4G81A

Crystal structure of a hexonate dehydrogenase ortholog (target efi-506402 from salmonella enterica, unliganded structure
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
253
structure length
253
Chain Sequence
ALFDLTGKTALVTGSARGLGFAYAEGLAAAGARVILNDIRATLLAESVDTLTRKGYDAHGVAFDVTDELAIEAAFSKLDAEGIHVDILINNAGIQYRKPMVELELENWQKVIDTNLTSAFLVSRSAAKRMIARNSGGKIINIGSLTSQAARPTVAPYTAAKGGIKMLTCSMAAEWAQFNIQTNAIGPGYILTDMNTALIEDKQFDSWVKSSTPSQRWGRPEELIGTAIFLSSKASDYINGQIIYVDGGWLAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hexonate dehydrogenase
publication title Crystal structure of a hexonate dehydrogenase ortholog (target efi-506402 from salmonella enterica, unliganded structure
rcsb
source organism Salmonella enterica subsp. enterica serovar enteritidis
molecule tags Oxidoreductase
total genus 100
structure length 253
sequence length 253
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4g81A00
1E3WA 1Y5MA 4A10A 4BNHA 1MP0A 1NM5A 2OMEA 5DF1A 4DRYA 4BVAA 2YUTA 3I4FA 4YA6A 1LA2A 4FFOA 4CLOA 1LRJA 3L9XA 1SMKA 3PYMA 1D8AA 3S8MA 4YB8A 1E3LA 1R4MA 2WM3A 3UGKA 5KVCA 4RPKA 1UDAA 1OC4A 1EVZA 3INTA 3KLMX 4DGSA 2RH8A 2DC1A 2VHZA 4BB6A 1I5RA 5I7FA 4M55A 5K6AC 2FHSA 3G49A 3WLFA 2YJZA 4WGGA 3RCBA 3DBLA 4UUPA 4BIIA 5CDUA 1IPFA 2HK8A 3LT2A 4OXYA 1T24A 1GD1O 4FSHA 3QY9A 2JD0A 4MVJD 2NVBA 2YY7A 1MB4A 1RM3A 4J7UA 4D3FA 2GF2A 2Y05A 4OO3A 4YRBA 3BHJA 3NT4A 3Q2KA 2BFMA 1UZMA 5IJZA 1KIFA 1HETA 1XQ1A 4UAGA 4FJ0A 1O8CA 5FFFA 1EEHA 2Y0CA 3NRCA 1QR6A 3ICPA 2R6JA 1DB3A 1V9LA 3DO5A 3JQ6A 2VHVA 1AGNA 1UJMA 3CTMA 4TKMA 3DBVO 4WK6A 4CPDA 5DBFA 5C7OO 1WMAA 3KV3O 1PJ3A 4DLBA 3PYLA 3UOGA 2ZTLA 1HE4A 1M76A 1I01A 3WYBA 1GYQA 2WDZA 1J6UA 3H3FA 1V3VA 2EW2A 2O23A 4CMEC 4CQLA 4CM9A 1ISGA 4J6FA 3KEQA 1AE1A 1BWSA 3GGGA 3QJ5A 3PLNA 3VZSA 2H9IA 2O3JA 2VTDA 3BMQA 1PZGA 2JHGA 5L95A 2VYVD 3HHPA 3UW3A 1DO8A 1PTJA 1XIVA 2PGDA 2XOXA 3E9QA 4MKZA 4G2NA 4E2ZA 3A4VA 4DQXA 1QYWA 5EL0A 2Y1OA 3HJAA 2GASA 1JTVA 4AJLA 4DIBA 2EHDA 1SB8A 1E3JA 1XU7A 1E5QA 5JE8A 3RU9A 5BR7A 2F1KA 2CVZA 5GMOA 1HDXA 2ZKLA 1LI4A 4AJIA 4OMUA 3U4HA 2H63A 2XAAA 1B15A 4KUHA 4IDDA 4J1TA 4D42A 2O50A 4FOOA 4CM8B 1E7RA 1UAYA 3I23A 1NBOA 4HXYA 3DFUA 4WEQA 1FXSA 4I08A 1A9ZA 1U28A 1ENPA 1NFQA 5GZ3A 4TWRA 3ETEA 5CFZA 1WW8A 2CVQA 3AM5A 3WG9A 4MVJH 5CP8A 5L53A 1JAYA 1DC3A 1QYXA 3CMMA 1RWBA 1I30A 2DBQA 3BA1A 3GH3A 1PEDA 2IEBA 3GN2A 1A72A 5ITVA 4O59O 1OFGA 3MZ0A 2X9NA 1LC0A 3KUXA 2X86A 4YJHA 1DBVO 1GR0A 3DBHA 4JBGA 1V3TA 3B70A 3RFXA 1Q1NA 1BXKA 2HMWA 4FW8A 4BO4A 5B12A 1GADO 2H6EA 1TLTA 2OL4A 4D3SA 3RUCA 4BNGA 1UXHA 2OHXA 4GQAA 4ALIA 1F12A 3GHHA 1K6IA 3ENNA 3A1NA 3KBOA 3GG9A 3Q11A 4NK5A 4MVJI 4L73A 1A9YA 3AUUA 1NAHA 4IUYA 1NPTO 5G4KA 2G17A 3LYLA 4XQCA 1SOVA 4U0JA 1YDWA 4CQMB 1YB5A 3Q2IA 1NR1A 3BMNA 3C3XA 1RM0A 5I9NA 4FFPA 4D46A 5JC1A 4FN4A 2BMAA 1C0PA 3ZCXA 3E03A 4WKGA 1EUDA 4D0SA 1YL7A 4DPMA 2GZ3A 2VHWA 4QT0A 1LLQA 1ZK3A 4JJGA 1K6JA 4NMHA 5AOVA 3WXBA 1U9JA 3DMTA 4JK3A 1F0YA 3OQ1A 1D3AA 1BHSA 3WMWA 2AG8A 2NTNA 1ZXLA 4MP6A 5FYDA 2HK7A 2CMDA 2CFCA 1PZHA 3V1UA 2RBEA 1D4FA 2VOJA 3OJFA 3WIEA 4F46A 4JBIA 3ADPA 5F1OA 2ILTA 1F8GA 3K9QO 4ZRNA 4CMCA 3WICA 2EG9A 3KYDA 5T8KC 4JN6B 4BGVA 3F1LA 3TFQA 4Z6KA 4BKQA 1ZEMA 3OM9A 4OAQA 2D3TA 1CEQA 2PV7A 3UFXA 4KDFA 2O3RA 3ORFA 2VZ9A 1BW9B 2JD2A 4PLZA 1HF3A 4PZEA 2A94A 4QX6A 1TT5B 3F3SA 3ULKA 4B4OA 4EI2A 3TSCA 3TFOA 4GMGA 1C1DB 3U62A 4IINA 3I9JA 1PJQA 1GDHA 2PKRA 3OHSX 3Q0EA 4LGVA 4XYMA 1YQDA 2ZK7A 4RVSA 2NUAA 4HFRA 4P4NA 3AU9A 4PZDA 2NU8A 4RPGA 3DQPA 4W7IA 4P4GA 3OH8A 4FJ1A 3DEYX 4OHUA 1KS9A 2V65A 3GA0A 3WBBA 2EGGA 4A0SA 3RD5A 4IDCA 5EESA 2O48X 2IEDA 4PG6A 3GRKA 4BV8A 1LBEA 2UUOA 4CM1A 2GUGA 1NQ5A 3OJ0A 3VPHA 4CR8A 5EERA 1E3IA 2H5LA 2YW9A 3JQDA 4PN3A 4Z9FA 3NDRA 4CMGA 4B7XA 1P1IA 2I67A 2HRBA 2NSDA 2PH3A 3BMCB 1SO8A 1HYEA 4YJGA 4GKVA 3DAPA 3IP1A 1N2SA 4ROSA 1HE2A 2X5JO 3OJLA 4R01A 4OH1A 3VPXA 3S2FA 4TZKA 2YV1A 1U4OA 1HL3A 2DT5A 5TT1A 4E5NA 2GRAA 1XU9A 3JQ8A 3HNPA 5L4LA 4E12A 3WGIA 3KB6A 1YKFA 3I9LA 5DP1A 1K5HA 1SEVA 3CPSA 2EXXA 1ZKMA 2DKNA 3JQ7B 1WDLA 3ROMA 2P9EA 2PZMA 5HA5A 4N18A 2A9FA 2O7QA 2GN9A 2Q49A 4KDEA 3HB4X 3T7CA 1LDEA 4XA8A 4CLEA 1FJHA 1GFSA 1SZJG 1ZFNA 4R9SA 4XCVA 3S2IA 1QP8A 5U9CA 1QYVA 4NI5A 1I32A 4EUEA 2VWGA 2JFFA 2WYWA 3P19A 5EJ2A 1L7EA 1S6YA 2QYSA 3INGA 3GVCA 3L6DA 1GQYA 2VUUA 3OMLA 5HBRA 4A2CA 4AJEA 1YWGO 4WEOA 3WR5A 3HN7A 3GLQA 5COBA 1ULSA 1P1KA 1E6UA 4FR5A 3I9NA 5KIAA 3QW2A 3IUPA 1ISFA 3UAGA 3GR6A 2FPPA 1Q7CA 4KTVE 3E18A 3GAZA 3C85A 4AICA 4M8SA 3P7MA 3PWZA 4J9UE 1JKJA 3A9WA 5JFOA 2ET6A 1R4NB 4GVLA 1KEWA 3UVEA 2C2XA 4E31A 3CMCO 3BTSA 4G5HA 3JQBC 5C5IA 3IIEA 5TRTA 2Q99A 4BS9A 5MGBA 3GVPA 1VJ0A 4HUJA 2JCXA 3JQGB 2R00C 4A5OA 4CM4A 1Y8QA 1UP6A 3PQFA 4PVCA 3E1KA 2ZTUA 3NKLA 3KTDA 3JQFA 1J4AA 1GYRA 9LDTA 1N9GA 2ZB7A 1WMBA 4N5MA 3TZCA 4O63O 4EEXA 1VM6A 2YFQA 4EEZA 2IXBA 1PGJA 2WD7A 8LDHA 1O9BA 2CY0A 3DR3A 3HDJA 4IJWA 5A04A 5L4NA 5L3ZA 4IJVA 3OSUA 3ST7A 4YAGA 2OO5A 1F14A 3LF2A 3U09A 1BXGB 1JA9A 1HTBA 3ASVA 3ZU5A 1ONOA 1PR3A 1EDOA 2VNSA 3IQDB 3JD1A 5TLSA 5EIOA 1VI2A 1K89A 1MFPA 3JQAA 4MVJM 2W2KB 3GNSA 2D4AA 1EVIA 2HQ1A 5TIIA 1QG6A 3GUCA 3IL2A 4BO6A 2C7VA 1NP3A 5L45A 1WWKA 3FI9A 3BMOB 3ZWVA 4ZRMA 1BGVA 5AXCA 4KOAA 4RLHA 4A03A 5CAEA 1CYDA 5G0TA 4L4RA 4XGKA 4B4WA 2NQTA 2YQ4A 4B4VA 1CETA 1WPQA 2OOSA 1LDYA 2Y1DA 3GK3A 2H1SA 4J49A 4KQWA 4P4LA 4UULA 3PGJA 4GWGA 5A05A 4GGOA 4D45A 2PZJA 3H8VA 4FFMA 4II3A 1YVEI 2WTBA 3C1AA 4KP7A 1IY8A 1R15A 3ZV5A 1QKIA 2VYND 1XCBA 2HLPA 1ORRA 1SPXA 2I65A 1ZW1A 3RJ9A 4YAIA 4CV2A 3ZH2A 1MG0A 4U8GA 1SAYA 1YJ8A 4CMHA 2WYVA 8ADHA 5CG1A 5I7SA 4JJIA 1Z75A 3PHHA 1XG5A 3PJGA 4PGFA 3WS7A 1BTOA 2Q46A 2DAPA 1I3KA 3G79A 3ICCA 4CR6A 1UXKA 5MDHA 3GZ4A 3AFMA 5TT0A 3VPGA 5JAZA 4IJKA 3C8MA 2G1UA 1ZEJA 4FBGA 5DP2A 1F17A 1OBFO 3ONDA 4E5KA 2ZIZA 1RM4A 1SEPA 4S3MA 3TJRA 1CERA 1PS9A 4F6CA 3AUAA 3G0OA 1HLDA 3JV7A 4B7CA 2ZYAA 1LC3A 1HE3A 2X1HA 1T4BA 4YXFA 1NFFA 2YYYA 4LK3A 3DHEA 3BIOA 2GDZA 3PWSA 3GZNA 1X0VA 3L77A 4Q3CA 5H82A 3V2GA 1YJQA 4XYEA 4YAEA 2EW8A 3A06A 4BNLA 2Q2VA 1Z45A 3IAHA 1IB6A 2X0NA 4L4SA 1BVUA 3N7UA 5KJ6A 2BELA 2NTVA 2P9GA 3CEAA 4I5GA 5JYEA 1YS4A 4D0RA 5K6AA 1F06A 2VT2A 1G0NA 4ZVVA 2C5AA 3SXPA 3W6ZA 4UEKA 1ADGA 3BAZA 3GY0A 2AG5A 1X7DA 4Z9YA 1U5CA 3AOEC 3PJEA 4K6FA 2X58A 4BNZA 1HT0A 4DLAA 1V3UA 2J3JA 2VZ0A 4H7PA 5HS6A 3MTJA 3E5MA 3F46A 4ND1A 4D43A 4R5MA 1ONNA 4NBVA 5LDHA 4JNKA 3WMXA 5HRUA 4CUZA 1JVBA 1Z7EA 3WYEA 2CUKA 1H6CA 2BF7A 3QIVA 5BT9A 2VWHA 1B0AA 2C0CA 2E6UX 4FPXA 5HTOA 2DTXA 1ZMOA 3JYNA 5G0SA 1VL6A 3GF4A 5L7WA 1Y7TA 3GC6A 3PFFA 3SBOA 4CMEA 2F00A 2UAGA 3SJUA 4QO7A 3RKRA 5JO9A 2P2SA 1XDWA 2VN8A 2RIRA 4MJLA 4BO7A 1A5ZA 3FN4A 3Q3CA 4TRJA 1MA0A 4RGBA 3VZQA 3N74A 4WLFA 2Q3EA 5EQDA 4D41A 4RPJA 1Y9AA 2HJRA 1H0KA 1U4SA 4IBOA 1D7OA 3AI3A 3WGTA 1QSGA 1LLUA 4RZIA 1GPJA 1M66A 3RJ5A 1O0SA 2PGJA 3C1TA 4JQCA 1MGOA 4IJUA 4PIVA 3GDFA 4M86A 3QP9A 1B7GO 3NJ4A 1HDRA 3NX4A 3CKYA 4KUEA 4GH5A 4ITUA 1KVUA 2GR9A 3DDNA 5A9SA 3WWYA 2UDPA 3B1KA 1UP4A 4BGIA 3KXDA 4DIOA 1E1MA 3DONA 3LC2O 4AJJA 4CR7A 1E3WB 1HE5A 3LT1A 3H9UA 3VDQA 3WDSA 5A5FA 4B3IA 5L4SA 4RJTA 1XA0A 4J7CA 3KYCA 2D2IA 3GFBA 4CLOB 1UH5A 1MV8A 1QV6A 2FPIA 3ZWWA 1DEHA 1DAOA 2W2LA 3ROQA 2DBRA 3INRA 4BKUA 1R4MB 1B14A 4WLNA 3NGLA 1OMOA 3L07A 3HB5X 1LQTA 1VJ1A 2ZTMA 5DOVA 4MO2A 5JAQA 1UXIA 2E37A 2NADA 1GCUA 3D3WA 3LC1O 3ZNPA 1ISIA 4R69A 1A4UA 1FK8A 2OORA 3U4IA 3DBLB 1I10A 3ANMA 3ADOA 4Y67A 3EK2A 4M1QA 1IYZA 4XIJA 2CNBA 2XXJA 3CZRA 4I5EA 5ER9A 3F1KA 2V6BA 5F21A 3FCOA 4OM8A 4BV9A 4R16A 1WDMA 2IZ1A 3QV1A 4LVCA 4YEDA 1YDEA 4IIVA 1GZ6A 5BNFA 2JL1A 4IQ0A 5IXYA 1EE2A 1Y8RA 2Z1MA 1Y9EA 3TZKA 3E48A 4Y9DA 3AI1A 4R1TA 1J5PA 1PL6A 1VKNA 3TL2A 2AW5A 5T5QA 3BTUA 3VZRA 1E7SA 4XYLA 2O3SA 1U2GA 4Y6PA 3JSAA 4M87A 3A14A 2X8LA 4MDHA 1AHHA 1LDGA 4IPTA 4ZQBA 4TKLA 2QHXA 2OGUA 1LSJA 5DOZA 5AXBA 2DUUA 4MOWA 4CQLB 1GY8A 1QMGA 4RZHA 1NVMB 2GN8A 3D7LA 3NTRA 1EFKA 4LSWA 2I99A 4XQGA 1GL3A 3BMQB 2AXQA 4U6QA 3JQCA 3PYXA 4DLLA 2OBYA 1KVSA 4RL6A 1XLTA 3E9MA 1A7KA 4TQGA 1UUFA 3ZWXA 3HFSA 3ETGA 2POQX 3MTGA 3OEWA 1DJNA 1C1XA 1DHTA 1P31A 4P38A 4AJ4A 2EKPA 3FWNA 1ZO8A 4HNGA 5A1TA 1PS8A 3R6DA 3TZ6A 5T8KA 4DMMA 3VH4A 1CQIA 1NX6A 1U2DA 2Y1GA 3ENKA 4W99A 3ZU3A 1Y81A 1IZ0A 3I5MA 1QXSA 3L6OO 3EZYA 4IDBA 3ZHZA 3IC5A 5FI5A 4M89A 4YPOA 1RYEA 3ZU4A 1BDBA 1T2FA 3WQSB 1C14A 4PLYA 4BO5A 4HV4A 1T2EA 1R0LA 1ULUA 2PD4A 4Y6SA 1ISJA 2VCYA 3DZIA 1EBUA 1HSZA 3H2SA 3KZVA 3GHYA 3NDIA 4HNHA 4BNIA 5LC1A 3R0IA 2JFHA 3D5TA 3NUGA 2J3HA 4CODB 4WCFC 4CMIA 1YO6A 4WE3A 3WGGA 3PZRA 4H3VA 4MVJA 1ADCA 2VHYA 4ALNA 1YQXA 3WLEA 6LDHA 4FC7A 3E8XA 4MPDA 3GQVA 4K6CA 4OL9A 5K0ZA 1NHGA 5A02A 5IN4A 1VC2A 2PD6A 3W4IA 3GNQA 4W9NA 4BNKA 1WLYA 3DZJA 3IS3A 3DWFA 4GWKA 4YJHB 1H9AA 3DBHB 4NBRA 3I3OA 3S55A 2EIHA 5JLAA 1TA4A 2X22A 1YOVA 1O5IA 5IF3A 2VZ8A 5TQVA 2VWPA 4Y98A 2QX7A 3JD4A 4RLSA 2CDBA 1PGNA 1G1AA 1HDZA 2JAHA 5ILOA 1KY5A 2ZCUA 1W6UA 1JN0A 2PTGA 3FTNA 5EMHA 3AWDA 4J16A 1HDGO 1UDBA 4PZCA 4L4XA 2EKQA 4EBFA 4U5QA 4J3FA 2GD1O 4TRNA 2P4HX 4IDAA 2QRLA 3AK4A 1SCUA 2D0IA 2EP5A 4IS2A 3GMDA 3PXXA 3L9WA 4YR9A 4NIMA 2VYVA 3BMNB 1FDWA 4J7XA 3STHA 2LDBA 4Z0HO 1QLJA 2J3IA 3LK7A 1S7CA 3ZHBA 3RI3A 4J1QA 3ZNNA 3H4VA 1YONA 3L4BC 2WD8A 2O2SA 3KVOA 5ADHA 1SNYA 3D0OA 2X0IA 3OETA 3Q9NA 4GLLA 3CUKA 3G3EA 1P1RA 3H9JA 4G81A 2X0RA 3TDKA 1C3VA 1KOLA 2G0TA 2VOEA 2FSVA 5F3RA 1VL8A 1WP4A 4NR0A 1YRLA 1LQUA 1X13A 3V8BA 1T2AA 1FDVA 4RF5A 3IKVA 3KYDB 1DIRA 4IDFA 3ZGYA 1H2BA 2P5YA 3U4DA 5TGDA 4DC0A 4HFJA 1HSOA 1E77A 4E2WA 3WNVA 3E9NA 5KJEA 3C7DB 1HKUA 1P1JA 5DT9A 1D1TA 3AUSA 3WNQA 1NR7A 1XHLA 2OBNA 3FF4A 1E7WA 3ITKA 4BB5A 4FFRA 2DTEA 3ZHYA 3U49A 1SOWA 1I3MA 4EJMA 4IGEA 3PHJA 5IG2A 1EUCA 2GCGA 3D4PA 3UCXA 3ZU2A 2AMFA 3IJPA 3IMFA 4PLHA 2B0JA 1R12A 3D4NA 4GAEA 5U4QA 4RF3A 2D1YA 4DMLA 2PWZA 4XDZA 2J5QA 4JROA 4LN1A 5FWNA 4MVJG 1XKQA 4IQGA 3JQBA 5JDIC 5JY1A 3I6QA 5TC4A 3ZWNA 1EDZA 3NV9A 4PRLA 3GAFA 2R00A 3QHAA 3QVOA 1MFZA 4XYGA 5B1YA 1AXEA 1GTMA 3FBGA 3OQBA 5ES3A 1FDTA 1BXZA 1YH3A 5L7YA 1IOLA 1MUUA 2FPGA 2HRZA 4BKOA 4WJZA 3FR8A 2V6FA 4I9NA 5JYDA 2CZCA 5CG2A 3FTPA 2UYYA 5G0VA 4DYDA 1Q7GA 5GZ6A 2EWMA 3DZBA 3QSGA 4YJGB 1PJBA 3P5SA 1NWHA 4P8RA 2B4QA 2GNAA 4BNXA 1I2ZA 1YL6A 3WSVA 3HDQA 4WOJA 2PZKA 2EGHA 1FF9A 3RC2A 3UKOA 1LRKA 3AM4A 1RYDA 3HDYA 3JQ8B 4GX0A 1P1FA 1ZJZA 5T64A 4NJMA 5JDCC 1KEVA 3C24A 3ZHXA 2VUTA 4YT8A 3QWBA 1EMDA 4EUFA 1VE9A 4ZQGA 3IKTA 1X14A 1QRRA 4XJSA 4RDHA 3OJEA 3WYCA 4ALJA 1P1HA 5KJCA 1ARZA 3NGXA 3KHUA 3LLVA 2D5CA 1I2CA 3PJFA 2PFGA 4PCVA 4Z3DA 1UDCA 5IN5A 4YYZA 4DYVA 4O1MA 4BQPA 1KVQA 2X4GA 4IZHA 2W98A 4XWYA 1U3VA 4YQZA 3DOJA 5DN9A 4CMJA 5CEEA 4A27A 3G1TA 5A3VA 1IULA 1HDCA 3GRPA 2YZ7A 1I8TA 5JCJD 5JC8A 2EERA 4BNWA 5A3JA 4YAKA 3QQPA 5F5LA 3F5QA 4FB5A 2FSSA 1K0UA 2O4UX 4CQMD 3QE3A 4L0QA 4UUNA 1JWAB 3LQFA 4QO8A 3TOZA 1E7MA 2RAFA 5COAA 1RKXA 1NTOA 3MOGA 3CSDA 1H5QA 2B35A 2Q1TA 4WUVA 1LDNA 5JPIA 4IMPA 3RC9A 3H5NA 3JYQA 4RDIA 4RVFA 4HFMA 4IXTA 4BKRA 4CV0A 4ZU3A 5CDSA 4GX5A 1TVEA 3SLKA 5JNLA 3IOYA 4WOKA 3MWDB 2B5WA 5A9TA 2A92A 3DBRA 3F6YA 1N8KA 3GPIA 3HE3A 2CD9A 1MC4A 2PR2A 3GNTA 5DCWA 2PH5A 2P68A 3MJ4A 1TEHA 2IYPA 5JXWA 2FZEA 4CM6A 1E6EA 3TRIA 3RFVA 5H83A 1DIAA 5G4LA 1T26A 3JQ9C 1GUFA 1NQOA 2HU2A 3GVIA 4NNJA 3UICA 4RCVA 4MP3A 2Y66A 1KEPA 1JLLA 2NVWA 4BO9A 3K8ZA 4M49A 2BFAA 4FFNA 3TZHA 5THKA 2IDZA 3F9IA 1YBAA 4M54A 4YBZA 1KC1A 1KERA 3JYLA 2WD7B 4Q9NA 1W0CA 3UH1A 2LDXA 3WWZA 4YTEA 4OSPA 3ZW9A 3OP4A 4H16A 1U8FO 3DAGA 2NVUA 4IM7A 3GFGA 5G2OA 4NG5A 3WSWA 3QRWA 4OXKA 1E3EA 1R37A 1WZEA 2JCYA 2WWRA 1Z82A 2B5VA 3ZNQA 2QW8A 3FNEA 3WFJA 3IUSA 1LNQA 1U7TA 3H5AA 4LCJA 1C1DA 5LDGA 4CLHA 2NQ8A 4JLWA 3U3XA 3F5SA 5I7EA 1UP7A 4N5NA 1A4IA 1YL5A 1NPYA 2I3GA 4LISA 4BO3A 2EEZA 3AOEA 4BNTA 2BI7A 2IRWA 5JCXA 5JO0A 3W8DA 2GSDA 3L0DA 4AJOA 1ADBA 1DRVA 2OP0A 2OXIA 3RUHA 1R6DA 1T1RA 2PA3A 2PY6A 4R3NA 3EZLA 4RPLA 4DQVA 4E21A 4L76A 1NWCA 1PGPA 2YHIA 3WX0A 4BNJA 4DVJA 5DCUA 3FHLA 4WLEA 1WZIA 4CM3A 3O38A 1WVGA 2Z1NA 5H81A 2G82A 4AL4A 4YT5A 1LDMA 2VRCD 3GOHA 5TF4A 5BSGA 4ZQFA 2V6MA 3A28A 2I66A 3E6AA 4I9UA 3QVWA 3DZKA 1O94A 2G76A 1LLCA 2NLOA 3VH2A 3VOSA 2Q4BA 4NBUA 3RUFA 1QYCA 4R9RA 3NTQA 2WE8A 2B4TO 1HZZA 3BYZA 1E3SA 1T2DA 2VUSA 4UVEA 3EHEA 1FDUA 2J6IA 4IGFA 4K28A 2Y0EA 1Q2XA 4YVFA 2BGLA 4QXMA 5AYVA 3I52A 2J8ZA 3TN7A 1XR3A 3JQ7A 5KVVA 2WEKA 1DC5A 3GGOA 2BGMA 3RFTA 3RASA 4U7WA 1L1FA 3FRJA 4YJFA 5EPOA 4DWVA 3DMTC 4NDNE 5DNAA 4GVXA 3PK0A 3PI7A 1TT7A 4HX5A 1X7GA 4CLRA 4YT2A 4MINA 2DFVA 2GYYA 4IQ8A 1I36A 4PLWA 3HZZA 1UXJA 4GBJA 3ZI0A 4BO0A 1M67A 5A9RA 2TMDA 1I33A 1H6AA 3WGOA 1DFIA 3CH6A 3GZNB 5DBIA 3RUDA 1E1KA 4HFNA 4YRAA 1C0KA 4ZGWA 4FQ8A 3VKUA 1IUKA 4AJNA 3WB9A 4EYEA 2O7SA 1ZSNA 1I24A 3PLRA 4QSMA 5T67A 4B3JA 4LVUA 3VH1A 1JAXA 2X9VA 2BH9A 3X2EA 4X54A 3PRJA 5L51A 4IDGA 1V35A 4LRTB 1MC5A 1N1EA 4A7PA 1I3LA 2QZZA 3KSZO 1VRWA 4FJ2A 3AI2A 3QVXA 2C7GA 3GG2A 3I9KA 4JJFA 3UF0A 1ZK0A 4FFLA 1IE3A 4IMRA 4PLFA 2O2YA 2EF1A 2NM0A 5ICMA 3TL3A 1NXQA 5BNTA 3PIIA 3V5NA 5KVSA 3JQGA 4E33A 3OQ6A 3DZGA 1E0DA 3TZQA 2VYNA 3OA2A 2X23A 3O9ZA 1NVGA 3NJ8A 1GV0A 3EW7A 4R4JA 4AJ1A 4FC6A 1NAIA 3LF1A 2AQKA 3ZWCA 1E7YA 3KSUA 3L6EA 1DLJA 3GUYA 3ROKA 1GZ4A 2HDHA 4U0KA 4FS3A 2HO5A 2ZYDA 4DUPA 4R68A 1SBYA 1ZSVA 3SX2A 2NACA 3UXYA 4E5MA 1JW9B 3HFGA 4Q3NA 3GVXA 1NASA 3OICA 3DC2A 4ND5A 1BXGA 3U0BA 2FN7A 2HMTA 3I4CA 1AXGA 1DXYA 3DFZA 1M75A 3V2HA 2CF5A 2P9CA 3M1AA 4KTTE 3M6IA 2CF6A 3OIGA 3RIHA 3DL2A 3I1JA 3I6IA 3G1UA 2G5CA 1CIVA 1PSDA 1YBVA 3AUTA 1CDOA 1KBZA 4B3HA 3BMOA 2HKIA 3KLPX 1SB9A 4CUJA 2CDAA 4TRRA 3ZNOA 3VDRA 4OYRA 3RU7A 5IDQA 3EGOA 2C07A 5TNXA 4O0LA 1K6XA 3R3JA 5A9SB 1XGKA 5CDYA 1DLIA 5G0WA 2XXBA 1DRWA 2B4RO 2PKQP 1LSOA 3ZN2A 1ZXBA 2X5KO 1ML3A 4ND4A 2NTJA 3JD2A 3KYCB 5IDYA 1P0FA 1KVRA 4CM7A 4RV9A 2AHRA 1XYGA 2I76A 1QYDA 2D5AA 2C54A 1P77A 5ILGA 1EQ2A 5B4TA 4JX8A 1PQUA 2RH4A 4WCFA 2QRJA 3H6KA 2A4KA 1XWFA 1DIHA 5TSDA 3D3WB 7MDHA 2X5OA 5FEUA 4XD2A 1U8XX 5FI3A 3RUEA 1U1IA 2AEFA 5EINA 2C82A 1B26A 2IZZA 3P2OA 4GMFA 1HLPA 3OA0A 3ONEA 1BMDA 4MVJP 3T4EA 5CDTA 2Y1CA 4C7KA 3W1VA 4CLXA 1P0CA 1V0JA 1NNUA 2HMSA 2YFHA 4OXNA 4UREA 2VT3A 2FOIA 2PK3A 4O6VA 1KY4A 2RHRA 1Y8RB 1ISHA 4OQYA 3O8QB 1N7GA 2EV9A 1WDKA 3F47A 1YBMA 3QWIA 1ISMA 3H3JA 3JQFC 4Q3EA 1G0OA 3GDOA 3NEPX 1PGOA 3L4SO 4XR4A 3PIDA 1LEHA 1EVYA 3DHYA 3JD3A 3TQHA 5IAAA 4AJKA 3OJOA 4UVDA 4MKXA 4BL5A 5JMWA 2BRUA 1GPDG 1GQ2A 1DIGA 5JBIA 4PG7A 3SC6A 2JFGA 2ZYGA 4FGWA 3WGYA 4HKTA 4TROA 4J2HA 2D59A 1ZSYA 1Y5RA 3PQDA 1C0LA 1KETA 3IJRA 1X7HA 1EQUA 1TI7A 4K26A 4L75A 4K9DA 1ADFA 3ZWYA 4JP3A 4RVDA 3H5RA 2NV6A 4JBHA 4C4OA 4BQRA 4KUGA 3EC7A 2FZWA 2Y67A 1PU2A 1V8BA 1VL0A 4JIGA 1PQPA 1H6BA 1P9LA 1YB1A 2X6TA 3EVTA 1PL8A 3PQEA 4KQXA 4W82A 5GY7A 1L7DA 4JXKA 2DU8A 3BZUA 2X9GA 5IXSA 4RF4A 4UEJA 1P45A 1W73A 3AOGA 3LDHA 4AJ2A 4DIFA 4BO8A 1YE3A 4K1LA 1TB4A 2UUPA 2B37A 3HUDA 2V7PA 4OIMA 5L7TA 5L40A 2UVDA 4MIYA 3WFIA 3WTBA 3SC4A 4AG3A 2BKAA 3GGPA 1W8DA 1EFLA 3RSHA 4DBZA 1UZLA 2HJSA 3RKUA 1AHIA 4LCEA 3B1FA 5U1PA 4CMAA 3Q6IA 1GEGA 3FPCA 4Q3DA 4CMIB 1GUZA 3OFSA 3WJ7A 1GAEO 1TXGA 4GSLA 5JDIA 2JCVA 4E5YA 1ZK2A 4XGIA 4QTZA 3HSKA 4GPD1 2Q45A 4D79A 2W8ZA 1T25A 3C7CB 5KJ1A 2JAPA 2O3TA 1DC4A 3UN1A 1AUPA 1Z7BA 2X7HA 3T4XA 4BO1A 4ZICA 4J1SA 3C7AA 1PZEA 2HCTA 2RHCA 1J49A 4DTIA 1VLLA 1YOVB 1CQJA 2ZQZA 5JY6A 3Q1LA 1PJLA 4WLVA 3VPSA 3DOOA 2B69A 5G0UA 4R51A 3BXXA 3AU8A 9LDBA 2JHFA 2GO1A 4CMBA 5CEFA 4XIYA 3WBFA 1OI7A 4I8XA 4PLPA 3U4CA 1PL7A 1ZUD1 5JDCA 4LMRA 4GX1A 3I9OA 3OECA 1ONPA 1N7HA 1M6HA 1ZCJA 2EJVA 1PX0A 3MCVA 1E1LA 3B1JA 5AQ1A 2QG4A 2GN4A 1HXHA 3O03A 3PHLA 3PP8A 3WQQA 5LCXA 3MOIA 4PLTA 4U6SA 3FD8A 4B4UA 4EDFA 2DPHA 3FBTA 2AE1A 1Y6JA 5EN4A 5AVOA 1F8FA 3NDJA 3MWEB 1FDSA 3PWKA 4PG5A 3WIDA 4E30A 1B8UA 2XF8A 4UUMA 4NHEA 2VNAA 2NU6A 1FMCA 3H7AA 3SVTA 4Z0PA 4GL4A 4ESOA 3PHIA 4XQEA 4ZQEA 3S1LA 4ILKA 2IZ0A 3PPIA 4UEOA 4ALKA 4LRSB 4PLVA 1DC6A 2WE7A 3AW9A 5ENDA 5ER6A 4CM9D 2QIOA 4FIZA 4QECA 3HG7A 1H93A 1E6WA 1PGQA 1RPNA 5C7IO 3PDUA 2ZB3A 4RORA 3PFWO 1XEAA 1EVJA 4GKBA 1YB4A 1Z74A 4NBTA 4DXHA 5BSEA 1MXFA 1CRWG 1HZJA 3MEQA 4J43A 1NHWA 4GGPA 3QWHA 1M6WA 4GI2A 4RVUA 3UCEA 1ENOA 3EMKA 4MVJE 4E2XA 4RPHA 2VHXA 2R2GA 3Q9UA 4CV1A 1WXDA 1JWBB 5G4KB 3KEOA 1DRUA 3GPDG 3ROPA 2I6TA 2AQ8A 3JQ9A 4NFSA 4RF2A 3V1YA 2NU7A 3WTCA 1T2CA 2DQ4A 4DREA 5JW6A 2HMVA 1AN9A 2O3UA 4OJNA 4URFA 3KETA 5IFLA 3VVBA 2FRDA 4MKRA 5JAMA 3ABIA 4UUOA 2YDXA 4BHTA 1Y1PA 4EW6A 2FR1A 4YCAA 3LLSA 1HRDA 2C59A 4BO2A 3AM3A 5T57A 4PG8A 3OIDA 3GMSA 2NWQA 3TWOA 5KWEA 1J0XO 4D3DA 4NZ9A 1M2WA 4F3YA 4JGBA 4ONEA 1A7AA 4Q3BA 2HK9A 1BDMA 3RVDA 2HUNA 5B37A 4NFHA 2VTEA 2ZJ1A 3FNFA 3LVFO 1LXCA 4NJMB 4OOFA 4WECA 5DZSA 5F1KA 5FF9A 4IIUA 4MIOA 4YJDA 1LDBA 1GU7A 1OAAA 4L9RA 1Q0LA 3QLJA 4R3WA 1X15A 4OSOA 4RQTA 2HMUA 4OQZA 1P74A 3O4RA 2Q4EA 2P91A 1LLDA 3K73O 5ICSA 5KOIA 4NU5A 5I9MA 2IXAA 5DCYA 3RQSA 3AY3A 2Z5LA 2DTDA 3ANNA 3T7EA 3KRTA 5CDGA 3EYWA 2CSUA 3DXFA 3G17A 4RQUA 3D3EA 2PD3A 1JKFA 4H15A 4UVHA 3KO8A 3B20A 4L74A 2BFOA 4NPCA 4F45A 3ONFA 4EJ0A 2CVOA 4JP2A 4DL9A 3AJRA 4HWKA 1LSUA 3NT2A 1PJ2A 4WPGA 5IZCC 4EZBA 4J9VA 4TMFA 5KJFA 2BHLA 4KMSA 3PDJA 1UR5A 2Q1WA 3ZWPA 4I1IA 3X2FA 2VWQA 3V2UA 4UVGA 1LX6A 5I7VA 3GN1A 3KYBA 3DBRB 3OIFA 2AE2A 2PGLA 3SLGA 4R1UA 5KKCA 2Y0DA 3JCZA 2E49A 3ZWMA 1GV1A 4B79A 2JD1A 1MXHA 2DPGA 3GEGA 4BNMA 4W4TA 1HDOA 3HN2A 4CM8A 5AXAA 1U3TA 4HY3A 1B2LA 3TPCA 5IZ4A 4XRRA 4OGWA 2ZJ0A 4BKPA 1LUAA 1EUZA 4R1SA 1Z73A 4AJHA 3LZ6A 4XGNA 3K96A 3B6ZA 4BMNA 4Q39A 2DFDA 1C0IA 4WLUA 4ALMA 1ZK4A 2EJWA 5B4UA 3LU1A 2NVUB 2Q1UA 3IDSA 2PZLA 1GYPA 2OZPA 3NT5A 2GPTA 4RVHA 1PZFA 1RM5A 3IP3A 4JCOA 3VAZA 5C37A 4J0EA 3QVTA 4J4HA 3RUIA 1K3TA 2QYTA 1EK6A 4Z9XA 3COSA 2JKVA 2IODA 3SJ7A 3KSDO 2GGSA 3TF5A 1JU9A 3P2YA 4LSMA 2D8AA 3M1LA 3MJEA 3OF2A 5F1PA 3WGZA 1KEUA 5IDXA 2EKLA 2DBVO 4E13A 1HEUA 5HS4A 3H9EO 1P33A 3JYPA 4CUKA 5JCJA 1VPDA 3I9MA 1P3DA 1E7QA 3DOCA 5IDWA 1XELA 2AEJA 4LW8A 4CQMA 4ZD6A 3ZWBA 4E5PA 1R66A 3CE6A 1R0KA 1Q7BA 4HADA 4W9NC 5I8ZA 3VPFA 2YHIB 5T6BA 3ZWAA 3LT0A 4PG4A 1B8PA 1LJ8A 4PLCA 2PNFA 4BGUA 1Q0QA 3O26A 4CM4B 4CMKA 5A03A 1Y8QB 5CPFA 5J23A 1JVSA 3H2ZA 2ZATA 4AJPA 1DAPA 3QWFA 2AQHA 3ON5A 1N9GB 3H9QA 3AY7A 1CWUA 1IPEA 4CM5A 5TJHA 4ZN6A 3K6JA 4YACA 3VHRA 4P22A 3MJSA 2GN6A 6ADHA 1UAGA 4FCCA 4NJOA 1CJCA 4I5DA 2UV8A 3DMYA 4YRDA 3ZV3A 1GEEA 1QORA 3JQEA 5BSHA 1BW9A 2YQ5A 1T1SA 1TT5A 3JQAB 4EITA 1X0XA 1QV7A 1WAMA 1P44A 4XR9A 4II2A 5EQFA 1E1NA 4NK4A 4YJFB 5CPBA 3QA9A 4XZ3A 4XRGA 3KOUA 3FNGA 4CLRB 3FPLA 3BTVA 1A71A 1LSSA 1WNTA 3R3SA 1PJCA 1BVRA 1PR9A 5GZ1A 1ZMTA 3CZMA 4YDRA 4ZHSA 3PTZA 3VZPA 4ZQHA 4MP8A 1ZJYA 1I2BA 4NH4A 2CDCA 3W8EA 3WQRA 4DBVO 4KWIA 1E5LA 1N1GA 3RBVA 1ENYA 1PWXA 4XDYA 4BNNA 4BNUA 2EP7A 2FR8A 3EVNA 4QFDA 3BMCA 3ZWOA 2O4CA 1BSVA 3D64A 3MJVA 4Z0TA 5AXDA 1N92A 3EAGA 2HSDA 5ITWA 3W8FA 3U5TA 4PLGA 4WASA 2OP1A 4KWHA 1ZK1A 4W6ZA 1UXGA 4GSKA 2Z95A 7ADHA 1IZ9A 4IDEA 4EUHA 3S2GA 5KTKA 4MIEA 3FWZA 3VKVA 1DOHA 1JKIA 2WJPA 2VRCA 3F4BA 2WYUA 4QFCA 4Z3KA 4Y6RA 1VSUA 4O5OA 4ND3A 4N5LA 1LRLA 2Y93A 1YGYA 3SEFA 1VJTA 3JYOA 3ETDA 4MVJF 1N5DA 3JQAD 2Y1EA 1NQAO 1LU9A 3D1LA 4F6LA 4N7RA 2Q2QA 4XEHA 1IHYA 4QUKA 4S1VA 1NFRA 2J5RA 2WMDA 1KYQA 3ANLA 5DULA 1GQQA 4UVIA 1D1SA 3HWRA 4Q3AA 3GDGA 4WNCA 1ZIDA 1R0SA 1PJSA 2AA3A 4TVOA 4NQZA 4FDAA 2V6GA 3MJCA 3HADA 3VTZA 4R1NA 3DTTA 3DZHA 3HDHA 5CEJA 3GEMA 4J90A 4CL8A 2I3AA 1E92A 4NU6A 2I9PA 3DTYA 3AFNA 4WCDA 4WNIA 1BG6A 5I9LA 4QQRA 4RVGA 4E0BA 5BSFA 4FOSA 2NNLD 2YDYA 4TZTA 4XX0A 4Y8VA 2BD0A 2C5EA 2TMGA 2YV2A 3ZW8A 1EZ4A 4BNVA 3PZBA 4CL3A 5KVQA 1R4NA 1Z6ZA 1IL0A 5DDIP 1H94A 4A73A 2Y1FA 4R5HA 3RWBA 4TVBA 1B3RA 1NYTA 1ID1A 3QVSA 3WGHA 2YV3A 4OKNA 4AVYA 1U5AA 1G6KA 2C20A 1YQGA 3CXRA 1QLHA 4DQUA 2BLLA 3RBZA 4BMVA 4WCFB 3JD0A 5HWSA 3CINA 4BUCA 3PJDA 2GZ1A 1DDOA 5KNLA 1X1EA 2W4QA 4XB2A 2DLDA 4R41A 5A06A 1HWYA 1ZZEA 3DZFA 4D44A 4DPKA 4YAJA 3S2EA 4IY1A 1K2WA 2VRBA 4IS3A 1XQ6A 3DAFA 3K31A 3W4JA 3V1TC 5C3MA 4BGEA 2P5UA 1ZBQA 2FWMX 4CV3A 2Q50A 3I83A 4BNFA 3K92A 3K2BA 3FR7A 4L8VA 3C1OA 3HQ4O 2W2KA 5F5NA 4J1NA 4TRMA 2E4AA 1B16A 4BOYA 1KVTA 2ZCVA 3FSRA 3RUAA 4E32A 1DPGA 5BNIA 3U9LA 5C7LO 4YT4A 2BFPA 4N54A 4ND2A 2DBZA 3WGQA 2OUIA 5HM8A 1MLDA 1PJTA 1GUYA 1EE9A 2YHUA 4KZPA 4IZIA 4D7AA 2PKQO 4NFYA 3VVCA 2QZ9A 1LTHR 2IYOA 1ENZA 4C7JA 5L9AA 4R54A 2DVMA 1VKOA 2Y99A 2ZTVA 2W90A 3UUWA 2J3KA 3ZDFA 2P4QA 4ZJUA 2BGKA 3EUWA 5BQFA 2JJYA 3K5PA 5JMPA 3K2EA 4BMSA 2E82A 2O3QA 5A5EA 3QWAA 2C2YA 3EY4A 1VSVA 3D4OA 5CHEA 3TOXA 3LT4A 4QEDA 3BHIA 2IE0A 1NQTA 2AEMA 1U7HA 3R1IA 4XYBA 4E3ZA 4J2OA 2B83A 3RBXA 2SCUA 3KM0A 3VC7A 1HYHA 3BHMA 1DIBA 4DPLA 4PFJA 3VH3A 2ZQYA 3H9GA 3E82A 1H2HA 4ZA2A 1T4DA 1HDYA 3DHNA 2OFPA 4HBGA 3UHAA 4J91A 3OEYA 4FGSA 1JQBA 1PQWA 5TJ9A 1MG5A 4XKJA 1EK5A 5KCZA 3ZZNA 4INAA 2DM6A 4E2YA 4FD3A 4I5FA 1MX3A 2FR0A 3FNHA 3ZV6A 4OOEA 2C29D 1EBFA 2AQIA 4J4TA 1H6DA 1B8VA 2GZ2A 4GLOA 4PRKA 3EDMA 5JSFA 3K30A 3RROA 1O95A 3BTOA 4IXWA 3NYWA 3OBBA 3PGXA 1B3BA 4CLDA 4DC1A 3D5QA 3PEFA 3MJTA 5DBGA 3LC7O 4E6PA 2BI8A 5K9ZA 4YQYA 4ID9A 1R16A 3ASUA 3ITDA 1DFGA 3UCFA 5JS6A 1I0ZA 3RAJA 2GLXA 4XB1A 2X0JA 4NBWA 2Y68A 1PJ4A 3L4BA 3ZV4A 4B8WA 4GX2A 4HP8A 3GT0A 3VTFA 5A4DA 3NTOA 4LMPA 1OOEA 3TNLA 1NVTA 1SC6A 2Q1SA 1A27A 5JAIA 3WOHA 3M2TA 1C1XB 2W2LD 3H65A 4PVDA 1CF2O 5I8WA 1W4ZA 4OKIA 2I5PO 3F4LA 3W4KA 4TSKA 4J0FA 1PS0A 3PVZA 1Q0HA 5ENVA 4B8ZA 2FMUA 1X1TA 4G65A 5TX7A 1DFHA 1O89A 2E48A 4EJ6A 1GZ3A 1DSSG 1OC2A 5B4VA 1PIWA 1UZNA 3LSYA 2ZB8A 5KKAA 2J5KA 1JDJA 2FY8A 1PWZA 4XQ9A 4W7HA 3RC7A 2A35A 1IHXA 3RC1A 3N58A 1ZNQO 2PLAA 2VQ3A 4YWJA 4ALLA 1KC3A 4RO0A 4XJTA 1YXMA 3GVHA 1RJWA 2RCYA 4EGFA 2QRKA 1XSEA 2QQ5A 1DHRA 4WLOA 3WJAA 3GEDA 2WSBA 4I9HA 5COQA 1U3UA 3DB2A 1GCOA 2NU9A 1DJQA 3M2PA 4BNYA 4A26A 2ZB4A 5IZCA 5TS3A 1H9BA 3JTMA 1OZAA 4J4BA 2GERA 5THQA 1BRMA 3O8QA 1ZVMA 1U3WA 2FP4A 2HAEA 3CIFA 1V6AA 2XPCA 1ZH8A 1HYGA 3PHGA 1NPDA 4E4YA 2DUWA 4B7UA 3NAQA 3W6UA 4AFNA 2Q2WA 1O6ZA 3E5RA 2B36A 1I3NA 3AY6A 4CJXA 4DA9A
chains in the Genus database with same CATH superfamily
3RVLA 3HKEA 1V1MA 1E3WA 5CNKA 1Y5MA 4N12A 1KTIA 4D74A 4PRZA 1E94E 3I2HA 2YZKA 5DF1A 2X2OA 5FNVB 3NPMA 4UZEA 3DE4X 3I4FA 1GZ5A 3NH9A 3HUEA 1GN8A 4F12A 3ZX4A 5ETJA 2H4FA 3RVPA 1QFMA 3H16A 3PYMA 1AKRA 1FFGA 2DPYA 4YB8A 2C5BA 3B3JA 2WM3A 3UJBA 3UMVA 5BPHA 2PR7A 1UDAA 3CF6R 4L0MA 2QTHA 3INTA 3KJEA 3IKLA 1HM5A 3KLMX 2RH8A 1G8HA 4JELA 3EPPA 4M1TA 4WKOA 3VR6A 5HJ5A 1VP3A 1C8BA 3G49A 4XSHA 3DBLA 4BIIA 4KAXA 3S8YA 3BBLA 4HH3C 4O25A 5CDUA 3QEAZ 1GQRA 3Q7QA 2DWUA 1R8JA 1VKZA 3BICA 3MA0A 3LBNA 4MVJD 3P9IA 4MYUA 4RY2A 2PT5A 4N3CA 1ZCZA 4DBLE 4X84A 4PV7A 1NVKA 2XOKA 1EJ6A 3EWIA 3PVSA 1UZMA 5TQ0A 5LYJB 4P36A 5D3MB 3X0DA 1HETA 1F0NA 1X1DA 2WPDA 2CE7A 3HYLA 3LUDA 2WIFA 2WQ6A 1SULA 1UBLS 3DGFC 2NT3A 1O8CA 3DT6A 5FFFA 4AO6A 2IS6A 1DKUA 2D8MA 2Y0CA 3ICPA 4BLQA 4DC9A 4KPEC 1G8MA 3DO5A 4R1PA 4BPRA 2VHVA 1AGNA 4OI2A 1FFCA 4CTNA 3FPGA 1LJUA 4WK6A 5L6MB 3WO1A 1MVOA 2YQZA 1T6NA 1ANKA 1WZNA 3FVVA 3B85A 1LPNA 3ZJYA 5EJ6A 2K5UA 2F4NA 1WMAA 3CLVA 3EIQA 4WKCA 2PUTA 2B94A 3UOGA 4DLKA 4NYIQ 5EE9A 4YMGA 3I09A 1HE4A 1OJ7A 3IRUA 3WYBA 1GYQA 1SUIA 2WDZA 1J6UA 4R71A 1V3VA 2EW2A 4CMEC 3ZEAA 2H07A 4G0NA 3ADCA 1NLZA 1FQKA 4KWTA 2OQVA 3ZD9A 5IJ9A 3A6PC 3GGGA 2JJQA 3FWHA 5CT9A 3VZSA 2O3JA 4OF4A 5CHYA 2GSWA 1PZGA 2JHGA 4IICA 4YRMA 2XT9A 2BZSA 2VYVD 4Q18A 1QAOA 2EFYA 4S2UA 5E2AA 1XIVA 3WYNA 4B6EA 1SHLA 1Y4AE 4OATA 5FO0A 1RRPA 3BILA 3E9QA 3HGTA 4MKZA 4OHWA 4E2ZA 3A4VA 3SSOA 4LJYA 1SCIA 1FVHA 2FOXA 4UBLA 2XVMA 4LVNA 4DY4A 2W83A 4DA6A 1IHDA 3DG9A 1T4CA 2GASA 1U0GA 1ZN8A 2GHIA 2XH8A 3IO5A 3QLUA 4KE9A 1JPNA 1UFVA 4ZDWA 4YRNA 5A7FA 4BE4A 4QG3A 4N0DA 1E99A 1KMMA 1XU7A 1P1CA 2DR3A 4Q16A 4BKMA 2WA2A 5BR7A 1EFRD 2G7ZA 1CUFA 2BMFA 2FJPA 5BV8A 2IHVA 4BGDA 4XW2A 4AJIA 2XW6A 4OMUA 2AIRA 5DM1A 5LQSA 1WXHA 2FDCA 2H63A 2ADMA 1B15A 4UHHA 4MK4A 3P5BA 4IDDA 4J1TA 5TVGA 4B85A 4D42A 1RT9A 1YR2A 3H11A 2OCBA 4JL8A 4C04A 1NBOA 3ODPA 3QIAA 3DFUA 5B1SA 3VJLA 2JHPA 2ZVJA 3BIWA 3O8NA 4I08A 2DMRA 5KTSA 3LUKA 3VC1A 1NFQA 2H1HA 2PM8A 2OK8A 3OU6A 3IOEA 4TWRA 4W1RA 5AO9A 3GI1A 2QNIA 4IXDA 5IKOA 3UMFA 3DKVA 1WW8A 3VXKA 2DSNA 3AM5A 3N2LA 3HKBB 3QEMA 4MVJH 2I54A 2AV6A 1JAYA 5FWXB 4JD5A 4LOAA 1MVLA 3GJXC 4GOND 2IEBA 3PE4A 4EHJA 1Y8AA 3PC2A 1G8PA 1YR7A 2X9NA 2Z9CA 3RIEA 1XAGA 1F60A 4OV6B 3AUYA 1DBVO 3GUVA 5JJLA 1V3TA 3B70A 1O8BA 1PFUA 1ORTA 4TKZA 2XDQB 2P7HA 1P0MA 1T3ZA 4FW8A 1QF7A 3AHEA 4BO4A 3SGLA 2H6EA 4ESVA 4RIFA 4D3SA 4M0KA 3RUCA 3N75A 1YRQA 2JFXA 4JJ6A 1VPEA 4CIXA 3PTLA 1DEOA 3A2MA 3ABSB 1DRJA 2PX2A 3GHHA 3GLUA 1VXRA 3I53A 1UWKA 1JIVA 1QK4A 3VFDA 3GG9A 2F43B 2JHAA 1FU7A 4TMXA 4KEAA 4CKCB 3EY9A 3AUUA 5HCIA 3IV6A 2HCBA 3AZPA 3DOIA 3F71A 4Q7MB 1I6WA 2ZR8A 3VGPA 2YIMA 3LYLA 1SOVA 1KWKA 1XA3A 4V39A 3E1GA 2W6ZA 5E7MA 1OZ0A 2BMAA 1BE8A 3BBPA 4D0SA 2J1LA 3K0AB 1S96A 4CIBA 1LLQA 3IUJA 1NX9A 2OGZA 3LNTA 4HDKB 2YWDA 1U9JA 1AKQA 2VK4A 2F3SA 4NMHA 3DMTA 1JJBA 1P0QA 4RUKA 1F0YA 5JCOA 3SG0A 1HQYE 1QOPB 1GU0A 3L41A 4DUGA 3DCJA 4FLFA 5D5PA 1D3AA 1BHSA 1HLGA 5KC9A 1CZOA 3IXQA 3M5WA 5FYDA 5L3QA 2CMDA 4V24A 4OHRA 1SBQA 2MSEB 2RBEA 1TCVA 3H75A 3IAM6 4UD2A 4YP1A 4WBNA 4KG7A 3HVJA 3PU6A 2C7BA 1MAAA 4ZRNA 2XJ4A 1VRVA 2PUCA 4CMCA 1KEEB 2YMQA 3KYDA 2OB2A 3L7KA 5T8KC 3SBEA 4JN6B 2IE8A 1U2DC 2WVGA 4JZKA 5DLEA 3FTCA 1YTLA 4P93A 4Z6KA 2DETA 1H8ED 2I0FA 2PV7A 2WKRA 3AIIA 4LOLA 4NENA 3UW1A 2YCBA 1SVOA 2EBFX 5F52A 4XWKA 3QNUA 1J2TA 4IL5A 5BUQA 6NULA 4PZEA 3B3AA 2Y0BA 1ADYA 2A94A 2ZIWB 3PGLA 3ZEIA 3AJDA 4JUDX 4HLUC 3U62A 1WF3A 2Q8NA 2RAPA 2VF2A 3HACA 5AKLA 3KTFA 3I9JA 3P0FA 1FFAA 1JG3A 1R4ZA 1YQDA 1ECFA 4RVSA 4IHAA 5E9QA 1CY7A 4A6XA 4P4NA 3AU9A 3QLEA 1ZINA 4PZDA 1C5KA 4RPGA 4Q03A 1JALA 1JHAA 4IDQA 1OTXA 2ACVA 8MHTA 1W48A 3DEYX 2Z8YM 3AB7A 4GEKA 2FUG1 2NZYA 2HQBA 4G5RA 4IMIB 4LYJA 4LVOA 2GKSA 2ZRJA 3RD5A 4IRXA 3U7IA 4AO8A 3BRCA 3OLXA 5LNK1 4FZ3A 3B3GA 3T1OA 1T9ZA 2QN1A 2GUGA 3VSEA 8LDHA 1PHPA 3VPHA 4CR8A 2YWXA 3A1DA 5EERA 2GK7A 3VVLA 1DJOA 5FHRA 2H5LA 2YW9A 1LJLA 3PVCA 1ATZA 4B7XA 4XAQA 2JLCA 2D1SA 1SO8A 1H42A 5AM0A 4XDGA 1W1WA 3NHPA 3Q0IA 4G07A 3IP1A 3JSXA 4CETA 1S4QA 2O8DB 1OV4A 4C4TA 2X5JO 3OJLA 2XKJE 3VPXA 1THGA 4FWTA 1RI3A 2XNKA 2YV1A 4PXAA 1UWLA 1Q1GA 2C7QA 5TT1A 1E4EB 4IG9A 1JLKA 4PR0A 1XU9A 5C53B 3H87A 3AF0A 4XEUA 4C29A 3BXOA 5IJAA 4BCCA 3KVYA 4M60A 4JSTA 2MINA 1QZ3A 5E6SB 3WGIA 4C0AC 1JDBC 1L1RA 3QV2A 5DP1A 1WF6A 4WY2A 2QU7A 3DV0B 5DK6A 3A4IA 4GECA 5C1BA 1R3DA 2A1UA 3IDQA 2O2XA 1XC7A 5HGJA 3N2YA 3HYRA 5ESRA 1FNNA 1VLHA 2ZW9A 5HA5A 5CDFE 1XPOA 1K4YA 3EAQA 4FKMA 1KYVA 4N18A 5JS7A 1TQ2A 4AIRA 2QJRA 4X44A 2O7QA 2ZRIA 1MB0A 1QIEA 3NZEA 3K71B 3HB4X 4I4TA 1ZHOA 1K8QA 2YWJA 4MKFA 4Q82A 4CF4A 1DQYA 3ED5A 1FJHA 2VH2A 5IKPA 2XD4A 3S2IA 3FWYA 2X1MA 1QAMA 4AY3A 2VBFA 3OZFA 4EUEA 1I32A 1KPGA 4G41A 2VWGA 1J0CA 4TGLA 5FWYA 1G3UA 3L4EA 1YQEA 4RL4A 1L7EA 3KKQA 4LAFA 1XCPA 2XODA 2BEJA 3GVCA 4WCVA 2VUUA 5HBRA 3LQ2A 2AVNA 4U2BA 1D6SA 1FPQA 4F4FA 5BSVA 5KWIA 3WYGA 1BEUB 4LQCA 4WEOA 4XGRA 3HN7A 4OFXA 3GLQA 3K1TA 2ECKA 4R2LA 3I9NA 5KIAA 1KJWA 4PC2A 4B9EA 3IUPA 1ISFA 3GR6A 2FPPA 2HCRA 2QRPA 4HQKA 2J30A 5AI8A 2EFDB 2XMRA 1F8YA 4AF6A 5ED0A 1TQ8A 3KYIB 2ZUDA 4AICA 4C3VA 1MC1A 4ETIA 1DCMA 5A2QA 3FPHA 5THXA 2I2CA 4HVAA 3ROEA 4C3UA 3GPCA 4MKIA 4N8DA 4KMMA 1P9WA 5HKAA 4K86A 2ET6A 1F4PA 5JSYA 1KEWA 2INGX 1QK3A 2WP0A 4WL0A 5A4AA 4G5HA 5EPUA 5F1YA 4GYKA 4ANFA 4BS9A 1EDDA 4CF6A 2BMEA 4PQFA 1VJ0A 2K2QB 2NSLA 2JGIA 4RJKA 5GV7A 2IYWA 3QXJA 3HDTA 4I5IA 3OC0A 3SM3A 3ZKAA 4A5OA 4CM4A 5BPFA 1Y8QA 4IMJB 4A1FA 3E1KA 3EISA 1XZHA 1N9ZA 3L8DA 3K9NA 2BZ0A 1OB5A 2GM4A 2YJ5A 3ZJUA 3EPHA 4R2JA 3W2FA 4H2DA 1J4AA 2ZB7A 3T1TA 4O63O 2G1PA 1IJBA 5DV9A 2WC1A 3TZEA 4EEZA 2BGGA 1K68A 4G1CA 4DSAA 2V5UA 5AHRA 2XEXA 1KSGA 1Q1BA 3CN9A 4OBBA 3IQZA 2NUBA 4G9GA 5L3ZA 4FYYA 4PANA 2OO5A 2FEOA 3TNJA 1BXGB 1JA9A 1JU3A 3LDAA 1IUNA 4DLSA 1PR3A 1IDN1 3IQDB 4GM1A 2ZITA 4XTCS 3WLMA 4ENUA 4QRIA 4AAYA 4GIBA 2B4KA 4KV7A 1U7WA 3IAS6 3JQAA 2C77A 5P21A 1Q7RA 3SFTA 4S05A 3A9RA 4Y2GA 2IEYA 1VFPA 4EW3A 3A3YA 2O8FB 3AHGA 3V4VB 3ZCSA 5BYAA 3UHPA 5L45A 5DYGA 1W36C 5TMPA 2IDKA 2WYOA 3BMOB 4ZRMA 3REOA 4TKVB 1VHLA 4PE5B 1T8UA 5ESDA 4A03A 3ESYA 3RNOA 4O02B 2QLNA 3OOJA 1HRKA 3N76A 5AR1A 1JHRA 2AGVA 1KKMA 3JX9A 4Q7EA 2HIHA 4MW7A 1JBEA 4UE6A 1VB5A 3FDZB 1Y34E 1E2EA 4I6JA 4YJ3F 1CETA 1WPQA 2W2QA 4MHTA 2OOSA 3GK3A 3ZXSA 3EQ9A 4MRMB 3OE7A 4UULA 1KK3A 1LPMA 1O9GA 3IRVA 4GUAA 1KJQA 5FL7A 4Z4CA 2P2ZA 3CJTA 2ZXEA 5JNSA 2EC5A 1P75A 4KH1A 3VGJA 4NULA 1M5RA 5KO2A 2PZJA 3L0OA 3PGVA 5DI3B 4DG5A 2ATVA 3KK0A 4KIGA 4NBKA 1KJNA 4LBWA 3CV3A 4COOA 4A5SA 1IN1A 3C1AA 4BX8A 1R15A 1DU4A 4M53A 3STYA 4CEIB 1QKIA 3Q12A 4H0CA 2VYND 2C8VA 1RAIA 3K2IA 3T99A 1U3GA 4DWOA 1YIOA 3PTAA 5M29A 2BGRA 2BTQB 2QLMA 1N7JA 1M33A 4JKOA 3JRXA 5C8ZA 4UZFA 4DXAA 2M2IA 4OAOA 2PUWA 2XQKA 3KVVA 1BQEA 4A8JC 1U8UA 1VCMA 3PHHA 3MG9A 3ET5A 1UFKA 3GCXA 3PJGA 3FNBA 4LHEA 3RG8A 2DAPA 3DZCA 3ICCA 1KDTA 3EUEA 1UXKA 1TKBA 3GZ4A 3HA7A 1T9HA 2DYKA 4URVR 3JZDA 1YB7A 3KR1A 4IDOA 1RTKA 4JI5B 2NAFA 2VNJA 3L0SA 4OLHA 2G1UA 4X24A 4B2IA 3IQGX 4I1VA 1C29B 1X87A 3ONDA 1IY9A 3KV1A 1JZQA 5DFAA 1SEPA 4B3CA 3ZKWB 3KB2A 4B1FA 4P82A 4M7WA 4BYMA 1QF6A 1JEAA 2AFRA 4F6CA 3G0OA 1HLDA 3JV7A 1KK0A 4HRYA 1EVQA 1HG1A 2F64A 2P3QA 4XM1A 4QBIA 2O14A 4UCWA 2QBYB 4ZEOA 2CGEA 3KJXA 1NBMD 1NFFA 1BS1A 1P7VA 4LK3A 3WRXC 4NX2A 3ZK7A 2DH6A 4Y2UA 4O2LA 5KBYA 3WIVA 2GOYA 2D62A 3HMQA 1X0VA 2VH5R 4FE4A 5H82A 2EBUA 2R4TA 3V2GA 4UNSA 1YJQA 2WG2A 4BNLA 5CCXA 4A6EA 5CCEA 3KE9A 3LGAA 1SWWA 2J09A 2E3JA 5F51A 1IB6A 2X0NA 4GZ3A 3U31A 1P4HA 4FXPA 5ALHA 3GU3A 2W2OA 3AEKB 3MCWA 4ZU6X 4E1AA 3B7PA 1YS4A 3I6YA 1F06A 4RGYA 3HCAA 2AXEA 2VT2A 4TUYF 3SXPA 1FSGA 1M34B 4RQBA 1UM9B 2PN1A 4WXEA 5JQGB 3FCUB 3BAZA 1CUUA 2PZEA 4Z9YA 4ZKEA 2XMBA 2GAOA 3VYTB 5CB6A 1OXUA 3NH6A 5FPSA 4K6FA 1PR1A 2FN4A 2BKXA 2E7ZA 2VQDA 1HT0A 3IEIA 3MLBA 4HWOA 1N5JA 2J3JA 2VZ0A 2VAVA 5HS6A 5BSUA 3WIOA 1TJPB 4AK9A 1XA4A 2ZSAA 2B82A 5J63A 2GXQA 2IPXA 4J0JA 3ZDYB 3OLCX 1L4MA 4DHEA 3B52X 3URMA 3U7EB 1VTKA 3G23A 4JNKA 1BXRA 3WMXA 3MLAA 2BBOA 1FDIA 3L49A 5DNCA 5HRUA 2PWPA 1TO1E 5EXXA 2XVXA 3WYEA 4NZOA 2CUKA 2X8JB 5J2UB 5EVCA 4KLRA 3L82B 1L7OA 2QDKA 4WKPA 5BT9A 2VWHA 4Q4LA 2Y9MB 3D0RA 4QYIA 4TLLB 3HGMA 1B0AA 2C0CA 2E6UX 3JVUA 4OL0A 2C4UA 2FSGA 4L6IA 4MYCA 3SBXA 4JI0B 1ZMOA 3JYNA 4HPXB 2XYPA 1UEJA 1Z17A 2YFYA 4FEYA 4JWTA 2WT8A 4R9VA 5G0SA 5L7WA 3GC6A 3SBOA 1Y48E 1FXWF 1CF4A 4G67A 3S1SA 5J3JA 1J8VA 1L0BA 3RKRA 2P2SA 1XDWA 4RFVA 1BN6A 3TX2A 1A5ZA 3OKCA 1RXVA 4DCTA 4H6WA 4DLWA 4D02A 2RAVA 4WLFA 1GTL1 4RK1A 5F2KA 2IYZA 3EGDA 4BRUA 3OUZA 4UTNA 1XL0A 3OI7A 1XXHA 4YMVA 3M6XA 1U4SA 1NDQA 3QZUA 2OTCA 1QIHA 1GPJA 2CSXA 1M66A 1KH3A 1Q50A 3DQZA 3C1TA 2D1RA 1MGOA 3MMSA 4DM7A 2Q0XA 1Z0ZA 3SS8A 2RGNA 5J4KA 3DFMA 4H1UA 5IJ0B 3OY7A 4RGQA 2ZT7A 2XWQA 5B3AA 5C4MA 5D7NA 2VSQA 2RCNA 3DDNA 4D8YA 1ZU4A 2UDPA 1NXWA 1W93A 3KXDA 5B2EA 1E1MA 1DZIA 5EMLA 5EJFA 3G0HA 5DGHA 5AM5A 3I62A 4GT1A 1MENA 5LXTF 4BJ5A 3H9UA 2BBWA 2Q2NA 3WDSA 2F3PA 2OQ2A 4OHXA 5A5FA 2VATA 3Q10A 4EKIA 2R96A 1W19A 2D2IA 2QQ0A 2ZQ5A 4GFDA 4PIPA 1RMTA 3GFBA 3TQSA 3COVA 2XLBA 2YL2A 1DKPA 1JYFA 3ZWWA 1GG2A 2R1UA 4M1OA 4YJ2B 3ROQA 1KSHA 2DBRA 1PWYE 3CLHA 3INRA 1R4MB 4WLNA 3Q3EA 3L07A 1A77A 2VDOB 3X1KA 1I1OA 2IVFA 2VS1A 3WL4A 2GBLA 1N2JA 1BHQ1 2E37A 2NADA 2YJTD 3V42A 3I61A 1A9RA 2GNOA 3BOSA 1DDGA 4O4IA 3C0KA 1M34E 2ZE6A 2CD7A 1ZH4A 1UXOA 1T8WA 2J7PA 1U8CB 1X8KA 3N59A 3HXPA 4Y67A 4X5OA 4M1QA 3K9LA 1K66A 1IJEA 1UBTS 1NVXQ 1UANA 1VMIA 3I8OA 4G1BA 4WZAA 3IUBA 1GTRA 2EQBA 4UXJA 3F1KA 1BWRA 2H0RA 2V6BA 3AR6A 5EZ5A 5ICEA 4MI3A 3GFOA 4PS1A 1ESZA 4O2BF 4BV9A 4R16A 4G4IA 4DABA 1N77A 1NVWQ 1EB9A 1PNVA 1ZOLA 2GPJA 4IIVA 4TWBA 2IV2X 5FPPA 5IXYA 1Y6GA 5C32A 4DG8A 1Y8RA 2Z1MA 3L4JA 3J80A 2NSHA 2QTAA 1N2XA 4UUBA 1OYWA 2IF0A 3EXEB 4H7JA 3T1VA 3U44B 1OGJA 1PL6A 1AK9A 1E7SA 5HQJA 1Y4SA 1X2BA 3ZQJA 1NVVQ 4N4AA 3JSAA 1HNXB 4HDNA 2QTNA 2X8LA 3NRBA 1AHHA 2EYUA 2XUHA 1M73E 3ZHCA 2D0DA 5JS8A 3KKZA 4ZQBA 3OWOA 5DOZA 4B34A 3IR7A 1J42A 1KMCA 2DUUA 1PP4A 2J0EA 2V7VA 2I1QA 1SBHA 3AX6A 3AHHA 3HO6A 2KE5A 2ZRLA 1GXSB 2YWFA 4R8MA 3LY5A 1EZZA 1JR3D 5I9SA 2ZBUA 3INYA 4UNIA 2NT4A 5DO9A 1EFKA 3N07A 5FX2A 4KHPB 4FMPA 4HEHA 1OFTA 1Q1AA 2I99A 2IVZA 2OHFA 3R5TA 4GW3A 2JFOA 4LDQA 1MO3A 3BMQB 4WWHA 5KNBA 5HK8A 3C3EA 5AJZA 1COWD 3FZNA 1KVSA 3O91A 2Q4TA 5LIPA 3NEAA 4KYUA 3ZWXA 5D87A 3ETGA 2DPLA 3JZAA 3MTGA 1LPBB 4B3TB 4G5FA 3L79A 3NBAA 3PR1A 1DHTA 1UBEA 3TTWA 2QTCA 2P8SA 3NVKI 1RVV1 3JPWA 3NDPA 3H97A 2GBIA 4XJVA 1GSHA 3DUFB 3KZXA 1V16B 1XEFA 4W5RA 3TZ6A 1YQWA 3VH4A 2VRWA 1CQIA 2Y1GA 3GLTA 2C58A 4W99A 3ZHUA 4IJ5A 2Q6KA 3L6OO 1P0IA 1PW7A 2G06A 2V0NA 3EQZA 4HH1A 4F93B 1PKXA 1C7ZA 4KXQA 5FI5A 1VZ3A 5D3ZA 1NUUA 1W44A 1OX4A 1EFCA 3FDFA 1EPUA 2CLHB 1VJRA 4PNPA 1ZITA 4HEA6 1QGZA 3D1VA 1ULUA 3D3QA 4AP6A 1XDBA 4QAJA 1YJBA 3DZIA 1F8XA 1HSZA 1T91A 1QGYA 1Z3CA 2DFTA 2JCBA 3FFBA 3GHYA 3H99A 3PR2B 4PXSA 3EVCA 3C8ZA 2J3QA 1P4RA 2KBEA 4JT2A 1MTZA 3NUGA 3E3OA 4RKFA 3LUJA 3N6XA 4RKWA 5KX5F 4WCFC 4IHJB 2DQZA 4HJRA 3R7NA 2A78A 2VHYA 3I04A 5L3RA 3LA8A 1YQXA 3AEUA 5KNCD 4EHKA 2V0CA 1AZWA 4ZO6A 5CB8A 2XMSA 1R9MA 1CDDA 3E53A 2ID7A 3L3BA 3F4KA 3GQVA 4MPDA 3X1JA 4ARVA 2REOA 4K6CA 5IN4A 3QM1A 1DC7A 1VC2A 2PD6A 3GNQA 4PY2A 1S8AA 1KEKA 3L8MA 3DWFA 1GNTA 2B8JA 3AESA 3MS7A 2ZAGA 3E3MA 1KO1A 1ZDMA 2P2NA 1VG8A 4XUDA 1RI4A 3EXIB 4C0KA 1L5QA 2EIHA 5C7YA 4B17A 1TA4A 1ODJA 1Y6QA 2WMOB 4HMQA 2OM2A 3HJCA 4KXFB 1EFPA 3WGKA 1SG9A 3LPDA 3HXLA 1FNSA 1Z0JA 4QDJA 1KZ6A 1U2RA 3IIMA 2QROA 4B76A 2PSJA 5HRCA 4LY3A 4L78A 2QX7A 2VHJA 2WUWE 1SD2A 3AP2A 1KY5A 3S7ZA 1IBLB 1KR2A 5FUXA 4YH1A 1JKMA 1JLRA 5A0TA 1QJCA 2PTGA 4U2DA 4G6ZA 3EVGA 2L2QA 2FE4A 2VJPA 4J16A 1MPTA 3I01M 4WOPA 4GE3A 4U5QA 2ZGVA 4XWAA 3LCJA 2E2WA 1SCUA 2EP5A 1T0BA 4TLMB 2YIVX 3BJRA 3H84A 4NIMA 3BMNB 4J7XA 4HGRA 3TM5A 3VBEA 6ABPA 5CMLA 5ALNA 2LDBA 2W6JD 2A0YA 4Z0HO 2OXRA 1M2EA 1N6RA 4K81B 3ZHBA 2EZTA 3RI3A 2V58A 5I9TA 5IAGA 4PC7A 1IXZA 2N9UA 1CK4A 4NYJR 3AY0A 1VE5A 5DGTA 5DLDA 3H4VA 2WD8A 4LDPA 3KVOA 2HWUA 1N2IA 3QNMA 4PHHA 4IV0A 3D0OA 4CI9A 2QVLA 4MWSA 4G81A 1H2AS 3SEAA 3BERA 4X3CA 1FRZA 1VPLA 1V37A 2J67A 3FWKA 4WFJA 1S9HA 1YR3A 3H13A 3KDSE 5E0KB 4DT1B 2X1VA 3VJRA 5DTJA 1IPHA 2ODNA 4MV8A 4GI1A 3IQFA 1TECE 2SNIE 2PA0A 3PC8C 1C9KA 3V8BA 3IKVA 4U2FA 4F6RB 4IDFA 1ZVJA 5C5DA 4DC0A 1GP2A 2ORYA 1DBPA 3CB2A 3FNQA 5BQXA 2IUUA 4E2WA 2OAP1 2JIRA 3UFXB 3GWGA 4NBLA 1HPLA 4D98A 3N6VA 4YLEA 5DT9A 1FZQA 1D1TA 4HQLA 5DYWA 4OCZA 2B61A 1AGRA 1PG2A 4L5AA 1XHLA 4DQ0A 3SVLA 1E7WA 2WM8A 3OUUA 3QU5A 4UMVA 2BISA 2DTEA 2ZTHA 4KQ9A 3BXHA 2CLCX 2GFQA 1Z13A 1N0UA 1I3MA 1DAIA 1T1IA 1X94A 3ZVLA 3LG2A 3ZU2A 2GCGA 4MW1A 5HR5A 3IJPA 5KNCH 4KR3A 4PLHA 5IBCA 4GC5A 1CR0A 4CN8A 1RLOA 2ENWA 1L8LA 2IYVA 2ZROA 4QJBA 3B8HA 2D1YA 3KUUA 4QUDA 4UOZA 2PWZA 4G23A 4G37A 4LN1A 2NU8B 4ZGGA 3P96A 3K5WA 3SZUA 3JAMA 3JQBA 4U9UA 5ILQA 3WB2A 4YV1A 4RX1A 5JDIC 1Z06A 1AF4A 1JDZA 3I6QA 3M70A 3QELA 3R3HA 4X91A 4PRLA 1FU8A 1L5MA 3NV9A 5EZYF 5TC4A 2X3YA 3GAFA 2R00A 3R7WA 5IF9A 5LL6P 1RLIA 1YULA 1GVNB 1TFUA 3QOFA 2FFHA 3FR8A 3AEZA 3K0FB 4WJZA 5CH8A 1IQPA 4ZK2A 1NSFA 1H0HA 5JYDA 1F2UA 1UBOS 4RLFA 4AMYA 4Q1AA 2Q62A 2G04A 2AUMA 3TXXA 3AXTA 4KAFA 1V39A 5G0VA 4DYDA 4GKKB 4C0XA 3EXFA 3GELA 4OP3A 1JB1A 4DXDA 1NURA 2EWMA 3BRQA 3DZBA 3QSGA 4W1PA 4DR1B 1NWHA 4RM2A 1GAXA 2DKOA 1YL6A 1MQAA 4ZI7A 1AS3A 4D3XA 1MX5A 2VJOA 3B7GA 3I34X 4LXQA 4DV7B 2FPUA 2PZKA 2W6NA 4H7FA 1FDRA 1AQ6A 1RYDA 3JQ8B 2OT3B 4QICA 1ZJZA 2ZSJA 5JDCC 3C24A 4FVTA 4CDGA 6GPBA 2P6UA 2IA5A 1MH1A 1E59A 1VE9A 1Y37A 4FMCF 4EUFA 1W581 1QRRA 4XJSA 1YBFA 2V7QA 4KRGA 4RDHA 2MHCA 3TBKA 1CHNA 2PVCA 4WACA 1I13A 5KJCA 3NGXA 1SU6A 4PAMA 2D5CA 4RHYA 3R75A 5HSGA 3SWWA 1WETA 3L84A 2PU5A 3L1UA 1W2GA 3VAAA 1H85A 3SN6A 4Z3DA 3C8DA 5BN5B 5CB4F 1XTRA 2EP8A 3CRW1 4B47A 4X1YB 3G82C 1TEZA 1JEQB 2W98A 4Z1OA 2A59A 3GUUA 4M9XA 1XFAA 3K09A 2D74A 5ALTA 3LBFA 2V4MA 5CEEA 4EHIA 3EA0A 1B6TA 3TIFA 4HTFA 4DDVA 2VL7A 1NONA 1IULA 3DS8A 3GRPA 4NOMA 4S0XA 3QVVA 1NBHA 1NG1A 5A3JA 2H4YA 3PQ2A 3Q0TA 3QQPA 4W8OA 2J87A 4YAKA 5B1EA 3F96A 1E5XA 5IUNC 4PHTA 5K0SA 5LLDA 4QTUB 2P9BA 3G5MA 4K46A 4OLJA 3PEWA 4L0QA 5EXEA 4B7ZA 3D3JA 2JBWA 4YP9A 3TOZA 5B7QA 3I0NA 5I01A 1NTOA 3CSDA 3VZDA 1H5QA 1XTZA 3D8NA 4WUVA 1LDNA 4ZDIA 4IMPA 4RDIA 4B71A 4UBMA 4CV0A 2GD2A 4BKRA 3TUZC 1CJUC 4ZU3A 1KFCB 4GX5A 2IHBA 3IOYA 3PPVA 2QAGC 4IIDA 5A9TA 1MB9A 2QSZA 3F6YA 2C88A 3EXHA 5AHXA 5F76A 5JZBA 3AR4A 3B3FA 4D2IA 2CLOB 2PH5A 5DCWA 1I51A 1EZ1A 3R0QA 4QPZA 4ZYZA 3FOEC 1LGYA 4XPIA 5SYAA 2WINI 3TLGB 3NTXA 1OI3A 3F67A 4S24A 5K1ZA 5E3IA 3T6KA 3WB1A 3MWFA 2CFOA 1G8SA 1QO9A 3HCRA 3NXKA 3ZDZB 3WAJA 2XF2A 4BYGA 5TF0A 4KHZA 1HT3A 4D5GA 3CLRD 1NQOA 4NNJA 1MNAA 4AECA 1BA3A 4RCVA 4L4UA 4CEJA 1VKHA 3K8ZA 1E20A 1WS6A 2X41A 1Z5GA 4IO0A 3S2ZA 4QNMA 1RKBA 1VQ1A 2CBZA 3HJTA 1ORVA 3KELA 3MMXA 4JDUA 1YBAA 4K3VA 5AM3A 1M6EX 2NX2A 1NBIA 1JQDA 1CT9A 2N42A 3GDWA 3TSYA 3ASYA 1XN4A 1JTEA 2WD7B 1EM8A 3KPWA 3PXEA 5DTIA 1YZQA 3MAAC 4RESA 2LDXA 2PYDA 3WWZA 3P8ZA 2R48A 4JI1B 1QDEA 2BFDA 3GBSA 2Z5GA 4TTRA 2GM3A 1ESNA 2NVUA 2EFEB 4NG5A 3P0EA 4W63A 3IR6A 3GRCA 3ILXA 1FTSA 2QU8A 2UZAA 1E3EA 1R37A 4M22A 4X9XA 4RIIA 2Q7DA 1YQTA 2A7QA 3ZCRA 4BATA 2FZ5A 3FNEA 1VG1A 2JANA 3A2KA 1XVLA 3QMVA 5CXQA 2JVKA 3DXXA 2FW1A 2C99A 2FEPA 3MD9A 1C1DA 4LCJA 4V0NA 3SCZA 2ZR0A 3K16A 4LRYA 2E5LB 1VBKA 3U3XA 3F5SA 3KUDA 4XGQA 5IM4F 1UJ4A 4QNNA 4N5NA 3DEKA 1A4IA 4YMLA 1U28C 1US8A 4IEEA 1VHQA 1T9KA 2UYCA 4N48A 1OF1A 3IDAA 3V2IA 2EEZA 3AOEA 5AI4A 4BNTA 2BI7A 3HBMA 4L8GA 5JCXA 5JO0A 1R6BX 1ZXXA 1C9MA 4L6CA 1N5IA 2NUPA 3B60A 3W8DA 4M9QA 2CHEA 4EKEA 1TU3A 2OP0A 3R3VA 1N8SA 1SC4A 1O94D 1T1RA 1Z2AA 3L06A 2PY6A 3VPBA 4DQVA 2FUKA 2WU0A 4FT2A 4JL6A 4ZO4A 1IOZA 3TI7A 1Z4IA 4FI3C 5K3DA 2BHRA 1MX1A 3NTLA 5ALJA 3O94A 4CM3A 5JTUA 3AONB 3K7EA 1WVGA 4JITA 1TM3E 5C8DA 3CF4A 1TRHA 3RVNA 2W42A 2MR5A 4YT5A 3B6MA 3FUXA 5ALGA 3V4OA 1XLWA 3UWOA 1KRWA 3W34A 1ZH2A 5H5JA 1ISPA 3T95A 1R8QA 1LLCA 2NLOA 1F38A 2Q4BA 4U7JA 2XYGA 2QIPA 4NBUA 4X90A 3RUFA 1QYCA 3U3RA 5CLJA 5FAKA 1WSDA 1MRNA 3K6RA 2NVOA 2WIGA 3BYZA 3JWGA 1E3SA 2ZWIA 1E1RA 1L5GB 2H0AA 1AB6A 1A2KC 2VUSA 4UVEA 3THSA 3TMAA 5J58A 2HSJA 2FNAA 2J6IA 2WFLB 4NHOA 2W6OA 5CLGA 3SQDA 3O8RA 3DO6A 4YVFA 3TL6A 1BKYA 1GA4A 3ZHTA 3ROZA 4XVRA 1RRFA 3WRWA 2CXRA 2QQFA 1NVEA 1OZFA 3EVAA 1MIOB 3I52A 4FYIA 4QU5A 1XR3A 5H3CA 1IXKA 1JLMA 1NMZA 3FM9A 4Y2XA 1M7GA 5FFNA 3WAKA 2AX4A 1CP2A 2YFKA 3P4UA 3RFTA 3FRJA 5IS2A 2ISSD 4R1QA 1QQBA 4JB2A 3ZVMA 2AC2A 3NMUF 1EVEA 2W6ID 3QTBA 3AINA 5EWMB 2J3EA 4BZQA 3PI7A 4I1OA 4PCAA 2FPWA 1TT7A 4CLRA 5SYNA 4CM4B 3OEEA 4CZ2A 2DFVA 4IRUB 4IQ8A 1I36A 3UUFA 5IYZF 4D0LB 4ZCMA 3MYYA 4E5DA 2ORWA 4F3TA 4GKAA 4YUZA 1SQGA 2WG0A 5FXMA 5A9RA 1I33A 2IEAA 1XZEA 2WV7A 1POXA 3CH6A 4F9GA 5AVKA 3RUDA 4NV0A 1X7XB 4L8FA 4HFNA 2H17A 2H2HA 5LZ7A 4JU9A 2A9QA 2X2PA 4R9NA 4JLDA 3R0VA 1IUKA 4O4LB 1L8QA 5H0IA 3WB9A 1P60A 1I24A 3PLRA 5MN4A 2QUBA 4TV8F 1UK7A 3I01A 4G24A 5J40A 5ADUS 3X2EA 1EXVA 2XCSB 2R7KA 1T5HX 1ZESA 3PRJA 4DADA 1Q22A 2XGSA 3KJNA 1I5OA 3OCZA 1MC5A 1PL0A 5B3JC 4R05A 1O08A 2M9MA 4MR8A 4RZUA 3E3AA 3R20A 3KSZO 1WZ2A 3QXXA 5JJKA 3CVWA 2ZJ5A 2SCUB 3CWCA 4IRMA 3A2NA 2QMEA 4NBSA 4DMUB 5CA0F 5HHTA 3EUAA 1OREA 4EGAA 2VPWA 4W5HA 1BAPA 1Z6XA 4OGLA 4YCCA 4RDCA 5T4BA 4TTQA 2DY0A 1S3IA 2C7GA 3N70A 1VYTA 4JJFA 4BV3A 1E9VA 3CNOA 4IMRA 2VTBA 2O2YA 2EF1A 3R3UA 1S1MA 4CFSA 4EVIA 2O5CA 4DLYA 3TL3A 1NXQA 1P8JA 1X9HA 5EIFA 3PIIA 4MYTA 4RTOA 1QIFA 5A3SA 1KXJA 5JANA 3DZGA 3K6SB 2BMDA 2OECA 1R9GA 3GLRA 3KXPA 4EG3A 3U60B 1B0PA 1QUFA 2GFIA 3OA2A 4JUBA 4AJ1A 3N7TA 3NG1A 1U99A 3K20A 3OCXA 2R87A 2ZIAA 3LYAA 1NAIA 4FC6A 3ZCPA 2YJGA 4TKUB 3ZWCA 4BUJA 1E7YA 4HGOA 4QVIA 2I87A 3TOCA 3L6EA 3ROKA 2A84A 5CVDA 5EJ7A 1UKEA 4Q9LA 4DUPA 2DRIA 1R6TA 4CIWA 1SBYA 1ZSVA 3I28A 3SX2A 2JCSA 2NACA 1CIPA 3UXYA 2DE0X 5M3BA 4E5MA 3PCRB 4E7OA 3NHWA 3KC2A 3T3GA 1XAJA 5BOSA 1YGPA 4FI3F 3GGDA 4ND5A 2Y1WA 3ESZA 3U0BA 3VHLB 4DCOA 3MIIA 2RHMA 2FN7A 3FAZA 3E9CA 5ADWA 1G6OA 1IBRA 5HE9A 2ZJOA 3I4CA 1K8ZB 2AHOA 3LCUA 2R6ZA 1T36A 2J6BA 4MAAA 1N0VC 1KMHA 3DFZA 4F3KA 4DDUA 3Q8KA 1DAHA 1BDIA 3OAAD 1FFXB 2CF6A 2IK8A 3OIGA 4KJXA 4KKXB 5KYYB 1VA5A 1GZ7A 3I6IA 4R83A 3G1UA 5AVVA 2WWFA 1YBVA 2B9VA 2K2WA 2HKIA 3GEBA 3AR2A 4KNVA 5JIBA 1JSCA 1NMYA 5AW9A 3VDRA 2HRDA 4OYRA 1XTJA 3O2QB 3L05A 3CCBA 2ID4A 3TEJA 2QV7A 1B2RA 3S5UA 1VDMA 1A8SA 4Q4CA 2E18A 5KTPA 5FO1A 4MA4A 2NZUG 3RLIA 5A9SB 2WLSA 5K0BA 3KTAB 1GRVA 2QXYA 5G0WA 3HU3A 4EDHA 2N46A 1C8VB 1ZNZA 4B3MB 4F9FA 4GU5A 3EF1A 2PKQP 1NE2A 1OLUA 2IHTA 1ZXBA 2O2HA 4O4HB 3RRJA 2Q41A 5J47A 4AYWA 3V6LA 1QKKA 3ABRB 2WZBA 3OSZA 1EWYA 1RJ9B 1SUDA 1XUOA 4B32A 2FSUA 5DHUA 5DXAA 4GDMA 4M46A 5EP2A 4NU8X 5IT9A 2R7MA 4IVNA 4Y2YA 2JAOA 4N03A 2D5AA 5ILGA 1P77A 3CPHA 1EQ2A 1OV6A 4QA9A 4C6TB 2FV8A 2Q9BA 1EAYA 2BFFA 3K1AB 1XEWX 4A0QA 5HCUA 2QRJA 2W6QA 2D5IA 5EY5B 4BQIA 1IUOA 2HQSA 2H4WA 4D6PA 4F5DA 1MOQA 3L7IA 2WAMA 4QREA 4Y2VA 2H18A 3C6XA 1FRQA 1SR8A 1BOFA 2X5OA 1V4VA 5KOHA 3P0JA 3RUEA 1XQXA 5KWSA 1LV7A 2IZZA 1XZNA 2RKWA 4GMFA 5F3WB 1VBMA 1NQUA 3KVRA 3GLIA 4CTJA 1F6DA 3OPYI 3T3HA 1ZM4A 1U80A 4G0UA 1YAHA 2FMKA 3L6UA 1L4NA 2Y1CA 3EMVA 4EVRA 1RS0A 2FPOA 4NJEA 2VF4X 1V26A 1M2OA 2HMSA 1QRUA 1VCHA 5GWXA 1PFVA 2BZGA 4UAJA 3RT1A 2F3UA 3B5JA 3FJOA 3MT0A 4MI9A 2EATA 5IVHA 2VJNA 1VE1A 3LQKA 1A5TA 1E9BA 1QE3A 2FP4B 1SK9A 1P6UA 2CEKA 1THMA 2CL7X 1OYYA 1G0OA 3GDOA 3AV3A 3Q8LA 4XR4A 3HS3A 3PIDA 3TM4A 4ZTUB 1LEHA 3AG6A 3JD3A 4LF8B 1PNTA 4LWQA 4AJK<