4KN5A

Crystal structure of a putative methylthioadenosine nucleosidase from weissella paramesenteroides atcc 33313 (target nysgrc-029342 )
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
235
structure length
235
Chain Sequence
YFQSMRYGVINAMAEEKAALVDAMIDEKKTTIAGKLFHHGKIGHVDVVVVESGIGKVASALTTTLLITNFGVDAVINSGSAGALGTDLRIGDIVIADYLAYADADARAFGYAYGQVPQQPARFKADTDLSNDLSESYEKVTDARLVRGLVVTSDSFIASNEQKQTILTHFPEAQSAEMEGASIAQVANYFDVPFAVVRAISDNANGEAGMTFDDFIVEAGQQSAQVLINFFEAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylthioadenosine nucleosidase
publication title Crystal structure of a putative methylthioadenosine nucleosidase from Weissella paramesenteroides ATCC 33313 (Target NYSGRC-029342)
rcsb
source organism Weissella paramesenteroides
molecule tags Hydrolase
total genus 80
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 3.2.2.16: Methylthioadenosine nucleosidase.
pdb deposition date 2013-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kn5A00
3KVRA 3E9RA 1A9SA 1Z5OA 4U2KA 4D98A 1CB0A 3BGSA 4G8JA 1RR6A 1A9OA 3O4VA 1ULAA 1Z34A 4TTAA 4FFSA 1Y1QA 1Z38A 4TXHA 4R2WA 5JPCA 4K6OA 2AI1A 4NSNA 5CXSA 4KN5A 4NY1A 4NS1A 4ECEA 1K27A 4R31A 1ZOSA 3NM6B 3LGSA 1JPVA 4QEZA 1JDUA 1T8SA 3EUFA 4TXJA 4OGKA 1PR4A 1WTAA 4F2PA 1B8NA 4TXLA 3C74A 4L5AA 1SQ6A 1A9RA 2B94A 3DDOA 1VFNA 1RXYA 1NC1A 1YQUA 5B7GA 3FB1A 3FOWA 4JWTA 4GLFA 3OZCA 3PHCA 4L5YA 4F3KA 1U1DA 1VHJA 2AI2A 1ULBA 4L6IA 1A9QA 1B8OA 4DA8A 3PHBE 2BSXA 4MARA 3ODGA 3U40A 3E0QA 1M73E 3UT6A 4R2XA 3E9ZA 3BL6A 4LKRA 3KVVA 5EFOA 4OJTA 3BJEA 4BMZA 5B7PA 3GGSA 1V3QE 1RXCA 1T0UA 1RT9A 4P54A 2HN9A 4D8YA 1PR2A 3LA8A 3F8WA 1JDSA 3LBAA 4OGLA 1ODLA 5CYGA 3K8OE 4L5CA 1OTYA 1Y6QA 4GLJA 4GKAA 4LNAA 1V4NA 1V48A 4E1VA 4F2WA 5CCEA 1LVUA 4DABA 1SJ9A 3TL6A 5ETJA 2IQ5A 2ON6A 2Q7OE 1C3XA 4QARA 4TXMA 1TCVA 4DAOA 1PR5A 3IEXA 4WKCA 1XE3A 5EUBA 1ODJA 4PR3A 3OOHA 3T94A 2QSUA 1OTXA 1G2OA 1ODKA 4WKNA 3QPBA 4BMYA 3DP9A 5EPUA 4DAEA 5F73A 1TGYA 2OC9A 1T8YA 3FAZA 4YJKA 3FNQA 1T8RA 3INYA 3NBQA 2HWUA 1QE5A 1RXSA 2RJ3A 3DJFA 3PNSA 3OOEA 4M1EA 2H8GA 1YR3A 1PWYE 3OZEA 3D1VA 3FWPA 1A9TA 1YBFA 1JE1A 3OCCA 2A0YA 4OEHA 1YQQA 4WKBA 1Z36A 1YRYE 4F3CA 4L0MA 1OVGA 1OUMA 3OZDA 3ONVA 5F7XA 1SD1A 1V2HE 4TS9A 4TTJA 4UC0A 4X24A 1PBNA 3PNPA 1ECPA 1JE0A 3EMVA 3UAWA 1JP7A 1Z37A 3UAXA 4DA0A 4QASA 1I80A 4PNPA 5K1ZA 1VMKA 3OF3A 4TS3A 4DANA 1K9SA 1ODIA 1U1GA 3EUEA 1RXUA 1RFGE 1Q1GA 4JP5A 4DARA 4D9HA 5IU6A 4IP0A 5F77A 3NM5A 4M3NA 2HRDA 1TGVA 4RJ2A 3GB9A 5F7JA 1NC3A 2I8AA 4DA6A 4EARA 3K8QA 1JDZA 3DF9A 2A8YA 3IOMA 2P4SA 1PR6A 4LZWA 3NM4A 1CG6A 1PK7A 1Z39A 1K3FA 1PR0A 1NW4A 1Y1RA 4WKPA 1U1CA 2QDKA 1Z5NA 3DPSA 1PF7E 1OU4A 5CCDA 1PW7A 1Z35A 1Y6RA 5C80A 1VHWA 4QAQA 3ENZA 4D8XA 2ISCA 3MMSA 4D8VA 4I2VA 3KVYA 3KHSA 3OPVA 3BSFA 1JDVA 1JDTA 5CXQA 5I3CA 1FXUA 1Z5PA 5DK6A 1PK9A 4QATA 4LNHA 2A0XA 1TCUA 1RCTE 2QTTA 2QPLA 1V45E 5IFKA 2OC4A 4GMHA 2OXFA 1LV8A 3FUCA 4YO8A 4WKOA 3MB8A 4YMLA 3P0EA 2I4TA 1N3IA 1U1FA 2AC7A 3KUKA 2GUWA 2PGAA 2A0WA 4QFBA 1PKEA 3OZBA 5F7OA 5B7QA 1ZL2A 4G89A 5KB3A 1Z33A 2XRFA 4BMXA 1SD2A 1U1EA 2HSWA 4M7WA 4TYMA 4MCHA 1OV6A 5B7NA 4TTIA 4OF4A 4JOSA 4BN0A 1PR1A 1Y1TA 3O6VA 3UAYA 4EB8A 2QTGA 3EEIA 3P0FA 3UAZA 1RSZA 4YNBA 5F76A 4TXNA 3KU4A 4LDNA 1Y1SA 4G41A 1V41E 5CYFA 2OECA 4H1TA 1LX7A 4OY3A 4F1WA 3UAVA 1T8WA 4DA7A 1TD1A 5FAKA 4MCIA 1A69A 5F78A 1A9PA 1RYZA 3SCZA 2AI3A 1JYSA 5F7ZA
chains in the Genus database with same CATH superfamily
1GO2A 1P7PA 4GZ5A 4U1RA 1CD5A 2ODTX 4CL3A 2OD9A 2QUJA 3HBAA 4WN9A 2FWRA 3ZE1B 4G1UC 1BDJA 1J2TA 1PZHA 5FFMA 4O1MA 1LTKA 4I50B 5GVRA 4DOMA 3GNSA 3GYGA 3K4QA 2PUGA 1NBEA 5AOVA 2G80A 3TSAA 4AFNA 4GW3A 2GYVA 3FCUB 4LJ5A 5DHAA 4JMPA 5U9CA 1E96A 3OG9A 4LXXA 2BJVA 5FL3A 3WLRA 1JR3E 1Z9BA 1MJ5A 2X13A 4R6WA 3ZD8A 3IVXA 2OHJA 1HA3A 4A82A 2QLFA 4CZ2A 1VKHA 3QVKA 4O2AB 3MAGA 2AFHB 4RTPA 2W9XA 4RKFA 4C4TA 1BW9A 1YIDA 3PZRA 1RKXA 3N3AC 3O8OA 1W7AA 4JEHA 3DLTA 2ATVA 5CH3A 2CL5A 1MJFA 4IICA 1QFXA 3AVWA 1OT5A 4B85A 5HMMA 2W22A 5J5AA 2O59A 1DC7A 1ZD9A 3IB3A 4EB3A 4TZ0A 1I9CA 2CXXA 3JSAA 2B4TO 3FCCA 3HCAA 3W5SA 1HL3A 1XRPA 5FFNA 1DAHA 3KKNA 3PKJA 3G3EA 2O05A 1EVZA 1L7OA 3GPBA 2CLKB 2B7LA 4JJAA 4L50A 1V1MB 4LQDA 1ZOSA 3PFFA 4TMFA 1YDHA 3JD4A 3LTNC 1YF3A 3L04A 3S4YA 1R9MA 3M5CA 3C6YA 3CINA 1RKUA 4CMKA 1SEVA 1W4ZA 4M0KA 2ZR9A 2PRZA 3OTIA 4EO4A 1FX0B 3A1NA 2PUWA 1YULA 1SVMA 4Z1OA 5IDQA 5KX5B 2WNIA 1COZA 2FMKA 1ZUHA 2ZYUX 4QECA 2H1OA 1N2JA 4OGKA 2I65A 4BX0A 1MAHA 2WUFA 3HWWA 1SBTA 5BR7A 3ZJVA 1FJ2A 2J7KA 2R7AA 4CMCA 3C4QA 5EJ7A 1CQZA 1M6WA 2FGJA 3C74A 4JODA 4MUGA 1SPBS 1LC0A 1KKUA 1G18A 2HIHA 1E7QA 3BWVA 1S4MA 1RXYA 3EGCA 3RIYA 1NC1A 4FMPA 1H2HA 2AUNA 4OBXA 2RGWA 4P33A 1RYBA 1TEVA 1E5QA 5AXDA 2QMZA 3F7NA 2ZYTX 4URYR 1DG3A 3UGTA 3TKYA 3L4EA 1NL3A 3RRNA 4R8KA 1SUDA 4ZPJA 1YS1X 4BLOA 1RBZA 4FC7A 3K0AB 2X0NA 1VGQA 3WWZA 4E4TA 3VZRA 1U3CA 2AXQA 5J4HA 1K89A 1YRQA 4KE8A 1I4OA 5BVGA 3DMNA 4DJ5X 2KHZA 1ZU4A 3FHJA 3LCCA 3WLJA 4US2R 5AW6A 4JLNA 4ACBA 3B6KA 4UUBA 3ADCA 2WICA 4AS1A 2GZDA 1E4OA 1UDAA 3G2MA 3R3YA 4XYGA 4DUYB 4AZWA 2Q99A 4XX0A 1VE5A 3OIGA 4G4SP 4RK6A 3THXB 5LQAA 3G5TA 1J1IA 1HZZC 3KV1A 4EENA 1AHHA 1GPWB 5I4CA 4DHWA 1L5FA 2OFWA 1EX9A 1AQIA 1UKVY 3BGOS 1L4YA 3PJEA 3N5KA 5THKA 1HE2A 1E2DA 2PXAA 3W2HA 1V5GA 1WMDA 2XBMA 2B21A 1HI9A 4HSGA 3J81k 3DEJA 5DDIP 3Q7QA 4CIDA 1QRTA 2VJNA 2CYCA 3SEZA 3FDZB 1AN0A 2ARKA 2OV6A 3A4MA 3DNMA 3QELB 1C4WA 1RLMA 1V5FA 1SBHA 3OQPA 4L5BA 2Z6VA 3HCBA 4O4JB 4Q1BA 5T3YA 3RGGA 2H4ZA 3SP1A 4FYXA 1U28C 5LDHA 1ZIDA 2XUOA 2QQGA 3PG5A 4OJQA 3L9XA 3RT7A 1E2KA 1E4EB 2JFYA 3RU7A 5EJ6A 2O8BB 3PJFA 3F6RA 3DVSX 1T2DA 1AKEA 2UZIR 1NUAA 1VBKA 4MWEA 2JRLA 1JG7A 1FX1A 4JT4A 1L2TA 5J2UA 4OGGA 1EDOA 1ZPDA 4BO6A 6AT1A 2GMWA 5CM9C 5DJ5A 3TSWA 2B2XA 3T1QA 4M86A 1H2XA 2ZBQA 1ES9A 4XVUA 4Z53A 4G4SO 4KEAA 5ICSA 1KTVA 1JSZA 2ZTVA 2HRCA 3SBEA 3QKUA 5KCMA 4NJEB 2JS7A 1XAJA 3O92A 1TUGA 3LVQE 3TQFA 2J3JA 1L4GA 1QKJA 3IEVA 4LXUA 3O2JA 2GOYA 2V6GA 4NFHA 4IIJF 4RWZA 5DM60 2BBSA 4N39A 4UU1A 2IXBA 1BFDA 5A62A 3DHYA 4CF5A 4WA7A 4ITUA 3SJCA 2LP4Y 3D0OA 3VSAA 4RD1A 2YJNA 1E9DA 3THRA 5DHTA 1Q0SA 5CT9A 1CUUA 1M1YE 4U0JA 1NUUA 2O3RA 1TJ3A 3OE1A 1NYTA 3HXQA 1X7DA 3BK7A 3P0HA 4RY9A 2QSUA 3OEEA 3ORYA 4AZSA 3DE0X 5B3AA 3NPMA 4C4SA 4ZOAA 1N9GB 3WKDA 3E23A 2FZLA 1I7QB 1VE1A 3JU3A 1UXHA 3I2HA 2W2OA 1KBQA 4II3A 1W5BA 2WWXA 1K98A 4UEQA 2WNHA 1DRUA 4R1NA 4RETA 5C8YA 4FDVA 5F73A 2DHRA 4MUJA 1W36B 3M5PA 2OC9A 3IX7A 3B7GA 1GT91 4YHBA 4DEYA 1TEZA 2FP3A 3MBIA 3A10A 1BKDR 3DBLA 2ZS9A 3LY5A 5DE3A 3NBFA 2C7OA 1M1NA 4FYMA 5JAZA 3WA7A 4JXKA 2YWBA 4LF6B 5LNK1 4DY4A 1Z4IA 1K97A 4FDAA 3T3PB 2OAP1 2DJIA 2IEYA 3C43A 3L7KA 4P82A 3T34A 4CKWB 3D1LA 5KPJA 1DG9A 4PICA 1CIPA 5IRCD 5DNAA 5I4KA 5F3WB 1CZNA 1RE1A 3QZUA 3WLAA 2XVZA 4G0MA 4XTRA 2WF5A 2A5DA 4HLUC 5D7BA 5JS7A 1E5LA 3HUDA 5E6UA 2A7XA 4HB4A 3B3GA 2PXHA 2DQZA 3DCIA 3Q9LA 4YV7A 1DFIA 2ROQA 3NHWA 3IIIA 3KOWA 3TLJA 2PFGA 3RRXA 4J3JA 2HT1A 2CHVA 1KDVA 2DKFA 1Q74A 3C3JA 1Z36A 3O8LA 4Q3DA 1SG9A 4KUEA 1L7BA 1E0DA 5J2TA 3ZBPA 2A84A 2OHGA 5TQ2A 9ATCA 3Q2OA 2C7PA 3OBBA 4E2FA 2Z2YA 4MRPA 4A10A 1SR8A 2I4NA 3MUNA 1RXWA 3ND6A 1DQNA 1SD1A 1V2HE 3WE7A 1NXWA 2P6OA 1AB5A 1UM8A 2WIDA 5JBNA 4KREA 1JBQA 3EODA 3OJLA 3ZIDA 1TZCA 4QOEA 1G3UA 1OWMA 4K1XA 4R40A 4EVSA 1PBNA 4BLVA 2XMCA 4DIEA 4LI0A 3L43A 1CRLA 1XZKA 2C4HA 1CW2B 1VDMA 3H5AA 3LUBA 4NI5A 2HA5A 1YI0A 3LCUA 1WKBA 2JIOA 2V6FA 4F9GA 2H5EA 1DAPA 2JIQA 3TQQA 3RIEA 3Q3IA 3CRNA 4Y7DA 4OHOA 2JI8A 3KD3A 1QYXA 3RBAA 4X92A 1VB3A 2WA2A 2WPNA 3QE0A 4PYLA 2FSIA 3WS7A 3ZWXA 1COWD 1KZ9A 1UBEA 1PJBA 2FSFA 2QB5A 1EX6A 3ETHA 4QU8A 1O94D 5D2CA 1MO4A 2FR8C 3HCPA 3VKUA 5L3VA 2QJWA 3PUWA 2VBFA 2YN4A 4EOGA 3C6XA 4NFLA 3QOWA 1XD2B 3ZE9A 1JEQA 2FWMX 2ORYA 4HBGA 5PGMA 3VTKA 3AW8A 4LZZA 1CETA 2OCBA 4EHFA 1DWPA 1IB6A 4TKZA 1E99A 2P0YA 5EE5B 5BPFA 4J29A 2QD1A 4M98A 2VHYA 3K70C 10MHA 1LK7A 4BVJA 1DXHA 4ZI3A 2PTHA 1KKMA 4O4HB 4EUEA 1D6NA 4CN9A 3ADDA 5B58T 4M3NA 3H13A 1L9KA 4HEA1 2G9VA 1ZNYA 2AG8A 3RUAA 2XUZA 1TYBE 4MRVA 1G3MA 2VK8A 4I4NA 4LMPA 1ZIXA 3SYMA 4IHJB 4YP6A 4QDXA 1BDMA 1HTBA 4RIIA 5KYYA 1PD1A 5AVJA 5DTIA 4JI1B 4HCJA 3LBFA 2F8SA 3WIDA 1T1JA 3B6JA 2VT7A 3QXCA 3RABA 2H2WA 4LHXA 4JBXA 3IOMA 2YWRA 4ER6A 1ILWA 3ZQJA 3NNSA 3NM4A 4QULA 3KFXA 4OKIA 3NR2A 5CA0A 1E98A 1UPCA 4K03A 3GUVA 3LDFA 5D1HA 1Y5MA 5ALQA 2R66A 2O2ZA 1QGED 4QGBA 3U3XA 1SUCA 1Z7YA 1XCOA 3EVAA 1QTIA 1UL1X 2LKDA 1IK6A 4I55A 5JXWA 4G0WA 4ZVPA 3LGXA 3A0UA 2EERA 1KBOA 1N5DA 4L15A 3RS7A 4M9CA 3I9KA 1PZXA 3TLXA 4MQEB 1C7RA 1PWZA 3D8RA 4PANA 4IKPA 1XNRB 3HR7A 2NUTA 2BKLA 4LDJA 1PFWA 3THWB 1Q7TA 2R00C 3UJ7A 3O0TA 1PFYA 2B69A 4P80A 4EG8A 2DB3A 4RJLA 4B0OA 5HIKA 3KSAC 1N0WA 5CGZA 3LZ6A 3ZDQA 1RJFA 3WLNA 5CA1A 2HO5A 1DIOB 2B1QA 1LNQA 2OOSA 1N6OA 1N25A 4BCCA 3PXAA 3DZHA 4NBRA 4NYIR 4YAWA 2BGJA 3ZGLA 5LYJB 2ZUWA 4G2TA 3NV7A 1RLOA 1UFRA 4P22A 4UJ3A 4B4UA 5C34B 3NPAA 1L5HA 3NO4A 4KWHA 4KRFA 1D07A 4QRIA 1WCXA 4FD2A 2C2ZA 2Z6AA 2Z2XA 5EYPB 3VR0A 3GLHB 3OPVA 4QIHA 3SBXA 3QFSA 4FKBA 1Y5RA 1RQLA 4RNDB 1KJJA 1ZJZA 1IB0A 4RKRA 4BLTA 4DTCA 3OEWA 5AVTA 2GAOA 4PXSA 1K4MA 2FYTA 1T6YA 5BPHA 1SU6A 1K7SN 1VJGA 2Z2ZA 4I9UA 3FFBA 6ABPA 2A0XA 2PE5A 1P80A 4CL0A 4UXJA 4Q4CA 3AW9A 3QPVA 1CJVC 1AO3A 5C18A 5D3KA 5P8WA 3JZFA 3DBIA 4YWHA 4AWAA 4BO8A 4DLVA 3X2EA 2OGTA 4FFLA 2ECPA 1LJLA 1PJAA 2RGGA 3ESQA 4RL6A 4YRPA 3WISA 3II6X 3VHXA 4WMLA 1EK2A 2FUCA 2CVPA 4QRHA 2W6CX 3MB8A 4YCDA 2OBFA 3D8TA 2HU7A 2MSNA 5ED0A 3WDLA 3FBTA 3QJYA 4NU8X 2C9YA 3QE2A 4WVLA 3O74A 3I1FA 3ZV7A 5EHQA 4P2BA 1PJRA 4MLDA 3VO8A 3CLVA 3I9V1 4XARA 4QSHA 3P0EA 4QLOA 3L1HA 5CLFA 3UATA 3KD2A 1U3TA 1M6HA 2QI9C 5AW7A 4U5XA 3V4OA 3UJNA 1A96A 4R8MA 4CUKA 4NX2A 1JR3D 4NDZA 3WI7A 5AM4A 5JD6A 3D6UA 3LKVA 2Q0QA 2O2CA 221PA 4TTPA 2ICAA 2Y1WA 4E3ZA 4CEIB 3N05A 4RMGA 1MDBA 3WJ1A 1I2BA 2GTIA 3P2EA 2CLDX 2MDTA 4UHCA 3V8QA 5I7EA 2PT9A 1KNXA 3KZMA 1MKYA 2QSZA 3Q0EA 2QX9A 4G56A 4PLPA 5LP6F 3D2LA 3ZCUA 1PNTA 4YRQA 5FWXA 4H08A 4M7WA 3THSA 5B64A 1DXQA 1FK8A 1RPTA 4XDHA 2AJTA 2PN1A 3OE4A 4J16A 1QRAA 3F2IA 4FHGA 5CLQA 1RKBA 1XCBA 2H29A 4ROTA 2B98A 4FUTA 3SQLA 1IZYA 3NCHA 3QENA 3GFOA 1FVHA 3FF4A 3Q15C 5JMOA 5FFFA 3BMOB 3I8XA 3GBSA 1Q19A 2FEOA 2XTNA 4MV5A 4ZYVA 4L0QA 4FS8A 2P3OA 4AD8A 1XEWY 2C82A 3M5WA 4XJVA 3VOBA 4J43A 3UQZA 1WCIB 2PBLA 2YVKA 2PANA 3CV3A 2HO4A 4JB2A 3RJ9A 3PGJA 1ADGA 3OZXA 3BPSA 3F46A 2GCEA 1J0XO 5BNTA 3DLAA 1Y7TA 3T1NA 1X19A 1RWNA 4PZCA 1FTQA 2BTQA 2FDRA 4NATA 4XA8A 4EFMA 1WETA 4DNXA 5HX7A 2J4DA 2ZRLA 3W1EA 2AFRA 1Q57A 5AI5A 3T0IA 5FJIA 1EFUA 1RI1A 3WSWA 3P32A 4IXDA 1DQPA 3QP9A 3W0LB 3KCQA 3QX9A 2NQ8A 2DJ5A 2L17A 3GY0A 1HOTA 3MD9A 2E89A 1Y80A 4FZVA 1T8WA 1XWIA 2BUAA 5M3BA 4M87A 3CLRD 5JNVA 3JRXA 1QO0A 2B36A 3HYCA 1ID1A 1UBFA 4UBOA 1FYWA 3G9ZA 1A69A 2HMAA 4HWRA 1GL9B 1CVRA 3MS2A 1KQGA 2C3UA 1AQNA 4RELA 3PSAA 3DAOA 3JQFA 3OKPA 1NNLA 4QJ5A 2XXAA 4IJUA 2NUBA 2PQ2A 1I7DA 1HTTA 2BMVA 1C2TA 4F4DA 1NLMA 4BFXA 2B0CA 2WEKA 3EC1A 3GNTA 4MVJE 1NVDA 2PX3A 4B1FA 3PT9A 4LHEA 4CLOA 4PGGA 1TU4A 3C41J 4GPEA 4QGFA 3ZWBA 5IBRA 1J70A 1VSQA 5CK4A 1PGQA 2YW2A 2QRZA 1VSUA 1MBZA 1V8FA 5ENDA 2WSBA 3KYCB 5BN3A 1NLFA 1HH4A 3Q1KA 5FR1A 4OOFA 3TW0A 2AQHA 3WL6A 1JHQA 2B78A 4R2WA 1XX6A 3WLMA 4XYBA 3GJ7A 4GGOA 3UB3A 3V55A 4L4YA 4ZAVA 2B5WA 1E79D 2JJMA 2QENA 4K6OA 2HJGA 4W6ZA 1OGJA 4OUDB 2Q45A 5U4XA 3FSRA 1FW8A 2AHRA 4MQMA 3AB8A 4L8VA 5I47A 1M6VA 4GZMA 3UYKA 5KJFA 3I52A 4MJ3A 4R98A 2WAMA 4UM9D 3U7QB 4Z4GA 5JJCA 4M0LA 5DX1A 1GKUB 4NY1A 5LFAA 1XLTC 3TF5A 1EINA 2ZPAA 2XMDA 3ABSB 4X8OA 3Q72A 2WB4A 2BMDA 1XHEA 4F9TA 3L07A 1ZUNA 1E3WA 1B74A 3PPXA 5DX0A 1R4MA 3CGGA 4ZT2A 5WRFA 5LZ2A 3ABOB 2DSTA 5IABA 4UHEA 1KK3A 3EULA 1E3JA 1P18A 4PX3A 4YRBA 1ND5A 2QZJA 1E7WA 2P7HA 3KTDA 1EP9A 1LW6E 2XXJA 3QG5A 4TLDA 5G0VA 3VNSA 4BO3A 1EXDA 4HAIA 2HHHB 5JZOA 1UWKA 1W35A 2VTDA 3KV3O 1GARA 1GV0A 4MV0A 4PQRA 2FKNA 2GO7A 4U00A 4PZUA 3SG0A 3HABA 3EDOA 4JI4B 5LR6A 4P92A 3R9XB 1A9RA 4NE2A 5CTJA 2YHSA 1JIQA 3VSBA 5FPPA 3PCTA 3C14C 4ARCA 4QUJA 1LJUA 4DBLC 4WLVA 1WZIA 1Y4ZA 3FF1A 1ZJ6A 3U3DA 3TZBA 1DLJA 4R8LA 2C2MA 2FE1A 1BA2A 3R9KA 3FTCA 2O8DB 2VA9A 5LQKA 1P45A 3OCUA 3ML1A 5EP3A 4D6XA 3N0XA 7ABPA 4FINA 4J0QA 2OHHA 1NJ8A 3C1TA 2XWQA 3JQ8B 2G04A 1HMYA 1FP1D 3RVQA 2X2FA 4RABA 3UHOA 3KL4A 3UW3A 1FSGA 2X5KO 5C8DA 1LF5A 1O5IA 1E9VA 3K15A 4OA5A 4L57A 3QFTA 3UHAA 4YRIA 3U5TA 2V0GA 1J0EA 2C88A 3CUTA 1NR1A 3KQVA 5AI6A 2EZ9A 2Q1TA 1TIBA 1XPOA 2FXVA 3QMMA 3MGAA 1I24A 1CUHA 3K9NA 1P2VA 3QFCA 1DARA 2CE2X 3R6TA 4P3NA 1RIIA 4A0FA 4R16A 1X8JA 3G9QA 4KI7A 3HVRA 4QXOA 4LV6A 1NE2A 1VSTA 3MMNA 4P4LA 5A7HA 4AJ9A 3BSWA 1SURA 4PXYA 3GD5A 4ME6A 3MT7A 4JP1A 4S1OA 1KYYA 1NW5A 1QOPB 2OMKA 3TCNA 2IP1A 1M2OA 3PDCA 4YCLA 1PG0A 4LKRA 3DOIA 1NFQA 2QD4A 4ZALA 3MT9A 4ZHSA 1OLSB 3D31A 1ONBA 2C92A 4HRVA 4LRSB 4NPAA 2OBXA 3KT3A 3GFSA 3P9IA 4TV8B 3C5HA 3JQAB 4IZHA 4D56A 3I62A 3AFIA 3NTOA 3V80A 1S96A 4P54A 1LFAA 4OEHA 3WIOA 2VWGA 1RI5A 3I1JA 4D8YA 5B58C 1E5VA 1FJHA 1B42A 4MUNA 2QRVB 3R0VA 4EQZA 2XI4A 4R5MA 4EQ6B 2HB6A 2N0SA 3O2SB 1ZOIA 4XVRA 1QP8A 3TIFA 4BWVA 3W4IA 1PK8A 1ZWKA 2Q2QA 1H2AS 4QYSA 1VLZA 1KAQA 1Z6ZA 1OVMA 5JFTA 4F97A 2GVNA 3PNYA 1Y3FE 3P19A 4LXIA 3S2YA 3IDQA 3U7IA 4CFYA 2YY6A 1DKLA 4OP1A 1TO2E 4HQ0A 4NU0A 3WTCA 4EX6A 5LOVA 3VYRB 4E33A 1CQIB 4UOEA 1EESA 2IPXA 3ET5A 3A6LA 3TOVA 1GQYA 4Q3CA 4X54A 5AHXA 2YMLA 1Z63A 4WESB 1TUBA 1YJAA 1OBFO 3PUJA 2EJCA 2DKNA 3I6IA 1Y6FA 3EZ2A 4MITA 3VYSB 1K6EA 3WNCA 2C4KA 4QDJA 5HOQA 4FX5A 1DXOA 3BB3A 1EXNA 3PPVA 4JYZA 1X8KA 1KYTA 2GJ8A 1RRPA 2XQFA 3FPAA 5CW2A 2D06A 1NXSA 4FQ8A 5DW3A 4QARA 3PI6A 5AKHA 4DLZA 3TW4A 4O02B 1O6CA 3T54A 3VOAA 3KE9A 2X3YA 3Q3JB 3AV3A 5IJ0B 1L4KA 1VP3A 1GL3A 2P9JA 2W2KB 3QLVC 4TLCA 1BAPA 1WP4A 5BORA 5JYCA 3NHYA 1SUWA 1BYIA 3M4ZA 2R79A 1OIVA 3GDFA 3LT5A 1I32A 4AY4A 2VPPA 3P0IA 3D5QA 4ETMA 1FNDA 3IUNA 1MGOA 2A88A 3H3XA 4BFLA 3FLMA 5DCLA 1XXHA 2O5VA 3NS7A 1H42A 4U7HA 3D8NA 3RASA 3UXYA 4NC9A 1NBWB 5K6RA 1Z13A 1E8DA 3ZIAD 1EQUA 4EDHA 1JAXA 4A73A 4E70A 2WG0A 1JHRA 5AJVB 4M36A 1CNEA 4U7FA 1J23A 1H8ED 1NR7A 1WP9A 2NVOA 1SY7A 4MRSA 3ZN2A 4B32A 1CJBA 1E2PA 3D02A 4JL8A 1WZ2A 3EMKA 3T3HA 1IXKA 2PSHA 1FTYA 5KX5F 1AJEA 4HDKB 2UVPA 5AKIA 2IZOA 1X7YB 4PPGA 5AUQA 5DM0A 4RA9B 3VPBA 2VDUE 3VM6A 4TM8A 1HQKA 2P9BA 3OE5A 3PE6A 3NUQA 2GAJA 1BU5A 3TDMA 4IVNA 4AP6A 3C45A 1TPYA 3ZYZA 1QPBA 2V3VA 5HZKA 3JQGB 3KLPX 3PGA1 4C4ZA 3EX7C 3T7EA 2B34A 1P9RA 1JLKA 3T1OA 3P9CA 1HNZB 1HT0A 2VHXA 2XYQA 2ZVJA 2HIMA 4FC6A 3FWPA 5TIIA 4ALKA 4G1BA 4AECA 1KI7A 3JTEA 1O57A 3A2NA 3DT6A 3LLMA 3MELA 2OLEA 1QFSA 4IFBA 1ULSA 4BVKA 3IQGX 2HJRA 3SLKA 1YQQA 3PWTA 4AZ3A 3WHPA 2AFVA 3QUCA 5DLDA 4HDNB 3HR4A 3AUAA 2XUHA 3I45A 4MV4A 1RMYA 4JEUA 2SKDA 2YH2A 3OZDA 5LQNA 1AKUA 1I33A 1T5DX 1AC5A 1QX3A 2AT1A 3DYVA 2JAOA 3E4CA 4DSNA 1CUWA 2IX3A 1SC4A 1CPYA 1NF3A 3I6ZA 4G5FA 3WNDA 4Q3LA 3IALA 5EE3A 1MIOA 4R1LA 2GEKA 3RYHA 4WEOA 3VR3D 1C3OB 3ES9A 2B4RO 4LYFA 2J0UB 3L7YA 1D2NA 2GTHA 4Y1FA 5ECYA 3RK0A 3PEEA 2HCFA 1JDBC 2VDWB 2EWMA 1S4QA 3IPYA 2QVYX 1HR0B 5DSZA 1SIOA 1U5CA 2Z0MA 1G6Q1 5ICEA 3IAFA 2OE2A 1JG1A 4ND7A 3BZUA 3GF4A 3ZVLA 1OBCA 2HMTA 4XEUA 3O82A 2GKOA 2MSWA 4TTSA 5JLJA 4D97A 2FZKA 4M55A 5KVVA 4PYNA 1WMAA 4IOLA 3VJMA 4JLWA 5E7JA 1MAWA 2NYRA 4YMGA 2IU4A 4AS2A 2EJWA 1GPAA 2JK1A 4I5GA 4EH1A 4K9LA 4MGKR 3CB2A 1SOAA 1ZMBA 2LV8A 4BO1A 3WFJA 1O5TA 4HYYA 2VSQA 1COWA 3I3OA 4FR0A 1KAEA 1KH1A 1YR2A 4WPGA 3U3MA 4EHDA 3OU6A 3REQA 3QOYA 1RC8A 2PXCA 3IUYA 4Y2UA 3M4JA 3W4KA 4JIMA 4HL6A 2GN1A 1Q15A 4UXIA 2WOOA 4OQQA 1EVEA 1TGVA 1BQ3A 1Z16A 4WBNB 2JLQA 2QP4A 2OUIA 1PW5A 3BE6A 3H17A 3NORA 2EFEB 1A2OA 1KZGB 4P36A 1WSBA 2QVCA 2F9LA 3SJUA 4CL8A 4Y9SA 5AKLA 2X3FA 4DPKA 4K3VA 4BB6A 3D3KA 5A1TA 4Z4IA 3PJGA 1QFMA 1JGTA 2GJ9A 4NECA 5G40A 3W2IA 3PA6A 4FIDA 2D2EA 5T4FA 4K28A 5EZQA 4BMSA 3O93A 2VTBA 2HLHA 2Z5GA 3E18A 4X5OA 4CLRB 1PZGA 1CG6A 1KO7A 1NI4A 5EZYF 1BNCA 2P65A 3I8SA 1T5SA 3ZU3A 5JRJA 2C5EA 2J5KA 2QQEA 4GRIA 4OHUA 3GZJA 1XMXA 4KU4A 4X64B 2JJ2A 4RMIA 3TUZC 2PGDA 1YCGA 1QCCA 3O5AA 1KJYA 4UDXX 2MTBA 2C8VA 3WGZA 2NX2A 4B2PA 3HA7A 4B9EA 3A4VA 2IYVA 4WXRA 3DPSA 3GFGA 3R0QA 1AV6A 1QHHB 3LZDA 3ZDXB 4RTKA 2B25A 5EUQB 1C9NA 3OWOA 5HKAA 2YJZA 5DXAA 2YRFA 2UYYA 4AZ0B 4OLFA 5BOVA 5F1PA 3U7HB 3B60A 2CSXA 3TRKA 4LQLA 2V7BA 1BD3A 4XDZA 1JA9A 4C6TA 2IEAA 4INZA 1TEXA 3O1HB 2V58A 1A4RA 3N2NA 4CHGA 2C42A 2QMOA 3OE7D 1U6JA 3L5KA 3QJ5A 5KO2A 3AINA 2P78A 2H5LA 3IEUA 4QAQA 1L4FA 4FLMA 4FN4A 4R0NA 4TLAA 3EVGA 4KR9A 4PNHA 3UHPA 2DFKB 3AX6A 2P8JA 1P0IA 4C7OA 1OHHD 3HEMA 5DNEA 3CEHA 2V6MA 1C8VB 4C0XA 2CHEA 1SC6A 6NULA 5I3CA 2F3PA 1EQ2A 1YI8A 3JYNA 2ZJ3A 1DVRA 1MN6A 4DJFC 4Z2YA 3NTQA 4PVCA 3L8HA 1HYGA 3A4NA 1LI7A 5ALKA 1R0ZA 5COAA 1LGYA 4BNDA 1GGHA 3ADKA 1PZMA 9MHTA 3ID6C 2VRNA 4XASA 4DB2A 2P40A 1X1CA 3PQ2A 3M6MD 1RAAA 5CDSA 4RQUA 5DHRA 3AI3A 4PLTA 3TUJC 4ZAXA 1FEZA 1I5RA 1JL3A 3DDUA 3COYA 4EPRA 4F1JA 4YRZA 2HR1A 2RH4A 3B52X 2JDIA 1GKLA 3OZVA 4GEKA 2ORVA 4LDAA 3DR5A 5AW5A 3GNQA 2NZXA 4XB6B 2FJUA 2ZJOA 4YLYA 1IHUA 1O87A 3HM9A 1KE1A 2IDMA 3E53A 3EVCA 2P5TB 4MVJD 3UEOA 2WJIA 2EKQA 4YJ3B 4REOA 1LBQA 4RMNA 1Z7BA 1G8HA 5AVOA 5C51B 2FK8A 2VDNB 2CL6X 4HX9A 1F8GA 1KEUA 4KLNA 2FPXA 1P62B 2LDBA 3H18A 3FVVA 4MVJH 4ZQHA 2FMFA 2NXJA 3EZYA 1L7EA 1LY1A 2ODAA 1OH7A 2RGNA 2XRFA 2V4UA 3AKEA 1UAAA 1FDUA 1J2RA 3BWYA 4NONA 3U3JA 3MFQA 3ROMA 4CM4A 5JQGB 2A0KA 4TS1A 1AXRA 1DIRA 1VE9A 2HQSA 3PGMA 3V7YA 1IOZA 3OFJA 2QNBA 4JOSA 1EGHA 4G1MB 2GDJA 4MVJF 3UJBA 1RYEA 2YL2A 1NOIA 1TEHA 3EGXA 4OBBA 4YJFB 5MN6A 2X15A 1JWBB 2RIRA 4MPDA 3WGLA 4CTJA 2QTGA 4HNVA 2Q2WA 1DAEA 2GNAA 4BOYA 1LDYA 2HDHA 1SGWA 1TB4A 4GO1A 4RVGA 2OO5A 3WMGA 3NDPA 2UVQA 4NZYA 1F2DA 5DHFA 4B73A 5KYNA 3F5QA 3S2EA 3NOOA 3DE3X 4FOPA 2CNWA 3NHZA 4Z7NB 1MB2A 1KXJA 2OFPA 3OCYA 5KIAA 3AY7A 3HUEA 4HEJA 5T57A 3TYXA 5P21A 3GJ0A 1SVOA 1MOQA 1N5LA 4M4SA 3RVOA 2O3QA 3PUIA 4P0TA 3M1IA 4AJ1A 2UAGA 1TF5A 3OT1A 1LRJA 5G0SA 1MH1A 5JALA 2QMQA 4LJKA 3PGXA 3DPUA 2A6PA 3PC8A 1TFRA 3ZXYA 4X20A 3O84A 4MUYA 4F1WA 1BE6A 2ODBA 4I3GA 3P9QA 2IHKA 4PC1A 5CAEB 2RGXA 3BRQA 3A2LA 2YWGA 4GOMD 2JVIA 4D46A 2DF8A 5BVHB 4IDFA 4PHHA 3DR3A 1BHJA 4QICA 3LDUA 1IG3A 1YASA 2NAFA 4EHJA 4KPYA 1UEXC 2JF0A 2GEFA 3JYHA 4RHUA 4UAGA 3UMVA 3SDZA 1G64A 4KXWA 3IQIX 4KI0A 2ZTMA 4YAUA 4YDSA 4YH1A 5L3ZA 2GB4A 4P86A 3MCZA 1JYSA 2B8EA 5EZSA 3KVRA 4JKYA 2FRVA 1I2MA 2QMEA 3FHLA 3AUXA 3ZNQA 3FJ1A 4LK3A 4H6WA 5K4GA 5IX8A 5K0TA 4UQLA 4BECA 1A7AA 4K5QA 4UCQA 1IHYA 3CONA 4NE9A 3RSZA 1N3YA 1RR6A 4PPFA 3UB2A 2D8MA 1O6BA 5AK0A 2QL9A 4K87A 5HE9A 4BO9A 2XHZA 1QO9A 1PD0A 2YMPA 3U56A 3KYBA 4MWSA 1G5QA 1SD5A 2C0QA 3ZZNA 3ICEA 1OWOA 3PXDA 4CG2A 3BXZA 3UWDA 1ILEA 3TW8B 2BGRA 4LMBA 4MZXA 3M9WA 1R6UA 4LGCA 2VP6A 5AOCA 1H1LB 1B93A 1IWPB 2GVDC 5A9SA 5CXUA 2P6PA 3OETA 4B17A 3FOEC 4PG6A 4XKJA 4C0QC 2PX6A 2QIPA 4MQFB 4B3JA 4PRYA 4Y1RB 3X1MA 1PKXA 2O1XA 3BIFA 4CM3A 1CY7A 2FUG6 3VVBA 1UXOA 2C2GA 3FZNA 3FRIA 3ND5A 1U5AA 3SHVA 5JAUA 3HYLA 4OM7A 1Z3IX 5IAGA 2WD7A 1ZR4A 2OCLA 3HU2A 3IBCA 3ORRA 5FXMA 4A8JC 4C21A 3FUUA 3JRWA 4I6JA 2I6XA 2WG2A 4LDPA 3W5AA 4UM7A 4HLNA 4Z86A 4KL8S 3KXPA 5IVIA 3GOHA 4B6EA 3PL5A 4G8DA 1C50A 2BC9A 1BN7A 2H0AA 1V3UA 3G0BA 3R4CA 4K05A 5FL7D 3TL3A 3BCUA 3BT7A 4EI8A 2COKA 4F1KA 1CFZA 3LW7A 2WTUA 4DPMA 2C77A 2CMKA 4DCMA 1MO6A 4UTZA 5FP0A 5KYXA 3Q9NA 1EI9A 4U7TB 5I7AA 3V4FA 3WKBA 2QQFA 4QBHA 3TMKA 3VGPA 5B36A 4IDDA 1Z0DA 4U2DA 1YCHA 2DU8A 2A9JA 2FR1A 3AERB 3MWDA 5GP1A 3KZCA 1R6XA 4GLFA 2GR9A 4MQLA 2H1IA 4UBKA 4P7GA 2XDQA 2JEZA 5U4QA 1VB5A 1F2VA 1ULUA 2WF6A 4WEQA 4ZN6A 4E5VA 1VHJA 3NTLA 4B3CA 3S8MA 1OX4B 3P9KA 4NBVA 2O2DA 3A36A 4OLJA 4QGAA 4QHSA 3RSGA 4D7AA 3PQ8A 4ZOQI 2SBTA 2O14A 5A4IS 2UU9B 5C1PA 2NZYA 3GVIA 3RREA 1MV8A 4H7DA 2FSGA 5KYKA 3BWEA 1O8CA 5CR9A 4HZGA 1C0EA 3PHBE 4MNTA 5IBQA 1Y98A 4XWWA 5AVZA 3W90A 1AX9A 1AMNA 5CCXA 4MARA 2CXPA 3KPVA 4EJSC 2ZJ6A 3OOSA 1RMQA 3CXUA 4LWQA 2OXTA 2KWIA 1M1YA 2XEXA 5L45A 1QGOA 4PF1A 1VPDA 3LX5A 4R2XA 3IP9A 1K5PA 2WWWA 5FO0A 3A4TA 2GILA 3TQIA 2IT1A 3GVHA 2W6ID 3TVDA 2NU9A 1T1EA 3S27A 3ZXUB 4ZVKA 3RTCA 4X1OA 5E7IA 3CUVA 3PE4A 1T36A 3NVAA 5CLGA 5LA6B 2CVFA 3R0JA 4YLGA 4NEQA 1RT9A 3F5FA 1F2UB 1GSOA 1PJ8A 1I30A 2YNMA 4RKYA 2FF7A 2G83A 2G08A 2AG6A 4X44A 1BXRA 4G0VA 1Y4UA 3BMCA 5A9RA 1L4HA 1R27A 3KQKA 4DLTA 3RJTA 5KZMB 4B87A 4NBTA 1G41A 4B3MB 3I2GA 4YR9A 3ZHBA 2OB2A 4OA8A 2RGYA 1EDEA 4RQAA 2J3EA 3AF0A 1I2ZA 1LBSA 4CLDA 3T38A 3BXGA 3KYJB 4AUMA 1QM5A 3H99A 2FQQA 2JIRA 1DQRA 4FMDB 4BJHB 1Q77A 5CYGA 2WJ6A 3AEKB 3T0FA 2BLNA 1OD6A 4RA6A 4R2KA 4RHXA 2Q0SA 1RYHA 4B3HA 4GE3A 1T0IA 1E0AA 1SCBA 4NK4A 5A3VA 4H7HA 3LC7O 4CMAA 3BD7A 4K46A 4QZVA 2MYNA 4MHOA 4ZV4A 1AGXA 3J81A 1V48A 4IIYA 1AKTA 1QU3A 4BRSA 1P2UA 4RD0A 1PEYA 2LXNA 2ZYHA 4G0QA 4DCVA 4E1BA 1I1HA 2BKUA 1SZJG 1U3UA 2EL9A 2ON6A 3L7LA 4HDQB 4PG8A 1R12A 3U4CA 3PCRB 1IPFA 1G9SA 1OV4A 4AIIA 4PAMA 3MGCA 4KKXB 2YHIB 4FXOA 3COVA 4S1PA 4TMYA 3TXYA 5K9ZA 1ABBA 3EXHC 2FPPB 3NATA 2CHFA 3MGBA 3JAMA 1C8BA 4W5QA 2QXYA 5T64A 5TPWA 1XE3A 1WD7A 2I76A 3H4IA 3UV6A 2CDNA 3RSLA 1Y0BA 4A0GA 5FOVA 3IPAA 3L01A 4OQDA 1GRCA 4EW6A 1EJBA 4BFCA 3DQQA 4U2GA 5IYZF 3VVLA 1M0TA 2PFSA 2P2GA 1TQHA 3HI4A 4OXRA 3B1VA 4HNAA 2BFDA 3REGA 5BWLA 3NBAA 4TRRA 4C7MA 3I2FA 3ZNPA 3LUJA 5T4EA 4DIFA 4QL3A 3DP9A 7GPBA 4DAEA 5IVHA 3DAPA 4FXPA 4Y2HA 3EN0A 2J46A 1SA0B 1T8YA 1Y3IA 3DT9A 2QSYA 2DPGA 3WQBA 4ISCA 5KDOA 4W9NA 2WDPA 3T7TA 3I2YX 3KEOA 2JEOA 1ODFA 4BLSA 1IZ9A 1RIFA 3H16A 4Z7JA 2D7CA 3EW9A 3NKFA 4L9RA 3E48A 4F60A 1ENZA 1XCLA 1IVSA 2XOKD 2Y6VA 4LHZA 4A23A 3ZIAA 1X9IA 2AWNA 3I61A 5JSYA 3VUEA 2QHXA 3OIVA 3KVOA 5T4HA 4CT0A 2OHVA 5MDHA 5AJTA 4YRRA 5LD2C 1C3LA 3TDKA 5ALUA 1H8EA 1TZBA 3RVMA 1GAXA 3E15A 5E4FA 2IA5A 1NASA 4G0XA 2BEKA 1THMA 1H2WA 3C24A 1OLUB 1I10A 1W2GA 1VZ2A 2RAVA 1XZQA 2XNCA 1KZ6A 2H4XA 4GPAA 5EG5A 2VAXA 3ECCA 4JUBA 3D1VA 3UTDA 3QKSB 2IYYA 3C2QA 4H1UA 5JS1A 2PMWB 5ITVA 3DDHA 3R3WA 2PAAA 2XMZA 3RO7A 4PLVA 1R0WA 4P93A 4L78A 5JEDA 1D5CA 1U8UA 2HAEA 2ZSKA 3EJWA 5BSEA 5EKXA 5DWVA 2NLOA 2VAPA 3ISVA 1OYWA 4FFMA 4OQZA 4JQOA 3VZBA 1DJMA 4U0KA 3DC2A 3KR9A 4NRDA 4Z9XA 2YC2C 1N5KA 1ZK3A 4UNQA 1XEXB 2XA1A 5A3SA 3BICA 1E2BA 1S2DA 3LO8A 4BV8A 3Q7EA 3D8HA 2C9DA 3CTMA 4AKGA 1Q84A 2VUUA 2X8AA 3GUZA 2X9VA 5K0BA 2BDUA 3FAKA 4I5EA 3UAGA 3EQZA 1LPMA 2IVFA 1TMKA 3VU8A 3VA7A 3LECA 4J2HA 4Q6WA 1XYYA 2EV9A 1PJTA 3HNPA 3PR2B 1HUQA 4UD2A 4OQNA 1MFZA 3UAXA 1XEAA 4RY2A 1Z4OA 5CT8A 3TRHA 3WRVA 4P4TA 1EDZA 2OKCA 1DUSA 2V4MA 4I1RA 4KH0A 2R4UA 2YIMA 4PAQA 3VR3A 4GUAA 4ZO6A 5K1ZA 4IM7A 1CUDA 3TS1A 1OBVA 2XUJA 2TMDA 2QE6A 4R1MA 2IPOA 3ZLTA 2GRAA 3FPJA 5FWNA 2YUIA 4P0PB 2BD0A 1M10A 4MZDA 4X7RA 1KPIA 2IHVA 4YMSA 3LIIA 4C3VA 1UMDB 3OZIA 3ZVNA 3L1VA 1R10A 2AOXA 4KB5A 1E2GA 2YJTD 3IQWA 3GMTA 2JIDA 4PLZA 4ER5A 5MFPA 2OVBA 3RAFC 1NXVA 4E5UA 5LMNB 1Z0AA 3W2FA 3D2BA 4X97A 1QB7A 1L8LA 1DHRA 4KPFC 1JAHA 2ZJAA 2XWJI 1ZJ5A 2VKTA 4OSOA 4NXNB 3OEHA 3EEOA 3QF4B 4LIPD 2ZIZA 1CR0A 4WXHA 1PVOA 2QR2A 2QUZA 1GFWA 1G8KA 5SZHB 3VC3A 1GYRA 5BW4A 1M83A 2D5CA 1SK9A 1R6TA 1Z5UA 2PL9A 3EQ9A 1XTVA 1J0DA 3JV7A 4H3KB 3KETA 2WM9B 1N6KA 1Y9AA 2GF0A 3BDIA 1FDVA 2BL4A 3I2JA 5AIAA 3ZJTA 2I8AA 2QD3A 2ZAOA 1J8MF 1MQ8B 4MR9A 5EZYA 5EJ4A 2F43A 4ENVA 3ZWNA 1D03A 4PCAA 4FZ5A 3IODA 4LDRA 4JOCA 1JDBB 1OXXK 1U0HC 4FEYA 4G07A 5K99A 5F9MA 1VE6A 2XIQA 1V8DA 3QOXA 1SWVA 3GH3A 4MEAA 1XVLA 3BXEA 4CR8A 5JSZB 5K09A 3GLRA 4PG5A 1PK7A 3DHNA 1XPUA 3EDCA 1KPHA 3DEHA 2ZTUA 3STXA 1LD3A 1O6ZA 1YGYA 2I9PA 2WSMA 2ZTSA 1AN9A 2R84A 3A3OA 3AIOA 3AVPA 3D8SA 2REBA 5ARDA 3WR5A 3ELDA 3CG0A 1QIKA 4KV7A 5KDDA 1AU9A 2JVKA 4OYRA 3JYOA 5GONA 3TOXA 2P2SA 1TLLA 4D82A 2IXEA 2Y92A 3BTOA 5JPIA 1PBTA 3DA8A 3FWNA 1VPVA 3H2YA 1FFBA 3KEFA 1ZMTA 5KOHA 3CZ5A 1P91A 1XI2A 4H1WA 1K7FB 4IFIA 2X76A 3RK1A 1HYEA 1WBDA 2RKOA 1FDIA 1GPKA 1OBOA 5F9HA 2Y05A 2ALJA 4OJNA 1PW7A 1R18A 1Y6RA 5T8KA 4DLLA 5AW4A 5KHOC 3R5XA 4NOJA 3CSSA 3JS5A 3FD8A 3Q3GE 1DNPA 2O54A 1CY0A 2CFOA 5INTA 2HCRA 2QLBA 1E1QD 3W9YA 2XQVA 4JI6B 3ELWA 1U81A 4ZDKA 1V8PA 1FQKA 3WB1A 3DKRA 1U2RA 1ZVMA 3W6PA 4Y6PA 4LZLA 3AUYA 4MUFA 4PLFA 1Q7CA 1KFJB 1JDTA 5LOVF 3SC4A 2JGDA 3EFHA 4COOA 3OE7A 4QGHA 4GMXA 4IIEA 1D1PA 2ILTA 2V7EA 3ET4A 4I4TF 4AO8A 2OAGA 3QEKA 3ANXA 4HDMA 4QPPA 4P3OA 1KKLA 4QODA 1SKAA 1TCUA 1P9OA 1II8A 2XUDA 4HNGA 4GZ3A 3UYLA 2J6BA 3ZKWA 2QPLA 3NHBA 1IN6A 5IWAB 3ERCA 2FH5B 4RDXA 3PQ3A 1B0UA 3SDBA 1AHPA 1GLNA 2C03A 4ZQGA 1PLJA 2CJWB 1F0PA 4JFAA 1WU8A 2JJ1D 3WGQA 1LV8A 5I9NA 1JJBA 1BGWA 4WKOA 2VJBA 3MJDA 4YMLA 3LWNA 4E1AA 1KAMA 3EOZA 3U1TA 3NVMB 1VA4A 3LHDA 1O96B 1W44A 1TK3A 4YP5A 1RABA 2AXPA 1NNSA 1Y6ZA 3A6KA 4HPXB 2GPSA 1RC1A 2BMFA 4M9RA 4WTOA 4C08A 1EJ0A 4QFCA 4WZBE 2ZJ0A 2J32A 1Y9JA 5BO5A 1CEXA 3KWFA 4B3DA 4BBJA 4DCCA 5LWQA 1KQPA 1U1FA 3W4JA 3HB0A 4XVHA 4AI6A 2VP2A 1ZX1A 5KTYA 3HBNA 1CZOA 1DAMA 1EVKA 3PXUA 1SNYA 1BVRA 4G89A 3H8WA 5KB3A 4FGKA 2WKSA 1G4AE 3E9MA 4MVJA 1FLDA 2HKIA 3E81A 1U4OA 5TMDA 1H2RS 4CKBB 1C0IA 4LBVA 2ONKA 4OHPA 3UFXB 3PUYA 4JLDA 1ZNZA 1O6FA 4WGGA 1SD2A 1KWGA 5AVYA 1MZVA 1OV6A 2OK8A 3MC1A 3PHLA 4YBRA 3N07A 5ICFA 1BJRE 3BMQA 3H83A 4D0LB 1T5HX 5FULA 3MCWA 3DYBA 3WYBA 4IJ5A 3U9LA 2LE0A 5ESWA 4CGZA 5FT9A 2C4TA 3GEIA 1UK9A 5EOVA 2R85A 2HEGA 4JH0A 3PXCX 4HFRA 3E61A 3K94A 1ORWA 1W9MA 1DCFA 1Z4LA 2GN0A 3AEQA 1UM9A 2CUTA 3N7UA 1J8DA 1J39A 5E6SB 1EM6A 4DV1B 3TNLA 5B55A 1YRAA 3N8GA 4WXPA 2NXNA 1G20B 1OAKA 1P17A 1T15A 2YUTA 4TWRA 3ZCPA 5KNCD 4BBPA 1ORDA 3FY4A 4QD3A 1RPZA 1F48A 2OV1A 3G6WA 2NTNA 4BVGA 5BN5A 4D3YA 1Q7GA 5JZBA 2ZULA 2GPWA 3OHSX 3BMXA 4LSZA 1KETA 2Y2VA 1LX7A 1N2GA 2QJRA 1C9KA 2DCMA 1N2IA 3KZXA 1Z15A 4XLTA 1YHYA 5EGNA 3VR5D 3U4HA 3K70D 3Q7SA 4FFPA 4JLVA 5ULLA 2YJ3A 2YYZA 1K7XB 4RJKA 3T5GA 2O7QA 2DBZA 3QEOA 4MCIA 2HT6A 3KAQA 4KGDA 1GEEA 4V0NA 3JD1A 3ZWPA 2R9VA 1CYEA 1NVVR 4L5JA 2FWAA 3U7FB 4KVZA 4CM9D 2XUPA 3TX2A 4A5OA 5BQFA 2CV2A 3SR4A 5KQGA 4BCBA 3UCFA 2VLIA 2ZGVA 2IGTA 2QRNA 5JMWA 2AC4A 5F5LA 4H0NA 3VR4D 3WMEA 1K7YA 5LBTA 1TNDA 4URWR 1KI4A 4AMVA 1Q3TA 2FWIA 3BWCA 4KMSA 1CB0A 4ZOEA 3AEUA 1YR8A 4CI9A 4DS3A 2F9FA 3H5NA 4HS9A 2YWEA 4QQKA 2GPNA 1PGJA 5TF4A 2H54A 1GQSA 2X7HA 2BBWA 3EISA 2C5AA 3NTXA 3ONEA 3H0EA 4O1HA 5IVDA 3VR4H 4DSAA 4IMJB 4N7MA 2GZAA 1C7FA 4OV6B 3KJIA 5SZIA 1DUVG 5CX1A 3SIPA 1YS9A 1NQTA 3CVJA 2PYDA 3B7WA 4P32A 5TRTA 4DTIA 1ESMA 4RZHA 4AJLA 5AESA 4HBZA 1QHSA 3LBIA 4CF3A 1XCPA 5EJEA 3CW9A 1NW7A 3EF0A 3M33A 3RNOA 3QEBZ 5FI0B 2Z5VA 3NONA 2WHPA 4HK4A 4LY6A 1B16A 4NESA 2WUDA 3DE5X 1M34E 2AW3A 2CBGA 1C7JA 3HA3A 1X7GA 3RSQA 5AICA 3DEZA 1GQFA 4RD3A 1I01A 2YYYA 5TVGA 3T4EA 3UMMA 5CBKA 3R7LA 2WFAA 5EIXA 4E2YA 2MSDB 1I7SB 1E92A 2FV8A 4ETNA 5M29A 2CVOA 1G21E 3H2JA 1U3WA 1LFDB 2IXGA 3K0EA 3DZCA 2XUAA 3O91A 2WAAA 4NS1A 5D6NA 5K0ZA 3V97A 1A2KC 3KQNA 3N7TA 4J4TA 3H1EA 4ZGGA 3P52A 4TKVB 1A7UA 3EHEA 3AI1A 1JPVA 4P6VF 2AFHE 1CZKA 4LJ6A 1LPSA 3KOMA 1RXIA 1CHNA 1Y6GA 2Q4OA 2Q6VA 4DM7A 3QVGA 1GUYA 2P2NA 3DTYA 3QNWA 1PR4A 2Y0EA 3RSFA 3L0OA 3GPDG 5BV7A 2NIPA 1B43A 1MT0A 1P4RA 1VBFA 1TJ4A 4TXLA 4AY3A 5COBA 3KDSE 1GPUA 3INGA 2RGUA 4WNAA 2QLNA 1R0RE 4ZO8A 2NXEA 3CIFA 3DBRB 1S6YA 1KC1A 1P7CA 3N76A 5DLPA 4JUAA 3WZ2A 1EHYA 4FWIB 3HCNA 1S9DA 4UARA 1HG0A 2IV2X 1KSHA 4UDYX 4D74A 1M6NA 1YQUA 4LWZA 1NRJB 1IM5A 2QL7A 2JCVA 1ZD2P 5SZJA 2O0JA 3O8BA 7MHTA 3A1EA 4Q7LA 3FWHA 4G4IA 3OHMA 3JYPA 3LUKA 4PU0A 3HB9A 3I76A 3V2IA 5JY6A 3A1WA 1Q1NA 2G06A 4MDYA 3UUEA 1LCIA 3RS3A 1VKZA 3CNHA 1ISPA 3L8EA 2BYTA 4Q01A 3CKLA 2WJZB 3UJHA 2GPYA 3WLQA 2JGEA 4BE4A 3V1LA 1C7IA 2AFIE 1IY2A 1NJ6A 1X2EA 4YIHA 2JFOA 4EZEA 1GFZA 4BX9A 1J5PA 3IQHX 2GBIA 1ZJWA 1PYDA 2FSHA 4H4CA 3CUSA 4JLSA 4RM2A 3B5JA 4GI5A 3GK3A 2GN9A 4KQFA 2C9MA 4I1VA 16PKA 3DM5A 4ZC8A 1DRKA 1M1XB 4TV9F 4BUJA 1EZZA 1V11B 2OZKA 4I3FA 1G38A 1B2LA 3R7WA 1S2IA 2BFCA 3KB8A 3D81A 1LDNA 1YVPA 1IHDA 2PEYA 2OENG 2O9JA 4A8JB 2X5JO 1KK1A 4RESA 2C4WA 1PIWA 2NVWA 1O97C 3I5MA 3LKZA 3NGXA 4DRZA 5KQSA 2OXCA 2PZAA 4JLAA 4JLMA 4EABA 1EGMB 1V3QE 4FBGA 3AIIA 1QANA 4DV4B 1C1DB 3ZQKA 1HLPA 1Z4JA 3RYFA 5IASA 3ZY5A 2DQKA 4II7A 2ZJ4A 1EFKA 2OV3A 1N1EA 1PR2A 3PUHA 2QUHA 2HXGA 3LA8A 4PAWA 1FSFA 4X85A 1D9XA 4YRTA 4K9NA 3R23A 2W6IA 2QI9F 2KB0A 4DCTA 1BZYA 2G9NA 4HPJB 2HX1A 4MPTA 5E1DA 4Z4HA 2P0EA 3E3NA 1CVLA 5EJIA 1ICIA 2YWJA 5IT9A 1XEWX 3K0CA 2Y68A 2Q1XA 4JS0A 3E8SA 2F1HA 1CRWG 3QQPA 4L5CA 1W0CA 4KNVA 4P5EA 3WGOA 1G98A 4AN0A 1Q95A 4DPLA 4DLKA 1F60A 4M0PA 4B4DA 2OQ2A 3HLYA 4MDHA 3EFBA 5TF0A 3NBKA 3C3XA 3E84A 4EKNB 5CCEA 4K9MA 4BJ3A 2UXCB 1MX5A 5C8XA 1Q12A 4TMZA 1JLMA 1QYRA 3BYZA 2GPBA 3ZW8A 1YQWA 2O8EB 2FPGB 4L8FA 5DRTA 2YVUA 3ZU4A 4YYEA 4A8PA 3IULA 3TB4A 4CQMB 2BBTA 3DFZA 2XT0A 1EUDA 2QTLA 4IS3A 5IYZA 4XIFA 3LG2A 1L5NA 1NDQA 2YXPX 5ABPA 5HGJA 5BUZA 3IEXA 2YWDA 4DWOA 2NZ8A 4AF8A 2C04A 3RRZA 4D9CA 1WBBA 1GNRA 5DBOA 4LMRA 1PL8A 4CFSA 1P7ZA 1UBJS 3M3PA 5FPSA 3VR2D 1W59A 4MAMA 2WAOA 2X41A 5AKZA 5FPYA 5H5JA 4BVFA 1SBCA 2B2CA 5IEJA 4MS3B 3H4TA 4MROA 4RNCA 1AQYA 2X7JA 4KC0A 2ZUFA 4PCVA 1IEVA 2HGSA 3G5UA 3TSCA 4M7RA 5A5DA 2H1RA 1I4LD 1DFHA 4B45A 2QVXX 2YXNA 3BK1A 1ZU5A 4L9SA 1J6UA 3MRXA 1G55A 3EDRA 5DF1A 3FGZA 3D9QX 4UVEA 1VL1A 4ZVUA 3WHKA 5JS6A 2WQZA 1LJ8A 1T9CA 4YY3B 3WADA 3CEJA 1CQJA 5AVXA 1SVKA 1IN4A 1A88A 3L6BA 2HBQA 1SKBA 1UKCA 3B9BA 4KQ1A 3EXIB 4KYTA 4ZVLA 4C7KA 4RLHA 1ML3A 3LVBA 1G7CA 2C0PA 3M5DA 4R1TA 3VR6D 2AZMA 4ZCPA 3FW1A 4X8LA 5EJ9A 2QKYA 3PA8A 4J9VA 1C9EA 3VU1A 2C4VA 4M9ZA 1AXGA 3BJZA 2GEDA 2HBZA 1C9MA 3A9VA 1QH8A 3WGVA 2D5IA 2N47A 4JEIA 4IDAA 4ND8B 1ORHA 4BKUA 5ITSA 3MA0A 5BSRA 1LF0A 3ZE0B 5DW0A 4MP3A 4FIZA 3EXHB 1W1WA 2FQXA 3COZA 4EMSA 2M6SA 4HZUB 4A6EA 3WA6A 2NZJA 3LKBA 1G3RA 3RJZA 5KEIA 1X77A 2PMKA 4BZXA 5LP1A 1RCFA 4HNQA 5DCYA 3UBMA 5DNYB 5DM2A 1HYBA 2FVXA 2MIIA 4DY6A 1ESCA 1IOVA 3G2OA 1NZDA 4E5SA 3AVOA 3PVZA 2NU8A 3EEBA 2GEBA 3EDMA 3JQ6A 3LQRA 2WSSD 3QEJA 5TLSA 4X90A 1KXZA 3KR0A 5IAEA 1DUIA 4GT1A 4J1TA 4K9OA 3RWBA 1WXWA 1CY2A 1B0PA 3U4MA 1X3SA 2QX6A 5NLLA 4KFTA 5CBPA 1AIPA 3VVCA 1YBVA 4RPKA 2RFLA 3K9QO 5BSVA 1FP4A 3TZKA 2GWRA 2VQEB 1J33A 1GKYA 3NAGA 1MCZA 3TJMA 3HTXA 1DPGA 3D59A 2NUAB 3NRBA 1I51A 1SEPA 1GAEO 1A04A 1JECA 2A0UA 5E2BA 1GU0A 3AI7A 3IKJA 1RBQA 1JFFB 1VIMA 2H1CA 1KJIA 2OBNA 1F51E 2PVSA 2OOKA 4LCJA 2W8BB 1YJCA 1CLEA 5IJXA 3WV5A 5LA6F 3FJOA 2CDCA 5KNLA 4Q9HA 1TM1E 3FPKA 5LD2B 2P9QA 2HRRA 4OD0A 4CMEA 5F1KA 4I6GA 3W3ZB 1RWKA 3AJAA 4I1SA 1J00A 4XYEA 5L3RA 4BNJA 1T29A 1H3FA 1TJ5A 1YOBA 2Y9MB 3GEHA 3DDWA 4IXNA 2DT5A 5CHEA 5E9AA 3AETA 3S1LA 2J6IA 3VZQA 3C5WP 1H2FA 3NLLA 4MDFA 1F14A 3UGKA 3VH4A 4CMJA 2Q4RA 1SBZA 4TSRA 4X6UA 2J3QA 2YV2A 3DQPA 1U04A 4Y6OA 4PLHA 1L5MA 1JG3A 4UMDA 1VOTA 1ZRSA 4NE7A 1Q0LA 1I0LA 4HYEA 4J7UA 4PGAA 1T4CA 4RHCA 4W7HA 3ST7A 4P3YA 5KQPA 3TLAA 4HNSA 4CCYB 1KY3A 1MJNA 2RG7A 2WU8A 4NZZA 4RYLA 3PFKA 1KVUA 1U2QA 2ZJ7A 4US0R 4AWXA 2WLSA 3R0ZA 2VI5A 1ABEA 2AL7A 1OFGA 3WLIA 2OV2A 1ZICA 3PP8A 4EUKA 3BEOA 4O0LA 4OYLA 5FPTA 3JD0A 2AEFA 1REQB 1Y3CE 3F9RA 2HNKA 4Q16A 1R8JA 1GCIA 1DDGA 1DTSA 1PJ2A 3NT5A 4EG1A 5IJ9A 5AKKA 1N2SA 2A8YA 1GUFA 1Y4AE 4ZA2A 1VL0A 2CVQA 1X80B 1TQ2A 3AZOA 5DHQA 4BDSA 4KPUA 1JBEA 2YMQA 3TRIA 2ZWIA 3HU1A 1F6DA 1GJRA 2ZU0C 4H7EA 5AI4A 1BHQ1 1RYMA 3GUHA 1B6SA 1ZK2A 4EB6A 4PSAA 1WEKA 1EZ4A 1V39A 2VQDA 2VP5A 1ZVJA 3MTQA 3MVEA 4MGZR 4R9UC 3VOTA 3NYIA 1E1CB 3GLQA 2FZWA 4Y1GA 1YFKA 2I4OA 3LBNA 2CMHA 1U1CA 3KB6A 3X44A 2CXRA 1UDRA 4PLCA 2YTZA 3WGUA 3OPYA 1BDHA 4EGFA 5F33A 1OXBB 2AZDA 1NVMB 2Z58A 4MA5A 2XH8A 5F12A 4GP7A 1N1MA 3NJ4A 3T06B 5A0TA 1NZJA 3OQ6A 3TEFA 5CCDA 1SXGA 4GM4A 1V7PC 3R7FA 2QRLA 3I32A 1XTRA 1YIAA 2QPTA 1OYYA 1M2NA 2REOA 5JY1A 1Z7WA 1JDPA 2VHZA 4Q7MB 3LHIA 3MMPA 4JB0A 3DMGA 3WAJA 1RP1A 4DC9A 2QORA 1GGVA 2B4AA 4PRLA 1TJNA 2J0VA 1DC4A 3F3SA 4CM8A 4JITA 4Q47A 5TGZA 3ONDA 1XA0A 1UJBA 4L1KA 4NBWA 1R64A 4PO1A 2AX4A 3V8RA 1QE0A 2HJSA 4D8XA 1ZUIA 1DBQA 2XVYA 4B48A 1VKOA 4UAJA 4AYWA 4C4RA 3O8RA 3V4LA 4JAVC 4FNAA 3BIWA 4A16A 1PV1A 5IKEA 3ZXSA 1UQUA 1CRPA 5BV1A 3KB2A 1TXGA 2I33A 1FXUA 3G5AA 1G2QA 2XSZA 1EPUA 4MW5A 5DGHA 2CGEA 1FRQA 2QWXA 4JBHA 3ZHXA 5M04A 1E1QA 3NZEA 4MGYR 1MAVA 3B1YA 4RZSA 2GN6A 3A1UA 5JTTA 4CTMA 3AR4A 4FYVA 3CR8A 4PO8A 4BTEA 4LPKA 3EXFB 1AGRA 1ECJA 2V6JA 3LVFO 4QBIA 4DIUA 2BHSA 2OM2A 3C6QA 5FNZA 2IIQA 2IYUA 2WJGA 1U0BB 1J90A 2PNFA 2A3RA 3NYQA 3FOZA 5BRAA 4Z0HO 1GU1A 3C3KA 2O06A 4EG7A 3E58A 3K0HA 1W1IA 4PY2A 3GLHE 3F6PA 5JJBA 4Y6SA 1TZMA 2XVXA 4MA0A 4OP3A 4S35A 5AKXA 3LQKA 3M4XA 4HUQA 4D5EA 3L0IB 2B2NA 2J7PD 1M76A 3NC1C 3PJDA 4AZVA 3AL0C 1L8OA 7REQA 5K3DA 3LF2A 4HFMA 1HDYA 4B4KA 4MI3A 1LX6A 3AF5A 1NVBA 3E0XA 4OJKA 3SYNA 1L5GB 5DI3A 3SSNA 1W94A 3D7LA 4EGQA 1IUPA 1YUMA 2JJ1A 4JUIA 3TVTA 4DMGA 2GUWA 1L4EA 4YI5A 3WGIA 4AQ7A 4R84A 4Q4HB 1RWOA 1Z6PA 1W5FA 1MAAA 3TEJA 4DNPA 2WJPA 3JASB 4NCKA 3DTVD 1MOSA 1U2SA 2GCIA 3JYQA 2C78A 4IUCS 3HXMA 3GAFA 4EDFA 4UBMA 5A03A 1NVGA 4K6HA 4C0LA 5K05A 2VL7A 1NY5A 4C4PA 4KO2S 4LWOA 3OZTA 4KQHA 3VPFA 2Z1DA 3FKSD 4N8EA 1LSOA 3RKSA 3ELBA 3BK2A 4OF4A 4W99A 1KU0A 4LY9A 4UAVA 1TO6A 2DBQA 4RZXA 1Y7PA 4YP1A 4ZQEA 3AKZA 1FB5A 1OR8A 4O2BB 2IH4A 1M74A 2IOYA 3A37A 4G1VA 3X1JA 1LBEA 2KLHA 1G5FA 2E18A 1FSZA 1YQ9A 3CLHA 3EEIA 2E5LB 4RPLA 5ALXA 2OR3A 1BMQA 5KTRA 2F8TA 4EY5A 3SFZA 4RW0A 2POQX 5IXSA 3V7UA 5HJ2A 4BLQA 4TXNA 1UCFA 1CXZA 4TL9A 5LMZA 4RTLA 1G3QA 2JAUA 1T2AA 3N0TA 4CKEB 3V48A 2PZLA 2VPZA 3EIXA 3ITDA 3RVBA 1S2NA 4LDNA 5D87A 3T3NA 3QVOA 1PS0A 2WFLB 4PIPA 1UP4A 1QTRA 3QW2A 3HU3A 3GOQA 1G3IA 2OECA 5A3JA 2FPIA 2R6FA 3PC3A 5BNZA 5HQ3B 2A86A 2P69A 4RVUA 5HZGA 1JNXX 3H75A 2V5VA 1RBMA 1RAEA 2W2MA 3CEMA 3A1VA 2OHOA 3ZY4A 1HKHA 2HBRA 2NZUG 5DRYA 4QDUA 1Z88A 4CUZA 1P4SA 2C2XA 1QF9A 3ROTA 2P68A 3TIVA 3E7DA 1EM8B 2HU8A 2VHWA 4J03A 2PGJA 2JW5A 2OO3A 3KKKA 4DUPA 1JRLA 5BMVB 4RJIA 3WLPA 1JPJA 5CFPA 3U0VA 3HH8A 3D4PA 3K2QA 5C35A 4B3SB 2OYSA 2CLEB 4IGEA 4D98A 4ETWA 3SXUA 3DMFA 4PV7A 2WWHA 1DKRA 2PS3A 3ZW7A 5AH0A 4E12A 1K6IA 2HA7A 1K8ZB 1QP7A 3CKYA 4TT3A 2QR5A 2RC6A 3MLBA 4CM9A 2ZSHA 1MPTA 5TGTA 4ABTA 4QOFA 3AKCA 2BY4A 3LWBA 4I4CA 4JDUA 5JVDB 1NMYA 5AUNB 1FIUA 5IUNC 3KUXA 3IAM6 3V2GA 3BOSA 1VCIA 3VR4A 3RFTA 2XAUA 1KZ4A 3D7RA 5ALRA 1HDZA 4POOA 4WVFA 1DB3A 3O7MA 3PQFA 1E94E 2NTJA 2R6HA 1YCFA 3CHYA 3ZC3A 1W6UA 4P7KA 4GZLA 5F2KA 5K01A 1R37A 3C8HA 3TMAA 3DNPA 1A8IA 3C3PA 4WL0A 3U4QA 1N34B 3BJIC 3HKBA 1JB9A 2OGUA 3WGTA 4C2AA 1G5TA 1QIFA 1TQ4A 4N18A 1ZH8A 4BPBA 2ZE7A 3V8MA 1TTQB 3I64A 4B7CA 2ZRBA 2GUGA 3IH5A 1DIAA 3NM6B 2HW8A 1OOEA 2BGUA 1DTWA 1NX6A 4I36A 3STYA 2J9YB 2FPSA 4EB0A 1LDGA 2X23A 1R74A 2FP4A 2O3UA 4LECA 2DTEA 4ZEMA 1F4LA 1IXYA 1DJPA 1T6NA 4O8CA 4TTRA 1YL7A 1RWWA 1FTNA 4FHFA 3VKGA 3MILA 2CCKA 1G0NA 2X8JB 4KIGA 5C5DA 2EARA 1JIIA 3U09A 4PAGA 1N6IA 3FR7A 4AF6A 3DOJA 4DLPA 4QAJA 2BR5A 1YOVB 1X7WB 1RM0A 4KWEA 3ZK8A 1MRNA 5CP8A 4DYDA 3CVWA 2AKEA 2HUNA 1RACA 1HFEL 2O8NA 3G13A 4HD8A 3G2QA 4LK2A 4XLLA 1VL6A 3HYRA 4P4SA 3RIGA 3KT0A 4EMBA 1LBHA 2CLFB 3FI9A 4DQUA 4F06A 4YRCA 5FDFA 3WAGA 3OA0A 4LEIA 5LVAA 3FBWA 1EUZA 1SBYA 4NJMA 4Y3UA 3FDXA 3B3JA 3T1YB 4E6PA 4UBNA 2JIZA 3OZCA 1NF8A 2WT8A 4J16C 2DCUA 4L07A 2AW5A 2J9FA 1Y81A 3HDVA 4RCVA 4DLXA 1W85A 2A0FA 3ORSA 1V0JA 1Y8QB 5CM8B 1F5NA 2QG6A 2X0JA 1YJBA 3MTAA 3KXLA 4NCNA 2BKVA 4DJDC 1QU2A 3IS3A 2NQTA 1ORVA 1DAFA 4TWAA 4DQXA 2HU2A 3KTFA 3PF9A 3EGIA 2ES4A 2WKQA 1ZH2A 3QNMA 2BVNA 4Q9LA 3AILA 3OTGA 1BWPA 4G5RA 4KXXA 4J9UE 4ZJPA 3AUJB 3D4IA 2H65A 2ZB7A 1I14A 5ARCA 2ZIUB 3QY9A 3CN9A 2HADA 4KIWA 3KWJA 1CLUA 3UW1A 2ZBRA 2OFFA 3BHMA 2HIAA 3E9ZA 3ZR4B 4KN8A 4TWBA 3GQVA 2XVAA 1JAZA 3EFEA 4IRMA 4NV0A 3MCTA 1G7TA 2LPMA 2FETA 3M8KA 3PGVA 3GGSA 3JYLA 2PZEA 4PYJA 1KQ3A 4FFVA 1QIMA 3U19A 2AE1A 1TF7A 2CUKA 2PYIA 1WHTB 3M82A 3ZX5A 1N1DA 3BL5A 4BXOB 3ETJA 1H6DA 2ADOA 1HE5A 3KJHA 4WASA 5DSTA 4JBWA 1W76A 1K5HA 3HDYA 1U0LA 2GZMA 2H1SA 3GUUA 4I8XA 2MSLA 1YA4A 5AI8A 2RHLA 1CZLA 2GBFA 3IAUA 4D4JA 2X19A 5ER6A 1AUXA 3HJRA 3VZDA 1A9ZA 2XF8A 1OAOA 4AM8A 2PRYA 4XTCS 1G1AA 1Q1AA 2R8YA 3MOSA 3UWSA 1QZTA 3VSCA 1X7ZA 5BSFA 3H42B 4MWDA 4OMCA 2YXEA 3H3FA 3NNNA 3QU9A 4QT0A 4XUCA 5B4VA 3P27A 4FYKA 1W34A 2G0TA 4HTFA 1SCAA 1F6WA 3SS8A 3ASYA 5EJFA 1CP3A 2I78A 4F3RA 1RZRD 1RQ2A 1SVUA 2PNJA 5ITWA 2G8LA 3IXQA 1HLGA 2H3EA 1KI2A 4BNYA 4RWEA 1B2RA 1D6MA 1NN5A 2AOVA 2QN9A 5DGCA 5ELMA 1DZ3A 4NOKA 1DX9A 1KI9A 2X40A 4KFSA 3L82B 4D4IA 5J4VA 1C0KA 4TXMA 1KSJA 2JLYA 1M2EA 5H02A 2NWQA 2QPOA 2QOEA 2DPLA 3AI2A 3GJRA 3HKCB 4HUTA 1RXEA 5GM2A 2F1RA 3IR7A 4PBSA 4H27A 2P2ZA 3A3YA 1OFUX 3SMVA 1RWVA 1WNFA 1H6AA 3CR3C 2HXYA 2HY7A 5IM4A 3ZS8A 4FP9A 3HA2A 3F6SA 3OOHA 2WR8A 2KM1A 4CPDA 1P1JA 1OYVA 2VDJA 4F8EA 4YFVA 3T94A 4URVR 5A5EA 5B4TA 2G6TA 1JQAA 1GTRA 5C5CA 4JL6A 3IV9A 3WWYA 2KS6A 1ODKA 3VPCA 5CB6A 4CI0B 3OTHA 2B4QA 5IKMA 4NNOA 3IAS1 5D00A 3UN1A 1LDBA 3MF4A 2AOTB 4ZCTA 5BV8A 1UWLA 1X1DA 3U4GA 4DR2B 4RKWA 1KJQA 4CRWB 3VR2A 4ZK2A 3AR6A 1GFSA 1T8RA 2FPLA 4GC9A 5I8WA 3G5MA 2JD1A 4WN9B 4YP9A 4NCJA 1NUSA 1PJSA 2JIPA 5IBPA 2VP9A 4R51A 2GLUA 3LPNA 5DOZA 5T6MA 4K3UA 5ALGA 4D4KA 4DT1A 1JFRA 4MYHA 2WVAA 3U1BA 3MINB 1R2QA 1W581 3CJTA 1EBUA 2HRQA 3DMRA 3LFHA 1E7SA 5I7OA 1FYEA 3Q41A 1E2MA 4C7XA 1S3GA 3GCXA 3WK7A 4G8CA 1E9EA 2QZSA 3BVPA 1JG6A 2JJYA 1GKKA 1KNQA 3I0ZA 4WOJA 5GV7A 2W4IA 3OOEA 4GXRA 4MICA 4UUMA 2VJQA 4NCAA 4BKOA 2FVYA 1KYQA 4ZYLA 2ZRPA 3EXEA 2NSLA 3DW3X 1YACA 2DFDA 3NUGA 2I1QA 4EPYA 2BGNA 2CNBA 2D1RA 3ZLVA 4AP9A 1E60A 3OLWA 3K1AB 2AG5A 2Q5IA 1F8UA 1KIFA 1TLTA 1XJCA 3CLSD 1YMQA 1XSEA 4OVKA 3BORA 3IIMA 2BAGA 3JVDA 4AC9A 3ZU2A 5FWYA 1Q6YA 1TCAA 4X6LA 3KIPA 3TXAA 4F5EA 2OHFA 4F3CA 5J1TB 3QRWA 5B6JA 2I4LA 4Q1DA 3S29A 2V74B 1JEYA 5KWEA 1WHSA 1BXGA 3GRUA 5KYWB 4IW3B 3O8QA 4RYDA 4DRYA 9GPBA 1L3BA 3KXKA 3M70A 5F7XA 2I91A 2P5UA 2IIPA 1LB1B 3LLSA 2A30A 2H06A 4WE3A 2OZLB 4Y8VA 3U26A 2QBYA 3H4MA 3QBDA 2X8LA 3OZGA 4MR8B 4H2DA 3G1TA 3ZE6A 1P61B 2HMUA 1L8QA 2PMDA 4FLFA 5HWSA 5J59A 3FB4A 1NZFA 4IVQA 2BR3A 3UAWA 4B8ZA 2DETA 3GRYA 1EE2A 4CEIA 2WSSA 1NP3A 3B20A 1UDWA 4QYMA 5JNTA 5H8WA 4M88A 3IKVA 4RD6A 2XXBA 1OA0A 2C95A 1HYHA 4PWZA 4QASA 3DLPX 3S8EA 1N77A 4N5LA 3W1VA 4DNQA 1PQPA 3TL2A 2GN8A 3DCYA 3DVAA 3EVFA 1XRMA 5IJAA 3S1AA 1QFYA 5LXTA 2XMGA 2LCIA 5EIOA 3SYTA 1XRRA 5FTJA 1N5JA 1P4GA 2O2HA 4YI3A 3OQBA 1A50B 1WQ1R 4L22A 1GNVA 5IAKA 1QVWA 2V7TA 3GFVA 3SF0A 5EC8A 4UBIA 5T5QA 4J2OA 2QR3A 3TGPA 4W9MC 2GHQA 1L5LA 5BVGB 1S8FA 2J4CA 3VU0A 2BHNA 5G4KB 4C3ZA 4EGAA 1JKIA 2IOHA 4G25A 5HIMA 4YMTA 2ZZMA 2QW8A 4DMUB 3VO1A 1CX9B 1DKUA 3ROKA 1ZVKA 4C88A 4RK5A 1A5AB 1Y82A 2ZT8A 4H7KA 1UXIA 3FYTA 5K3BA 1KU6A 1WXGA 2QN1A 3ZTTA 2ERYA 1K2WA 1MUUA 3IOCA 4XX0B 1G59A 4Z3KA 4IWNA 3M6AA 1P1CA 1Y4SA 5ILGA 1IUNA 4G63A 2OCPA 2W83A 4XEHA 4YQYA 5FJJA 1TT5A 1BA3A 1FNSA 1YJ8A 2EBHX 2JI7A 2CBZA 3LD9A 4LBWA 2PL1A 4V3BA 5DCWA 4FEGA 3V8BA 4JGIA 1FYXA 1XRQA 3DMTA 5BN4A 4JNKA 4I9GA 3H2SA 4U9HS 4QVKA 2VCYA 5L51A 4RQBA 4G3XA 2YV1A 3G82C 4KLZA 4D99A 4B76A 3H9JA 2WUWE 1WV1A 3ADOA 3DF9A 4Z9BA 3OO0A 3HXPA 1O4VA 4EG4A 4XJTA 4JJGA 3LC1O 3V1UA 2CLIB 1AKVA 2ZDQA 1AS2A 1ZMRA 3EEYA 4R68A 4KDEA 3DKPA 4TM7A 4X45A 1C3EA 1L1QA 4D0SA 2X8WA 5SICE 4MGHA 4ENQA 1PYGA 1B4DA 3I39X 3GJYA 1J97A 2PUDA 3BIXA 4YAEA 1ETHA 3CVVA 3ZGZA 1WMEA 4LMAA 1G5IA 2PZBA 2VBIA 2OESA 4WZBA 4YMHA 3FVQA 3ZWCA 4RVCA 4AIRA 2W6ZA 3NRJA 1TA0A 2GPJA 4BNMA 1OU4A 1VQ1A 1W6RA 2ZRCA 1HO3A 1S3IA 2Y4OA 4PPYA 4LCBA 3V3KA 5C4GB 3F6BX 3GMIA 5DULA 3K5HA 2FZGA 1ESDA 2C4MA 1SIUA 2G9QA 1HEUA 3CGWA 3JAKA 1PX0A 4JJ4A 3MT0A 2F3SA 4J2TA 5D1NA 4AVYA 3WSVA 4O4IA 3MWYW 2XQIA 4F6RB 1PGOA 5LIRA 1W48A 2Z3WA 3HR8A 3K7EA 3QUSA 4FE3A 2X1MA 5LQMA 4HN2A 3DWIA 1NRXA 1QS0A 3RAPR 5ICCA 4RHFA 1KI6B 4E5YA 2A1TS 1BDIA 4KGZA 2VBGA 4BX8A 4EELA 3PX2A 1LK5A 3SHTA 5KNBD 2IYLD 1V16A 3CZAA 3KPUA 3QQ5A 3W5HA 4DLBA 4R1SA 4GYWA 3CRW1 2ADMA 2BH9A 4ZDJA 3ER8A 4XWYA 3MMZA 5F4BA 4CCWA 3SE7A 2Q3LA 4LNHA 1H3NA 3TGLA 5GJWC 4MYRA 5HR5A 1XU9A 3JW8A 3N3BC 1YAHA 2X5NA 3A1TA 3T9CA 1QVRA 4RVNA 1TVKB 1N2HA 1EWVA 2ZAGA 1TQDA 2ZJ8A 4UUNA 4ZO9A 4MVCA 3UKOA 4Z54A 3CF2A 3QVJA 3VO9A 3LH5A 5IJWA 1BVUA 1AQUA 2YZKA 5JEEA 4JSRA 5EE0A 1WXHA 4TX1A 3GV0A 1QGUA 1EFPA 2OBLA 1CEQA 3FUCA 1FBNA 1VIDA 4HRXA 5JI2E 4P9NA 2R6JA 1M1NB 2PUHA 1VPWA 5I9MA 5KDLA 2ECFA 4L51A 5A4KA 5HPYB 3CF4G 3ZQ4A 4CV3A 4PFJA 1GNLA 2YDYA 1S0UA 5FB3A 4BYGA 4DCUA 4B3IA 3K0FA 1XQXA 4J3NA 4XWTA 3ZBQA 4EF6A 1KRHA 3V8EA 3D6JA 3HLKA 5JC8A 3NIBA 1P4AA 2ENWA 3E22A 2B61A 1Q0UA 2PKWA 1R5BA 2AC7A 4IV0A 4F11A 1WSAA 1FJGB 2FN7A 2A0WA 3LWZA 1L7DA 1PKEA 4ZI5A 2PMEA 3JD3A 2R6R1 4EJ2A 2IYOA 3QHQA 1K6JA 2J7PA 2WM3A 3I23A 3JQBA 3PEVA 2Q3CA 4JLUA 5E6UB 5FWAA 3VGJA 3NTRA 1LPNA 2H7CA 3CJRA 3IYLW 3OZAA 3LYAA 4NL4H 5H3CA 4ALJA 1O94C 2W90A 3THWA 1FF9A 4GX2A 4M38A 3O9MA 5E95A 2JLZA 1JMYA 2HJVA 3M1AA 2HQRA 4M21A 3W5UA 1GTJ1 2D5LA 3NQ41 2ZK7A 5EE9A 4TTIA 3IJRA 4DSOA 5DI9A 3D7NA 3K6KA 3IQZA 2XTJA 2JRCA 3K20A 5J2TB 3NDBB 1CTQA 1ZCBA 3L06A 5DPMA 2QTHA 1GHTA 1VKRA 4DBZA 1GR1A 4D4GA 1MABB 4MV7A 3TI9A 4MKHA 3ROZA 1M34A 3ESXA 1HV8A 3MT8A 5JNRA 3N6RA 4E11A 3VKHA 2OORA 5DN6D 1VLMA 1C81A 2F17A 2MU1A 1Z2CA 2RBGA 3ZHQA 3E9YA 1ZY2A 3SX2A 4B5LA 4I50A 2D62A 3F1LA 2C83A 1F8FA 1YJQA 3PNKA 3AJDA 1G21A 2WMYA 5KKAA 1HNWB 4MUBA 1PZFA 1Y1SA 1QAOA 2ZXEA 4HMOA 4Z1MA 4HAOA 4MCJA 1O7JA 4BLRA 3ZVKA 2JEYA 1GUDA 3OLXA 4WFJA 2RK3A 3K2BA 3MWEB 3PPYA 2ACKA 2HRZA 2X0EA 3AM1A 2AFHA 3GEEA 4Y0AA 1UBRS 1XWWA 4MUIA 4WI1A 5DM4A 2QX4A 2IF0A 3GROA 3Q5GA 2J30A 2NSHA 3O9VA 2VHTA 4MKXA 2ZJ5A 4WH0A 5H82A 3TVYA 4YUXA 1TD1A 3QPWA 1FMLA 1RM4A 5C31A 3SEQA 5B1HA 4WJLA 3DFIA 3K0BA 1IJKA 2FSUA 3U3RA 4EPTA 1R8SA 3DDCA 5K8IA 1JV2B 1G4UR 4MVXA 2BJWA 5KYTA 4GMKA 3MMXA 1V1MA 5F7ZA 3E9RA 4B79A 1XN4A 4ZXFA 4EI7A 4MEBA 3DZ8A 4DQLA 1TKCA 4PYMA 3G9UA 3CCCA 2QZPA 4L27A