA 2QPAA 1GO2A 1M83A 2QP3A 3DFZA 1SPBS 2AUNA 4AP6A 4O3FA 3U2QA 1G7CA 3K70C 1R5NA 3QI2A 4QOJA 3BK7A 1SA0B 3ZY5A 4NJOA 2Q7OE 1U2GA 1LBTA 1OFHA 3JQPA 4JBWA 2V9PA 5JCJD 2W2NA 3NJRA 1MVLA 4PPQA 3G2IA 4R31A 4GZ3A 2XCQA 3IHLA 2IV3A 4B45A 2AD5A 4WY2A 3QU7A 3RS0A 1DQYA 2VPXA 3DMTA 16PKA 4BNNA 3SG0A 1QQAA 3I92A 2GN6A 4O5OA 5DGIA 3TNJA 1CG6A 4GOJA 4ZA2A 4G4SP 2G80A 4K9QA 1G3MA 4KXVA 4MXDA 4TVOA 2F9FA 2PRIA 1HRKA 1M8KA 2ONYA 1K5GA 4Y1FA 4OBBA 5T4FA 4G81A 5F2OA 1QHXA 4L3WA 4Y0NA 1TJ4A 2IF0A 2JKYA 1W5TA 2R8RA 2Q5JA 1VHLA 4M1OA 4XSVA 1UEJA 5FBKA 2WM8A 4E2YA 3Q3JB 4KQ2A 1KQ3A 1L4LA 2WILA 4E08A 2H0AA 4QGHA 2YOGA 3ON5A 3C6ZA 3CR3C 5J23A 1X77A 2OR3A 2ZRKA 2JJQA 1KVQA 3WOHA 3IALA 4N5MA 2I4TA 1DQSA 1U28A 5TF4A 5A4DA 3HCFA 2A30A 1AQJA 3BA6A 4ZI5A 4EO4A 1IUOA 1HNZB 3PHLA 4S1TA 4QO8A 1BNCA 1OLSA 1U5AA 2E55A 4RVCA 3VMMA 3HO1A 3CX3A 3DLIA 1N0HA 2CEKA 4KC0A 4BNHA 2OWEA 5AI0A 1IY2A 4EARA 4QJ5A 1U7WA 5FUYA 1Q0HA 3ZWOA 2HA4A 1CE8B 2OHGA 4ZRDA 1NMXA 4K7JA 5HGJA 1ENPA 5ARDA 5FIUA 5L7TA 2PZFA 4R83A 2OBYA 1JBKA 3NPMA 4QSMA 4RQTA 3IE2A 1N2JA 4GEKA 1T6NA 3FSEA 1ILEA 2FAXA 3GFTA 3LUHA 4UHHA 3PE3A 5F77A 1JH8A 1UPTA 4GOND 3KEFA 2CLKB 1OFIA 4JVMA 5IJ9A 4AN4A 3LI2A 3ZI4A 3GEDA 3PGLA 5AXBA 1L5WA 1H2WA 1SKBA 1H2RS 2JAWA 1IXRC 2D5AA 2QL7A 3VR5A 1E1QD 1DDOA 4Z9FA 1IFXA 2PMEA 1EFTA 3E1SA 1KSGA 4ZP1A 4EQ6A 4B84A 2R47A 3KX2A 5ALWA 1P3JA 2WIJA 1QG2A 3G0CA 1BYUA 2VJNA 3KZXA 1ONNA 3V32A 5HF5A 1SU4A 2Y9MB 1Q3HA 4L08A 3ME5A 4J0HA 5ALEA 3UJCA 4I1RA 4XUCA 2K6GA 5BSGA 3BN3A 2JAPA 3ICQB 3C6YA 4QDOA 3ZE7A 2OOKA 1R0SA 2QRUA 1T8YA 4NCAA 2GCNA 4WKOA 1RRVA 3OWOA 1E2MA 2VBCA 2ZRIA 2YVAA 2Z2XA 1WXGA 4JSYA 3IQDB 5AM0A 1D6SA 2VHEA 3DOHA 1B8PA 3A9TA 2PBZA 3F6EX 3GRKA 1ETHA 5ITZA 1Y4ZA 1PSDA 4BO3A 2QT1A 4KBGA 4YRPA 5SYNA 3ZIUA 2G83A 3MJ4A 1ENYA 1ZXXA 1DCFA 1I3NA 1N5OX 1R66A 2GCEA 2D3TA 2MJLA 3DZHA 4K2AA 4X66B 2IFTA 2Q62A 4QU8A 4EJFA 4FJ1A 1HZJA 1EQ2A 2JB9A 3W05A 4P3PA 5SY6A 2O06A 5JO0A 1PJ8A 1A5TA 1VHTA 2JGFA 2ZYTX 1CRPA 3TW4A 2R1VB 1HURA 5LB2A 1QHHA 5CM2Z 1MX9A 5THKA 2QMZA 2BKUA 4TYWA 4GVXA 1ATIA 1W5FA 1G20A 3WKDA 1BRTA 3TM4A 3AFNA 1Z2OX 4QOSA 2FDCA 4C0KA 1DWQA 1P2UA 4YCDA 2P4SA 1JT9A 5DTJA 4X8LA 1YS7A 1QOZA 4J0CA 4C0WA 4JLJA 2UXBB 2PSFA 4Z1MD 1IG0A 4KEAA 3N86A 2TECE 1JVSA 3IEXA 3NYIA 4ESHA 4TTPA 4PVCA 2O8FB 3PUZA 1Z4PX 3H18A 3M34A 1EVLA 1BDMA 4E70A 2QTCA 3JAWA 1M1NA 4P5DA 2JLQA 4QYWA 3NNDA 3IOCA 4BJHB 4WFIA 5JTUA 3PLRA 3MJRA 4OQQA 3AY3A 1UIMA 4BLWA 1XJ0A 2H2FA 4MIYA 2ZJ5A 3C14C 1KHTA 3I37X 5HFNA 4CTOA 4G1CA 4GPTA 4KDRA 3H3FA 5EUQB 5TR9A 1BVRA 2MSKA 3BB4A 4BFCA 2GWRA 3HL0A 1EQAA 3PRKE 3HDTA 5KVCA 3BSWA 1XAJA 4L4XA 1WMBA 2FUEA 1W0CA 3UG7A 5HQTA 2OZLB 4GM4A 4M8IA 4ND8A 3GZNB 4RWEA 4QZVA 3K9BA 4DUPA 3HN7A 1NIJA 3EF1A 4LGYA 5D3MA 1JHAA 2MWMA 1GEEA 2ZJ3A 3AOEC 1UOQA 3E7XA 5FOXA 4BV2A 3H7IA 3QLUA 5DTQA 3UTDA 4YCLA 5HWSA 2GN2A 2RKBA 4B17A 5I01A 1CX9B 5IBRA 4LDPA 2IGBA 1Q3KA 5JDIC 1BZYA 1NKSA 2BZ1A 4UNSA 1M2JA 4FYYA 1E6MA 5HZHA 4TROA 2Q2OA 4W6ZA 2NIPA 3D9QX 3LK6A 4FMDF 2R2GA 3KT6A 1WSDA 1N1GA 1Z5VA 3D0RA 3AJEA 2NXWA 4LJ8A 1CUHA 4R7GA 1RT9A 1U0HC 3GCXA 5ALMA 2ZJBA 1D2HA 2YQZA 3IODA 2B2XA 4TV9A 4Y6RA 4M1ZA 1SQFA 1J9EA 4LX8A 4UTPA 1W0JA 2AWOA 5FNZA 2I7VA 1JDPA 1OLSB 2H31A 4YNBA 4UE2A 3DZGA 4K46A 1MMFB 2RGNA 5REQB 3IVGA 1UDBA 1XZPA 3WLTA 4QSHA 3Q85A 2OGWA 1Y7LA 2ZUVA 3G0IA 1O6ZA 3FYCA 1UZMA 2PX2A 3DFUA 2XTJA 4URVR 1R2QA 2V9ZA 1LFDB 4GLJA 5CT8A 5ESRA 3TCXB 1F5SA 1O97C 2VHTA 3TRKA 1UK7A 3DT6A 1F8XA 2FEKA 3B20A 2MYPA 1PF7E 3LGXA 2NPOA 2WTMA 3EXG2 5KHLB 5H83A 1OX4B 3CN9A 1QE5A 1V8ZA 2XYPA 4ITRC 4QGBA 2DUUA 1YGPA 5DDIP 2WAXA 3GH3A 3LGSA 3QQ5A 3JSAA 2XR1A 2YNMD 2BRUA 3K0AA 2OG2A 2OYSA 3GGDA 3ZWPA 4Q1EA 4M8KA 5ARBA 5ISMA 2AFIB 2VP3A 5ESWA 3ZGNA 4DLNA 4ER3A 1Z37A 2FE1A 2IU3A 3LLCA 5GZ6A 2JFVA 3DH0A 4E1VA 4F93B 4BVEA 1QU2A 1WKBA 1Y9EA 1ZJ5A 2C2GA 3I0ZA 2ZJAA 1BMFA 2WHPA 2Y99A 4M8SA 4RGYA 4ZDWA 4BEWA 2Q1YA 3GVXA 5BWOA 1H2AS 1VSVA 2WSIA 4MUMA 3CMMA 4QOEA 2J8ZA 4PAQA 3Q7EA 4GS5A 3ONDA 3GD7A 5HE8A 4WXRA 1NM5A 1G16A 4N3BA 2B9VA 3F6SA 3A9UA 5ALLA 5ITZB 4KN8A 1P33A 3NFRA 2FEAA 1K08A 3EOZA 1LTQA 2FPWA 5JJIA 1FLAA 1NMZA 1VBKA 2WJHA 3IA2A 3N07A 3ZS9A 2V03A 5EZ6B 2V6MA 3AKCA 4OJTA 1TU0A 2YCLA 1KHHA 3AIOA 2H4JA 3OO1A 3PEVA 4MW0A 3BBLA 4X0EA 4ZAGA 4D8UA 3OQNA 1N25A 2OSVA 1ZU4A 2QMUA 1PK7A 3QI7A 3TB4A 1AS0A 3A1CA 2ZYAA 1QUFA 2C8JA 2X4DA 5ESXA 2AZXA 1SK8A 3ZLJA 5IWCA 1U0JA 1TU4A 1U7HA 2WYHA 3QUCA 4HDSA 1A04A 1BWSA 1WCV1 5IP5A 4C7JA 1LRLA 1SKYB 5D85A 4RTJA 2B2CA 1F12A 1QGUA 2B8JA 4A2WA 1AD2A 1JLKA 3CVUA 1U2PA 3A6PC 2Y93A 2PS3A 2VDKB 4ZYTA 5F33A 1NOKA 4K9KA 4NAUA 2E6UX 2HF2A 9ABPA 2FHSA 4KMMA 4A8HA 2I78A 1R0LA 2C3OA 3ORRA 3DZ8A 2QXTA 1XAIA 3V8PA 4JI8B 1UXIA 4ZT2A 2XLBA 3KUDA 3FVRA 4QRHA 3ZDEA 3T9DA 3T7CA 3PR1A 3A6DA 3EW7A 3RG2A 4GF5A 4EYQA 1I1NA 1QHYA 2H4ZA 1WKVA 3ILVA 3P2IA 4G37A 5E8JA 5DBOA 4DDHA 3BIFA 4R8SA 2NVOA 5KNDA 2PT7A 2VCEA 2Y68A 3P9SA 4RKQA 4DUZB 5IJWA 3HGQA 1M1NB 5K6RA 4OQ4A 4A8JB 3U0BA 2O59A 1GN8A 2ZOSA 1ZSYA 1NOJA 3F71A 1VE3A 3GPCA 3HSSA 4F71A 3U31A 5B1SA 1LV8A 4KVGA 4WOJA 2A4KA 4K6HA 4FN4A 1KYXA 4G1MB 1CFZA 1EVQA 1Q2XA 3M82A 2MSLA 4OK5A 1S3SA 4TTTS 4ND8B 1V5WA 3OF3A 5TQJA 1XD8A 1BOFA 4AECA 1FVOA 4GMHA 1QR6A 1TC1A 1ZXBA 3W4KA 1Z0FA 4MJ3A 5D3MB 1H65A 1MO4A 1U0TA 2FVYA 2J1LA 4NTZA 1GLNA 1NF8A 4ZPXA 3UK1A 5ELMA 4ENWA 2P2CA 2QLBA 4R41A 2HJSA 1NU6A 1V8PA 1XT6A 1U7ZA 4X1IB 2IVZA 1OGIA 2PGNA 2EZTA 3JYQA 3F8TA 3MBIA 5CT5A 5BWBA 3L0OA 4CQMB 4H0FA 3OCYA 4OQPA 4X97A 3T06B 3BCSA 3WLSA 1IATA 1Q1ZA 4RJTA 5A04A 1MRNA 4CIVA 4OXXA 1WPGA 3TLYA 5EJ5A 1L7RA 1SD1A 3BGOS 3HP1A 3R5XA 4I2VA 2P9JA 1EA5A 4X41A 5AOBA 3TMKA 2JLUA 3CKMA 4U7GA 3NM4A 5J59A 1B42A 1QKIA 4UEOA 1IQRA 1VPDA 4FEAA 2WSBA 4JWTA 3IQEA 2A1UA 4X90A 1Y4UA 3G3EA 3KR9A 3OTHA 3UWDA 1O57A 4UARA 3WJ2A 3E58A 3KZ1E 3C85A 4N48A 4N39A 2FMKA 2HT6A 2O50A 2PYDA 4BX9A 1IY1A 4BASA 4YRRA 3OKFA 2VVTA 2FQ1A 4GR9A 5ALTA 3HXKA 4KX3A 3MM4A 1EP3B 2BFOA 3E5MA 3GFVA 4TL6A 2VK1A 2DFTA 1R00A 4RMIA 1CIPA 1K9SA 2DQZA 1BE0A 3NOOA 1VPTA 3P0FA 4FMPA 1Q92A 2PO5A 1IM2A 1XDGA 2H7VA 3L7KA 2E4WA 1KAGA 2DZDA 4HGNA 3RJMA 1UBRS 5DB4A 5EHGA 4TT3A 4UCQA 4Y2JA 5BRAA 1TQHA 1X1EA 3HXPA 2G0TA 2I4IA 3WGTA 2QTVA 1KGDA 2VWQA 3SLKA 1WD5A 3DGFC 3FROA 3IT1A 4JDPA 2XOKD 5A2QA 2A9JA 3I83A 4BVHA 2BZGA 4B6FA 2ZSFA 3EEBA 3ESXA 3DE0X 3O1JC 4UAVA 5DJ5A 2EGUA 2VJOA 3K9GA 3BH7A 2WHPB 4C3ZA 3E0XA 1GADO 1L8OA 1UBHS 2H2WA 3B7PA 3WJ7A 1Q50A 4JMLA 1R0ZA 1NQXA 2GCPA 2C2OA 2QM8A 2HSDA 4I81A 3U4GA 1GSHA 4GOOD 3G8BA 3OF2A 3Q11A 2JJMA 1Y9AA 5THXA 5AW5A 4N18A 2B37A 1IHOA 2X8JB 2O1XA 3MAGA 1IBSA 4WX2B 3KB1A 4MLZA 3SAJA 3PFKA 4RW0A 1ETUA 2P9ZA 5ADWA 4KVZA 2DHRA 4IZIA 2AOVA 3CPJB 4O4LF 5EP1A 3UMCA 2UVPA 3QFRA 1W4AA 2B82A 5D1HA 3VUEA 3N8KA 5KTRA 1C1XA 1Z7WA 2ZVPX 4MUAA 4PBRA 3BJZA 3C41J 3ELDA 3NBMA 3T5TA 1R0KA 2JFPA 3M8KA 1JQEA 3K5WA 3P5SA 1HTTA 3W34A 4WCFC 2UZ4A 4J4TA 5EMNA 2QNRA 1P74A 1SXGA 3EG9A 1NE7A 1QGUB 4WSOA 1ZVJA 2YFQA 4U2EA 3ZD9A 1C7FA 5B7NA 2I5PO 1EXVA 1TPYA 3Q9NA 3VHLB 2Y1XA 4WY5A 1L5OA 4FKZA 1YIOA 1K7CA 3KPYA 4QHYA 2D0DA 4D9GA 5LPNA 2JLWA 1GFSA 3BJIC 4R54A 5KTMA 4W5WA 1MENA 5LA6A 3FHOA 3TVTA 3WLIA 5JQGF 2I1WA 3GNSA 2I6TA 3ZZ1A 3ABSB 5DHAA 3I64A 5ALFA 3WTBA 5AW8A 1ADBA 1L8AA 1CJMA 3QX7A 3ROQA 5DYTA 2I9PA 3LUBA 2BGIA 2PIDA 5FWNA 1BXRA 4RIIA 1H93A 3LL7A 5L4LA 2NO0A 3IPLA 1F06A 1O58A 1J0CA 1WEHA 4E1AA 1Z5GA 5JO9A 1NIPA 5KWVA 4R2JA 3KK0A 2ERCA 2LE0A 3GDOA 2V7XA 2OV3A 3FYUC 1ENOA 1SZCA 4L8VA 1D0VA 1WXHA 4CM5A 1XZNA 5FI0B 5A4KA 2R0QC 2GZ1A 2FLWA 4LY6A 4CMEC 2Y67A 3EODA 2CJWA 4TOIA 4Q9LA 2ZTUA 3D6HA 3DT8A 4J43A 1GZHB 2VDRB 1BFUA 2VAWA 4LQDA 1Y8ZA 2O20A 4N5LA 3FYDA 3TW6A 1V5EA 4LJKA 5CAEA 3R5SA 5HZGA 4B9EA 2D0PB 1T9HA 5TXGA 1BG6A 1MOQA 2JH8A 5BN1A 4IFTA 3HU1A 3CCCA 4WDQA 1C8VB 2UXDB 1YRHA 1P0MA 4M0EA 4N7JA 1HL7A 3CH6A 4E3WA 5IF9A 2G5CA 4L51A 2X0KA 1BE1A 1Z07A 3K2BA 4OXYA 4G2TA 1Q0SA 4RD4A 1SG6A 1GPKA 1X3LA 3V42A 2BFMA 3RU2A 3D7LA 2L2QA 4YJ2F 5DM70 2P11A 4JA2A 5IDQA 3W8EA 3MIIA 5IULC 4WK4B 1GU0A 3OJXA 1DMSA 1LSUA 1S01A 3JATA 3EPLA 4AQYB 1GA6A 1LBQA 3KFLA 5B1IA 3WLKX 4E2XA 5BPFA 1R9JA 1ZK1A 3A6FA 4FFPA 1PBNA 4OFBA 4MS4A 1PUXA 1XD9A 3PJFA 1DC5A 3Q88A 5HEKA 3ZY4A 1KORA 4A7PA 2B69A 3QMMA 2YXBA 4GOKA 5FPQA 2A1UB 3A2LA 4OYLA 3JALA 5JQWA 1QFSA 1F1BA 1TLTA 1P1JA 3KSMA 4GOLD 2ASEA 5FUWA 3OBIA 5B64A 4R2IA 4AUKA 1GTMA 3OCJA 4Q1DA 4U1RA 4IOKA 2NX2A 2C5GA 2B5WA 1SCUB 3L05A 2V4UA 1AZLA 1L1EA 4HZIA 5BY2A 3MELA 2CMKA 1NASA 2AXNA 3HUDA 4KHZA 5E1DA 2FH5B 1C5KA 4X85A 3TOVA 1CHNA 3I9OA 1IBLB 5JCJA 4E09A 3CV3A 2JBWA 1B43A 4QHTA 3G23A 4L8YA 1ID8A 4BAUA 1Y98A 4D0LB 4JWKA 1T6BY 5JR3A 2X8BA 3GA5A 3STYA 4MJLA 1DOAA 3TI9A 4AW9A 3WMEA 2AJCA 3A14A 3JVIA 4R3WA 4D80A 3IQFA 5CVJA 2QTVB 4Y7DA 2GYVA 3DAGA 1L5NA 2QZSA 3TD2A 7ADHA 2REQB 2WM9B 4Q3CA 5I4KA 3V8NA 4HN4B 1Y6ZA 2VQSA 4DA0A 2X5JO 4G26A 4M9UA 3FHTA 3QW2A 1T4CA 2YY5A 5I7FA 4CUZA 4Y9UA 2XCTB 2HTFA 4Z0NA 3VO8A 3AH8A 1ESNA 3GDFA 5E4FA 3EF3A 4PNEA 1VSQA 1ZI9A 2D54A 2ZTVA 1N0IA 1SOAA 1YS1X 5TARA 2OGSA 2ACWA 1RAFA 1OMOA 4XPZA 1G8KA 1NVUQ 1U8XX 2O2GA 3ASVA 5FO1A 4KNYA 1CDZA 1B3RA 2QM3A 1GFIA 1OFUX 1GTL1 4IIFA 5EJMA 5T5QA 1DFIA 1BMDA 4L3OA 3RS3A 3WWYA 5CB4F 1O4WA 5UKDA 1ECCA 2GO7A 2VJLA 3R1IA 2A5DA 2FVXA 1QHGA 1C1XB 2LKDA 1NUHA 4CL3A 4TTRA 1YRYE 5E2AA 3JQEA 2MMGA 2PMDA 3OFND 4D82A 1MAAA 5DNYB 4HZGA 3EB9A 3LY7A 4NF2A 5BSFA 1BDIA 1YDHA 2Z4TA 4ER5A 2GM9A 4PRZA 2WMNB 3O8DA 1GGNA 2HCFA 3EG9B 4H6WA 3PB3A 3RYFB 5B58C 2QVZX 1PYGA 3B7WA 3DVQX 3LU1A 3K73O 1OQAA 3QFTA 3VOBA 3NGLA 5EPUA 3IUYA 4UBNA 1MJHA 1GAXA 2VF8A 2R00C 4EX6A 3P8ZA 3TRDA 1E1QA 3JQAD 4H3HB 3FM9A 1JR3D 1SHKA 2VF2A 1XTPA 2QY9A 5LA6B 1F8UA 4WZZA 4ALJA 3DBVO 3W6NA 2IWHA 5PNTA 2SKCA 3NTLA 5HMMA 4URXR 4N5IX 3V4FA 3NRBA 3EX7C 1VL2A 4PSCA 2GFHA 2RGCA 1FQKA 1XA4A 3J7TA 3QLEA 4E12A 2OP1A 1R4ZA 2NP6A 2NNWB 2OQ2A 1TADA 3VZDA 5HKKD 1G60A 3EWIA 1FUYB 1FSSA 1O03A 2G1AA 4M7OA 4ETMA 3DOUA 5TMEA 5AW0A 1VQ1A 4XQCA 1EGHA 3Q7IA 5TQ2A 3BWCA 1X9HA 2O4CA 5AOVA 1V4VA 5BYBA 4FZ5A 4WA8A 2EF1A 4G0MA 4DKXA 5MGBA 2POCA 4ZOEA 5F98A 1S8OA 4UCXA 3ZK8A 1QIEA 4ARSA 2I2FA 2JGNA 4PHCA 1E8DA 2FPLA 3NHKA 2VHUA 3LLMA 2H57A 3MZ0A 3R44A 3WIUA 4EPTA 2ATVA 2JA2A 3LY5A 1EX7A 2FR8C 3DZCA 3AYXB 3EJ6A 1ZD1A 3R6TA 4AIIA 4DARA 5K8VA 3H84A 4EKGA 4EJSC 5K3SA 1DC3A 3VVBA 3L8YA 4TXMA 1HE5A 3P9NA 4ISCA 3TOCA 2ZUTA 4EY5A 5DLQC 3MMPA 2W42A 4MR8B 1FDWA 3RU9A 1ULBA 2BHLA 3SVLA 3JATB 2QJFA 4PFJA 1J9GA 5JNWA 4RY9A 4Z1MA 2XB6A 4OMUA 3NT5A 2REBA 3HBMA 1IVNA 2ID9A 2XWBF 4MS4B 1YCGA 4URZR 4DPMA 5ER9A 2XCIA 4PNHA 2WF8A 3H87A 4BWGA 1WAMA 1YULA 1MNAA 4AZ0B 5BOSA 2JBHA 2QGZA 3REQA 4EY4A 4WXPA 2WPNA 1IYZA 2ZWMA 4UASA 3IUEA 4ATNA 1FYXA 2OENG 3V8MA 2E87A 1TM7E 2R5NA 3DCYA 4JV5B 2CBGA 1AX9A 2F55A 4EJ6A 3G82C 3PC2A 1JJVA 1K2VN 3D5TA 3URMA 3U49A 1S2DA 3ZQJA 4O1IA 4DPLA 3C5CA 4ABTA 2C1ZA 1DAEA 1KNQA 2ZBQA 3TKAA 4UHDA 5LLDA 1Y6RA 2XT9A 1YQXA 5CGQB 1RWWA 3PEEA 4DANA 4Z8YA 1U7DA 2HU5A 4ZJYA 2NUBA 3KBOA 4YGXB 1TTQB 2RG1A 1H69A 1YI1A 3L1UA 1SU6A 1U8UA 5K3BA 2QL5A 1Q14A 1NNLA 2I62A 4MOWA 3MILA 5G0WA 1ULTA 3VPFA 1NNUA 1B0UA 2V5UA 3OZSA 4AYTA 1XPUA 1YE8A 2ICAA 3AEXA 3MS7A 3DZJA 3EUFA 3T7RA 3WNDA 3R20A 3B1FA 1B0AA 2J07A 2QMQA 2W6QA 3B9RA 2KHZA 5HILA 5IC5A 3ABQB 3SIPA 3Q7TA 1MB9A 4V0KA 4L9AA 3AHIA 3II6X 5CFNA 5TNXA 4I3HA 5EY5B 1YKFA 5DN6D 4XPIA 3LYUA 2VT3A 1ZK3A 1ZW6A 4IS3A 2NTNA 3A3PA 3TLMA 4LW8A 2JLCA 4LWZA 3LV8A 3U26A 2ZGVA 4UHCA 4L75A 3HDJA 5DX1A 4PG4A 1RYMA 4CT4B 3V8QA 3GEGA 4BEJA 2HGSA 1CF2O 3CUVA 2ZU6A 4P4SA 1WBBA 1NJ2A 3C7AA 3HCNA 2PXHA 1R4NA 3AJAA 5AM5A 3VHQA 1Q7BA 3G9QA 3KQQA 5TB5A 4FNGA 3SSNA 2HHCA 2OYCA 1T43A 4G65A 4AZSA 1EDBA 3N8NA 2PZAA 4BFUA 2VJAA 1DGQA 3V4LA 2PMFA 3H4VA 4IIGA 4RGVA 1YZFA 4FJ2A 1CDDA 2AE1A 2QIPA 4N82A 3GUUA 2PUDA 1FP2A 2G7ZA 1SUFA 2FR0A 1T1SA 4BV8A 4XM2A 2ZS8A 4G5YA 5BRNA 4YFYA 1JSRA 2NO6A 2OBXA 4J0KA 5I7AA 3WQHA 5C8XA 1ZQ1A 1N1MA 1PQUA 4RDHA 1VLJA 3MVEA 1XU9A 1KL7A 3UIEA 3S0JA 2J3QA 2YNMA 2CYCA 4IF6A 3OUTA 4WH0A 4XUGB 4IF4A 1J2TA 2A5FA 3GFRA 4DILA 5JXJA 2Z5VA 3BMNA 2QZZA 1A7KA 3DWFA 3V7WA 1I01A 7MDHA 5EWJB 4C08A 4WEQA 2CKDA 4M54A 4AG5A 1QZ3A 3RVSA 4IJ6A 1NQTA 3IKTA 4GLLA 4UUBA 1U3FA 4IRXA 3P9RA 5JCPA 3TGPA 1ESMA 2I65A 2G4CA 1U94A 4FFLA 3KAQA 4TTJA 5LB4A 3OCZA 1NJGA 1O95C 1TM4E 1VG0B 2H2DA 4OJNA 3WLMA 2TS1A 2I67A 4HCJA 3TSAA 4FOSA 1KYTA 1XN4A 3QNUA 3WK9A 2GYUA 5KS2A 1C9EA 4ZFNA 2C57A 1VLHA 4HX2A 2FX3A 1FDTA 4WXEA 1X19A 1MCZA 2JL1A 1F3OA 5E9QA 3X1DA 5CFPA 7ABPA 1TZBA 1OXKB 3QWHA 3CLRD 3KDAA 4EFLA 8GPBA 3W2FA 2OCPA 2QTTA 3QITA 5LLSA 3KKEA 3CBGA 4C3UA 4TWZA 3KIPA 1I6MA 1RPAA 4ESEA 1LDYA 4ZEWA 4GBMA 5AW7A 5H4GA 1VE6A 4N01A 2X22A 2CLEB 5CCDA 4YC7A 4BFTA 4DR1B 5JNVA 2JGAA 2YWDA 3KR0A 1RHKA 3P2EA 4YJGB 5SZIA 1Y37A 4HO1X 4AU1A 1A82A 4C06A 4IY1A 1JB1A 1Q7GA 1V43A 1ZOIA 2G72A 3EDCA 4C89A 1NYQA 1KP3A 4GBED 4B3HA 5K1ZA 3D6AA 4JDUA 4YRDA 3ER9A 1SULA 1XCOA 2RB4A 4DJAA 2Q5CA 1M8JA 1Y6FA 3AI1A 3G6KA 2WOJA 1UZAA 5KMGA 1M3SA 3O8BA 3EOBI 4OMFG 1NVKA 2I6SA 4NL4H 1EH5A 2ZETA 2RDMA 5KQMA 2X2OA 2ZQZA 3I5MA 5BOSB 3O3MB 3OOEA 3OIDA 4OGLA 2JVKA 4WLVA 4J3FA 2VUTA 1T8WA 4JLNA 3BAFA 1QE0A 4LBVA 3V1MA 2VS1A 1N92A 1JG1A 2ZRDA 4HB0A 1M6VA 2EL9A 3G8AA 1FXUA 5AXAA 1SBQA 3RYTC 4H15A 4OJYA 5FLYA 4TYNA 2QRJA 2ZATA 3LUGA 4NULA 4M21A 3ZIAA 2OO7A 1G9XA 2A94A 2GN0A 1KFKB 3K09C 3HXMA 3QVUA 4CODB 3GY0A 3K9FC 1JIQA 5A5DA 3TPFA 3BQ9A 4FFBB 1TT5A 1TQ6A 3MB8A 5KSPA 5JZ9A 2RGYA 1CUVA 3OECA 5EWLB 1R12A 4WZ6A 4CKWA 4DXAA 1XTQA 3JTEA 2D5LA 4N5HX 3PITA 1J1ZA 3D7MA 4QTZA 1MG0A 1CQJA 4PGFA 2XODA 1S5PA 1GRQA 4KXFB 1F51E 1UKYA 3IBTA 1S7CA 4FGLA 4OM8A 4AKGA 2XA9A 4PRLA 3T0IA 1MIOA 1UBLS 3RS8A 1B15A 3WKEA 1RCTE 4HUQA 2Q3FA 1U0GA 5KHAA 1Y3DE 2A84A 4MQFA 5MHTA 3VDMA 1KEKA 1FFDA 2GARA 3PPVA 3IV6A 4IDPA 3A9RA 3LUPA 1T9ZA 2PRKA 2E0IA 3PFHA 4XPIB 1YC2A 3BIJA 1FJGB 1OJ7A 2BFDA 1WA5A 3PQEA 3PU6A 3AF0A 3TX2A 4I4IA 2FJUA 3TQFA 1Y5MA 2RH5A 2JRLA 3JASA 4BNUA 4ZQCB 1AO0A 2VP9A 1NQOA 5E7MA 4AFNA 4KRGA 5H7XA 4QREA 4CV1A 1TJNA 2GPYA 4IW3B 1B76A 4N0PA 2WIAA 4RD0A 1GTVA 2YFYA 1T5OA 2XJ9A 3HSKA 4DAOA 2HUNA 4MYCA 1OYYA 3BRCA 3CWCA 1PW7A 3SYMA 1RZVA 1XLTC 4DG8A 2JGMA 3R77A 4DIFA 4H1WA 4BLUA 1D6MA 1JQ3A 1G98A 2YWXA 3S81A 2DQSA 2QUHA 3CLTC 4IHAA 4MK4A 3RC7A 3U48A 4BO7A 5JVDF 3U7HB 3SHVA 4NXMB 4JQCA 4H1VA 5DASA 4BVLA 5HRAA 4I4TF 4NP6A 1IOVA 1GARA 4Y9DA 2C3PA 2O8NA 3PC7A 5BW6B 4D56A 2BYTA 2BP7A 2IDZA 3LPNA 2DQKA 4HXGA 4RHXA 2C9CA 2JK0A 2ERXA 3G7NA 4J1QA 4ZMBA 4KV9A 1B3BA 1M1YA 3BJMA 3QEKA 3VOTA 1U7TA 4UFPA 1Y33E 1T8TA 4KPUA 4YV0A 1X6VA 2XOKA 3NEJA 4UCFA 3V8VA 4L8GA 3PWSA 2ZVDA 4HLUA 1RBMA 3LOQA 1N1EA 4KQIA 4XE5A 3FMGA 4D81A 1D04A 3HABA 3V48A 3SXPA 2YMQA 2QG6A 4BX0A 4DRYA 2QV0A 4B85A 4HDAA 4X1OA 1ZVMA 3SC4A 5DIFA 1EZ1A 1Q7TA 3L04A 2W6NA 1ZGZA 2BC9A 4CQNA 2G25A 1JL3A 1TLLA 4WK2B 3P45A 3BD9A 2YCBA 4AICA 3M2TA 2NT3A 2RKWA 4NHOA 1S0UA 1PQYA 4DG5A 1W29A 4FHGA 2OWDA 3JWIA 5ILOA 1E2NA 1XWIA 5J4YA 3ANXA 3U60B 4O0MA 2Q6OA 1U7UA 1CR1A 1JPJA 1YRQA 3C3AA 4ZVQA 3EUEA 4Q9JA 5IBQA 3S2YA 1KMCA 1WF3A 1ESEA 2ANCA 1SCBA 1RLUA 2GRUA 3DOCA 3IFSA 5IRCD 2IBSA 2QU8A 4KQJA 5ALRA 1K66A 1CRLA 3W78A 4KI0A 1EUDA 4B82A 2HRZA 5B3LA 5JS8A 1RRPA 3ZEIA 2A3RA 3M0EA 4RD2A 5DOZA 4XB2A 3CLUC 3S1AA 4BP8A 4BQRA 3ASYA 1K88A 2IPLA 4GZLA 4YCAA 5HUJA 3CF0A 1A9PA 1Y5RA 1HG0A 1FRZA 4M36A 4OVKA 4RM3A 2JCVA 3T4PA 2ZRPA 4S0ZA 1E3MA 4L7VA 3DLBA 1S2IA 1Y5IA 2G28A 3EMKA 4B32A 1PEYA 4MQ4A 3SE0A 3HR8A 2J30A 3QKTA 3KSRA 2PFSA 4WZBE 3E03A 1BA2A 2VI5A 2D8MA 1C3VA 3KTOA 3LHFA 2VYFA 3O92A 4Q9AA 5FXMA 4AS3A 5KMGB 2GBGA 5LQRA 5AOAA 3ZUPA 1XCBA 5GIOE 2O6HA 5JCXA 2D7CA 1KVUA 2FEXA 2YY7A 4ZI3A 1MHTA 1X94A 3ITEA 4CV3A 1CJKC 5EESA 1Y3AA 2FSHA 5IJ0B 2ZCVA 2KE5A 4JENA 4UW9A 3QPUA 4BVBA 1JQBA 2ZZMA 3E3MA 4LGVA 4HG2A 1YUNA 1JSXA 5FUMA 1KS9A 3JQGB 2IZOA 4MRSA 1JILA 1RI4A 2OORC 2QNBA 3C3WA 3FTNA 4ZWNA 4EA8A 1WCIA 4L0CA 1FIUA 4PX3A 3SHTA 4ZYXA 3EIHA 3RHFA 1JYSA 2ZJFA 3ZCQA 1B6GA 2I6FA 1IQUA 2C99A 2DHEA 1E0SA 2FZLA 2WICA 2VSQA 3LX4A 4M4SA 2ZJ0A 4QUKA 5G02A 3IL2A 1Z56C 5HF9A 2NTEA 1HE3A 1UMBA 2FG5A 3HJUA 3VTZA 5ES4B 1XQWA 2RHWA 4G5FA 3GAAA 2BF4A 3NOVA 3X1JA 4CKWB 5A4IS 4UAJA 2GAOA 3M49A 2UUCB 3NUZA 1V39A 1CQJB 3NS7A 2C7OA 1U0BB 3K5IA 4MUJA 4P5PA 3OZGA 5A2GA 2GPSA 3G2QA 5HNKA 1E1RD 1UL1X 3I1FA 4XJSA 3KKOA 4S04A 2PLAA 2AG6A 3TTUA 2A7XA 4RCYA 1WMDA 3AFMA 5HIJA 1Z6XA 3HYCA 1NN3A 3WWEA 1AG9A 5JI3E 1CIVA 1LS1A 1T0UA 1U6IA 2A14A 2Q0HA 2YASA 2ZRGA 3BWEA 3EPRA 3PE4A 4D3XA 5C35A 4MTLA 4PYOA 4HY3A 3LHSA 4FBMA 1N8KA 1Z36A 3AJRA 2BFDB 2MHCA 2YDXA 1S3FA 3R0VA 3TLGA 4B0OA 1WETA 3NDJA 2RK6A 2Q7XA 5CYGA 3EGIA 1ZGGA 2ZI5A 3ZZUA 1T1RA 1VJRA 3DYIA 3FNIA 4HKTA 1NU8A 2O0MA 3CCBA 4J49A 4MWTA 5KYGA 2OAQ1 4IV5A 4KGZA 4CV0A 2MDTA 3ND5A 3L6OO 1MB2A 1MA0A 3FWHA 2C00A 4CG1A 4DAEA 2ZIXB 3TEJA 1Z2EA 1YB5A 3TIGA 4BNKA 3U7FB 5LIRA 5EKDA 2NYRA 3MWJA 1EWTA 3H6GA 3AVTA 1L4GA 4G07A 2J87A 3ETJA 3NVDA 2WYWA 4O4IF 2O0LA 2OM2A 5JMWA 5G3ZA 1JHPA 5I47A 2V7BA 4KR6A 3BTSA 3HB4X 4C4YA 3GRFA 5EXDA 2CLHB 2DH5A 2YICA 3ESYA 1E8MA 4U2BA 5IH3A 1EP2B 1WB6A 2P2DA 1Y6GA 3WP1B 2NXJA 1M1YB 3EQ6A 4TSRA 5AJUA 1BJTA 1FYEA 3WDKA 4ETIA 4DCTA 5TMDA 4QPPA 5M7EA 4KPUB 1GG9A 4IBOA 1SU8A 1L5HA 1YJ5A 1ZMBA 1N5MA 1RWPA 4MW9A 1RAHA 2B4QA 1SBHA 4HBGA 3HTXA 3D31A 2WJVA 4DYHA 4NH0A 1LTKA 5IYZB 3OEHD 3IESA 3NAZA 3GOQA 4D45A 3EGDA 2YWRA 3FCOA 3LTEA 2X2PA 1MG5A 3LUFA 4HXFB 4B4WA 1R10A 2HNKA 2OBMA 1GZ5A 3W04A 4F3KA 1UC8A 4KMSA 1RKQA 3TAHA 3BMQB 2YC2C 3N7UA 1ZSVA 2A8YA 3ZBTA 3KP1A 1WB4A 1Z63A 4MI3A 4UPVA 1ISHA 1UBMS 2AN3A 2FWMX 2H9IA 2NSHA 2IYZA 2YJTD 3R6DA 2Y05A 3SQLA 2IPNA 3VR1A 3ZU6A 3PT5A 5JMTA 5LVAA 2PLWA 5HP4A 2ONCA 5AM2A 5F76A 5GADl 3QKRA 3FGPA 1U2RA 3M6FA 3T1VA 1ZO8A 4NU6A 4F04A 2ZJYA 3R3VA 4DEXA 1Q84A 2VZ0A 4DR3B 3ETLA 3OFNA 2N47A 3K0FA 4U6NA 3NALA 3RRMA 5FL7D 1RC1A 4DA4A 3GT4A 2PS0A 4LRSB 4B80A 4MR9A 4YCCA 5L3QA 1TJ3A 2ACVA 1F38A 1HE8B 2VEDA 4I6GA 2OO5A 5DXAA 4B2YA 1MN6A 3IAM1 4OCZA 5E6SB 3T0GA 3BE5A 2IYSA 2EYQA 2NV2B 1M1XB 3ZCXA 2I34A 3U17A 3RSOA 1IDN1 3KVOA 3F8WA 4TXHA 5ALNA 2D6FA 1G5RA 3WFIA 2FYTA 5KQLA 3JQAA 1GRNA 3ACCA 4UM5A 4UU0A 4CLHA 3NVAA 3SZ3A 1ZH2A 5I8WA 3IV9A 3ER6A 1PKXA 1YJ8A 2A3NA 3G2HA 4QAJA 3HYSA 4UZSA 3P2JA 4MZDA 1C2TA 3O8LA 4IWNA 4F3TA 3X1WA 4C4XA 3TZBA 1W1IA 4GPIB 4JLVA 1XJ5A 4GX5A 1IZYA 5ALIA 2IYPA 3I4CA 2Q7DA 4AWXA 3GZTB 1N4DA 5H8WA 4RX1A 1V3UA 1P7WA 2QR3A 3A3KA 4HH1A 3L7CA 2Q0XA 4QPJC 5D00A 5HKKA 3PHHA 4UDYX 1IXYA 5A7GA 3DM5A 3H2KA 3N39C 4TQGA 1BDHA 1WCIB 5EOVA 1MDFA 4C2UA 2RHGB 4ZYWA 4TZKA 5CA1F 2DFDA 1KPHA 3GZJA 2A0UA 1UJ5A 4I6EA 4I08A 1TMOA 2NVUA 4QOGA 4R1TA 4XQ9A 3UGTA 1B8NA 3L8FA 2X2FA 4B4VA 1UMBB 4N3GA 4NX2A 3KKNA 1NDQA 1IXKA 4XSHA 2GEJA 1G8SA 2P2LA 1ICEA 3IO5A 4OUKX 2RBKA 2V97A 3A4NA 4P4NA 5F7XA 1X7DA 1Z15A 3AU9A 4YCSA 1XMOB 4ZU1X 2PMWB 2QZJA 3E53A 4BU0A 1V47A 2YZKA 4G0XA 2EQAA 4HBZA 4U2CA 3G9ZA 3P9XA 5F3WB 1O08A 1C4OA 5A3JA 2D1FA 4M9SA 5FWYA 1ZR4A 3F6BX 2B30A 3BZWA 1O54A 3IQZA 1BQ4A 3FBTA 2FFAA 1GDTA 4JXZA 3ZDDA 3NH9A 3U4IA 3OBBA 2CB9A 4NRDA 1DELA 2IU6A 3FDXA 3ZCTA 1Y81A 3T3PB 2QBYA 3VR4D 4MVJI 6ABPA 4MYSA 2PT9A 4CG2A 5JZBA 3N1UA 2FUNB 3RSSA 4WFKA 1L4NA 3C3BA 4JLKA 5T41A 4QUHA 1XXHE 1BU8A 2C2ZA 5EINA 2BUBA 5FO0A 1LW7A 3JR7A 3RADC 3TQTA 2YH2A 1COWD 1VHWA 2WTBA 3L8HA 2DT5A 1NR1A 3D0QA 4JNKA 1JQKA 1AE1A 4Z8XA 1TUBA 4EDFA 3GLGA 3MJSA 1FFBA 2QTMA 1Z4QA 3IBGA 1ZI6A 2BEUA 3EN0A 2C4WA 2Q6TA 4JT2A 4RU1A 3RIHA 3I62A 1XU4A 3TZEA 4CETA 3PWTA 2VDMB 4AXBA 2W6ID 4B2LA 1R37A 4JJZA 4ZPJA 1NT4A 1CQIA 1RKVA 1YRAA 2BV3A 2XQKA 1Z25A 4WRRA 2QMOA 5IVDA 5FORA 2C84A 3UQZA 2VJDA 4ZTUB 1WX1A 2MR5A 3PJRA 4Z4FA 4Z7JA 1Q3TA 1MP0A 4MYDA 2FNAA 5JZVA 4CM8A 2JKZA 4GWLA 4LHVA 2AJBA 1SZJG 1P77A 4ZU6X 1ZM7A 1BU5A 1PT8A 1GRCA 4Q21A 5HJ5A 3RB8A 1NWCA 3F4KA 3HUEA 4P36A 4UBMA 3Q8KA 3PQFA 4FS8A 5EZYF 1QYVA 1L5HB 1H1LA 1DAIA 1KXZA 3MTBA 2YR0A 4IPTA 1N9GA 2GPTA 2O8BA 2CWDA 3I0NA 1UXHA 3ZNOA 4G8CA 5EIEA 2BGKA 3D2AA 3BHNA 4HX5A 1G6HA 4R5MA 5LQKA 4BYMA 4DLTA 1P7CA 4GI5A 4Z2AA 5KPJA 2JLYA 3A6EA 3EGDB 5EJEA 3PQCA 1BCRA 1AXGA 2C4NA 3FNQA 3WNZA 1U9IC 4BKPA 2HU2A 3FE2A 4FFOA 1FSFA 3CEPB 3QBEA 3Q3HA 5DN6A 3W3ZB 3WYAA 4RH3A 2JFUA 2Z6UA 2GVDC 4FFVA 4F8YA 3MCWA 4BNLA 4IXDA 1HDZA 4BO9A 4KQ9A 1GITA 2PN1A 2C54A 2PRSA 3LT5A 3KHTA 5DX0A 1JSCA 3WO0A 1RLTA 1U7PA 2XT0A 1YR6A 2ZRAA 1GVHA 3B8EA 3EA0A 3EOAI 2JJ2A 3L18A 1VGRA 4W8GA 4A92A 4E7PA 4ZDKA 2XWSA 5BMVF 5DYIA 3W5JA 5JPDA 1IHYA 4M76B 5IAOA 3WAKA 4XOUA 2QGFA 5BSWA 5K8IA 2BGMA 5KUTA 5DNWA 5CCBA 3H4MA 3P7MA 1RZRD 4AG3A 4PV7A 1OYWA 4O5AA 4WXMA 2X42A 5DRTA 5JS2A 3R0XA 1RIIA 5JZOA 5KYKA 2W2MA 4X1KA 3DWEX 3EPJA 3KKQA 2WU1A 2PYZA 3JYNA 1IN7A 3MRTA 1M2VA 3QX9A 5H3LA 3VJMA 1VL5A 1EWRA 1U0FA 3G5MA 1DC6A 1KH3A 1NW9B 1NJSA 3OPYA 3D4NA 4RZUA 4ZVMA 3SQXA 4L9WA 1X3SA 3I1IA 3IC5A 1LNQA 4OQLA 3IUBA 3OIGA 4RMJA 2GK6A 3CS3A 3JQAB 1X14A 2LXNA 3K1ZA 3QA9A 3OKAA 1V9SA 1V8OA 3U7RA 2IOFA 3LQRA 1WL8A 2IXFA 1R6VA 3UC5A 4ECAA 1U8FO 3BULA 4KR3A 3QOYA 3R2JA 1TD1A 2OOSA 1PDOA 3HDGA 1UPAA 4HAXA 3ROFA 1THMA 1JG6A 4QUAA 4YRIA 5ERYA 4DM4A 1Y1KE 4ZO4A 1XTZA 1GNSA 4RV9A 1LEHA 1C7IA 3QA3E 4UEQA 5CXXA 4TTVA 4DC0A 4TWBA 2AR9A 1QIJA 1O6FA 3T1QA 1IPEA 2AF3C 2UVDA 1MABA 1V3VA 2H1IA 2KQUA 2OFFA 4YPVA 1S96A 3KQHA 2I33A 3W2IA 3TMAA 1P17A 1HE4A 4Q12A 3OU2A 2WP8J 3G49A 1E3DA 1HLFA 1CK4A 5FOTA 5JMPA 4BFZA 4BRWA 5HYVA 1ECFA 4Y1RB 1JGTA 3I2JA 4X1YA 1JT2A 5ALGA 3MCZA 2PXCA 3HXLA 3PPWA 4IGIA 1HT0A 3UF0A 3K70B 5D84A 1TUGA 1QH8B 1SB9A 2ZI7A 3ORSA 3PR3A 4JI6B 3WIVA 1ZVQA 3L9WA 4PTLA 2RJNA 1QIIA 1XVIA 2HK7A 3EMVA 5DCLA 3U3KA 2F43A 3ORHA 3E9NA 3M7IA 3OSUA 4CCYA 3FKQA 4ZCMA 2G36A 1JNXX 4A03A 3ZBUA 4BGIA 3TNLA 1DKQA 2PMBA 1X7XB 4I4NA 3RGWS 5CNJA 2Q6KA 5CXSA 3R3YA 1Q1QA 3FNEA 2FG7C 4KQ1A 2XWJI 2C9BA 1YIAA 3WNQA 5JSZA 4L2IB 4W6QA 2HHAA 5T4HA 1BHQ1 4OXIA 1UJNA 1KYYA 2TMKA 5GJBA 3REGA 2R8BA 3QUQA 6GPBA 5JDIA 2DR3A 3K71B 5C8YA 1MT0A 2ESRA 5CXQA 3SXJA 2X9GA 1YMQA 2QR2A 3N58A 4IDQA 4IGAA 2E1PA 3S55A 3HC7A 1BGVA 3ETDA 4C4AA 1PQWA 1ILWA 2PS1A 4FDVA 4DQDA 4XIFA 1J99A 2RK4A 4FQ8A 1PZXA 2C5EA 3IUPA 5P21A 4C7VA 4X92A 5K4HA 4RXMA 1TMKA 1RYBA 2MINA 1SD5A 1TUBB 1FYFA 5KZMB 3HVHA 2BEUB 2OP0A 4C5AA 3E05A 2XTMA 2VH1A 3O21A 2XGJA 4JVOA 4KQXA 1AUPA 2I80A 2JCSA 2ZVQX 4IDGA 2DBVO 4NY1A 2FGJA 1YMUA 2VK8A 3V2GA 3BFPA 4IUBS 1U4OA 3GP5A 3D8NA 2CV1A 2C42A 1I1HA 1YK1A 2XMPA 3RS5A 3THSA 4HNTA 1W2GA 2NYUA 1VMEA 3KE8A 2IYVA 4CF7A 3GJQA 5MFPA 1UT8A 2YWJA 3I2YX 3SFVA 1DKUA 4QTUB 2XE4A 2XUKA 4LY3A 3FNHA 1U3UA 2EJBA 4LJ7A 1NG9A 4RHEA 3E9EA 2H1FA 1E4OA 1NX9A 4Q4HA 1TMYA 4CM8B 3LFHA 2FN8A 1KQFA 1JH9A 3QKUA 4ZK6A 2X1LA 4ID9A 4UVDA 1D9XA 4KBFA 2CE2X 3TM5A 1FRNA 4YMVA 4PYNA 5MN6A 1H1LB 2RC6A 2O8BB 3ZS8A 1YJCA 1CF4A 4KKXB 1E4EB 2ISQA 1ZBDA 2P1RA 3CF4G 3GI1A 3OZRA 4MI9A 1CNMA 4RLFA 1U1DA 2PTHA 1W49A 5EIWA 4NOLA 2IYNA 2ZYIA 4F7WA 4TRJA 1BCRB 1EEHA 4S12A 5FI5A 5FKJA 3UJAA 4HT3B 3W3AD 1SMKA 3DB2A 3QPDA 5I9IA 3BB3A 2EJTA 2M1XA 1FUKA 2VXOA 1Z73A 4RS3A 1L4MA 3AF6A 3HWWA 4FB4A 3HBFA 3MPOA 4JB8A 4QBHA 3ZXSA 2J32A 2AS0A 3TIVA 1YASA 2QJOA 2P0YA 1HG1A 4M0CA 1QYXA 1UH5A 2VSYA 1SURA 1KWKA 1Z74A 1NDHA 3I04A 2VG8A 3O8NA 2FPKA 2CY0A 4NYMQ 1RVV1 1DDIA 1UIRA 1XOIA 2VSXA 4ITUA 3KFXA 1USWA 1TYBE 1Z5UA 4LV8B 2W71A 1U8EA 2J0UA 1T2EA 4DIEA 4EPVA 1B1CA 2QP4A 1DQPA 4I1YA 5FOVA 3DBIA 4D92A 3MCUA 4LGCA 3R7AA 4X1KB 2CL0X 2Z8YA 1W88A 1JIJA 4GO1A 1ZVKA 2DGDA 4LYEA 4ZDIA 1G19A 1B2LA 4GZ5A 1ZUNA 3EDQA 3WKAA 3FWZA 1CDEA 9LDBA 1JTVA 3BHJA 4MHSA 5JDCC 3TLEA 4U2FA 1GCUA 3GA7A 4AUMA 2JS7A 4UU8A 4FCTA 1S4MA 3DVRX 2PKQP 4G0QA 4OHZA 1PL0A 5E38A 1FUIA 1G8MA 1YTLA 1OTHA 3KBBA 3LSTA 3NHFA 4UJ3A 5KKAA 5IPFA 2CHEA 5FFMA 2IE0A 2V4MA 1RXSA 3B12A 3BTVA 3KUCA 4OY3A 5AM4A 3A31A 3HEMA 2YMMA 3GVCA 3S3TA 1MO5A 2AXQA 2X0NA 5TT1A 5F5XA 4IMIB 2RHCA 4LDRA 2BKAA 1ZYUA 1MABB 2FRDC 3DZKA 2HNAA 1Z2PX 2RH8A 3ZWAA 1ZH4A 4HFRA 3PUKA 1OTYA 3SX0A 1F2UA 2QSUA 1TNDA 3PNKA 1WF6A 5FJJA 2FG6C 4GKBA 2IZ5A 3Q0IA 2BLNA 4RPJA 3T3MB 1QP8A 4DUYB 4JX9A 3N8IA 1JMKC 2DWQA 4HN2A 4MUHA 2Q9CA 2DWOA 4R9NA 4TLCA 2YL2A 4N47A 2CCJA 3RQIA 4HATA 2DM6A 1EESA 1EFLA 3TQCA 3PCRB 1L5FA 5K03A 1KY2A 1SUBA 3N6XA 4BV9A 4LJRA 2O23A 3HCDA 2AEEA 4UEWA 2CT8A 3F9IA 2FPUA 3R3JA 3C48A 1NBEA 1CQZA 1UMCB 3ND8A 5FAXA 2B8WA 2AC7A 3K72B 3KV3O 3NANA 1UFKA 2F64A 1VG8A 2GT1A 3PUIA 4FMCB 4AROA 1IN5A 4E2WA 4XASA 1K68A 2W90A 4DMGA 3OTGA 2D2XA 2RMKA 3TTYA 1A9RA 1CS0A 1FXWA 2WNIA 2FMXA 4FHFA 1DXYA 1N3YA 2P0AA 3UJPA 3N7AA 4B0PA 1VOTA 1JF8A 1R4MA 4M0UA 3F3YA 3JQ7A 1N2GA 1G3RA 4EBBA 1VMIA 1OR8A 5EL0A 4ZC1A 4QYTA 4BKOA 4FWIB 2IYRA 2RHHA 4D5EA 4JIGA 3ZDQA 4PX2A 1QH0A 1J97A 3BX1A 5ALYA 3M6XA 2XYRA 2BM9A 3DV9A 1TRHA 2LTAA 4ROSA 3QBJA 5JMOA 4DA6A 4ZQFA 5G4KA 1X2BA 4MQMA 4E5VA 1K8QA 3B1JA 1M1ZA 1LPAB 2AE2A 3L4KA 4EB3A 4NXNB 3MJDA 3K0BA 3AR9A 3A6KA 2JAOA 1YB2A 3KQSA 3PPYA 5JAQA 5DBEX 1RRMA 1TKCA 3H1EA 4Q4HB 4MLPA 1P45A 2CNDA 2WJGA 4C43A 3EPKA 3AIIA 2UV8A 2NZUG 3LHIA 5DYNA 1B8OA 1IN1A 5TY0A 3L01A 4E94A 1KBZA 1ICIA 2A5GA 4ZV7A 3I6YA 1ATZA 1U2ZA 4AXXA 3DKPA 4HVAA 2P6MA 4DVGA 4YP5A 5D6OA 5CDFE 1ISSA 1TJ5A 1X1BA 1GGVA 2O2HA 1M72A 4M88A 3EA5A 2BEWB 1E1RA 1ZMXA 2A0WA 2PWPA 1NWHA 1QHEA 1TB4A 3C7TA 3OY7A 1KYVA 4PE5B 5COAA 3ZHSA 4B44A 1A4IA 4G8DA 4NPCA 3UMMA 2XIJA 5DBFA 1FTNA 1R0XA 4B7UA 3EULA 3BICA 3FTPA 4UQLA 2C0QA 1QP0A 4V38A 3PNSA 4KMRA 3C4JA 4OP3A 4RF5A 3ZU3A 3K1YA 1DG9A 1P80A 5J2TA 3L7MA 1JIXA 1O9HA 2BL4A 2FU5C 2QX8A 1P9NA 3CHYA 2J9XB 5AK6A 4JJIA 1SCDA 4QJ4A 2O8DA 1ZD3A 1QBGA 1AHHA 3HVRA 3P0IA 4DL9A 1XD2A 1GUDA 1LWOA 4MQBA 4B3SB 3DHWC 4NDZA 4UZEA 1PFGA 2BN4A 3ZVKA 3DMHA 4CTKA 3SKYA 2G5PA 5BSEA 3HCWA 3RWOA 5HM8A 5JAMA 1BS2A 3ZJTA 1E3LA 1EFPA 2DKFA 2HREA 2QJRA 3KJEA 1P61B 3N0WA 2KBFA 1TYAE 1WEKA 3MWFA 4HEA1 4LHSA 4A26A 5A4AA 1SEVA 3DTYA 1D8TA 1GL7A 3HKEA 4FMDB 1VC2A 1E2DA 1D2GA 2J0UB 3LH5A 3LTNC 5AJXA 4I6JA 1G5FA 2XLCA 1AN9A 1CUGA 2XYGA 1DMRA 2BGTA 3P1JA 1RM3A 2E4XA 3HH8A 4MV0A 4PONA 4GM0A 4PFQA 3ZHRA 3TJRA 1E5QA 1WMSA 5KYUB 4Q5IA 5B6PA 1FDIA 3KFVA 4BGVA 2IUUA 3OE7D 4H2DA 5FP0A 4B8ZA 2VLIA 4PTZA 4CKEA 4JGIA 2IYOA 1ZUNB 2WOOA 1CQPA 2F1RA 4EUEA 1DHRA 3L7JA 5LP6A 2E21A 3R7DA 3HYNA 3KZOA 3RK1A 1Q44A 3CNHA 2A5JA 2X77A 4BB6A 1A98A 4LXGA 4DA7A 1RBQA 4LY0A 1SGWA 5JS6A 4OGFA 3I8SA 4HB2A 3T7AA 5IF3A 1A88A 2RGBA 2Q8QA 3L4BC 1QF7A 1VMAA 5CH8A 2CXHA 3OEHA 3CINA 3KJXA 3HVKA 5EMHA 3VYVA 1VL1A 3ZE2B 2PGDA 4Q34A 2IP2A 1O94D 5CK5A 4UFNA 1P2SA 4EW1A 1NXPA 1T0IA 3TXAA 5ICCA 2WFZA 3EH2A 3WHIA 5HS4A 1F2UB 3PD1A 2PVSA 3DJYA 5ALUA 5KVSA 3QU5A 4AMZA 3LE8A 2DT8A 1TA4A 2QW8A 4O2RA 2O8VA 4JOQA 2DU8A 4ARUA 1Y34E 4MV3A 3ZN2A 3ZDZB 4JITA 4CF3A 1TTTA 4JBXA 4KV7A 5C5CA 3C8ZA 4ZVVA 4S0XA 2H8GA 1A9XB 1YRWA 2ISCA 3FF1A 3FYUA 1EBUA 2C3YA 3OX1A 3TZCA 4WL0A 3ZHBA 3T15A 4NCXA 1NQ5A 2Y1KA 1ECJA 1Q20A 2WWXA 4F7DA 4AF6A 3A1SA 3HZHA 2NU7A 4JUBA 3C5WP 4B87A 2VDUE 4K03A 2CXSA 5HDQA 3BZBA 2GDJA 5FL7A 4CYMA 1H6CA 2YWEA 2G67A 5GJCA 1OLUA 4OAQA 4BE9A 4ZAYA 1CQWA 1I33A 3WLQA 2W6CX 5IBPA 1OX6A 2FPXA 4R68A 1W76A 2YVUA 5FPKA 2Z1MA 3GWGA 1BX1A 3BHMA 3WLNA 5ENZA 2Q8PA 1E69A 3D7RA 3FMVA 1Z45A 4I1VA 1SUCA 4QUGA 4YP1A 1Q74A 4LXIA 2AMYA 3OIUA 3SC3A 4KWHA 4N7BA 4Q3AA 4EYOA 2IOQA 1HI9A 4IH9A 3W6UA 1VECA 2PM8A 2X3FA 2W5UA 2Y1FA 3WB0A 3JZIA 2HLPA 2NAFA 1Z29A 3E6AA 2JRCA 1T5DX 1K8YB 2ECQA 2QZPA 3E9MA 3Q6NA 1Q83A 3QH4A 4PYIA 4WHMA 3ZTTA 4A10A 2GEKA 1HDGO 1R5JA 4OLHA 4COOA 5C5IA 4XOIA 1MZPA 1POWA 4O3MA 1V2HE 1YS6A 1YH3A 3HJGA 4F45A 4NZZA 1I0LA 4PLWA 4PNZA 2D7JA 3OESA 4TMFA 4IGEA 4LPKA 5G4KB 3S28A 3TE6A 2WAOA 1PYDA 3KU1A 3CZCA 3AR8A 1M0WA 3RVOA 2G1PA 1AGYA 3EXFA 3OZIA 5HK8A 5I4BA 2KW5A 1NP3A 1XV5A 2V7EA 3MOGA 2XUIA 2GPAA 2IXDA 2OMEA 2QQ5A 4O1HA 4Z1OA 2DLCX 4J16C 1WV1A 3NU1A 3WHLA 4Z4HA 1U2DA 1YZHA 4W5NA 1KK1A 2BM1A 1ZICA 1RAGA 4TN5A 4A73A 1G7RA 1IHXA 2L42A 3CJQA 3T1TA 5A62A 2NAPA 4XRRA 4CCSA 1EVKA 1JFVA 3E82A 2XAAA 1MX1A 3WMRA 3ZDCA 5DNAA 4NIMA 3VH2A 3LZCA 1Z4KA 4IICA 2VSNA 5I5EA 2WINI 1XQYA 1RHJA 1ML4A 4MVJA 3WL7A 3L7OA 3VGJA 3NMUF 2OCXA 4GLFA 2R62A 3NBQA 3TVDA 5C32A 3VR4A 5JBIA 1XA3A 1DTWB 4TL8A 5AKHA 2O8DB 2HCJB 3WZ2A 1R6XA 1D0SA 4RZSA 1EFVA 3AJ8A 3NOQA 2QPLA 3CU5A 4Y6OA 5DTMA 3DDZX 4PZYA 1U8AA 2RI1A 5TGZA 2EKQA 3PDJA 2BSQA 1Q0TA 4LNUA 1E1DA 3DL0A 2PWYA 3AEQA 3FUUA 1LDEA 4K88A 5A02A 1UDRA 1YI0A 4DCSA 3B85A 3C3KA 4P53A 3AESB 3IAS6 2WSLA 3HA3A 1LY1A 2A1IA 4O1MA 2W6IA 1B93A 3QM1A 4F5EA 3NLLA 2DWUA 2NZWA 4I9GA 3CZ5A 3RU7A 4KQKA 3WSWA 4PSUA 1NBOA 3LC2O 3D5QA 1X8LA 1WW2A 4PZ0A 4Q7MB 1T9CA 1XU7A 3LWZA 1ODCA 4ZOLF 2OAGA 3VBCA 3HKCA 4YALA 1ABBA 3A4YA 3JD1A 4MA4A 4Y2RA 3RFXA 3NIWA 3GHHA 3PTZA 4GXNA 1F6BA 2P30A 3PHGA 4G23A 4L0QA 4RACA 5TSDA 2VOEA 2HA6A 3JR3A 4QA9A 5LP6B 3IUMA 4CIBA 4MUYA 3VDXA 4FK8A 2CF5A 4FXOA 1PG5A 1NF2A 1YDGA 4PC6A 4X6XA 1LX7A 4AQDA 2RCNA 1LW6E 4KFSA 1XRPA 5CYOA 5EE0A 5JLJA 1PGPA 4F2HA 5IK2D 3NOXA 5A1TA 2IC5A 1MORA 4BP9A 3HCRA 4ZCRA 1G5QA 2VXYA 4ZT5A 4DDVA 2IYXA 3QG1A 2TMDA 2A59A 1S8FA 2OCBA 3HJBA 3QXCA 4PQRA 3RVKA 4DMRA 2HZ7A 2Z2KA 3RLFA 3DL4A 1H0KA 5F1KA 3A1FA 3IILA 3HU3A 4KYUA 5CGZA 5JLAA 3H9CA 3VTKA 4GU5A 4TUYA 3PG5A 4D9HA 5ADHA 4NQZA 4BX3A 3RUHA 1B00A 1VL8A 1UZLA 1VE5A 5KDOA 3SS9X 3CF4A 5ICMA 1NVWQ 1QIHA 3SLRA 5LZ5A 2IH5A 1RI5A 2WIFA 4MKIA 4II3A 1V9LA 1LI7A 5TT0A 2PA3A 4JVLA 3D43A 3FYUB 1GIAA 5IBCA 1GPUA 1U99A 3KYJB 3VKWA 2AOXA 1CJUC 5A05A 3V3KA 5GGXA 5IVIA 1FE8A 5G0TA 4CKBA 2BI4A 1ZRHA 3CG4A 1OLUB 3T7TA 1M67A 1J22A 1OH8A 1UKBA 1UBSB 1ZJJA 1QIKA 3CH7A 3B9BA 4X8OA 3NHSA 3DGEC 4LHYA 1KKMA 5CYPA 5C1PA 1JG3A 3M2PA 2FR8A 4C0HA 1Y7HA 3FGNA 1FFSA 4GL4A 4RK1A 5L95A 1ZM9A 3JAKA 2DUWA 3NDPA 3SI7A 4HTFA 5CB4A 3H5OA 1NP6A 4Q3EA 2WFAA 5CFLA 3AR3A 2YYSA 1K9VF 4R1SA 4K6FA 3SDBA 1RFGE 4O2AA 3RRZA 3QZUA 5H9WA 1ODJA 1PW5A 1RHQA 1US8A 3D0OA 3UB4A 4BTVA 1TM5E 1JWBB 4IKEA 4D7AA 3TFWA 6YASA 2ZIUB 2AEMA 3BGDA 3G6WA 3V6MA 3HKDA 3O9ZA 5A5EA 2OAEA 4KQWA 2I54A 2IHUA 1SBIA 2VL7A 1U6KA 2OXRA 3U81A 3WRXA 4ZKEA 5HR5A 2FEWB 3WIBA 4UCWA 1N7JA 3G2LA 1SFRA 1GTG1 1XWWA 2K87A 2CL6X 4PGAA 3DAHA 1ONBA 2C88A 1J90A 3O4HA 3KHSA 2ZB4A 3WHPA 4DRXA 3GPLA 1ZVVA 1FFXB 1LLQA 3EXFB 2BFEB 3RVQA 3WYDA 4HFMA 1BWRA 1I2ZA 3EQ9A 3JPYA 4LSWA 4MAMA 4B40A 5JQGB 1WABA 5KI6A 2J0SA 5D5HA 5B7GA 1M34A 4LK2A 1RWBA 3LW8A 3GT7A 4DA8A 2HHLA 4JLAA 2ANBA 4CM3A 2JCGA 1NVBA 2Z95A 2EQ5A 3LQFA 3KTDA 4V0OA 3RNLA 3GROA 1UJ2A 3R4VA 5L3ZA 1RJ9B 3KWJA 3E35A 3QKSA 2MSEB 4Q1CA 4US0R 3WIEA 5C3MA 1GYRA 3GW8A 3AF1A 3H0EA 3I6ZA 1G3IA 2ZB2A 4QXPA 5AT1A 1RYNA 2OESA 2PUTA 2R65A 4I9HA 4KN5A 3FIUA 1WUJS 1BVUA 4G3XA 5DU2A 4IXMA 3WGMA 4RDXA 1W94A 1FU4A 5J40A 3RF6A 2FSVC 1Z7YA 3JQ8A 3NORA 3VSEA 1XK7A 4LBZA 2GZDA 4Q4JA 5FULA 1EFVB 2C4VA 3FTQA 5CCEA 4NFHA 3KVRA 1VLZA 2ORVA 3VVMA 3KQVA 2NTVA 5K0SA 2COEA 3U1TA 3BDAA 3H1TA 1Z4OA 3JRXA 4Z0PA 4JLSA 5EPOA 2P40A 3LF2A 4GRAA 4L8LA 4ZVNA 3DZBA 2W98A 2Y2VA 5FPHA<