1C2TA

New insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
209
structure length
209
Chain Sequence
MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New insights into inhibitor design from the crystal structure and NMR studies of Escherichia coli GAR transformylase in complex with beta-GAR and 10-formyl-5,8,10-trideazafolic acid.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE
total genus 68
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 1999-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1c2tA00
1RC0A 2GARA 1JKXA 2BW0A 4IQFA 1RBQA 3DCJA 4QPCA 3W7BA 4ZYUA 1GRCA 1YRWA 4YFYA 5J63A 4QPDA 4EW1A 4ZYXA 4ZZ0A 1ZGHA 4TTSA 3N0VA 1RC1A 4TT8A 1MEJA 4ZZ2A 5J9FA 4ZYVA 1ZLYA 4R8VA 4ZZ1A 3AUFA 3P9XA 4TS4A 3AV3A 4NV1A 4ZZ3A 1RBYA 3DA8A 1MENA 4YFVA 1C3EA 1ZLXA 1RBZA 3KCQA 4DS3A 4ZYWA 1FMTA 4S1NA 3R8XA 2CFIA 2YWRA 4ZYZA 3TQRA 3OBIA 4EW3A 3TQQA 3GARA 1NJSA 2FMTA 4Q12A 1C2TA 3Q0IA 1S3IA 1MEOA 1RBMA 4PZUA 3NRBA 1CDEA 5CJJA 4ZYTA 3O1LA 2BLNA 1GARA 4ZYYA 4EW2A 1CDDA 3LOUA
chains in the Genus database with same CATH superfamily
1JHYA 1B0UA 3HCEA 3DCJA 3L84A 3OF2A 4HWGA 1E61A 5DBIA 1OAKA 4MV0A 4WESA 1E1DA 3FPGA 4QGSA 5J4LA 3SHTA 2F1JA 1YBFA 2PH5A 2ZBUA 1ID8A 1N2IA 1FB5A 2NO5A 3FKSA 4PSVA 4EAQA 4FT4A 4ZZIA 1SG6A 4Z4GA 2KHZA 4MUJA 3L7KA 5KTMA 4H0CA 4QFDA 3TTYA 2C0CA 5TB5A 1Q2XA 4UULA 4OGGA 1XZPA 1Q5PA 2SECE 1D2GA 1DXYA 5KWIA 1F38A 5IARA 3COYA 3B6EA 1TMKA 2VDMB 4B3GA 3MINB 2PBZA 3S5JA 1IUPA 5P8WA 3TLKA 3DZHA 1VSVA 4FZ5A 2W6JD 1UBCA 2HAEA 3IUBA 3K8ZA 4KBYA 5J2UF 2AQKA 1RAAA 4ZODA 3DMNA 3E82A 3BB4A 4RTOA 1KTVA 2QTBA 4BGDA 4D6PA 4BFYA 5AJWA 1ULZA 2P7IA 2WPDA 1EVLA 4V0LA 4A16A 4RORA 2REOA 4A5OA 5L3QB 4M1ZA 3VU9B 3I58A 2IHBA 3GCWA 2JANA 4Q6WA 4C6TA 4K6FA 1E7MA 1UR5A 1F60A 1V11A 4KXWA 2HJHA 2Q6TA 2I4IA 4WRRA 4WOCA 4UM8B 4G5HA 1GIAA 4XLTA 1D1TA 2I67A 1EFKA 1L7QA 4A8PA 3W2IA 1M8FA 3FYHA 2HA0A 2F7SA 5FBHA 4EHDA 3H6GA 3TI7A 5DW0A 4M0PA 1EQAA 5EPEA 4IIJA 1WD5A 4DCTA 4OJYA 4BXOB 5IS2A 3WDLA 4G63A 1XP5A 3RBAA 3I5XA 1SBTA 1VMDA 3H1PA 4LHSA 4BLOA 3FJYA 2HDWA 4Q9LA 3EHDA 3DE1X 3I2GA 3OLWA 4XPIB 5DN6A 4PPFA 4YJKA 1CZUA 3O8BA 1T4BA 1NF2A 1YT5A 3OKPA 3P1JA 4JJZA 4WACA 2ZIZA 2CLFB 4MUFA 4BMCA 2D4AA 1I24A 1TMOA 1ZI8A 5J40A 4OQYA 4B5LA 5B6IA 3NEJA 3L4BC 1IRIA 3O8QA 1K6JA 3EZFA 4CV0A 1CUJA 3VR3D 1X0XA 3B9QA 1XPRA 2YTZA 4RTNA 4X1IB 3HCNA 1RMYA 4ZQGA 1OZFA 3EDQA 3T9DA 1YKSA 2LV8A 3ENQA 3OE7A 5IDXA 3CT4A 4AG3A 4N76A 2LE0A 3QPUA 4M1MA 3KAPA 4CQJA 1QC5A 1GV0A 2Q4EA 3D3KA 1BRTA 3R6DA 3ELBA 1JV2B 3C8UA 3W6NA 3RTEA 4FYIA 1PFQA 3QTLA 2O2EA 2EQ5A 3CISA 4H2DA 3KOYA 4HAOA 4IKOA 3ZD8A 4FCVA 3VAAA 5A6SA 5JS6A 5BR8B 4AZWA 2Q7OE 1G42A 1YFZA 1PFYA 1RR6A 3C6QA 1BX1A 1CHNA 1H3NA 1MN6A 4WH0A 3KYDA 2WG0A 3O4RA 4I3HA 3CX7A 1GN8A 1E8MA 1OWLA 3OX2A 4MQ6A 2R7AA 1ZRMA 4PX9A 1PNOA 4HV4A 5KC8A 3VKGA 1ZR2A 4M76B 2QXYA 1CJMA 1K7YA 1SBQA 3ZH9B 2FW8A 3NNNA 5ALGA 2NP6A 4I4TF 5C52B 1LK7A 5MGBA 2FDXA 3VDRA 3CHYA 1RM5A 1P3DA 1V8ZA 1VYUA 2ODQA 3N3AC 4OQPA 2PZEA 3MT0A 1VGQA 2J5KA 3DZCA 3H99A 3E2MA 4FMCF 4MGEA 4MGYR 3BCSA 3KT3A 5E9AA 1X3SA 4ALIA 3OHMA 2OO7A 5KC9A 2O2XA 3C74A 1X1BA 4HO1X 2P78A 4TKVB 3CKYA 2P91A 3V2IA 4C06A 4C6HA 3BB3A 4XQCA 5K3BA 4MS3B 1OU4A 1M3SA 2ZAYA 3DEIA 5LPNA 3S2IA 2H2WA 5DWVA 3NMUF 5B7NA 1CB0A 2AHRA 2YZMA 3AR8A 4EKEA 1M34E 5B6PA 5F2NA 2ZCVA 5A4MS 1ST3A 3GHHA 2DLCX 4M55A 3UMSA 3GJQA 3PC4A 3R2JA 1HEYA 4PWYA 1LWOA 4NP6A 3H2JA 3UXMA 4QJ4A 3AHFA 1KIMA 3VZQA 4FDVA 3FMVA 4HG2A 3RC1A 2INGX 1RNLA 4YRQA 3PLAE 3AVXA 2OO5C 1RP1A 3PDWA 2E5WA 4MJ7A 1T43A 4WFQA 3T7EA 3G0IA 4NYIR 4XWAA 4MHOA 2WJGA 3HXLA 1ADJA 5IYZA 1Z7WA 1GQ2A 3GH1A 3FOZA 3RBZA 4ZJPA 3HBMA 2IBTA 4Y2PA 2YV5A 4XDHA 4HH0A 2AGVA 4HT3B 3M83A 2VDQB 2IKSA 3ZKAA 5IJZA 4LISA 4ND3A 5BPHA 5EA2A 1H5QA 4XVHA 3T3HA 5JRJA 3WGZA 4ID9A 2EBHX 5J1TB 5TPWA 2PWZA 4Q7EA 3TG8A 4TM7A 4WDRA 3UJ8A 3LHKA 5BSHA 2BMWA 1H0KA 2UDPA 3H2YA 3ZJ5A 1XRSB 4IOKA 1Z74A 3GJYA 1VMEA 4RFVA 1I3CA 5K4AA 1UL1X 3EVZA 2ZRGA 1KO1A 1LLDA 1VSUA 4KIGA 1N8SA 1JHUA 1EB9A 1DUIA 1JSLA 4BP3A 4JBXA 3FVVA 2W90A 2A0KA 4NABA 5F4BA 2W2KB 3L1JA 3ORQA 2PYDA 5D2CA 3WGNA 5ESWA 5CMLA 2QRVB 4OMDA 5C8VA 4ALJA 3BTVA 3SJAA 2YOHA 1W47A 4L4ZA 1Y3DE 1YBHA 1Y1QA 2DQZA 3JQQA 1D4AA 4U7FA 3ADBA 3P20A 4JLUA 3IMCA 5A71A 4GMFA 3ZGLA 1J0CA 1JA9A 1YDWA 3LK7A 3PGMA 4JI7B 1E7YA 3ZI0A 2JGEA 2WWRA 3DONA 3PQ3A 5AO9A 1KMQA 4QLAA 5H3CA 4JU8A 1PE0A 3TOSA 3VSEA 3HYLA 2N9UA 2PWAA 2C2KA 3FM9A 3BGWA 2ZIUB 3FYSA 1UBGA 3N1UA 4WV3A 2O1WA 2OUIA 2CZCA 3I72A 4HN9A 5CDTA 3PDJA 2O2JA 3SZMA 4BWGA 1OAOA 3PHHA 5CJ2A 1E1QD 2G80A 3QG1A 2NV0A 1YJ5A 1W4LA 5AVTA 4YJFB 3T1NA 2VPTA 4MUYA 5GM1A 2C5AA 2IKQA 3FFAA 4TRJA 3WWZA 1T5TA 1Q0HA 1REQA 1WS6A 3EUEA 1SHLA 4RD4A 3VTFA 2FUNB 1DBRA 2YV3A 4AZ0B 4OUDA 5CIWA 2DSNA 1IRXA 3QYPA 1TZJA 3D6TB 5EESA 5HF8A 1ZJ5A 4WKNA 4CL8A 5LLTA 2XCSB 3PPIA 1KFBB 2XVAA 4AKHA 3SBDA 3OJWA 4X00A 4CFZA 4CMGA 1ACLA 1DO2A 2P35A 1CDEA 3FAZA 4ND7A 3RV3A 2FOIA 3LMKA 3PEUA 2FSHA 1IEWA 4A2WA 3HPQA 3M5PA 3FPHA 4E5KA 2FR8C 2BW0A 5I47A 3DFMA 1N2JA 2VATA 2KE5A 1MX1A 2WTEA 4QOGA 3O8NA 5IPFA 1Y5NA 2IL1A 4E1BA 2D7JA 2ISQA 3AEQB 3QEKA 4Q3OA 3HG7A 3ET4A 3CLVA 3W78A 1RI2A 1RPAA 1YBMA 3R3WA 1S4MA 2TYSB 1KK1A 3FUTA 4BKRA 1BH6A 3IELA 4MVJA 2I62A 1CRWG 4EF6A 5E6RA 4FUQA 2H8GA 2DFTA 2JGDB 1M8PA 4NAVA 3AP1A 4MVCA 5E4TA 4BZWA 2C59A 4NZPA 1ZITA 5IT9A 3UOAB 4GPD1 3ZE8A 1JG2A 4US0R 4KKVA 3T0FA 1U0HC 2I8CA 2NN3C 5EIHA 4DA7A 4YCSA 2P2GA 3R3JA 2WICA 1RWXA 4IO1A 3M4YA 1GCOA 5EKDA 4D9KA 1N1EA 1WDMA 4N8DA 4WKBA 2CFTA 1YXMA 5ALIA 4LJ9A 4MROA 2FZCA 3ZZUA 2D2IA 1RWKA 3JWHA 3P9ZA 2B1RA 4JGIA 5LU9A 5HG0A 1GZ6A 2W6PA 4YI5A 3BWMA 3K1AA 4AICA 5HIAA 2CWWA 3D7NA 2KS6A 5JLAA 1UBNA 2CEKA 2Q5QA 3OUTA 2P6RA 1JLKA 2NVBA 5HF9A 1OH8A 1GNTA 4EY7A 1QE3A 2ZTSA 4UAGA 1P2FA 2G1AA 3VDMA 4GM1A 1FXUA 1Q0SA 4OHBA 4WECA 5KYUA 1WZEA 1SKMA 2W83A 5HF5A 1WXEA 4U3JB 4XGRA 3PJRA 3ICPA 3U3KA 3P8ZA 4PSUA 2W6QA 3MEQA 1BKYA 1Z5WA 3OTWA 2YVQA 1JJVA 2XXBA 5T8KC 4C7XA 1W0JA 2EFJA 5E4JA 2A9JA 3IP9A 3VI4B 4URVR 2XOEA 1GXSA 5F2EA 4G0NA 4QGAA 1I1HA 2B5VA 1SU8A 3INRA 1H1LA 3PQEA 2A5FA 4L7VA 4P9NA 4Q4JB 3RODA 4E6EA 1D9ZA 5HKAA 4MI6A 1YB1A 4B43A 1FYWA 1GCUA 4DBLC 1FUKA 1NSTA 1XEFA 3HTXA 2ZJBA 4YVFA 3ZBTA 3W5JA 2X2PA 3NTQA 4CEJB 3CM0A 2LRHA 5EL0A 4ZV9A 5J3JA 3E35A 3G79A 2JLQA 3MPOA 3N2GB 1Y89A 1A2KC 3BDVA 4DIOA 3DWIA 4MRMB 1N5KA 1OD6A 2ZCUA 5FR1A 3G2PA 1HH4A 1I7PA 1B6TA 2QTFA 2WV9A 4FNOA 4CIWA 4PZ0A 3M5CA 1NW8A 4YMWA 2NSDA 2I87A 3PA6A 1WDKA 3QE4A 4U9HS 4BBZA 1GZUA 2WYVA 5A3JA 4FHEA 1IJEA 2EEZA 2FF7A 3NIGB 2FR8A 4MW2A 4BRUA 1Z88A 4G4SP 4HGRA 1EE1A 1GEEA 4MRRA 5L4SA 1XTKA 4NENA 4ARBA 1NW7A 2BSXA 1XK6A 3NGLA 3PUIA 3ZJVA 4CIXA 5JBNA 1KR2A 4GLLA 3IT3A 1J0BA 1XIVA 3QENA 4L28A 4R5HA 2C54A 3BHIA 4G0PA 3M1AA 3VR5D 4FFNA 8OHMA 1U0JA 3D4BA 1ZNYA 4MWSA 2AZTA 3AZOA 3QLEA 1WDLA 1ADBA 4FEYA 3CX6A 4E09A 5HK9A 3OFJA 2HH9A 2WYIA 4Y0NA 3PJDA 5K5EA 2C42A 1S01A 4Z0TA 3GRPA 3BJIC 2BKLA 2LIVA 2X40A 1TA0A 3FSJX 2W2TA 4ZGBA 4D43A 4ZGWA 4GBGA 1GZSA 2PGAA 2Q45A 4OQEA 4LRWA 4N3GA 3S2UA 3GJSA 1JDJA 2VP0A 1SVSA 4ITUA 3NWBA 1B0PA 4UDNA 3AF0A 2FXVA 2KMLA 5IKOA 2RG7A 4INPA 4MH0R 1CQPA 2M1ZA 2WHEA 4EUSA 1AVTA 1WO8A 1PAUA 1ST2A 2BKXA 2QN3A 3AERA 3ANMA 3DL4A 4MNTA 1PI3A 4URWR 5DM4A 5J4HA 4ZAGA 1IN6A 4FC7A 4HSEA 1FNMA 1C1XA 3A6DA 2COKA 2NO7A 2YXLA 3HM2A 4HQKA 4JB0A 4KXNA 4CIAA 4I9GA 4MVJE 4WNAA 5IW8A 1OE0A 4LHVA 5NLLA 1SKUA 2OZLB 1OMOA 3PNSA 1WCYA 1WM1A 1DPFA 2AN5A 3L49A 2FG6C 3LE8A 3W3AH 4JI8B 2FDCA 4C6RA 5AJZA 4JQOA 1KAGA 4G4GA 1DTWB 1RZRD 2PX4A 5CLQA 4E4YA 2Z09A 2VOJA 5AIBA 3KT6A 4I19A 3DMYA 3LZCA 4OL0A 2WSMA 1TKAA 1SUFA 1L6IA 3NHUA 5HKBA 1MQ8B 2E4AA 4QTXA 3PX2A 1E18A 1SJ9A 3E9YA 5J4VA 3QI7A 1BDIA 1NN5A 1PNQA 3A31A 2XB9A 1R6VA 5LD2C 2JIZD 1OXXK 2EBWA 3O4GA 1JEYB 2FPUA 1MAAA 3M6UA 2CDCA 4TUYB 3M33A 4PG5A 4KXMA 2FJPA 1G7SA 1NPTO 3D4OA 5LCXA 1I7SB 3BWDD 2AUNA 3A6KA 4DBLE 1YR9A 2FWJA 1K08A 2VJQA 1RRVA 2XXJA 1GTMA 2VAVA 2WM2A 2XDAA 2V59A 4HNVA 3IAHA 1F7VA 5BN4A 3EDCA 4YH1A 4RK0A 1BWPA 3UTCA 5FNVA 2EBUA 5T6BA 2AV6A 1T9CA 1RRCA 5CURA 2H2GA 2Y92A 1I36A 4Y6LA 4HDRA 1Q14A 4KQKA 1FXWA 1FE8A 1DOZA 2C4NA 3CNNA 3HV2A 4JA0A 3TE7A 3HR7A 3Q8XB 4NLLA 3WGGA 1VCMA 3FWZA 1H93A 5KTYA 1NR5A 1QU3A 5C3UA 1OA1A 1XU4A 5CDSA 4HH4A 1VIVA 4EBFA 5IAOA 3ANNA 3QP9A 2WWHA 2F64A 3IE2A 3VNVA 3B1VA 3RC9A 4M37A 3WOHA 1KMCA 1WBJB 2I6UA 2Z98A 1LRLA 8GPBA 2E5LB 2NP7A 4BNDB 1P2GA 2P1DA 4Y6PA 3RHZA 3MJTA 2VBFA 2HWXA 1YA8A 4P82A 4GOMD 3LF1A 1OVMA 1BD4A 4LDQA 1HYEA 2HMSA 1KDRA 1CY1A 1WMEA 5KQMA 2B8EA 5FWAA 2GYYA 2UZIR 4RHCA 3ASUA 3CZPA 1UJ5A 2D1TA 1GFWA 5AJVB 3UWPA 1M2HA 2BFOA 1XRLA 3OZ7A 3DEKA 1QIMA 1Y48E 3GVPA 3VMMA 1T1EA 3O3MB 2PEZA 4FIDA 3ZWPA 1H2WA 1JS1X 3DHEA 4JR2A 2F4VB 5AOVA 3CVUA 4DNQA 1IQ0A 4HLUC 5F52A 4QUGA 1TK3A 3SX0A 3VR6H 3DKIA 1VL8A 3MYYA 3X3HA 4CFYA 2C4UA 3WADA 4C04A 4DMHA 1K8YB 1NL3A 1T10A 1X70A 2HXYA 4GLJA 4D1YA 4URFA 2YX1A 2VDNB 4GLFA 1J49A 3H3JA 1US8A 2D5IA 1BCRB 1DRUA 2AB0A 4HGYA 1ZM3A 1GN9A 3MINA 3U31A 4X97A 2W48A 1H1DA 3IUYA 4I1VA 4D98A 3K73O 4UCWA 2H4YA 4BMSA 1JDBC 2ZW9A 4I55A 5JSUA 3BFVA 3OPXA 4PAQA 2J3KA 1RAGA 1KMHA 3NDIA 1TEZA 1ZN9A 1EAMA 2B30A 2XX3A 1T1GA 2F3TA 3WK8A 3FA2A 2PX6A 2JJ1D 1B14A 1HDOA 4G41A 2DETA 7REQB 1BDHA 4MYHA 4U6QA 4TYWA 3E9CA 3U4GA 1RWNA 1KXZA 5IH3A 2ZJAA 2XQFA 1Y82A 3OO1A 2JLCA 4R1OA 1ZA2A 1XYVA 2IZOA 2QTWB 4HS4A 5FQOA 4D8VA 2CCGA 1S8OA 4B2LA 3ZD6A 3LWBA 3U0VA 1MEJA 1VJDA 2C4KA 2P9FA 2PXAA 3O2NA 4DV7B 4HPXB 4XQGA 1EBFA 4K6MA 1N7JA 2AXEA 2OBFA 3HI4A 3NDJA 4E2WA 5ICMA 3ADDA 1OX4A 5E0KB 1W9HA 4KX3A 3F3YA 2WTNA 4IW3B 1P1CA 5JZOA 1Z2NX 2QEQA 1XQYA 1PJTA 3DBRA 1YZUA 3IQHX 2PSDA 4LZJA 4F8YA 1MC1A 5EXPA 4RZHA 3RSLA 3LIIA 1EXNA 3VAZA 1EMDA 3G68A 2XIQA 3Q0TA 4Z4QA 3UO8B 3EG9A 3ZJTA 2O8BA 2ETVA 1BHO1 1JRLA 1MABA 2MSWA 5FLKA 1MU0A 3B51X 1YDHA 3L0OA 3CR8A 3NT2A 5LR6A 1JI0A 2BMFA 4Y2GA 3SIPA 4KREA 3EARA 4R8MA 2DZDA 4HYYA 2BT4A 3KZKA 4KP7A 2Y68A 2UZ1B 2JFGA 3OETA 5B53A 1ZXBA 3K2IA 1VC2A 1E6LA 1YBAA 2XCLA 3I6MA 5FP0A 5G3ZA 1DHTA 2XA1A 5BSUA 2AKYA 2H6EA 3HVIA 5INTA 5KU7A 2IYRA 2D2EA 5J2TB 2G5PA 3FWHA 2KB0A 1A9OA 1O6CA 1FS5A 2IYFA 1JTEA 4PLPA 4KLCA 2WTUA 4X71A 1NP3A 4OAQA 4BB6A 1H4SA 2HSDA 3DZFA 1T9DA 2XMGA 4FGKA 1N5OX 3D54D 3PQDA 3CR7A 3ITEA 4BN5A 2A1UA 1MP0A 2G88A 1QLJA 3DBIA 5H82A 3AVTA 4PGHA 2DT5A 1NSYA 1G41A 1FP4A 1JEAA 4G4SO 4WNIA 4Z7OB 4K8RB 5F9HA 4XVRA 5DU2A 2PO7A 5AJTA 3QLUA 1BOFA 4F96A 5KZMB 5KNBA 1I3LA 2D2FA 1T1SA 1JLLB 4Q6BA 4ZKEA 1GA4A 3VYSB 1VJ0A 4HAZA 5AW6A 2VRCA 3HHEA 4RK6A 3THYA 4LQDA 3A70A 2IYQA 4R1PA 5EXDA 1CS0A 3LRTA 4CKXA 1O96A 4HNQA 4MMZB 1OT5A 3ZHSA 2C58A 1DJLA 1EXWA 5TMEA 1MJHA 3GAMA 1ESMA 1VSQA 5KSZA 3HO1A 1BDJA 2QJOA 2C2GA 3H4IA 3LC7O 4I55B 3N7UA 4QYXA 5KYKA 3ZWQA 1C14A 1AO3A 2G3YA 1PR0A 2ZAIA 2ZBEA 1ZW6A 1XRNA 4ZVNA 4B9EA 1ZK0A 1M34B 4M0LA 2BI4A 1GPBA 1MX3A 3FUXA 3AI3A 4G36A 1B4DA 3CF6R 2V8OA 4EY5A 3V3KA 4C21A 1FYDA 5HJEA 2SKDA 4D96A 1VKRA 9ABPA 2Y1CA 1I2BA 5EE0A 5F1OA 2I6FA 2JJ2A 4WN9A 4EPVA 5JIBA 5DM2A 2D5LA 2Y1LA 4E5UA 3U7HB 2FPXA 5AK5A 4D97A 4A1OA 2P2SA 3RHSA 2XMQA 4JP3A 4EB6A 5LDHA 1E3WA 1YR7A 3G9QA 1EWRA 1C3OA 3LQ2A 1YI0A 4FYXA 4R01A 4PYNA 4ZYYA 3MC1A 2JC3A 3DH0A 1SKYB 3SWWA 3AF3A 3FR8A 4CIVA 1CX9B 1JBQA 1PRYA 3H84A 4RD0A 4ZYLA 2G07A 4G01B 3FROA 1SWVA 1BKDR 4GNRA 4OHOA 4D9EA 4DSTA 2ZRJA 4CKCB 4A2PA 2QTCA 4HHEA 4WOPA 2G0TA 3MXOA 4M0DA 5L7YA 1QAOA 2IZ5A 4RM2A 2DPLA 2HGZA 2DQYA 4JUCA 2WJYA 3V8RA 1BYUA 3MCAA 5G4LA 3OX1A 2IX3A 5KAMA 1K4MA 3V7WA 3AHIA 1Y33E 1QNLA 1WP9A 3ABQB 3E0XA 2IPNA 3KUXA 3NALA 3BGOS 1L5RA 3JARA 4ICIA 1T3SA 2FSGA 2QQ5A 3L77A 3QFHA 2CJPA 4QYSA 2C94A 3ZCPA 3B6IA 1DZ3A 4NS4A 2V96A 3AINA 1QK4A 3E27A 2APJA 2FETA 2ZKIA 4TUYF 4NYJQ 1W5BA 3LECA 2TSYB 4TPKA 2VPPA 2EZUA 4OV6B 2XZTA 3FOWA 2WFLB 4BNMA 3QU5A 2VCEA 1JDZA 2WPNA 3TOCA 3AXSA 3GWGA 3ZVKA 2I78A 4ODIA 3H5LA 4BO0A 4YRCA 5JPCA 4L78A 3OZEA 2PH7A 4MPRA 5AW9A 5J4KA 3M81A 4BB9A 3MWKA 3MMPA 2JCVA 2QZPA 2Z30A 3E7PA 3I5UA 3CUUA 4BJ6A 5K03A 3OM1A 4YA6A 3QXJA 1K88A 2ZRNA 3ELYA 2HF8A 4D6YA 1M8JA 3PF9A 4UMEA 1WPRA 3JQRA 2BELA 4O5AA 3UUWA 4FQ5A 4KQFA 3HDGA 4PYOA 2ZR0A 1YA4A 4KGVA 2G04A 3T41A 4CCSA 2ZREA 2IY9A 4YCBA 4K5QA 1JTFA 3EW7A 1WVIA 3AFOA 1QCCA 3AWDA 1CR0A 5ES4B 5EMHA 1DXHA 3CLUD 4O4IB 2R96A 3ABZA 1M6YA 4AIRA 4HVTA 2BJWA 4C2UA 1VXRA 3FPAA 1AC5A 4KE8A 1KZ4A 5FWNA 4C0HA 3OP1A 3G23A 1G64A 1O08A 3EXHC 2ODBA 3GP3A 3ZW9A 4EQ6A 3L93A 5KBYA 3CR3C 1KTIA 3K15A 1I3OA 1KP9A 1CP2A 3AEUA 3ETDA 3MUEA 2R60A 1H42A 3O94A 4N3NA 3RRZA 5IUKC 1J9ZA 5FWXB 1S96A 1M9NA 1PO7A 4C5AA 3U1TA 4NOLA 3UZUA 4F6LA 4BOYA 3R5KA 3FE2A 1VSBA 3I2FA 4DUYB 4WADA 4DDWA 2W6IA 3AL2A 3CSSA 3DAFA 1Y3FE 2PR7A 4HZUB 4QOSA 2VHUA 4CDRA 1SPXA 2ID7A 3KEGA 4I6JA 1ZSYA 4JBYA 1Q7EA 1J06A 2BBSA 2O48X 4N5MA 3WLHA 3W5BA 3WHPA 4B3HA 4EMBA 4RLSA 2FX5A 3B3QA 2BY4A 3BMQA 2DPXA 4RA6B 4ZEWA 4GFDA 2UKDA 2GEBA 3NUGA 4TMYA 4D42A 3OZCA 3STHA 1T5LA 2X0NA 3PRYA 5ICFA 2WD7A 3VHRA 3VX4A 3MCZA 4EG4A 1W8DA 3AJEA 3LOUA 3AVYA 2IDKA 4TM8A 1WR8A 4UARA 2FH5B 4DQXA 2QXTA 3DAPA 2P9BA 3R6TA 4CNQA 4FILA 5A3RA 1UKZA 4A73A 5JAMA 4RW0A 5CIYA 2JK0A 3COJA 2CXHA 3EH1A 4LX8A 2I6QA 2JVIA 4QFMA 4Y3UA 4JT4A 1HE1C 4CV2A 2IJGX 3CNBA 3BULA 3FPCA 5HRUA 3R6WA 3PFNA 2P8SA 4BU0A 4L85A 1Q44A 3ICCA 4B6SA 4O4LF 3F1KA 3SFVA 2ASEA 5JHGB 3OQMA 1SCKA 1NATA 2EXXA 3HJRA 2PVPA 3WLTA 5K09A 1WCIB 1F1JA 3WWOA 1Q7BA 4WHMA 1GZ7A 4EHJA 1R4ZA 1R64A 3GRKA 1U63A 2Z95A 1NRWA 3IKJA 3AY0A 3N0RA 5DNVA 5LD2B 3GJ3A 3T4PA 5KOYA 4NG4A 3VR1A 1K2WA 4O1HA 4CT0A 3HWWA 4LDZA 3GZJA 1ZJZA 3NVMB 1Z4MA 3GBPA 4LMRA 2B4QA 3F7NA 3GCZA 3GUHA 3NWPA 4GYWA 2JAHA 4DTIA 3GT3A 4KFCA 4QGHA 3DYVA 1JR3A 2PWYA 1Q6ZA 2GQ0A 2YWJA 2ENUA 3FFXA 3BHMA 2QTAA 3USCS 4B5KA 1C3XA 4OQLA 4DABA 5DMHA 3I0MA 3TZQA 5JW6A 1SKYE 1PL6A 3D6VA 1CEYA 3KEOA 3ILHA 4TVKA 6ABPA 4RJLA 5DWQA 4YR7A 4YC7A 2H52A 2ZITA 4OHRA 4JBNA 1SZPA 3SZUA 1BHSA 5CA1F 1OYWA 1R37A 4PU0A 5B1SA 1VKJA 2X0DA 2C8VA 3N2NA 4NCXA 5EXSA 3GUUA 2Q0QA 5HQ3B 2EQAA 5ESRA 2HYDA 4MVJG 4P92A 2F90A 2YVAA 2YNMD 5LQNA 4C3OB 2NNWB 3OQ6A 2F43B 1C4XA 3WB2A 4OSOA 3CUTA 3AM3A 3C0KA 4PY2A 2B1GA 1GDHA 5DLEA 1HR0B 1W581 3EEQA 1LTHR 3JTMA 5I7HA 1AM4D 1HO3A 3H04A 4LOLA 4DQDA 1XA4A 4IX9A 4IYRA 4HAVA 5CT6A 4ZJYA 5I51A 1NVTA 4N5NA 4YHBA 1KAQA 1IZYA 3OOYA 4YJGB 2VA9A 3F90A 2NZWA 4OX9B 3E7FA 4V1CA 2RGNA 1Z7EA 2DY0A 3GR6A 4PC1A 4YS6A 1DEOA 4RTKA 5E6UB 3K6RA 3DBVO 1D1QA 1QDLB 4MS4B 3I0NA 3N75A 2FPKA 3IILA 1DXOA 4F4UA 3BMCB 2ERYA 3EPJA 1IATA 3GG2A 2C07A 1S0UA 4RMIA 1AKUA 3UCEA 1NI4A 3OWXA 4Y30A 4CUKA 1K8XB 1R6TA 1ZCJA 3GD7A 3FNEA 5ALMA 2OORC 2NAFA 2CNNA 2O23A 2X6QA 3CIFA 3P9QA 4GE3A 3DT6A 4KIUA 4NYMR 5G4KB 1ZEMA 4PFSA 5DSTA 2Q3BA 1JECA 1ZIXA 2O3RA 3JRWA 2IXGA 3BOSA 2JARA 4BLRA 2BHLA 2CXTA 3OCWA 1V4VA 1FFGA 2PPVA 4KH1A 2PZAA 3UAWA 1DTSA 2AQIA 2DJIA 2YINC 4FSXA 1E2PA 4CEHA 1ESEA 2BUBA 1KYTA 1C0LA 3QKTA 4Q93A 3RYIA 2I2BA 4YUAA 4O4HB 3UMGA 1W94A 5B4VA 6ADHA 4TT3A 5JSFA 1MA0A 3QNUA 4POAA 3NBUA 5A2GA 2H9YA 4TZ6A 2Q0HA 5F98A 1I8TA 1QOPB 3BIWA 3AF2A 3WIEA 1YAHA 3NBZC 2EU8A 2I7VA 4P54A 3GRCA 1LVUA 2H3EA 1I94B 1P19A 1FDWA 2A0XA 4INZA 4FE7A 3AT1A 4LZZA 1UPAA 3KPVA 5BURA 1VE1A 1XNHA 2WA1A 3LKVA 3DHWC 4OYHA 5JXJA 1IBSA 3SP1A 2IOFA 2A92A 4DMRA 2F67A 2JFFA 3WB9A 2VF4X 2GAOA 4OX9Y 1Z4PX 3QIAA 5FTWA 2ATIA 821PA 2AXQA 3CVXA 2CMDA 1USWA 4HDOB 3FH0A 1UK7A 3CX3A 5EXXA 2O1XA 2PRIA 3MQFA 2GXAA 3ETJA 2M98A 3FJOA 3GVCA 3NTUA 1SXJA 2BP7A 2FMIA 2ZSFA 1ECLA 4DNOA 2A9OA 1AKRA 1E3JA 4MLCA 4DLSA 1AOXA 2W70A 4EJ0A 1Q7GA 2EF1A 3PNKA 2F9MA 5LOVF 1QP4A 4UVEA 4D4HA 1R74A 1ZJYA 3FOAA 3E9EA 4U7JA 5FL3A 2X7JA 2QRKA 2XT0A 3NJ4A 5ILGA 4LZAA 1P33A 2B1IA 2OZKA 3F74A 3QIVA 2BEWB 5ALTA 3TKLA 4DBZA 2W93A 1DIHA 4PCVA 5BNIA 1H2XA 5HDBB 1BMTA 1K2VN 5FNZA 2IZ6A 4YASA 3OLXA 2RGNC 1G8JA 3KHSA 1E62A 4EO4A 3L5OA 4ID3A 1DC3A 2K87A 3CF4G 1LBTA 1V6SA 3BH7A 5ELXA 4JLBA 2Z57A 4QOJA 2QJFA 2Q9AA 1F5NA 3H13A 3LH5A 3PPVA 1S2GA 5JALA 4PLZA 3VNSA 4J0CA 1L5VA 2I1WA 3AR9A 1ORWA 1SQ0A 2QVXX 5EZSA 4DLXA 2QAGC 4BVJA 3HB0A 4H6WA 1KERA 5HUHA 1NVGA 4HGOA 1ZW1A 1NRJB 3DEJA 4NV3A 5EIBD 4FDMA 4FYVA 1J0XO 3NG1A 3B36A 3X0DA 4AJLA 3DUFB 2B0CA 2WD7B 3AP3A 4JJ6A 4YRLA 3FHOA 4IZOA 1GSHA 2NM0A 1PZFA 1XLUA 5CVCA 4YREA 4P2GA 2CNLA 3FLMA 1LUAA 4QICA 3E4DA 4TV9A 2RGEA 5H3HA 2UUAB 1H6BA 3QKRB 4BFVA 3AUJB 3FR7A 1FQOA 2YHIB 3UJAA 1PV2A 1KMHB 1SXJE 3K0BA 3A11A 3WDMA 1JB9A 3OQJA 2OGTA 3P2JA 5E6RB 5CYGA 1ABFA 2J9FA 2AQ8A 4R54A 3E9MA 3JQGA 2FEXA 1ADGA 1QQ7A 1R9JA 2ZJZA 3JWEA 1M75A 2NNLD 3OQHA 4OH7A 5T4FA 1K3UB 1XDDA 3TG2A 3EVTA 4L2IB 5AHXA 3NOVA 5DX8A 1P7WA 3U62A 1ZD8A 5K05A 2VRWA 4J91A 2YWGA 3MMSA 4IDHA 1LPBB 1U4SA 2RGDA 5GTDA 4ES6A 4ALLA 2FPLA 3MTAA 2A94A 3ZLJA 3RAGA 3SXPA 3K70B 3BSFA 1XZAA 4FFBA 2CMKA 2RIPA 1WSWA 1U6IA 1IIBA 1EX6A 4K9RA 3T52A 1J70A 4MRSA 4FC6A 4D9BA 1LS1A 1KI1A 2C4HA 3ZXXA 4Y2VA 4DM4A 2CJYA 2IEBA 2Q6VA 2J85A 4MQ5A 5THQA 3U44A 1D9XA 3ESDA 1ZZGA 1LRKA 2AF3C 5G02A 1QIIA 3T3OA 3DDNA 2HZBA 4F1KA 1X7WA 4JD5A 4XJTA 2ZUCA 1Y5RA 4Z4HA 2VHTA 3ZU2A 3AYXB 3AM4A 1LPPA 3VH3A 3RUHA 3LZDA 4BRSA 1DTEA 5GY7A 3WBFA 1JBEA 1V37A 3KQNA 1PYOA 1E2BA 4Z1MA 3DUWA 2ZRMA 2ROQA 4HYTA 3NR2A 3WGKA 1T4CB 2ID9A 2ZRAA 3FPLA 1QX3A 2V7QA 1N6NA 1D03A 1GRCA 1O9BA 1PP4A 1PQPA 1Z33A 2ZUBA 4HLDA 4O3FA 3CLRC 5D87A 4RVGA 4B7UA 1JU9A 3F2IA 4FONA 1R0WA 1TT5B 4NMXB 4PO1A 3K9CA 1TMGE 1FQKA 3C3MA 1D3AA 3O2QB 4E5DA 3DE2X 3SM3A 2QE7D 3A4NA 5KYYA 2PSJA 3OPNA 3VPXA 5D84A 3BHNA 2I99A 4AJJA 4NH0A 4QEKA 3PFCA 2OK8A 2J7KA 1SEVA 2NUTB 5DTIA 2VWHA 5KNDA 1P9RA 4OP3A 1YHZA 1TRHA 1XVVA 3K0CC 1LWNA 4AY5A 2X19A 1P0IA 2QAGA 3U1BA 1XXLA 3QNMA 1ICIA 3K1AB 2ZR7A 3KCNA 4XA8A 1CUWA 1DRWA 4QYMA 5A7FA 1KO4A 1LX7A 2OXTA 4CMHA 5FHQA 3E8MA 1R8JA 1S2MA 1YB7A 2HK9A 4WJZA 1T2FA 4GZ5A 2BGGA 3FTPA 3GJ0A 2ZDHA 1Y7TA 4OJTA 4QRHA 3CJRA 3CLSD 4DVGA 1XA0A 2C9OA 2V98A 4KUGA 1SCIA 1ZGCA 5ALKA 1KK2A 3IJRA 5FL7A 5BRNA 4F3TA 1C7RA 2B9VA 5CYFA 2X5OA 1XX6A 4MXDA 2R79A 3W6UA 1IEQA 1UMDB 5L40A 2CT8A 1KSGA 1IH8A 1K97A 4HLQB 3TBHA 3TX2A 1MVOA 4Z8XA 1EUDB 1F8GA 1ISIA 1GTVA 5C1BA 4C14A 3UFBA 1RKBA 2FRXA 2WRZA 3P97A 5BVGB 3IPRA 3VPGA 2R4UA 2V3VA 2HUNA 2Z5LA 3R9XA 2JIOA 5EP4A 1QFSA 5LP6B 2BCJQ 2CKDA 2N0SA 3H8SA 4QE3A 4R81A 2NU7A 3RS3A 4GVXA 2OQRA 2ODAA 4BQFA 2CLOB 4LDJA 3VU8A 4Q00A 4CMJA 4ZFNA 4OUKX 4AYTA 1KFEB 1JR3E 1JSCA 1WPQA 1I1OA 4HDMB 3LUFA 1FMFA 3L7BA 3SYRA 4BN4A 5IVKA 2DWCA 5JZSA 1WQ3A 1FDSA 2IHJA 2ZS7A 3BRQA 1MB3A 4B09A 4TYYA 2R6FA 2YH2A 2Q9BA 2MTBA 1JDSA 1C8BA 1WW8A 2JASA 1TPYA 5ENDA 3EBPA 1XCGB 2QOEA 1RZ3A 4A0FA 3RYCB 1MUUA 1OILA 2R7MA 3LP6A 4IFIA 4XB2A 5J2TF 2GS9A 3L7DA 4XQ9A 1LK5A 3ORSA 1TADA 3WMFA 1UM8A 2I3AA 4WQMA 3WYBA 4HUQA 3I2HA 4C7KA 2V5UA 1UF9A 4NCAA 2A88A 1Y37A 4GOLD 1N7IA 2A2ZA 3UW3A 2GAAA 2R8BA 4H4CA 4AWXA 2GHQA 3NKVA 1M2NA 2O9JA 4KU4A 2QL6A 3P4XA 4RY2A 5ESXA 3ZY4A 4GLOA 1MD9A 4UW9A 5B7GA 1KVQA 1DQPA 2PLNA 3ETGA 3KJEA 2HXSA 4N03A 1N2XA 1V1MB 3MUNA 4DIKA 4F8JA 3S1LA 8ADHA 4DV4B 2IQIA 1IXSB 2FSFA 4UQPA 4BO1A 1N1DA 2AJLI 3IIJA 2O50A 3C4VA 1YO6A 3R0QA 2LXNA 3LD9A 1UT6A 1N0UA 3EW9A 4J3NA 3TLMA 2FP3A 1HG0A 1TEVA 4JKYA 4NNJA 4E2ZA 2C3UA 4YMSA 1V96A 2W43A 1Z5GA 4F6RB 1A69A 2BM0A 4IIFA 4FJ1A 4LOIA 2JATA 4C20A 2R5FA 1VDMA 2RI0A 1KH3A 4LGMA 1KPHA 3ZCUA 5L8VA 4JT2A 1QIEA 2P2NA 1G3RA 4KB5A 4YEDA 2IWHA 2DGDA 2HA4A 2OYSA 1I7DA 1Z6GA 5BYBA 1KAHA 1RI3A 1W88B 2PM8A 2ZQ5A 5SICE 3RO7A 2BEVA 1KZ9A 3HFJA 1JR4A 4BP9A 1IWBB 4E88A 7MDHA 5BMVF 2Z6VA 3A6FA 1IZ9A 1V8PA 2PN1A 1ARZA 2P9ZA 1CR6A 2R65A 3C3CA 2XTNA 1EDBA 4D8XA 1M6VB 2HR1A 3VU0A 1JG4A 1ZCBA 3MOIA 2G40A 2REBA 4WZZA 3E03A 4B3FX 5M34A 4Y2RA 5LYYA 3DP7A 5FF9A 2KQUA 2FZLA 3N0XA 4O2BB 5C1IA 1XHFA 2YWBA 3IHLA 1BXZA 1Y1LA 1NFQA 1U1DA 2ZJYA 1DX4A 4IJQA 5A9TA 4M0MA 1L5LA 3ROQA 1PSWA 2DULA 1NX9A 1IG0A 1P2UA 3AIMA 4N40A 4BZPA 5GOZA 4UMVA 4RQTA 5AXBA 1XQVA 1YSCA 2B21A 1CJBA 1KO7A 2HADA 2VK8A 3FBWA 5KNBD 4J0DA 1F2TB 1TJ3A 1DAEA 5ALPA 3JWGA 4AZ3B 1RWWA 5DNCA 1A9XB 2VLIA 3DZKA 5D00A 1C0KA 3KJGA 4FFBB 3TSZA 4GPAA 3NVKI 3Q8WA 1GG2A 2YCLA 3MYRA 2OECA 2PUJA 4NBUA 3OT1B 4PGGA 3SHVA 5GIPE 2F1HA 3DJFA 4AJHA 3P5SA 5EP1A 3CO0S 1GR1A 1RKUA 3QVVA 4I4IA 4M6WA 1JMVA 4P08A 3SSOA 2GBIA 3R7SA 1Z26A 4N3BA 3N2EA 3IAUA 2K4MA 2IDJA 2C3PA 1A5SB 2BISA 1FFBA 1K7XB 2BR5A 4DGSA 5AOCA 1HLFA 3EC7A 4X7RA 5JRZA 2RGYA 4KN8A 3ISVA 4MRVA 4EGJA 1WWKA 3CZMA 3D1JA 2OVFA 2SBTA 1DC7A 1Z5ZA 2WWXA 3G8BA 1NMYA 1YRLA 3HKDB 4H1VA 4WZBE 4EA7A 1PZXA 1XGKA 5CDUA 1IOLA 2KYRA 3PQ2A 1ENZA 5LYJF 4HGPA 3UJ3X 1TFRA 2J45A 2SHKA 3GT7A 1KKMA 3M3HA 1F9AA 1QGYA 4DA8A 4PHGA 5CM8B 5EVJA 1AK2A 5ECDA 4CI0B 1JQEA 2AD1A 4MX8A 2J08A 4G0XA 1P4SA 3IDAA 1LI5A 3FUUA 5JDCA 2MSLA 2L82A 1G5TA 3ZBQA 4QM7A 2B8WA 4FXOA 3FRJA 1CHDA 4QGFA 1TC1A 5IN4A 2PKCA 3P0IA 1L5ZA 1N4AA 3QVUA 2WE8A 4RQAA 4UZFA 2FKNA 2VYQA 1WUKS 4LTMA 3TEJA 1H4TA 3E05A 1N7GA 3DDSA 1EM8A 4HDMA 1PZGA 4XFKA 2WF6A 1IXZA 3ONDA 2DPGA 2IEGA 4MVJI 5CBPB 3NHJA 1NOIA 3LG2A 4KVFA 2YNMC 2ZAOA 3GLFA 2REQA 3OCZA 4KNVA 3ZV7A 2C3YA 3FOCA 1MG0A 4INOA 1YD7A 4ISCA 1V25A 2WB2A 4UFOA 2WEKA 5H83A 3ZVRA 3BH0A 2XNJA 3UJ6A 1VG9B 3DV2A 4KGXA 2NZVG 4F3CA 2D06A 1PTJC 1VGRA 2UV8A 3MRTA 4UPVA 5LWHA 2X1HA 2GBCA 1D7AA 3A9TA 3H2BA 3O0DA 4RADA 1KY4A 4Y7CA 3K9FC 3QGMA 1AXEA 4PFQA 3S40A 1JAIA 4ONEA 4B2PA 5EIEA 1LTKA 1X3LA 2CC2A 5LXTF 4BKUA 3D2AA 2YICA 1N0HA 3QI2A 4QWMA 3O8OB 3HXQA 3EXAA 1NF9A 3D0KA 2LW7A 2VDKB 2RGBA 2QN9A 4V2IA 4RL4A 3W5VA 1KAOA 1ZHHA 1GKIA 3D7SA 3NTOA 2VO1A 2V0CA 5I3CA 5IABA 2D2XA 2H2AA 2HIAA 3LYUA 3WAGA 3FCEA 3Q3HA 3OUZA 4J0QA 1N6LA 4K87A 1P4GA 1W6RA 4DSAA 3MS2A 1IULA 2B6NA 2PKXA 1X92A 3AMVA 4WOKA 2IV3A 2O8VA 3FB4A 4C1NA 4CKYA 3FSEA 4BUJA 1OFTA 1Z4IA 4YFVA 1T9BA 1CKEA 8MHTA 4I5FA 3IULA 2F3SA 2A9FA 2ZJ6A 3INGA 2ORVA 2QN1A 4KTTE 4OIMA 3R7BA 3ROGA 1LPOA 4AQYB 3GHYA 3BD8A 4COKA 1ZH6A 5CEJA 4X20A 3UMVA 5DOZA 3NOOA 1XNQB 4QTZA 4TGLA 4DV5B 2AJCA 3SJCA 5DMXA 1J56A 3QFCA 4LNAA 4N7RA 4B8WA 4MWEA 2XSZD 3KD3A 4OQMA 4RNDB 2OKCA 2AFIB 2BFEA 3DZIA 2Y1OA 2GILA 4C78A 3L1KA 3AHJA 1RXYA 1QYWA 2QWXA 2NO0A 1UINA 3FYDA 4AX4A 1P1KA 1QYIA 3RTGA 2F3PA 3RGGA 3I09A 3DFFA 3INNA 3O82A 1T2UA 5DN6D 1DAOA 1HWYA 1LQ2A 3ANTA 1DAKA 4DPKA 3V4OA 4MIEA 3C6KA 5BWBA 3UAVA 1UODA 2JHGA 5AVRA 1DCFA 2CNOA 1DG9A 1A5BB 4ARZA 3QFTA 2OFXA 3BE6A 4L8WB 3U5ZB 1FX1A 1JIIA 1Y8AA 3LWDA 4AG6A 1O95A 3IA2A 4JBWA 5CB8A 3IDZA 3SYLA 4I1PA 1CW2B 2IPLA 2G9VA 3Q5GA 4JR1A 2BPOA 3N3BC 4OXYA 5I9BA 1UKEA 3WJ1A 1Z4OA 1E9BA 2Z5GA 3LLUA 5GOTA 3VO2A 5BXQC 2O8FB 5AKZA 3GLIB 4PX5A 1JHPA 4LYEA 2AOTA 5DPMA 3TZKA 2GXQA 1B3BA 1K5PA 1UJNA 3R0ZA 4ND1A 1T8TA 3H1TA 3JAMA 5IZCA 2H7YA 2QYSA 5MN4A 3EUAA 2GRJA 1A9YA 1N3BA 3I42A 1FDUA 1YR3A 4WINA 1JG7A 4CKEA 3PNOA 1M1YB 4LY6A 3TYXA 3K6SA 4RANA 1G7CA 3AM1A 3MGCA 3F8TA 2WAAA 3KHTA 1QVWA 1NNLA 4EJSA 4BTVA 3LPAA 4K7JA 2JF0A 5CRIA 3NUZA 4JODA 3NVAA 2D0IA 3VR0A 4ZDKA 4R1NA 1PJQA 3OJCA 2XZOA 1DIGA 2R8YA 1NVFA 1RP7A 5AK0A 3SKVA 3SIWA 4PBRA 1TZMA 1E9DA 4TZKA 1DKUA 2BFNA 3N0VA 4I46A 4YJ2F 2BRUA 2PZFA 1B8UA 2B82A 2VSFA 2UYQA 3DFUA 3GQVA 5FWYB 2DHCA 2Z4TA 4FW9A 4G65A 4I3GA 4L02A 1VLHA 4LBZA 5LNK6 3T1YB 4FMDF 2G08A 2P5YA 3CKKA 4QULA 2K2WA 3C5VA 4FINA 1U1FA 2ORWA 4LEIA 4C0JA 3RVRA 1TM7E 4EP1A 4Z7JA 2EKZA 5FDFA 5I7EA 5LYJB 1V4BA 1KGDA 4OB8A 2IZ7A 5IC6A 5IAEA 3WYDA 3TCKA 1XSEA 3EMDA 3WKDA 1MAVA 4WX2B 6PFKA 3KE9A 1W85B 4UMDA 2IYZA 5ALDA 1IZ7A 3I5YA 1UKVY 1ADCA 1P5RA 3NM5A 4UM9D 1T2AA 3T06B 4CV1A 5LQAA 4U7WA 1H94A 3IAFA 1WKCA 4LPSA 1PLJA 3L3BA 1QHEA 1J4AA 2WPDD 4FDAA 3BGDA 2V6FA 1GU0A 3MERA 2VDLB 2V7GA 3D2BA 1WCIA 5CJPA 221PA 4R8RA 1ZNQO 2A9RA 3DC2A 4JLOA 1UC8A 4UNQA 4C5CA 3OIUA 5C18A 5F21A 2IHKA 2HWWA 2ZS9A 1TQ4A 4KFSA 2GGSA 1PKEA 1NNEA 3A6PC 2F00A 2QG4A 1R3UA 3B9RA 1A2OA 2VDJA 2XV1A 2XUQA 3EGDB 4CKZA 3MTIA 1YVEI 1NJ5A 2CL6X 1PR2A 2PXCA 4MUIA 4PSAA 4Y67A 2RHMA 4URZR 4MQMA 3ZQUA 2GM9A 4PQEA 4QDOA 1BVUA 4B31A 4BLUA 1SUEA 1I6WA 5CXSA 3RJ5A 4JXZA 1U80A 1H0SA 3P2EA 4L2IA 4RD3A 2ZYTX 4HF7A 5HJ2A 1CR2A 4DG5A 1SG9A 3N86A 2QU8A 5F1YA 1TYAE 2QLFA 2EC5A 5FT9A 1SUSA 4LGVA 3O38A 3V4SA 4KCGA 1NIPA 3F5QA 3OF3A 4JYBA 1SIWA 4JUBA 3SC6A 3OPVA 3PUKA 1A2BA 4IGAA 3QZUA 4JX8A 5GP1A 3CNOA 2DU8A 2W6OA 1X14A 2J7PA 4YV7A 1VHTA 3H05A 5AM4A 1GPAA 4IDOA 3RVJA 4C0LA 1RLJA 3AIIA 3OURA 4NECA 3NWOA 4Q3BA 2FTKE 1EUCA 2Y1EA 3ZOKA 2P4QA 1EM8B 2ZSAA 4J0KA 1YS2X 4M7WA 1BA2A 2H4JA 3KKQA 3M3PA 1VL6A 2ANCA 2XOKA 3K3PA 4PBTA 2CDAA 3EASA 2HDOA 4WBSA 3VU1A 1UAAA 4TRMA 5T4EA 3EFOA 5JNSA 4BKMA 1A9ZA 2XA9A 4JLSA 2QE6A 4X6LA 3U4CA 2QPAA 3H8WA 1Z3CA 3NHAA 4N1AA 4EJSC 1ND6A 4BQIA 2Q5CA 3HKEB 2XZLA 1AKEA 2OG2A 4NS1A 1ZGJA 3WK9A 3UV3A 1HUQA 1J7JA 1P0CA 1LSJA 2O2SA 4CL0A 1FTNA 3Q72A 3DL7A 3KT0A 1JHDA 4FU0A 1S89A 2HL6A 3IAS1 3UWDA 2XUOA 2BMJA 1K7SN 4I5EA 1OX5A 2ZBFA 3CGGA 4JA2A 4UUMA 7REQA 3OJOA 2CYBA 2FGKA 2OB2A 4XVQA 1MMFB 4ZD6A 5TS3A 3H0EA 1XE3A 3VVMA 3EEOA 4DR7B 1FP7A 4YR9A 1U8YA 3UG7A 4C3UA 3GZ4A 3D0QA 4HX9A 1MJGM 3E3AA 4F1WA 4LGYA 3GLSA 1J99A 1PR5A 4AVYA 1NBIA 4ZT4A 2WB4A 4BASA 1HT2E 3HKBB 5AW4A 1EJ2A 2WINI 3HL0A 5DI3B 4DXAA 4KWCA 2GPSA 4CLRA 2XCRB 3R9XB 2G25A 2BGIA 2DQKA 2NSLA 1G21E 1T6NA 2FA9A 2QY9A 1T36A 2YJ4A 4PHTA 3DNMA 3L0PA 1JN0A 2H29A 3O95A 2XDQB 5DYYA 1ZINA 2E9SA 4RVUA 3RVDA 2ZSJA 3UWOA 2H2DA 2J5XA 1JUDA 5TARA 3QWAA 3GGOA 3FPBA 1V3QE 4DDVA 1IMOA 4QARA 4YRBA 2C4TA 3HYNA 3LLCA 2O8BB 2BBOA 4KACA 3QPVA 3EOZA 1SVWA 3FFWA 4G25A 5CA0F 5DO9A 2Z58A 3C6YA 4R16A 4IIHA 2GAIA 1C8KA 3GXOA 2AD5A 1PR3A 2NU6A 1DUVG 1PK8A 5E3IA 5I8ZA 1Z7GA 1R5NA 2J30A 1FRQA 4HRVA 5K8JB 2IIBA 1X87A 2OCAA 4DJAA 2Q1WA 3T5CA 1QGDA 3K94A 4QSMA 3L01A 1UXKA 4Q3DA 4YQYA 5EQDA 5JARA 2DWUA 2V5VA 3GELA 1ZBQA 4AZ0A 3WSTA 2HPAA 2R8EA 2OGWA 4E6PA 4WUTA 2CV2A 2QM0A 3L8CA 4W1SA 1BXRB 1E64A 5D3MB 4XD2A 1W46A 4YHHB 3BFKA 4U6SA 4YV2A 2HN9A 5IYZB 1WRBA 3PJEA 1U8CB 3N59A 3BF8A 4GBJA 2AUMA 2FZ5A 3G89A 1MH1A 5GQSA 4BE4A 1T0PA 5L9AA 2W6ID 3AIKA 5FOUA 4AMZA 1NBAA 4KWEA 4UC0A 1RBMA 2F8MA 5KREA 3P9PA 4FZJA 1GTG1 1GCAA 1I0IA 3VKWA 4YPOA 4IGFA 1XF9A 4FYHA 3B7PA 5HIMA 2Z8YM 1ZK2A 2VJOA 2AKAB 1AK9A 1OQAA 1H9BA 3ND9A 5AI0A 3S5UA 4LZLA 4WN3A 4M1YA 4C29A 4B3RB 3TMKA 1TQ6A 4EMUA 3U3OA 3RQSA 3JASA 3TQOA 5AFSA 1MIHA 3GY0A 1SHKA 3RU3A 3VPAA 2QQ0A 3EZ6A 5L3SB 5ITVA 1XJCA 5DKFA 3DLTA 5BSMA 2OG1A 5F76A 3U9LA 3QUTA 2HHLA 4B7ZA 2IDMA 3QVSA 3R9KA 1WXQA 2ZRLA 1VBKA 4U2GA 3KELA 1BXGB 1M1YA 4F3YA 4MRPA 5F64A 3UK2A 4F21A 3SC4A 1QH0A 1BU8A 2HQ1A 1G6HA 2VJAA 2P9GA 3I9FA 2BFDB 3EWNA 3DM5A 3GZTB 4AXBA 3L6UA 4Y1RA 5JADA 5DI3A 4IAOA 4KE6A 3A3YA 4O0LA 4V1CB 2ATVA 1R27A 4M98A 1YQXA 1Z8NA 4JJ4A 4KO8A 5C80A 3SF8A 1U4OA 3FDJA 3PWSA 3HCCA 3O26A 4EYKA 1NBEA 3VR6D 1T3ZA 3ASVA 3A9SA 2J5QA 1DWPA 1G2OA 2YN4A 3OUUA 4PCLA 1FW6A 3BRSA 3ENZA 1YCDA 1ONOA 4OB6A 4UQOA 3UXYA 1I6LA 4CETA 4ARAA 2GAJA 3LT2A 2OFOA 3QSGA 2Z3ZA 5BSRA 4F0JA 4JOBA 4B6RA 1FSSA 3EVEA 3PHBE 2M32A 2R7NA 4I5GA 3LCRA 3RIYA 3ZGZA 2IGBA 4DCOA 4KX5A 4IVPA 2IS4A 3QH4A 3TM4A 4JWKA 2O8CB 2Z3WA 2BGMA 4RESA 1RQLA 1SMKA 4HFNA 1E3DA 2MSKA 4YXWD 2H0RA 1EESA 3AHGA 4X95A 4YUVA 3D1LA 1W88A 4O4JA 1WUIS 5ALSA 2IHVA 5JSKA 4IIEA 4NONA 4BUZA 4MVJP 5T4HA 4AMUA 3EGVA 4C4YA 3PHIA 3QWBA 1XZKA 4JH0A 1Y63A 1ZVJA 2JRCA 4X9XA 2A5JA 1W36D 4GEKA 2QRVA 3UQYS 3UKDA 1DQYA 2B92A 3KFXA 4QBKA 4QQNA 1JFFA 4NH4A 3S1AB 5CP8A 1HPLA 1SVMA 1MGPA 4LRSB 1VJRA 2FLVA 1OX6A 2P40A 3EZLA 2OM2A 3N28A 1C1HA 4RYLA 3ND8A 4DV2B 4C03A 2UZ1A 2Z6QA 2JLVA 1UKBA 2WMDA 4GEGA 3MTJA 1Z82A 4DGQA 2C98A 3NRBA 2OUKA 3LL4A 3O83A 1JKFA 3LXMA 3M9LA 4JX9A 4M89A 4ZZ1A 1J5EB 3LVBA 1UPCA 1YGPA 3NIFB 4C4SA 1ZJWA 2XLCA 2HNKA 3E53A 1OWMA 5FPYA 2PBFA 3S2GA 2HSWA 3CN7A 3LSYA 3IDQA 3IE1A 4D82A 3UPTA 5ALQA 4DJJA 4K9QA 5IDYA 5G0UA 3D31A 3BJMA 2H48A 2JI7A 4QJ5A 1P9WA 3JZMA 3PD0A 2EFCB 2J0UA 3F97A 3KJFA 4IQ4A 2GDJA 3ZZ0A 4WBNB 1YA6A 3R5SA 5AVOA 1YS1X 3GGDA 1PJSA 4KLRA 4NKRA 9MHTA 4LRYA 2JGIA 1MOSA 1TOAA 3DHVA 1P3JA 1YACA 1GGMA 3PD7A 3MB8A 5HIIA 3O75A 4LBYA 1U5AA 2H57A 3LF2A 4HXYA 3HCDA 3ZY2A 3VOSA 1UJ2A 3PFKA 5FL7D 2VT2A 2HUPA 2IPXA 3HADA 2JCGA 4NY1A 1MZPA 1I10A 1JIXA 2J4CA 1TVCA 5EN4A 5JCJA 3PGVA 4EO9A 4OQDA 3AB7A 3TQCA 2W2PA 13PKA 5EC8A 3VTAA 4F4HA 5EUBA 4WAUA 4RPKA 3U9TA 1WCXA 3BZWA 4UUOA 4YRGA 2VZ9A 3NBAA 1G20E 3NANA 3ZS8A 5AW0A 4K26A 4AWBA 3C6XA 4RO0A 4RFLA 4PVCA 3O1JC 1P4RA 2VKQA 2GX6A 4HNGA 4U2DA 5D5QA 3L9WA 5LBUA 3USES 1P6XA 5CB4B 5KYNA 1EVQA 1FMCA 1MO4A 3N6XA 3UUEA 2WWIA 4O4LA 4A6EA 1PT8A 3I9MA 3ADCA 1ZH0A 4NBSA 2CLMB 4KXVA 4ZT6A 5REQA 1VBNA 2F1IA 2ECPA 2GLXA 1Z17A 2X3UA 2H2IA 1IWOA 3AC0A 4ZI7A 4QQ8A 3TSYA 3H9QA 1YVRA 2VYVD 1PZNA 3JQBA 3MK31 3OQBA 1DKLA 3KV1A 2JIZA 2RFLA 1JJ7A 1C7QA 2FYTA 1HE5A 1ISSA 2W2KA 2GZ3A 1ZS9A 3DW1X 4FGZA 4HFRA 4NPAA 3WHKA 2AFRA 4CN8A 1I13A 3NVDA 3VGJA 1M1YE 2JHAA 3BIJA 5L7WA 2X8JB 4F5WA 1X39A 4IDNA 4YI3A 5A62A 1QRTA 4ZZ3A 3V8EA 1U3DA 1XEWY 4MKGA 4E15A 1XWIA 1I3MA 5GONA 3BMNB 4EAAA 3D8TA 1JIQA 3KD2A 1U2TA 4L9AA 4ZVTA 3H1FA 3R3YA 1BH2A 1OASA 3IT0A 1KJJA 4EGQA 1A4XA 3A06A 1L7BA 1FU7A 1ODLA 2QRGA 2Q2OA 3H9UA 3GP5A 3IBFA 2AG8A 2GARA 2YWCA 3C7CB 2RHDA 1ULSA 3DSRA 3EG5A 3RU7A 2QUHA 3TWOA 2VF8A 5FFNA 4YX9A 1UJMA 4LJSA 4HWRA 1SK8A 5FB3A 4ENSA 2CVQA 2AN3A 3WQSB 1TVKA 4TROA 3SC2A 4ER0A 2GB4A 2XNDA 2ECFA 3FFTA 2WUDA 1ZOOA 3AONB 4IJWA 5EE3A 2HKIA 2Q6OA 5EIFA 2GAFA 4B87A 1MAUA 3V2HA 1XAJA 4BO9A 3GMSA 3PC6A 1GY8A 2EL7A 2HY7A 4GGOA 4TTIA 5FO1A 1FOEB 4NXNB 2FWRA 1JJBA 1Y4SA 5AK4A 1QJ4A 2ZM6B 1PIWA 2HIGA 3KQUA 3WLMA 4D9IA 2NT4A 4ZK6A 1CEQA 1EWTA 1WEKA 1GAEO 3FZYA 2IY7A 3P52A 2PYIA 1PJRA 4BNIA 3LUPA 4JGBA 3KVOA 4XSHA 3LM8A 1TQ8A 1M8GA 1XB2A 3QMMA 4TV8F 3O21A 4ETNA 1TJPB 3VHXA 2QRJA 4LNUA 2M9MA 3GN2A 3OZRA 3AVVA 3SDBA 3K71B 2AFHB 3SY8A 1MRZA 2A1TR 1N2OA 5M5BA 1L8QA 1SA0A 1XTTA 5FOXA 1TM5E 4XLLA 3ZV6A 1IQUA 2BGLA 4C7JA 4YCMA 3H2ZA 2YC2C 2YUIA 1Z0UA 3HP7A 3CVVA 3HJFA 4MW1A 4KXLA 2PD6A 3DDWA 1ETHA 4ARSA 4JYZA 3HEAA 4MKIA 5IF9A 4DCNA 4WIAA 3G5AA 5TT1A 2OE2A 3AEXA 2VBGA 5DM0A 1TKRA 3QVTA 2O0JA 2XW6A 4OJNA 1V47A 3ZWWA 1F2VA 3K6KA 4YAOA 2J3HA 1G3MA 2VPXA 3DQZA 3O03A 5I9IA 3BKWA 3AI2A 1CG6A 1S3GA 1WZNA 2ZRPA 3E2IA 1PJ8A 4IKPA 4R9NA 1UBUS 4Z8YA 4BLQA 4AAYA 1AGXA 1OZ0A 5K0LA 4JY7A 2FW6A 1VLVA 3JQBC 1WXIA 5HTOA 4MLPA 3G5TA 4IG9A 5LQUA 2YWFA 5LBIA 1RJ9B 3GEPA 2PGLA 4EVRA 5K0JA 4DDKA 1OGIA 2IZ0A 3HABA 1LK0A 2QTZA 3BMCA 4R2HA 1XDGA 1NE2A 2HLDD 5BNFA 4CM4B 4F1JA 3H11B 3MLBA 4LC0A 2GN4A 4N5DA 5CYOA 4XE5A 3TD6A 1J5XA 4U4AA 2CVPA 1NWCA 1QRAA 1RLIA 2A0YA 1NVVQ 5KS2A 4EZIA 4LI3X 4EWLA 2Q27A 1NN0A 1LZKA 2CLLB 1GG8A 4I50F 1HDIA 4MI1A 4Y2SA 4XFJA 1QUEA 4R0NA 2ZSKA 1R0SA 3VBCA 1L6RA 3TTTA 1Z0AA 1NW9B 1NVXQ 5B3LA 2EATA 3FW1A 3V1UA 3U7EB 3N2IA 3V4RA 4ITRC 1ISMA 1W1WA 1H66A 4X41A 4TLCA 1MDBA 1P4HA 1FUEA 3C6ZA 4XI9A 4CR7A 1CFJA 2J1LA 3B12A 3LCVB 4OQ4A 1U7WA 1D09A 1GV1A 3KSRA 4I4LA 5EJIA 1Y9EA 4JLDA 2ESRA 1PEDA 2GHTA 1RLMA 3IC5A 4Q12A 4HNSA 3LVRE 1G3IA 3BDIA 2P62A 1G19A 1GAJA 3H19A 3Q6IA 4O4IF 2GBLC 1UT8A 2ASVA 2ATEA 1P5HA 3TD9A 6REQB 2ECKA 3R6LA 5FWYA 7ABPA 3TVYA 3RW9A 2XYRA 3ZXYA 2PZLA 5A03A 1I32A 4X1YB 4DHWA 1GNQA 1OPRA 1AKWA 4L9RA 4NIMA 1J33A 3ZHBA 2B34A 2BDTA 1EGAA 3AJDA 1N3YA 3IQXA 1L9XA 5COAA 1XYYA 4X54A 2E5FA 2E6KA 4A8HA 4BHTA 3HO8A 3KTFA 2ODNA 5EZYB 3RS0A 3U13A 3AI1A 1ULAA 3C70A 3E23A 4ZCMA 4J7AA 1SZJG 2AL7A 3H6KA 2PZBA 4ALNA 5C2JB 2GN2A 2FAXA 2X58A 1GKKA 4U2KA 2VHWA 3HSSA 2OXCA 3JQAD 3T7TA 1YZTA 1WULS 2YC4C 5B7PA 2I2FA 1JDBB 3GC6A 3CONA 1JLHA 1RYBA 2A5DA 3FWYA 4P36A 2I6GA 2Q4RA 1Y4UA 3ENKA 1ODKA 3EZGA 4HFMA 1ECPA 1MB9A 3EZ9A 4P4UA 5J63A 5AVSA 1PVOA 2IITA 3D9QX 4XYEA 2F9FA 3FGOA 4KITB 1JMYA 1NU6A 1UAGA 1HGXA 1UBHS 4JSTA 4ZO8A 3U40A 4YMLA 1NVDA 4FYJA 1XEWX 1RT9A 3STVA 1B74A 2OAGA 4HEHA 1DAPA 3UYKA 5HQ3A 1ODTC 1IZ8A 2VQFB 4QBTA 4N0DA 2YDYA 4EGFA 1I5RA 3FNIA 3NFYA 3G2OA 4S0XA 3N39C 1C4KA 1FIUA 2YYYA 1FF9A 1AIPA 1UOPA 2XMCA 2CXUA 3MZ0A 1N8TA 1C30A 3NXSA 4DR1B 1G3QA 2C1EA 3Q98A 4E2XA 5KUTA 2O2DA 2OZVA 1CYDA 2D0OB 1INLA 2HBRA 10MHA 2VNAA 2WIAA 3O4FA 4DREA 2WT9A 3L0IB 3KX2A 4AROA 1XLTC 1E2MA 2DUUA 4M9QA 4IVRA 1VQ1A 3EFBA 3LL7A 3F6EX 1PDWA 3CVJA 3IT1A 4EIWA 4YMUA 1KL7A 4WL0A 2XUJA 4EECA 3SIRA 1M8KA 1US8B 4YP5A 2Y0PA 4IJKA 2W98A 3KWJA 4NOKA 1HOTA 2I9KA 2O5EA 1G5PA 3MWEB 3SOZA 4PHCA 2ID8A 3ORHA 1T9GR 3HU1A 4D8TA 1FYXA 2VPZA 3KDAA 3OA0A 4KW7A 3I8XA 4AM8A 1GRRA 2CD7A 3PKIA 1DX9A 1OZAA 3EOAI 1W30A 2HEIA 2MSNA 2HX1A 2DR3A 1N33B 5CHYA 5T8KA 4W6ZA 4D5EA 5DBHX 1SGWA 4OD0A 5ECWA 3PRKE 1CUYA 4JLPA 5IN5A 2PNJA 3OEED 3TINA 1N36B 3SU8A 1L5MA 4RK5A 3HUDA 3WNCA 1UBLS 1CEEA 3TVDA 4EABA 4CFSA 2IH2A 2G28A 4U00A 1XQ1A 4P4GA 1OH7A 2ZIFA 2PCLA 2BM8A 1OJLA 4TT3D 4QYTA 1XZHA 5B37A 2DXIA 1KI7A 3BE8A 3SR0A 2X42A 2QG6A 5KO2A 1S3FA 1YR8A 2G9QA 2GEUA 1S2OA 3FIJA 1RRKA 2MHCA 2Y4NA 1LU9A 1VYTA 2BDUA 3ROFA 4K6GA 4MKFA 3HJNA 4KAAA 1U2DA 3C45A 1QZXA 1YC2A 2AMJA 3CSDA 1V1RA 4BC0A 1DJOA 5IK2A 4ZQBA 1LDNA 2JHPA 3ZC3A 4ISBA 3GO4A 2KI5A 5BV8A 4KKXB 1V0JA 1W73A 4X24A 3L8FA 1E5XA 1T24A 3MTGA 4FLMA 3WYEA 2UZ4A 4GBED 2W5UA 3T34A 4BWFB 2YV1A 3PPWA 2ENWA 1JDUA 4ZOQI 5JE8A 3C1OA 3EVGA 4AJEA 5KTNA 5JAQA 1ODIA 3GFFA 3V1KA 4DLWA 4DS3A 3UHAA 4F97A 2GVNA 4S2EA 2Q3LA 2PRZA 4FEEA 3TQRA 3NT4A 5B55A 5BN1A 1PKXA 3F5FA 2VZEA 4I2VA 3CUWA 3NHKA 4PRZA 4L6IA 1ZBDA 4J2HA 2HIMA 1OHHA 1BJTA 2PT7A 3H9EO 2DFKB 1KQNA 1Q92A 3T9EA 1N0IA 3ASZA 4PPNA 1V8BA 4DMUB 5BUCA 3H9BA 2GZDA 5D85A 2FMFA 2PT5A 5G41A 2JCBA 4LJ7A 1KO8A 1M74A 2RI1A 3QVOA 3EH2A 3ZTWA 1CZOA 3OT5A 4ASUA 3THOA 1HYHA 3SLGA 1Z5UA 2XUFA 4HEJA 5JNWA 2EBFX 1L5YA 2E85A 1Z07A 5JQGA 4TMZA 5LP1A 5HPYB 2ZUUA 3SJUA 1KOJA 5BN5A 1V39A 2I7XA 4RKFA 5DN9A 5EYPB 4DB4A 1W34A 1QRRA 3K0AB 5L6LB 2X0JA 3KFVA 2HXGA 3PUXA 1QR6A 3PI6A 3VH4A 5KJ6A 1H05A 2QTHA 1ZNWA 4R7GA 4YQEA 3P2IA 4TLMB 3TCNA 1ZZEA 5T57A 1OXMA 2XVXA 5MN5A 2A5GA 1JEQB 4W9RA 1EZ1A 3PJGA 1OLXA 2R00A 1Z34A 1LXCA 3NWJA 3O84A 4LE2A 1K7EB 4RD1A 2CDRA 1W96A 4Z51A 3IPYA 2OZLA 2H11A 1WW2A 2PJDA 5C5CA 3QTBA 4D74A 5CB4F 4F92B 5DK6A 1J0EA 3DOJA 1XD2A 1ZM7A 3K20A 4I9FA 2QGZA 4EG0A 4ND2A 3SPXA 2ZE5A 3OCUA 1ODFA 2ZS8A 5E0OA 2DHDA 1Y6ZA 3IT2A 5A2QA 1L8AA 4Z3OA 2XXAA 4IDBA 1SXQA 3L18A 4B79A 4D9CA 4JC5A 1R1DA 5EY5B 4RDIA 5HSGA 2O4UX 4IFEA 4H16A 3LO8A 4LQLA 4JJEA 3VH2A 3DTVA 1YHNA 3LQKA 1N5JA 3A6GA 4RGVA 4QECA 1CY4A 3BD9A 2HJRA 4XARA 1IN8A 3FCOA 5AHRA 5K6AA 3VKHA 5TDHA 1ZESA 3LZ6A 5F7XA 4ENUA 3ABOB 2PH3A 3IIMA 3KR9A 3OG9A 4EMSA 4D26A 3WMWA 1EA7A 3OOJA 1T2EA 2Q1TA 1T6YA 3H2SA 2J0SA 1C80A 3JZFA 4UJ3A 5AI4A 4OPMA 5HS6A 1Y34E 3LOPA 3SX4A 1PJCA 3H87A 5KX5A 4IHQA 2G5GX 1USUA 4RPLA 4ER6A 2YYSA 1N8KA 2I34A 1T5SA 1XCJA 4WMLA 5H0IA 2V7PA 3ZU6A 5C4GB 1M0WA 1GZDA 2PU7A 1N3LA 3BIFA 4UXJA 4GD3Q 1MC5A 2XCTB 4Q7QA 2A67A 1WBBA 3I92A 1TA9A 4NHOA 4YUYA 1F2UA 4GBMA 3RT9A 4CG1A 3ZDEA 3ITKA 5K0ZA 3ZDBA 2JVJA 1MGOA 1T5HX 2OXFA 2II6A 2C7BA 4UUNA 3RUCA 1Z0SA 5HCIA 4NQZA 5EMJA 3AHEA 1HNWB 4BTEA 4ZOBA 3FXAA 2C78A 3OZFA 3S7TA 1D04A 3BTOA 4TKUA 1D2HA 4D57A 4HAYA 5ER6A 1LZLA 3NXKA 4BEVA 2BDEA 1NDHA 1BA3A 1JXAA 1QV6A 1Y3HA 4JJKA 4MQLA 2RG1A 4JP1A 1N0VC 5BNZA 4A36A 3PI7A 1O94A 4RF5A 4TRNA 3F46A 3WISA 3X1WA 5JH7F 5E7MA 4U7DA 2QJWA 1BTOA 4HLUA 3PFFA 5TPWB 1UXOA 3BZUA 3K9GA 3CB2A 4IDAA 3BSWA 3L1UA 3BWBA 5DTEA 4B75A 1P5FA 2OPBA 3MFYA 3FTFA 4MQBA 2GJ8A 2C4WA 1G2PA 4PYRA 1PJ2A 2VXCA 2HA7A 3WA7A 4ZIRB 1XA3A 4I3FA 2HNAA 4B84A 2EIHA 3CB4A 3W2EA 3I73A 2VZLA 3UJ9A 3BT7A 2YL2A 3HNPA 2Y9PB 2XE6A 3LGSA 3RC7A 1IPHA 1NQOA 1XJ5A 1CQIA 1ZM2A 3BVPA 4RDCA 5T3YA 3FLBA 4MHSA 4S12A 3WGLA 2F8TA 5EMLA 2JB9A 5D8DA 9LDTA 1UWKA 2WWYA 4H6PA 4KHPB 3R5TA 5IBRA 3LNTA 1MB2A 2V7QD 3DEHA 2LP4Y 3ZWDA 1OLUB 1WL8A 1TM4E 1M1UA 1Z62A 4UHCA 1RPJA 3BMOA 3TAXA 4EG3A 4J03A 4RX1A 5G2OA 3RC2A 1NUSA 1SVNA 4Q4CA 5I5GA 4QIHA 1PEAA 4L0CA 5F78A 4G1BA 1KY2A 3Q7PA 5COQA 3UMJA 3SJ7A 5TF4A 3OEHA 4K9KA 2VDVE 3WLFA 3M34A 4R05A 1VIAA 1ECBA 3I3SR 4EHNA 2FSPA 3QEMA 1TT7A 1KI6B 3MAGA 5MHTA 4RAQA 1CJVC 1QGOA 2V7TA 3UXEA 1OCEA 2HRDA 4EEKA 2CE7A 3R4CA 2A58A 4QHYA 1YUBA 1TEHA 1EJ0A 1ZMTA 1QIJA 3KQTA 4CU5A 5FQNA 3LFTA 4E07A 1RRFA 3D3WB 3W4KA 4LSWA 1UC4B 2WHRA 1P45A 5DM1A 3W5IA 2QP9X 4BS9A 2PRYA 4DLKA 3TECE 3BMNA 2E2WA 1DC8A 4YMVA 5K4GA 3B5JA 4FDUA 3WLPA 1PHRA 4R83A 4FZ3A 4TQUS 4WPGA 3ELUA 4PXYA 4KR2A 2AG1A 1GPH1 3ZXSA 1LBEA 2AFHA 5K6TA 3HEBA 2PUBA 2RBGA 5CYPA 2WYUA 3OC0A 4BBJA 4O3MA 4C4AA 2CL0X 3PWZA 1KI3A 2RDMA 5HYVA 1RADA 3RYCA 1EUYA 3KUUA 4BCCA 1LNQA 2X1MA 4UMFA 1L8LA 4Q9KA 2HWUA 4AMBA 1PQWA 3LUDA 3W7AA 1AUVA 1JR6A 4H3VA 2P30A 2IOQA 4CM9A 3UFXB 1HTTA 3PSAA 3O3OB 3OQ1A 4BVFA 5KHLB 1J2TA 2V6BA 2X3FA 4F11A 1NQ5A 5KNDH 5LU8A 1O94C 1OT3A 1P0PA 2JFHA 3FPEA 3TE6A 1R88A 3H7IA 1E9SA 2C1ZA 4E5SA 2H1HA 5LLDA 3KVNA 2ZZMA 2BM1A 1G17A 5H70A 4BO6A 2ECOA 5AVVA 4EGSA 3MIIA 5T67A 3PC7A 1HQKA 3PR3A 3SFZA 1TYBE 1XTRA 1MNAA 2VWGA 4MW5A 3ZKWA 3W1WA 1M33A 2IU4A 1YB6A 1R12A 1QOZA 2YRWA 4M6WB 5HXAA 5EHZA 2RGCA 4C2TA 1JILA 3AVWA 2LIPA 3G1UA 3IS3A 4KYTA 3K9NA 4NV0A 1IZ0A 1QONA 3R41A 5F5LA 4EL0A 1C9EA 2CCJA 5I5EA 3LRPA 4B3MB 1ULHA 3OPYI 3ILYA 3TIXB 3BMOB 4XVUA 3OU6A 2OC9A 4BNZA 2PQ6A 2AZMA 2WAOA 2WDPA 4P3YA 2DTXA 1VBMA 1URPA 4M83A 5F1PA 1XQXA 2WIBA 4EELA 3TZCA 1JHRA 1XDWA 4RJJA 5LQMA 5FA5A 3EGOA 2C7GA 1RI5A 2FCRA 2VP4A 4P4SB 5GWXA 3QELA 4JUIA 4RIGA 1VGVA 3KP1A 4MUXA 5I7UA 2DECA 4F4CA 1PBNA 4RZSA 2CHGA 4LF8B 1OXBB 1JXMA 4CGZA 2MSDB 4U0JA 3KQOA 3PQFA 4NZZA 3PL5A 3SEFA 5DHTA 4I36A 4AW9A 1QPGA 3QMPA 1JIJA 2BSAA 5IM4F 3MELA 4HAWA 3HY6A 4UKDA 4JLVA 1LJ8A 4P4NA 4MA5A 5MFZA 1Z6ZA 1J2YA 3CNLA 3D5EA 1VP9A 2AOUA 5GGXA 2WD9A 5JD6A 2ORYA 4ZQEA 1Q3HA 4B3BA 2YHSA 2GM4A 3X1MA 1LDBA 3WWPA 2YHIA 1NE7A 3DCIA 1ZN7A 1TNDA 5H16A 4CTJA 4HR7A 2J3QA 1LGYA 1RQ7A 2VSOA 2BTQB 1BMDA 4RKWA 3F8SA 4MQFB 5E2BA 3WGYA 1EFAA 1BU5A 3VJLA 4F2PA 3G0BA 3Q3EA 3V4PB 3C24A 1GA6A 1KHTA 1W87A 5JC8A 2IH4A 1TW2A 5LQJA 3DLBA 4XYGA 4OXQA 2J8ZA 1J8MF 1PQYA 2XF2A 1X9HA 3UFXA 2E1RA 3GGJA 1COWD 1SCUB 4E11A 2REXB 1H8HA 3V8MA 1QQ6A 4E5MA 4F2WA 2Z6AA 7MHTA 1II9A 3LNCA 2IEDA 3H1EA 5FNVB 1W0KA 1HF3A 1L7OA 3MNFA 3A2MA 2YFHA 3OEYA 2H7XA 4PG6A 4X66B 3VNUA 3GI1A 3SAJA 1KVTA 2P4UA 2OV6A 1BIFA 3N0TA 4O4IA 4YALA 3P5BA 4GGPA 1X74A 1QTRA 4WZAB 4JK3A 5G0TA 1EGQA 4IQFA 1V8OA 2WWVD 4EA9A 5JXIA 1B3RA 3LVQE 4IUBS 4IP0A 3ZR4B 1ACMA 4WFIA 1P6QA 1VDZA 1HA3A 2YJGA 1BWRA 4JBGA 1NY5A 1K1EA 5FBVB 2IHUA 4AJIA 4LSZA 5CA0B 2UYCA 2Y2UA 4JT9A 3DPSA 5F3RA 3WRYA 3UKOA 1OY1A 4C7OA 1Q91A 2QTTA 1OXUA 2JZOA 3L04A 5TQ0B 2D54A 4N7JA 1Z29A 1HDGO 1M7BA 2PD4A 3F71A 3Q7SA 1J24A 2JEZA 2ZWIA 4BNDA 4ERNA 5A7GA 2CMHA 5LFAA 5EG5A 2ALJA 3FYCA 1U1CA 1EWVA 4KMOA 3UAGA 2Q8NA 1T3TA 4KI0A 5DHQA 3RVMA 4B85A 3RWMB 1DRKA 3LI2A 4OHFA 3MJ4A 2XAUA 2EARA 2PS9A 1SVUA 3DE7X 2X14A 4JLJA 3ZWNA 1T6XA 1MC8A 2OM6A 4BBAA 1IWPB 5IJ0A 1MB0A 1A8PA 4L5YA 2X9LA 1N92A 2QM8A 1E2QA 4PRLA 5KNCA 4AN0A 3EXHA 1QDEA 1QGUA 4G85A 4FR2A 4R1QA 1YL6A 3OLZA 2RGGA 4V39A 2E4VA 4WLNA 3AVQA 4GI5A 2BGKA 4RKQA 3RAFC 4FWBA 2CUNA 1DIOB 2YCBA 3IAEA 3IPAA 5FOWA 3WK7A 2XYQA 1KI9A 3JX9A 1OTHA 2OPHA 1XRQA 2HB6A 2WJAA 3RYFB 1I7NA 4JHXA 2YZKA 1PWXA 4DDHA 1SUBA 1JFTA 1GUYA 4R2LA 4OJKA 4HL6A 1Q95A 3I1JA 3LLVA 5TE9A 1E4VA 2O0MA 2BFBA 2P68A 3L07A 3OCJA 1XJ0A 2OB1A 3ANXA 4Q0MA 3IQDB 3GYGA 2NGRA 5FV7A 1A4RA 4C7MA 2COEA 2G5TA 4YDQA 3N76A 4M49A 4GKVA 1XFDA 3TGLA 4OXKA 3I53A 1UXIA 2V6GA 1FSFA 3PR2B 1GUZA 1MVNA 1K66A 1GPDG 4I2NA 1EFTA 4K9OA 1KAEA 3Q8LA 2QRLA 2XCOA 2XMDA 2Y76A 4C4OA 5GVRA 4IDEA 5AW7A 4KN9S 1PG5A 1B23P 2ZQYA 2YXEA 3N70A 3TJZA 3GQBA 4JVOA 2ZSEA 1LQTA 2VYFA 3GJ8A 4WOBA 4CMEA 4E3ZA 2ZT7A 1JHMA 3TTUA 2EVWX 3C3BA 3Q6MA 1RE0A 2XRZA 1E79A 1Q0QA 2J3LA 3K30A 3GDGA 4RPJA 4DV6B 1T0JB 3AR6A 4RLQA 4PLGA 5JNUA 2GFHA 2VR1A 3EG9B 4X8HA 1YZ3A 5DGXA 3UATA 3GDFA 1E58A 2XUKA 4KSBA 1NOJA 2P9YA 2QM7A 2EJTA 2W2NA 3UK7A 4BNTA 3V6LA 1C8VB 2JBAB 4JI6B 2JI6A 3EZYA 3PXXA 4OHPA 3U4QB 1PL7A 1RLUA 3EXFA 4UPEA 1KP2A 1D0SA 3I8SA 4IG4A 1W4AA 4D3ZA 3VRHA 4R3UC 4TLBA 4LNHA 1KH2A 4FDLA 5FAXA 1E63A 2IPOA 2FFHA 2AUTA 2PUHA 4OUDB 1O5TA 2CVHA 2WWTA 3HMQA 3NRCA 3GV0A 1PL0A 4PAWA 3W90A 5KSOA 1E4EA 3T9FA 4YQZA 4W5QA 5AUPB 4S05A 5JCOC 1X9GA 1AQIA 2CF5A 5IC4A 1IBKB 5BY2A 3A9CA 1PFKA 5BT9A 3GUZA 4UTPA 1A27A 3MJRA 2ZU6A 3EFOB 4PG4A 1J0AA 4FPXA 2DUMA 4WY5A 3NEAA 5C8YB 1QYRA 1T8UA 3ZQKA 3EODA 3HPRA 1J8FA 3GXBA 4Q15A 1NI4B 3IPCA 1OBHA 4UNSA 2AOTB 5IASA 4JUDX 5CA0A 4FB5A 2BEWA 4IGIA 3NYRA 4CCYA 1E6UA 2OD2A 4R31A 4KXFB 4L4YA 4ZRDA 1NAIA 4CG2A 4TWJA 2BZ0A 2W8ZA 1L5HB 4RGBA 3SF0A 4CIDA 3N8DA 1TPZA 1QO9A 3DZJA 4G5XA 4LYDA 4XQEA 5BVGA 2BFFA 4IVNA 1AGPA 3ZN2A 4X7MA 4KWHA 4JB3A 3EBOA 5JEDA 3BJRA 3DOFA 3MJDA 1MA3A 1X13A 1K75A 2GLUA 2I54A 3B8HA 1LFAA 4RTRA 3I9JA 4DCSA 3ZU3A 4LJ8A 4RXUA 5HZHA 3TNYA 5BYKA 3BXFA 3IUSA 4WASA 5YASA 5DCYA 1ZX1A 1ORHA 3HH8A 4V0SA 4HNHA 3DZDA 4PIPA 3AEYA 4YO8A 3I30X 5BUSA 2PKQP 3OHPA 2EJBA 2AI3A 2X8JA 5HJ5A 4LCBA 2WYOA 4S1PA 1HQDA 4XX0B 3G9XA 1DWUA 2DJ5A 1UBJS 1IXKA 2F17A 1NIJA 3GFVA 4YAKA 4GSYA 4IQ8A 5KSPA 1LKZA 1O5OA 2DY1A 3RRYA 3MILA 4JMLA 5BORA 3T7DA 3JAWB 1P7VA 2G71A 1IUKA 2IOFK 4D0LB 3I9V6 4Q7KA 2H7VA 3T5DA 2KWIA 4YLGA 3IERA 3KLOA 3U3RA 2WT8A 3BQMB 1XTIA 1D07A 1UPUA 3UBTA 1OIWA 2AMVA 3BCHA 2XB6A 3E8XA 1UADA 2GTPA 2VP3A 3FUCA 3Q7EA 4KV7A 1K5HA 5LQSA 2FPIB 3LIPA 4ZVKA 1LBSA 1XWWA 4QG3A 4CEHB 4CM6A 3F6RA 1XROA 2ZGVA 3OESA 1BROA 1SOWA 2P2LA 1GG5A 1O5IA 4O4HA 4KQ1A