4KN5A

Crystal structure of a putative methylthioadenosine nucleosidase from weissella paramesenteroides atcc 33313 (target nysgrc-029342 )
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
235
structure length
235
Chain Sequence
YFQSMRYGVINAMAEEKAALVDAMIDEKKTTIAGKLFHHGKIGHVDVVVVESGIGKVASALTTTLLITNFGVDAVINSGSAGALGTDLRIGDIVIADYLAYADADARAFGYAYGQVPQQPARFKADTDLSNDLSESYEKVTDARLVRGLVVTSDSFIASNEQKQTILTHFPEAQSAEMEGASIAQVANYFDVPFAVVRAISDNANGEAGMTFDDFIVEAGQQSAQVLINFFEAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative methylthioadenosine nucleosidase from Weissella paramesenteroides ATCC 33313 (Target NYSGRC-029342)
rcsb
source organism Weissella paramesenteroides
molecule tags Hydrolase
molecule keywords Methylthioadenosine nucleosidase
total genus 80
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 3.2.2.16: Methylthioadenosine nucleosidase.
pdb deposition date 2013-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kn5A00
1PBNA 5JPCA 1ECPA 1Z34A 4DAEA 1A9TA 3DF9A 1A9OA 4L6IA 1RT9A 1CG6A 3QPBA 3NBQA 4U2KA 5B7QA 4P54A 4D98A 3C74A 1PWYE 5F7JA 3OZEA 1WTAA 1Z33A 1YQUA 1U1FA 1LX7A 1OVGA 2H8GA 4DA0A 4D8YA 1ODJA 3LBAA 1Y1RA 3DPSA 3KVVA 3OZBA 3UAXA 1NC1A 2I8AA 1JYSA 4L5CA 1T8RA 4TTJA 1JE0A 2I4TA 3ODGA 1PR5A 3E9ZA 1V3QE 3KVRA 2HSWA 1YR3A 3FUCA 3DJFA 4UC0A 3MB8A 1V48A 3F8WA 3U40A 1C3XA 5CCEA 4QAQA 1TCVA 1Y6RA 3NM5A 3O6VA 3E0QA 1V2HE 3NM4A 4QASA 2HN9A 5FAKA 3OF3A 3KVYA 3P0EA 4EB8A 1QE5A 2ISCA 2QPLA 1YRYE 4YJKA 1U1CA 4YO8A 2OECA 3KUKA 3PNPA 1I80A 1RCTE 1T8SA 5CXSA 3T94A 5C80A 4TTIA 3FNQA 4GMHA 4TS3A 3BJEA 4L5YA 4LNHA 4LDNA 5DK6A 3IEXA 5CCDA 2A0WA 1VHWA 1N3IA 3K8QA 4LNAA 1OUMA 4L0MA 1Y6QA 1PR0A 3KHSA 4FFSA 5IFKA 4OJTA 1G2OA 5EPUA 4D9HA 1V4NA 4QARA 4DA7A 1YBFA 4K6OA 1ULBA 3ENZA 5EUBA 2RJ3A 2AI2A 2HWUA 1PR2A 4WKCA 4YNBA 2IQ5A 3PHBE 4F1WA 4M1EA 4QATA 4TXLA 1Z5OA 1OTXA 1RXUA 1T8WA 3FB1A 4OY3A 2HRDA 4QEZA 4DANA 3O4VA 1JPVA 2QSUA 1Z36A 2XRFA 2AI3A 4G41A 3UT6A 4WKNA 2ON6A 3OOHA 1ODLA 1RXCA 1TD1A 3FAZA 2QDKA 1SJ9A 3LGSA 5B7GA 5B7PA 1Z37A 2P4SA 3OZCA 4F2WA 1JDZA 4JP5A 3P0FA 3EEIA 5CYFA 1JDUA 3PHCA 4M7WA 5F77A 5CYGA 4MARA 1Q1GA 2AC7A 1PR1A 1V41E 2QTGA 3OOEA 1OV6A 1U1GA 1JDTA 3FWPA 4TXHA 1A69A 4MCHA 4OF4A 3KU4A 4TXNA 5B7NA 1Y1QA 1K3FA 1SD2A 4TXMA 2BSXA 1T0UA 3NM6B 3UAVA 4OGKA 4DARA 1SQ6A 5I3CA 4R2WA 5K1ZA 1LVUA 3TL6A 1U1DA 1PW7A 4TYMA 1JDSA 4G8JA 4NS1A 4F2PA 1B8NA 4LZWA 4RJ2A 1Z5NA 1OU4A 4BMXA 5ETJA 4M3NA 5F73A 4PNPA 4BMYA 1PK7A 5F7XA 2QTTA 4YMLA 3OCCA 1PR6A 4GKAA 4I2VA 3OPVA 1Z35A 4DABA 1YQQA 1JP7A 1RXSA 4TXJA 4OGLA 1ODKA 1VFNA 3UAWA 1XE3A 1ZL2A 1ODIA 4WKPA 1CB0A 1RR6A 3DDOA 1TCUA 1OTYA 3LA8A 1M73E 3EMVA 2OC4A 4D8VA 3BL6A 1TGVA 4TS9A 1K9SA 1RYZA 2A0YA 3BGSA 3ONVA 4DAOA 5F76A 1LV8A 4GLJA 4F3CA 1PKEA 3PNSA 2OC9A 4D8XA 4R2XA 3INYA 4GLFA 1JDVA 1VMKA 5CXQA 4ECEA 1A9QA 4NY1A 4IP0A 4TTAA 1TGYA 1ZOSA 4F3KA 2A0XA 3K8OE 1Y1SA 1JE1A 2OXFA 3GB9A 4KN5A 1PF7E 4H1TA 3OZDA 4QFBA 5EFOA 3FOWA 3SCZA 2A8YA 4DA6A 4EARA 1PR4A 1RSZA 1A9PA 2PGAA 4JWTA 3UAYA 5F7OA 4DA8A 3EUFA 4WKBA 2AI1A 1Y1TA 4L5AA 1Z38A 1U1EA 3BSFA 1A9RA 2GUWA 5IU6A 4G89A 1V45E 5F7ZA 3DP9A 4OEHA 3D1VA 5F78A 1A9SA 1PK9A 3E9RA 1K27A 4BMZA 5KB3A 4BN0A 1NC3A 4NSNA 4PR3A 1RFGE 1ULAA 1VHJA 4LKRA 4MCIA 1SD1A 1Z5PA 1RXYA 4X24A 3MMSA 3UAZA 4E1VA 1NW4A 1B8OA 3EUEA 1T8YA 4WKOA 3IOMA 3GGSA 1FXUA 4JOSA 2B94A 4R31A 2Q7OE 1Z39A
chains in the Genus database with same CATH superfamily
2DQZA 4MEAA 2ROQA 1IM2A 5K8UA 1I7LA 1QS0B 1YIAA 2Z9CA 4DSNA 4EKDA 3THWA 3VH1A 5B6JA 1NGSA 3QFRA 3OOYA 2H4ZA 1E64A 1R12A 1JILA 2XSZA 3G2KA 1NY6A 3P9CA 4OM7A 4EZEA 1EHYA 1X86B 4JJ8A 4YTEA 2WFAA 3MBOA 3GPLA 3G1WA 1FDSA 4RPLA 5JWHA 3PF9A 4J6FA 3C3JA 1IY1A 1I3OA 2J3DA 4QQNA 3CH6A 1G98A 1VIAA 3NDBB 3AZPA 4V3BA 5B3JC 4LIPD 1SC6A 3KAPA 4KK3A 2WD8A 2QJRA 2JEZA 4TLLB 1VGRA 3EXHB 4R8SA 4DJ5X 1NZFA 3L07A 5CVJA 4PO1A 3R24A 2YW2A 1TVKA 4HFJA 5C1IA 2BUCA 4DGQA 1NNSA 4G5GA 2NVBA 1PWYE 2FUCA 4KBGA 4JYBA 3C24A 3LDGA 2QAGC 1QV9A 2XYQA 3ICVA 3Q6NA 3QUTA 3VPCA 4YQFA 1RLMA 1Y4AE 1R5BA 4BIMA 2Y1KA 3KTAA 4UAUA 4JBYA 4PCVA 1D07A 4L16A 2OCAA 2XA1A 3IPRA 4TKVA 5ECWA 1AHHA 2Z1NA 3NBYC 1TC1A 4E5MA 3HR8A 3C6KA 1SUAA 4FD2A 2WWRA 1L6RA 1ODJA 2XKJE 2HM7A 1EK6A 2DUJA 4X94A 3SF0A 3SZUA 3MJEA 5KHLB 3AL3A 1QGZA 2OVFA 3PQ7A 1V4VA 1JYSA 1TIKA 3S81A 1EINA 3THYB 3JWHA 4M49A 3FMFA 1NP7A 1ZUD1 4DYDA 5AVUA 5UKDA 1SBYA 3DWFA 4EABA 4EKIA 3OZRA 5JPIA 1T3ZA 1P31A 5AVQA 1O57A 1AKUA 2W43A 2PZKA 4KQJA 2P3QA 4Q03A 4DUPA 4F2DA 1JMVA 4HWSA 2CCKA 3P0RA 4RDHA 3GRFA 3A28A 5JHHB 5IJXA 3QEKA 5LYJA 4WGFA 3H5VA 1OQAA 1XTRA 2B4KA 5L3ZA 3KOMA 4AXXA 5M2QA 3E9ZA 1R7RA 1FUUA 4GNKA 3UAGA 4PGAA 1Y1LA 4RLSA 3DYIA 3OFJA 3PTAA 2GPYA 3VNVA 5EWLA 1P1FA 3DB2A 2KMLA 1XNQB 3PNQA 1B41A 2VF4X 2VDPB 2DHEA 4JU8A 4XKJA 3ZGOA 2B5VA 1NMYA 1YL6A 2H18A 2WHQA 2FCAA 1CUAA 3MB8A 4A8JC 2J0SA 3GEGA 3CQ9A 3PZBA 3UT0A 4BKOA 8GPBA 1U5BB 3B9RA 3LCVB 3Q85A 1JR3A 3O6VA 4BX3A 2RK3A 4LC1A 3U4GA 1KMQA 1J70A 4KZKA 2HT1A 2G1KA 4JVSB 4QUGA 4C20A 1NHGA 4K3VA 2B82A 3ZZMA 3UN1A 1NN3A 1P2SA 3F7OA 5FFFA 1R6UA 2JC3A 3PNVA 4QASA 5GM2A 3RR2A 3Q98A 3SEAA 5KI6A 3PHIA 1JUDA 5DM4A 4UBIA 2GFIA 1NMQA 1Z6GA 2IS6A 3P5BA 3O1LA 5K6AC 5LWHA 3O83A 3D0KA 2H1LA 1SHKA 3LTEA 4UHEA 4DNOA 4QJ4A 3LY9A 4KDFA 1OBCA 4ENTA 1X9IA 2IZ1A 2JHPA 1EWVA 1KYYA 4LW8A 3VU3A 2RIPA 4I81A 5I9LA 1L5QA 2I1QA 1VMIA 3KUKA 2FF7A 4HWRA 1XRSB 5A4KA 3TVDA 4R2HA 3HEBA 4WLVA 2I78A 5JNTA 3M3DA 1AKVA 1TZ2A 3S40A 3DE3X 3AUYA 3G5AA 3WKBA 1ZR2A 1WVMA 1GA1A 1E4EA 5JCXA 1QOPB 3VXKA 1Y4UA 3IBCA 5DK6A 5LU8A 4L27A 2AMYA 4IHJF 4KDRA 5KVVA 1VBNA 4CMBA 3K4QA 4GIBA 4KB5A 2A0WA 1WP9A 1VIDA 2DLDA 1K7SN 4GGPA 1V16A 1H2BA 4MRNA 3U3XA 3CRNA 5KOYA 4QTZA 1QYXA 3ZE6A 2AEFA 2YHAA 2I1LA 3K8QA 3VR6A 5L7TA 1PEKE 4QJ3A 5KKNB 4REQA 4QJ5A 5MFZA 1DFHA 1IZ9A 5ALHA 2QX8A 3PKJA 3S2ZA 2DGDA 1P9RA 2P2ZA 2XMDA 3PG5A 2ANCA 2Q5EA 4YCJA 5DHPA 2OBNA 2XWJI 4PONA 2IHUA 2VXBA 3UUEA 3RG8A 1G41A 3BCHA 2OAGA 5IFKA 2NQTA 1YRBA 3DMYA 4HDKA 5L45A 1G2OA 3TBFA 4DLSA 2AKEA 2F55A 3R8CA 5KKAA 1UR5A 5C9ZA 5B4TA 4YRTA 4TN5A 1EP3B 4OHPA 3ANTA 8ADHA 2H7CA 1NP3A 3CEPB 3E3MA 4UBKA 2A1TR 4JIMA 3P9SA 5E4JA 4B09A 2Y71A 1P4RA 4IJ6A 1XF9A 3QEBZ 2G83A 1P0IA 1RZVA 5FUMA 4YASA 2I3ZA 2WB4A 5LXTF 4PE5B 3LDFA 3ZXXA 4HPJB 5IP5A 1PQUA 1WHSB 3BXXA 2EJBA 4HBGA 4O6VA 4DEVA 5HOEA 2OKGA 4NU6A 4S0XA 1BW9A 4K9DA 5E3HA 4RHFA 3NTQA 2H3HA 1PGJA 2PO5A 1NXWA 2Q5QA 4I50A 1Q57A 3CT6A 1E9BA 4WCFC 3LHIA 1G66A 4FQ8A 4FT4A 1ZO8A 3MMXA 2IDMA 4HUJA 4J9UE 3CJQA 1CNEA 2GASA 1NBAA 3P9KA 5HP4A 4R8LA 3RF7A 2ZATA 5I8ZA 3MJFA 3R0VA 3GNTA 3VNSA 5K20A 5EZYB 4IIGA 4CM4B 2C3OA 4CUKA 3WGQA 2FWRA 1XZIA 3RVQA 1C0EA 2AW5A 4WCVA 4ZAXA 2RAVA 3KJIA 1KAMA 1XZ8A 3MTIA 3TZHA 1SJ9A 1C1XA 1TAQA 3F7TA 5ER9A 2FEPA 3ROTA 4HX9A 3DVAA 4PRLA 3UKDA 3WADA 4J16C 4N03A 4HPXB 5CM2Z 3V7FA 2FFJA 1ID8A 2BKVA 1NT4A 3VRHA 4LF5B 4RM3A 3ROZA 3DBOB 1W19A 3OT4A 4IJ5A 4INZA 1TK9A 3BGIA 5KJEA 4B3IA 1V25A 4NAHA 5CYGA 4IDQA 1IJKA 2ZREA 1ISGA 1RNLA 4MVJP 4WY5A 1FU4A 2JZCA 3KTAB 5DIFA 3OA0A 1R4NB 3ZD9A 1S8AA 1EFHA 5K51A 1YO6A 3GFSA 1DG3A 3AJ9A 4NV3A 3DO5A 3Q12A 1JIQA 1JLHA 1BWPA 1B0ZA 4C3ZA 1NJ2A 2WJGA 3BHMA 2DR0A 3JU3A 3TTUA 4FKMA 5GJBA 1HI9A 4GH5A 1E94E 2GK4A 2XAAA 4I9UA 4G0MA 4N49A 3TR6A 1AK1A 1Z74A 4FYKA 3MOSA 5KNCD 3LWNA 5KTSA 1YUMA 1U3GA 1EJBA 2QQ5A 1NMEA 2XA9A 3PRYA 5H1YA 1XCOA 2GYYA 2VHUA 4O63O 1HQKA 1NM5A 1SAYA 4JLVA 4MJLA 2FHSA 1KY5A 2HJVA 2ZI7A 3T5DA 5KNDD 1FFBA 3MPUA 2R97A 5E9AA 4XVUA 3KUUA 1RAEA 1CIPA 2NXWA 3GV0A 4Q7KA 3JZFA 4TXNA 1P5ZB 2IE0A 2PJDA 1PHRA 1KEKA 2PAFA 3EAGA 4HGOA 1K3FA 4RMNA 1SD2A 2PWZA 4C22A 3OQ6A 4EPRA 1UJ2A 4J6EA 1BKYA 4EHIA 3W8DA 3JSAA 5AFSA 3VH4A 1FK8A 1LDGA 3G2PA 1S2IA 2HTEA 4CM1A 1H69A 1GLNA 2QTVA 3L0SA 1U80A 3UAVA 3FM9A 5DGHA 5E6SA 2XOKD 3RU7A 3DPUA 1DRWA 4PHGA 2SNIE 4BNLA 1SQ6A 2LDBA 3GJQA 4MICA 4R2WA 1Y80A 3HKEB 1Z2NX 3QITA 3V7YA 3VO8A 5KVCA 3NYQA 3TPFA 2RHDA 3C1UA 4DWJA 1T2DA 1IOVA 4CN8A 2PMCA 3T3NA 3ZYZA 1LBHA 1JVSA 1REQB 2CY0A 4EJ0A 5AHWA 1VL0A 1V0JA 4NS1A 4FN5A 3CGGA 2GNPA 4LDQA 5GP1A 3FWKA 3I2JA 4P84A 4RAOA 5GMOA 4MDFA 1XHEA 3NHYA 3ZU6A 1J4AA 4UFOA 2J41A 1SIOA 4O25A 1WW3A 4CKEB 3OI7A 1KF0A 4LXXA 3CWQA 1KOLA 3G2JA 3CUYA 1YJXA 2CV1A 2BI7A 5J4VA 2XE7A 4GI5A 2IYAA 4LRSB 3TSCA 2ZRFA 5ITSA 5TF0A 5HBGA 5ULLA 3LRXA 4JXXA 1TJNA 1KORA 3N07A 2XMPA 4MJ7A 4ZT6A 5AR1A 1EUCA 3OCCA 4Q47A 2FPWA 3GJ5A 4GU5A 4NU5A 5AK4A 3OPVA 4X1IB 1PTJA 4OU5A 2D59A 5A71A 4H7EA 4HAUA 4E5NA 2HR1A 2VHVA 2UXDB 1JP7A 1A3CA 1NE2A 3P4UA 3IDAA 3WTBA 1NDUA 1PZFA 2O7NA 2OBYA 3PF8A 3WIOA 3CW2A 3VPHA 2ZS8A 2DCUA 4KMSA 4W7HA 5JD3A 5IT9A 3QX3A 1OROA 1RZUA 2G28A 3LUKA 3W78A 1BQEA 1E6WA 2AHOA 4OQLA 3BDVA 4H15A 1KXJA 2C0CA 2OHGA 4AKEA 5TEWA 1ZL2A 4L3VA 2DY0A 1XLVA 4BYMA 2NVUB 3DBLA 1ZK1A 4RWZA 3KSZO 1N6OA 3M1IA 4UHFA 5DM2A 1C41A 2QMHA 4KXXA 4LXUA 4A9AA 5D1NA 3PUKA 4BJ1A 2BP7B 4Q4JA 2XJ4A 1TCUA 2VDUE 3WMGA 5KVAA 1OTYA 3KSDO 4HTFA 4NG5A 2PYDA 3DNPA 3R7NA 1CRLA 3CT4A 3RVPA 3T12A 4R71A 4ZV4A 1R0SA 2V6FA 4QQ8A 1X74A 4MS3B 1TO2E 2HWWA 1ZI8A 5DIZA 3N8DA 1OZ0A 1YKGA 1F17A 1OXUA 1DXQA 2VPTA 3ZH2A 3MWFA 4DE5A 4DPMA 3HXOA 2E82A 2FSHA 1IVSA 1F8YA 3OTGA 2IEAA 4EHLA 1JB9A 2WJPA 3MBIA 2WG0A 3ONVA 4DAOA 1LV8A 3ESYA 1ZNQO 4L2IB 3DAFA 4BEJA 2WYVA 2ZTVA 1WDLA 2IZZA 5F3WB 1UJ4A 1UP7A 2EJUA 3I5AA 2CNDA 3DHWC 1XK6A 2QK4A 3LVBA 1NW8A 2CF6A 3Q3VA 1M8PA 4ZVLA 4DMMA 3FOBA 1R66A 3C6ZA 1JEAA 3L6OO 3R41A 3VZSA 3GHHA 5BSFA 1WLYA 1A76A 2I03A 5F1OA 1XMJA 3GVXA 1P3DA 3B3GA 3TLEA 3VHQA 3KO8A 4QBGB 5TPZD 1K7CA 1HZZA 1SKAA 2X8JA 3OVMA 5FI3A 2NTNA 4G81A 4BBPA 3IBSA 1UWLA 3RHTA 4LECA 3PD0A 4NOLA 4WZAA 2GA9A 4BMNA 2JGRA 1STOA 1UH5A 1VG0B 1TM4E 1NKTA 1CDZA 4Q3EA 3WLLA 4POAA 2ZRHA 2FEKA 4KMMA 1LJ8A 5K03A 3GIDA 3KEGA 1W48A 3IUBA 4PFQA 3SQXA 4GBJA 3I9MA 4YJ2A 3RVLA 1QMPA 2DT5A 3H9QA 1C1YA 2G07A 4P7GA 2VNAA 4P5EA 3P96A 2C83A 3ELBA 3ANNA 3DEYX 4FK8A 3GXBA 4IXWA 3RSGA 1NU6A 3NHMA 3WGTA 4QDZA 4W5QA 1PIWA 4M22A 1OBVA 4Q9LA 4KRGA 2IOQA 2SHKA 4ZCIA 1GQFA 3BCUA 5D3QA 4GR9A 3WG9A 2HV9A 3R75A 1R9GA 3SNHA 1CUYA 1I0ZA 4HP8A 1DTSA 1E3DA 1B7GO 2G9NA 2PGAA 4B74A 4BFZA 4HGNA 1CS4C 2W11A 1Q1QA 2JFQA 2WVAA 4BN4A 2MTBA 2WFLB 3JYOA 3AYXB 5F7OA 4B3FX 1YE3A 1RMTA 3Q9LA 3RQSA 1XQYA 3QF4A 4ZVKA 3WGUA 5CDGA 5GZ3A 4ON9A 2P3SA 2RK4A 3A3KA 1OV4A 5JATA 1N34B 2GAFA 3DHVA 4RTKA 1BS1A 3F97A 3PJDA 2Q49A 4GOLD 3S5UA 1NJ5A 2ZS9A 3IIEA 3Q3GE 2P2YA 2ZVQX 3ML1A 2GAJA 1YC2A 2E4ZA 3HVIA 2ZSEA 4KO4S 3RJ5A 4C0KA 4G1EB 1NI4B 3R7SA 4YAJA 4BP8A 1EQUA 2GLTA 3DZDA 3HI6A 3UENA 3PUXA 1RU3A 2GN8A 4CM8B 3KB1A 1NLMA 3QE3A 3Q8KA 2IKSA 4A36A 4FJ1A 1YAJA 2XDQB 3D81A 3EC1A 2VZEA 3ILSA 3KPVA 2V7QA 4QBKA 1SBCA 3RVMA 5KQSA 3QFFA 4A92A 2HA6A 4DXHA 3TW8B 3T34A 3THXB 3D6TB 3QEJA 5AM2A 1DAFA 4HOYA 5I7VA 2YMPA 1PZHA 3UXEA 1T5HX 1RAGA 2PUTA 4FCCA 4HN9A 2QQGA 4YV2A 3LLUA 2QDXA 1E1QA 4FGKA 4LFCB 4GYWA 2V03A 1IUPA 3FLAA 1NHWA 2DFTA 2ZRJA 2E1RA 4OBWA 3UCXA 1DC7A 3T06B 3RIHA 1NJGA 1C1DB 1FP4A 1JQKA 5ALIA 1I2ZA 2XQVA 1BEUB 2XQIA 2V6GA 3DTNA 3Q8WA 1XA4A 4NBKA 2RI1A 3GA5A 3M33A 2ZKIA 4GPD1 3PQ6A 4NU0A 2QE7D 3UHOA 1JXOA 4HB2A 2XZLA 4FS8A 5BW5A 2POCA 1Y89A 3MS7A 1WKVA 3I6ZA 1PT7A 3NI2A 1E6MA 4TZ0A 1EVQA 1KVQA 4PLGA 1XZCA 4CKBB 4YCCA 2ZIGA 4YUXA 3IXMA 2XCQA 3OP4A 5CLIA 5HFAA 3UT5A 1OLSA 2YDYA 5A04A 4FDUA 1BS2A 3BXFA 3IMGA 3TMKA 2DZDA 4L95C 2W83A 3FHOA 4EG7A 3O1JC 1Z8NA 4ZJYA 5JNUA 3ZKAA 1SIBE 3NVMB 1PWXA 3TUIC 3ZPXA 1V47A 4PPYA 3DF9A 1U2DA 1RHQA 3DMTA 3ZVLA 4YRDA 1P7ZA 2KWIA 1O03A 2IGBA 4JN6B 4RF2A 5CNJA 1BS9A 1W85B 1FYVA 3TWOA 3S8EA 1U0EA 4BRUA 2G1PA 1N3BA 1FFXA 3FUWA 1KU0A 3QRWA 4OHWA 3RDPA 3UK1A 3VSCA 2OORC 2J7PA 4J7UA 2O1EA 2Q50A 1Y81A 1QKKA 3ANXA 3C6XA 3GGOA 3CUEF 3DT8A 3ZS8A 1Y7TA 3LPCA 4RIHA 4A4DA 4KIJA 3VPXA 5EP4A 1OAKA 1SOUA 3BB1A 2PT9A 3KFVA 3CR7A 3K20A 5BYAA 3LFTA 4JKOA 4YS6A 4DNFA 1XZPA 2ZAOA 5ALZA 4CF7A 2XOKA 3G7SA 3OLQA 4WJZA 3W3AA 2Y68A 5DH9A 1XXLA 1J8MF 2BRUA 3USES 4E88A 2Q8QA 2O4UX 3AR6A 4ARUA 5A4JA 5JSFA 3HCFA 3RJTA 4CE6A 4PLTA 1B6SA 1O89A 4R5HA 3T0GA 3OUTA 4MAFA 2PXHA 2YV4A 4W8HA 2RJOA 4BGDA 5KYWA 2MSDB 1UBUS 2ZK7A 4HTAA 4UPDA 5ALOA 2XUIA 2Q3DA 3HL0A 5IDXA 1U7TA 2R7NA 2WUWE 2P2GA 2X0NA 2QE6A 4KSBA 4RD1A 1DOAA 2CLCX 2O2JA 2QTCA 3E23A 1QM5A 4IUYA 4ZT7A 2LKCA 1S1MA 3BGDA 1GNLA 1CC1S 2OTCA 4R6XA 4WPGA 4QTUB 4BMPB 3CLHA 3DZHA 4ZQGA 2I3BA 1E9DA 2QTLA 1F2UB 4QUAA 4LZLA 1S2DA 3NVAA 4MMYB 1O95A 1TO1E 2ECQA 1KETA 3GFBA 3L0DA 3KC2A 3R3ZA 1W0JD 4RE5A 1HMPA 4E1AA 1Z82A 2AOWA 1MD9A 2WJ3A 1O6CA 7ABPA 2N3ZA 2Q3FA 2XTZA 3FBGA 3IA2A 2ZAGA 3FFAA 1QLJA 1E2JA 4I3GA 2TMGA 2O5VA 4O4LB 3VHXB 4EJFA 1JHYA 4RTSA 4ID9A 5BV2P 2ERXA 4Q21A 1X39A 2A4MA 4U7HA 1P1IA 1UP4A 4GDMA 1Y37A 3DP7A 1SG9A 5BW4A 1GL9B 2DQYA 2PZFA 4QBFA 1D5WA 2CYCA 2BM0A 3VOSA 3BGVA 2AKYA 4M36A 3C5HA 2BTQA 2HN9A 3HJGA 3CZPA 4LBYA 4BPBA 5DLQC 1YB1A 2FXVA 1N9ZA 3KVYA 2XNSA 3CLTC 1N5OX 3CCFA 2BMWA 4HDKB 3DAPA 4JI2B 3GF4A 3WK6A 1XB2A 2ISCA 2XB6A 4LDRA 1G8GA 4DB2A 1GLVA 1ACMA 1PKXA 3EH1A 5KTMA 1GARA 1RI1A 1XR3A 3VKFA 3BKWA 3K0HA 1G20E 2OESA 2M6LA 3V8MA 4CEHA 1MOQA 1BVRA 1I9CA 2ECOA 3FJOA 1DEHA 1M1YE 4KGDA 3PS9A 3AW9A 1TA9A 3NXKA 4N6OA 2YINC 1Z8FA 1WZNA 3FNQA 4QO7A 3ZNQA 4HDNA 3RASA 4EA8A 5CAEA 1T24A 3DOFA 3NNSA 4B2PA 1GGVA 2ZLBA 4CLOB 2XAUA 4QOJA 3LQYA 2DLCX 3KJFA 1OWPA 4LDNA 4AM8A 1R6AA 2SCUA 1X9GA 4CQMD 1M66A 1YRAA 4U7FA 3QYAA 3W7VA 4PGGA 3OLZA 1SXJD 1GPBA 4QJIA 1X80A 1DIBA 4HVCA 2AR9A 5AW4A 3ZOZA 1V8PA 4B75A 221PA 2HHLA 3U37A 4Q1VA 2PL1A 2AG0A 2DF8A 4ALMA 2H2FA 2AF4C 3TZQA 5DDIP 5DM60 1NPTO 5C8VA 4DM4A 4NPCA 2IELA 2VZ0A 4NHOA 4WFQA 1L8QA 3H0KA 5AKJA 1G5QA 1H4TA 1NNUA 4QQRA 4C0JA 2DJ5A 1ZJ6A 2X8AA 3U4QB 1KRXA 2WT8A 4CL2A 3OE4A 1IAVA 4MGZR 3W4JA 1M34B 5HKAA 3LFHA 4LF7B 3A9WA 1MAUA 3DEIA 1PV2A 3EY4A 2FEOA 4HK4A 1YF3A 2MU1A 3TZBA 4AY2A 2Z09A 1I5EA 1OFTA 3KHSA 4FYVA 4FYYA 5CR9A 4R83A 1Q0UA 3KR9A 4KYIB 4OJTA 2JJ8A 3ELUA 2AE2A 3WYNA 3Q0TA 3VMMA 4YMIA 4BWYA 1F0KA 3QOWA 5T3YA 4BNZA 3JWJA 1YVPA 1U2PA 2Z3WA 3IJPA 4TT8A 5AH0A 2ZB2A 5JBNA 2E5FA 4YRJA 2J5BA 3PDHA 4F4DA 1H1DA 3JQQA 1D4FA 3QBTA 5B36A 4MK4A 2OCLA 2WJZB 1GYRA 4HH0A 5CDFE 2ZQ5A 3B89A 3VYRB 1PR2A 1RLOA 1T9KA 4O2BF 2IYZA 2O07A 1Q16A 5U1PA 2DBRA 5AKIA 3DA8A 3H19A 2WF9A 5A0TA 1MAVA 4MGKR 4C7OA 2NXNA 2X14A 3QP9A 2OB1A 3HKDA 3VYSB 1ULUA 1P2BA 1RXUA 3I5UA 2G4VA 4MUBA 3TO5A 5AOCA 1DQZA 5KO2A 3IHLA 4QEZA 3FSGD 3RTCA 2AEJA 1AKYA 2QJWA 3O92A 3R6GA 2E9SA 3R9XB 1O94C 1HYGA 3EBOA 2A4KA 1Z8HA 4E70A 2VR1A 2WM9B 3MMZA 1I7DA 2QG9A 2GYWA 5CFZA 1E1CA 1FQKA 2F9MA 4KQKA 3TJZA 4R1QA 2R66A 2PAAA 2O0LA 4I99A 4JJFA 4RD2A 5E9WA 4ZVNA 4ATNA 4ITRC 4OYHA 3QEMB 1E69A 2GPNA 2QDKA 2IV7A 1Z4QA 2UYYA 2OM2A 3L8MA 4BNJA 4DIMA 2GERA 3HDJA 3WWEA 1U8FO 2CFCA 3GPCA 2GDJA 4NABA 4DSTA 3HZZA 2PKQO 1MW9X 1QVAA 3KLOA 2M6RA 4JP5A 5IUKC 4UM7A 3ZI4A 5LJLA 1M0EA 1E5TA 5CFQA 3C7AA 2I2DA 2N1BA 2OT3B 3PHCA 4E0BA 2PM8A 2ZTHA 1Z22A 4ZQIA 1NSFA 2FQQA 1XPOA 1SPBS 1Z6AA 2Q0QA 3AUFA 4BO0A 4A91A 5E2AA 3L77A 4IEFB 3ZCRA 1WUYA 1HSZA 2ADMA 1SKMA 3FCAA 3LECA 2DFDA 1YMQA 4BNIA 4F04A 5AP9A 1H94A 1KIAA 1P2FA 1SKUA 2BFDB 2NYUA 2P9YA 2VHEA 3CH4B 2XE4A 3IVGA 1TZBA 4HLUA 5K0BA 5L4NA 3GLFE 2XD9A 1QH1A 1UF9A 2Y05A 3BILA 3OT5A 3A3YA 1Y8RB 3OE1A 3TNLA 3EXG2 3AIOA 4FGZA 4I5EA 1F3LA 4X6LA 4OF4A 5I4BA 3F4LA 5J5AA 4GPTA 3QX7A 4AP9A 4BO6A 5A9RA 2V7EA 1AX9A 2C2WA 1XQXA 2HX1A 5LN1A 3RSOA 2AC2A 3WSWA 1GAEO 1VJRA 4NZMA 5EQTA 4PYRA 3FB4A 4AQDA 3B1ZA 4EFLA 3EWAA 1GTL1 4UUOA 3RUAA 3E27A 2Q0SA 2G4CA 3FSGA 4I5GA 3SMVA 3CR3C 2EZUA 2NV6A 1NVGA 1XRJA 2YN2A 1P0QA 2FMXA 3ETDA 3M8KA 4FOOA 3V8PA 3T3OA 5T7BA 1T0UA 1J9ZA 2QL5A 4OGKA 3IP6A 2ZRDA 1CJKC 1SXHA 3LF2A 4QE3A 5DP1A 5HKKA 4NLLA 2CUTA 2CZGA 2EKPA 4OI4A 3GEIA 3F5QA 2V7PA 1LC3A 4WDQA 2O59A 3BE8A 1LQUA 3GUHA 3ABSB 1HK7A 3SHVA 1P91A 1BAPA 2AUMA 3WA7A 1ADCA 4BB6A 3WLAA 2CSXA 4D25A 4IL5A 4HX2A 2CV0A 4J43A 2VLIA 1DQPA 4H7HA 3LPDA 2C59A 1MTOA 5D87A 4AULA 2XYPA 2IEIA 4UEOA 1ZD5A 4MUHA 3L9XA 2JFFA 3GRVA 3WRYC 3WNZA 1LFAA 4W63A 2BOVA 5AI5A 3NATA 3WZMA 4JJKA 4F6LA 3BXGA 2JGIA 2N75A 3PGXA 2CVHA 4MWDA 3MUOA 5IBPA 4BGVA 3CZ9A 1I8TA 4UKDA 3ITNA 4CODB 5KJ6A 3HWX1 3IAS6 4G26A 5EJGA 5JIBA 4PLVA 3X1XA 1JQ5A 4XQEA 4D56A 4YMLA 5IT5A 2FR0A 2B25A 2PJRA 1RCUA 3L82B 1YBAA 1SKBA 3I28A 1F5SA 3DOJA 3GOQA 1OH6A 1PJAA 5H5JA 1I7QB 2HYDA 4RVOA 1TM5E 2PKCA 4DMHA 3MELA 3ZHYA 2UXCB 4TV9F 2VYQA 2Q6KA 4F8EA 4OCZA 1NJ8A 1R0CA 2ILTA 2HGSA 3T1OA 4Z51A 4WAUA 3L93A 1M10A 3MTQA 4DY4A 4IWXA 2ORWA 2PD4A 1N4DA 3IVMA 4HS4A 4J8PA 4DC9A 3WDKA 3DW1X 1GL7A 3PC8C 2NU7A 1L2TA 3D1LA 3O95A 4PCUA 4TTSA 3TIFA 2FN8A 1GKIA 4MV4A 3SFZA 1GPNA 3ZWNA 3ZOKA 1S0UA 1TJPB 2I22A 4HI0E 1H2WA 1JR3D 3E7XA 3ESZA 1PL7A 4MW4A 5DWDA 4Z54A 2Y1EA 4CPDA 2X77A 1DO0A 2XUGA 5BR4A 3HCOA 1PEYA 4NQRA 1Y3IA 3FHLA 1OVMA 3F6SA 2IXTA 4IR7A 5AHRA 2HDHA 4P8RA 4UMVA 4A8JB 3LXMA 3GP5A 2JGKA 2GAOA 3SQDA 3SS7X 3OJWA 4Y0NA 1JJBA 4KLNA 4KAFA 4O1MA 3QJ5A 1Y3CE 2XT6A 4U2CA 3VSDA 1DELA 4NH4A 4GX2A 1E6CA 3M1YA 4EVSA 3G0HA 2QZSA 4GNRA 1JAZA 3Q7EA 3QFSA 4ZTUB 2QN7A 2XXJA 3R5TA 4JOBA 2GCGA 4QLAA 4UTOA 1JSRA 4RJLA 4YQZA 1AXEA 5AO9A 1NQWA 4BQEA 1M34E 3TW0A 3DOCA 4XIGS 3EDMA 1Y4SA 4U7PB 1ZFNA 3X1KA 1SXJA 2FPIA 4YHHB 1VGQA 4L4XA 1AV7A 3HU3A 5G3YA 1HQYE 3SX2A 1Y7IA 3PHJA 3QUQA 4QTTB 2M2IA 1DG1G 4C4XA 2Y0CA 1JDVA 4JLSA 4F4UA 3W5JA 1ZAYA 1O94D 5LNK6 4JH0A 1IG3A 5BSVA 1IN6A 1QKJA 5I7OA 2BUBA 3WBJA 3GAFA 4CJXA 1W2WB 2XTNA 1VYTA 4ILKA 5LP6C 1UM8A 4JUFA 3KU1A 2X13A 4KQMA 2GX6A 2JJQA 3DO6A 1EUZA 4Q37A 4UFNA 5A7FA 1I6MA 2ZRNA 1UAAA 3L0BA 3QEMA 4G0OA 4JT4A 4KLCA 1RKXA 4TT3D 1M1XB 1R0BA 3BRQA 3VU0A 5C1BA 4TVKA 1CY2A 3VR4D 5AJYA 5D84A 2WIKA 3GLIA 1A8PA 1MB9A 5TIIA 4QG3A 4G0VA 2WDPA 2X8BA 4DA6A 2C07A 5I5EA 1ZK4A 4K9PA 2UXBB 1SZJG 3RHFA 3ZWMA 2I7CA 1Y7HA 4BO7A 2REBA 2JFOA 3EPKA 2P65A 3V1LA 3OJLA 1P77A 3QKWA 1XV5A 4HC4A 4P81A 3AUAA 5TJ9A 4QVKA 2ORIA 2B0JA 3A6EA 3OU6A 1RRPA 2B21A 3KALA 5IARA 2CDNA 1IEQA 4J3NA 3BT7A 3AHEA 1DB3A 2CN1A 4KE7A 4KYTA 1QRUA 2FK7A 1T5LA 1O0SA 2IPAB 3LL7A 3EAQA 3ZUPA 3G7UA 4RVSA 1QH1B 2H48A 1GKLA 2CL5A 1YL5A 5C8DA 4N48A 4NMXB 4UNNA 3FTQA 3D8NA 3OZIA 1MBZA 2R60A 2M6SA 3LT4A 2W6NA 2A94A 3BSYA 3U4CA 4GEKA 5T5QA 3VGJA 3OEHA 2VRCA 1PFVA 1LV7A 5D01A 4YR7A 3HTXA 3B52X 3ODPA 1W6UA 5JAQA 5K3OA 2GN1A 4X8HA 4EH1A 1N2EA 4IMIB 2GO1A 2ZPTX 1VZ2A 4FW9A 3KKPA 2ZWAA 1TIBA 1DKPA 2ZRGA 3COZA 5HS6A 1BMFD 1PK9A 4GBMA 4K81B 1NUPA 5AESA 2BDEA 3QLEA 5ALUA 3HL4A 1VQ1A 4HJXA 1KO8A 3CPEA 5A9SA 3MK31 4M46A 1ZS9A 1IXZA 1N8TA 1NDQA 3JQPA 3LXUX 4GWGA 3KB2A 2VQ3A 1V5FA 2CDBA 4ZOBA 5BVHA 2XGJA 1JEEA 3ZTWA 4OI0A 1EWQA 3FMPB 2IYXA 3K6JA 3OX3A 5JBQA 3OURA 4A8TA 1XZKA 3GY0A 1RZ3A 1SVMA 3WIUA 1MQ8B 2QT0A 1C7JA 4WLNA 1B8OA 1O5OA 3BWVA 1L7PA 7REQB 4KXNA 1RYMA 4WKOA 2IHBA 3C2QA 2VDWB 4CR7A 3DLPX 2QRHA 2GJ8A 3NNNA 1J8DA 2J9FA 5JY6A 1J8QA 5F2EA 4GG1A 4ZZ1A 5J43A 5LIPA 4O2BB 4HR7A 1XNJA 4GXTA 1IEXA 4WLEA 3UJ7A 4H7IA 4DXAA 3BZUA 5AKLA 1LJUA 3ELWA 2X76A 4O2RA 2Y1GA 1K86A 2OBFA 1W0JA 4ND4A 4QPPA 1YDHA 2Q6OA 3TRFA 2SBTA 1KFKB 2X1MA 1ACJA 4PHCA 3OM8A 4EG4A 3HLTA 4YLGA 1UKVY 1LPPA 3ENNA 2XMBA 4FI3C 1SC4A 4FHEA 1E58A 2A59A 2GNOA 2HLDA 3IH5A 4IDFA 5AJVB 4YRSA 2QRNA 4GC5A 1BFDA 3OPNA 1E2IA 3JY6A 3NORA 4UHKA 2ZBPA 3EGVA 4XYBA 3RC9A 3AP3A 3HB1A 4V0SA 1OLUB 2PDAA 4YFVA 2GLXA 5JQGF 3O9ZA 4BXOA 3FZGA 3JV7A 5HCNA 1JLKA 4ZOLA 2UVDA 3DJYA 3DZCA 3ZBUA 4EOGA 2X19A 2B34A 1O9BA 2HSEA 1N6PA 1QFYA 4J0CA 4PGHA 1ZKMA 3OZEA 2EW1A 3IOCA 4MWTA 5IDVA 1FNMA 3RUPA 4E09A 4PN7A 1LY1A 2YWBA 4JP1A 3U17A 2Q2VA 2FUG1 4H6WA 3OIFA 1N8NA 4FBGA 2ICAA 3MAAC 3ELDA 2E21A 1C9JA 4U0KA 2QPTA 3L0OA 3ER8A 4WBSA 4HX5A 4WSOA 1SBIA 4KQWA 1FEZA 2HKIA 1WCWA 3RCBA 4RXTA 4GUAA 1SRQA 1YR1A 2P68A 3NTLA 4MR7B 4NI5A 4HYTA 5T4BA 1AUVA 3S7ZA 3NYRA 3DPSA 4KXYA 3B60A 4XD2A 1NBIA 1BE0A 3MMPA 3B1YA 4PC7A 3CPJB 2MMCA 4M0LA 1JQBA 3KBOA 1T6BY 4URUR 1IPFA 1PNVA 2B5OA 3R9KA 3RUCA 1XF1A 3IBYA 1XVVA 1ZUIA 3T3EA 3ZZTA 1YDMA 1DQSA 5LR6A 2J5XA 2XNCA 2NUTA 3ACDA 5CFPA 3H8JA 2I8CA 4HHEA 3WLEA 1MEOA 2KI5A 2QJTA 2XUHA 3DV2A 3IE2A 2D4AA 3MERA 2GDZA 4EPYA 3MZ0A 4CI9A 2IEGA 3H6GA 2BHTA 2IRWA 4RANA 5FHRA 5CB4B 3AEQA 1SQSA 1TTQB 4Q3BA 1QOZA 4RLHA 1FJXA 1SEVA 2P1DA 2W6IA 4Y6PA 2JVKA 2JG3A 4XX0A 3PNOA 3U40A 1USUA 2QZZA 3SZLA 3WS7A 1T2NA 1ADYA 4AZTA 2IEZA 4CCAA 5I9IA 3C3XA 3F96A 4OHMA 5HPYB 1FP1D 2EG9A 1Z2CA 1FVHA 3D2LA 3TW4A 3ASUA 3STXA 3WQQA 4OU4A 3S1SA 1IIBA 2ZE7A 1CY6A 2HUPA 4Y67A 1J49A 2VHWA 1AQNA 1NQTA 2HJWA 2Q46A 4NMMA 1RKQA 5GIOE 5DHRA 2GBPA 5H3LA 1COWA 1U0NA 3LZ6A 1PGQA 3LUDA 2ID9A 5A3VA 1VECA 3I9KA 3M7IA 3ONEA 4DQUA 4BCCA 2EJWA 2HF8A 1Y9ZA 1UEIA 2I6GA 2V4MA 3L01A 3L6DA 4KP7A 4AJEA 4EB6A 2O3RA 3D6JA 3FYUC 1E60A 2IT1A 1ORHA 3OEWA 1B15A 4WN9A 4YJKA 3SXPA 3WGYA 4E1BA 1ULTA 4BV2A 4LF9B 4X60A 2WE7A 1J5EB 2XYGA 3KZKA 4P7BA 3KELA 1KMMA 1TYBE 4GQAA 2JIPA 3HXLA 1MC5A 1SR8A 5C1PA 1P39A 1EESA 1V5WA 3FVVA 3CPHA 4YRGA 5DX8A 2OO7A 3PYMA 1IEWA 4TL9A 3X1ZA 5KYYA 1TD9A 1EXVA 3HV2A 2B20A 3VTKA 2FOLA 4AMVA 2B0CA 2BVNA 4BV9A 3QOXA 4XIFA 3VYTB 4L02A 3TQQA 2I4LA 4U5XA 5D6NA 3UTCA 3I3OA 5KAMA 1ZRSA 2B9VA 3SKVA 5EGNA 4YYZA 5AVYA 3EXFB 4Q19A 3B5EA 3AF6A 2XZDA 3V2IA 3EIFA 1QX3A 1UBNA 3CLUC 4FWIB 1XTPA 2W2QA 1G21A 2C1EA 5BRAA 5BR8B 3DWGA 3V2GA 4LNAA 2Q2QA 3KEOA 4RPCA 3GI1A 3ENQA 2PSHA 4UBJA 3ZWKA 4YUYA 4DR7B 1FLNA 4RD0A 4EGAA 3ZHTA 4IBOA 5L95A 4WOCA 5E1OA 1FDRA 4FCWA 4RJIA 2D5LA 5KSZA 2I2CA 5IMBA 4EMSA 4NWIA 2X3UA 4NCAA 3L04A 1FFSA 3P20A 1W4BA 1NZJA 1PVDA 3ESDA 2IY7A 4JT9A 5EPUA 4IFTA 1Y1PA 5JS8A 4D81A 1QHFA 4JXZA 1DS6A 2C97A 2WIJA 2J85A 3O73A 1M1NA 3IVXA 1N2OA 2C8KA 2XF8A 4ZEXA 4QU5A 4MKIA 2RGYA 3FPEA 1Q83A 4DR1B 2AI2A 2HWUA 3S4YA 3TIGA 1EUDA 4JBLA 3RBAA 2J08A 4I1UA 2G06A 3IB6A 2YOGA 1BXZA 4DZZA 4ITVA 4CG1A 2ZB7A 3V8EA 4EJMA 1GUYA 3Q7IA 3RVDA 3ZWOA 5CT8A 3WNCA 3K6RA 4FDTA 4TLMB 4AK9A 5JNLA 2JAPA 1YI0A 2R8PA 5B37A 1MQ9A 3SNKA 2XDWA 4AO7A 4FTWA 3T9CA 2QX9A 2X2EA 2BT4A 2VJNA 2ZWVA 3M9XA 1Q7EA 4ABYA 1E89A 4BEWA 1OGYA 4X61A 4YQEA 1KZHA 2WAAA 1P1RA 1I1OA 3Q8MA 2ZUTA 4MVWA 4UFPA 5GGYA 1IG0A 3A32A 1P6XA 1XXHE 1PJLA 4F4IA 2PH7A 3IX7A 4PZEA 1VCOA 2NSJA 3FYHA 3RK1A 3LLSA 2GXSA 4AIRA 3OZCA 2GPAA 3M2TA 4ZOCA 4LAFA 5HE8A 1ZNWA 2V7TA 2VN8A 3H7AA 4LQLA 3VDQA 1WB5A 1A4IA 1PEDA 3G7NA 3L7CA 5EUMA 3VR2D 4AX4A 4YCMA 4TLBA 3RUFA 2PS9A 4HDOB 2BEWA 4EY6A 3ZV5A 1EK0A 2JJYA 3QENA 4TVSA 3HCAA 4HQLA 1BWSA 3IP9A 4MKRA 1IULA 3CV3A 3IHTA 3QQ5A 4FZRA 3L0ZA 4YMSA 5B6PA 2PRYA 5EP2A 3S28A 3NHKA 5C2JB 5C5IA 2IYWA 3F8SA 4KEAA 3HN6A 2YV5A 1WDKA 3QFHA 4MX8A 5FHQA 2ES4A 4DLAA 1TUGA 4LYDA 4BQOA 1KAEA 2HHCA 3NG1A 3U80A 2ANBA 2GN9A 3FHJA 4ME6A 2CDRA 4EGJA 2QV0A 2RARA 3O3CA 1VBMA 5K2MA 3OQHA 3ONNA 3JZAA 5J5CA 2OQRA 4CMAA 5G53C 1WB6A 2PL3A 2D06A 2XQJA 3VZPA 2JIBA 2Z83A 3HB9A 4BV3A 4F5YA 4MR8A 1OJLA 5AW5A 1CYEA 4IXMA 2GD0A 3EWSA 1OYWA 3INRA 1ABBA 5FWDA 1Y8ZA 4GYYA 5C8YB 1LW6E 2H1WA 1NJ1A 3EA5A 3GMSA 3QHPA 4GM1A 1VKHA 4OKSA 3O8RA 5HIKA 2JFHA 2HY7A 3A9UA 3COPA 5EWLB 1SCQA 4DARA 2GLUA 3QU4A 4RS3A 4AICA 1ZH4A 3WNQA 1NAIA 5ALEA 4A8PA 3U5ZB 1JAIA 1ISRA 3ORRA 5FX2A 4EPVA 2YR0A 3WGIA 4HAYA 4GICA 4K9OA 4D9EA 2RBGA 1JRLA 4O08A 2QN1A 4A03A 1QFJA 2J5QA 1YDFA 4OL0A 1PYDA 2VDRB 4P6VF 5JRDS 2REXB 2X1LA 1CZHA 3FLBA 3LW7A 4YJGB 4LOJA 3GZJA 4HMQA 3GFOA 5A3RA 1FIUA 3LD9A 4I1VA 1WW2A 4YRCA 3BRWA 3EEOA 1V9CA 1PVOA 4D26A 4MW6A 3AFMA 3LI2A 4Q7EA 3IODA 4PPFA 2FW1A 3TFWA 3L2OB 1QG4A 1AO0A 9LDTA 1KK1A 4FX5A 1XMOB 1SZDA 2FB9A 3IHWA 4PCLA 4ZCSA 1TYZA 3D5EA 4MV6A 3RTBA 1WBBA 5FD8A 1HFKA 3AEUA 4MPDA 1Z35A 2H07A 3ER9A 3LQ4A 3V9AA 4OB8A 2RAFA 1V6CA 5K4GA 1NXSA 2HGZA 5CM8B 2I54A 5BSRA 4DLYA 4H1WA 2V7VA 4R7GA 4ZEWA 2FRVA 1XMPA 1PBTA 4P0PB 1HLFA 4HEQA 4V0OA 4XASA 3ZWDA 4X66B 2V9PA 3GCDA 2H2HA 1YUBA 1KYWA 4PGMA 2WVJA 3BE4A 2WD9A 3H5AA 2PS0A 2JLAA 3MCVA 1FF9A 3E1SA 1H8ED 1FUEA 2YMQA 3PX2A 4LRWA 5CJPA 3PSHA 1E1DA 1OZFA 2E55A 4J16A 1QV7A 4DREA 3URKA 1DPGA 4C03A 2P90A 3I5XA 3WKEA 4REQB 1Q17A 3OCXA 4O2BA 4D4IA 2AZ4A 5K0ZA 4C2AA 1SWVA 1QS0A 3EH2A 3FNEA 4NMLA 4B3DA 4FDVA 5HGXA 1T13A 4M55A 1M73E 2X9VA 2FQXA 1RLJA 3INGA 1GY8A 2FG6C 2PY6A 3IAFA 4GM0A 4MUFA 3TEJA 4EJ2A 1DMRA 4IKOA 4PRKA 2NU8B 3X1YA 3RHZA 4PU0A 3BGSA 2FEMA 5DHFA 4OREX 1E1MA 4E12A 1RQRA 2O19A 5CVDA 2WLSA 3DZJA 2CJFA 1O97D 1QR6A 5LPNA 2IOFK 3VC2A 1SCAA 4HNQA 1XK7A 4FU0A 4WX2B 1GKYA 1ZUHA 1AQJA 1M5RA 3JRWA 1AE1A 1RRGA 3IJEB 4I6GA 2J6IA 1YXMA 5C32A 3DZGA 3EB9A 5CURA 1FMTA 2Q5CA 2PBRA 4KPFC 4B84A 4J0QA 4LRUA 2XKKA 4JJ4A 3PHHA 4UBNA 1DQYA 4G25A 1A5AB 4W8GA 3ZX4A 4D8XA 2IIPA 1XGKA 2HLHA 3PFGA 2O8FB 4RKFA 4TKVB 5HBRA 4FP9A 4YT2A 2NMVA 4FMDF 2MSWA 2ZSJA 4ZU1X 3U3OA 3Q3CA 2DTDA 4PINA 2RGDA 2DPLA 5KDLA 5LOVB 1G7RA 2ENWA 3PSAA 1E2GA 4GX0A 3K8OE 3KOUA 3M5PA 1CS0B 3ITEA 5D6OA 1Z5GA 1OLOA 1MO5A 1JE1A 1XKTA 2EOAA 2VSOA 3I37X 3I72A 3KJZA 4GUDA 3SZ3A 3TTWA 4H0FA 4BGUA 4JLUA 5IH7A 4G4SP 3M4XA 1KC1A 4QYIB 3KQVA 4RZQA 1VPWA 1PNTA 2V55B 4ZC8A 5BRJA 1JZSA 2ODAA 4UUNA 5FI1B 3SWWA 2AW3A 2VH1A 4CCWA 2PL9A 4JL8A 3SCZA 4YAGA 5IW8A 4MVCA 4XYEA 4EVQA 2X5KO 3T1QA 3GROA 1A8IA 3PDIA 1T2UA 3SMQA 4N7JA 2WAYA 4PZCA 4ML3A 3U7FB 3L3BA 2F9LA 2VBCA 4XGKA 5K6TA 3E48A 3IBTA 3KEFA 4L5BA 1H42A 2JD1A 1BH2A 1Z0DA 3F5MA 3IRVA 5LMUB 2VDWA 1GTRA 5C1OA 2XODA 1YT5A 4P4TA 1JPNA 5DBHX 3OKPA 4AKHA 1JLLA 2XDAA 5EERA 1ZZEA 3GD7A 2XSZD 4K1XA 3GFRA 4U5QA 5FULA 3CF4A 1CY4A 1X7ZA 3GHYA 3M3PA 1PTJC 2X0EA 3UG6A 4JC4A 4BTVA 3TD6A 2LBPA 1Z38A 3HRKA 3M1LA 4K5QA 1ZNZA 4BX8A 3H05A 1AMOA 1Z0FA 3U60B 2FQWA 2X40A 2ZUCA 3UV7A 1ZMBA 3AVPA 4X63A 1H2FA 2XMSA 5DE3A 1PFQA 1XEWY 2Y0BA 2BCJQ 1TUBA 1WXDA 2PCLA 2ZVJA 3DQPA 3ZKWA 3UGJA 4IAOA 2QNIA 1M8GA 4KW7A 4TTQA 4UBMA 3ZGLA 4KRYA 5FDFA 3CIFA 1I4DD 1WXFA 2NUPA 1BQ3A 1EDZA 5DLEA 1FS4A 3CW9A 3EULA 4OP3A 2G17A 1CETA 2B7CA 4HNHA 3TK1A 1G4HA 3NBXX 3SE0A 1PV4A 4U6SA 5F64A 4C43A 1NBMA 1PG5A 2PRSA 5ADUS 3GWGA 3PGA1 4WV3A 5EJ7A 5BQPA 4PBTA 3UCFA 1EGMB 4OHYA 1YI8A 4B35A 4DIOA 1GV1A 3AP1A 4DMKA 5AW3A 1OH7A 3IOEA 1JEYB 3AVXA 2HBQA 2GTPA 3N0XA 1FC0A 2OFFA 2PLAA 4JI3B 4JJZA 4GR4A 2AXNA 3OU2A 3RQIA 3WYFA 2AK2A 4C4RA 4B44A 2G36A 2PLNA 1U65A 1BHJA 5B1DA 1PLKA 2VYFA 4EYGA 2A9PA 3PIIA 1HTTA 4P92A 4EZBA 2FV8A 2R7AA 3K1AA 2P2DA 3QPCA 1WTCA 3AF4A 4N0MA 4KX5A 3DHYA 1NVTA 2GBCA 4KL8S 5CMLA 3W8NA 5EP3A 5JPCA 1NY5A 1KAOA 1U8XX 2WP0A 4TKUB 5BQ3A 3U16A 4HDSA 3IMCA 5KSYA 2E4AA 2ARKA 3I01M 1M9NA 4WT7A 1DARA 1E2QA 2BCEA 3EGXA 1EIZA 3ROEA 4Z53A 4HH3C 1GDHA 2PS1A 5DSXA 1YCFA 3IEIA 4LF6B 1QCCA 4ZOLF 1CQJA 2PUWA 3V8NA 5JD5A 4L9WA 4OLHA 3A2NA 3SBEA 1WZIA 3H1FA 2E48A 2JJ2D 1K0UA 4BB9A 3HDQA 2PUHA 3GLRA 4HGRA 1WY7A 4QVGA 4U2KA 1DSSG 4XVQA 3RYIB 1R8XA 2WJWA 3AWIA 4YCAA 2ALJA 2JCXA 5AI6A 3L6BA 5FPTA 3M4NA 5T6BA 3BF8A 2NYVA 4MZXA 4OH1A 2BV3A 2GCOB 4KKVA 4RPJA 3RYTC 2PX6A 4ASUA 1R4MB 1U4OA 3AUXA 3PDJA 3R1IA 4QBHA 2JL1A 4AZ0A 1YQUA 3UK0A 3T5CA 4CQLA 1NFFA 3PNBA 1JQEA 1ZIDA 4FYHA 3HBFA 5ISMA 2I9PA 2RHTA 3TMAA 1CUUA 1JZQA 2OXIA 1SKYB 1UQTA 3IDSA 1Z18A 3VNBA 5LDDC 1I01A 4BZXA 1QZZA 3W3AD 1I94B 5ESDA 1UFVA 3EASA 3I9OA 1EFKA 5EKSA 1F8XA 3A27A 3ZGNA 2JIRA 2J09A 4BP1A 1W1WA 1E7QA 1XZAA 5IANA 2BEJA 4A6EA 3R7FA 3ZWPA 4DG5A 4EELA 1ZI9A 1E63A 2PQMA 4XJXA 5ALKA 2BC9A 4X7MA 4PHTA 1NNLA 5FB3A 4ZCLA 1VA4A 2XMZA 3F5FA 3QKUA 4UZSA 3ADCA 4I1SA 3SQLA 1V6AA 2C5HA 4TTJA 1Y7PA 2FAXA 1T3TA 4RZSA 4Y7CA 1RBYA 4FEAA 4DKXA 1OFUA 1JHPA 4BQNA 4KXUA 4KFTA 4R2KA 4RKQA 2CBZA 2G25A 3CLSC 3VPBA 2MINB 1ZM9A 1A2OA 3E7DA 4QU8A 2B8TA 5TC4A 1YQXA 1QCYA 2XT0A 2FI1A 3ROFA 2X5NA 2FW0A 3KVRA 1CJCA 1N2IA 2OWEA 3HDTA 3SM9A 4EFNA 1F12A 1A97A 4V0MA 4AYXA 5BNIA 5A4AA 3V7UA 3RSFA 3AI3A 5EHQA 4KREA 3QVGB 3ST7A 1P80A 5FEUA 5TPWB 4BQQA 4CU2A 1WKCA 1JHUA 4BZWA 4ZDIA 1WXIA 2AZTA 3IA7A 5GONB 3N6XA 3TQCA 1LPBB 1N0IA 4DOMA 5GTDA 2O06A 2PHZA 4RCZA 4OHOA 1I30A 3QMMA 4IIXA 3PHGA 4YP5A 5GOTA 2VDMB 3RJMA 4J76A 2YN0A 3E9EA 1E79D 3GJTA 3JATA 3UMFA 3D4IA 3BRSA 4C87A 1VG1A 4CIAA 2ZJ2A 2BGIA 5G3ZA 1JHVA 4Q12A 3E6AA 3S29A 3ZXYA 2FETA 3D59A 3QPWA 1L5KA 3C7TA 3HN7A 3V8VA 2FUG6 4U63A 4Z4CA 1NIJA 2C4TA 1HXHA 3K2QA 3CIOA 4D8WA 5KYGA 2XCTB 2XGSA 3K71B 3C0KA 1R9NA 4X97A 5E6UB 2VTVA 3ZTYA 2NUTB 1MRZA 3BH0A 4KR9A 3BPSA 1GL6A 3KQQA 4CDRA 3PNKA 2M98A 2WSMA 2XR1A 1V95A 2AX4A 3BK7A 3QELA 4G6ZA 4G84A 4HATA 2KM1A 1X19A 3DE2X 1QAMA 1AUQA 1HM5A 3H8SA 2ZB8A 3PFKA 1POWA 1JLLB 1ISMA 3W5CA 4ECAA 3W6UA 1P73A 3PNMA 3R9WA 2UUOA 3H17A 1JBQA 3DMTC 2CFSA 4GBED 1GTSA 5DMXA 3DZFA 2C3MA 5AOVA 1JR3E 1TADA 4Z0TA 5TLSA 1MHPA 1R18A 2Q9UA 1R6TA 2VAPA 5EZ6B 1MW8X 4EA9A 1EZ1A 2CXSA 2OORA 4W5HA 1WCIA 1ZONA 1CUWA 3OU7A 2V7GA 4LG1A 4QELA 3K2BA 4FMCF 5BSWA 1OUMA 2A5JA 3DHEA 3VPAA 2RGGA 4CCYB 5JAHA 4TUYB 1R5JA 3MEQA 2ZBGA 1DC3A 4A0FA 3QE9Y 4C7VA 3H5LA 4NBNA 3MD9A 4UU8A 2O2EA 4KFCA 3GMDA 1YWGO 3R3YA 4ZEOA 2DQSA 4DYHA 4YMVA 3IUMA 4QARA 4KNVA 1QAOA 4M9UA 4NOJA 5K3SA 4B76A 3HXMA 4EPWA 3FCUB 1RLIA 4UJ3A 2VTKA 3HNRA 1QP8A 2H9AA 4QNMA 1RBMA 1AZWA 4LXGA 5JDIC 3OC0A 1ZXXA 3PUHA 1KI9A 3I3SR 4HXGA 4B6FA 1Y1KE 5FIUA 3T99A 3RIXA 3LBHA 1FUYB 2VVTA 4LISA 5JAIA 2WT9A 3O8LA 4FQ5A 3GEMA 3ZJ5A 1SUIA 4HQ6A 4TM7A 1TZKA 3DV9A 5H70A 4HLCA 4R9VA 4P58A 1RQGA 1KPIA 1NUAA 1OTXA 2BFOA 2J5RA 2VPIA 4JVLA 1V5EA 3L4EA 1K2WA 3O0TA 1QLWA 2R87A 2NO9A 3NANA 1JFRA 4KNYA 1QQBA 4GMDA 3QWAA 4E22A 2JLCA 1GZ4A 3EXFA 1KJWA 3COWA 3D02A 5K9ZA 1I0IA 1N2CB 4KNWA 4ESVA 3WP0A 3UPUA 1G21B 2BM1A 4G01B 3EXHC 1NVBA 3ZWVA 3LGAA 3I1FA 1YMUA 2ON6A 2PBLA 2UZ3A 4FXPA 3W5UA 2CLFB 2GFHA 2VUHB 5EJFA 3VZBA 3DFKA 4D0NA 3L7LA 4J0JA 3G88A 2X7JA 2ABWA 3MWGA 4JELA 5K0CA 1GZ7A 4O02B 4HNGA 3WI7A 3T5TA 5B7PA 2JLZA 5LWQA 2P4SA 1G3UA 1GA6A 2B2NA 1RJDA 2XRMA 1E2UA 3B9PA 1X3LA 1M2FA 4IIJA 4JX9A 1QCZA 4PG4A 1GEGA 2NTJA 3U3JA 2BISA 2H57A 1A82A 1JKJB 2QVXX 3AUJB 1HL3A 1XQ6A 3N0RA 4P22A 4DA4A 1XAIA 4BMSA 1U0LA 3EZGA 2HCJB 2B7BA 2AC7A 1C30A 3CLKA 2QQFA 5BUSA 1U3FA 3L8EA 2WRZA 3RSSA 2MWMA 3HMKA 1R2QA 2OO5A 3LW8A 3EXIA 2Q1WA 4ARZA 3TKLA 4RPKA 5K3FB 4LXHA 3WNBA 4TYWA 4NJEA 4RGQA 1GGNA 1ZHHA 2EEPA 4CEIB 3U0VA 1SUCA 1TCCA 3R0JA 4TXHA 2D7DA 1U9IC 1ZU4A 4TZ6A 3F98A 2OQ2A 2J48A 5K3FA 1EFAA 4NZZA 2P5TB 3JARA 3OMXA 4UE6A 2BFPA 1N8KA 4QDJA 1VKJA 3KAQA 2Z4SA 3C70A 1WV1A 1KKMA 5ALXA 2NVUA 4RXUA 4TSFA 1L5OA 2W2OA 2XGGA 1KSHA 4ZARA 3BWXA 3QY9A 3RRNA 3GP8A 1N5KA 3NT5A 3WYDA 3EVEA 3AEUB 4BCBA 4EF6A 3EY9A 3KV3O 5EINA 1RYEA 2PR7A 2ZT7A 5EJ9A 1TFUA 4Q3DA 1OCEA 1E62A 5D86A 2XOEA 3Q7QA 2RAUA 2ID7A 1SIWA 3C7DB 1EGHA 4AX8A 4EGSA 5H02A 3G23A 1WQ3A 5YASA 3ZV7A 3N0VA 3ZVNA 1JIUA 4LGCA 2XD4A 4IHJA 4J0GA 2QUHA 3SC3A 2NT4A 1ST3A 4C2TA 3HFRA 4EFDA 1ZLXA 5GY7A 3RB8A 2IS2A 2F8MA 2XYVA 3AL2A 1VLZA 1B1CA 3NFYA 4ZQEA 1FE8A 4TYMA 2CHGA 4MIYA 4RWEA 3KLMX 4OFXA 1C8LA 1VIMA 3UNXA 2WZBA 3EQ8A 1ZQ1A 2JAOA 2WM2A 3Q72A 2QB5A 3FGZA 5FT9A 1JJIA 3ESRA 5K7SA 3GDFA 4NICA 4MV1A 1CZLA 1H3FA 1UJMA 4PYMA 2WUVA 3TAXA 4BMXA 2HMUA 2H2IA 3OM1A 4EENA 2FKAA 4KWHA 3QEOA 4LZPA 2RGUA 4X44A 3STUA 3KE8A 4NR0A 2PR2A 1PO7A 1V1MB 2YVAA 2OV1A 3T4EA 5IS2A 3SHTA 2DM6A 3ECCA 2XDQA 4LOLA 4O4JF 1ILEA 2ZWIA 1TJ5A 4YUVA 3UB2A 2A1UA 2DR3A 2MOKA 3PRHA 4ZAZA 3FXAA 2EQAA 1VPVA 3IUQA 1GNRA 3MCUA 4DADA 3UJ9A 2C82A 1QH0A 2QL7A 4C89A 4EJSA 1EJ0A 2AK3A 2GJSA 3G5UA 3M6XA 3I39X 2XTJA 5BXYA 1U02A 3E22A 4N1AA 3AF2A 2IOFA 3BS4A 1V8OA 3EYAA 1J2EA 1DUSA 2H4FA 2HK8A 1QPGA 2O2IA 1KZ7B 3JQ9A 3QOFA 4B33A 1SWWA 3KX2A 1C9KA 3R6TA 2Q9CA 4UOEA 4C6TA 3WL6A 4URXR 2WY2D 4PR0A 4YCNA 1PQYA 1BVUA 2IBSA 4R3UC 2G80A 1ZN7A 2BFDA 3TJRA 5A3SA 3KKOA 1VLQA 5B5SA 2XE6A 3EMKA 1T26A 2XH8A 1A2KC 2AMLA 3TLGB 4CCYA 5BWOA 4BNYA 2WTNA 1M34A 1ZCBA 5E7MA 1SXJE 1SU4A 4A7PA 3TZEA 2O8CB 1XMQB 2PZMA 5TQ2A 4DPLA 1JU4A 5HDBB 2ZW9A 3I01A 1TGVA 4TYNA 2C04A 2Y6UA 3Q5DA 1TMOA 1GPDG 1WQ1R 4M2LA 2IV2X 4C4TA 2YWEA 3P2YA 4Z4HA 2QUJA 2FPXA 2JI4A 1FDIA 3A11A 2YOHA 5DM0A 2D1RA 3HUTA 3FUXA 3NDJA 4HYYA 4PZPA 3NBAA 3MJTA 3JQEA 4X3PA 1KDVA 4F3CA 2QMEA 4ENWA 1NMXA 1T4DA 1QGOA 2XJ9A 1DRVA 1AHNA 4F46A 3QVOA 5AHXA 1DAEA 1EVLA 4XOUA 4CI0B 5JD6A 2IPMA 4EVIA 2ZTUA 4XM2A 3OMLA 1YS2X 1VG8A 1Z62A 3I8OA 3SN6A 4C7OB 4WZZA 3GAAA 1A8HA 4AZ0B 2A1IA 4GLFA 1TMYA 1S6YA 1U7DA 2FJ0A 3T1NA 1G42A 2QL9A 2YVUA 2ZTMA 2E6KA 4BZQA 1JR6A 1DHTA 2QRQA 1BE1A 4E08A 2A30A 2OCPA 2RHRA 1JN0A 3DG9A 1FS5A 3H4MA 4HH1A 4QFDA 3LUCA 4BKUA 3ISTA 1CPYA 1EGQA 4M1SA 3Q4GA 4YDSA 5F9FA 1H2AS 1WAMA 2YWFA 1X1SA 3RT7A 3HU5A 5ECDA 5FBZA 4AP5A 1NVVR 1YB6A 5J4KA 1FX1A 1IBSA 3BM5A 4BLRA 3OOWA 4DC0A 1PJCA 1U0GA 3B3FA 4O4JA 4BWFB 3V32A 1MH9A 4FW8A 5TE9A 2QAGA 4XI9A 3EFOB 5DN9A 4DQLA 2XXBA 5KWJA 2CCGA 1PJBA 3OF2A 1DCFA 2QMUA 4I08A 4OIFA 3NHWA 1P7YA 1SN7A 4XGRA 1KSFX 2HCTA 1GWNA 3FDIA 5FOXA 3UWKA 5HF8A 5CD1A 3WGHA 5H68A 3DBIA 1HLPA 3JQ8B 2KYRA 3SYRA 5SZKB 4Z1OA 3R3HA 4UNQA 1NUSA 2FSPA 1A9PA 2NVOA 3U7HB 1J20A 1MC8A 2FW8A 3SHQA 1ZOLA 1D2MA 4P5PA 4ARZB 2W9XA 4OJKA 4EG0A 3KEMA 1SCIA 4DLZA 1L4LA 3IT2A 1TCAA 4A0HA 2I55A 2JGFA 4U7TB 4QODA 2IYLD 2PGDA 3KFXA 5J2UF 1XD2A 1X1BA 4J0KA 4UNIA 3OQIB 5K3AA 3L6UA 1TEVA 1C3OA 1W25A 4XX1A 4UVIA 4CTKA 3ICCA 5DYGA 4EATA 5BSHA 3JWGA 4QBTA 4DT1A 3OLXA 1LPNA 1VKRA 1WMFA 5K3BA 3C5VA 1UPXA 1XTKA 5DHUA 1PD1A 4BPRA 4MUJA 1ZJZA 3ADDA 5A5GA 4DMCA 5LOVA 1OH5A 5KOIA 4WOKA 4ZI3A 2QW0X 2SECE 5I48A 5HKKD 2R4TA 1NR5A 2Q2NA 1NDHA 3EVTA 4MGEA 2YHIA 4A8JA 3VBCA 1TZCA 1VHTA 3VR0A 4DBZA 2E4YA 2NO1A 4IVNA 5FR1A 2ZETA 4M6WA 2F4NA 4QEKA 5AKGA 1F8GA 5ITWA 1RJ9B 3S70A 4ILEA 2WZQA 2JANA 2F64A 4MLDA 4ZKEA 3ZS9A 2DHQA 4HRAA 5E1DA 2OOKA 5DBGA 5IVPA 4RTNA 2VZ8A 3K73O 5LQCA 2PXAA 3M6WA 1DC6A 1W6RA 3TD2A 4C3VA 4ESEA 1M1UA 1X3SA 2AFVA 4Q00A 4Z8YA 2J32A 1DIGA 3H1TA 5K6AA 1EFPB 1HYHA 3IOMA 3LY7A 3WYGA 1F6DA 2IYNA 5KYXA 2QR5A 5CXUA 4PQYA 3H11A 4AD8A 2WU3A 1GKKA 2ZAIA 3EDCA 1I3KA 2PKYX 4KTVE 3NALA 3ZE2B 2B9EA 2OHVA 4BEBA 2DH6A 4N3AA 1UFOA 2D2EA 4DBVO 1EG7A 1T3LA 2FR1A 2NXCA 5ELMA 2XB4A 2CHUA 2EDAA 2GK7A 4NJMB 4AURA 5E4TA 3UXYA 1HYBA 1Z34A 1OWOA 3U4QA 1U9CA 2DQ4A 4M1WA 1A8SA 3E84A 4ED9A 3KR2A 3QVSA 3WFZA 4YPOA 1AGXA 4LWPA 4TWZA 2PRIA 4B4VA 5DNCA 4D9FA 2YY5A 1ES9A 3EPHA 3WAGA 3RFCA 4ZCRA 2AGVA 1GD1O 1TVMA 3EHDA 4HAZA 1EZ4A 4LYGA 4LDAA 2PMBA 2CLHB 5GV8A 3RYFB 3X43A 3G2QA 3CUVA 2ZJOA 4LXYA 1GL3A 3NX4A 3W90A 1R6BX 3NKFA 5J2UA 1R0YA 2EBHX 2GF2A 3JXEA 4RHTA 2QN3A 2OEPA 1SO8A 4JIGA 2VCHA 1Z33A 3RJ9A 1KI6B 2H29A 3CO5A 4MVXA 5DEOA 4EUSA 5T8KA 1U4NA 5I4CA 1DADA 2PMDA 1T2VA 2P6PA 2E6UX 1G1MA 2ZS7A 4AJNA 4BFXA 4RHEA 3KP1A 1ZL0A 1Q0ZA 4EL0A 1LF0A 4UNRA 3GLTA 2WG1A 2DPGA 5TARA 3VUFA 3OAAD 1GZVA 1E8MA 2GZRA 1S3SA 4DY6A 4OQYA 1Z45A 2JA1A 3FN4A 5KNLA 3RC7A 3NHBA 1GPH1 2PCJA 5GINE 3BD6A 2ZI4A 1N2XA 5F3DA 5SY6A 3HB7A 1XZFA 2HFJA 5TMBA 2QWXA 2VI5A 3TRKA 2BGWA 3W2EA 1QB8A 1DRJA 2ZRLA 2DRIA 3ADOA 3IQXA 4EEKA 3GJZA 5IC4A 3HWWA 2B1GA 5FH9A 4XGNA 1HR0B 4FR5A 3I6YA 1Z47A 4WCFA 1FJGB 3K5WA 1GA4A 5KNCH 1FNBA 3G0CA 4BNXA 2B92A 2FFRA 3TRDA 3ABRB 1T36B 4L28A 4BMDA 2CZQA 2F3RA 2PFKA 2JD0A 5NLLA 6LDHA 1BJRE 3I42A 4QNNA 4RFLA 1GZ6A 5JYEA 1WABA 2R1ZA 3ZHBA 2ZT8A 4WL0A 2WWFA 4A15A 1T6ZA 1YJ5A 2ZYVX 3IOBA 3KAJA 1W5FA 1UK7A 1BW9B 2G82A 4C4SA 3NWEA 4CMHA 1QRSA 2OD9A 2FRXA 4HMOA 1E6KA 4TMKA 3ETEA 4C76A 3J80A 1KP9A 3D8SA 3U1BA 1X7WB 2AMJA 5ALGA 4PLPA 2J7PD 2J9FB 3DDHA 3EZ2A 1QP7A 2ZE6A 3VO2A 3BEOA 5JANA 3F5DA 1VE1A 3KEQA 5GZ1A 3KZCA 3K1YA 3FHTA 1PUXA 4Y2GA 3A6PC 5G1NA 1H0RA 3IQHX 2D1YA 1EWYA 3MWDA 3OFVA 3W1WA 2XW6A 1IQUA 2I5PO 1R37A 1BXGA 2JJ1D 4YO7A 2GPSA 3Q5GA 2IYYA 2QY9A 4OHFA 2OUKA 4Q9AA 4BE4A 4OA5A 2HO5A 1QE5A 5EJ6A 3T4UA 1MT3A 5AKYA 2ZSAA 3RS5A 2BMDA 2C03A 3OD1A 3ZXIA 4CFSA 3Q8LA 1ZH8A 2IEYA 3OEYA 1U31A 3ITKA 1VYVA 3RSCA 3RW9A 1UXIA 1ZJ4A 3K9GA 4OMCA 3NHPA 3N86A 3PNPA 2D4HA 3I45A 1OLUA 3ANMA 1HYQA 3DBVO 1C0KA 1NM5C 1TLTA 2VWHA 3D7LA 4TVOA 5EC8A 1J24A 3ZDXB 1A9XA 1Y3AA 3THXA 2G9UA 1Q2XA 3ANSA 3FMIA 3WIVA 3B2NA 2BL4A 1ML3A 2A7QA 4G5XA 5TMPA 1N2GA 3JYLA 4G5YA 6Q21A 4LOAA 4IINA 5ICFA 3DLHA 2Z5LA 4TRNA 5CCDA 3G2HA 1VE6A 1XPJA 2O23A 3QXCA 3QVGA 1JW9B 1R0ZA 4LVOA 2H1RA 3M89A 3BF7A 2GYVA 1DX9A 3MM4A 4FUQA 3TLYA 1XJCA 1YFLA 5TS3A 3E0XA 3PLRA 2DOKA 3WQRA 5IKMA 1A9YA 2ZYGA 1ESMA 1EP9A 1UMDA 2CSUA 3ICOA 4YMUA 2JLYA 1XTJA 1MENA 4L0MA 4UZEA 1JKFA 3GNLA 4NNPA 4ZALA 4G8BA 4F7DA 3AQIA 4MVJA 2ZZNA 2H5IA 3EBLA 2O2HA 2ZSKA 1JSZA 2A78A 5CBKA 5FWYA 1PR0A 2ZWOA 4P3NA 2RHLA 2GAAA 4N5HX 1LZKA 4FFSA 2AYXA 1Z5ZA 3NV9A 4QM7A 1T9GS 1OXSC 5CHEA 5AK5A 5KS2A 4TTPA 2Q6LA 4F9GA 5LQMA 2FZLA 2NADA 4E11A 2K87A 1E1RA 4YP1A 4BX9A 3MUNA 4ZO8A 5FOTA 1VJ1A 1Y3BE 3PENA 4DMGA 1MC4A 1ZCJA 4RVDA 1SQ0A 2EZ9A 3D3JA 5G4KA 4ZQFA 4FNOA 5EIBC 1YR9A 2VWQA 5JCOC 1TA0A 1ZG3A 3NIBA 4IIVA 2J30A 5KTRA 4NEQA 4AJPA 2WOOA 4M53A 3QSGA 4R8VA 4GMKA 3MFYA 3PHBE 2CNBA 2CB0A 4CGYA 5KHOC 3ZWCA 5AKKA 1W35A 5TR9A 1LW7A 4OFBA 5MFPA 2C8JA 3SBOA 3C45A 3H75A 3LKDA 1MC1A 2ERYA 2Q4RA 4UHBA 2HDOA 2WU8A 4MQ4A 4PFSA 4LN1A 4XR4A 5AVZA 1AUPA 1FU7A 1KEEA 1RQXA 4NBVA 4QX6A 1I2AA 1JPVA 1SEPA 2VJBA 4QZVA 1Z16A 5EMHA 4OHVA 3N2KB 4POOA 2DLNA 5FA6A 2QIPA 2QRLA 2W2MA 2XBLA 2XB8A 3BBLA 4XWYA 5DT2A 1AZLA 1ODLA 1EE9A 1TYEB 2XV1A 3KWLA 4WUVA 1CY1A 3RYHB 2IGTA 3OE7D 1A4RA 1QHNA 4HWTA 5ALNA 5EKTA 4DUGA 2O8CA 1ZUWA 1VMDA 4DCCA 4BUZA 2VDVE 2C31A 4JJEA 3OOSA 4OP2A 1R0LA 4DZRA 2VLBA 1WMSA 3UTDA 1EXNA 2BMEA 3UWMA 3WQHA 4EM6A 5JXGA 2FNAA 5LBUA 3I0NA 2VXYA 2GZSA 3G2MA 2CLKB 1GU0A 1Y7LA 4LY9A 1JDZA 1UDCA 5EJ4A 3IP7A 4GLBA 4IMPA 1MEEA 2F43B 4O4IF 3UOGA 3J81k 3QU7A 4TZTA 1ZVVA 2CVQA 1FX0A 5JUWA 1B73A 2EF1A 4JA2A 2O20A 3C3DA 3QKRA 2O54A 4RHUA 3WBBA 1QQTA 5BR7A 1ZN2A 2EGUA 2MT9A 2WKSA 4RQTA 4JBHA 1ENZA 1WXEA 3SIPA 1HNZB 4OG2A 1OKKA 2AFIB 3H8VA 3BMQA 1YU9A 2JBAA 5ICGA 3AVVA 3P9IA 1I4LD 4RH1A 5LQNA 3X1WA 2HXYA 3D6VA 1DIAA 3LQKA 3MTEA 5AXAA 1DEKA 3DMPA 5CVVA 1L1EA 4NYMQ 3U44B 4F71A 3SD7A 4YFYA 3DOIA 4BAGA 3JWEA 4OQFA 1OSNA 5GJWC 1TYCA 3DFZA 4GT1A 2A1UB 4GI1A 1ZVQA 3ZGVA 3HJFA 1G8SA 5B53A 1HG1A 5HFJA 4HB0A 1NYLA 2LGJA 1N5IA 2NZXA 3JAKA 2GEUA 3LZCA 3V1KA 1IM8A 2ZRPA 4TXMA 5H59A 2GILA 2P79A 2QL6A 4XWAA 4R1LA 4GXQA 2R85A 5KQLA 4FHCA 4DS3A 3DF7A 5DRYA 5CW2A 1UIRA 4P83A 1UMKA 1R6DA 1T5TA 3SDZA 4LJ5A 2XE8A 3OZTA 4NYJQ 4ALNA 5JAZA 1MF7A 4OSPA 5C7LO 3FUTA 3BFPA 1QGUA 4W5OA 5CBPB 3SBDA 4EK9A 2JFXA 3HYNA 2HSZA 4CV2A 4HV4A 4WFIA 3CVXA 1UIMA 1VL5A 1I33A 1HZJA 1U1DA 2GEBA 3NONA 3OZVA 2QBYA 5DHSA 1AZTA 3FBTA 3U3KA 2AJDA 3TS1A 1IJEA 2Z04A 3H87A 1C3OB 2GCPA 4DIFA 4YRLA 4ND2A 8LDHA 1FXWF 4DWVA 2ZYIA 1LLDA 2ZJ1A 4KRXA 1QU2A 1XCJA 2IVFA 3IRUA 1J22A 3HU2A 1M6VA 7MDHA 1KIFA 4XSVA 3U7RA 2RGCA 2HNAA 4WN9B 1C2TA 1E9EA 5THQA 1K7EB 4QFMA 4NRDA 2JIDA 3T9BA 3A6ZA 4NFLA 4UM5A 2IE8A 4CZ2A 3WWDA 2QD3A 1U7PA 5KTTA 5I7SA 3LXXA 3GRPA 4WFKA 2XRZA 4K2AA 1V4BA 1VE7A 4OKIA 4BO8A 3VVMA 4BTEA 1UXJA 3IESA 3GRUA 4J7AA 3EXG1 1D2CA 3AFGA 4C0BA 1IOWA 3IQFA 4YT4A 3PRJA 2W48A 3BA6A 1XDBA 1L7AA 2C88A 2ECFA 2VP3A 3OJFA 1YI1A 3FKQA 2ZYSA 1EX6A 3C6YA 3WFIA 2QVGA 5G2OA 4ZVTA 2WICA 3K9LA 2IDJA 1B42A 4QLOA 3SAJA 3R3XA 2RAPA 4XVRA 4C7BA 1TQDA 3S1AA 2BEWB 3C3WA 4I1OA 4NKRA 1QJ4A 4MV9A 4EYSA 1ZR4A 4UASA 4ZFNA 1AH2A 4N5LA 1NI3A 1IONA 1JBEA 4LY0A 3T5PA 1CUZA 3W79A 2XVAA 2YS6A 3U56A 4GSLA 1G9XA 2WHYA 1WR8A 3GG2A 1O2DA 1N78A 4WKPA 1JKXA 5JO0A 2XGOA 1ONOA 1XCPA 4E5PA 1KZYC 1D1TA 1C7EA 3HO6A 1KOGA 3AJDA 1EMDA 3JQAB 1MDBA 3VJLA 1VP9A 1QMGA 3H1EA 1QDUA 2BIFA 4ZCQA 4CM8A 1E1NA 3QNUA 3T9AA 5WRFA 3Q0EA 3S6JA 1O0CA 1KMCA 4RSHA 4Z4IA 2QUIA 1IYZA 1R5OA 2OA0A 4B0OA 3VDMA 4LSMA 1UDXA 3Q11A 3AVYA 1UT6A 1C9DB 2A0YA 2AZMA 2XITA 5EA2A 3V42A 1DXHA 3EK2A 1S3FA 2QJOA 1KI3A 1NN0A 1CY8A 3ND6A 1NL3A 3IULA 4K28A 4KUHA 3UATA 4AU1A 4G5SA 5C4GB 4JI7B 2AOTB 3NR2A 1GCGA 3K2IA 1FSPA 4G24A 1GZHB 3OFND 1RAHA 2RG1A 3OIGA 1B0UA 1VJTA 4J3FA 4JVNA 3WIBA 1GTG1 4DLWA 2BKAA 3F2VA 1I2DA 3NTUA 4LHYA 1YB5A 2VCYA 3HGTA 1FP4B 1JDPA 3PUWA 4I3HA 1CUDA 5BPHA 3SVLA 1Z29A 1EVJA 1OFUX 1Q7BA 1Y8QB 1B3BA 1HL7A 3NCHA 4IQGA 1BVYF 2OG1A 4D9BA 5FLEX 3AR4A 4A0SA 4TZKA 1XRMA 2INGX 2HBZA 3R5JA 1UFQA 4QRDA 5GADl 4DC1A 2Z3VA 2OGUA 3HEMA 3MJVA 3R76A 4QM6A 2V59A 3RVSA 1NVAA 2SKCA 3MRVA 5HIJA 2PSFA 2XYRA 4C4OA 2IHVA 1BXRA 1TGYA 3JASA 3T54A 1FZQA 1GVNB 3QW2A 2KS6A 4HDRB 3W8FA 1GUDA 4TT3A 2D0DA 3LYHA 1PHPA 2HRQA 1FFYA 4BC1A 1PEAA 5DU2A 3IMEA 3CR8A 3WB1A 1OPRA 2PD3A 4PX5A 1RYNA 2F17A 3K09C 4C01A 4R1SA 1A27A 5DHQA 4Q39A 3UANA 4RHYA 1RJ9A 4NEHB 3I04A 3BMOA 2X0IA 3A25A 4MUIA 2QX6A 5G41A 4B6JA 1T4BA 4F93B 2VATA 3CA8A 1EAMA 1X7GA 4N8SA 4G4JA 1XFDA 2HRZA 3HSYA 5IULC 2AZDA 1WETA 1HF3A 1YE5A 2P1RA 4UTVA 2ZJ3A 3G85A 3QHQA 3D4OA 1V8ZA 2JLSA 3GLHA 5KNCA 1VPDA 1PDOA 4I4NA 4M9XA 5E2IA 5KOHA 3TN7A 2IZ5A 1KI4A 4K6CA 2UUCB 2WHRA 3G5LA 1YS9A 4JITA 1AGRA 521PA 4OFWA 5LB2A 1ODCA 5HQJA 1FDTA 2C2ZA 3K8YA 3PUZA 4IDPA 1MRSA 6AT1A 2X2OA 2I3GA 4DG8A 4AJKA 4FILA 2Y6VA 4XEHA 5HZMA 4G97A 4MMXB 3V4LA 1EBFA 5BSTA 2QORA 4JC0A 2VPXA 4YJHA 5L3QA 4Q82A 2RC6A 3TI9A 2P9TA 3BERA 2CT8A 2X6RA 5BV1A 1JU9A 4RX1A 5JXJA 1UBTS 2RHBA 5HK8A 3EZ9A 2EJVA 3O3NB 3PC4A 2OKCA 4G89A 4WK0B 1UADA 4Q4CA 4GKBA 5CCXA 4RM2A 2E5WA 4B2YA 3F46A 3RADC 2O0MA 3KKZA 1XO1A 4TSKA 2EERA 2I67A 3HBAA 4MRSA 5AJUA 3UAOA 1EK2A 4HRXA 4C0HA 1Y5IA 2O0KA 2R84A 1X1TA 1FY2A 3A8TA 4I9NA 5FUBA 3RTEA 4NX2A 2Y0PA 1VMEA 2WTEA 2WWXA 4JT8A 1U28A 1W36B 1O8CA 3FTFA 1NC3A 2RHMA 3PPYA 2J33A 4LV8B 4X6XA 5LP6F 2VSQA 3PA6A 3IDQA 4TX1A 1GG5A 1XTUA 3KT6A 5ERGB 1XDGA 3GG9A 1WMBA 2OENG 4QA9A 3HBNA 1ILWA 4TGLA 4E1VA 1UBSB 3MSXA 1WCV1 4ETMA 1T8YA 1VSBA 4Z9FA 1QFSA 4F2HA 5LM3A 1N77A 3V6MA 4H31A 1CZRA 5CX1A 2BH2A 2O8FA 1G9SA 1KS9A 2R00C 2BGLA 2VDKB 1XD8A 4ADSG 2PGXA 4FVTA 1HBJA 4PWYA 1JDNA 5A6VA 2HL6A 2WKWA 3H13A 4RL6A 3UMMA 4W5RA 1RRCA 3RE1A 1BFUA 4C29A 4HNAB 4CDMA 2YJ3A 2C2HA 3BMCA 3NWJA 2R1VA 3UIEA 2EFDB 3QIAA 3VDNB 4BLTA 1UMDB 3A70A 4HO1X 3YASA 3HHPA 3P7MA 4N9WA 4WOPA 2JEYA 1DAOA 3PJGA 1G7TA 1V3UA 2O0HA 4L0CA 3ZDZB 1BD4A 1G4UR 2HU7A 4TMFA