5BSKA

Human hgprt in complex with (s)-hpepg, an acyclic nucleoside phosphonate
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
214
structure length
192
Chain Sequence
SPGVVISDDGYDLDLFAIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVAVISETGKAKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Synthesis and Evaluation of Novel Acyclic Nucleoside Phosphonates as Inhibitors of Plasmodium falciparum and Human 6-Oxopurine Phosphoribosyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 60
structure length 192
sequence length 214
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5bskA00
1IBSA 1Y0BA 2PS1A 3QW4B 4MB6A 5K51A 1JLSA 5JSQA 1I13A 1G9SA 4RANA 1TC1A 5KAMA 5KAPA 5ESWA 5BSKA 1O57A 4JLSA 3LPNA 1OPRA 1ECBA 1DKUA 5HKLA 4M0PA 1G2PA 1BD4A 4S2UA 5IPFA 1D6NA 1DKRA 4PFQA 1HGXA 1UFRA 4QYIA 4RHTA 1L1QA 3ACDA 2E55A 3ACBA 4KN6A 1WD5A 1UPFA 1V9SA 1P19A 2JKZA 4QRIA 5E38A 2PRZA 3S5JA 4X45A 4OHCA 1STOA 3KB8A 3HVUA 3DMPA 4RQBA 2GEBA 4LZAA 1NULA 4JITA 1XTUA 1DQPA 1P18A 1O5OA 1QB8A 5BQOA 5BRNA 1G9TA 1QK3A 3H83A 1XZ8A 1DBRA 2JBHA 2XBUA 1ECGA 1XTVA 1I0LA 4LYGA 4TWBA 3GGJA 4LYYA 4RABA 4RHYA 2FXVA 3OZGA 4P3KA 1I5EA 5IAOA 1A96A 4M0UA 3GEPA 4QYIB 1ECCA 4RAQA 1XZNA 1G2QA 1OROA 1NONA 1P4AA 1U9YA 2P1ZA 3GGCA 2DY0A 5JV5A 1ZN8A 4P82A 4WN3A 2VFAA 4P83A 1VDMA 3N2LA 5ESXA 1TC2A 5EUCA 2JI4A 3LRTA 5BQPA 1UPUA 1A97A 2AEEA 4LZOA 1CJBA 1JLRA 3DAHA 1BZYA 4RQAA 2EHJA 1A95A 4PAWA 1QK5A 4P81A 1DQNA 3EFHA 1P17A 4FYMA 2JKYA 4F8EA 1L1RA 1VSTA 1ZN9A 4RACA 1W30A 2H08A 4WMLA 1AO0A 1QCCA 4Z1OA 2H06A 1BD3A 1FSGA 3NAGA 1I14A 1A98A 2YZKA 1HMPA 4LZNA 4P80A 5HIAA 1GPH1 2HCRA 4RHXA 1OREA 4RADA 1A3CA 2H07A 4P86A 1Z7GA 2IGBA 4RAOA 4RHUA 1MZVA 4P84A 3ACCA 3G6WA 3O7MA 1ZN7A 3MJDA 1U9ZA 1QB7A 1GRVA 1J7JA 3OHPA 4X44A 1A4XA 3M3HA 1LH0A 1R3UA 2WNSA 1VCHA 3DEZA 4RV4A 1QCDA 1QK4A 4ZFNA 2C4KA 1XTTA 4IJQA 1ECJA 4M0KA 2PRYA 1YFZA 3MBIA 1PZMA 3OZFA 1I0IA 1ECFA
chains in the Genus database with same CATH superfamily
2HPVA 4EG4A 4RV5A 4CQLB 1AURA 4HNGA 3AZPA 3RK0A 4PBTA 1C8VB 4TTJA 4LBZA 4CM6A 4EFNA 5CLJA 1BFDA 4IWXA 4OG2A 3HCRA 3KOXA 2GCGA 1X80A 1RADA 3PNOA 4UPDA 5GZ3A 1MX3A 2AR7A 1BYUA 5IMBA 2WM8A 4PFKA 4ZVVA 2IIVA 3K9QO 3RVBA 2KW5A 2VAVA 3SICE 4CG2A 1P80A 5A6SA 3N6VA 3P0HA 2GBLA 4RTQA 3KPJA 4IDEA 3EK2A 3OY7A 3T7TA 4E5VA 5BQXA 1BVRA 1PTJA 3LM8A 1AQJA 3WIVA 4AKGA 4BCDA 3B1WA 5CB8A 3ZDCA 4TQAA 3WMRA 1JG4A 1E3TA 4X93A 4AMGA 3O3CA 3T9EA 5INTA 5EKUA 2PH1A 5AVVA 2WMNB 4ZRNA 3RU3A 1GWNA 2B69A 2W48A 5EVCA 4A2WA 3WGUA 3IV6A 2XDWA 1C7ZA 2BF7A 3IAS6 3S55A 1E2QA 3UA3A 5LQRA 2C57A 2GBIA 1F2TA 1S9DA 2WWHA 3HYLA 5AM5A 3V7WA 1D9ZA 2IH2A 1TA0A 2SKDA 2Q1XA 4UHKA 1BROA 4LYGA 2FZWA 1RWPA 3VDMA 1KYQA 1CUXA 1PJZA 1PT5A 3AOEA 3PNYA 4KMRA 3VHRA 4PX5A 3M81A 3T1OA 2REXB 1CY0A 5LXTB 1E62A 2YASA 3LECA 1QDLB 2XTZA 1H8EA 4RLSA 5F4ZA 3SEQA 2B98A 3IQXA 3ITEA 1R1DA 2VF5X 3SQDA 3FAKA 3DEKA 2GSWA 3ONEA 5KTOA 1RPTA 1Y63A 3HXTA 2GZMA 1NMXA 4OK3A 3KLNA 3CCFA 2VWHA 4GD3Q 4GZ5A 1YQQA 1KI9A 2WWRA 4R5HA 1RWQA 3K09C 3K2QA 3T5PA 4GIBA 2VJDA 3VQTA 5DJ5A 3VU3A 2GYYA 4LVOA 2K6GA 4IZHA 2A0UA 5TQJA 5KCMA 4I81A 4G1FA 2HDWA 3CUVA 3MW8A 3RB8A 1PJQA 4R7TA 1A7JA 3ZYCA 4DQ0A 4FC7A 5D86A 3UWOA 1UFQA 2LUOA 4TV8B 4X66B 1HSOA 1YUBA 3QFTA 1E2BA 5A0TA 4DMKA 1LY1A 2FQ1A 2RJNA 3E7FA 2PQMA 1FRVA 2J9FB 4UHCA 1N5DA 2ZYRA 1XMVA 3RFCA 4D41A 3LO8A 2HJSA 3NKFA 1YT5A 4IO1A 3B2QA 2G07A 2OBFA 3WIOA 2V3CC 3DFFA 2G80A 2R7KA 3AEKA 3G6KA 4IHQA 4L9WA 1R16A 2IX3A 2WVJA 3D3QA 5F33A 3K5WA 4LGCA 1T4CB 5ALHA 5LDHA 4CF4A 2ZR8A 4RKEA 1ZEMA 2Q1SA 3TL2A 1QFSA 2HYIC 5ARCA 1LH0A 2D2FA 4O08A 2UXCB 1P0CA 4CTNA 4EI9A 4DDMA 3M33A 1AMUA 5EFZA 2AMYA 3OPYB 2O2XA 5IABA 1QCDA 2ZI3A 3F4BA 1W4AA 2BEWA 3BGSA 1UDXA 3LT1A 1KR5A 2Z8ZA 3GVPA 4HC4A 3OJCA 3OLCX 1T3LA 2FRDA 4KV9A 3JYHA 4XASA 4TVSA 4CE6A 3I5UA 4J76A 1QJCA 1NF2A 5COAA 1RC8A 2HWYA 4QQRA 2PT7A 1AK2A 1FDVA 5ER6A 4J0KA 4ABYA 4YACA 1YRQA 1L5NA 5KIAA 1HURA 4Y9SA 1N2GA 1H6BA 1NFQA 2OHGA 2AKEA 1BJKA 3IQWA 2XCQA 5IH7A 4LSWA 3WLTA 2JFGA 4YUXA 1K7FB 2VUTA 3FYHA 4O8CA 2XOKD 3TEMA 1TC1A 2WKWA 2FFQA 3G85A 3NWPA 3QU4A 3T5MA 4JI8B 2K5UA 5AW7A 3FTFA 2Y1LA 4CMIA 2G70A 1DWPA 1RRVA 2IUEA 1M2NA 4I2NA 2VXYA 5FOSA 3A3OA 1JKFA 2O2DA 3EQ7A 1RKQA 1J21A 2UZ1B 4S2UA 2NU9A 4A8TA 4WVFA 3RI3A 3IIEA 3SLGA 3UB4A 5FTMA 4F86A 1RAGA 1TLLA 2O2JA 3DQZA 4KACA 3U49A 1DOZA 5SZKB 4UHBA 3MCWA 3TQCA 1YL5A 3HCPA 5ILOA 1K63A 3X1YA 3F96A 3O73A 2FG6C 4LZWA 2ZGVA 4Y9TA 3TBHA 3HDGA 2IYWA 2D4HA 1J1IA 3EWAA 3MAJA 4NENB 4TQUS 5T67A 3SSOA 4CUZA 4B76A 3RYCB 4FGWA 2BGRA 2BFAA 2WPDA 1R0RE 1IJBA 1C41A 2ZI4A 3V8MA 2XNDA 4KQWA 4BKUA 1QQBA 3IUEA 3E5MA 4Q19A 2G67A 4XSGA 4FE3A 4FHDA 4DS3A 3PQ8A 5L3SA 2O7SA 3CE9A 2EFEB 4QRHA 4YO7A 5I4KA 1RPAA 1UBSB 2P1RA 1P9LA 3KJFA 4D74A 4L5JA 2FQQA 2NVOA 2QTVB 3RNLA 4AYXA 5ITZB 3KJNA 1PVVA 3K2IA 4JN6B 3EEQA 1UKAA 1K66A 1TIBA 2J48A 2KM1A 1E9AA 1NL3A 5P21A 1CRQA 4L1KA 5JI2E 4C14A 4GM1A 3S2UA 1G6KA 1MNAA 4Z0HO 3D8BA 5JAIA 3B5IA 4DWWA 4MI6A 2H31A 3BGDA 3QEBZ 4UCFA 3WGYA 4FIDA 1F60A 2ZW9A 2XGMA 3QXCA 3TPFA 3WMFA 1SC4A 5MN4A 1WDMA 1RFLA 2I33A 4D9NA 3NLLA 2ZB8A 3OO1A 3GBPA 2HSDA 5C7LO 3KEGA 1OX6A 1QKJA 3GW8A 3UWMA 4U7TB 1UAYA 5PNTA 1BS9A 4EUHA 4G67A 3V8RA 3ZUPA 2HT1A 1JIIA 1G1MA 3CJQA 4G0NA 4BZXA 5KX5A 4O5OA 2FZCA 4R9RA 1OLUB 3LNCA 3C24A 3DGFC 4BE4A 5KOYA 2NO0A 3DGEC 4ISCA 4A5SA 2ZIZA 4B2IA 3P9ZA 1L6RA 4FFOA 3GDWA 4JLPA 2BDEA 5CDYA 3WZMA 4M9SA 2M6KA 2B8EA 4URXR 3B52X 1JGTA 4ZVPA 1MQAA 5EEHA 4EA9A 1SK9A 1P3JA 3N0WA 3G3EA 2O8EB 3QNMA 3D4NA 4RULA 3BMCB 4MA0A 3EXAA 3EGWA 3NBUA 3TRIA 3B9PA 3MN1A 3FTCA 4F56A 4QDKA 3V4FA 3CLVA 3PXDA 1ISSA 2O1XA 1N57A 4FN4A 1T5HX 1DADA 2ZANA 1KQ3A 2QMUA 1X8LA 4AYTA 2A1TS 4LMAA 4R1TA 3BJMA 3IVXA 3RT9A 1CF2O 1ZC3A 3D7KA 3VOAA 4ZHQB 1PD0A 4JT4A 1UKCA 3DWGA 421PA 3AUKA 5AICA 5ICSA 1SVMA 1Z2AA 2ZRQA 4QGHA 3LYLA 1OX4A 1PZNA 2JKVA 3DVAA 4M53A 4X5OA 4CG1A 1Z36A 2JFWA 4YJGB 3FMPB 3IJEB 5LYJA 1WETA 3D43A 4HDQB 1C8KA 4BN4A 4PIVA 4JGIA 1MABA 4CM9A 3WIBA 3M4YA 5ITZA 5J4VA 3UTDA 2WTBA 1NY6A 2P8SA 1B8NA 2FMFA 4H6PA 4I4NA 1LEHA 1DJNA 4FWIB 4MQFA 5G02A 3RWOA 2ECFA 1ORDA 4DLWA 1N6NA 2HO4A 4U3JB 3C3CA 2CNLA 2CSUA 5HK8A 3VTZA 5K7SA 3UT0A 1PJ2A 4JWTA 5ETJA 1OBFO 1YR1A 2JS7A 2YXEA 4UU1A 2JFBA 2E4VA 5EWLB 4LJRA 2EYQA 3RKRA 3T38A 2CBXA 2MINA 3GAMA 3OFVA 4BNWA 2JGIA 1I6WA 1BCRB 3Q9LA 4GNKA 5E38A 5EERA 5JJIA 2EKQA 3FDZA 2PZLA 1N0VC 2D3TA 1FTNA 2GI4A 3M7IA 4TMZA 4N5LA 4L0DA 1PL8A 4XWYA 2RIRA 5HFAA 4BEJA 3EG9A 4HVCA 2BH9A 4HB2A 4HATA 5J63A 3Q7PA 1N5OX 1W0KA 4NBTA 1V7ZA 3AR7A 1P18A 1WABA 4MV8A 4RV9A 3UQYS 4CM8A 2FK8A 2WG1A 4C20A 3HEMA 1IQ0A 2DUJA 3GLRA 4DXHA 4GEGA 2XUZA 3WSWA 1CB7A 1MAHA 3FNIA 1KU0A 2HTFA 2Q5CA 2QLMA 5DLPA 4QDJA 3OWHA 4WCFA 2NTNA 1R6TA 1HR0B 4YP1A 2NUAB 1E1NA 1SGWA 1TYZA 4A3SA 4O4HF 4CIVA 1L4NA 2FWIA 4UQOA 4IF6A 4KQ2A 1Y6JA 3GZTB 1J6UA 1MENA 5E3HA 3PNLA 4I6JA 5DM60 2YWRA 1EIWA 3PG5A 3LHFA 3GT7A 4XZ3A 4EO4A 3T4UA 4MRVA 4OI1A 2BKLA 4GOJA 5KNBH 2JIBA 5KOJB 5JMPA 3NIBA 4TOIA 3TW8A 3HABA 3I2FA 3QPCA 5JO9A 4BDSA 4R05A 4YFYA 1AX9A 2VNSA 4AB1A 4FDTA 4GT1A 1PS0A 5GONF 4MS1B 1TUGA 3GNLA 3Q6NA 4GC9A 4IUYA 4UXHA 5ALKA 4A26A 3GFOA 3LVBA 4MUMA 3D3KA 2HRCA 4Y67A 4R0VA 3R9WA 3EC7A 2Z04A 3CKKA 4K5QA 4X90A 2PL9A 2ANBA 5B3LA 2EG5A 5EQTA 4KHPB 2HIAA 3U1BA 3CLHA 3IQZA 2VDWA 1LJLA 4IFIA 4HGRA 2HQ1A 4FR2A 4UASA 3EHDA 5CLHA 1L5KA 3SM3A 1U28A 1QVWA 1XV5A 2OZLA 3Q7SA 3JTEA 1VKJA 3QKUA 5TQVA 3U1TA 4OLAA 3NVAA 2APJA 3PF9A 4HWGA 2B6NA 4PC6A 3WYNA 3P2OA 3DHVA 3A7DA 4D82A 1TUEA 1YS4A 3N58A 3HR7A 5EKTA 4DGSA 2AI3A 5AXDA 4B5KA 4LW8A 3QSYA 5IJ0B 3KB1A 1E1MA 1E2GA 2ATCA 2BEUB 3UMFA 1R4AA 2B4KA 4TTQA 4RMHA 2GN9A 4U7DA 1Y9ZA 3CV3A 1F1JA 4A82A 3NANA 3TQIA 2M6RA 2WV7A 3F90A 3H2ZA 4TLEA 2OO5A 5EA2A 4B8ZA 4F0JA 2IEYA 1Z5VA 3LPLA 4ZJPA 3MMNA 1E2FA 1D1QA 3OIWA 1LPBB 1V48A 1ES9A 2PX8A 3QU9A 2XGJA 4RJ2A 3BCSA 3WWEA 2C0CA 1KIFA 3BMOA 1EUZA 1E7SA 2NZ2A 3BWBA 1BE0A 3H0CA 3IOEA 3LZCA 4XEUA 2PIAA 2EZ9A 1QO0D 3ADPA 1PK9A 3NJ4A 4WLFA 2RH4A 4ENWA 2ABWA 1RYMA 4LRSB 3OCYA 4OGFA 3S4YA 8ADHA 3RRJA 2YXBA 3K9NA 1Q95A 1YIAA 3AUAA 3O8DA 5BSKA 3V4PB 3MGCA 2MYPA 3JQPA 4R83A 4EBBA 5D6OA 5K03A 1G2PA 2BGIA 4I9FA 2CK3A 1TYDE 4BMPB 4M9QA 4CIXA 3TLGA 3QENA 4ARSA 3UKOA 3CF4G 3N2EA 2D0IA 1RYHA 3H19A 5LDDC 3L0BA 1NVDA 4H27A 4R7GA 3AXTA 2V0NA 4TVOA 3O8CA 2PKQO 1I1NA 1Y5MA 5G4KA 4UDXX 1E61A 1ODSA 2QJOA 4PSAA 2QPLA 4BUCA 1BCSA 4MR8B 4UULA 3EVAA 3ZYZA 2NQ8A 1LRLA 1KTVA 4GPBA 4C3OB 4ZEXA 4ZI7F 4JLVA 4IIYA 5B55A 1FFCA 3UY4A 1KR2A 1R4MA 4JX8A 2X1HA 1RTKA 5DBFA 2QW8A 4F60A 2O57A 2XH8A 3SJBA 2Y76A 4KQ9A 1KVUA 3DC7A 1UFVA 5GZ6A 1QCZA 4E07A 2QUKA 3H1FA 3EXHB 3DEIA 4BVAA 1QO9A 1VI5A 1DCTA 2CUNA 3KPUA 1U2EA 3DF9A 3HV0A 3NFYA 3OKCA 4XGIA 4BTVA 3O94A 3TB4A 5DMXA 3WGLA 1YQEA 4YJFB 1XK7A 3ME5A 4F1KA 2W6PA 3UIEA 4G8DA 1C0LA 1NI3A 2ODEA 2VNKA 4LZPA 2JAWA 3TAHA 3TDMA 5KC8A 1AN0A 1HTWA 4WK6A 4XM2A 3QYAA 4WY2A 1KO7A 3CNEA 3FVTA 4L8FA 3KTDA 1ZH0A 4HPWA 4P83A 5THXA 1GPNA 2LDXA 2AEFA 1TX4B 2H85A 2B9EA 3FOAA 3K1AB 4GKVA 3NOOA 2ADFA 3I2IA 2CXNA 1UR5A 2E18A 3EF3A 3NHZA 4FOSA 4MV9A 4RGBA 3EOZA 1R18A 2O50A 1HQDA 1C4XA 3OUTA 4X61A 4Q1DA 4CZ2A 4EKEA 2XNKA 3ETJA 4LXGA 5JFTA 3DL7A 1YS1X 1BHSA 3QU5A 4JSRA 2IY9A 4Z1MD 1TJ5A 1PSWA 5FHQA 2QRVA 1GKUB 4H7DA 4OVKA 1N0WA 4EMSA 5ABPA 4KQJA 3R7DA 2QRKA 4C0LA 3QF4B 1GZVA 1K92A 5TXGA 5FOQA 4UATA 2B8TA 1J99A 1HDZA 2REQA 4O2LA 3MT7A 1BEEA 1JIQA 2PGJA 1X3LA 4RF5A 4FSXA 4G36A 3WMEA 4C0HA 5IXYA 5A5GA 2PVPA 1DLIA 1D2AA 5FWXB 5TT1A 3O26A 1SHTX 1KFBB 1YZHA 3FDJA 5LBUA 3FM9A 4EJ0A 4HNVA 5KQGA 3IILA 4J91A 2OG2A 1FJGB 1Z08A 1IJFA 2X8JB 4GSKA 4PXAA 4B32A 2HWXA 1X1CA 4RENA 1MO6A 1B1CA 4GDMA 4DW8A 4CF7A 4AZTA 1V6CA 1F38A 1N8TA 1NQVA 2HXYA 3D7LA 4FT2A 3DC2A 5JCJD 1KK0A 1WVGA 1E3WB 3FSGD 3GRPA 1W52X 3VV3A 2GLUA 2VYND 4MW7A 3EGOA 4KYIB 3T0FA 1WXQA 2HJWA 1SAYA 2WHEA 3AINA 3OMXA 5AVUA 1GNLA 3LWZA 3QVSA 1JXMA 2A5JA 3SX0A 3ZCSA 1GNTA 2B92A 4QA9A 3Q9NA 2Q5HA 2J5XA 4DDHA 1Y1SA 1Y4AE 2OA0A 1O94C 5JUWA 1Y8AA 2CFTA 3ILXA 3Q0TA 2P62A 1J1ZA 4X6UA 4BEWA 1WXEA 2Z2IA 3DM9B 1CV2A 4RWEA 1RW4A 3U39A 3E3NA 4KVZA 4YO8A 3LC2O 4QAQA 1DKLA 1Y80A 3RRZA 3RRYA 3ZHOA 4ETNA 2RB4A 2WIGA 3SX4A 4DUYB 2ZQ5A 4EH1A 1GD1O 1YDGA 5H4HA 5A3JA 3DS8A 4W1QA 1QAQA 1RBYA 2GJ4A 3HHPA 4E4RA 3JQ9A 3UOGA 2QUBA 1ULHA 5HE9A 1SZCA 3F6SA 3W5CA 1SG6A 1DIHA 1RC0A 3EN0A 3F97A 1ZVVA 1UBMS 2RAFA 3W3AA 1GSIA 1XQYA 4WXMA 4G5QA 3LTEA 5CH5A 3T7CA 4ARAA 1A9QA 1JA9A 2PN1A 3L0CA 1UC5B 3QVMA 5GINE 1RZRD 3V3TA 1E5LA 4QU8A 4ETMA 1N2HA 1PJAA 4MV3A 4Q24A 3E6AA 6CHYA 1NBMD 1OF1A 3AEUA 2RFLA 3FF1A 5CA0F 1FSZA 1VPEA 3EMKA 4KNYA 3QKSA 3DPUA 1Z8NA 3GFBA 1JT2A 1N2CA 1UADA 4XYGA 1L5WA 2ID9A 4UZFA 2UVQA 5T4HA 3V4SA 3U4QA 2AFRA 1TB4A 1H85A 1TF5A 2W8BA 5JNLA 4AYWA 4FZRA 1K4KA 1FFDA 4RIGA 4RSGA 4EGJA 2IF2A 3DBHB 2IPAB 3LKVA 3OEEA 3LP8A 2JI6A 4G5OA 1D2HA 1OT3A 2ADOA 1T36A 3CLTC 4X71A 3K0SA 3PDIA 2IDKA 3EBPA 4U7GA 4X7RA 1YZTA 4ZCTA 2OV3A 3L8HA 4W99A 1S4QA 1T9GR 5HR5A 2IIBA 1H4QA 1CRZA 4DCMA 2WTAA 1RDFA 1WCYA 3T9AA 4YP9A 1X86B 4K6FA 1CYDA 3RF6A 4C7OA 4ZAYA 2YWBA 4NQRA 3U4DA 4MAFA 4BFSA 1GSOA 3OVMA 3GDHA 4K9QA 4R2XA 2W2KA 2H1RA 1ADYA 3NAZA 1XZFA 4IOMA 4P58A 1FC0A 2V97A 1IWBB 2A86A 4JENA 5JD3A 4XQ9A 5BPFA 2VPZA 2IPNA 1YZGA 1XJ5A 2I7DA 2JNWA 1WEKA 2L19A 2QD2A 1P7VA 3GD7A 4REMA 1S2LA 2GO7A 1T1SA 1ULAA 1D09A 1NJGA 3CLSC 3IAM6 3VR6H 4HWKA 1BU5A 3M5DA 4JI0B 2OCBA 1KP3A 5JJKA 5HILA 1AXRA 1VECA 4NBKA 2OD7A 4EMTA 1PI3A 1D03A 1A2KC 1Q1BA 1FRFS 2Z3WA 3KYDB 4OBXA 3IA2A 2QMEA 3PUYA 4F3RA 5L51A 2HWKA 3QVXA 4GPEA 2HF2A 1UEXC 2TECE 2WC1A 3VAAA 4W8OA 3OZBA 3QJYA 2RK4A 4GS5A 4YRZA 2WU8A 1KWGA 4C4OA 1GFIA 3H99A 4R8VA 2ANCA 2E49A 2R7NA 5JU6A 5B57C 1RYBA 1E3MA 1EMDA 3CZAA 3S6JA 4QD3A 1CUCA 1LF5A 1ESZA 2D1FA 2R00C 3KVNA 4HGOA 3W7BA 3BB4A 4H2DA 1R5NA 1YK0A 1VPWA 4B3RB 5ECDA 1P0IA 1Z0UA 5EUQB 1K4YA 3NUZA 1ZUNA 2WUGA 2KLBA 4EX6A 2JVKA 2AA3A 4Q03A 4EY8A 1PFQA 1YC5A 3GFVA 3WOVA 2P35A 2KJQA 3PQ7A 1BXZA 4URYR 3PXXA 2EJWA 2B61A 2NT3A 3ER6A 3MSCA 4XLTA 4W1SA 3AKZA 4N3BA 2BFBA 4BKQA 5IHXA 2JRCA 1BSVA 1J90A 1G7TA 1NW8A 3H2YA 1U4NA 3I4LA 3NOVA 1BKSB 4WE3A 4B6JA 1C9KA 3CCBA 4PRYA 3ORQA 4AWBA 1H5NA 3PHJA 5FADA 1Z4MA 2WSBA 2XT9A 4BO4A 1Y6RA 2LXNA 2Q4OA 4WKPA 2H48A 3SPXA 2BGJA 1KPIA 2BVNA 2SKEA 2ZP1A 3P97A 4RQTA 1KQPA 2ERCA 2OL4A 2YXDA 2VP4A 2WOOA 3KAJA 1S2DA 3D2BA 2WFLB 3UZUA 5KTTA 4CT4B 2R4UA 4Y6SA 3VI3B 4CNBA 3TNLA 1MGPA 2WABA 1T0BA 4PLVA 5ILQA 4OSEA 3TXAA 1SQ0A 3ZCXA 2JLXA 4Y0AA 1N2OA 1WJGA 1J2RA 1O4WA 4HMQA 3HA5A 4G1EB 1SR8A 4OAQA 4P2GA 4ZVMA 5GMOA 1DG9A 1FW8A 3B3FA 3EXEB 4IGAA 4KOAA 5AKZA 3GLIA 1THZA 2NO5A 2JK1A 4L5IA 4U9UA 1G6Q1 1L7NA 4E15A 2ZB7A 2IDMA 1FBNA 4NCBA 1Q14A 2H3EA 1MXHA 3AEZA 5FAKA 4LHSA 1J9EA 4DA0A 2CYAA 2VT3A 1FP7A 1YA8A 1YS9A 5HDQA 3ZWPA 4CGYA 3HVRA 3UJ8A 5JYBA 3JAMA 5ALRA 1GKKA 4B3XA 2GEFA 4NICA 2YZ2A 3CKYA 1BDIA 3JD4A 3PQ2A 3TM4A 2FR8C 5I9IA 2BFCA 1C30A 3P71T 2XF2A 4KN8A 2B0JA 2XTJA 4X7MA 2XQKA 1SBHA 1Z6TA 3G89A 3ZDYB 1RLMA 5K20A 3R3ZA 3H9BA 4E0BA 2EKDA 1G5FA 1CZKA 3VO8A 4DCCA 3ZI4A 4Z51A 3QELA 1XVLA 2A5GA 4G6ZA 2QN8A 2DECA 2E4XA 1WY7A 4MNTA 3DF7A 4PYMA 4FJ1A 3L0YA 3TLKA 1VG1A 1ZMTA 3OKPA 2BUBA 1YRHA 4Q4JB 3SHTA 3W4IA 1S2MA 3KEOA 4KPUB 4BNXA 9LDBA 2IS4A 1V1JA 4AF7A 1COZA 4FZ5A 2CDBA 1JEEA 3LT4A 3FOEC 2UUOA 3GLSA 3X2EA 1ORHA 4AX4A 4QNMA 4RXMA 2F67A 1NBHA 4BVFA 5JQGA 1LV8A 2P5UA 1I80A 2AFHB 1UK9A 4MV7A 4TL9A 4PF1A 1GQSA 4QFMA 1HOTA 1GGHA 2C2BA 1EG7A 4ICIA 1NQUA 2R7LA 2ZI6A 4FOPA 4OHOA 4Q37A 1FTYA 4YRTA 1KC1A 4BMSA 3HSYA 5MF6A 3KQYA 1JBEA 3EEFA 2O5RA 1ZNYA 1P1FA 5CLFA 3GJ0A 2GPYA 4BO5A 5B7QA 5AJTA 4AZVA 5F9HA 5I8WA 1RPNA 4TMTA 2FU5C 4UD6A 5E6RA 1NF8A 3H0EA 1U7XA 2I80A 2G9VA 4JLOA 4D9FA 3F9RA 4X54A 4PZYA 1PWHA 4H1VA 2DQZA 4JOQA 1QIEA 4IIHA 5ARBA 1K0UA 3R6LA 4IH1A 2O8FB 4O4HA 3TFOA 3WGZA 3E22A 3MUNA 2Z0MA 1C1DB 1RJDA 2NUBA 1D2CA 4MZXA 4HAXA 2C5AA 4RQUA 2P3SA 2QPTA 4E1BA 3OMLA 4Y98A 2NMVA 3PUVA 1JE1A 2I9KA 3AHHA 1XNJA 4WJKB 1GO2A 4WXEA 5LZ2A 5D3MA 2C5SA 3U3MA 1WY5A 3JYQA 4XD7D 3RVNA 1ECFA 1T2DA 2PZFA 4TUYA 2IDZA 4KXYA 4LYEA 1KMMA 3UJ7A 2JLUA 1Z47A 3CBQA 3VSAA 2B25A 2PGNA 3FLEA 3OIGA 4UEOA 2COEA 2ODBA 4K8RB 1ZK1A 4UM9B 2D6FA 4DV6B 1DMRA 1EGMB 1TDJA 3A1FA 2FWAA 2YUTA 3PC7A 1EUDA 1KI3A 5DLEA 4HDCA 5G0WA 4MKFA 5A4KA 1EXDA 1FDTA 5G53C 4OMFG 3H13A 2VKQA 1YI8A 3SFVA 4A2PA 1MC4A 1RZ3A 3M9LA 1UC4B 2MR6A 5EJ2A 4ZXPA 2V3WA 2WYVA 4DQKA 4A6DA 4E51A 2WG0A 4P8RA 2ZBFA 4OFXA 2FXIA 3VOBA 3KFVA 3MGAA 4C0XA 4Z8YA 3JAKB 3M83A 4BNHA 3QFFA 1WP4A 2Y1CA 4WUTA 4IVNA 2FE4A 1T9AA 3C7KA 1U63A 1LPSA 3TJMA 3N2YA 4NATA 1S8OA 3RTBA 1GZ3A 1QIHA 1NRIA 1ORWA 3NHAA 3Q6IA 4EJSB 1YVEI 2I54A 3C3AA 5K8LA 3AR5A 1D2EA 1PR4A 1C3OB 1Z2OX 3RQIA 3RYFA 1X7ZB 2H9IA 1XCJA 1JJ7A 4YVFA 1TQ8A 1U2GC 3PD7A 4RHYA 3FLAA 1QYDA 4AICA 2HJRA 2J5KA 3MUFA 2H8KA 2ZJYA 4L51A 4FX5A 3AXSA 3G59A 2Z2ZA 5JWOA 3OBBA 4BHTA 1YQGA 1WPGA 2VWPA 4I1SA 1MLDA 1YRAA 2G9UA 2JH8A 2YVLA 3EDCA 4RVGA 3Q1KA 1BDBA 2DFPA 4H7EA 4HXGA 3LP5A 1HYGA 1TL7C 2A9RA 1T9CA 2FPPB 1DUSA 1RMTA 3L82B 3TNYA 4FLFA 5JV5A 3BRSA 2CNWA 3I4FA 2QL9A 2BEKA 4NE2A 1A71A 4RZSA 4YAIA 3QFHA 2OHOA 2MYNA 2RC5A 1GL3A 1U3CA 4JZYA 4L4XA 4WY5A 4C4ZA 4ZEOA 5FTLA 3IL2A 3KBOA 1I2AA 1CHNA 1XN4A 3H04A 2FHSA 3ANYB 4GRAA 3OZDA 1ZVQA 3LDUA 2OCXA 3C5CA 4INPA 2GZAA 4JH0A 4KSYA 2CHQA 3F71A 5IAKA 3T5AA 3AF6A 2HR1A 4E03A 2OAGA 3HJAA 2XYPA 1XHLA 1PR1A 5AJUA 1UBEA 4ZI7A 1WZIA 2ZB2A 4DV2B 2PEZA 4YJ2F 1P7CA 3I9V6 2ZJAA 4TLCA 1PBNA 1M0SA 3W9YA 2I8CA 3OCZA 2W22A 3QEAZ 2R751 4EO7A 5LYYA 3STXA 4EY6A 5CGZA 3AWDA 4RMIA 2W6NA 1ZK3A 2I0FA 4OBBA 1VKZA 4XDZA 1GQRA 4AG5A 4HJRA 3E53A 1EB8A 1U8XX 1VA4A 5AHKA 1PTJC 1GRVA 5LZ5A 1G4HA 2I2DA 2WU3A 3BX1A 2JFUA 1JMKC 3H3JA 1YJBA 4ZP1A 3ZV7A 5BV0A 4RTOA 2QM8A 3GLGA 1J8DA 4JI5B 2NU7B 1SK8A 2ZKLA 1Y8QA 1GPAA 2BISA 3C7DB 4QOIA 5LKRA 3QVWA 1GGMA 5FL7A 4D0GA 5ALIA 5K3BA 1W25A 4V39A 2EWMA 1W73A 2D74A 3MWYW 1OXMA 4DBLE 5HZGA 3TGPA 1W85A 3PEUA 3JYOA 2OR3A 2QENA 4NJMA 4UTZA 3RS9A 4DLKA 5EJ4A 1NE2A 4OQXA 4OGGA 4RDHA 4XIIA 4A91A 4M9ZA 3BGVA 5F9FA 3SIRA 3VRHA 5AD1A 1EWYA 2W37A 5EE9A 2TMYA 3ZCRA 3WNDA 4OA5A 1T6BY 3REQB 5HPYB 3OQ1A 4W5NA 2ZT6A 1C4KA 1MX1A 1MFPA 3CPEA 2X2EA 13PKA 2Q1WA 3DMNA 3LBHA 3CZ5A 3NHUA 3H0KA 4DBZA 2Q2NA 2JA1A 3V4OA 7AT1A 4EJ2A 1W36C 1M8PA 5AKXA 4ZYLA 2IEGA 5BSTA 3RJ9A 4C4RA 4DQXA 5CCBA 4PQYA 1HLPA 3C3XA 3GP5A 3MCUA 4G8CA 5GGXA 1LBSA 4PAMA 4KC0A 5HS6A 3C6KA 4W5RA 5CB4F 1D2NA 2W6CX 4P9NA 1HYQA 1NFRA 3A3YA 2C9MA 4XAQA 5IAGA 4MSUA 3WDKA 4Y6OA 4E3WA 2VAMA 4V3BA 4AG3A 4DOMA 2IVFA 3KC2A 4MVJI 4OEHA 4TZTA 4HEQA 2H59A 5CAEB 1K89A 4XRRA 1GCGA 1K98A 3HGTA 2ZAIA 4N1AA 3NYWA 2YJZA 4D4IA 3LQ2A 2A8YA 4HWPA 4OB8A 4OQZA 1QH0A 2QP9X 1AK1A 3C7AA 5BRJA 4KRXA 2GZSA 1CD5A 2XYRA 3WLPA 5KYGA 1K2WA 1EUCB 1KOGA 4H7HA 3GBVA 5AVWA 3DHNA 2QM7A 3LG2A 2GRAA 4LJSA 5EJ8A 2ZTHA 4J4HA 4A0SA 4HMOA 1GFZA 4EI2A 4POAA 4IEIA 3M70A 3R9XA 1TYBE 2IXAA 1XU9A 4YIKA 4ZTZB 3CNOA 1U1DA 4QTXA 1U9YA 3GYGA 3PNMA 3K70C 3EMDA 3WHLA 2FSIA 2W6OA 4A6PA 1GA1A 1I32A 1V43A 1PS8A 1DC4A 1ABEA 1NUTA 2R8PA 4LRUA 3U40A 3ZHQA 1QHHA 1XL0A 4I19A 3PC6A 4QSMA 721PA 1JLKA 2I91A 1JHXA 2AYYA 3I92A 3KAKA 3O21A 4L6AA 4B75A 3K6SB 1JYFA 1EYZA 1YRLA 1Z3IX 3I6YA 1KNQA 2ORIA 3L0PA 3A6PC 5I6DA 1ZWKA 2AUTA 2DTXA 2F8MA 2LV8A 2ECKA 3JD1A 4NDNE 2AJBA 2OXEA 4KSBA 4EJFA 2IUTA 5AW3A 2IFTA 1G59A 1IAVA 1DE0A 4RACA 3N39C 5TPZD 1NR1A 1ZVMA 3KQVA 3VZRA 4NOMA 4HWOA 5CA0A 1M5UA 2RCNA 4KTVE 1BA2A 4PO8A 5CA1B 4L16A 1G8YA 3B20A 4BQSA 4LYJA 3ZWAA 3OOHA 3TMYA 4FVTA 3MPOA 4MR7B 4YA6A 1NF9A 3G8AA 4EAAA 5EZYF 2O8DA 3K0AB 3GMDA 1SVWA 1FS5A 2YN0A 3SAJA 4CF6A 5AOAA 1SBNE 3FWPA 5LR6A 5ELMA 3F46A 1OH7A 1TXGA 3IPXA 4KBFA 5TF4A 4YCLA 4E2YA 2I4LA 1GVNB 3DW1X 5ALEA 4WXPA 3T7EA 1GUFA 1VSBA 3ZZUA 1EP9A 1ZEJA 5A05A 4JBYA 1JX6A 2BYTA 3M3HA 2MOKA 1H2YA 4KRYA 3PS9A 1NYRA 1RACA 2OO3A 3A4VA 3JQCA 1T15A 3LDFA 2AOXA 1JWBB 3Q8XB 4Y2QA 4F4CA 1QOQB 1TQHA 3DZ8A 1TVMA 1ZGZA 1U0SY 2X6TA 3BRCA 1L4EA 1OXSC 1FPMA 2EW8A 3NNSA 4MMXB 4GLLA 4DLLA 5EJ5A 1T2FA 2NXWA 2P0YA 3I28A 2HMWA 2PS0A 4XE5A 1EGQA 1KVTA 2PDAA 2YOGA 5A5DA 3CUKA 4B2YA 2RGGA 3IEUA 4DB4A 5FBZA 2PKQP 4JI2B 1EFRD 2R6GA 1A8SA 1JR3A 3ROGA 1NUUA 1D4FA 5E7MA 2Z1MA 3TTSA 4NCNA 3KM0A 3PL1A 5JZMA 4TYPA 1QC5B 4BV8A 3PQ6A 5KYNA 1LX6A 4K0KB 1AKMA 1YJQA 1SG9A 1IN4A 5A62A 1NOJA 1HTBA 3RRMA 4DIDA 2R60A 2Q4EA 4L78A 1N2IA 3LLVA 4AMVA 5KYXA 4CR7A 5FPYA 1Y6GA 4FB5A 4JT2A 3ZVRA 3ZV5A 5AVKA 4B9EA 5FNVB 4FW9A 4IJKA 3SKVA 4MIYA 2OCAA 2BZ1A 1PT8A 2F7SA 3GUZA 3PHIA 3FZYA 4WKOA 1MUUA 2QTRA 2WSSA 1SUDA 3GO4A 4PCVA 4Y2RA 1IYZA 4L02A 4CLOB 4DEXA 4EHAA 4ER0A 1CP2A 3WJ7A 3BK7A 3QVKA 1E2PA 4B6QA 4DILA 2RHBA 2F55A 2G4VA 4RHEA 1H2BA 3HQ4O 4HEA1 3SHVA 2YYZA 1QRDA 2R6CA 4A8JC 1YDEA 3DOHA 3TN7A 4ZOQI 3B82A 4GYKA 1Q57A 3TH5A 1X9GA 3E1KA 2WUDA 1ENZA 1K68A 4N8EA 3B3QA 5L95A 2XTNA 1Y82A 3OLXA 1QIIA 2WSIA 4Z9AA 4HH0A 1VFPA 1XIVA 4P3NA 4AWXA 4E46A 1NG1A 5FR2A 2WINI 2HXGA 5TVKA 3FF4A 4FHCA 1WDLA 1TGVA 2OV4A 2PCLA 2WU0A 3L0SA 3MIZA 2XZOA 5IK2D 2OHJA 1LUAA 5AUQA 5CT4A 5FI5A 1NATA 3VR4D 3PGA1 3O2QB 3LDGA 1SC6A 5G2OA 2LKCA 1UPUA 4F3CA 1VJ1A 3UC9A 2HF9A 2ZWAA 2G6BA 3A1TA 3FROA 4UNPA 4OFZA 4N7JA 1KXZA 3PX2A 5ED4A 2CLLB 4JUAA 5DBIA 5DLDA 5FUXA 2M6LA 4W7SA 2P9ZA 4X3OA 1W0CA 1TUBA 1LLQA 2D62A 2H63A 2MSKA 3ORFA 3UF0A 2DHQA 1ZGHA 3UCXA 2VF4X 3ZE8A 3HK2A 1R74A 3B9BA 3W8FA 4F84A 5JDIA 3CLKA 2WYIA 3QUCA 3X2SA 2C07A 5LXTF 1DO0A 2X0EA 3LGSA 4R2KA 3ETEA 4RL4A 3NETA 4NS4A 1CR1A 3RS5A 1GXSB 4DYDA 5GV8A 2W5UA 4ARZB 2X0JA 2XYVA 3T3EA 5IBPA 1E98A 4AZ0B 2I5PO 3NX4A 3R9KA 4MP8A 3DYIA 2VATA 4TWIA 3TEFA 2CWDA 2TMKA 3C4QA 3MWJA 2JLVA 1DARA 4JJIA 1YE5A 4OJMX 3KZXA 4ZDIA 3M4ZA 4TZ6A 1NJSA 5DX0A 4IG4A 2ZSFA 4QM6A 2VZ8A 3GCZA 1NQAO 1RJ9B 3U44A 1MQSA 3H7AA 3DOUA 3NPAA 1KO4A 5IM4F 2C77A 3BJRA 4E7OA 4TV8F 2FZGA 4IM7A 1IBSA 1LK0A 4AJ9A 3L8GA 4OB6A 1SQ5A 1FUKA 3OX1A 3G5MA 5DEIA 2H7CA 2C1ZA 2ST1A 1PEKE 1JJFA 3CLRC 2P67A 2C9YA 3LPDA 3L4SO 4PLTA 2AV6A 3GGSA 1XR3A 1NBWB 3OT4A 2ZRFA 1X87A 2GKGA 1RYYA 3I83A 4WCFC 2FWBA 5EPEA 1Q21A 2QXUA 3ZBPA 3HADA 2Q3BA 5CG2A 3IEIA 1RKXA 2Z58A 3FTDA 4X64B 4XUEA 3PRKE 1W5FA 1G1AA 3E0XA 1FUIA 2JEOA 1PR5A 2F3QA 3DP7A 5KVQA 3A3NA 3RU2A 2E21A 3P1JA 2ZSBA 4V0OA 1KE1A 3VR5H 1G63A 1WMBA 1E77A 3AF2A 4FILA 1SUWA 4ILEA 3UH0A 1SU8A 5ARDA 4B44A 2DMRA 2VXOA 4JDPA 1OY1A 2GWRA 4CLEA 4ZZIA 4ZU1X 1YTLA 2UVDA 2Q7XA 4G4IA 1FZTA 1PUJA 1R9JA 3WLHA 4TQ9A 1VRCA 4A4DA 4DNQA 4EHIA 5KOIA 1FK8A 1RYEA 1CY4A 4N5IX 4FYIA 1L8AA 2VDRB 3H83A 4FZ3A 4PZZA 4AIIA 2EJCA 3OBIA 2J3LA 2ACKA 2O8NA 3PR2B 5FPPA 4DCSA 5DGHA 1HYEA 1MB2A 4P7GA 1BE8A 1QV6A 1U28C 4UBJA 1O95D 4YUYA 1Z73A 1PR2A 2FPMA 4N76A 2GJ8A 1YK1A 3DZBA 4D9HA 4JA0A 1R0KA 1ISHA 4UEKA 4OKSA 1QYRA 3NU1A 2O0MA 5LP6C 2YS7A 5I3ZA 1WKBA 1N1DA 2PLFA 4LHEA 2PZMA 2ODAA 2ZJ0A 1BVUA 3OJXA 1MQ8B 1PV2A 2J3QA 4WLOA 5EPOA 2RHCA 3WVNA 5FBWB 4G1MB 2HA3A 5B3JA 3ED1A 1SUCA 2MTBA 4KE8A 2ATIA 2REOA 4D44A 4BLPA 5CD9A 2BELA 4N7MA 2Y8EA 1RI2A 2K4MA 1JJAA 3ND8A 4EFMA 4HDOB 2D13A 3ICEA 4ZKEA 4GG1A 4N01A 2ZRLA 1T0JB 4GXRA 4Q02A 4Z4HA 1RU3A 3HCNA 4DDUA 2JBAB 3WNVA 4FDUA 5H59A 4YUAA 3RNOA 3FRJA 4URFA 4EB6A 3HXPA 3U7HB 2JAUA 2D59A 3L1VA 1N33B 1ULTA 5GVSA 4YCCA 3DZFA 3AFOA 1I2DA 3GJTA 1YBHA 1TCCA 1NT2A 2GFIA 3S7TA 4D99A 4CTOA 1U0OC 2GCEA 2V98A 4FINA 4JGGA 4QBHA 5JOQA 1GZ4A 2OAQ1 1XEXB 2QLLA 4OL0A 2X42A 1PT7A 4PX3A 5LU8A 3VR6D 1VJDA 2F48A 3VNSA 5EIXA 3SXUB 1LRKA 3CLUD 2EZ8A 4C7BA 4N0EA 4L50A 4LRXA 1WCIA 1ONBA 2VHJA 1EG2A 3BJEA 1U7DA 4P33A 4AKHA 3FCXA 4AXXA 5L3QB 3F7MA 2AJDA 2H4WA 2NADA 3H1AA 1TM2A 4UFPA 2WTXA 2I6GA 2CC2A 3RRNA 3EXG1 1HYBA 4HTFB 4L6IA 3DWIA 4HAIA 2QN1A 3F9CA 1M2HA 1M2OA 1OI2A 2ZIXA 4UBNA 3IIMA 4UAJA 3VU9A 2QTZA 4HFMA 2D0DA 1FFAA 1Z7WA 5DYTA 2CXSA 2EP8A 4B87A 1Y9AA 1Q1QA 2XGOA 4B2LA 5CFMA 4CFZA 4WJLA 1ZU5A 3L04A 3O4GA 3C3YA 3D3EA 1VLMA 3F6PA 4BVKA 5KHOC 3PTLA 1AO3A 1UMBA 1SEPA 3OX4A 3VH1A 4DQLA 5CDSA 3O9ZA 4LECA 4JJAA 3W2EA 5AUPB 2VPQA 3IHKA 3L49A 1KSHA 5AHWA 3EVTA 2LZ0A 3ONDA 4HQRA 4JDUA 3ZLJA 1C3EA 2Y0BA 3RANA 4A0FA 3HO6A 5LWHA 1EUQA 1KBZA 1I7LA 4QJ3A 2NT4A 4L4RA 2VAXA 2I4MA 1N2CE 3ONWA 3QUAA 3K0EA 1A8QA 3OA0A 4KWHA 3GB9A 2P2LA 4OHUA 2WJGA 3WGHA 3WGMA 1RR6A 4I9NA 4RTPA 4AJEA 2HA0A 3IMEA 3GEHA 3QX3A 3RHZA 5ESDA 4JASB 1II8A 2Q5IA 4AN0A 2W6JA 2Z8YM 4F5YA 4ZHQF 3KPYA 4KR2A 4WXHA 4AY2A 2JGFA 4LHYA 4BMOB 4NU6A 3P2KA 2CZQA 5FD8A 1L3BA 1SU7A 4X20A 4X6XA 2P8JA 5KSOA 3VXKA 1FVFA 4UD2A 3V46A 2AUNA 3GP8A 4DSZA 4KX5A 4LOLA 4BLSA 2RHRA 3WBBA 2CXUA 1P2TA 3D6TB 3NWJA 4MAAA 4M0DA 2O2EA 2L42A 2QVXX 3URMA 3A9UA 1RFGE 1HE2A 2YZNA 3DP9A 3JQRA 2P75A 4I4TA 4E1VA 2WAXA 2YZ7A 3CLTD 4HDSB 3AP2A 4LJ7A 5FOXA 3THWB 1GUAA 3ETLA 2FZEA 3ES9A 3FFTA 3IUYA 4JU8A 2ZJ8A 2I2CA 4DRXB 1VYUA 2WWTA 3DZCA 4J3FA 4B3DA 2ZPAA 4U2BA 4YP6A 5AVZA 5JNTA 5CB4A 4ZOAA 4AVYA 1XNRB 4K26A 1UOOA 4UUPA 2VZ9A 4IRXA 3RYHA 2BEVA 3R3SA 4Q6BA 2XECA 3ABOB 4LI3X 1C1YA 3LHKA 3ZS9A 4PYJA 1IBKB 3K5IA 4UZSA 1VLZA 1U8ZA 1KS2A 4K9PA 3CH7A 2HBZA 3HLYA 4MUAA 4FFWA 3K1JA 3PBKA 2JGLA 2VAPA 1X0XA 3AKDA 4JBLA 4J6EA 4LMPA 3VV2A 2AQHA 4ZYXA 2C31A 1JYEA 2L17A 1O6ZA 3EIEA 1SWWA 3TIFA 3PC8C 2VBCA 3CG0A 1YB7A 2FR0A 1EDEA 4NMLA 1T1RA 1TYCA 1GPH1 1CJKC 2HCRA 3FWKA 4YROA 1I3NA 5FBKA 2J3IA 3KKNA 1DKOA 4C7XA 3F8TA 3S1AB 3JQ9C 4P84A 3UMJA 1EQ2A 1SUBA 4S1OA 1R6BX 1UMDA 3F4LA 2WIJA 4PHHA 4AECA 3PRJA 1Y6QA 2A92A 2OMEA 4I7EA 3O8OA 4FJ0A 4B0OA 3Q2KA 1GR0A 1Y5RA 4N03A 4MRSA 5LQAA 4JIGA 1TOAA 4EKIA 4KXMA 3U9SA 2QL5A 1TE2A 2SBTA 2G1JA 1CVIA 2HDHA 5J5VA 5I3CA 2X9LA 4B4VA 3DTVD 3BULA 3RT7A 3G8DA 3HCCA 4COKA 2RH5A 3H4IA 1Z06A 2VAWA 1JEDA 4OHVA 1I2CA 1Z5PA 3R23A 4EQ6B 3AL0C 6ADHA 4ALNA 2JLZA 4K40A 1LLFA 1ZBDA 3CPHA 3K35A 4L95C 3RBZA 5A5VA 3AHEA 2HK7A 4DCPA 5E1MA 4W82A 1BNCA 2V8BA 1IZZA 1Y5IA 3RUCA 3GLIE 3H18A 3HB5X 5I9BA 2BMWA 1GTVA 4KO3S 4HZUB 2GJKA 4J75A 3TRJA 1IWPB 3OAAD 1L7RA 4M6WB 4UHHA 2GLTA 2IE8A 2RKWA 4I8IA 5EZYA 3KO8A 2DSNA 1E2DA 3B38A 1G8MA 1EFVA 1FLNA 1PR9A 4BB5A 1GPLA 4JC8A 2OG1A 3EARA 1E99A 3SOPA 2DQ4A 1EXWA 2EIHA 3EIQA 4PWZA 2RI0A 5CIYA 1R0CA 1YIOA 3LGXA 2FZ4A 2EKPA 5LYJF 1FMLA 1K8XB 2RB5A 4E5NA 1A76A 1D04A 4R51A 3IAS1 2JASA 3HVUA 4NG4A 3ZUGA 4LQCA 4WBNB 1Q1AA 1NAHA 3H7IA 4IZIA 3FMVA 4QELA 3ZXUB 5DLQC 1UPAA 3INNA 3SE7A 1OV6A 3EMVA 3ZWMA 2X77A 3MBKA 1CP3A 2SKCA 4A2QA 5E9JA 3CWZA 5CFNA 2XI4A 1A7UA 2J3HA 3MELA 4KQEA 1JDSA 2IXFA 3E58A 1Z4PX 2X0DA 3VMMA 3UAXA 4BZQA 4PXSA 1XJWA 5DHTA 4CQMD 2FHPA 5ERGB 4DMLA 1BMTA 4DY6A 1LDNA 4HRYA 1BG6A 5LDGA 2QTTA 3B78A 4V1CI 2H2DA 4LV8B 2DXIA 3TDKA 3HB9A 3V9PA 4C07A 1VHJA 1MEEA 3HKBB 4NMXB 3ORYA 2WUWE 3LC7O 3QIAA 4Q4HB 3GFQA 4MVYA 1Z0SA 3V8QA 3SM9A 5CEJA 1TLTA 2IZ1A 1DXYA 1US8A 1W35A 1CE8B 2FWJA 3TF5A 4LF9B 1ZAKA 1OH6A 2Z3ZA 2OXIA 5DNEA 2NZVG 2CJYA 2WMYA 1J5PA 2PU7A 3PKJA 1H1LB 3A58B 4LFBB 1U4SA 3GGDA 1CVLA 1E20A 1G16A 3V2HA 4K05A 2WAYA 3FLBA 2PUFA 3H4MA 4S35A 3L7CA 3LIPA 1K5HA 5FPQA 4JUFA 1RE1A 2W98A 4CKBA 2VH1A 3WJAA 3HTXA 1WQ4A 2ZUVA 1I1QB 1RPJA 1FU4A 5AKJA 4AJKA 1NPYA 5IC5A 3H6HA 5SYNA 5GY7A 2PR7A 1YO6A 4BQEA 1AGYA 4CQLA 1Z4QA 3PIIA 4AWAA 5CX1B 2H1FA 3I12A 4P86A 3TZLA 2R6R1 3W3AH 4RL6A 1LI4A 2CFIA 2R8BA 5JEEA 1QZXA 5FUYA 1GPDG 2AKYA 2SCUB 3KT3A 1RD4A 4BWVA 2WJ4A 4N18A 3U0VA 1QB7A 5ADWA 3ONNA 1FNNA 1ZD5A 3AJ9A 3DULA 3S8EA 2O0KA 1DOAA 4RMGA 2D3WA 1JFRA 5F52A 1JPUA 1BHO1 3F7TA 3GFSA 4EHJA 5GZ1A 3RK4A 3CM0A 1NJ6A 3A2NA 4IUCS 2XZTA 1EQUA 3JAWB 4FNOA 4HB3A 3JSXA 3ZH2A 3HYTA 2QGFA 1U6IA 3BIFA 3KZOA 3T7KA 1VI2A 2A1TR 2JHPA 4KV7A 1WB6A 2QM3A 1WCWA 5I5GA 4J43A 5GWXA 3X2FA 2ZZNA 3W5HA 4IICA 1A7AA 2XNJA 5DMHA 4NZNA 2QEQA 1I7NA 4F3KA 1KEVA 2VWGA 4P34A 3VVLA 1V5EA 3DE2X 1GKIA 2O4CA 4MV4A 1GM5A 2EEPA 1Y8RB 4P31A 1RHRA 4TYMA 3NYRA 5EJMA 3OJFA 3ZD8A 4OA8A 1N1GA 3DVSX 1CW2B 3QYJA 4FOLA 3SWWA 3ZCTA 4BV9A 1ZICA 1BN7A 1WAMA 4LJ9A 5BW6B 4BNZA 4Z4FA 5LXTA 1SUFA 2YN4A 5DH9A 3JQFC 2J3KA 4S1PA 3L77A 3RSLA 1G7SA 3CT4A 2GBPA 3PT9A 3SFZA 1OGIA 4DPKA 1DTEA 2X9GA 5LIPA 4WOPA 3B51X 3N2NA 3TLEA 4UW9A 4HV4A 2AFIB 1BX0A 3ITKA 4ZALA 2IXDA 5HJ7A 4DADA 4NYIQ 4C7VA 3R76A 3BHJA 3K15A 3EGDB 3PUKA 1TEVA 2PY6A 4M0MA 4U2FA 4XB6B 4EUFA 2PT5A 3CVXA 5LMNB 1WDTA 5FUVA 2GXUA 3BWCA 2XYGA 3OZIA 1BRMA 2X15A 4F46A 4M4SA 1Q92A 4M38A 2C9DA 3B36A 2XITA 1K7YA 1OZGA 3IMCA 4R8MA 4TV8A 4XLZA 3N74A 3SNKA 5AVSA 2DR2A 3E1SA 1A82A 3GUVA 3A14A 4B47A 1JRLA 4GBJA 2J9FA 4F4UA 4MVWA 3CSSA 3WRXC 1T24A 2BR4A 1RWMA 2P2ZA 2KBFA 1A2OA 3N6RA 4CLRB 1XLTA 2NV6A 5LLTA 4FX2A 5IAJA 2O8BB 1NVWQ 3FWNA 3WMWA 1QYXA 5BN4A 3H05A 4AS2A 3IEXA 5M2QA 1ZW6A 5CP8A 4FFPA 1T4CA 2VPTA 1S3IA 4LZLA 5JG7A 3TUJC 1XP5A 4C87A 4H4EA 1TM3E 4P4LA 4Q9KA 3HGMA 5C3MA 5FWDA 1P8JA 4ZZ3A 4QFDA 4E5KA 1KTIA 2I4IA 4YCAA 5AI9A 3MJCA 1KYIA 1WMAA 3DO6A 1KYXA 3GX1A 4MAMA 3OPYA 4NS1A 4O8ZA 4C78A 2VQFB 1M33A 2FPKA 2IQIA 4HGYA 2H29A 1WMFA 2G76A 2H54A 3EODA 1H1TA 3G0HA 3HBMA 2VJCA 3EXFB 2OENG 1QQ6A 1ML4A 2YJ4A 4K9DA 3BXFA 3RROA 1YA4A 3BD6A 3UTCA 3A05A 4NCIA 4X94A 2HZBA 1WVIA 1KIAA 3WFJA 3D7RA 3H86A 1EIZA 1DEAA 3JQBA 4F93B 1LNZA 3EQZA 3I37X 3RC9A 1K5GA 5LL6P 1GILA 5CW1A 4J1SA 3CPJB 3CBGA 4GVPA 1QYIA 4HRVA 5A02A 5H9WA 4MUKA 4V38A 2H57A 1XDZA 5H3CA 3U3XA 3RU7A 2I7TA 1PG2A 3IOBA 2O1EA 3K9BA 2UZ1A 1QF7A 2WNSA 2ZTLA 3WYEA 3OLQA 3UVEA 1GV0A 1POWA 3A4LA 4LYFA 1HFEL 3KEQA 3G5TA 3PD1A 4BUZA 1WA5A 2F2TA 1L5MA 2YY5A 3R6WA 4PFJA 3LBYA 4J94A 4YRCA 2F9MA 4P5PA 4QZVA 3H2IA 4OD0A 1DTSA 4RD4A 4X8HA 2XVYA 4IHKA 2OV8A 4GYWA 1FFXB 4NENA 5E4FA 4D45A 3FN4A 2H3HA 1LB1B 4FYXA 1PNQA 1D6SA 1YDFA 5K09A 3NXSA 1NVVQ 3OZXA 4P93A 1KQOA 3NATA 5KDDA 3ZV3A 1UDBA 2W70A 4PHFA 4GR5A 4UAGA 4CT5A 2RARA 3I05A 4IS2A 1JSRA 4IVQA 5C8DA 3QLJA 1WCV1 1UKEA 2VSXA 4U6NA 3L7LA 1COWA 3AI3A 2PR2A 3L6EA 2D5AA 1G3RA 2JHCA 1AIPA 2QTVA 3EDMA 3Q11A 1EU1A 3OZAA 2LIPA 3HG7A 2RBKA 3UV6A 2JJ1A 3MBOA 1K6EA 3TS1A 3SSAA 4DG8A 1A9PA 2YC4C 4UMDA 2X0NA 1QIFA 3TPCA 2GPNA 3PLAE 2ZYAA 1IEVA 4D7AA 1H4VB 2IQ5A 3FCOA 2J0VA 3RS2A 1DC8A 1AGRA 3U7IA 3HO8A 2ID8A 5EJGA 1JTVA 3DTVB 4CFYA 3PPXA 3KQUA 2NZYA 3RBVA 4RIFA 3CE6A 4O4LB 5K9ZA 1CFJA 1W2HA 3IIIA 4JNKA 3TKYA 5JD6A 1W6RA 1S8AA 1XD9A 4LJYA 1WW3A 4MKXA 5IJAA 3R5TA 4DLAA 4ACAA 4CKCA 4YV2A 1Y4UA 3CR3C 1YZUA 2KE5A 1B41A 2ZIUB 4TSFA 4DKJA 1UC9A 3WXBA 1S3GA 3GY0A 4NZ9A 2X3YA 4FNGA 2V6JA 1G6HA 2C97A 2RJ3A 3QE0A 4D1YA 1OLUA 5DV9A 3UK1A 5JZOA 3SQNA 1IRIA 2YTZA 4Z7NB 5SZJA 2VEDA 4LOIA 3E5RA 3GAZA 4Y6LA 5C31A 1F6WA 4MK4A 4EPTA 1KZ9A 4ZYTA 1DDOA 2DUUA 3HEBA 1P5HA 2ZDHA 4XR9A 2JK0A 1ZK4A 5AKHA 1N7HA 2XMGA 2FZ5A 1C2YA 4L85A 3WK7A 4P3OA 3ZD9A 4V0MA 2ERXA 1JMYA 3BQNB 1AGPA 2YNMD 2WE7A 4AN1A 4Z7QB 2V1XA 2DFKB 4N7BA 4PR0A 4E6PA 5KMGB 2HHAA 4KX3A 2ZJ6A 3BMCA 4CR8A 1IG3A 1GU1A 2B7CA 2CB9A 2IF0A 4II2A 4QVGA 1JLMA 4HT3B 3JQ7B 3L4EA 1KJNA 3UOWA 1ML3A 2DTDA 3WL4A 3OFND 1SC1A 1DBQA 2WWXA 5IKMA 2YKGA 2Q6KA 2GTIA 2NUPB 2VS1A 3LUDA 2HCFA 4ZO9A 1JUDA 4XCXA 5EC8A 4EEXA 2I78A 1XTPA 4ZHQA 4ME6A 1ND5A 3BCHA 3MGKA 2P4EA 4QU5A 1W49A 4U2EA 1EAYA 2ETXA 3S1SA 5CB6A 3TD6A 1FP1D 1ZIDA 4JQYA 2QN3A 5DTJA 2BBTA 5AW4A 1DUIA 4JB0A 1HORA 3V7UA 3NHRA 4IFEA 3NTRA 3M4XA 4KMOA 3LUHA 3OLVA 2Y0CA 1JB1A 1DJQA 4PNEA 2CCJA 3EGVA 5BXYA 5L9AA 3SHOA 3ETCA 1UCFA 3ROEA 1JDPA 6AT1A 5C34B 3ZQKA 4YCBA 3VVCA 4U3JA 5I5EA 2VDVE 3FPLA 3KX2A 4O4IB 4P3PA 3T4EA 3C7TA 3ZWXA 2B83A 4AY3A 3K0CA 3Q3CA 3CX4A 2M98A 1FX0B 1QUEA 1VKRA 3IKMB 4JR2A 4NPAA 4MI9A 3UAZA 2DWPA 1JR3E 1LKZA 3T5TA 1EWRA 3JQGB 1BCRA 3N2GB 4PVCA 3PFBA 5FI0B 3ITDA 2IVZA 5BQFA 3EW9A 3SYLA 1ELOA 2HMAA 4CUJA 1DV2A 1UH5A 4JYZA 4Q7EA 1LWOA 2W43A 1LGYA 2EP7A 2FPIB 1KF0A 3J7TA 3TSOA 3NIGB 4QDUA 5EOVA 3G23A 3UM9A 4BX9A 1N32B 1JDJA 2XDYA 3BWVA 3VUFA 2WY2D 3E3AA 5EZSA 4G5HA 4XUDA 4KVGA 5DK4A 5EHNA 2EZUA 4B6GA 1SU6A 1D0SA 2YZMA 3CW8X 1BGXT 3LWBA 4ALIA 4Z9BA 1NUAA 3IQDB 2J3JA 2JLQA 3NIFB 4NJOA 3K6JA 3QNWA 3LUBA 3VGJA 2VP2A 3O91A 1VDZA 2E4WA 3A70A 4BFWA 1B8OA 1LK5A 3M6UA 1CY1A 1EVQA 2DCMA 1IATA 1ZVKA 2AMLA 2GJAA 2Q9UA 4K46A 3S5UA 3ZEIA 1KVQA 1L5YA 3H4TA 4EKYA 3K96A 1L8XA 2XWSA 2BTQA 2QKYA 1CUZA 2XB9A 4QGFA 2BFMA 2YYAA 3SX2A 5KOJA 5D84A 1QH8B 3LUAA 3I39X 5EXEA 4AY5A 3C8MA 2FUNB 1TQ2A 2P68A 4LNAA 3W5JA 2WM9B 2Z8XA 3WMGA 3ILVA 3M6IA 1UDAA 1A4IA 3MJRA 2B8JA 4KQGA 4MS1A 4R40A 4KAJA 3TIVA 3Q8KA 4YECA 4B3FX 5HEKA 4FWTA 3T6KA 4RZXA 2PS9A 4MLDA 4MUFA 4XIGS 1JALA 2RI6A 5AKEA 3THOA 1U2TA 2AOUB 3AIKA 1QOZA 4YQZA 1V41E 1CCWA 3ZBTA 5I9MA 4D0SA 4H35A 3MGGA 4H6XA 1EFDN 1TK2A 1I9CA 2X9QA 3CXUA 5EEGA 3ZJUA 2O5EA 5E8RA 4JI6B 1YJAA 4AK9A 4GXTA 4YCJA 2AZMA 1PQWA 1QGDA 3EUWA 4R31A 3LBAA 3ZKWB 5LZ4A 1NNLA 3HU1A 2P6OA 3RIYA 4PC3A 3RTGA 4K6HA 4UE6A 4B6EA 1N5JA 3PV0A 4HN4B 4RJTA 4QHTA 2G83A 4X6YA 4LK3A 2ZSIA 5EUCA 1A1SA 1O1YA 5FQNA 1CDZA 5IJ0A 3AL3A 1C0PA 1NF3A 2BEUA 4ZDWA 1RABA 3E4CA 4FCVA 4YASA 1VLHA 3PUXA 3KB2A 4WZ6A 2FOIA 2A9FA 4XGQA 5AHOA 3F4KA 1DU4A 4L3VA 5ALJA 5KOHB 2XUKA 5FAXA 2GM4A 4Q34A 1PQUA 2IV3A 4CN8A 1N0IA 3VR1A 1X42A 2CMFA 1X1DA 2J4CA 4L2IB 5JANA 4G56A 1J07A 3C41J 1NI5A 3P4XA 4HQNA 4P92A 2GN1A 4DB2A 3WG9A 5K2OA 3QA3E 4OQEA 4CF3A 3DBLB 1RVDA 3DXXA 4LY3A 1XX6A 4BNDB 2PE5A 3CSUA 1B14A 1Q15A 3CQ9A 3PNVA 4RAOA 1LC3A 2ZRCA 2C99A 3MJDA 1P6UA 1S6YA 3R7BA 4C4TA 5U9CA 1UM9B 3I73A 2IHTA 3RSZA 2Q5JA 4U2CA 4P5EA 1G0OA 4P4TA 1TUIA 1Q7TA 4F6LA 3UCEA 5JJLA 4I46A 1JTFA 2IJGX 4O4JF 3IVGA 3WDMA 1SBCA 1M8FA 3DCYA 3QJ5A 2JCYA 5H80A 2FWMX 2IYOA 3QITA 5HFJA 4HBZA 3ZG6A 3GH1A 4XJTA 4ARUA 4UMVA 5I8PA 2FUKA 5JISA 5IN5A 1KMCA 4K1XA 3ZZTA 4LY0A 3AF1A 1JAZA 4KLNA 1IBLB 1LDGA 4IILA 1SUSA 2ZRIA 4RF4A 4N82A 4M9UA 1DRUA 4ROSA 2XOKA 3PNSA 2HTEA 1P1JA 4OYLA 4Q7MB 3SXJA 1ZZEA 1XLWA 1E9VA 2ZKIA 1HRKA 4PG6A 1M1XB 1O97D 1ZI8A 1AU9A 1OVMA 2P77A 3F6RA 1VJTA 5LCXA 2IOQA 3DMHA 3BMQB 3STVA 1FMCA 3LC1O 3OC6A 3D6UA 4BMYA 1PVOA 2IYSA 5JYCA 1R8SA 1RM5A 1WZCA 5L45A 4YJFA 3HA2A 3EZFA 4OYHA 5LNK6 3EX7C 4G65A 2EIXA 4YDRA 5F2OA 4NYMR 1E1QA 1KEWA 3FMIA 1YXMA 2CXXA 4KFSA 4KQIA 2FE1A 4Q1VA 4RE6A 1AOXA 5BWNA 1UP7A 4FT4A 1Z4LA 2YWHA 2WU1A 3VHLB 3K1AA 3K2EA 1KP9A 1E9DA 1X7XA 2ZB4A 4RVCA 5FV7A 1KI6B 2YBDA 1H23A 4PVDA 1E1YA 4RS4A 3U3ZA 4BL5A 2NLOA 4ZI3A 2PWAA 3D31A 3EGXB 1RNLA 5ECWA 521PA 1MVNA 1OHHD 5K8VA 1K0FA 2G77B 4EZIA 1MO4A 4F4JA 5KYWB 2GPWA 2TSYB 5K1ZA 1TGYA 4IDBA 3E23A 3AEQB 5KTYA 4ZCSA 4LXUA 1JJVA 4BLTA 5JDIC 3QF4A 3BL8A 3ZDZB 3CMCO 5AWFC 3UJDA 3ZXYA 4AMZA 1FVHA 3ZY2A 5IBQA 1P2GA 2BKXA 4OKIA 5FWXA 1XU7A 2DG2A 3JQDA 1XRRA 5IX8A 1GQYA 1RI1A 4WAUA 4B4KA 3ML1A 2VO1A 2X8JA 1LRJA 3QVGB 5A1JA 2V9CA 1X6VA 1E5XA 3O95A 4C6RA 2XWQA 4RFLA 4JVOA 2GN2A 1JXQA 4PTLA 4KQXA 5K3SA 4E5YA 5BQ5A 2VH2A 1E3WA 3D7NA 3ODGA 3FHLA 5FP0A 4D25A 3T1YB 1RQRA 5D5PA 2OAP1 3EY4A 1GDTA 2FDRA 3IUMA 4F8EA 1IN8A 3CT6A 4K6CA 1KDVA 3V1YA 4DT1B 4YCMA 1ZJ5A 3EZYA 5BWMA 3H42B 2MHCA 4FU0A 4IH4A 1MT3A 3VZSA 4BKMA 1N6KA 2BLNA 4ZGBA 3OE5A 3TOVA 2CEKA 4MWEA 4NONA 3RC3A 1VE9A 2DC1A 3JS5A 1AUXA 3OM0A 3TLCA 2ZR7A 4BO0A 5L6LB 5CLLA 2D54A 2G82A 4EATA 5CVVA 1EQAA 1HDRA 1C7RA 1T3GA 3EPKA 4MHTA 3TZCA 5C3UA 1CQIB 2WP8J 3TQOA 1BXRB 3NRBA 5FOWA 5C4MA 4QKQA 3LQFA 3A3KA 4KYUA 1HA3A 2H9YA 2YYYA 3AFIA 3G13A 4FUQA 3RE1A 1FYEA 3P9RA 2FEMA 1DBSA 2Y6VA 2RGEA 3KQPA 4YAOA 4LNHA 1C80A 2ZZKA 4BU1A 4Z2AA 5ILGA 5KWIA 5CYOA 2GO1A 5CFOA 3Q12A 4MQUA 2K2WA 3KSBC 1J0XO 2R96A 2PNFA 3SN6A 5CA1F 2IYFA 2C2WA 2FZVA 4CIYA 2WAAA 1XDWA 3CONA 2NOAA 1I94B 4KSCA 4IV8A 3HVKA 1UDRA 2XMBA 2XQFA 3DBHA 3K6KA 3U3KA 4EFDA 5D85A 4PYKA 3U3DA 5G0SA 2SECE 4R81A 3OTWA 4K9RA 5B3AA 5IPFA 3CZRA 1Y7HA 3I3OA 1L5QA 2XT6A 3TGWA 1JEAA 3KOMA 4EGAA 5TS3A 4YMVA 3OCXA 3FKJA 1TMKA 3UUFA 1X14A 5B3JC 3RG2A 2R68A 4YBZA 1YASA 3TE6A 1JI0A 3Q3VA 2FX5A 1OH8A 3DNFA 4REQB 1MTZA 1FLVA 5DASA 2IP4A 3AUJB 1DQRA 4MGHA 1OTHA 1QV7A 1Z6QA 2WHQA 3MQ4A 4TXJA 3P26A 2EHDA 3G0BA 5L7WA 3L46A 4UTNA 3E9YA 3VJLA 3BXOA 3TWOA 2ZVQX 2BPOA 5L7YA 4RDXA 4GHWA 4QGGA 2ORWA 4XW2A 5IASA 4CEJB 3CJRA 2HMTA 1CJVC 1W88B 1U6KA 1ZA1A 3R0VA 2GM5A 3O2JA 3O8BA 1GFWA 5BQOA 4BECA 5MHTA 3EYWA 3PWTA 1HDYA 3W5IA 2FLWA 1V3VA 4LOJA 3KYDA 1BU8A 3DG9A 3NDPA 4P7KA 2GPTA 3TIIA 1D5CA 1PJLA 2R48A 3P7MA 2MJLA 3JZDA 5DNWA 3D8SA 3U9TA 1I4EB 4N8SA 4E5PA 3BM5A 3ETHA 4H7KA 1T4GA 1ZJ6A 2ACVA 1NLUA 2W6QA 1DXHA 3RRXA 3RASA 1ZN8A 2C3OA 1ZOSA 3AU8A 4XDHA 2VG8A 5FNVF 4S24A 3NIDB 1DLJA 3ID6C 1PHRA 1V5WA 1U1IA 3NP9A 4PLFA 4YRAA 4KZPA 1GKYA 2FEAA 3H2BA 3L4BA 3D02A 3WE7A 3ZDEA 2P9TA 3LVRE 3BIWA 2P6NA 4BTEA 4KU4A 2XVAA 3FYUB 4QUBA 3UT5B 1Z34A 2B3TA 2IIPA 5E2BA 4DPMA 5DXAA 3C7CB 3TLXA 3TINA 1T2EA 1U5CA 4C43A 2Q4TA 4RVUA 5EIEA 3L84A 3K1YA 2O7RA 3DLTA 1YCDA 4V2UA 3VU0A 3O3NB 3NVMB 3UG6A 4QXRA 2C8VA 4HAUA 1PW5A 2EBUA 4NFHA 2Y0EA 4X60A 2ZBVA 1DNPA 2BFDB 3LX5A 4WDQA 2VA8A 1YS7A 2PX4A 2AWNA 4KB5A 5IARA 5IEJA 1TCVA 1KDZA 3H5AA 3PWKA 2DOKA 4TKLA 2HHHB 4LVNA 3S7ZA 4HLUA 2P0EA 3NYIA 2ZT5A 3KJZA 4MLCA 5HUHA 2UYQA 2WFLA 5JCXA 3VR5D 1EHCA 2NO9A 1CJUC 1MIOB 1UBKS 1W9HA 3IEVA 3GDGA 4UNIA 1JR2A 2NQ2C 3NC4A 3O9VA 4CV0A 3DWFA 2J46A 1ZNZA 2CMHA 3GNQA 3KDAA 3R74A 3WYBA 1DI0A 4Y2JA 4F72A 1QU2A 4DM7A 1SXJC 3GN1A 3EXEA 1T2NA 2VRCD 4R2IA 4Y7DA 4AJIA 5B7NA 2PXHA 2EJBA 2R6HA 4EYSA 2RGNC 5AVOA 1EWKA 3X3HA 3ILSA 3EZ7A 4M1WA 3BDAA 3G79A 3AGQA 1MU0A 5JY6A 4ZV9A 1WXFA 3V33A 3II6X 2G06A 3MRSA 1B6TA 1QKIA 4F92B 2WYUA 4K9MA 4F6RA 2QRQA 1XZMA 4O2AB 3R5HA 1Q3TA 1QO0A 1OX5A 2I2AA 2W83A 3P2MA 3GWZA 4EB3A 5H7XA 3F67A 5COQA 4YT2A 3L8FA 3I1JA 1Z39A 4MW4A 3KVRA 4J1NA 4GVLA 5JMTA 3MQ2A 1KBQA 2F3SA 4NBVA 2NM0A 3HWX1 1ZP6A 1KI4A 2FETA 3AWIA 3DFKA 3EZGA 2HGSA 1JDUA 3ROQA 4URZR 1Z3CA 3EGCA 4XWKA 3UFXB 3RODA 2NU8B 1FE8A 2VZ0A 3IVAA 4K2HA 3KPVA 3M6VA 5G1OA 5C37A 1A9RA 4JYPA 4Q4JA 1Z0DA 4L0QA 2FMXA 2GDJA 3H9CA 5CYGA 2GZ2A 1FFWA 1LDBA 2B2CA 1IXRC 1HUQA 2G04A 5EWJB 5CH3A 5SY4A 3OIUA 1ULZA 4KYVA 4TTVA 3T5DA 5I7RA 1GTSA 1KYWA 2PTGA 1FDWA 2ZJ2A 7ADHA 3U31A 1AC5A 2VDLB 3ADOA 4S1NA 2NAPA 3T4XA 4TWRA 1ZJYA 3LA6A 5DB4A 5A7GA 1OIVA 3AR9A 1XAGA 2YUIA 4LBVA 2I2XB 2X6QA 1R9GA 5G0VA 5KSWB 3B8EA 1ZOLA 4N39A 4BGUA 1X1RA 2GK3A 4A92A 4AMYA 2V7QA 2O5VA 2Z6QA 1EFLA 2FYTA 1ISJA 1IL0A 3JWIA 3QPAA 7MHTA 1U3DA 3ETDA 1U8EA 1PK7A 4QBFA 3HVHA 5CNJA 3ET4A 3MD9A 3LP6A 5EP4A 4D3DA 1YBMA 3G2IA 4KWEA 3RF7A 2BHRA 4CL2A 3DE0X 1KZ7B 1KBOA 4X91A 4Y2GA 4CCSA 3S8MA 5CH8A 3IDQA 2O8FA 2H2HA 1ESEA 4LZOA 3G02A 4ZOLB 3UANA 1YOVB 3BJZA 4C29A 3AKCA 1W1IA 3S2FA 5HM6A 2GJSA 5MFZA 5E6SA 1KNXA 2ZJBA 1U7UA 2IU3A 1QRRA 4RVFA 4Z1MA 3KKZA 4AG6A 5A4JA 1EI9A 2W4IA 5KJFA 1B1AA 1Y34E 3LVFO 2Q9AA 4AO6A 4FC6A 4Z7JA 5MGNA 4ZOCA 3SHQA 4YT8A 1IAQA 1EZZA 1MOQA 4WWHA 4QOGA 5G4LA 4P0TA 4CL3A 1Z2PX 3PHGA 2WB2A 4DLNA 1FVXA 3BXZA 2OC9A 4MP3A 2XQGA 3ONFA 5LB2A 1QHXA 1AKRA 3ICWA 1YHYA 5F5LA 1XD2B 2PBRA 2P2GA 1R0LA 3KQLA 4O25A 4L7VA 4YJHB 2PJDA 3QTLA 3KG2A 2O48X 3LLMA 5LP6B 3TOZA 5K0FA 5KTSA 4LMRA 4HLNA 1YULA 4LF7B 1R9NA 4GKJB 1HG0A 3GJ6A 1NM5C 4FKMA 4NPHA 5JCJA 4B73A 3IE1A 3KQWA 1MG5A 2EJTA 2HC9A 3LPAA 3E2PA 2HLNA 2Z1DA 1SY7A 3KKMA 2QUAA 4Y30A 1HT1E 1DJLA 2QRMA 3K9WA 3PJGA 3VSCA 4YHBA 5BMOA 5A4MS 3GG9A 4LC1A 3O5AA 2JJ8A 3X1DA 4AF6A 1HNXB 4IDOA 2ZAOA 4RELA 1F0NA 3VR2A 2XSZD 5I7UA 3JW8A 4FGUA 3OEWA 1XZJA 4I0WB 3FKSA 1CG6A 5E7IA 4EJSA 1PEDA 4RANA 4A0GA 2BUAA 1AUPA 3V7FA 4CM3A 1C3OA 1QS0B 2Z4RA 3LT0A 1L7AA 1X7ZA 2ADMA 2M2IA 2N1MA 2R1TB 4OI0A 2X3UA 3EVZA 2HSGA 2DJ5A 4LXXA 2IW3A 4C04A 4HR7A 2UXDB 2NZ8A 3ZVNA 4KR0A 1C8LA 3PHCA 2VHQA 1UKYA 3BF7A 1L1QA 1PQYA 4J3JA 4MRMB 1ZD8A 1CLUA 1UZMA 1XMOB 2DCUA 1A8HA 3IP5A 3GCDA 2O8CA 1IQPA 2C4NA 2FPPA 3W9SA 3GU3A 3CZ4A 2OXCA 2J9RA 3O0TA 4Q3BA 4ZQIA 4OGKA 5J2UB 3V4VB 5AYVA 3WTBA 2C2MA 4GUDA 4M9RA 1RZRA 3ER8A 2OB1A 3OSZA 5KYTA 1ZQ9A 3B8HA 4MVJP 1PD1A 4B35A 4D98A 2NPOA 1NBMA 2OVBA 1JH9A 1FYFA 1K1EA 1P45A 2C3PA 3D1JA 3LPCA 3N8IA 3VKVA 1MH9A 2GNOA 2XZPA 4LAFA 4S0XA 1BWSA 3ZWYA 5HA5A 3FFBA 1NLZA 3ECCA 1SJ9A 4IHJF 1CVRA 1OJLA 1R0XA 2HT6A 3TXYA 1M1NB 4X9XA 1YQWA 3QMMA 5AOBA 2YJ5A 1T8WA 1XTVA 1WXWA 1JT9A 2BKUA 4BGEA 1ZGCA 2OXRA 2PZGA 2DT5A 5T64A 3H65A 3C97A 1AT1A 2PRJA 3MS7A 2F1IA 4R9NA 3TDNA 3WRYA 3GAFA 4EG1A 1BFKA 2IYVA 4HNSA 4KLCA 2NYVA 1S02A 3B3AA 3BRWD 1W4LA 1CXZA 1G8KA 4P82A 1Z7BA 4OF4A 3CO0S 4YAEA 3FPGA 4BFLA 5FWYA 1N5IA 2OFPA 1REQB 4TYYA 2XXAB 1OLXB 3OC0A 3SBDA 2JF0A 4J3NA 4MPRA 2NSJA 3OH8A 3V8NA 1JLRA 5AKYA 2A57A 3QFSA 1IM2A 2DLNA 3OZ7A 1ESMA 2WM3A 3A28A 4CT0A 4XX0B 2GK6A 3C43A 1KQNA 4BKPA 4G0XA 4G5RA 2WF6A 4RC9A 4PPNA 1AO0A 4BGDA 4ZOBA 1XTQA 2CVFA 2ZVPX 3OM8A 3GG2A 1BO6A 1ST2A 2P9FA 2XCIA 3OX3A 1E7RA 4LY9A 4ZV7A 4ZQCB 3AVOA 4A2CA 4AC9A 4BEVA 4CIBA 4BB6A 1E6EA 3REQA 1XTJA 1I0ZA 2QD5A 5F3DA 1LS1A 5HTOA 3CKLA 2QUHA 3LCRA 1ZMRA 3OU2A 4GF5A 2B30A 1P4SA 3GJRA 5HS4A 4DR4B 1NYQA 2QSUA 4KBGA 5EXXA 4JEMA 1ZH4A 1U99A 4GKBA 4UXIA 4HUTA 1O08A 1ONPA 1OYOA 2CBZA 2Q3MA 3M49A 3DEYX 1XZGA 2C3MA 5FF9A 4EGSA 1PSZA 5GJWC 4BO3A 4BPBA 3O83A 1BS1A 1KY2A 4OI4A 3FNRA 1B16A 1J0EA 5B53A 5CAEA 1AS0A 2Q0XA 5DNDA 1DT5A 3Q7RA 4OXIA 3V4LA 2DBRA 4D4GA 2O6LA 1RZVA 2FPLA 2H4YA 4DJTA 1N77A 1JQDA 2D7JA 2RGYA 4FFBB 3O4HA 4KDRA 4B7ZA 4JCOA 1SUIA 5A3QA 2QUJA 3ZHUA 4OI2A 1NRJB 4DJFC 4OXXA 2UAGA 2ZIVB 1EUCA 4KAXA 4CKEB 4XIJA 1KMQA 4JFAA 1ZM2A 3RFVA 2BEJA 3AHCA 2J33A 2AJ8A 3HB7A 4KE7A 4BVGA 3ONVA 2A0WA 1FNBA 1ZM3A 2WQ6A 3DAFA 5KQLA 1CRPA 1KP2A 1N2ZA 2DP4E 1Y89A 4FMBB 3ORSA 4B3MB 1NFFA 4OXRA 2RMKA 5IWCA 3K32A 4ZQFA 1Z6XA 2ES4A 2G5TA 3NAMA 3RSOA 4DARA 4XVCA 4ZYUA 2QT9A 4LZZA 3C3MA 2GVNA 4RHCA 1IEWA 1X7YB 2H4HA 3NG1A 5TMBA 7YASA 2W8ZA 4DMGA 5HUJA 4H7FA 3M0EA 1XL1A 3T9DA 3K6SA 4W63A 4PYIA 1G17A 5FLXA 1LS6A 4J49A 4PCLA 4JKOA 5JLJA 4M3NA 3ZNQA 1T1JA 2FMKA 3PXAA 2CE7A 2YY6A 1CZRA 1RWOA 3ABZA 4P4NA 4PNZA 4MMYB 3NBYC 4V0ME 4EECA 2BWJA 1EVYA 2JI9A 1IHDA 4EY4A 8AT1A 4LE2A 4FYVA 1M75A 3WLIA 5KKNB 2EQBA 4KXLA 3IEKA 1LXCA 1UPXA 3IT2A 5TC4A 3PEEA 2C9ZA 1M5TA 3OLWA 5SY9A 4EG5A 3OZUA 4JKYA 1M34B 1DZ3A 1GPYA 1Z0AA 1AUOA 3AF0A 4GICA 1L5LA 4DYVA 2ET6A 3VPDA 4LTNA 4XPZA 3JALB 3FD8A 3V00A 1DCMA 4LXTA 4PO3X 2OOSA 5CT6A 3I9LA 4URHA 5L53A 2EWVA 2XZLA 3QE3A 4KE6A 2HMYB 5IUJC 4BY9E 4MRNA 2C84A 2G3YA 4XIYA 4AIRA 1F06A 1PSDA 4WBNF 5C80A 3QLEA 1GG9A 4HH4A 1XPOA 2C4HA 1OW3B 4DHWA 4PZLA 4XYLA 4P0QB 4DV3B 3PFIA 4R4JA 2PUCA 5ES4B 1LX7A 3O2NA 5KNCH 3EEYA 3DXFA 4TYWA 2KYRA 2XNHA 2GCOB 1O6BA 1IZ9A 4LHVA 4QYXA 1VLQA 1I14A 2PKRA 2V5VA 3E81A 4FD2A 4R6WA 5HOQA 2DEUA 3OO0A 1ZJJA 1RYFA 2I4NA 1GRCA 4L57A 2CWWA 5F4BA 1CZNA 2PX5A 1R88A 4WESA 3G2KA 1VHLA 4C7JA 4K6GA 4PQFA 4CIWA 1F8YA 3M9XA 3B70A 3K8OE 2GK4A 3O3MB 2Y9PB 5KNLA 1J42A 1QC5A 1YZNA 1ZUIA 1KPHA 2LCQA 4EEKA 3UPUA 1H22A 2BSXA 2XKAA 3W2FA 2QTBA 4NWIA 1XNHA 2WP0A 1GZUA 3ZU5A 1RQNA 4AAYA 4KH1A 1C3LA 4FEEA 2CD7A 1X1SA 2GKSA 3F6EX 4OJNA 5BWOA 1N5RA 5EE0A 2ZVJA 3UXEA 1XGKA 3L1UA 4J6FA 1N8SA 1YB6A 5DWDA 5FNVA 3ROXA 4ER6A 5KWSA 2OBYA 5DM70 4I5EA 2JLRA 4O2RA 4PHCA 1VJCA 3IKTA 3C98A 3SSNA 2LCIA 121PA 3IDFA 2O3TA 4R8RA 1G5TA 2RAVA 1W4CA 1USKA 2JJQA 4QYSA 3IJ5A 2QZPA 4TKUA 5JBIA 4XD7A 4G5GA 2GILA 4PBRA 2QXTA 4BS9A 3QW4B 4ETWA 1JDBB 3BHIA 3D6MA 3HXKA 1D1SA 3T1VA 4JC4A 1YRBA 4KQ6A 2QL6A 3C16C 5TS2A 4CLOA 3OE1A 4JC5A 4PGHA 4YAFA 5DI3B 2RAUA 3DOOA 4KI7A 3WLEA 1G98A 4ZJZA 4EEZA 1RSZA 5K6TA 3N0XA 3KCNA 4RVSA 1Z25A 4QDOA 1PFWA 2P5SA 4K9NA 3NTLA 3U37A 2PWZA 5G1PA 3P9YA 1R12A 2FX2A 2PJZA 3MLBA 3PQEA 4ENSA 2IZ5A 4QOEA 3R8FA 3DLAA 2VP0A 2VUIB 2XRMA 1LBHA 2ZLBA 3S2SA 1MDBA 3W6PA 1JEOA 4H3SA 3DL2A 5BW5A 5CDHA 3D0KA 3L4KA 2QRUA 3S27A 1NP3A 3HNPA