4G81A

Crystal structure of a hexonate dehydrogenase ortholog (target efi-506402 from salmonella enterica, unliganded structure
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
253
structure length
253
Chain Sequence
ALFDLTGKTALVTGSARGLGFAYAEGLAAAGARVILNDIRATLLAESVDTLTRKGYDAHGVAFDVTDELAIEAAFSKLDAEGIHVDILINNAGIQYRKPMVELELENWQKVIDTNLTSAFLVSRSAAKRMIARNSGGKIINIGSLTSQAARPTVAPYTAAKGGIKMLTCSMAAEWAQFNIQTNAIGPGYILTDMNTALIEDKQFDSWVKSSTPSQRWGRPEELIGTAIFLSSKASDYINGQIIYVDGGWLAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative hexonate dehydrogenase
publication title Crystal structure of a hexonate dehydrogenase ortholog (target efi-506402 from salmonella enterica, unliganded structure
rcsb
source organism Salmonella enterica subsp. enterica serovar enteritidis
total genus 100
structure length 253
sequence length 253
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4g81A00
2OXIA 2OGUA 3ICPA 2FR8A 2YQ5A 4K6FA 2IZ0A 3ZHBA 4JGBA 4MDHA 4R5HA 1CERA 3VZQA 4D44A 1BDBA 1DJQA 1PSDA 2WYWA 4OKIA 4S3MA 4W4TA 3RJ5A 1PZHA 3A1NA 5KJFA 3F1LA 5LC1A 4CM6A 3KYCB 1LQUA 2AEMA 1C14A 3ZGYA 4NDNE 1EE9A 1T4BA 2P4QA 4M86A 4TROA 3PRJA 3WIEA 2A35A 3K2EA 1ZH8A 1R16A 1I2CA 4IJUA 3VH4A 1UDBA 1E5QA 4MVJI 3UVEA 4W6ZA 1JKIA 3ZHXA 3WGIA 5I9LA 3VPSA 3F3SA 1TLTA 2X0RA 4R51A 3L77A 1EZ4A 3LQFA 1ZK1A 1IE3A 3WMWA 2QZZA 1DB3A 1P77A 1PS8A 5H82A 1JKFA 1KY5A 4CV1A 1GEEA 1UZLA 3ZU4A 2VWHA 2VNAA 3A4VA 4CPDA 4E5KA 3VDQA 3FNGA 1HF3A 2OBNA 4BKRA 2TMGA 4KQXA 5KKCA 4IZHA 1GQYA 4CM4A 4BV9A 5DBIA 1CF2O 2PH5A 1TXGA 4W9NA 3ZDFA 4PCVA 1AN9A 3HWRA 1ONNA 4CR7A 4B4VA 2ZK7A 2I99A 5G0SA 4GKVA 1MP0A 3OMLA 4PLTA 3HB4X 3BHIA 5K0ZA 1PGQA 4PG7A 4EYEA 4KP7A 4YYZA 4B3IA 1NTOA 1UDCA 1VJ1A 2Q99A 1JA9A 2J3HA 3ZU2A 4J1TA 3KBOA 4JJIA 4GWKA 2DTDA 3M6IA 4YWJA 4ZICA 2GN4A 1ML3A 3WYEA 5JBIA 1U28A 1U4OA 3ZWVA 3UCFA 4IXTA 4CM3A 4OMUA 3RC1A 3DWFA 1LLQA 3PQFA 4J49A 1YB1A 2FN7A 2ZATA 5CEFA 3M2PA 2B5VA 2VCYA 4CV2A 2JFFA 2Z1NA 4MVJE 3OF2A 3RJ9A 5JLAA 1PZEA 3IUPA 3JCZA 1IPFA 4DPMA 1Z7BA 4P8RA 3D4PA 3WFIA 2WYVA 5F1OA 9LDBA 4GGPA 3WBBA 4UUPA 2HUNA 5DNAA 2B37A 2Y1EA 4FOOA 4MVJF 1YBVA 2BF7A 4DIOA 5JS6A 1Q0LA 1GV1A 3FNHA 5T57A 2BGLA 1YL5A 3I5MA 1R37A 1JVBA 4WCFA 1YJQA 1QR6A 1VPDA 3AOGA 1T1SA 3DZJA 4PGFA 2BFOA 2G76A 9LDTA 3I83A 1J4AA 4BNKA 1LNQA 4FIZA 1ISGA 1E7QA 3VH1A 3NT5A 4OOFA 5BNIA 1FDVA 3BTVA 4BGIA 3WR5A 2HMVA 1NPTO 1Z82A 4IJVA 2PGDA 4YAEA 4GBJA 4AJPA 4II3A 4D46A 4E12A 3D7LA 1UXIA 2VN8A 4FS3A 5BNTA 3HADA 2O3JA 4KOAA 1XEAA 1PEDA 1HSOA 5JDIC 1WP4A 1TT5A 1Z45A 4P4GA 4HKTA 1N9GB 3LC1O 1QORA 5DP2A 4K28A 3LK7A 1XA0A 4BHTA 1UXKA 2FPGA 2RAFA 3RBZA 4NBUA 2WD7A 3I6IA 4DXHA 1MG5A 3DAFA 1XQ1A 3AUSA 3H9JA 2W98A 4Q3EA 1JW9B 2DBZA 3ZW9A 3I4FA 6LDHA 4B8WA 1BTOA 4OQYA 4PLVA 4NU6A 3RKRA 1Y6JA 3PLRA 1X0XA 2WEKA 3DBHA 3ZHYA 2NTJA 2VOEA 5L45A 1EE2A 3F9IA 3QVWA 2E82A 4YJGA 2Y67A 2DBVO 1B3BA 2D4AA 3WXBA 1WPQA 2GD1O 1LDGA 1LQTA 3OICA 3DAPA 1HE3A 3GZNB 1UUFA 3M1AA 1LLDA 3NGLA 3Q1LA 4FFLA 4FW8A 2VWPA 5TC4A 1PS0A 4G5HA 1P1FA 3VKUA 5A9TA 2YYYA 3I9OA 4GX2A 4XRGA 2PH3A 5DZSA 2EP7A 2WDZA 1E7MA 4JLWA 2DUWA 4I9NA 1LLUA 2HK7A 3HDQA 3Q6IA 3LT4A 2X7HA 3DHEA 4TKMA 5TT0A 3TRIA 3HFGA 3DC2A 2Y1DA 4CMJA 2QYSA 4CMHA 4D0SA 2OOSA 1Z7EA 4JJGA 1FDTA 1DOHA 2X1HA 3H9GA 4Z0TA 3OM9A 5JO9A 1MA0A 2YDYA 3BTOA 5ENDA 2QHXA 4II2A 4L4XA 4UVDA 1SB9A 4G65A 1BVUA 4D7AA 3OJ0A 1GTMA 1WDLA 2LDXA 3VPHA 5KVSA 1B0AA 1WAMA 2W2KA 4K6CA 4Z9YA 2V7PA 1U9JA 2AEJA 4B7UA 1E92A 2HCTA 4OHUA 4DC1A 1E7YA 1JU9A 1P1HA 3PFFA 1BW9B 5CG2A 5IFLA 3EVTA 4JQCA 3S2FA 1Y8QA 2PWZA 5L7YA 1I0ZA 1E3JA 3JQAD 3GR6A 3ITDA 3V1UA 3DMYA 5DBGA 3L4BC 4ND1A 2ZB4A 5AXBA 4CLDA 4DBZA 1E3WB 3S2IA 5A06A 1PJ4A 1JAXA 1NQTA 2C59A 5AXCA 5DCWA 3RBVA 4LMPA 2C54A 3VPXA 4CM5A 3HDHA 4IQGA 2DFVA 3FCOA 1Z6ZA 2PD3A 4I9UA 1LDEA 1E6UA 4J43A 3L0DA 4BNZA 4HFMA 5KNLA 3WLEA 1KC1A 2Y93A 3NX4A 2JCVA 4J0FA 4ND2A 3P5SA 2NVWA 1UJMA 4NK4A 3FI9A 4ALLA 2VHZA 2HJSA 4BNVA 2ZYDA 2WE7A 3O8QB 3PYMA 1B2LA 3L4SO 4BO4A 4EI2A 4NI5A 2HSDA 1I3KA 1ORRA 2AMFA 4FN4A 1OOEA 4LRTB 2VZ0A 2AQHA 1DFIA 3ST7A 1H6AA 4CQMD 2X5JO 2OZPA 4PLHA 4FFPA 1HDOA 1Y8RB 3IDSA 5IZCC 3G1TA 4K26A 4PZDA 3AM5A 3PWZA 2DFDA 3JV7A 3FWNA 4UULA 4CM9D 2O23A 3NEPX 2JFGA 3N58A 3BMCA 8ADHA 1DBVO 1DAPA 1M75A 2WYUA 4UVEA 2BFMA 2FRDA 4OSOA 4CM8A 3WQRA 1GZ4A 2NSDA 5HWSA 3T4EA 1JDJA 1SZJG 5HS4A 3CZRA 5TSDA 3C8MA 1Q2XA 4EUEA 1VI2A 4D42A 4NJOA 4YR9A 2CVQA 1ZK3A 2R00C 3MJCA 4TRJA 4F3YA 1A5ZA 3KHUA 3EUWA 3I23A 4Q3NA 3TZ6A 3E5RA 1IPEA 2VHYA 3RUIA 5A03A 2BRUA 2Q49A 4RZHA 4ZVVA 2GZ1A 1CYDA 4BV8A 3RFXA 1ADFA 3LLSA 3D4NA 4R9SA 1N1GA 4Q3AA 4CQLA 1GCOA 3ZWWA 1NQOA 4S1VA 5JC1A 3W6ZA 4MKZA 4RVHA 2RBEA 1U7HA 4RVDA 4AFNA 1LLCA 1A7AA 4FJ1A 1X7HA 4PG8A 3FR7A 2GPTA 4J7CA 3U9LA 4BKQA 8LDHA 1ONOA 1Z74A 2ZB7A 3GHHA 5I7VA 3DOOA 4XX0A 5FWNA 4MPDA 1IULA 4CV0A 3DBLB 3U4DA 4F6LA 1FK8A 2DKNA 1K5HA 3CKYA 3RROA 3T7EA 2O3TA 3LU1A 4NHEA 3WMXA 4EUHA 2DVMA 4A27A 1LDNA 1BVRA 2YV3A 2VQ3A 2EKLA 2H6EA 1LA2A 1YL7A 4UAGA 3F1KA 3EZYA 3PFWO 4J91A 1ZSVA 4ONEA 1SB8A 3TOXA 2PKQO 4TRMA 3UUWA 4XD2A 4RF2A 4BNXA 4BNGA 3U09A 2VRCD 1RJWA 3OA2A 5KIAA 1QKIA 2HO5A 5L4SA 4RQTA 3PK0A 3JYPA 3DZBA 3WYBA 4KDFA 1U3TA 3LZ6A 1C3VA 3H9EO 4R9RA 4GVXA 1WMBA 4J2HA 3JD2A 4RPGA 1E77A 2X0NA 4LCEA 4A5OA 1BRMA 2V6BA 5HA5A 3TWOA 3OIFA 4YJDA 5TS3A 3KXDA 2Z5LA 5HRUA 1O95A 2CD9A 4CLHA 3LDHA 1TVEA 2Q1WA 3IQDB 5ICSA 3GNQA 1E7RA 1IHXA 4JIGA 4JJFA 1YQGA 3JQ7A 3JQGA 3ETGA 1ZMOA 1J5PA 2ZB3A 3K73O 4XJTA 3UOGA 4J7UA 2X8LA 4U5QA 1SAYA 3PPIA 3C3XA 3JYOA 2ZQZA 2VHXA 1BDMA 2D5CA 3WGZA 1U3UA 2JJYA 3VAZA 1QP8A 2B69A 4PLCA 3WTBA 2QIOA 1ADGA 1DC5A 4CMAA 5A9SA 3BHJA 1HT0A 3EAGA 5JYDA 4XIYA 1LRLA 4TRNA 1EVZA 4R3NA 3DZHA 2GO1A 2WD8A 5U4QA 1VL0A 1I10A 3SJUA 1KS9A 2O2YA 3GEDA 1E3IA 1M2WA 4ND4A 4CR8A 2CDAA 1X7DA 2CFCA 5EINA 3GNSA 2ZIZA 1ENPA 4DBVO 3H3JA 5I7EA 5L4LA 3LC7O 2EERA 4WUVA 4Q3BA 1OBFO 5HBRA 2CDBA 4U8GA 1MB4A 4YQZA 5G4KB 2PZMA 2NWQA 5ITVA 4QUKA 1ISIA 3OBBA 4NR0A 3JQAA 4ZRMA 2Y05A 2Y1FA 2HK9A 3AU9A 1O9BA 4IDCA 3C24A 3OECA 1DC6A 5CDUA 1CJCA 3PXXA 3PDUA 2VOJA 3KV3O 3K96A 4BO8A 4BOYA 1ADBA 3ENKA 1R15A 4IUYA 4RQUA 4YXFA 4YJHB 5F21A 4OXNA 4AJ1A 3RVDA 3CTMA 4JP3A 3TZQA 3AUTA 4DVJA 2UUOA 3BA1A 1WVGA 2BGMA 4WNIA 4JXKA 3H2ZA 3ZV6A 1GU7A 2VWQA 4HFRA 3KRTA 3IS3A 4ZJUA 2RCYA 1QXSA 4I5EA 3PLNA 4RDHA 4BO3A 4YEDA 4LCJA 5AYVA 1NHWA 5GMOA 3CMMA 2AG5A 2VNSA 3O03A 1VRWA 1GY8A 2NNLD 5F5NA 3D3EA 2FP4A 1MG0A 4ZD6A 3W4KA 1H6BA 4AL4A 1HZZA 1DXYA 4BNTA 5HTOA 3FN4A 2W2LD 5C7IO 1E5LA 1ISHA 1HTBA 3I9NA 1C1XA 2XXJA 1L1FA 3S8MA 2DPHA 1PTJA 3WGYA 1YH3A 1V3UA 4CQMA 4YAGA 2ET6A 3HDJA 4KUEA 3TL2A 1HZJA 4MKRA 2JKVA 2EW2A 3AJRA 3FR8A 4XQGA 1XELA 4MP8A 2Q1SA 5L95A 3PJEA 5AXAA 1NR7A 2C2YA 5L3ZA 3W8FA 4CM9A 1DHRA 4E31A 1KC3A 3PTZA 4PN3A 2QRJA 2O3RA 2Y66A 2JL1A 2EKQA 4WEOA 1T1RA 3PJGA 3GK3A 1EUCA 1XSEA 4D3FA 2RIRA 2NVUB 1I01A 3HG7A 1NXQA 4Y6PA 2X4GA 5EERA 3H9QA 3SX2A 4BVAA 2Q1UA 4IMPA 3PWSA 1P3DA 2NVBA 1O0SA 1C0KA 3KYDB 1P45A 1RM3A 2BFAA 2UDPA 4XDYA 3WB9A 4BMSA 2Y1CA 3BZUA 4D41A 4ZQFA 4BKOA 2O48X 3ADOA 3NT4A 4LK3A 2YJZA 2GGSA 4E0BA 5CAEA 3WIDA 2E49A 3HQ4O 1ZW1A 3W4IA 4U7WA 3GFGA 4O0LA 5T8KC 1F0YA 3D5QA 4DIFA 4U6SA 3D1LA 4U0KA 4XIJA 4ALIA 5CG1A 2PNFA 3MOIA 3L6EA 4XYLA 3EHEA 4LSMA 1ULUA 3ZU5A 5EN4A 2IRWA 2PD4A 4BMVA 5JFOA 1GV0A 3P7MA 4LW8A 4FB5A 1ONPA 2RHCA 5JCJD 2X9NA 3F46A 3WWZA 2BKAA 1R6DA 2I5PO 1E6EA 4CUJA 5CDTA 1NAIA 2YHIB 3IUSA 2O50A 4BGUA 3PJDA 4DQVA 3PHGA 4A26A 1XYGA 4HNHA 4XQCA 1GYQA 1XU9A 3JQFA 3KSUA 3NYWA 5I9NA 3QIVA 2IZZA 4EITA 2DBQA 3I9LA 2VRBA 1W8DA 1BGVA 3BMOB 4GL4A 5LCXA 3KSZO 2EWMA 2P9EA 4Q9NA 2C82A 4TRRA 4AJEA 2V6GA 3SEFA 4RPJA 3B70A 1HETA 4TVOA 1K0UA 3WQQA 2HMWA 3AUUA 4E33A 4EDFA 1ZCJA 1QRRA 1P74A 1UZMA 3RC2A 2F1KA 2IDZA 1RM4A 1BXKA 2VT2A 1SEPA 1CQJA 3QLJA 4E2YA 2Q2QA 4OM8A 5KVCA 4OYRA 1UXGA 3FWZA 1HE2A 5TT1A 2QRKA 4ZGWA 1E1NA 3K6JA 1K6JA 3ETDA 4F6CA 3CSDA 5JDCA 2CUKA 2HMUA 3RAJA 3X2FA 5K6AC 1JVSA 4XB2A 2G17A 4YAKA 3PJFA 3WSWA 3ABIA 1NVGA 2WWRA 1FXSA 3GC6A 3OEWA 1A9YA 1I2ZA 2FMUA 2YV2A 3CMCO 1GZ6A 2QQ5A 4N5MA 4D45A 4Y8VA 5JAZA 4WLUA 3W8EA 2JAPA 1S7CA 3FSRA 3ZZNA 1AXGA 4WECA 4DYDA 1KEUA 5IN4A 4CUKA 4I08A 1X15A 1YRLA 4QQRA 1I3NA 4RZIA 1V0JA 3I4CA 4QO7A 4Z0HO 3TFOA 2VHVA 4L8VA 1E1KA 1GADO 4GGOA 5L51A 5B4VA 4WLOA 4ID9A 4FD3A 1PZFA 5IDWA 3H5AA 3AM4A 2RH8A 4P4LA 4DUPA 1FDWA 2C20A 1DO8A 5GY7A 2SCUA 2VYVD 4EJ6A 3F47A 3E9NA 2EJWA 4D79A 4F45A 4J3FA 1KOLA 2X5OA 3A9WA 1HDZA 4XWYA 4CODB 4HUJA 2GN6A 4CUZA 1CRWG 3VPGA 1NAHA 2IYOA 2QX7A 4MOWA 5B37A 2DAPA 3RCBA 1DJNA 3UN1A 2WJPA 3KEOA 1E0DA 3ONEA 1N9GA 1QYCA 4Z9XA 4GWGA 1IB6A 4GMFA 1L7DA 4L76A 3NTOA 4JBIA 3U62A 1ULSA 2CF5A 5B1YA 4BGVA 3ZU3A 1UDAA 2H5LA 2IODA 5DT9A 4NFYA 1GUYA 3KOUA 1C0IA 4GPD1 2CZCA 4EZBA 3S2GA 1A72A 3LC2O 1E3SA 3AI3A 4N5NA 3EDMA 3GVPA 5AXDA 3BMQA 1HLDA 5T5QA 5L40A 1KERA 2CDCA 1PJLA 3BHMA 4MVJP 4IXWA 5KKAA 3ADPA 3K31A 4HWKA 1M6HA 4C7JA 4IGFA 4AG3A 4LVCA 3INGA 1MFZA 2DLDA 3RUAA 3AY6A 1GPDG 1R0KA 4LRSB 1I8TA 5KOIA 4QEDA 1W0CA 4CMEC 1GFSA 4JX8A 2D5AA 4UUNA 1PL8A 2W2LA 2C5EA 3WSVA 3ZWMA 5ITWA 4DC0A 4RLHA 4KWIA 4DGSA 4MVJD 3UCEA 3GEMA 2XPCA 1U8FO 4WCDA 3OIGA 2O2SA 3AOEA 2ZJ1A 1G0OA 3UGKA 4O5OA 4CMBA 2Y1OA 3LVFO 3RBXA 4L4SA 5JYEA 2GR9A 3K8ZA 1SBYA 4AJOA 1ZK4A 4IINA 4FCCA 4R1SA 4A7PA 5L7WA 4NQZA 5G0VA 3UXYA 1EMDA 4I8XA 3GRKA 2CNBA 2YQ4A 1MLDA 5H81A 1AUPA 1F14A 2NTNA 3FNFA 1IYZA 5GZ6A 2PD6A 1ARZA 3X2EA 1OMOA 3VTFA 3WGOA 2NTVA 4C7KA 5G2OA 4Y6RA 5T67A 4MVJH 1BW9A 1ZFNA 2V6FA 4AICA 1Y9EA 4DPLA 3LSYA 3C1TA 3IOYA 1AHHA 1FJHA 3U4IA 1P0CA 4O63O 1UH5A 1K6XA 3COSA 3JQ8B 3OJFA 1U3WA 1E3WA 3ANNA 1MC5A 3I9JA 3BTUA 1XDWA 2AQIA 2TMDA 1W6UA 1E7WA 1I33A 4WASA 2ZYAA 1OZAA 4WLFA 2CY0A 1EDZA 5EMHA 2OBYA 5JMPA 4H15A 4RVSA 4IZIA 4B4OA 3L6OO 4MVJM 2HJRA 4FC7A 3FPCA 3KYBA 2E48A 4I1IA 1EK6A 1LJ8A 1P1IA 2VZ8A 3NRCA 2OHXA 1LDMA 5C37A 3DQPA 4TVBA 1H2BA 3OQ1A 4RPLA 3QQPA 3SLGA 5JCJA 3RIHA 1T2CA 1DIRA 4C4OA 1NWHA 1UZNA 3O8QA 3ANMA 3VH3A 1JKJA 3QW2A 1KVQA 3IJPA 3K2BA 1N7HA 3HUDA 1U7TA 3O9ZA 4CLOB 4RO0A 2W8ZA 1GQQA 3ONDA 4IS2A 4NFHA 4FOSA 4OO3A 4RCVA 1IZ0A 3LT0A 4ROSA 3S1LA 4BNYA 1P0FA 4BNMA 3PGJA 1FDUA 1GCUA 1Y8RA 2JHFA 3RD5A 3NJ4A 2VYND 1PX0A 3PP8A 3G3EA 4HNGA 5IDYA 3QSGA 3T4XA 4EJMA 1PGPA 1VJ0A 2YZ7A 5T64A 3E5MA 1HXHA 1TT5B 1NPYA 4Z6KA 2GZ2A 5FI3A 4DREA 4O6VA 2I3GA 1FDSA 3R6DA 4HXYA 4Z0PA 2PZKA 4WPGA 4GX0A 1E7SA 4NMHA 5LDHA 3OSUA 1RYEA 4BO7A 3FPLA 3IP3A 4PFJA 5FF9A 3I9MA 7ADHA 3GGOA 3H65A 1MUUA 4QSMA 2EIHA 3FTNA 3MCVA 4IDFA 3VHRA 3DZGA 1ISJA 4CLRA 4M49A 1VLLA 1ZK0A 3ROQA 4RDIA 4IBOA 4PLFA 1JQBA 1X14A 3DXFA 3CIFA 3NAQA 4DQUA 4OJNA 1PWXA 1NHGA 1BXZA 1HWYA 4LN1A 5I7FA 3NKLA 4I5GA 2NU8A 5KWEA 5IDXA 3RASA 1XGKA 3HHPA 1ZIDA 4AJLA 4ND3A 4TMFA 4I5FA 5L7TA 3GQVA 3WQSB 1P1JA 1LC3A 1U2GA 3WGQA 1VSUA 1HYGA 3PI7A 4RVGA 3VOSA 4YA6A 1YDWA 5IXYA 3V5NA 1GYPA 1BHSA 4L75A 3DBLA 2EW8A 4A03A 4KTVE 2VYVA 4H7PA 5DOVA 4IJWA 3GOHA 4XGNA 4PRKA 2FZEA 1P33A 1R4MB 3KB6A 5TX7A 3DOJA 2D59A 4ALJA 2AQ8A 2RHRA 3V2GA 2I9PA 1UXHA 3QY9A 2B4TO 1FMCA 1R12A 3KUXA 3M2TA 1E1MA 1ID1A 1PR9A 1NVTA 1Q7CA 4YJFB 1H9BA 4NPCA 1OI7A 3C1AA 4D43A 3WFJA 3MJVA 4XJSA 1LSSA 3QWAA 3K9QO 3RUHA 3I52A 3CPSA 3JQBC 1Y8QB 5G0TA 2H63A 4F46A 3GNTA 5DCYA 1AE1A 3P2OA 5JCXA 2NU7A 4BIIA 1NWCA 1QYDA 2B5WA 2E37A 3SBOA 4R1NA 1F8FA 1ZUD1 5I8ZA 3JQ6A 5A1TA 5BQFA 2DC1A 3ZWYA 5BSEA 4MINA 4J7XA 2AW5A 4R68A 3RC7A 1B3RA 2Y0DA 2V65A 1AXEA 3MJ4A 3E8XA 2GNAA 4J4BA 4M54A 1NP3A 2AQKA 1G0NA 1PJSA 1K3TA 3A06A 3GGGA 4R54A 3EZLA 2G5CA 3RFTA 2X0IA 1O6ZA 4M1QA 5T6BA 3HNPA 2GSDA 4MVJA 4PZCA 1VSVA 3BTSA 2IZ1A 1HYEA 2OORA 2OFPA 3CUKA 1C0PA 2D2IA 1JAYA 3HB5X 3AUAA 1YBAA 3PYXA 5TLSA 1BG6A 1HL3A 2Q2WA 3LT2A 3LYLA 3NT2A 1SPXA 1V8BA 4W82A 3KO8A 1T2FA 3W4JA 3H5NA 5BSHA 3BMNB 1FF9A 3F5QA 2XAAA 1TT7A 4A0SA 3JD0A 5CP8A 1O89A 3GDFA 3I9KA 5ILOA 3QWIA 5MDHA 1IOLA 1PL7A 3JQCA 1ISMA 1PJTA 4BS9A 5GZ1A 1I5RA 5EPOA 2Q45A 3OJEA 4IIUA 1HKUA 4LMRA 3U0BA 5CFZA 1HDGO 1DIGA 2YW9A 4QFDA 2O3UA 4WEQA 3KLMX 3MWDB 3WNVA 4E2XA 3PQEA 2PA3A 3NDIA 5G4KA 1L7EA 3GVHA 2ZYGA 3AW9A 3GUYA 1IUKA 4OXYA 4CMEA 2H9IA 3PHHA 4BKUA 1YJ8A 4B79A 2DQ4A 4BNJA 4EEZA 1GZ3A 1EUDA 1QV6A 1D1TA 4D3SA 1HE4A 3GFBA 3DMTC 5U9CA 1LDBA 3AM3A 3DZFA 4GI2A 4YJHA 2BGKA 2IE0A 3EC7A 3VZSA 4OAQA 3TOZA 1Y81A 1E3EA 3MEQA 2FWMX 3RI3A 1PU2A 1MXFA 3AY7A 4NBTA 3TJRA 2FHSA 4CR6A 3U5TA 4W9NC 3ETEA 1X1EA 5JDIA 2Q4BA 1DRUA 4XYBA 3W6UA 1UP4A 2AEFA 4HV4A 2JCXA 3UAGA 4ESOA 5JNLA 4OOEA 1VKNA 4Y67A 1Q7GA 1EVIA 1NM5A 3KM0A 3ON5A 4DTIA 3NDRA 2ILTA 1DLJA 1NBOA 2P9GA 2GLXA 2WSBA 3DL2A 4O1MA 5DN9A 5TNXA 3UH1A 1EEHA 4E4YA 2P5YA 2Z1MA 4IDGA 3ANLA 3GY0A 3PHIA 2EEZA 3VVBA 2B36A 3TZHA 1EFKA 2JD0A 5JPIA 1ZEMA 4B3HA 5A3VA 1BSVA 3ICCA 1YB4A 3I3OA 1NYTA 4XRRA 1GDHA 1NNUA 2NQTA 2R6JA 2VYNA 5L9AA 3NV9A 1TA4A 4B3JA 5A9RA 1N1EA 3WGTA 1B16A 4GSKA 1PGJA 2DT5A 1VM6A 2WMDA 3OQ6A 2ZCVA 3PZBA 5I8WA 4MJLA 3D4OA 3LT1A 3FBTA 4PVCA 1N2SA 1O5IA 1PZGA 3ORFA 2J5KA 4M87A 4QX6A 4PIVA 4CMIB 4YQYA 1XU7A 2I6TA 3KTDA 4KTTE 5COQA 3WG9A 4J0EA 2NVUA 2IXBA 2HAEA 4RPHA 4WCFC 1LUAA 3QVTA 2J3JA 3JQDA 4W99A 1LDYA 4XGKA 2PR2A 3V1TC 1YVEI 3JYQA 4G2NA 1T26A 2NU9A 3F5SA 1NPDA 1U4SA 4PG5A 5TF4A 5DOZA 5F1PA 3V1YA 4RPKA 2I66A 2FZWA 1PJQA 1EVYA 3H8VA 1N7GA 1IHYA 3ASVA 2WTBA 1YS4A 5LDGA 2GYYA 3FNEA 3TFQA 1D3AA 5MGBA 3TZKA 1XCBA 3JQ7B 3JQGB 5JO0A 1SMKA 4ZQGA 3Q11A 4ZRNA 1F8GA 1JWBB 3AI1A 3KSDO 4DPKA 5B12A 4DLAA 1QSGA 2YDXA 1B26A 4PRLA 3D3WB 4XR9A 3VTZA 1QLJA 1I36A 4YRBA 4WE3A 4YT2A 4JP2A 3UKOA 1MC4A 3EK2A 3GPDG 1Z75A 5KCZA 1R4NB 2NV6A 1A7KA 3ROMA 4EBFA 3L4BA 4QO8A 3IMFA 5B4UA 4FFMA 1LX6A 1U1IA 1ZNQO 3S2EA 2ZTLA 5A9SB 4OL9A 3IJRA 2JD1A 1PQUA 2EKPA 2PK3A 2X6TA 1N8KA 3ZNNA 4A10A 1RKXA 4LSWA 2Y99A 4DMMA 3C7AA 1U8XX 4ALNA 2GN9A 2GERA 4XB1A 4QTZA 3ONFA 3GRPA 4X54A 3DBRB 4N18A 4XCVA 4L0QA 1TI7A 1WZEA 2OUIA 2GN8A 2CVOA 5I9MA 2CVZA 2DBRA 2A94A 2HQ1A 2PY6A 4J1NA 4K1LA 5KJCA 1ZO8A 1Q0HA 2NQ8A 1IY8A 1KEPA 1O8CA 1UAYA 1T4DA 1C1DB 3VKVA 4D0RA 3G1UA 3ASUA 5KJ1A 1DC3A 1QYWA 3GG9A 2C2XA 1Y1PA 2YY7A 1A4UA 4BO5A 2Q4EA 4M8SA 1V3VA 4NJMB 3LF1A 4I9HA 2C5AA 5ICMA 3ZH2A 2UUPA 1ZVMA 3KYCA 5IZCA 5CDSA 1Y5RA 2EJVA 4R41A 5EQFA 4J9UE 1JWAB 3ZI0A 1B8VA 2XOXA 4JCOA 3DAGA 3L6DA 3UFXA 3MTGA 4BNWA 5FI5A 1V35A 4GX5A 1GUFA 3ROKA 5COBA 4AVYA 1MFPA 5IJZA 1KVUA 4OH1A 3INTA 3UCXA 2Q1TA 1WDMA 2D8AA 2JFHA 2P91A 1OC2A 3CEAA 3C7DB 4RVFA 3E82A 3GVIA 3G0OA 3ROPA 2UVDA 5B4TA 3WDSA 1XR3A 2R00A 2P68A 4UREA 4KQWA 2BLLA 4Y6SA 4PZEA 3FBGA 4NFSA 3SC6A 2VRCA 1K89A 1LI4A 3QWHA 4OSPA 2Y0CA 2ZJ0A 4J2OA 5JY1A 2Y1GA 4NIMA 3DONA 2FR1A 4CQMB 2X86A 4RL6A 1BXGB 3GH3A 1RM5A 2PFGA 2AG8A 4LGVA 1PJ2A 4WLEA 5JY6A 1YOVB 1RM0A 1VE9A 2BI7A 3DHYA 3FD8A 4PG4A 3O38A 4M89A 2C07A 1W73A 3E1KA 1CIVA 4J4HA 3TQHA 2QRLA 3QVOA 3OP4A 5A05A 5KVQA 4FJ0A 4CM7A 4EJ0A 1N5DA 1ZBQA 1V3TA 2J5QA 3O26A 1QLHA 1ZJZA 5TRTA 2O3SA 1WW8A 1WXDA 2X22A 4M55A 4XQ9A 2IYPA 2P5UA 3LF2A 5A4DA 3RUDA 2B4RO 5A3JA 5K9ZA 4ZHSA 1LRKA 1T24A 2B0JA 1TB4A 1YXMA 3DHNA 1E6WA 1GPJA 4N7RA 4YTEA 3EGOA 1ZSYA 2E4AA 3E48A 4XA8A 3GN1A 5DDIP 3WNQA 1RYDA 1Y9AA 1DIHA 2JHGA 4PLZA 4XYEA 3UHAA 1H2HA 4UEOA 1CQIA 2PV7A 3Q2KA 5FYDA 1SNYA 1H94A 3CINA 3PHJA 3Q3CA 1A27A 3IIEA 5CDYA 1CETA 3WTCA 4HADA 4Y98A 3Q0EA 4AJKA 1P44A 1WDKA 3R3JA 3VDRA 3VC7A 4YAIA 1DIBA 4ALKA 1LEHA 5JW6A 3GVXA 4JN6B 2GDZA 4UVIA 3VZRA 3U49A 2OL4A 4UUOA 3TN7A 3N7UA 2FR0A 5CPFA 4FGWA 3GGPA 4WNCA 4ZQEA 2W90A 2VHWA 1GYRA 3B1JA 3GDGA 5HM8A 4BO6A 3DMTA 1XG5A 2QW8A 3FTPA 1T25A 1X0VA 1XIVA 4Q3CA 1KEVA 4GKBA 3A14A 5C3MA 2DU8A 2DM6A 2D3TA 2YHUA 4J1QA 2DTXA 3U4HA 2LDBA 3NGXA 3H5RA 2PKQP 2I67A 3RWBA 4E5PA 2JD2A 3QJ5A 1LXCA 1A9ZA 1X7GA 1NX6A 1ZEJA 4E2WA 1LSJA 1KVSA 4QFCA 3ZHZA 5ENVA 5H83A 3DBVO 5KTKA 2IXAA 5EIOA 1R0SA 3H6KA 3MWEB 4MIOA 6ADHA 3F6YA 2G1UA 4Z9FA 5GZ3A 5EQDA 3RSHA 1VL8A 3PZRA 4Z3DA 3RU7A 3HN2A 3RUEA 3IKTA 3SLKA 3JQ8A 1LC0A 4IQ0A 1GL3A 2O4CA 3H9UA 5CPBA 1KIFA 2B35A 3PGXA 4MVJG 3JTMA 3ZV3A 5IDQA 1YB5A 3PQDA 5DF1A 4YT8A 1DHTA 3IC5A 3QRWA 1DLIA 4BNLA 3ZN2A 3GZNA 2NM0A 3P2YA 3MJSA 4FGSA 1D7OA 2OO5A 2YV1A 1ZKMA 1J6UA 5EESA 4ALMA 2VTDA 1D4FA 1BMDA 4NH4A 3JYNA 5THQA 4U6QA 3WBFA 1W4ZA 3I1JA 1KY4A 2O3QA 5F3RA 2ZTVA 4J1SA 4NNJA 1XKQA 4CL8A 2P9CA 2C29D 3E18A 4NBWA 3SVTA 4GVLA 1GD1O 3GVCA 4E6PA 2EP5A 1ZMTA 3GLQA 1F06A 1R66A 3OFSA 4Q39A 3DZIA 4UVHA 2AXQA 4NU5A 3PDJA 5JE8A 1WWKA 3RFVA 4MIYA 4KMSA 4KZPA 5ER6A 1G1AA 1A71A 3ZWCA 5IXSA 1M76A 2I65A 3HFSA 1EUZA 3HDYA 4CM4B 5J23A 1Y5MA 4CLOA 1XHLA 1UP7A 2BMAA 2NLOA 4HP8A 5I7SA 3ZNOA 5EJ2A 2HKIA 1YKFA 1NFRA 3QA9A 1LU9A 1YGYA 2PLAA 3SJ7A 3GF4A 3R1IA 1H5QA 4TKLA 4DLBA 4WGGA 1M66A 3DO5A 3D64A 4BB5A 1SOWA 3B1KA 4B4UA 3CE6A 4BO9A 2AHRA 1PL6A 3L9WA 1NR1A 4R69A 4BO2A 1ADCA 3JQ9C 3JD4A 2QG4A 4H16A 4CM1A 3HN7A 4XEHA 4BNNA 2CF6A 3L9XA 4BNFA 4WOJA 1HRDA 2GZ3A 3ZNPA 2Y68A 4DIBA 3WGGA 2FOIA 1Z73A 3AFNA 2BD0A 5CHEA 1KEWA 2EGGA 1VL6A 3BMQB 4IMRA 4BGEA 5C5IA 2HMSA 2A92A 5JXWA 2J3KA 2FPIA 3A28A 4JBHA 4H3VA 3RU9A 3GA0A 5CEEA 1YQDA 1T2EA 4E30A 4CJXA 4ZA2A 4R4JA 5F5LA 1I3MA 4DA9A 4P4NA 1QMGA 4WCFB 4AJJA 4GLLA 1EBFA 1O94A 3GMSA 3K92A 3P19A 4BO0A 1MXHA 5JMWA 2OMEA 4DYVA 1PGNA 3B1FA 3QE3A 2OP0A 2ZKLA 4W7HA 4R1TA 4YB8A 4QECA 1AHIA 4FBGA 2NADA 4WKGA 1PR3A 5C7LO 1CDOA 3DB2A 1DC4A 2QYTA 1YONA 2D1YA 3E03A 1R4MA 1H0KA 2Q50A 1R0LA 2DUUA 4FSHA 5TGDA 4YRAA 1G6KA 5T8KA 3U3XA 4MP6A 1HEUA 4Y9DA 1HYHA 3ZWOA 3JQEA 1JLLA 2R2GA 4J4TA 3SXPA 1NVMB 4JROA 4PLPA 5IG2A 1ZSNA 1E1LA 2WD7B 4L4RA 5F1KA 4DL9A 1DDOA 1MV8A 3OJLA 4YJFA 4MIEA 4RGBA 4INAA 1HDYA 1LRJA 4FPXA 3NTQA 4ZN6A 1QYXA 2FY8A 5A04A 1DSSG 3DBHB 3V8BA 3EW7A 2JCYA 1UP6A 1EK5A 2DTEA 3DFZA 4FFOA 1KYQA 4WK6A 3S55A 4PLWA 1DAOA 2X23A 1VKOA 4GH5A 4YJGB 5DBFA 2ZCUA 3ZW8A 1RWBA 4BNHA 2NUAA 3PYLA 1DFGA 2F00A 4LISA 1QYVA 3TNLA 1H9AA 2X0JA 1I24A 3GZ4A 1HDRA 1VC2A 2PGLA 3ZV4A 2GUGA 1H93A 4YCAA 2E6UX 4IS3A 3WJAA 2PZJA 4UVGA 4NZ9A 3DFUA 2UAGA 1H6CA 3WOHA 2J6IA 3GN2A 2YFQA 2EV9A 3B6ZA 3R0IA 4XQEA 1V9LA 1M6WA 3RUFA 4AJIA 4UEKA 4YRDA 1EDOA 2NU6A 1EQ2A 2QZ9A 3JYLA 4XKJA 4YT5A 1CEQA 4XYGA 4BUCA 3N74A 3MJEA 4URFA 1Q7BA 5K6AA 1LTHR 4CLXA 5IN5A 3CZMA 4MKXA 1U5CA 2VT3A 3BMNA 3IKVA 3PEFA 4D3DA 5C7OO 3OH8A 2D0IA 3GT0A 5EL0A 5HS6A 3ZWXA 4B8ZA 4DMLA 3G17A 4TWRA 4PLGA 1LBEA 4FR5A 1K6IA 2W2KB 4WJZA 2J3IA 3ZWBA 3QHAA 4IDEA 4RV9A 5FEUA 2GCGA 2Y0EA 3V2HA 4CL3A 1MGOA 4ZQBA 5DP1A 4GQAA 3TZCA 4IDDA 2VWGA 3KLPX 1CWUA 3BAZA 4E3ZA 4AJ4A 4KUHA 2P2SA 2HLPA 2X58A 3QVXA 2C7VA 2IEBA 1BWSA 4GLOA 1U3VA 3TPCA 4TSKA 5TIIA 5DCUA 4BKPA 2GASA 3G79A 3UF0A 1B8PA 2VUTA 5CDGA 2EG9A 3F4LA 1WLYA 5KJEA 4BB6A 3U4CA 3W1VA 3NUGA 4IGEA 3V2UA 4ITUA 4L73A 4J16A 5BSFA 4B7XA 5IZ4A 3JQFC 4CLRB 5A02A 4OXKA 3SC4A 5TQVA 3OA0A 1HDXA 4GMGA 1UR5A 4GX1A 4XR4A 5IF3A 4AJ2A 1DFHA 2ZTUA 4N54A 4J90A 1ENOA 1B15A 2BHLA 4Q3DA 3OIDA 4E32A 2WM3A 3NDJA 1OC4A 5A5EA 2HU2A 4L74A 4FFRA 3ZV5A 1IL0A 1P31A 3EY4A 5L53A 2POQX 4IDBA 4O59O 4OIMA 3T7CA 1KVTA 5JC8A 4IQ8A 2CSUA 4CMCA 3JD1A 3KETA 2Z95A 5JDCC 2ZQYA 3AK4A 3VZPA 4QT0A 2Q46A 2B83A 4BQPA 3H2SA 4TZKA 3E9MA 5U1PA 1PJCA 1XQ6A 2J5RA 2VTEA 3FF4A 4OGWA 1S6YA 3HE3A 1ZXLA 3JSAA 1GUZA 4W7IA 3EYWA 3NTRA 4K9DA 4FJ2A 3QWBA 3BMCB 2VUUA 1HE5A 5JAIA 4CM8B 1PJ3A 1H6DA 1U5AA 2AE2A 1P1KA 4NBVA 4ND5A 4DRYA 3FRJA 5BT9A 2X9GA 5ES3A 3WS7A 1D8AA 4CMIA 1YL6A 4E5YA 3WWYA 1ENZA 2BELA 3GAFA 2A4KA 4KWHA 2VZ9A 1DPGA 5BNFA 3DZKA 2HRZA 1JN0A 5JAMA 3MJTA 1WNTA 3VH2A 3VPFA 5ER9A 4A73A 4GSLA 1T2AA 1OAAA 3QV1A 4HFJA 2BH9A 3DDNA 4CQLB 3KVOA 3PWKA 1YQXA 4I5DA 4JNKA 1MX3A 4FQ8A 4IJKA 1YE3A 2AE1A 4RVUA 3D0OA 4KDEA 2Q2VA 4R5MA 3UICA 1NQ5A 1YWGO 2EHDA 4YDRA 1J49A 1PJBA 1LSUA 4B4WA 1UAGA 3BIOA 4HFNA 2X5KO 1QV7A 5JSFA 4R3WA 1YBMA 1JTVA 5G0WA 4E2ZA 3ZWPA 1DEHA 2A9FA 4B7CA 1B7GO 2FPPA 3D3WA 3R3SA 2B4QA 4JK3A 3AWDA 3Q2IA 1KETA 4EGFA 1X13A 2O7QA 4FC6A 4IIVA 3TL3A 2BFPA 2NACA 3W8DA 3IAHA 1DIAA 3QWFA 1GAEO 1R4NA 2CMDA 1DRWA 1U2DA 3D5TA 3TF5A 5COAA 3JQ9A 1B14A 3CH6A 4RLSA 3L07A 1SO8A 4A2CA 4E5NA 4QXMA 4HBGA 1PGOA 1Q0QA 3KZVA 4WLVA 1A4IA 3CXRA 5BSGA 3EVNA 4MO2A 3GHYA 3RC9A 1ZK2A 3DTTA 2FSSA 3M1LA 4NK5A 4PLYA 3DBRA 4IDAA 2P4HX 1IZ9A 4J6FA 3OEYA 1J0XO 2PTGA 5CEJA 1OFGA 1PQPA 1DRVA 3C7CB 1EFLA 2C0CA 1ZZEA 2XF8A 2VUSA 3INRA 3PVZA 1C1DA 2HK8A 2YUTA 1T2DA 4RORA 3ENNA 3KYDA 4DWVA 3AOEC 2W4QA 1K2WA 1F17A 4BNUA 3MOGA 4E5MA 1I3LA 4RJTA 4YVFA 1EBUA 5IAAA 1ZJYA 3BYZA 3B20A 4FFNA 3H4VA 1SCUA 1B8UA 3IP1A 4NJMA 1ISFA 4HX5A 4P22A 4RF3A 1I32A 4BL5A 4DLLA 3H3FA 3I6QA 4YAJA 1F12A 1Q1NA 3ZWAA 4Z3KA 5DULA 3H7AA 1QG6A 3RKUA 1HDCA 2UYYA 5TJ9A 3JD3A 3K5PA 4CV3A 4IY1A 4AJNA 3GMDA 2GRAA 4J9VA 4DQXA 2X9VA 4EW6A 3WGHA 1XWFA 2RH4A 3KEQA 3RQSA 3F4BA 4GAEA 4RF5A 4L9RA 2HMTA 4HY3A 4XGIA 4AJHA 3WX0A 2AA3A 2O7SA 2Q3EA 1PS9A 1GQ2A 4EEXA 2G82A 4U0JA 3MTJA 2YHIA 4OQZA 2XXBA 1PIWA 4XYMA 4IM7A 3O4RA 3VVCA 3ZNQA 3BMOA 1NFQA 1KVRA 4KUGA 3AY3A 1BXGA 1NASA 1AGNA 2EGHA 2BI8A 4XDZA 2O4UX 3RUCA 4EUFA 5KVVA 1YOVA 3GEGA 3MZ0A 4WLNA 3AFMA 3C85A 5ILGA 4R16A 3E6AA 1V6AA 3WICA 1YO6A 1LSOA 3PIIA 3Q9NA 1I2BA 2I3AA 5L4NA 3JQAB 1RPNA 1EVJA 4CMKA 4ZU3A 3K30A 4YBZA 2FSVA 4TZTA 3OHSX 3OQBA 3ZCXA 1HSZA 3QVSA 4OKNA 5A5FA 2ZTMA 2PGJA 5THKA 5AVOA 4ILKA 3AI2A 4R1UA 3OJOA 5G4LA 3HJAA 4NBRA 5JAQA 2C7GA 1PWZA 2JAHA 3EMKA 1NQAO 3TDKA 3ULKA 3STHA 3WJ7A 1VJTA 1SOVA 4JBGA 1I30A 3ITKA 5G0UA 3DR3A 3TSCA 3DTYA 4UEJA 1YDEA 3GPIA 1WZIA 4IPTA 1TEHA 2H1SA 3HZZA 2V6MA 1SEVA 2OP1A 2HDHA 5FFFA 3G49A 1SC6A 4RF4A 3WLFA 4BMNA 2I76A 4NG5A 2EF1A 4G81A 4YT4A 1ENYA 3LLVA 3PHLA 4TQGA 4FDAA 2WE8A 1PQWA 1C1XB 3DOCA 4YACA 5AOVA 1NFFA 3IL2A 3JQBA 4WOKA 5TJHA 4PG6A 4MP3A 3GUCA 4E13A 4BNIA 1M67A 4PVDA 4ZQHA 3GG2A 2PKRA 5AQ1A 1P9LA 3ZWNA 1E3LA 1X1TA 3PIDA 4BQRA 5BR7A 3NJ8A 2EXXA 4P38A 3E9QA 4CLEA 1C0LA 1WMAA 3Q9UA 4LVUA 5ADHA 2YFHA 1N92A 1ZXBA 3AU8A 2DPGA 1D1SA 3FHLA 2IEDA 1P1RA 3QP9A 4BO1A 3GDOA 4UUMA 3BXXA 1KBZA 2HRBA 4XZ3A 7MDHA 3OETA 1GR0A 2GF2A 4E21A 3UW3A 1EQUA 1Y7TA 4YPOA 2G0TA 3C1OA 4R01A 1HLPA 3DEYX 3HSKA 3GAZA 2ZB8A 3WYCA 1GEGA 1UXJA 4CMGA 1XLTA 5KJ6A 2J8ZA 4N5LA 2UV8A 2PZLA
chains in the Genus database with same CATH superfamily
1BXRB 4ZGGA 2FR8A 2FEWB 2J08A 3O8RA 3N2NA 3P9KA 4US2R 4K6FA 5SV2A 4EPTA 3KS9A 2PFSA 2QRUA 3QFRA 2DQYA 3VKWA 4D44A 2QMEA 1BDBA 1DJQA 1FFCA 2WYWA 4OD0A 4W4TA 4XGRA 2QUIA 5ALFA 1E9RA 5G02A 5TE9A 3L7CA 3RJ5A 3H0KA 1NV9A 3HUTA 5LC1A 4CM6A 4KQEA 3E3OA 2JJQA 1LQUA 2FRDC 1C14A 2PJUA 4NOJA 4NDNE 4QELA 3QX8A 1GPKA 2WKWA 2AW3A 5EJ6A 1RJ9A 2BKEA 1R16A 1X7XA 4HQOA 3JWHA 4IJUA 4I55B 4Y0NA 1Y5IA 3UVEA 4W6ZA 1PFQA 1GRNA 2PN1A 3AKCA 3WGIA 1XEWX 5HKOA 3VPSA 5E6UB 5I3CA 5F3WB 3NORA 3F3SA 4LEIA 5CJJA 1TLTA 2GNPA 1EZ4A 2YIMA 4TQUS 4A8TA 1ZK1A 3SFVA 2CV1A 4KSBA 4BMOB 2BUCA 1KY5A 1T1JA 1GEEA 3ZU4A 3FSJX 2VWHA 2ZUBA 4BZXA 5F51A 1R10A 3O6VA 3PEYA 3M0EA 4E5KA 2J0UB 4DA0A 2PKCA 3F2IA 1HF3A 2WY2D 2FMXA 4BKRA 1WUIS 1Z4QA 2ZDGA 2ZI4A 1WXGA 4U00A 1N3YA 4IZHA 5KYYA 1J1UA 4F56A 2LRHA 2OBLA 2C5GA 1JHUA 1R50A 2V0NA 3E4CA 3ELYA 1PEAA 1E9BA 5DBIA 3T1OA 1TXGA 3CVVA 3NNSA 3ZBQA 5TPZA 3QPBA 5J2UB 3WLAA 3PWTA 4NYIQ 2PE5A 3ONNA 4ZVPA 2I99A 4YDHB 1XLUA 1OFUA 4PLTA 1CQJB 2HGSA 5E9JA 2YHAA 3HC7A 2CW5A 2H16A 1EGAA 4QWWA 1FDOA 3IIMA 4TLLB 5B1IA 3WL5A 4HX2A 4C0XA 2IPXA 1NTOA 1ZCZA 5K8UA 5JMOA 4BMZA 2WG2A 3ZU2A 3S6JA 3VKHA 3UMBA 5TQJA 3QEJA 2QLTA 4YWJA 1QH8A 1GL6A 4ZICA 1ML3A 2IDMA 4NEGA 5DYWA 2GAFA 4Q6BA 3G2MA 3WI7A 2P90A 3ZWVA 4KQGA 4F7DA 3GPBA 4UHFA 4DIDA 2UYQA 1R8YA 3K8QA 3JWJA 1G4UR 4LBZA 3MWGA 4OQLA 4Q1DA 2JGAA 1WUYA 4UNNA 4BVBA 4DJ5X 1H2YA 3EA4A 5CEFA 2PQ6A 2GHRA 4MVJE 2QD5A 4JMLA 2PGNA 1AKVA 1M2OB 3IUPA 2GJSA 4DPMA 5JEEA 3UJHA 2ZSJA 4BEJA 5BUZA 3WFIA 4DDKA 3L1VA 4DEXA 3WBBA 1SA0A 4R3UC 2BF7A 5FA6A 1VI5A 1Q0LA 2QL5A 4M98A 3FNHA 4TYPA 4K0KB 1DMSA 1D0IA 1LBIA 1YL5A 3NHSA 4X1IB 1W4RA 3HRHA 3G0DA 1MQ8B 4MITA 2I54A 3AEUB 1QR6A 3H2YA 4PGFA 3DZJA 1UKBA 4LWQA 4DG5A 4UATA 4PYJA 5B7QA 1V2HE 5HXAA 4CGZA 1E7QA 2JZCA 1MC8A 2FEOA 4I9FA 1IVSA 2IKQA 4C3VA 5FTKA 1U2RA 3DHVA 1Z82A 1WCWA 3PUYA 2PMWB 3EG9A 2PGDA 4ASUA 3K0CA 5ICCA 3KPJA 4LNAA 5CNIA 4II3A 1MAAA 3D7LA 1G7RA 1SQFA 3CR3C 3IAXA 4WNAB 1EX1A 2I4LA 4KQCA 2QTLA 4S1WA 4UHBA 3QPAA 5CURA 4D4HA 1Z45A 3SZGA 1P9RA 3AY0A 4CIWA 4HB2A 3LC1O 3U7QB 1T6ZA 1S8OA 3L0CA 2D7CA 2HHJA 1WP9A 4R0VA 3M3DA 3ABRB 2I71A 4B6OA 2QTZA 1L8OA 4QHSA 4BHTA 1ZS9A 2RAFA 3ZHRA 2WD7A 1L5QA 1S5PA 1FP4A 1YE8A 2YY6A 3BGDA 2FE1A 4R6WA 4DXHA 3CV3A 4FU0A 3T5GA 2JIMA 4CG2A 2A9PA 1L5NA 2VA9A 2W98A 3NFRA 4Q3EA 1OQAA 1Z39A 4N3GA 3D6VA 4BQNA 2Y4NA 2VJNA 4UJ3A 4XFKA 2H17A 1X0XA 3DM9B 3PLRA 3R75A 3ZHYA 5BT8A 1QE0A 2K2WA 2OR3A 3VPBA 2AKAB 5ISMA 4DV7B 1QHFA 1N78A 4L8LA 5L45A 2UZ4A 2AX4A 2JFUA 1HEYA 1S4QA 2GK7A 4JYCA 2WWWA 1X9IA 2Y67A 1NVKA 1B3BA 1OPRA 2DBVO 3HCPA 4WT7A 3VZDA 2GD1O 4ES6A 1LDGA 1MVLA 2O7VA 3FLEA 3ZHTA 2OQRA 4TMTA 5CT5A 3PFBA 3LI2A 3VR0A 3NGLA 3TRJA 2QENA 2ZRLA 3FTFA 4XD7D 1ZN8A 1QIMA 1YZNA 3FA2A 3IEMA 2FU5C 5HGJA 5A9TA 1KL7A 4GX2A 1MOZA 5JJCA 4XRGA 1E7MA 1ZPDA 1JX6A 3DV2A 2R8RA 5HEKA 3LL4A 3MIIA 1OU4A 1NC3A 3BCRA 2XA1A 3Q6IA 4FYYA 4C05A 4TKMA 2QN9A 3WYAA 4FMCF 3DC2A 5TQ0A 4FK8A 2H1WA 1CZRA 2Y1DA 4CE6A 3FCAA 4RYLA 4K3UA 4FZJA 3AGQA 3SQMA 1NJ8A 4D4JA 1K88A 1X1CA 4NMMA 3K0FA 1W0JD 1NOJA 3QX3A 2ZJ3A 2EAUA 2VJDA 1CDDA 1PP4A 2XTZA 5IUKC 2PSDA 1CDZA 1MA0A 2OXFA 3BTOA 1E2HA 3N2KA 3OU6A 3QMPA 1QDLB 1TVKB 3NOQA 3TLMA 4F97A 3P9NA 4L4XA 3QMMA 2BGUA 1BVUA 1DVRA 1KAEA 4OXQA 2LDXA 4JL8A 2WTXA 3QPVA 1K8XB 5LFAA 2K7FA 1FUEA 2PZAA 4YMVA 4KE8A 4LF7B 5CFPA 4S0ZA 4K6CA 1SKBA 2V7PA 1GGMA 1S8NA 2Y0BA 3IEXA 2CHVA 3ZE7A 4DW8A 1BA3A 2IITA 1E92A 3PSHA 2HCTA 4RTJA 3IO3A 2AFHE 4C0JA 5JJBA 1RYBA 4OHUA 3NWOA 1E7YA 2WKQA 4KO4S 4P98A 3RIGA 5CG2A 4Q7QA 2Q1XA 3EVTA 1JFSA 3I8XA 4O1HA 2ZGVA 3BT7A 3HKDB 3C5WP 5DI3A 1TIPA 1WD7A 3WBKA 3OF3A 3ITDA 3DMRA 4O3MA 1VGQA 3MWLA 2V1XA 3GCDA 1ZLXA 1DQYA 4ND1A 2JEOA 2HLDA 4PO9A 3OQJA 1OA0A 4KE9A 3U6BA 2J9RA 4G5GA 4JC4A 4NX2A 5FWYB 1WHSB 1U9ZA 1NQTA 1RXYA 4EI9A 4HX9A 3PGMA 5AXCA 3ZCQA 1HQKA 1L6RA 5K05A 1ZGBA 4KKXB 4DWWA 1Z5UA 2DEUA 1JALA 1GAQA 3G1WA 2DFVA 3HDHA 2WW8A 1M34A 4IQGA 3EX7C 1DAHA 2PD3A 4I9UA 5J9FA 1T9GR 1ANKA 4J43A 1GFZA 5KKNB 2GH1A 2QXUA 1AHNA 3HLKA 5JD4A 3NPAA 4OHRA 2Y2UA 2VTKA 2YWFA 4DR7B 2Y93A 1G16A 1JKXA 3NX4A 4YJ2F 3EY9A 3R7WB 4J0FA 4J0IA 4BMXA 3P5SA 2UZ3A 5ALTA 5JJ5A 1UMBB 3FI9A 3OE7A 4GD3Q 1JTFA 4QUEA 2R8PA 4AZSA 4QLBA 821PA 4B3RB 3L46A 4K81B 1HYBA 2WVHA 4BO4A 4EI2A 5ALVA 1I3KA 1ORRA 2AMFA 3JPYA 4EY3A 4LRTB 2JNWA 4JB3A 1N0IA 1YI0A 2X8JA 3QU2A 5FWDA 3RV4A 3HYLA 2VZ0A 1P4HA 2AQHA 2QJTA 4PYKA 4DY6A 2X41A 3CUUA 2PSJA 2QTGA 3OJXA 3WL3A 3ACBA 1FLVA 1ZP6A 4CQMD 3ZDDA 4M9UA 1YFZA 4FKMA 4PLHA 4PPGA 5FOVA 5KZMB 2R7MA 5AICA 1HDOA 1EA5A 1RZ3A 3EFHA 1V96A 4LRYA 2HT6A 4G56A 3HCOA 2CJPA 3AM5A 3I9FA 3PWZA 4MO9A 2DFDA 3ER9A 4L2IA 1G20B 1OZHA 3JV7A 1GJRA 1USWA 3ZTYA 1U2TA 5A2QA 2P9ZA 1DTWB 3NEPX 1AGPA 4ZOQI 2C2OA 1DBVO 2FRDA 3NHPA 1I1HA 3Q8LA 3SEZA 4CBVA 1JLLB 4FUQA 3PPVA 3FHJA 4JY7A 4MAMA 4OBBA 4FMDB 2AOUB 3G8YA 2YJ4A 2YWBA 1W88B 4MMZB 4ITVA 1ZGJA 1V1JA 4P5DA 1HDEA 3B52X 1WCXA 1RWWA 2FW9A 1A5ZA 1GZUA 3AC0A 4F3YA 4FFDA 3TZ6A 1VXOA 3E5RA 1UC8A 2FN3A 1KMMA 3KIPA 3GWGA 3W6NA 5A03A 3UGJA 4BFYA 1T2VA 5EKSA 5IXJA 4NAVA 3RFXA 2Q6IA 1FP7A 2IP4A 2LE0A 4QPZA 1N1GA 2AYXA 3I9V1 1QTQA 4I9GA 4NCNA 3T7SA 1Z88A 2ACEA 2JJ2A 3ZWWA 1NQOA 3D8UA 1A2BA 1T2NA 4JP1A 1AB6A 1YTUA 1PG2A 3W6ZA 4MKZA 3TR6A 3EIOA 4RVHA 3B36A 2VYFA 1BZYA 1GITA 2PSHA 2HFJA 2V7WA 4UTXA 2ZB2A 1CRQA 4C6RA 2XYVA 3TSWA 1RAAA 4TWIA 3UWPA 1KSGA 2ZIFA 3FR7A 4QX6A 4JYAB 3CLUD 4J7CA 3BIXA 4BKQA 2QVLA 2SHKA 4R81A 2F43A 3JATB 1RXVA 2RGGA 1FS5A 2XCTB 1I7NA 4YRZA 4L72A 3QE9Y 2O2DA 1XZMA 2ECQA 4IWYA 4XX0A 5TB5A 1CRZA 3OFVA 4G0YA 4OBWA 1KTVA 1QM5A 1IULA 2PUCA 1JQ5A 3G0IA 1Z4JA 2PZBA 5LOVF 2O3TA 1XC7A 2Q21A 2ZBPA 3WMXA 3L8MA 3IV9A 3TD6A 1G17A 1G21B 3TOCA 3VDNB 3ZJ5A 4EUHA 2XJ4A 5AVWA 2DVMA 1XD2A 3HEBA 1LDNA 3UYLA 2VQ3A 1CUZA 1GTJ1 2V59A 4LRQA 5ALKA 3NBXX 3VNVA 1IXKA 1ZJ5A 2B3TA 2RHTA 1R74A 4Q02A 4UAGA 5HF9A 1OF1A 4B7ZA 1T1GA 4QGHA 5KWIA 1E5DA 3UUWA 2BLNA 2HW8A 2WIGA 1A0OA 4RF2A 5K0NA 4FYMA 4BNGA 2VRCD 4PZUA 2XA2A 3OA2A 4LGCA 1OLSA 5D87A 2HO5A 3QG5A 4LI3X 2H31A 1TJYA 5B2ZA 3TSAA 2HMAA 2WC1A 4P5PA 3PK0A 4RQTA 3DZBA 3COZA 4KDFA 4KBGA 1RHQA 1UOOA 4M36A 4R9RA 1I9CA 4ABYA 4KYVA 2H1OA 1LVHA 1J42A 3DOHA 1F9AA 1CR1A 3VR4A 1U63A 2QX9A 2WIKA 1O3YA 4J2HA 5IUJC 2YV5A 1H5NA 4GE3A 4JC0A 4RPGA 3SN6A 4G5SA 4LCEA 1L7VC 3RS5A 3GFTA 4A5OA 4LF4B 1BRMA 4H1TA 3HXMA 5HA5A 1UDRA 4MUEA 2R86A 5AW8A 4L9WA 4MV1A 4PS0A 5BVGA 4KW7A 4WDQA 1CQWA 2BFFB 2E4YA 4US1R 1G5FA 4NE2A 2BSAA 3OKFA 2XCQA 5IH3A 4C30A 1RACA 1TUEA 3I39X 3ZJTA 1ZI9A 1JLKA 4IVPA 4PFKA 1X87A 3IQDB 3CRMA 5ICSA 1IHXA 4QYXA 4BYGA 1RLUA 1YK0A 2HLHA 3O8DA 4G8DA 3SNKA 4BIMA 5AW2A 3IPRA 1J5PA 1XTIA 3F8SA 3RANA 1OR8A 4LS3A 4PR0A 5DNCA 2X8LA 4JH0A 3I5XA 1ZVQA 4KLNA 3P52A 3AHCA 3JALB 5EZ6B 1P2UA 3CSSA 3TG8A 4N5IX 3C3XA 3JYOA 1HYQA 1BDMA 3LNTA 1YVPA 1VMEA 2J41A 1QIEA 5IDVA 2HEGA 2HBYA 2G9RA 1CT9A 1ZY2A 3EXFA 4PANA 3GQBA 4KXLA 4RPIA 4FNOA 4JLPA 4E15A 2I7VA 1QMPA 2QIOA 2RCNA 3LUJA 1ADGA 2D0OB 2XMRA 3KUCA 1QHGA 3QYPA 4GOXA 5A9SA 5HM6A 5CD1A 5JYDA 3SC2A 3MHTA 3VMMA 1DX9A 2J3LA 1NW4A 5ITSA 4R3NA 3KQOA 1AV6A 4I0WB 5U4QA 5IM4A 1BKSB 5DVZA 1YVUA 3SJUA 3L8YA 3ZVRA 4DWJA 1L1RA 1DCFA 4P4TA 1LTQA 3L4JA 1XWIA 2VDPB 3IRUA 5JHHB 1IIBA 5T6MA 9MHTA 1TA0A 2P35A 3B78A 1Q12A 2OV8A 3S8YA 1SQGA 2H0QA 3TW0A 4QYIA 2MINA 1AS3A 5I7EA 1DQPA 1EFVA 1M7BA 3ORHA 2VHCA 4H3KB 4G1EB 3FHCB 2ZSEA 4JC8A 4QGGA 4N0DA 1P17A 2HM7A 4FMPA 2FK7A 5A4KA 3BZWA 3MJRA 3WJ1A 2HOQA 2FUG1 5G4KB 2PZMA 2NWQA 5ITVA 1JHQA 1ZI6A 2C9MA 2WPDD 2CUTA 4DAOA 1YQWA 3JPWA 3LCVB 3KJIA 4BX9A 2H2IA 1WKCA 1COWA 3HHEA 2REBA 3W5BA 3UGTA 3HN6A 1Q3HA 2HK9A 2PFKA 2Y1FA 2QYHA 3AL2A 1DGQA 2ZWOA 1CNEA 1DC6A 1LWOA 1RKBA 3L82B 1EUDB 4IGKA 3REQA 3S5UA 1P19A 2NPIA 4HF7A 2QA5A 3DFMA 3M6WA 1QK5A 3C6QA 3ENKA 4KJXA 4WACA 1IEXA 1CP3A 2ENWA 3SZUA 2OPHA 1O57A 4D0GA 2FUNB 2G70A 4C4TA 4JP3A 2UYCA 3WGMA 4DVJA 3EF3A 5KTYA 4JXKA 1GU7A 2UVQA 4LZLA 5JVDB 4BFXA 2VWQA 2X4DA 5A5VA 2Z9DA 3KRTA 1NVVQ 5DYIA 2RCYA 1M8JA 3MINA 4LCJA 4B9EA 1S2MA 1DV1A 3CVJA 4V2UA 1FX0A 5B6JA 3DWIA 3JS5A 5EZYB 1VRWA 1ZOLA 2BPOA 1L0BA 3GJ8A 2R8ZA 3F90A 3BGIA 1JYFA 5IBRA 1H6BA 1DAMA 2BFWA 1DXYA 3GT3A 5HTOA 3FN4A 1D2HA 1KZ6A 3BXGA 3I9NA 2XXJA 3QYJA 1L1FA 3RVOA 5P8WA 3HI4A 2WHRA 2PUTA 3W3AD 4BPBA 5HMMA 3HV0A 4W1QA 4YV7A 4BLSA 1KI9A 3M4NA 3IOCA 4Q00A 2B1RA 3ITEA 3VR2D 1XMQB 2HU5A 3HB0A 3ZC3A 1CY8A 1M7HA 1LK0A 2CHFA 2N9UA 2VHEA 1NIJA 2EW2A 4FYKA 1V6CA 3VU3A 4JI7B 4B3GA 3II6X 5L95A 2PWYA 2RC5A 3HWX1 4A2PA 3KSRA 3R7BA 3W8FA 3PICA 5GIPE 1DHRA 1BJKA 1TMOA 2OHGA 2A0KA 3PTZA 4NLLA 4YP5A 3EIXA 3TE6A 4AW9A 1Q83A 4DLZA 3JZIA 1GG9A 2C5FA 5ALNA 2N47A 1WVMA 2OLJA 1T8PA 2UXBB 1IY1A 3UOAB 3PHBE 5F77A 1EWQA 4PCLA 3LUDA 2GA9A 4Q0MA 5M34A 3O93A 1FUUA 1M1YE 3GK3A 3VM6A 1TKRA 3TMKA 1M1NA 3L0YA 4X6LA 2RJ3A 4EVRA 5BUSA 1XPJA 2VDRB 2EFCB 1O97C 4O2AB 1O94C 1MJ5A 1GG8A 1YTLA 4IUDS 5EP2A 2X4GA 3WRXA 4YV2A 5C8DA 3H9QA 3SX2A 4BVAA 2Q3LA 3IR7A 3W3AH 4ECEA 3PDIB 3ZVKA 4ZT3A 1OWPA 2YHBA 1QIGA 2B92A 5CBKA 3EISA 2ADFA 2PL1A 3TX6A 5IH7A 2X9QA 1N3IA 3KYDB 1GCAA 2RSLA 1PCXA 1RM3A 1THMA 2Z9CA 3L04A 3EXIB 2JLQA 2ETVA 4DCJA 3GLIB 1A7UA 4F84A 2Y1CA 1MZVA 3BZUA 3C5CA 4EATA 3DCYA 4ZQFA 3DOIA 2A67A 1WXEA 3Q12A 2IH2A 2O48X 3ADOA 3UAVA 1BH6A 2CEKA 1Q77A 1SCUB 4LOIA 3PA6A 4JLKA 2RGRA 1E3MA 1VMIA 4FE4A 3GFGA 4O0LA 4R8SA 3DDSA 5T8KC 1VPLA 3OM1A 2FTKE 5JARA 1GKIA 5FWAA 4DIFA 2C3MA 3LOUA 1VIYA 2P0EA 4UNRA 4MYDA 4LFCB 4L15A 4AMVA 1KE2A 5LYJA 3RRFA 3NBUA 4IF4A 4LSMA 1U7XA 1JFTA 1A9PA 4MWBA 1YUBA 2EP8A 3ZBTA 2PD4A 4J0CA 2RE8A 1VYHA 4NCAA 1Y3DE 1GV0A 2RH5A 3P7MA 4B09A 1KOFA 1EM8B 4FB5A 1ZOPA 2FMHA 4JVSB 4P3KA 3Q8MA 2X9NA 4WGFA 4JXXA 1VLVA 4PYMA 1CUXA 1ZC3A 4Y1RB 3TKAA 3WWZA 5REQB 5HKKD 1L4YA 2I5PO 2C96A 1VRCA 3SVZA 2QX6A 3TB6A 2CVHA 3DFKA 3LXRA 1XYYA 2H1FA 1F5SA 1GYQA 2OD2A 4HNHA 5D00A 5T3UA 3SG0A 1MRNA 1Z12A 4B40A 3ZGOA 4HRVA 3S44A 2YXEA 1JLRA 1JHRA 4G0MA 2DBQA 3I9LA 4HNSA 2VRBA 1W8DA 3THSA 4Q9IA 2C82A 3CJRA 4KQMA 2JLSA 3DE6X 1MJNA 4F3NA 1R8SA 8GPBA 2OO3A 4GXNA 2AF4C 4HXFB 2QNRA 1MA3A 1HI9A 4WA8A 1HETA 4UTZA 4TVOA 1K0UA 4EDFA 1D2RA 1TDJA 2FFHA 2AK2A 1RKQA 3G6WA 3LQYA 1J0DA 2F1KA 4TMXA 1D2CA 1SEPA 1G5HA 2MYNA 3UOWA 3W9BA 1IAQA 3K7EA 3C74A 3NQ41 1SD2A 1HRKA 4KACA 1UXGA 1DMRA 1YMUA 4TLBA 5KVCA 2PG3A 3G02A 1HE2A 4AKTA 5BMVA 2QRKA 1T4CB 5EVCA 1AMNA 1QO0A 2KMLA 3BZBA 2Q8PA 3JASB 3U6KA 3ETDA 2XW6A 1RBZA 2VIIA 1M2HA 2QR3A 4I3FA 2IWHA 2J7KA 5JDCA 1I94B 1EBBA 2ZJ6A 1N9KA 1ORWA 1SKUA 4Y2HA 1ZMRA 4K9NA 4YAKA 4KR9A 2OUKA 5HILA 1FPQA 3FRHA 1NI5A 1CC1S 1FW8A 5ALGA 3MTQA 2DFPA 3RSFA 3TNDA 1P80A 1YC2A 1UANA 2AFIB 2NO0A 3CMCO 4FHCA 4LF6B 1U0TA 5JAZA 4WLUA 3UFXB 2IJGX 3K1ZA 2GARA 1QG4A 3Q3HA 2NO4A 4LYFA 5EIBC 1S7CA 3DAOA 2FKAA 5BRAA 5EG5A 2QM7A 1NBIA 3CONA 2WABA 3OM0A 2WNSA 4WECA 3UHPA 3UV7A 4Y9TA 2LXNA 2EQBA 3IVCA 5ED4A 1KEUA 2JLRA 3LUPA 1DEOA 2VXYA 1SXIA 3OKCA 4LQLA 2OQVA 5I6DA 1D0SA 2Z08A 4O4IB 5F2KA 3H0EA 1PUIA 3IT2A 4F5WA 2UZ1B 1BQ4A 4QQRA 1TQ4A 2XB4A 4QO7A 2BONA 1HNNA 4L8VA 1KQ3A 2AOVA 3CF0A 2P4EA 4WLOA 2H7VA 1U7WA 1PZFA 4XX1A 4WKCA 5HNKA 1SGWA 1A2QA 2Z3ZA 1L7XA 5LU8A 2JH9A 2C20A 1A98A 2J30A 2YTZA 4YI3A 3EQ9A 3FWPA 2SCUA 3GLKA 4WOPA 5LQUA 2GKGA 2F64A 2EJWA 3LPAA 3M4JA 4DNXA 4DSUA 4RAOA 5FUBA 1JEYA 1N32B 5BN1A 4OU4A 2VDWB 2OC9A 4EKGA 3BWVA 1SBZA 4GC5A 3TGWA 4W5WA 2BJVA 3OZIA 2GN6A 5LVAA 1GXSA 1NAHA 2IYOA 2QX7A 1KDTA 2PQ0A 2ZVJA 3MT9A 4MOWA 2HO4A 3LUKA 4MQ4A 1ZN9A 1DJNA 2H0AA 1POXA 3H86A 3C3WA 5B3JA 3ONEA 1Y4AE 5DWDA 4WZBE 3ZHOA 1JI3A 4ER6A 1DBSA 4ZKDA 4GMFA 1L7DA 4L76A 3U62A 2SKEA 1KMHB 3CCCA 5IAJA 1UDAA 2R84A 1RBQA 5EUBA 3I6MA 3DEKA 1GUYA 4GPD1 1VLHA 3U44A 2CT8A 4Z5XA 4EZBA 1SVOA 2L18A 2ZE5A 1DU4A 4ACBA 3LYHA 3IPCA 3OMWA 1OGYA 1NJ2A 2HRQA 1HFKA 3QKIA 3BMQA 3O4HA 1ZOOA 5LDDC 1H23A 4MRAA 4EX6A 1X7ZA 2BN4A 3P0EA 2IYFA 2WF7A 2G4CA 3G8AA 1XHEA 1AX9A 3BHMA 2HYIC 3TIXB 2ONJA 3MCUA 4QUBA 1QOQB 1T1EA 3K31A 5LLDA 2H8KA 1RWPA 3CO5A 1BCSA 1W52X 4C7JA 2ONKA 4IGFA 4P58A 4LVCA 1Q20A 4AG3A 5FUMA 1MFZA 3VDMA 4EMTA 5A4MS 3LSTA 1I8TA 2C1XA 2WU1A 3AR5A 3BB1A 1W5EA 1ZAYA 1IOVA 1HDIA 3EGDB 4ZZ2A 3TBFA 1LNZA 4UUNA 2GLUA 3WE7A 1A5TA 1YR9A 5LP6A 3ZWMA 4RLHA 1RYMA 4KWIA 3EC1A 4OHVA 1XL1A 4CHTA 3GEMA 2NYAA 1Y5NA 4O2LA 1U8FO 2DPYA 1U1GA 2O2SA 1PKEA 3VGJA 1RYHA 2OSVA 2Z9BA 3RBXA 4YALA 4L4SA 2GR9A 1FMFA 3AETB 1DOZA 5HCNA 3RLFA 1D0VA 3PVSA 2P3OA 5CA0A 3OQHA 4AMGA 3CWQA 4ZWNA 5CR9A 2B34A 1SVKA 4NQZA 1X39A 2W7TA 1EMDA 4UTVA 3OQPA 5FAKA 3IHTA 4MHOA 5HUQA 5BVHB 2ZAIA 1RQXA 4JI3B 3H18A 3JRWA 4L07A 1QK3A 3CA8A 4YRKA 1HOXA 1YVRA 4BJ5A 1P81A 4KNWA 1ZNXA 3HJFA 2J9XB 1DADA 1IYZA 3MJHA 1L5YA 3FM9A 3EHDA 2PD6A 4AO8A 1K4YA 2IK8A 3U3JA 3NVAA 3KQNA 2G4LA 1Z29A 2Q0QA 3I42A 3LRXA 4HRAA 4ZPXA 2DPMA 4LFAB 2GCPA 1JR3E 3NP9A 4H1UA 1A8QA 4Y6RA 1LV8A 1BW9A 5G2OA 3AB7A 5KPJA 3A6GA 1L5HB 2CGEA 3LFUA 2G28A 1GCGA 1P5HA 3IOYA 3SZMA 3RS8A 3EN0A 4FZ5A 5JLJA 2HA4A 2RDMA 4YRCA 1JG7A 1UH5A 5EXTA 3MJDA 3AP1A 4PYQA 4NXNB 5EJIA 3COSA 5F73A 3JQ8B 3QX9A 1Z0JA 5JU6A 1G8KA 3K1TA 4E22A 2TMKA 3ZD8A 3J7AC 1U3WA 1E3WA 2ORED 3ANNA 1NJGA 3I9JA 4NV0A 4B84A 1XXHA 3E3NA 4IH9A 1ECBA 1E7WA 4AS2A 3HXOA 1MAHA 3VBEA 3DLCA 1MH1A 3T0IA 4MJXA 2CY0A 3ZCTA 5JMPA 2OBYA 4OJQA 4YMIA 3O95A 5SY4A 1Y6GA 3EXG2 3P9IA 4LPSA 1PNOA 4MVJM 2HJRA 3FYSA 3TLYA 5CVCA 1DCKA 2E48A 4Z8XA 3ZK8A 1BO6A 3IMGA 1EK6A 1IK6A 3OKPA 2GXAA 3G88A 2XZLA 4OVKA 5LQCA 1CE8B 2REQA 3O2QB 2OAP1 4RPLA 2OYCA 3A6PC 4MS1A 4HH4A 3ZDAA 1EGVB 2M98A 4U63A 2F1IA 3TE7A 1T2CA 3U31A 3BCHA 1DIRA 2RGEA 4G9GA 1UZNA 3O8QA 4REOA 1JHDA 2XQVA 2PUEA 4HGPA 5ALHA 4EG4A 3QW2A 2W58A 1BAPA 2EBFX 3FGNA 1E5TA 3R3UA 4MHTA 3IJPA 4DA4A 2C8LA 2JAWA 4QOJA 1QANA 2WA2A 2WZDA 3FPJA 1V4NA 3HUDA 4D97A 1GNSA 1QAOA 4MWSA 4V0RA 2W6JD 3T3GA 4KXWA 4BNYA 5KWJA 2JI4A 4YNBA 3H83A 4BNMA 1J8FA 1ISSA 1OH7A 4HDMA 4RJJA 4HNGA 3TLXA 3AHFA 3EFOB 2XOEA 1SBNE 3MB5A 5JNUA 3QA3E 1NOKA 1VJ0A 5FPKA 1RFLA 3LCRA 4UPDA 5AI5A 5ELMA 4WBNB 4IIFA 4R2XA 5CB4B 4HLDA 2BFDB 3D2AA 3FVVA 1OIXA 1P6UA 2JW5A 4LC1A 4O6VA 2PYDA 1XRMA 3OEHD 4HXYA 3T52A 1CZKA 3OCCA 1NMXA 4QLAA 5LDHA 4RSGA 1PAUA 1RYEA 2WSSD 1LFDB 2ZRCA 4FSDA 4PFJA 2FWNA 4ZODA 3I9MA 1QE3A 3A10A 5FF9A 3VKFA 4AB1A 2X8WA 2XDYA 5K20A 1F6BA 3V8QA 4GXRA 3KEFA 2EIHA 2XWJI 2ZYTX 5CA1A 4NH0A 4P0QB 1QTIA 4FNGA 3T7TA 3KPYA 1F4VA 1YJXA 3NHUA 4R1LA 1YJAA 3F49S 4PLFA 4RDIA 3WLSA 5TMPA 3CN7A 4L51A 1L7BA 2VVTA 3A9SA 2M1XA 1NUSA 2Y2VA 3CW2A 1BS2A 1NU6A 4I50F 2C1ZA 5C81A 1BFUA 4YV0A 1EVEA 3BJMA 4C4SA 1F60A 4I4TA 2IF0A 1NUUA 1GTRA 3H2GA 2QTAA 5KWEA 5IDXA 3R7FA 5DNDA 1KI1A 1IBLB 2CVFA 2Q1YA 4LXQA 1ZIDA 3GLHA 4TMFA 4ODIA 4ZDIA 1QZ3A 1MEEA 1A88A 4I5FA 1V9SA 1NYLA 3RODA 3WQSB 1NLZA 1PG5A 4TTAA 4TSRA 1LC3A 2H08A 4Q5IA 3SHQA 3TR5A 2ID8A 3WGQA 4F2GA 1JEAA 3L7YA 4RVGA 3VOSA 2IS2A 4JJKA 2XIJA 4N1AA 4QXQA 2EW8A 2NZ8A 3DFIA 3KSMA 3QUAA 4KTVE 4A03A 3H2JA 2FQ1A 5JRZA 1D8TA 1AT1A 4IJWA 4XGNA 4F96A 4PRKA 3BK2A 1TM5E 2FZEA 1NBAA 2FMFA 1TO2E 1UMDA 2W6PA 1UBTS 3OX2A 3CVXA 2PWAA 3OT1B 3IMKA 5JS2A 4ALJA 1M2FA 3P9RA 3KHTA 5FLEX 4EPRA 2CUNA 2I1LA 2GJ8A 1FMCA 2VJAA 3NO4A 5AW1A 3KUXA 3N5CA 4AD8A 2AT1A 4F9FA 4R71A 1DG3A 2R8XA 1Q7CA 1QH0A 4IHJF 1A8HA 1H9BA 2QTRA 5KAMA 2H7CA 3VUEA 5DTJA 4QOGA 1OI7A 4D9EA 3ER6A 4HDRB 4XJSA 1LSSA 3RUHA 2ZAYA 2H5EA 3I52A 5P21A 3K09C 1KQNA 5ADVA 2IXGA 2NO1A 3VBCA 5DNVA 1T0IA 2G1JA 1Y8QB 3JQBC 5KHOC 5IKXA 5DCYA 1AS0A 1YF3A 3P2OA 3USCS 2NU7A 2PX2A 1TAHA 4RCYA 3OCWA 1QYDA 2E37A 1L5VA 2R8OA 1F8FA 1ZUD1 3N6XA 5BSEA 1AF4A 2EOAA 2CCJA 4MINA 4AURA 1ZCBA 3ROZA 1JHAA 4RIGA 2J4FA 4S12A 3T7KA 5AIBA 1W9MA 3RC7A 1B3RA 2BMFA 2FSPA 5HJ5A 4JEMA 3HKBA 1AD2A 1AXEA 1THTA 4MV0A 1H4SA 3NIFB 3HJCA 1JMYA 1V7ZA 2X3YA 4B4DA 5JTUA 1Q15A 1TF5A 5DLDA 1QH1A 2O0MA 2OCPA 1WV1A 4N7BA 2O57A 1MEOA 2VLBA 3IEVA 1FYEA 4M1QA 2PZFA 5T6BA 3HNPA 1YR7A 3QVMA 5E2BA 2FFJA 3FTDA 3PENA 2FCAA 3Q87B 5KYUA 1HYEA 2VP5A 3EXHC 1HQYE 1H8HD 3CUKA 4ZOLB 1H22A 2D2IA 3VNRA 1YBAA 1L5WA 4ER3A 3Q6NA 4D9MA 3RVBA 1XLTC 3CX3A 3NT2A 5H02A 2AUMA 2PSSA 2EZ4A 1BKYA 2YWJA 2BEUA 4Z4FA 3EIFA 3LVQE 4B35A 3H4TA 4OYLA 4TL7A 1NBHA 3UIEA 3DTVB 5C9ZA 3MGKA 3FWHA 5E7IA 1D03A 2VNIA 4OGKA 4LAFA 1JPUA 1E8NA 2XAAA 4K86A 4TV9F 4DBLE 1EP1B 2FUEA 5CP8A 2HWXA 3TTVA 2QL7A 5KWVA 1XF9A 3I9KA 3E2IA 4LJLA 3JQCA 2NX2A 1Z0FA 5GZ1A 1V5FA 5T4EA 1I5RA 2WT9A 5IVPA 3H8JA 4MUYA 3UQZA 4N0QA 4TKUA 4C0SA 2AUTA 2Q45A 4IIUA 4YIHA 1AG9A 4LMRA 4H7IA 5CFZA 1W4CA 2FZLA 2YW9A 2O3UA 4IX9A 2EHJA 3STWA 3KLMX 1XZEA 4GLJA 3WNVA 4LFBB 5J47A 3RF6A 1L7EA 5LQAA 2ZYGA 2VP0A 1KR2A 3QMVA 5JANA 1Y3AA 3ZD7A 4BQEA 1EFPB 1NBEA 3PFGA 3QW4B 4B79A 3WVNA 2QRVB 5KO2A 1J2EA 3PKJA 3O7MA 2IA5A 4XTCS 4EEZA 5KVAA 1GZ3A 2G9UA 3MCWA 1R3DA 2P7IA 2PR7A 5A0TA 4C0BA 3DZ8A 2XKKA 1QV6A 2ZZNA 4ER0A 3DYIA 1QVVA 1HE4A 5LA6B 4MX8A 1QAQA 1II8B 3AM3A 3H5OA 1KGDA 1ZD2P 1A9QA 3Q8XB 4GMDA 3GXBA 4OAQA 1F0KA 1XRLA 4KVZA 1TZJA 4KQ2A 3OZXA 4GICA 5IEJA 4A6XA 1MXFA 1V6SA 1UF9A 2OCKA 4Q7KA 4WDRA 2XE4A 2PT5A 4XYBA 4EGJA 3LDAA 4G1BA 1UP4A 1MMFB 4HDKB 2JCXA 4O4HF 3UAGA 4ESOA 4Z4QA 4OOEA 2KB0A 3DEIA 1GO2A 4GP9A 3S2UA 1Q7GA 1NM5A 1DCMA 2G08A 2XMZA 2YWCA 3NDRA 2WM8A 2Y8EA 4NJEA 1NBOA 3E84A 2IHKA 1U2PA 2PXCA 4Y7CA 2ISQA 3P9PA 4MUBA 1T6NA 2JIDA 3DL2A 2FWBA 4QBHA 4ZVNA 3UH1A 1R5JA 1F1BA 3TMAA 4GKJB 2XSZA 2AJLI 3K5WA 3RSSA 3LP5A 1WMFA 4TXNA 3G59A 3TZHA 4G0OA 3FIJA 2F9FA 1JT2A 1XTBA 4G8JA 3P45A 3OTHA 4IOLA 3WK5A 1AMUA 2BGRA 4AMYA 4N3BA 1NYTA 3WYNA 4BBJA 4LJRA 2ARKA 2HQBA 3D7SA 1CZOA 4IXMA 5DNYB 2ZRMA 5ILQA 3EARA 1TA4A 4LNHA 3FSEA 1C9NA 4KQFA 3F9CA 4IFEA 1G38A 1Z62A 1ZZGA 3VOAA 3ZLJA 5I8WA 3M3HA 3DLHA 2ZCVA 4MJLA 3D4OA 3LT1A 2W2NA 4HXEB 1YZGA 1N2SA 2VEDA 4MA5A 3SKYA 4KQJA 3IDAA 2VJYA 3ID6C 1G5PA 5AHWA 2VSQA 2EYQA 4M0FA 3WG9A 2F17A 4J0EA 2WJGA 2DP4E 2IXBA 2NVUA 1T9HA 3Q7RA 4WRRA 2RFLA 4M9ZA 2GBLA 4XGKA 2PR2A 4KFSA 4N5DA 2R6FA 4FYHA 3UQYS 3F5SA 1CNMA 5TF4A 5AD1A 2NYUA 5DOZA 4B6EA 3TQQA 4D4KA 2O19A 2DR2A 3ICEA 2MMGA 2AWOA 3W2TA 2XX3A 3F7OA 3L92A 4NZYA 4FEAA 3TLGB 4RUKA 2HIMA 4TMWA 5AVVA 3OUUA 3ASVA 1UKYA 1X7YA 1ZMBA 1YS4A 4F3KA 2J33A 3QKSA 1EWVA 1KPHA 4OQEA 5IJ9B 3PC8C 2C7OA 3EPPA 4OFZA 3TZKA 3JQ7B 1KI4A 2OV3A 4NYIR 3ZIUA 1ICEA 3CLRD 3RK1A 3W78A 1M83A 1ILEA 1E2JA 4CVNA 3SIWA 2HA5A 1CEEA 4C14A 3MLBA 4DPKA 3OTWA 2YDXA 3MCTA 2FPPB 3D3WB 1KYTA 3VTZA 4LE0A 4X20B 4L57A 2OLKA 3ZJUA 4JP2A 3UKOA 1LD3A 3O9VA 3EK2A 3GFVA 4YMLA 1UQRA 3GPDG 3PHCA 1R4NB 2NV6A 3B60A 1HG1A 4OBXA 4JCCA 1EDEA 3G2QA 3L4BA 3ROMA 4FFMA 3WQHA 2X14A 3OZGA 3RNOA 3U3ZA 3U7IA 4QLOA 5L3SB 3UJNA 1ZUIA 1JG2A 3EDYA 3FPFA 1O5TA 1SUWA 1ZIPA 1W2WB 3FJOA 4MPJA 3R74A 5GADl 2X6TA 1Y1SA 1RKXA 4LSWA 2Y99A 5E3JA 3DDWA 2A5DA 2RB4A 1Z5VA 2C2KA 2FWRA 4EYGA 3P0HA 2JFQA 5ENZA 2J3QA 3EDRA 5DRTA 3PUHA 2GERA 1LVGA 3THWA 5FX2A 3IHKA 4FHFA 1QVAA 4OJTA 3EPJA 4N18A 3HYTA 3FPSA 4E88A 1I1QB 1EIWA 1ZDMA 3V46A 3KZCA 4UNSA 5DLYA 1CUWA 2H4YA 3LGXA 2PY6A 2QP4A 2WF9A 1WL8A 4J1NA 3GJQA 4K1LA 1Y1LA 1T3HA 2V8BA 4X9XA 4D9FA 3MQ2A 4OQNA 3BQNB 3FMIA 5FOQA 1K63A 4D26A 3L7DA 4D9KA 1O8CA 5GONF 4CG0A 3SQOA 5KJ1A 4DZZA 1GZ7A 2I22A 5DNUA 1RYNA 1RDFA 1Y1PA 2ZT8A 2HEIA 3QLUC 4WD3A 1WCYA 5LXTF 2KBEA 4I1UA 4DXAA 4KNYA 1DUSA 3GEIA 4NJMB 3AIKA 4KVAA 2E5LB 1FSSA 1QVZA 4FR0A 3PRHA 1M5UA 2B1IA 3P5BA 3ICWA 4I3HA 2EFYA 1M2KA 1V11B 4Q1EA 4UD2A 5J5AA 1XCMA 1GLVA 1Y5RA 2EJVA 4ND7A 4ISCA 4QQKA 3C7KA 1VHTA 3KKZA 3P19A 4G2TA 4XH9B 4DSOA 1SOUA 3FDZA 5FPPA 1JVNA 4QXAA 3UNXA 3RGGA 5B58C 4JOCA 2LTAA 2EL7A 4HPJB 4HTFA 4CFZA 3CF2A 5DM70 3DT8A 2O2CA 1RWQA 2G9NA 5E6UA 1MFPA 4RD0A 5HCUA 4CTOA 2FPSA 4OH1A 4HD8A 2D8AA 2JFHA 3O0TA