4G81A

Crystal structure of a hexonate dehydrogenase ortholog (target efi-506402 from salmonella enterica, unliganded structure
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
253
structure length
253
Chain Sequence
b'ALFDLTGKTALVTGSARGLGFAYAEGLAAAGARVILNDIRATLLAESVDTLTRKGYDAHGVAFDVTDELAIEAAFSKLDAEGIHVDILINNAGIQYRKPMVELELENWQKVIDTNLTSAFLVSRSAAKRMIARNSGGKIINIGSLTSQAARPTVAPYTAAKGGIKMLTCSMAAEWAQFNIQTNAIGPGYILTDMNTALIEDKQFDSWVKSSTPSQRWGRPEELIGTAIFLSSKASDYINGQIIYVDGGWLAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hexonate dehydrogenase
publication title Crystal structure of a hexonate dehydrogenase ortholog (target efi-506402 from salmonella enterica, unliganded structure
rcsb
source organism Salmonella enterica subsp. enterica serovar enteritidis
molecule tags Oxidoreductase
total genus 100
structure length 253
sequence length 253
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4g81A00
1X7GA 1WDKA 4G65A 2PKRA 2GN4A 5C3MA 3WQRA 4W9NC 1ZSNA 4CMAA 3V1YA 4LRTB 1J49A 2UYYA 3C8MA 2O23A 4E4YA 4IXTA 3GMSA 2YHUA 2EW2A 3HB4X 1YL7A 4U5QA 1MUUA 3PFFA 5G4KA 3DMTC 3UGKA 1MP0A 4H15A 1W0CA 5MGBA 2FZEA 1CJCA 4E2ZA 4LN1A 2NSDA 1NPYA 4F45A 1ISMA 4GSKA 1EK5A 1J5PA 2DUUA 4CR6A 4CR8A 2VTDA 1I8TA 3JTMA 3PGXA 1T1RA 1C1DB 1GQYA 3W6ZA 1T4BA 3GDFA 4HBGA 4BIIA 2TMDA 3ZV6A 5JYEA 5KWEA 2BFMA 1NP3A 2NNLD 4LCEA 3ZI0A 4IDEA 5IN4A 4PLWA 4MVJH 1YO6A 3RKRA 1YBAA 4DGSA 4QTZA 4PG5A 2OBNA 1X14A 1KS9A 3LVFO 1OC2A 1EK6A 3LZ6A 3OMLA 3PYXA 1ZZEA 3LC1O 4TMFA 5BQFA 3BTUA 1LSSA 2NVUA 3H5RA 4X54A 5JCJD 4OQYA 4RF2A 3MJ4A 3PIIA 4I9NA 3PPIA 3V1UA 4R01A 4DBZA 4XQEA 4D0RA 3QWFA 3AY3A 3ZNQA 4OOEA 5ER6A 4BKOA 2F00A 4Z9FA 3OICA 1EQ2A 4W9NA 1PZGA 3GY0A 3ZHXA 4LK3A 1JKFA 3H3JA 3ZGYA 1YOVB 3VZSA 3I9NA 2LDXA 1XR3A 3QWHA 4IJVA 4NHEA 3ZZNA 1AHIA 4RVSA 5JE8A 3ABIA 1DOHA 2FZWA 1LQUA 3DMTA 3SC6A 2GO1A 2YFHA 2VYNA 1HE4A 3I23A 2W98A 4PZEA 4BNXA 2W90A 1TB4A 2BD0A 4J1TA 3PDJA 1B3BA 2JAHA 2HAEA 3INGA 3DB2A 4K28A 4DXHA 3SLKA 1SEPA 2QQ5A 3D3WA 4K26A 3L9XA 4MJLA 1GCUA 1LDBA 4XD2A 2O2SA 3WICA 1RM5A 2YFQA 5JSFA 1DRWA 4CMEC 4DYVA 3HNPA 1CYDA 1R0SA 2E37A 2ZYAA 3ZWXA 3GGPA 3RC9A 4GAEA 1WWKA 2JHFA 3MCVA 3OIGA 2PK3A 5I7VA 3EYWA 4MVJG 3EAGA 2DFVA 2GR9A 4ID9A 2C0CA 4WEQA 4YJDA 4YJHB 2WDZA 3DBHB 3BMOB 4OKIA 2Q1WA 4RVGA 4OKNA 4CM8B 1MFZA 1PQWA 2DBQA 4GLOA 1ENYA 4J3FA 1LX6A 4RF5A 2AQIA 1ISGA 5C37A 1E1MA 3L07A 3QV1A 4YJGA 2CDCA 3OJEA 4WLUA 1DB3A 1ID1A 3HSKA 2W2LA 4U0JA 3WIDA 3D1LA 1XLTA 3AOGA 4FR5A 4KP7A 3BZUA 5ENVA 5LC1A 4BQRA 1U5AA 1VI2A 1A7AA 5TX7A 5ICSA 3HG7A 1WDLA 2GGSA 3KETA 4QO8A 2PGJA 4WLEA 1I3LA 4BNKA 1DRVA 3ZNPA 5CDTA 3H5AA 3MJEA 2X5KO 4BVAA 4ALIA 4ALKA 1FDTA 5A4DA 5A1TA 3PVZA 3GNTA 2CMDA 3RWBA 2FP4A 3F9IA 3ZHZA 1HL3A 2JD0A 1A71A 2ZB7A 1KVQA 1KEPA 1Y5RA 4JQCA 3GG9A 5AXAA 5T64A 3W8DA 1PGQA 2G1UA 3ZW9A 3KSUA 3FNEA 3WGTA 3FBGA 3DZFA 4M49A 3ZU4A 1GL3A 4CMEA 4L4SA 2Z5LA 3ZV3A 2FOIA 1Z82A 2Q49A 2FHSA 2ZYGA 5LCXA 4M1QA 7MDHA 5JAZA 2HK8A 4FGSA 1LDNA 2X5OA 3LF2A 3U62A 1T2AA 5JYDA 3IOYA 2PWZA 1SZJG 1LA2A 1QYWA 1VSUA 1Y8RB 4Z6KA 3E18A 4Q3EA 1JVBA 2RHCA 1A9YA 3WFIA 3HDJA 4BO6A 1WMBA 2NTVA 3GFGA 3I6IA 4HFRA 4JNKA 5JDCC 4BO0A 5C5IA 1U5CA 4BHTA 2J5QA 4XJSA 2HRZA 3EUWA 3WLEA 4J91A 1DAPA 4RCVA 1NFRA 3NJ8A 3AWDA 2R2GA 4EITA 3INTA 2UV8A 3Q2KA 3SVTA 1IYZA 2CZCA 3QVSA 4MPDA 4JGBA 3JQ7A 3DO5A 5TIIA 3BTSA 1MA0A 3D5TA 4GX0A 1TVEA 3ZU5A 4Y8VA 3LDHA 1ENOA 3ZHYA 1JAXA 3HQ4O 3QIVA 2PGDA 3ITKA 3O4RA 1VPDA 2VZ9A 4ZJUA 1LLUA 2EW8A 1OC4A 1I2ZA 3C1AA 4J43A 4YAKA 4CQLB 2XPCA 5C7LO 3AOEC 2HCTA 4MIOA 1CIVA 1O89A 1ZEJA 3E03A 2P91A 1HE3A 5BNIA 1ISFA 4JROA 1NWCA 4Q3BA 2OXIA 3LYLA 2C07A 3V5NA 1T4DA 1Q7GA 1VL8A 4BO1A 2HJSA 2NTJA 2O3SA 2VZ8A 1V3UA 4UUMA 2X9VA 2IZ0A 2Q1SA 1LI4A 3WYEA 3U4IA 4ND5A 4NR0A 4J7CA 3MWDB 4MVJA 1KEWA 2PFGA 2WE8A 1C1DA 4YTEA 4HXYA 5EERA 5JMWA 1SMKA 1HYGA 2F1KA 2EEZA 3GUCA 2FSSA 3RASA 3NKLA 1EBUA 2ZTLA 4NBRA 2WEKA 3H6KA 3KYCB 5EQFA 3PI7A 2ZTMA 4RVHA 5F21A 4D43A 4CMJA 3KYBA 3I9MA 4EUHA 4AJEA 3BMNA 5EN4A 1D1TA 1DIBA 3E1KA 5JDCA 1PWZA 5ER9A 4RL6A 4RZHA 4H3VA 1GTMA 4NDNE 4AG3A 3VZRA 3RCBA 4JP2A 5B4VA 2LDBA 3GDGA 4CUKA 4JJIA 3UAGA 1DRUA 1E3SA 1WPQA 1ISJA 1HZJA 4KMSA 3HE3A 1U1IA 3AY7A 3TWOA 4DYDA 1BHSA 3CUKA 3PFWO 4R1TA 3DWFA 1CF2O 1EVYA 3LC7O 3HDYA 3KLPX 3DC2A 4NJMB 4B4WA 1N1EA 3H2SA 3DFZA 3HN7A 3KXDA 1FDSA 4ITUA 1GUFA 1R0KA 1YOVA 3OJ0A 4LVUA 3AOEA 2YY7A 4CM6A 3K73O 4NFHA 1HYEA 2DLDA 2QHXA 3PYMA 3WIEA 4BNUA 4E0BA 1IPEA 2C82A 4J7UA 2XAAA 4NBWA 4PZCA 3WGZA 3C1TA 1BVRA 2DKNA 4R9SA 2ZB8A 4DPLA 3RQSA 2D0IA 5TT1A 2HMWA 4J2HA 4Z3KA 5KOIA 2DBZA 1L7DA 2VUUA 3DFUA 3JQAD 4U7WA 4P4GA 1R4NB 4ZQEA 5JFOA 4IDBA 2Q1TA 5COBA 1BXKA 4NBTA 3OF2A 1I3KA 3Q0EA 1ZH8A 5F5NA 4YRBA 2VT2A 1NFQA 4IQ8A 4KWIA 3DOCA 2RBEA 3BHJA 2GF2A 1ONOA 4WK6A 1UZLA 1E5LA 1BVUA 3FRJA 2HMSA 1O0SA 4Y6RA 1T1SA 4ZU3A 2E4AA 3C7AA 3DBHA 3RUAA 4DQXA 2BHLA 1HE5A 1CERA 3S2FA 3TZHA 1DDOA 5JBIA 4KDFA 3I3OA 4D0SA 3N7UA 1GD1O 2YHIB 1VL6A 4WEOA 1IL0A 2O7QA 1UJMA 2QW8A 2V6FA 3JQ9C 3AU9A 3IJPA 4R1UA 2NLOA 4CUJA 1YWGO 3RKUA 3R1IA 2D8AA 4YT8A 3U4CA 1E7MA 1PS9A 1UAYA 1K6XA 3E9MA 4PLPA 4D44A 1S6YA 5JCXA 4CV2A 3I9KA 4I5DA 4PG8A 3ANMA 3AM4A 1GEGA 1ULSA 4FSHA 5BNFA 3WGOA 4BMNA 1YBMA 5JO9A 1SNYA 3DR3A 4RF4A 3PHJA 3WLFA 3D0OA 5CAEA 2R6JA 1N92A 5L7WA 2X0IA 4LGVA 4L74A 2NTNA 2OMEA 1GR0A 4XIYA 1P1JA 5T6BA 4LMRA 5DCYA 3I9OA 3UCEA 4YYZA 2VUSA 3NT5A 5ILOA 2HMVA 2P5YA 4ND1A 4WOKA 3NT4A 5EJ2A 2FPPA 1C0KA 2Y0EA 4W7IA 1JKIA 3PTZA 4RQTA 1T2DA 2BKAA 3GEGA 4BL5A 1YVEI 5B1YA 1S7CA 4L73A 5I9MA 4AVYA 2PD4A 4FDAA 1B7GO 2H5LA 1GUYA 3WFJA 5J23A 2VWGA 1I30A 3RFXA 5AYVA 3JQ8A 5K0ZA 1DHTA 2I76A 3K2EA 3F5QA 4EEXA 4P4NA 4NQZA 2VWHA 4CM3A 3KHUA 3S1LA 2Y0DA 3IUPA 2VRCD 3IP1A 4IIVA 3DQPA 4D46A 5KVVA 4NMHA 1SOVA 2AG5A 5JNLA 4FJ2A 3F1KA 4U6QA 4WKGA 3ZCXA 1RYEA 5I7SA 3GMDA 4DIBA 3DTTA 2O3RA 4KQWA 4E21A 3G49A 1BRMA 4XA8A 4J7XA 4AJNA 3DBLA 4G5HA 2BFOA 2DT5A 3W1VA 2BH9A 2DPHA 3LLSA 3UKOA 4CQLA 1F06A 4BGUA 2GRAA 1PGJA 2GZ3A 3K9QO 4Q39A 1DFGA 3GHHA 4XYGA 4UAGA 4IDFA 1PIWA 4I5FA 1OBFO 3AI1A 2YQ4A 3EZLA 1C0PA 1IHXA 3KBOA 4G2NA 5TS3A 2DAPA 2CVZA 4PFJA 1I24A 1QORA 4J4BA 2VHZA 2A92A 3NGXA 2NU6A 1B8VA 1GZ6A 4I5EA 4ONEA 1NM5A 2OO5A 2VNSA 4C7KA 4XQCA 1YDEA 3NDIA 3AU8A 3L6EA 2XF8A 2DTEA 1DIAA 1H6DA 2RAFA 1HDCA 2VHYA 2PH5A 4W7HA 4D79A 2IDZA 4XX0A 3RIHA 2OP1A 3K8ZA 3KYCA 4L76A 4DC1A 1AXGA 1H2HA 1PX0A 4OL9A 1VJTA 2TMGA 1U4OA 2Y1EA 2WD8A 5HS4A 3L9WA 3AUUA 3WYCA 2Q4BA 2Q99A 1PJ3A 1U7HA 2Y0CA 4IJUA 2P5UA 5DCWA 4BB5A 4OXYA 3QY9A 4AJPA 3DDNA 3T4XA 4OM8A 3CMMA 4PRLA 1YL5A 2CDAA 1C0IA 1PJ2A 4L9RA 3G79A 2EJVA 1K89A 3M1LA 4N5MA 4BNYA 3WXBA 4E3ZA 2GUGA 2P9EA 9LDTA 2C7GA 3F1LA 2O7SA 1KIFA 5JY6A 4GX5A 4Y98A 3VTZA 3VZQA 4UVIA 4FFNA 2BF7A 1ADBA 4I8XA 3BMQA 3JSAA 4WLOA 2V65A 2Y1CA 3GNSA 3LT4A 2AHRA 1QSGA 3NTRA 1LLCA 3FF4A 2IEBA 4WJZA 5AXBA 1TEHA 3U4DA 5K9ZA 4N7RA 2B37A 4YAJA 1HTBA 3CKYA 1R4NA 3PLNA 4PVCA 2O48X 2R00C 4LW8A 3WGYA 1C0LA 1MV8A 4E32A 3TDKA 4RJTA 4CL8A 2FR8A 4UVDA 4BKRA 4LISA 1MG0A 1HDYA 3AUTA 1V3VA 1O8CA 4CLOA 1RPNA 5IZCC 4II3A 4GH5A 4DC0A 1H6BA 4MINA 1IPFA 1GDHA 2FR1A 2G0TA 2DTDA 3FPCA 5CP8A 2ZCVA 1X7DA 3NX4A 3NTQA 3I9LA 3KRTA 1BWSA 3F4BA 4KDEA 3VTFA 2GERA 4XR9A 1D1SA 2YHIA 4GLLA 1VJ1A 3WMWA 2RH4A 1DLJA 4XCVA 1QR6A 5CEJA 2QYTA 4N18A 3OA0A 4DLLA 1LC0A 2JFFA 1F12A 2X9GA 2IZ1A 1GQ2A 2FRDA 5T57A 5GZ3A 3RC1A 2EKPA 4TRRA 4OSPA 2H1SA 3PJFA 4GBJA 1M76A 3PJEA 1LNQA 4H16A 1U8FO 3FHLA 4CQMB 4E13A 3PP8A 4FB5A 5DDIP 2J6IA 1I3MA 4TQGA 4XB1A 1UDAA 2BI7A 1X13A 4PRKA 3TL2A 1R16A 3ZWNA 3WBFA 5I9LA 3OIFA 1DXYA 4GX2A 2VYND 3GZNB 4NK4A 4GI2A 4RZIA 1H93A 1GZ3A 5ADHA 5KCZA 4R5HA 4IPTA 3CMCO 2NADA 2R00A 4AJLA 1UP7A 1GYPA 4XIJA 1QP8A 3GNQA 5DP2A 3RUCA 1C1XB 1JLLA 1ORRA 1T25A 4W6ZA 3UCXA 5IZCA 2C59A 1W8DA 4D45A 2JCXA 4WE3A 2PZLA 2HSDA 2PZJA 3D4PA 3VPFA 1HZZA 4YT5A 1K6JA 3LLVA 2ZJ1A 2XOXA 1I2CA 5BSEA 1O95A 4AL4A 1GCOA 3B1KA 4BGEA 1ZMOA 4R5MA 3WQSB 3DL2A 4L75A 4GPD1 1KY4A 1GPJA 2H63A 2JHGA 2VT3A 3M1AA 4OHUA 4R1SA 3JQFC 1FXSA 3RROA 4CM5A 3NUGA 5C7IO 2J3HA 4R3NA 2W2LD 4FS3A 4CV1A 2AA3A 4ALNA 4UREA 1K6IA 4WOJA 2X7HA 2B83A 1ISIA 1EDOA 5JC1A 3ONDA 3VC7A 1P45A 3AY6A 2O3QA 3F47A 1HETA 3PZBA 1GV0A 2NU9A 1P74A 1KVSA 1XG5A 3GAFA 3E5MA 3RUEA 1LRJA 4NNJA 3VH3A 1G1AA 1JDJA 2X0RA 4RVDA 3X2EA 4CM7A 1H94A 2PR2A 4BNGA 4E2YA 1LDYA 4FFLA 1ZK3A 1YQXA 1E3JA 1P0CA 3DMYA 3EGOA 4PVDA 4S1VA 4A0SA 1UR5A 3ZV4A 4DLBA 3UUWA 5F5LA 1I2BA 5JO0A 5FEUA 1TT5B 4Y9DA 5KJ6A 4D41A 5TNXA 2I9PA 2JFHA 4HFNA 3R3JA 1E3EA 1XU7A 2OL4A 4EUEA 4JN6B 1UXKA 4OSOA 2QRKA 3ZNNA 4BO5A 3KLMX 5DN9A 4L0QA 3RUHA 2V6BA 2EIHA 1PWXA 1Q2XA 2IE0A 1E7YA 1NAHA 1ZUD1 3S55A 1E1NA 5U9CA 4G81A 2NACA 3W4KA 2AW5A 3UW3A 2Q46A 3CTMA 2Y1DA 3W8FA 2QZZA 3L4BC 4FOSA 3F4LA 4Q3CA 4XGNA 5JLAA 5AXCA 2B5WA 1YL6A 3JQFA 2CUKA 3WDSA 1HKUA 1O5IA 5L3ZA 1C3VA 3G0OA 4YR9A 1N8KA 3BTOA 1GV1A 3KSDO 3M2PA 3KYDA 2QX7A 2EP5A 3PIDA 4BB6A 1P33A 1SB8A 2O3JA 1YB1A 2GYYA 3FTNA 3VPXA 4YJFB 4IDCA 5IDYA 4BNNA 4J2OA 1HXHA 1RJWA 2J3KA 3LF1A 4Y67A 4YAEA 2YQ5A 4ZD6A 2NM0A 3GR6A 3NJ4A 5U1PA 4Z3DA 3EK2A 3IKTA 2V6MA 2ZTVA 4LRSB 5HTOA 4JXKA 4EGFA 3RFTA 3ROQA 1Q0QA 1BDMA 3CEAA 1XIVA 5KJFA 1B3RA 3U9LA 1QV7A 1GQQA 4FD3A 2FWMX 2DTXA 3JYPA 4II2A 5TLSA 4MVJD 4JK3A 1QG6A 2C20A 1ZBQA 3C3XA 3V2UA 1CRWG 2PZMA 4J0EA 4J9UE 2GPTA 3HFSA 1NR1A 1T26A 4CLEA 4NIMA 1XA0A 1JTVA 1KY5A 4NI5A 3ZV5A 4NFYA 1DFIA 5EL0A 5I8ZA 1YBVA 5KNLA 1IHYA 1RM4A 4CLDA 3PRJA 3ZWYA 5BSHA 3QVOA 2ZCUA 1J4AA 2PD3A 4IY1A 4MDHA 2EWMA 4DQVA 4YXFA 4J1QA 4ND4A 1QKIA 4O6VA 4DVJA 1CQJA 1Q7BA 3MOIA 2JJYA 2FMUA 3L4BA 3K96A 1QYDA 2GN6A 5H81A 2YW9A 4PLCA 2ZIZA 4HADA 5F1PA 3RSHA 3OJFA 4YACA 3WG9A 4QXMA 1N2SA 3C7CB 3IP3A 4FJ1A 4YT2A 4CM4B 4BOYA 4IJKA 1NPDA 1BW9A 5KJ1A 3WQQA 4RGBA 5JDIA 1XYGA 3ZWWA 4CQMA 3DBRA 4OMUA 2NVWA 5G2OA 4F6LA 3TZKA 3OBBA 3AJRA 3SJUA 4B79A 4EZBA 1P1HA 1HLDA 4I9HA 4D3FA 1ZO8A 2RIRA 4TSKA 2HO5A 5H82A 3TPCA 4FC7A 3GZNA 5ES3A 4FN4A 1QV6A 2OP0A 3L77A 1EE9A 2B5VA 3ON5A 2VZ0A 4TKMA 5DNAA 3T7EA 3BMCB 2Q2QA 3PWZA 4IQGA 2GSDA 4CODB 2QYSA 1Y6JA 1JU9A 3PHHA 2NU7A 4XWYA 4JBGA 3WSVA 1RM0A 1C1XA 4CLRA 3CIFA 4M89A 1ENPA 2G76A 4ZQFA 2X4GA 3JQGB 3K31A 3STHA 2FSVA 3QQPA 1P3DA 2W4QA 2P9GA 2VOJA 1E3WB 1HYHA 3KZVA 4IBOA 2JD1A 2WD7B 3T7CA 3D4NA 3GFBA 3H8VA 3UH1A 4PLYA 4IMRA 1KVUA 3GVPA 2Q2VA 5FI5A 1NXQA 1LXCA 4W4TA 3WX0A 3WOHA 1TI7A 3P2OA 4CMCA 5A04A 5AQ1A 3GEDA 2RH8A 1FK8A 3Q9UA 1EBFA 4JJFA 3QWBA 4B3JA 4URFA 1U3UA 4OQZA 1R0LA 1GFSA 3GG2A 4BKUA 4M86A 4ZRNA 4Y6PA 3CE6A 5A03A 1XHLA 1E7SA 3FN4A 5G0WA 1SO8A 1E6WA 3U5TA 4MKZA 3MWEB 4RDIA 2WWRA 5JAQA 3ETGA 1GU7A 2D3TA 3JQAB 1XELA 5CDSA 4BNMA 3GAZA 4J16A 2IXAA 3DAPA 2GDZA 1HDOA 1UAGA 4WLNA 4J1SA 3FWZA 1PR9A 2C2XA 1GY8A 2VOEA 3WYBA 4DREA 4I9UA 5L95A 3W4JA 5K6AC 4ZVVA 1B8UA 4QT0A 1R12A 4CMHA 4BS9A 1XEAA 1ML3A 2Y1OA 4P38A 1PJBA 1HT0A 4XRRA 3G1UA 4BKPA 2DVMA 2HLPA 5DBGA 4BO2A 1U28A 4AJJA 1G6KA 4GSLA 1TT5A 1P1RA 2O50A 4O1MA 3GVXA 2J3JA 1UZNA 1Z7EA 5DCUA 4WPGA 3DZBA 4EDFA 1NQ5A 3O8QB 4GX1A 2GASA 1U8XX 3EZYA 3GVCA 1KERA 3EDMA 1NR7A 4Z0HO 4MO2A 4UEKA 2BGKA 1NWHA 1BXGB 1PJ4A 2CY0A 5B12A 1YH3A 1Z6ZA 1MXFA 3IS3A 8ADHA 1EVJA 4UVHA 1K2WA 1C14A 1N9GB 4BGVA 2EHDA 1SCUA 1W73A 4NU5A 1I10A 1DLIA 1EDZA 4CV0A 1IZ0A 1Y5MA 4ZN6A 1Q1NA 1LTHR 4AFNA 5G0SA 5L4NA 3JD3A 2J5RA 1GPDG 2J5KA 5G4LA 1WP4A 2GCGA 3OQ1A 1HSOA 3CZRA 3DZIA 3GQVA 2DBVO 5EINA 2CD9A 5AXDA 2EJWA 1A4UA 3P19A 4IZIA 4Q9NA 4ESOA 1FJHA 4IUYA 4HP8A 1LDEA 1CQIA 4O63O 4CPDA 3KB6A 2E49A 2UVDA 1YJQA 1XQ1A 3AI3A 3K6JA 2NUAA 5IXYA 3NEPX 5L9AA 3PWSA 1YXMA 4MIEA 3JYQA 2YV2A 1LLDA 3PQEA 1ZW1A 2JAPA 5I7EA 5GY7A 4DUPA 1QLHA 2GN8A 1Z7BA 3E48A 4XB2A 1R6DA 4IGFA 3ST7A 5F1OA 4DQUA 3WS7A 3HADA 3NDRA 4NJOA 4ALMA 5L4SA 4M87A 1LLQA 5K6AA 1LBEA 1LDGA 3T4EA 3OJLA 5ENDA 4OJNA 1KVRA 2D2IA 4YJHA 3BMOA 1M67A 2NV6A 7ADHA 4CM1A 2OORA 4CM8A 3HWRA 3ENKA 3SJ7A 1KYQA 1ZEMA 3GT0A 2PA3A 1BSVA 1MFPA 4NG5A 3WGGA 3OSUA 4YDRA 1VJ0A 1MC5A 2PY6A 3ROMA 1QYCA 3RJ5A 4EBFA 2X0NA 3VKUA 1UUFA 1F17A 4NPCA 4L4RA 4ZQHA 2H9IA 4N54A 1O94A 3A28A 4RQUA 1PTJA 3PDUA 1HSZA 1MX3A 4MVJM 3U4HA 4UEJA 1F14A 2X5JO 2EXXA 4A26A 5IF3A 1Q0LA 2YYYA 1PL7A 5LDGA 1ZK4A 4CLXA 3PK0A 5F1KA 1N7HA 1U2GA 1KETA 1ZJZA 5TT0A 3ADPA 2VRBA 2X0JA 1ONNA 3ORFA 3QWAA 3QHAA 4KTTE 2ZB4A 3ITDA 3HDHA 4TZTA 3C24A 1U3WA 1M75A 1FDUA 4RVUA 1OFGA 5GMOA 4PLVA 3GVHA 3ETDA 4YT4A 4BGIA 2B35A 4CMBA 3WWZA 4JIGA 5U4QA 3GRPA 1AN9A 4ALJA 3WNVA 4XYBA 3OEWA 3BHMA 1ZJYA 1UZMA 3JD0A 2DQ4A 2P4QA 1JAYA 2IYOA 2VHVA 1PZFA 3WGHA 1SOWA 3PHLA 2ILTA 4FJ0A 1WVGA 4Z0TA 1XWFA 3JQBA 3FI9A 1Y8RA 3EVNA 3C7DB 5COAA 3OQ6A 2GNAA 3RU9A 2QZ9A 3I6QA 4RDHA 3PQDA 4UEOA 3ROKA 3GGOA 4EJ0A 4YVFA 4DWVA 2VQ3A 1VE9A 2HK9A 4BNWA 1A9ZA 4B3IA 4CLHA 4K6FA 1ENZA 3WSWA 4K6CA 1DSSG 1KC3A 2CSUA 3JQGA 3FSRA 1FDWA 3O38A 5GZ6A 1E3WA 3TL3A 2D5CA 2WD7A 4GKBA 5LDHA 1KBZA 3Q9NA 4PLTA 4PG6A 2I66A 3PQFA 4PN3A 4ZICA 4S3MA 4AJKA 3IQDB 4B3HA 3LSYA 5DBIA 4BNZA 4TZKA 3RBZA 4WCFB 4EYEA 3SXPA 3AK4A 3RC2A 4HY3A 3RUFA 3E9QA 3V8BA 4BO7A 3ANNA 3SLGA 3UXYA 4U6SA 5G4KB 4GWGA 3PJDA 3ZWBA 2VHXA 3GVIA 4QUKA 5TRTA 1E5QA 2I3AA 3IKVA 4E12A 3IJRA 4R16A 4MKXA 2NU8A 3RD5A 1ZK2A 3U3XA 2E82A 3PXXA 4CV3A 1O9BA 3RI3A 3IC5A 1NQOA 3O26A 1KEVA 3E82A 4BMSA 1YE3A 3SEFA 1JWAB 2DPGA 3BAZA 4MVJF 3PYLA 3ZHBA 3F46A 4F3YA 4P4LA 3WTCA 4M8SA 4AJIA 1I32A 1YDWA 3QVWA 2HQ1A 4GGOA 1PEDA 1A7KA 3OP4A 2QRLA 3E8XA 1DC3A 4P22A 2EP7A 2WM3A 3K30A 3C1OA 5JS6A 3Q3CA 1OI7A 5L7YA 1HDGO 3HN2A 3O8QA 3TJRA 5FF9A 2BI8A 2OZPA 2NVUB 1DHRA 2PV7A 3QLJA 4OYRA 1BXGA 2O3TA 2Q50A 3ZNOA 4EJMA 1PL6A 1NX6A 3QP9A 4CM9D 4E2XA 4D42A 5AVOA 4UULA 3D64A 3DAFA 1HEUA 2AG8A 1FF9A 4NJMA 3B1FA 4F6CA 4ZHSA 4ROSA 3RUIA 4NBVA 4TRNA 1DC5A 1I3NA 2W8ZA 2IYPA 2JL1A 3VH4A 2CVQA 3UFXA 4OOFA 4IZHA 2NQ8A 3DOJA 3GF4A 4QFDA 3I4FA 3TN7A 4IIUA 4B7UA 5IN5A 2QRJA 3DBVO 2Y99A 3SX2A 4HFMA 2PNFA 3UF0A 3VPGA 1XGKA 5KJCA 2EG9A 2P2SA 4KZPA 4LMPA 3DZJA 4DMMA 3H7AA 3FTPA 3QRWA 1EUZA 4YEDA 1NPTO 3BHIA 3GPIA 5B37A 4YAIA 3D3WB 2P9CA 4DLAA 1T2EA 2CDBA 3DHYA 3QE3A 2DM6A 5EPOA 5BT9A 4MVJP 4KWHA 2D5AA 5IDWA 4U0KA 2YV1A 2DU8A 3EW7A 4Z9XA 3VDRA 3NYWA 4YRAA 2AXQA 1SPXA 3GLQA 3H5NA 3HFGA 4M54A 3JD1A 2I99A 1MXHA 1EZ4A 1YQGA 2Z1MA 4A7PA 2OOSA 5A06A 1BG6A 1JKJA 4O59O 1EFKA 2A35A 2DUWA 5KKCA 3E6AA 1BMDA 2VYVA 4EW6A 1OOEA 4YJGB 3KOUA 3KO8A 3GZ4A 3MTJA 4QSMA 4XDYA 4RPGA 3OM9A 1XU9A 3CPSA 1N7GA 5IDXA 1X0XA 4IDDA 1UDCA 4UUNA 4WLVA 5JMPA 1B2LA 1X7HA 2J3IA 3I4CA 2PKQO 4INAA 4R1NA 1PQPA 3A14A 1GADO 4RF3A 1F0YA 1ONPA 1I36A 3PWKA 5TC4A 5T5QA 5KVQA 1HDXA 3Q11A 1ADCA 1EQUA 4WECA 3FWNA 3M6IA 4PGFA 1NQTA 5I9NA 5IZ4A 1EUCA 1WXDA 4WUVA 1ZSVA 4PIVA 3ULKA 1U3VA 2POQX 1MC4A 4I1IA 3HHPA 2VWQA 4IQ0A 2I65A 4NK5A 4W82A 4LCJA 4ALLA 2PZKA 2UAGA 2OUIA 4D7AA 1I33A 2V6GA 3JYLA 3MEQA 4XZ3A 2YUTA 3D7LA 3NDJA 2G17A 3ZN2A 5IXSA 4XR4A 3S2EA 1F8FA 1GZ4A 2B4TO 1LSOA 4J90A 5FWNA 3D4OA 4R4JA 3D5QA 3PHIA 2ZATA 1DO8A 3ICCA 2QIOA 3H3FA 1ADFA 3L6OO 4DA9A 1MG5A 1PL8A 3W6UA 1OMOA 2JFGA 3RBVA 4Z0PA 3O9ZA 2HU2A 2XXJA 3R6DA 4BV9A 1GEEA 3FNFA 4CM9A 3FR8A 1ARZA 1WZEA 1GAEO 4JX8A 3TQHA 4IM7A 1PS8A 4EEZA 4RVFA 5JW6A 2A9FA 2B0JA 2IXBA 4HNGA 4QQRA 4A2CA 1MLDA 3WBBA 1UXJA 3WJ7A 2IRWA 3MJTA 2CNBA 2HMTA 4DBVO 3VPSA 2OHXA 3ZU2A 1PU2A 4UUPA 5DOVA 3HJAA 3H9QA 4GL4A 4MP6A 2HRBA 3RC7A 1PZEA 2BLLA 2OFPA 1BXZA 1JVSA 3V1TC 1QMGA 3W4IA 1WW8A 4FC6A 4WNIA 4RLHA 3GGGA 3JQDA 3QW2A 4HV4A 1QRRA 4XGIA 1H5QA 4WCFA 3S2GA 1LU9A 1ZFNA 4PLHA 1X1TA 3K5PA 4UVEA 2EKLA 4YCAA 1NYTA 1HE2A 3ROPA 3DTYA 4JBHA 2ZYDA 4FQ8A 3AW9A 3B20A 3OQBA 5THQA 3CH6A 1Y81A 3RAJA 1ZMTA 3AM3A 4PLZA 4CQMD 2X9NA 1BTOA 1J6UA 4B7XA 3B1JA 5G0UA 5L4LA 2E6UX 4FCCA 4BUCA 1NVTA 1PS0A 3UHAA 1M6HA 2VHWA 2WE7A 1LSUA 5BSFA 1Q0HA 1K0UA 4WLFA 4BV8A 5I7FA 3ZDFA 1Y9EA 1U7TA 3QJ5A 4TKLA 4KQXA 5EMHA 2AMFA 3BMNB 2ZKLA 4IGEA 2JCYA 2PD6A 1YONA 5COQA 1KC1A 2O3UA 1XKQA 3N74A 4J4TA 5ITWA 1ZNQO 4YPOA 3G17A 3KV3O 1W6UA 5A3VA 1TXGA 4I08A 1NQAO 3F6YA 4AJHA 5L7TA 1UXGA 1JWBB 4HKTA 4NU6A 1UH5A 4A10A 1V0JA 4WCDA 3ONFA 3KEOA 3H9UA 1M2WA 5EIOA 1ZKMA 3CSDA 4A27A 5JDIC 5DZSA 1FMCA 2BMAA 4DL9A 3PHGA 4CR7A 4GVXA 3BTVA 2Q45A 3V2GA 2FY8A 3NRCA 1BGVA 5TSDA 4CMIB 1SC6A 3EMKA 2CVOA 3DXFA 3F5SA 4GMGA 3ENNA 1EEHA 5CEFA 1RKXA 3VKVA 3FPLA 2FN7A 5IDQA 1CEQA 1XQ6A 5ICMA 2PH3A 3CXRA 4U8GA 3GDOA 4GVLA 2BFPA 3WR5A 4IINA 1VM6A 2I6TA 4XJTA 5A9SB 3QVTA 4F46A 4BNLA 3PGJA 8LDHA 2UUOA 1D3AA 3ETEA 1R37A 2FPGA 5TGDA 2BGMA 1KEUA 1B16A 2JKVA 3QA9A 1X15A 3AI2A 4LVCA 3GC6A 5JAIA 4TVOA 3OH8A 2HDHA 1E7WA 3LU1A 4GMFA 4HWKA 4FPXA 2O2YA 4J9VA 4GKVA 3A1NA 2X1HA 1LRKA 4Q3DA 5CG2A 2D1YA 3KEQA 5TJHA 4YQYA 1GYRA 4BO8A 2CF6A 3GN1A 4E5NA 3TNLA 4MVJI 3KUXA 3PJGA 3MJVA 4XGKA 3U09A 3MJSA 4E5YA 2X58A 4ILKA 1AHHA 2AQ8A 1YJ8A 3OETA 5TF4A 1K5HA 4AJ4A 3K2BA 1NNUA 4GGPA 4J49A 1JQBA 1QYVA 1CETA 3PEFA 5F3RA 4YWJA 3ICPA 1L1FA 4NBUA 1EUDA 2YDXA 5DULA 3ZWAA 2ZQZA 1ZXLA 4JLWA 1AGNA 4LSMA 2DFDA 1JW9B 4DTIA 3G1TA 4XYLA 1DEHA 4O0LA 1UP4A 3DZKA 4RPLA 1DC4A 2G5CA 5H83A 3H2ZA 3Q1LA 1LDMA 4WASA 1E6UA 4E31A 1YKFA 4CJXA 1DJQA 2X22A 1Y8QB 3LC2O 5KIAA 2EKQA 1ZVMA 2GZ2A 3RUDA 4BQPA 3WNQA 1IY8A 3I9JA 3KVOA 3UVEA 3I5MA 2Y05A 4P8RA 4TROA 5JCJA 3FR7A 1NASA 3JYOA 3FBTA 4QECA 4PCVA 2FPIA 3OJOA 4R54A 1R4MB 2X8LA 3JQ8B 2IEDA 2HK7A 3TFOA 1WZIA 1U3TA 3TRIA 1V3TA 1E1LA 4XQ9A 2HMUA 1PZHA 1HDRA 3VOSA 4YBZA 2C2YA 1QLJA 4CUZA 2EV9A 2OGUA 4C4OA 2EGGA 5CDUA 4TVBA 3UN1A 5DT9A 4ZRMA 4A73A 3GEMA 5DP1A 3P5SA 5JY1A 4IS3A 1CWUA 1V9LA 3RVDA 3WMXA 1WLYA 3BIOA 4BKQA 2O4CA 1B15A 1UXIA 1EVIA 1LQTA 3VZPA 3BYZA 3WJAA 4RPKA 3VVBA 4BO3A 3DBLB 1SB9A 4B8ZA 1YGYA 1V8BA 3E9NA 4I5GA 3FCOA 4E5PA 4ZGWA 1PR3A 4FBGA 1XCBA 3TOZA 4B4VA 4XYEA 1ZXBA 4FW8A 4RPHA 4RO0A 3EHEA 4YQZA 1W4ZA 4O5OA 4IJWA 4NFSA 5KVCA 1X1EA 1D8AA 3QSGA 2ZQYA 4BMVA 1NAIA 1VL0A 3A9WA 5DF1A 1YB5A 4D3DA 3GA0A 3TF5A 3OHSX 3SC4A 3AUAA 3ZWVA 4E6PA 2UUPA 6ADHA 5T8KC 3LQFA 2C7VA 1PJSA 1DBVO 3WTBA 3MTGA 4RLSA 4E5KA 1YB4A 3TZ6A 5IJZA 3HUDA 4GQAA 4QO7A 1G0OA 1IOLA 1X0VA 1HF3A 3V2HA 1F8GA 1P77A 3EY4A 2VTEA 4E2WA 1DC6A 3TFQA 1T24A 5CPBA 5CEEA 5HM8A 4HFJA 2O4UX 4DRYA 1KVTA 3DHEA 5FYDA 1P1FA 1NHWA 2C5AA 3DZHA 1VLLA 1XSEA 4WNCA 5KKAA 4RV9A 4AJ2A 4OXNA 1TT7A 4MIYA 4B7CA 4YRDA 5EQDA 5G0TA 4BNIA 2RCYA 4BO4A 4R41A 4TRJA 5ITVA 3ZWMA 2PKQP 1KOLA 2I5PO 1A5ZA 2I3GA 2BRUA 1DPGA 1H9AA 5HA5A 1ZK0A 2ZJ0A 5THKA 1E6EA 1WAMA 1ZK1A 3ZU3A 1N1GA 3DOOA 4YJFA 1O6ZA 1PJTA 3HDQA 3WWYA 3U0BA 1R15A 4XQGA 3LK7A 2Y68A 3RU7A 3WB9A 2P4HX 1J0XO 3ZW8A 3MJCA 2YV3A 3ANLA 4CMIA 1A27A 2PLAA 4L8VA 3JYNA 3GN2A 1PGNA 3BMQB 2RHRA 3GPDG 4FFOA 2Z95A 1LRLA 1AUPA 3H65A 3FD8A 5IG2A 2AEJA 1V35A 5T8KA 3AM5A 1DIHA 3H9GA 3BA1A 3F3SA 3JQBC 3RJ9A 4IDAA 2B36A 2X86A 3PZRA 2YZ7A 1HRDA 2D4AA 2NVBA 5T67A 3S8MA 3C85A 3VDQA 3NAQA 1E7RA 3DEYX 4TWRA 5A9SA 5JXWA 3LT0A 1YRLA 1T2FA 4J4HA 4NZ9A 3NGLA 4E30A 3QWIA 1VSVA 3LT2A 2P68A 1NBOA 3JV7A 4CLOB 3ZWPA 4CMKA 1P1KA 2Q4EA 1H9BA 5TJ9A 1UP6A 1Y1PA 3K92A 1ULUA 4W99A 3X2FA 5CPFA 4ZA2A 3GH3A 2W2KB 1U4SA 2AEMA 3PLRA 2WTBA 1UDBA 4FFMA 3RBXA 1PGOA 1P31A 5CFZA 4UUOA 3L0DA 1IULA 4NH4A 3NT2A 5A3JA 1EMDA 3WGQA 1MGOA 5A5FA 1OZAA 3ONEA 4JCOA 4R3WA 4BNTA 5L51A 2WMDA 1PSDA 2ZTUA 4KUGA 2X6TA 3O03A 5G0VA 3TSCA 3EVTA 1E3IA 4CM4A 1E7QA 1XDWA 4GWKA 4KUEA 3DONA 3GK3A 3I1JA 3I52A 4ND2A 4B8WA 4BNHA 2WSBA 3ZWOA 3ZWCA 2Q1UA 2JCVA 4AJOA 3IIEA 4MP8A 2ET6A 1A72A 3VHRA 4XDZA 4YAGA 3ASUA 2A94A 1CDOA 3BXXA 3VH1A 1SBYA 5HBRA 1DIGA 1PJCA 3CINA 1N5DA 4K1LA 3E5RA 1H0KA 1PJQA 2AE1A 1Z73A 5B4TA 5KVSA 1DJNA 3BMCA 1HWYA 2I67A 4J0FA 3N58A 2B4RO 5L53A 1Y8QA 4DMLA 2AEFA 3AFMA 3MOGA 1WNTA 1H6AA 1U9JA 3CZMA 5CDGA 1G0NA 3GHYA 2V7PA 2E48A 5A05A 4A5OA 1P1IA 1NVMB 3QVXA 4R69A 4OGWA 2OBYA 5MDHA 3ADOA 2JD2A 1R4MA 4DIFA 3VVCA 3OECA 4IMPA 4PZDA 1NVGA 2QG4A 2BELA 3Q6IA 3KM0A 3D3EA 4QEDA 5KJEA 1A4IA 2Y93A 2VYVD 2HUNA 3B70A 4AICA 3AFNA 1YQDA 3HZZA 5A9RA 1V6AA 1Q7CA 3I83A 4ZQBA 3JQ9A 2GZ1A 5BNTA 3MZ0A 1LJ8A 1H6CA 1E0DA 4OXKA 4JBIA 4B4UA 4LSWA 5A02A 5AOVA 1SEVA 1ZIDA 5IFLA 1E3LA 3JQAA 1VRWA 4C7JA 4E33A 5C7OO 4ZQGA 2C54A 5FI3A 1B14A 1MB4A 4HUJA 5TQVA 9LDBA 3OIDA 2ZB3A 4BNVA 1PGPA 4OO3A 1Z45A 3W8EA 3GUYA 3H4VA 4J1NA 3R3SA 1E92A 3A4VA 3JQ6A 4IDGA 4DPKA 1I0ZA 2Q3EA 1T2CA 4YA6A 4XEHA 2Z1NA 1QYXA 3IUSA 4PG7A 2PTGA 1HLPA 1PJLA 2YDYA 1E1KA 4PLGA 5A5EA 2VWPA 5ILGA 1NHGA 1TA4A 4L4XA 3TZCA 1D7OA 3B6ZA 3COSA 1ZCJA 1GYQA 4Z9YA 4XRGA 3G3EA 3JQCA 4FIZA 3L6DA 2X23A 2C29D 5CHEA 5FFFA 5L45A 3UCFA 4BNJA 2EF1A 1DAOA 2ZK7A 4Q3NA 2VN8A 4R68A 1EFLA 2VUTA 1TLTA 3KSZO 3FNGA 4BNFA 5IAAA 1N9GA 2PGLA 3JCZA 3R0IA 1SAYA 3OA2A 4H7PA 1H2BA 2VCYA 2C5EA 5HS6A 2GN9A 2G82A 5BSGA 1JA9A 1WDMA 4D3SA 2EGHA 1K3TA 4JP3A 1B26A 4JJGA 3JD2A 1D4FA 1P44A 5CDYA 5L40A 2AQHA 1IZ9A 1JN0A 2UDPA 2YJZA 3JD4A 3KYDB 4FGWA 1DIRA 4PG4A 5JC8A 2NQTA 3H9JA 4WGGA 1NFFA 2BFAA 3FNHA 4R51A 3ZH2A 2CF5A 4XKJA 1RWBA 3IDSA 5CG1A 4DIOA 1P9LA 4CL3A 2IODA 1GUZA 4ND3A 2B4QA 2FR0A 4HX5A 3SBOA 4J6FA 2GLXA 4FFPA 4RORA 1B0AA 1RYDA 1VC2A 2EERA 1PQUA 1HDZA 5B4UA 3UOGA 1IE3A 3VAZA 1E77A 4EI2A 5A9TA 2B69A 2CFCA 2HKIA 1LC3A 3ASVA 3EC7A 1NTOA 3OFSA 4BO9A 1BDBA 4MP3A 4TRMA 3UICA 1ZSYA 3VPHA 3Q2IA 3U49A 1VKNA 4OH1A 2Q2WA 1YS4A 4FFRA 4RPJA 2VRCA 2Y66A 1EVZA 3LT1A 1AXEA 4M55A 5DBFA 5JAMA 1L7EA 4B4OA 2W2KA 2VNAA 1FDVA 2Y67A 1VKOA 3GRKA 4K9DA 3INRA 1DFHA 3P2YA 1P0FA 2H6EA 3AUSA 5HRUA 2WYVA 1Z74A 3HB5X 4OAQA 1ADGA 1QXSA 3H9EO 5KTKA 4KTVE 2A4KA 1AE1A 1RM3A 1Y9AA 2NWQA 4WCFC 1M66A 4IXWA 4MKRA 4N5LA 2SCUA 5HWSA 1IB6A 4QX6A 1I01A 3IL2A 2J8ZA 3IMFA 2AE2A 4KOAA 3JQEA 3VH2A 3S2IA 5I8WA 5JPIA 2XXBA 1Y7TA 2WYWA 4IS2A 1U2DA 1BW9B 3IAHA 3L4SO 5BR7A 3TOXA 1IUKA 1LEHA 4AJ1A 1OAAA 3DBRB 4PLFA 4DPMA 4XYMA 2GD1O 4EUFA 5DOZA 4A03A 4N5NA 3P7MA 4Q3AA 3DHNA 1I5RA 4OIMA 1UXHA 1B8PA 1WMAA 3NV9A 4UVGA 4Y6SA 4MOWA 1R66A 3OEYA 2WJPA 2DC1A 4QFCA 1M6WA 4YB8A 6LDHA 3TZQA 4E5MA 3DAGA 2AQKA 2DBRA 4EJ6A 3M2TA 5EESA 4FOOA 3DZGA 3KTDA 4HNHA 1Z75A 3RFVA 2WYUA 2IZZA 4KUHA 2BGLA 4R9RA 3A06A 2HJRA 1LUAA 1ISHA 4CLRB 2D59A 4CMGA 2Y1FA 4MVJE 5GZ1A 1LSJA 3WGIA 3NTOA 1EE2A 3GOHA 2Y1GA 3JQ7B
chains in the Genus database with same CATH superfamily
5BMOA 2ZIWB 4Q6BA 4F4UA 1FW8A 4W1PA 5EIXA 1EBBA 1IN5A 3NWOA 4Z99A 3WQRA 1J8YF 4W9NC 2ACKA 4WFKA 4LBZA 3R75A 1MQAA 3ER9A 2UYYA 3HR4A 5ALHA 4H31A 1COWD 4IXTA 3GMSA 3LQYA 2GKGA 2YHUA 3HB4X 1M1UA 3G5TA 4QTTB 4MW2A 3BERA 5D5QA 2I2AA 3PFFA 1LNSA 2GK4A 2P0EA 5CTAA 5E2AA 1CE8A 3VU9A 5B6IA 3A37A 5G4KA 2NMVA 2VQSA 4JVLA 4G3XA 5HKAA 4WACA 1MP0A 4H15A 5ALLA 4L27A 4RHXA 2REBA 1K3UB 1MO6A 3FVWA 1NUTA 4F45A 2ODEA 5AJHA 3KB8A 1L4YA 2MYNA 4HSGA 1KWKA 5E6SB 5GIOE 5G1NA 1J5PA 3IERA 5D6NA 5DJ5A 3TEMA 1ZM3A 3H2IA 4B3GA 4CDNA 5AW1A 2VTDA 4L8LA 4ZC8A 2C0QA 4UXIA 2WC1A 5FULA 3LBIA 1Z15A 2B1GA 4BX8A 5AD1A 1OASA 1TKCA 4RJIA 5CCBA 5CLJA 2ENWA 1CD5A 2WUFA 3JVIA 3HL4A 3LDGA 3AUYA 4DM3A 1LW6E 4J29A 1CX9B 3HUFA 4LCEA 5B1SA 4HYEA 3T1NA 1NW8A 4XWWA 4P7BA 5CTJA 4LE1A 2PGAA 4GE3A 4JUIA 3E5NA 3PEYA 5GONA 3OT1B 1S2LA 2Z2JA 2V58A 1T5HX 3SQNA 2LRHA 1ZY2A 4ZOAA 3I01A 1N78A 3HH8A 3ZG6A 3KJGA 3U4GA 3W77A 3LVFO 1OC2A 1EK6A 1JQJC 1YR3A 2Q8PA 2QRUA 3MD0A 1CRZA 2OCDA 5TV2A 2VJDA 3SXUB 2QX4A 4CFSA 1OLXA 1Q22A 1U9IA 2IXDA 4OP1A 4LCBA 4RF2A 3ZDDA 3MJ4A 3QLTA 3V1UA 1USGA 2H11A 3NBUA 1N2ZA 1R50A 4KPUA 4UD6A 4XQEA 4D0RA 2P2ZA 4RZ3A 4OOEA 2EF0A 5ER6A 4KSBA 4BKOA 4MR7A 2F00A 4Z9FA 1DINA 1MAAA 4DZRA 1VL5A 1HDIA 2Y4NA 1J5EB 2R8YA 1ZGCA 1GSAA 2QTAA 3GY0A 2YHAA 3INNA 1WPXA 4LK3A 3H3JA 3NCHA 5AK3A 3DD1A 4ZEMA 5BR8B 4C0SA 2KI5A 1LVGA 1ZITA 4IJVA 1N2CA 3WL8A 5KYUA 1XA4A 2ATIA 2KJQA 5HFJA 2CV0A 2HHHB 4PZPA 1UWCA 1M8PA 1KFJB 1RJFA 3HJTA 1W1IA 3MWJA 4C4TA 3MGCA 3I6BA 4REOA 2VYNA 2FLWA 4PZEA 5CLLA 1TB4A 4EF4A 4FZVA 3LQ2A 4J1TA 3DE0X 3IHTA 4MVYA 5EJAA 4BLQA 4ZDKA 3DB2A 3GLKA 5JALA 2COEA 1BJRE 2WU3A 3M6UA 3P2KA 3BD8A 1ODTC 2QQ5A 4B43A 3ECSA 1FJXA 3WICA 2BDEA 1GCUA 3HZHA 2GH1A 2YQZA 4MZXA 3OUUA 4QDKA 4PZ9A 3SFZA 3VYUB 5JSFA 3FTQA 1UZAA 3WRYA 1BE1A 2ZI4A 4H6WA 3ABRB 1R0SA 4HUQA 4BEJA 1W9MA 6GPBA 3DMGA 4LF5B 3GP8A 5KYKA 1FTGA 1ZMBA 2INGX 3AKZA 5EJ5A 3MCVA 5DW0A 2QIPA 3VYWA 2QTTA 5BWOA 1CZKA 5I7VA 4G97A 2V7QD 1O3YA 3UMCA 2AK3A 2PIAA 3AXSA 3DGFC 4RTSA 1FQWA 2WM9B 3I09A 3LJKA 3HLYA 1EWYA 3CZ4A 3QFCA 4WXEA 4YJDA 1Q0UA 3BMOB 4OKIA 3KKLA 4RVGA 5TB5A 1MTOA 4FFBB 5CH3A 2ZUVA 2D00A 1AQIA 2XUKA 2ZYWX 5LDDC 1LX6A 1YT5A 2QR3A 3U44B 5KB3A 5GOZA 1U94A 5C37A 2E89A 2FW7A 3RAEC 2JATA 1PG0A 1V8PA 2NZXA 4RPCA 4HDRA 2W2PA 3OU7A 1S7GA 4U0JA 1E0KA 3GLUA 1HY3A 2C84A 4FZJA 2OXCA 4FR5A 3BZUA 5CGQB 1QK3A 2O7NA 1VI2A 2P9QA 3R3VA 1FP1D 2D1FA 3ISJA 1A7AA 3SSNA 4JX9A 2A1UB 2IW3A 3M0EA 1E69A 1RAGA 2Q7OE 3KETA 4WLEA 1TO1E 2Z5GA 1UC5B 4BNKA 3ZNPA 5KHOC 4M2LA 2R6CA 2ZIFA 5MFZA 1KK2A 2ZS7A 3DMPA 3PVZA 5CAEB 2XMZA 1OZGA 3GNTA 4IIXA 4NAHA 3U3KA 3E8MA 1NURA 5IJWA 1H1LB 2JD0A 2HRDA 3BK2A 1C9DB 4TM7A 2PMEA 1RXUA 3TMYA 4DWOA 3OBIA 5ESXA 3QX9A 5AKEA 5TY0A 1S2DA 2IYEA 2MSDB 1TM3E 3R0QA 2PCLA 3WK4A 1S4MA 5HXAA 1H8HD 4X6XA 3TNFA 2FPWA 2WD9A 3OOEA 3P2MA 3WGTA 5A6SB 4KBYA 4M49A 4ANFA 2DFPA 2WVGA 4DDTA 1EIWA 1JDBC 1EVQA 3R6WA 4WESA 1P7YA 2ZYGA 3R7DA 1L5NA 1PV2A 4JYMA 5TS2A 5I4KA 2B94A 3V4ZA 2IZ7A 1BFUA 1LDNA 3LF2A 3QPAA 2PWZA 2VHQA 3FZNA 5CYGA 1VSUA 5IF9A 1SXPA 4D4MA 2VTKA 3ZY4A 2G07A 1Q50A 2GWHA 4TLMB 1GGHA 3E18A 1JVBA 4P5PA 3WFIA 1U63A 1BKDR 4D8UA 2ZZMA 2NTVA 4V0LA 3I6IA 3PQ7A 4JNKA 5JDCC 4UDNA 3RS7A 3TSZA 1U5CA 5ES4B 4MUHA 4XJSA 3EUWA 1NY6A 3DUWA 4URWR 2ZU6A 4DOMA 1TQ4A 4EITA 3RYCA 4HHEA 4CU5A 5EKXA 3CPHA 3T7SA 4B4DA 1LBQA 3A2NA 4ITVA 3SVTA 4LXTA 2P3LA 4GEKA 4MPDA 3QVSA 3UJ9A 4AMUA 5EKSA 3NATA 3UNXA 1JEYA 4E03A 3JVUA 2ZPTX 1MA0A 3VDMA 4L3VA 4ZYVA 1NUQA 3MWLA 1JAXA 4QDOA 1L8AA 4L15A 2F1RA 3DQQA 4HAZA 4NENA 5IVDA 2VZ9A 1GPUA 4ZJUA 5BQXA 5CGZA 1LLUA 1FNSA 1OC4A 4BC1A 4N76A 3C1AA 2YZNA 4CQLB 4MDFA 3S44A 3RK4A 1H42A 2ZI5A 1QJ4A 1BZYA 2XWJI 4MIOA 4P82A 5HG0A 1F9AA 1AU9A 2QE7A 4R2IA 4G4SP 2OXIA 4AF6A 4JBLA 4D6YA 3BJMA 3LL7A 5ESRA 3S5JA 4BO1A 4UUMA 1ZVVA 2D5IA 2IHNA 4OI4A 1MNAA 2HUPA 4LZLA 4MQEA 1OWLA 1C9NA 1LVUA 1XVVA 2OY0A 3VHLB 3IQGX 3R41A 3T15A 4C22A 1J39A 2Q4OA 4OQXA 1I4DD 3K8OE 3KFLA 4JHLA 1LI4A 2FK8A 2QGZA 3BM5A 4MXDA 4ND5A 4NR0A 4RYDA 4W5WA 2XY4A 4UBMA 1UQTA 1WBJB 1KEWA 1FP6A 3OQPA 2Q9CA 4ZZ2A 2JIRA 4YTEA 2AKEA 4YC7A 4WL0A 2HSEA 2ZM6B 5DGDA 2Q9UA 4RMIA 3FCXA 5D5HA 2FSSA 3RASA 2XVAA 3ZZMA 3NKLA 5AW9A 1EBUA 3BGIA 3A6EA 2I0FA 4FHGA 4NBRA 5BSVA 3KJXA 3NXSA 2EP8A 5EQFA 1U2SA 2JGJA 4GRDA 3RGGA 3EQ6A 4CMJA 1ZBDA 1H1DA 2A9OA 3I9MA 3JATA 4QC2A 5EN4A 5DHAA 3S70A 1GTMA 1G8FA 3GLHE 4PSKA 5LOVA 3UJ7A 4AG3A 3HYRA 4EMTA 5DTJA 3VZRA 4JP2A 3GJTA 1KRWA 4DDWA 2QSJA 1JG6A 2F8MA 5K03A 3H4MA 2XDAA 1N2EA 2W6QA 3KYIB 4FWIB 1A5BB 1KQOA 1B0PA 4QZVA 4IEIA 3HE3A 5FPKA 1UJNA 1WOYA 3LRPA 4O2BB 4HDMA 4JGIA 3DWFA 2VQFB 1EVYA 4FK8A 1QFJA 3BS4A 1IIRA 4X5OA 1Y5NA 3DC2A 3QW4B 4HLUA 4NJMB 3ZK8A 4C4RA 3P1JA 3H2SA 3DFZA 1KOFA 3HN7A 3KXDA 3PSHA 1Q0PA 1G5PA 4LPKA 1IAVA 3VSDA 1Y98A 3C7KA 3AOEA 5HF8A 4DEXA 4CM6A 1TQ2A 4YUAA 3IBTA 2ZUDA 3UFXB 2YNMD 4D8WA 4Q7MB 4P86A 1Q1BA 4DTCA 2ORED 1Y82A 3BWCA 3E58A 3PNYA 4IMIB 4NBWA 2O0HA 3SSOA 2EZ8A 3N2LA 2DKNA 4R9SA 4ZTUB 2ZB8A 4KXQA 3RQSA 4R2MA 2D0IA 5TT1A 2YJ5A 5ULLA 1NJGA 1KPHA 5IBPA 2DBZA 2XEDA 2Y4OA 4OVKA 2VUUA 3DFUA 3UAZA 2W9XA 2GYVA 4NZOA 3S4YA 3UC9A 4UTVA 5JNTA 2PLRA 4X41A 4D9EA 3ORSA 1X8LA 2DYKA 2D0PB 1RABA 2XUOA 1KI1A 1YA4A 5JHHB 5L3SB 4UUQA 5IK2A 5D3QA 3TQFA 1PNQA 3F90A 2VT2A 4YRBA 4IQ8A 4KWIA 4QAQA 2OUKA 5GVSA 1WXQA 4WK6A 2H7YA 3S3TA 2ADOA 1UJ5A 1YCDA 1E5LA 3QLVC 5CRIA 3W05A 1VMDA 3CV3A 3ZBPA 5AM1A 4ZPXA 3MJFA 5CH5A 3LTNC 4JGGA 5J63A 2AOXA 4RJLA 3RUAA 1TTQB 4CKWB 3WWDA 2XUHA 3MCWA 4UMDA 1AUVA 1CERA 1J5XA 1J00A 2P6OA 3LW8A 4PYOA 2V3WA 3TW6A 1HM5A 3TZHA 1GG8A 4IH4A 1JX6A 1KMQA 5FEMA 3IYLW 1GD1O 2AJCA 2YNMC 4G5OA 1R5JA 2AX4A 2O7QA 2PUJA 2QW8A 4NEQA 2RGAA 2V6FA 5CCXA 2PLWA 4C4ZA 4N3AA 3T0IA 1X7XB 3UOWA 2G25A 4RELA 2DP4E 3ZKAA 3PNKA 2E4XA 4G0YA 4ZVQA 2GZSA 3K94A 5TEVA 3C48A 1JEAA 2YY6A 4M1OA 1NW7A 4BX3A 4D8VA 1MR3F 2QP4A 5JECA 4PLPA 2IHKA 4K05A 3U7FB 1R88A 2DH5A 2RHJA 4MR8A 2ACEA 4PNHA 5JCXA 3I9KA 3NHZA 1R8YA 3QVGB 2I1WA 4WWHA 1D2RA 3AM4A 3ANMA 1ULSA 1OVMA 2C58A 3HA3A 4FSHA 2RKWA 4L3WA 5CX1A 5AKLA 5JO9A 4WBNF 1VG9B 5ICCA 3I4LA 4DGQA 5IVKA 1GVNB 1T9CA 4OEHA 1RBMA 1T36B 5BV2P 2F4VB 1NI4A 2XGOA 4RNDB 5EWLA 1A1VA 2OMEA 1Y6FA 1M0TA 4LV5B 4YYZA 5D86A 2VUSA 3EF0A 3NT5A 3OCZA 2C5BA 5JYBA 4LJRA 4ND1A 1QP0A 2P35A 2Y0EA 1CEYA 1NI3A 1Q11A 2PUEA 1JKIA 2RHDA 3PVSA 4YY3B 4RQTA 3X43A 4JNCA 4EKDA 4RULA 4GZ3A 3BAFA 1DU4A 2J6HA 1S7CA 1Z8NA 4MTLA 3GRAA 1F0NA 4FDAA 2H5LA 3WK5A 4CIWA 3QTBA 2CZGA 1D6MA 2XBUA 4ZHQB 5J23A 2MINB 2VWGA 5AVVA 3LPDA 4LNUA 4V03A 3BCRA 3AZQA 4WZBE 5CYFA 2HBRA 5FKJA 3SFVA 4DBLC 1BQEA 2IKSA 3O2NA 4L7QA 3F5QA 4LDJA 1HYBA 2ID8A 2V03A 4QXOA 2WKRA 1TCAA 4P4NA 4NQZA 4EPYA 3W5AA 1H3EA 1TADA 1V39A 3KHUA 1XN4A 4X84A 4UTPA 2Y0DA 2ZWVA 3QYFA 1VKRA 2PBRA 3QX7A 1JQKA 1W2WB 2VRCD 2O14A 3ORHA 5EHQA 3HO1A 4I7EA 1OFIA 4CEHA 1MEJA 1WMFA 2ZR0A 1U9ZA 1M1XB 5I7SA 1Z2DA 4GM1A 1FCJA 1Z6TA 4C0LA 4A36A 2OHHA 5BSUA 5IAOA 1Z5UA 2WQZA 1KJYA 1T8RA 1Q5PA 2RGGA 3L8MA 4G5HA 4HDSB 3WISA 2EKBA 3ETJA 5D8DA 2WJGA 2P8JA 3UKOA 4G6ZA 4QFBA 4ZT5A 3UUEA 5EMKA 4M0PA 3UXHA 3L7JA 4BGUA 1OIWA 2GZ3A 3IKMB 4IJ5A 1L5QA 1Z2OX 3GHHA 1ODLA 4UBIA 5HK9A 1OKKD 3M33A 4I5FA 5IAJA 4EJSA 3BILA 3EZLA 2I80A 3O84A 4F4FA 5F9MA 1VG0B 4QOEA 5CD1A 1PT6A 2OC4A 5I7HA 5DEIA 3MWGA 3OZ7A 1KJZA 5H9WA 3V55A 4G2NA 4I1YA 1GRVA 1XAHA 1RZVA 2VAWA 3ZHRA 1CF9A 3N6VA 1VHLA 3PR1A 4J4BA 4LE0A 4MZDA 4MW7A 5BN1A 3ILYA 1GAQA 3W2GA 3ZD7A 5FADA 2GD2A 4JT4A 1OFTA 1T0JB 2HYDA 4ODIA 4TV8A 3HDTA 4ZIRB 1QGZA 2AGVA 3NDIA 3L6EA 2GPAA 4DR5B 2XF8A 3QG5A 1F6DA 2WJHA 4B46A 1H6DA 2WFLB 4UNIA 2ECFA 2C7PA 3O3CA 2VHYA 4V0RA 3B5EA 4YJ3B 5ALMA 2IDZA 5BUCA 1Q0TA 1K1EA 1MJGA 5KQLA 3RIHA 2ZJAA 3KYCA 1FX0B 4JT8A 4M60A 3U3DA 1K27A 2WYIA 4QXAA 1WMEA 1KHHA 4L76A 1AXGA 1M5UA 4Z49A 2Y1EA 2WD8A 5HZHA 1QPZA 4RMNA 5DTIA 1GOTA 1HMYA 3FSGD 2C2KA 2Q99A 1OFUA 1C30A 4EB6A 1STOA 4HGPA 4IJUA 4BB5A 4DDKA 1HH4A 4PBSA 4DILA 3QY9A 1KXZA 2Q3MA 3DDNA 3KTAB 4LYGA 3T4XA 3J80A 2WJVA 3CMMA 3EIEA 2C2GA 3JZMA 2A6PA 1GTZA 3HRHA 2VYCA 4LF4B 3UT6A 4ETIA 4ENUA 4RD6A 1XWWA 1KJWA 1U5BB 5DLYA 3G79A 1Z3CA 1Q7RA 1K89A 3B53X 4N5MA 3M5WA 1JMKC 2VP2A 1JE1A 2P8SA 4PAMA 5LZ5A 1KMHB 2P9EA 1SOUA 4PYLA 4H7DA 5D7BA 1KIFA 3GELA 5F52A 2P69A 1ORWA 2FLKA 3ICOA 4CXMA 1IK4A 2G06A 4MVWA 1P7PA 4UVIA 1JJVA 3VTZA 3VZQA 4YHHB 4I8XA 2GZMA 3GCXA 4FDVA 3ZCSA 4C6RA 3ZGZA 3HBNA 3FG9A 2D1RA 1J20A 1PL0A 3AR8A 2V65A 3JSAA 4FIDA 2COUA 2Y1CA 1XZDA 3K8YA 4P3KA 3I5YA 1L8OA 1QSGA 2MSWA 3LXMA 1F7UA 1LLCA 3W1WA 1G3MA 1DWUA 1HBJA 1KYVA 2IEBA 4QNMA 4TKZA 1V5EA 5AXBA 3MA0A 3FPSA 4RC9A 3PLNA 2O48X 2R00C 2IT1A 5D6OA 2XDYA 1RWMA 1FQKA 4RJTA 1A2OA 2XBLA 2YRXA 4CL8A 2FR8A 4F2GA 4RE6A 5K20A 3CUVA 4Y2GA 2OGSA 1MENA 2J9GA 5IJ9A 2XVYA 4E15A 3IBFA 1X39A 1HDYA 1SHKA 3AUTA 1K66A 3GFSA 4II3A 2IX3A 1M1NB 5ENZA 2R5WA 1A96A 2Y2UA 4R40A 3K0AA 1GDHA 2FR1A 1K7FB 1IWOA 1JG1A 1HO3A 3QEOA 2JRLA 2AF3C 3Q9SA 5I9BA 2TS1A 1O95C 5CP8A 4HTFA 2V5AA 2WJWA 3KUKA 3CBQA 3RSQA 1J70A 3NTQA 2H18A 2XWSA 2G4VA 3BL8A 3N8IA 4DCCA 4D5GA 1BWSA 1RQGA 2JA1A 3A10A 3FYSA 3EMBA 4YMIA 4F8EA 1NYRA 1Y48E 1D1SA 2YHIA 1XK7A 2H17A 1VJ1A 1PHPA 1TCUA 4G25A 3AX6A 5JWHA 4GU5A 3UT0A 3A4IA 1EX6A 1JGTA 3C14C 3OHMA 4XCVA 1WTAA 1QFYA 3E3MA 2CE7A 3MB5A 3UUGA 4DLLA 1RPJA 4M9XA 3I45A 1UOEA 4X7BA 2VF4X 2X9GA 1USUA 2IOQA 2OWEA 1GQ2A 2FRDA 2HYIC 4IKEA 5GZ3A 5J4KA 3RC1A 2EKPA 3N8HA 2H1SA 3PJFA 4RK7A 2B78A 4GBJA 4TUYA 1M76A 5BMVB 3TEJA 5JZMA 2AJLI 4K6KA 4E13A 3PP8A 4FB5A 1CS4C 4MDEA 3R44A 2NO4A 2J6IA 4C04A 1I3MA 1M6EX 1LWNA 3CUYA 4C1NA 2M9MA 2D2VA 1SUBA 2FW1A 4NTZA 2JLBA 121PA 3KXKA 4EF6A 5I9LA 3OIFA 4X00A 1DXYA 5FYQA 3LUBA 4GX2A 4R1PA 1YJAA 2VYND 3GOQA 4OG2A 3TQIA 2IH2A 2WAYA 3EXAA 5JH7A 1SM4A 4M46A 3ORYA 1W36B 4U7JA 4EHFA 4IPTA 4CEIA 3RHZA 3IQIX 1LLFA 2WYOA 1WCWA 5C1DA 2P4SA 3SOZA 1QIEA 3PLAE 5KNDA 2DX7A 3AF3A 3P9CA 3ZDXB 1U0TA 3RUCA 1XRSB 1SBNE 4JLUA 1BJKA 1C8VB 4G1CA 4OI1A 1FIUA 1ZAYA 1JLLA 3C4VA 3QEJA 4JBWA 3WGMA 3R8FA 4W6ZA 5I3ZA 4WE3A 1WE2A 3BQMB 1W44A 3DB1A 2HSDA 3D4PA 4NZYA 4CDMA 4EPRA 3FPBA 3R7LA 1TNDA 1ZZGA 3W6OA 5MHTA 3FCAA 1TJ5A 2HQBA 2XOXA 1WZCA 2VDOB 2ZJ1A 4RMJA 4NCBA 3N0WA 2R79A 3QJYA 4A0HA 4B31A 1RRCA 3B1KA 2HSWA 4BGEA 1DKPA 4A6DA 2JZOA 1UBLS 2ZRCA 1KY4A 3OCXA 3BE5A 3C5VA 1GPJA 2JHGA 2Q5QA 3IV7A 4S12A 4B3FX 1SC4A 2WT4A 4A16A 4XSGA 3D8UA 4QTXA 2FFBA 1PQ4A 1POXA 1S0UA 5LLSA 1J56A 2XTZA 3JQFC 3T7JA 1S8AA 4P4SB 4DMCA 3NUGA 1FYDA 1J2UA 3D3KA 5IUKC 1R9NA 1XI2A 1FB5A 4NMXB 1PFGA 4R3NA 4CKCB 4QM6A 5A7FA 3QFRA 2AA3A 4Y6LA 2CB0A 2JHAA 2CXUA 1K6IA 1L4MA 2HF7A 3CVOA 3FOFC 5EJMA 4Z4FA 5DGIA 3TLEA 3RSSA 1ISPA 3TTUA 1ISIA 4CWAA 1RZRA 1DQPA 2SKDA 3ONDA 5FP0A 5AESA 1UADA 3AY6A 4ZT4A 1MORA 1BX3A 4B71A 1HETA 1AQLA 4UDXX 1GV0A 2XNDA 4RA9A 3BFJA 4HK4A 1XG5A 2I2CA 2FVYA 2GNPA 4ZOQI 1I7QB 1LRJA 3EH2A 2QP9X 1JDJA 3WA7A 4RVDA 5AM2A 4ARIA 4R2JA 2FOLA 4M8LA 3K35A 1H94A 4FB4A 3F73A 3F3MA 1OTYA 5IHPA 3DMYA 3EGOA 2GD0A 5DKFA 2VATA 4DMUB 1Y7HA 5HE8A 4RXUA 1QIFA 1XDUA 1SHJA 1UR5A 2VDRB 3CUUA 1CTQA 1UMDB 4QOGA 5TEWA 2PX2A 1PR5A 2ENUA 3KU4A 4Y9DA 1KDZA 1E58A 1B0ZA 4CKEA 1NZFA 5IKEA 3B2QA 5TNXA 1UKAA 4R1OA 2BFCA 1NF2A 1XU7A 3HP4A 4DDMA 2ZYTX 3E3NA 3DFKA 4P5EA 3V7NA 3F2VA 3KLMX 4MW5A 3Q7QA 3LOPA 3ADKA 4L0QA 3RT1A 4B45A 2V6BA 3A1WA 1IQ0A 1QK5A 4WK4B 2LGJA 4GZ5A 2XTJA 3DWIA 3D59A 1UWKA 1ZUD1 1IOVA 1DOAA 1E2EA 2BMEA 2H2FA 2Q62A 2H4FA 2H4YA 1K9SA 3NDBB 1Q1GA 3QZUA 3UW3A 5K8UA 2Q46A 5EIBC 3GP5A 1Q95A 1D0VA 3UHPA 3QE9Y 4E46A 4R0MA 1MB2A 2NXNA 3WGLA 3L4BC 5GIPE 5HDQA 3F4LA 3NHFA 3ID6C 4Q3CA 1OYWA 2B5WA 2Y8EA 1NRJB 4AYXA 2FX3A 5D1HA 3WDSA 3DM9B 1HKUA 1O5IA 3DC7A 4C7VA 3OFJA 2VR1A 3QYPA 4YROA 2HIHA 3P2JA 4UQPA 3BTOA 3U31A 3COWA 3NM6B 4WUTA 5FR2A 2NZ2A 2LKDA 1JPUA 2W2XA 4KMRA 3QUBA 4AI6A 1XXHA 3AF2A 3FAKA 4DAEA 3D6AA 1UCFA 2Z5FA 4R8RA 5BYAA 4N41A 5A5DA 2BUAA 1AXRA 4KW7A 3LMKA 5JRZA 4NRDA 4JYPA 2JFQA 1DAMA 1RJWA 2QE7D 3LF1A 5LBTA 4BMNA 3DVQX 4KOEC 5U1PA 3GR6A 4IHKA 2XECA 3EK2A 1PFKA 4Y2QA 3ROZA 1W46A 1YKSA 1QX3A 1YQEA 2ZTVA 2UZ0A 3H18A 4EGFA 2Z9BA 3RFTA 2WKPA 3O0TA 3N39C 2BH2A 1AY0A 3FWPA 3V7YA 5KJFA 1XIVA 4OQPA 4PO1A 1W36C 2GCIA 4A8PA 4C0KA 1KEEB 4II2A 1NU8A 4FD3A 3PNSA 3EXHC 4C0HA 3O9MA 5KTNA 1TJ3A 2I3ZA 2C20A 4JLPA 3FHCB 4JK3A 4O33A 1QCYA 4J9UE 4YI5A 2GPTA 3ZD8A 3ML1A 5CLHA 1QIKA 4JB8A 3RLFA 1TM5E 3MOSA 1PTKA 2FGJA 2ZJ7A 3COVA 1OE0A 1JSRA 1Q3TA 1UWVA 1W9HA 2YIVX 1XA0A 2VP4A 2X8BA 1JTVA 1KFBB 1KY5A 1YQQA 1EGVB 1NDHA 5ERGB 3VO1A 1JJBA 4X6YA 2FSVC 4G1BA 5I8ZA 4C5CA 3NYRA 1VP9A 2G1AA 3LUGA 1RM4A 2OLJA 4CLDA 4DQ0A 1XMOB 1KZYC 3ESAA 1Y9JA 1GRQA 1PNOA 3A1UA 3RK0A 4C7BA 4EQ6B 2EWMA 3BGOS 1XO1A 4HVLA 3OOJA 2ZSUA 8ABPA 2GRJA 1XP5A 3PJRA 4ND4A 2IHUA 3JWIA 4DVJA 1PX2A 2BJVA 4OFBA 4KKXB 3S2ZA 3MOIA 5TMPA 1Y3AA 1CSEE 3CEPB 2O8DB 3W5UA 3C6MA 5LMCA 4U2FA 1GNTA 3VDNB 1VDZA 1CULC 2ZJFA 1XRNA 5AIAA 2ZIZA 1RI4A 4HADA 4BAZA 3RSHA 4JJZA 3OAAA 5AFSA 1D04A 1AGPA 4IDPA 3USZA 3IP3A 2PSJA 4DDHA 3E23A 4CM4B 4IJKA 1NPDA 1T1JA 1BW9A 3AFIA 5AHKA 3I01M 621PA 1MBZA 4RGBA 1A50B 1RLTA 4ER7A 3OE7A 4OMUA 1OR8A 1QZXA 2ZIXB 4O5AA 4JOBA 2HMAA 3RJTA 4B79A 4EZBA 1WUIS 5CT5A 3OSZA 2TMKA 4HEA6 4OHPA 1HLDA 3C70A 1HX7A 1VQ1A 3LSTA 2VSOA 2QRNA 4I9HA 4D3FA 1CUAA 2QPAA 1KAGA 4Q47A 4L6IA 5H82A 4FC7A 3BFKA 5DE3A 2B8TA 1INLA 1KI8A 1ORDA 4BQOA 4DSZA 3V8RA 2CVHA 1TF5A 3ON5A 5K0TA 2MSEB 3DEKA 4N49A 3SKXA 1E2LA 2OAEA 1PVDA 4MCJA 1GDDA 2RJOA 2VZ0A 1YK1A 3EDCA 4RLQA 4TKMA 3RYHB 4TKUB 3T5BA 3RIMA 4NYJQ 4A15A 3VR6H 5EXEA 5BN5A 1X3SA 4O2RA 1Q91A 5LJLA 2R44A 4HMOA 3SVLA 5IK2D 1C1XA 3KQSA 3JVDA 4HAXA 4POOA 1CZNA 1ENPA 3V34A 4DJFC 4XDGA 3JQGB 3FMOB 3P0FA 1FLVA 3SF8B 4UU8A 1P3DA 4WGFA 4B6JA 1AOXA 3KZVA 4NS4A 5K0FA 4KITB 1DIOB 1AK1A 4ICIA 1J1UA 2GFHA 1Q1ZA 4LE2A 3HPRA 4JY7A 4HWRA 5B55A 3OZIA 4HLUC 4JEHA 3GVPA 1G7CA 5FI5A 1UBFA 5I3CA 1LBSA 1MOPA 4O25A 1KDOA 3WX0A 3DT6A 3QUAA 5F78A 4ASUA 3P2OA 1UF9A 5AQ1A 3GEDA 4X8MA 5B7GA 1IOZA 1X1BA 2ZSBA 4HBZA 5J4VA 3WIOA 2DZDA 4K86A 1U7OA 4URFA 5AVSA 4MS3B 1FLNA 2BZGA 4JQYA 3U3OA 3H04A 2QM8A 1FUEA 4J7AA 4AO7A 1XEXB 3EBOA 1NN3A 2NN3C 2BDTA 1CY1A 1TLLA 2BCJQ 1M2KA 1T6NA 1XJ5A 5E6SA 5JAQA 4EK9A 5AVZA 5ESWA 4LX0A 5HZMA 2IBSA 1AV7A 2D3TA 3WRVA 4XARA 1Z07A 3QLUC 2RHLA 1XELA 3WLKX 2Q7XA 4BTVA 5CDSA 2IHYA 3L0SA 3L6CA 4Q3LA 3K5HA 2ZJ6A 1NMEA 4J16A 2Z8XA 2GDZA 1QQTA 1ZUIA 1UJ6A 2C98A 3CX6A 4PAWA 4MUKA 4J1SA 3WWEA 4CGYA 1SD5A 1EXVA 3ZGOA 2Q5CA 3GJXC 4I9UA 4M7OA 1RADA 3DWGA 3QVJA 1TGVA 2AWOA 2O05A 2YXDA 3RJZA 4N8DA 4BS9A 5HSGA 1E9FA 3OT1A 1DQYA 2OQRA 1XEAA 1ML3A 5FOUA 1PJBA 2O6LA 2DVMA 1QLWA 3IURA 4E5DA 1R0XA 3AUKA 3QF7A 1TT5A 1C5KA 3D81A 3KCNA 4GSLA 4JITA 4KFTA 3SE7A 4J07A 4EDFA 3CNLA 4NAVA 2GASA 2BHNA 2A9JA 3DDSA 3EZYA 3UMJA 2G6BA 2H92A 1NR7A 4Z0HO 1PJ4A 4IICA 3ENZA 5B12A 4DUZB 1TQDA 3TQSA 3DAHA 3IS3A 3W7VA 4KL8S 1Z0UA 3KAPA 5FD8A 4UVHA 1N9GB 4A8JB 3SIXA 2VUIB 4US1R 3DVLA 4INJA 2RGBA 4NU5A 3UMSA 2OB2A 4CV0A 1IZ0A 1VBFA 3TKYA 1Q1NA 5IMBA 3UMFA 4B87A 5L4NA 3AVWA 3BJIC 2R6AA 3JD3A 2QUBA 3IQHX 4AIIA 5IPFA 4QARA 5ECWA 1WP4A 1HSOA 1LPPA 3CZRA 4ZQCB 2DBVO 5EINA 1BIFA 2JIBA 2EJWA 2X0KA 4IZIA 5E9AA 4C05A 2Z57A 4ESOA 1CS0A 1CQIA 4M9CA 4O63O 3ELWA 4CPDA 1DBSA 3G0HA 1LPSA 2Z30A 3CA8A 2UVDA 4WOPA 3RRFA 2M6LA 2ZRAA 5LMUB 4O4JA 2Z6QA 1YXMA 2NYVA 3JYQA 4JB3A 1QANA 3CPEA 4A3SA 1C4KA 1J1IA 2ASVA 1MCZA 4MV8A 3PQEA 4B47A 2JAPA 1DADA 4DUPA 3T3GA 4EX7A 2PLFA 1Z7BA 2D0DA 1NSYA 3ST7A 3UV6A 3TIIA 3HADA 3NDRA 3PEEA 5HNKA 2O0MA 2VDUE 4EA6A 2HTFA 4M87A 4OLBA 3RSGA 3T4EA 2JAQA 3PC3A 1L7XA 4N6NA 1JMYA 1JBKA 1UIMA 1JNYA 3BMOA 1SVKA 2HHCA 4NSNA 4CM1A 1JPNA 5AK6A 3SJ7A 1KYQA 1ZEMA 4NG5A 4ERXA 4HX2A 1VJ0A 3U44A 3REFA 2HPVA 3KEMA 3L7NA 4EM6A 3PEUA 4EBFA 2X0NA 1YS9A 2BF4A 1VBKA 1XOIA 4FEYA 3BSWA 4XQ0A 1U4NA 4ZQHA 4PCUA 4AM8A 4D4LA 3W5DA 4N54A 4G89A 2ZRKA 2MSCB 1O94A 3DXXA 1KE1A 1U3DA 1MAWA 1NMQA 1PTJA 2WPNA 1XLVA 2JGDB 3DWEX 3N2EA 4EAAA 4B5KA 2XLBA 3E3LA 2A1UA 3MSCA 3U4HA 2RGUA 2X5JO 1X7ZB 3NHKA 2BE7A 2AW3A 2RGXA 4N3NA 1CLUA 5IF3A 3IDOA 2HPAA 1OROA 4Z4EA 1PL7A 2FSPA 4Z1MA 5LDGA 5JBNA 4GDMA 1ZK4A 3E7DA 1RLUA 5L3QA 3EWSA 1D7AA 3ANXA 1T3ZA 1ZJZA 3DO6A 4ROTA 4DF3A 1XVUA 4EW3A 4F06A 1HE8B 1EUCB 2ZB4A 5JI2E 3EMVA 3NVMB 3HVRA 3C24A 1JSZA 1U3WA 3C98A 4WQMA 3D31A 4LXUA 3OJCA 4RVUA 4E3WA 2NW6A 5DLQC 2ZJZA 4LY3A 4G41A 3AFHA 3ZI7A 5C1OA 4Q21A 4AN1A 3ETDA 4YT4A 2B35A 3EJWA 1DKNA 1O87A 1XBTA 4WZAA 4ZMSA 2VSYA 3BRCA 1NC1A 1V3QE 4MYUA 4A6XA 3T5PA 3JTEA 4WT7A 2O8BB 5A6SA 1DJMA 4ALJA 3WNVA 1D2MA 2GETA 1NBHA 1M3SA 1TLFA 2OCYC 1NULA 2IWHA 1E89A 3IUQA 1FU8A 4GOXA 4QGBA 4ZAXA 2P3OA 4G9EA 2P6MA 4G63A 4QU8A 3LUHA 4JYBA 1Y4UA 4ZMRA 2VHVA 4NS1A 2W6MA 4AAYA 3WGHA 2FNAA 1RC8A 1JDZA 1SOWA 3L06A 3RSLA 5EHNA 1GZ7A 4ARVA 4WJLA 5LLDA 2G1JA 1X70A 3L6RA 4NJEB 1RW4A 5KNDH 1S8OA 1VKJA 1DARA 1TYDE 4NDAA 3RV3A 1H9CA 3X2SA 4W5TA 3GLIE 4UEOA 3ROKA 3WL6A 1EHYA 2BEVB 4GXQA 5C3UA 2HK9A 3ESDA 1A9ZA 3FPKA 2VLBA 5FUBA 1A2QA 2NYRA 1VLZA 1T8TA 4KLCA 3K70B 4XWTA 2O2DA 4UEQA 3AQIA 1PFWA 5HKBA 1KXJA 2WD7A 3J7AC 1G6HA 3IPXA 4NOJA 5DFAA 4F72A 4HGZA 3Q9NA 1U7WA 3WB2A 3I39X 3H1AA 3FTEA 1FZTA 4ZICA 4FWTA 4S3MA 3FX2A 2WUGA 1KI7A 2EGUA 4WCFB 5LQRA 1Z36A 2CGEA 3SXPA 3PF9A 4EYEA 3FCYA 1OSNA 3AWIA 3E9QA 5CDFA 2P90A 3MCTA 3ANNA 2C4HA 4JWTA 3SLGA 4JVSB 3SQOA 4X3PA 1A9RA 2Q29A 4U7HA 3RYFA 4FKMA 4PHHA 3U4QB 3LDFA 2PS0A 1E8NA 4QUKA 2J3EA 2A3NA 4S35A 1U0BB 3LH5A 5ISMA 2J33A 3N0RA 1FUUA 2A9QA 2JCGA 3F3KA 1SCBA 1NJ6A 2IELA 4U9HS 3NKFA 4LMBA 1O9BA 3Q6MA 3V00A 3KHTA 4TLBA 2BR4A 3UANA 3O26A 1Y3HA 3U9SA 1H0HA 2A33A 2YIDA 3PD1A 4G0QA 4O2LA 3SEFA 5C7YA 4AKIA 1VJCA 1RIFA 1TJYA 5LA6B 3G0GA 4P4LA 2FZLA 2LD4A 3WTCA 4M8SA 1JDNA 2OG1A 1YDWA 3IIJA 3M6MD 3QVWA 5A0TA 4H0CA 1A7KA 3L49A 4O4HB 4UM9D 4OHVA 2QRLA 3LZDA 1WNFA 1RRGA 1UKEA 3L0ZA 5K5EA 2QT0A 3MMXA 2PQ0A 5L8VA 1PBTA 3OQJA 1ZS9A 2JGIA 2ONZA 2XW6A 4PWZA 3DOEA 1MX1A 1HDGO 4FFWA 1BN7A 4NDZA 4UBJA 3O8QA 4LY6A 4R7TA 3TZBA 3TJRA 5EZYF 4B75A 5AM5A 5A5VA 3QMVA 3RSZA 5CB4B 1AGRA 2BI8A 3WLHA 2UVPA 3VYTB 3GAMA 3ZNOA 2JPDA 3ZXXA 3QX3A 5DGXA 3LL4A 4IOMA 1E20A 1OF1A 4RK6A 1N2IA 4X91A 1PL6A 3LWDA 1RPZA 4CM9D 4AUNA 1NJ2A 2K87A 1LBHA 4NP6A 4U6NA 2YXNA 1S4QA 1SC1A 5C81A 4D25A 3FUWA 2AG8A 3REQA 1FF9A 3FNQA 1PP4A 5ITZB 4NJMA 3V9PA 2XE7A 3B1FA 3JALA 1NKSA 2GYWA 4B7ZA 4PC3A 4Q93A 3MLBA 3QXSA 4HDOB 1FFYA 3VH4A 1X3LA 3UFXA 2DPXA 4IZHA 2JJQA 2NQ8A 3DOJA 3OOYA 3TN7A 3I1FA 2R7MA 1LS1A 1PRYA 3KEFA 2XWBF 4G8JA 4A82A 1PUJA 2JAOA 3DBVO 5EZSA 2KM1A 4HAYA 5IHXA 4H17A 5HJ2A 1TGYA 2E5LB 3VPGA 1N75A 2EG9A 1MJ5A 4PSVA 3KR1A 5LZ2A 1CUWA 1T9AA 4R8KA 1LQ2A 4GC5A 3QM1A 5DYYA 2Q9BA 3UTDA 3K0EA 1RZRD 3KXIA 1GPMA 2ZJ5A 4JU8A 4YAIA 2JAXA 2F3UA 4RJJA 3D3WB 3L8FA 2XNDD 3LBAA 3MTIA 1T2EA 1DAFA 4F2PA 2O07A 3ZU6A 5CBKA 3RVLA 2HRCA 4FYWA 2FPKA 3ZJ5A 1EH5A 3ORQA 4FI3F 5K1ZA 5L3SA 3GMTA 1GRCA 4CG1A 3RU3A 1EUYA 4FYPA 1WX1A 4NICA 4HEA1 3EPKA 3DS8A 3CJQA 1YKGA 1J9ZA 3OY7A 2AXQA 4IIFA 2ZRIA 3TR5A 3GLQA 1GVHA 5KAPA 3H5NA 3HFGA 1WG8A 4YDHB 4COOA 3TCNA 4RTOA 3OUZA 3OU6A 1IEWA 1EZ4A 1YQGA 2FCAA 1F4PA 2P9FA 3DUFB 4RD4A 5KC9A 2IITA 5KNBA 4D4JA 4JLMA 1TMGE 5H4GA 4ISCA 4B0PA 2EZ4A 4G67A 5A06A 3PC2A 4L8FA 2I54A 4H1HA 1AJEA 1JKJA 1YZ3A 1MMFB 1XRLA 1Z0AA 2A35A 2ZI9A 1WQ3A 4HN2A 3HWSA 2JGRA 4EA9A 2QPTA 1DJPA 4EPVA 5KKCA 4I9GA 1EFHA 1RAHA 4OA8A 5J5AA 5KWJA 3W5CA 1OOEA 3WNBA 2A5LA 4EO9A 1HFJA 1RMYA 1JILA 1JR3A 1X9HA 4D4HA 3V9AA 2O8FA 5DEOA 3RGWS 3OF5A 4QSMA 3CKKA 3OM9A 1E4OA 3TE7A 3N0VA 3OQVA 1T0IA 5IDXA 4KIJA 3VX3A 1FFXB 1OBHA 1OZFA 3K4QA 4WBNB 5JTTA 1I2AA 2WOOA 4KLAA 4IX9A