1C2TA

New insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
209
structure length
209
Chain Sequence
MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE
publication title New insights into inhibitor design from the crystal structure and NMR studies of Escherichia coli GAR transformylase in complex with beta-GAR and 10-formyl-5,8,10-trideazafolic acid.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 68
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 1999-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1c2tA00
4ZYZA 4ZYTA 4YFVA 1ZLXA 3GARA 3KCQA 4IQFA 4EW1A 1GRCA 2CFIA 1JKXA 1C3EA 4EW3A 3Q0IA 3O1LA 1RC1A 4ZZ0A 3NRBA 3AV3A 2GARA 2BLNA 1C2TA 3OBIA 4QPCA 1RBZA 5CJJA 1CDEA 2BW0A 1MEOA 3W7BA 3DCJA 4R8VA 4Q12A 1NJSA 4DS3A 4ZYXA 1S3IA 5J9FA 4S1NA 4QPDA 1ZLYA 4EW2A 1ZGHA 3TQQA 1RBYA 1FMTA 4TTSA 2FMTA 3R8XA 1RBQA 4ZZ3A 4ZYVA 1GARA 4YFYA 3P9XA 3DA8A 1MEJA 4TS4A 1RC0A 4ZYWA 4PZUA 3AUFA 4NV1A 1CDDA 5J63A 1YRWA 3N0VA 4ZYUA 1MENA 3LOUA 4ZYYA 2YWRA 1RBMA 4ZZ1A 3TQRA 4ZZ2A 4TT8A
chains in the Genus database with same CATH superfamily
1C9JA 1KS2A 1M8GA 5JANA 3WGJA 2CLSA 4ND2A 3W0LB 3DEYX 4AM8A 2P9YA 3C3MA 2WD7B 1RI4A 3UUFA 2PMKA 1QTQA 1LS6A 3RIHA 3GGJA 4LHEA 1S2NA 3HCWA 4XQCA 2JHGA 5HQJA 2EG9A 1IZ7A 3QFFA 2JAHA 2DF8A 5ICEA 3TDNA 3LY7A 4NEHB 4IINA 4UARA 2FE4A 3CN9A 5G02A 3ZNQA 3QWBA 5AQ1A 1XPOA 4LMAA 3HDTA 1WCV1 1BRTA 3ILHA 3OQ6A 4PC1A 3H2BA 3W8DA 3T9BA 3ZJ5A 1W88A 9LDBA 4ZT2A 2FK8A 3DOCA 2W2KA 4LNUB 3H4TA 2PQ2A 3JQFA 2QTVB 3UK0A 1F7VA 4FR0A 3ZH9B 1U8XX 2BF7A 3O90A 4AZ3A 1EK0A 1WMAA 1B26A 3R3UA 3BK2A 1CJUC 2BHRA 5BQ3A 4ALJA 4ZCMA 3PNKA 4R81A 3IOMA 1Z16A 1ZD8A 3U1TA 1H69A 1UBUS 2ZI7A 4UVGA 2WYHA 3EHDA 5AKHA 2XKAA 4HUQA 4TS1A 4URUR 1GGKA 1HETA 1JWBB 2ET6A 4ZKDA 1W85B 3FB4A 1WKVA 3B9PA 3M6XA 5SY9A 4YO7A 4DLSA 1WXEA 2FAXA 1CR1A 1ECBA 2DWCA 5SYAA 1USUA 4C0JA 3H8JA 2AZTA 2BFPA 2XE6A 4I08A 1BVRA 4GLBA 3B3AA 3OT4A 4DV3B 1BJKA 3B78A 2QOEA 1WMBA 1X3LA 3OPMA 3R6TA 4NZNA 4ZQHA 3KYIB 4WN9A 2GBCA 4TN1A 3UAXA 5I7SA 1GCOA 2HMUA 4HPXB 4RTLA 1EE1A 4ZT6A 5KMGB 4DL9A 4BX9A 1GQ2A 3LWDA 3WLRA 3EEBA 1C1DB 1DKQA 1E59A 1GVNB 3NWOA 2X8AA 1K7XB 1YUBA 3EWIA 5JEDA 1HSZA 2FPGB 1DKLA 2JGFA 3R6WA 4MVJD 1OKKD 2EBUA 4G5HA 1O6BA 4P54A 4AJ1A 4K8RB 4L5YA 2C7VA 1SK9A 2JD2A 2HCJB 5KYUA 2RHLA 1I7QB 1AT1A 1SKQA 5A5EA 4KPUA 4I81A 1IMOA 1PG2A 2BMEA 3P0JA 2XMRA 5I3CA 3K0HA 4PX2A 3TL3A 1DGQA 1IG3A 4HL6A 2ZVPX 2B4AA 4BGDA 1RC0A 2AI1A 3OZTA 5KREA 5BR8B 5FAKA 5HRCA 5G53C 5TPZD 1EGAA 1SUCA 1XALA 3BEDA 3KOMA 1GQRA 2X0RA 3SS7X 3GLHE 4FC6A 1KAOA 2C3MA 1XCMA 3Q9UA 4S12A 5DI9A 2Y1GA 3FWZA 3L1IA 4CHGA 4N9QA 4HPWA 3ZCVA 3FF4A 4RA6A 2B9EA 3U0BA 4CQNA 1PQPA 1CJBA 3EJ6A 3N0VA 2O2YA 1LI5A 4X60A 4BB0A 3BE4A 2G36A 3C3KA 1XO1A 6GPBA 3BCRA 4XASA 4EL5A 4EP1A 1ISRA 1CB7A 1UJNA 1RAFA 4FFBB 1USVA 2ECPA 3OY7A 5JSYA 3FCOA 4U2FA 3SICE 1NVKA 3B7WA 2O7QA 3GRCA 3PD7A 4QPZA 4DMRA 5TQ2B 4LRUA 3TTSA 5FBRB 4D8WA 1M5RA 1KRWA 2JIPA 4HB4A 2FUG1 5ICSA 3ESAA 2AFIB 5BW5A 3GEGA 2VQ3A 2D62A 3BJMA 1ZLXA 3AR4A 1YULA 1H6DA 3EEYA 4BX3A 3ETDA 3GNSA 5LKRA 4NYJR 2J0VA 2VK4A 8ATCA 3LYLA 1PGQA 4KACA 4PG7A 5FHRA 1QRSA 3GPLA 2V7EA 1Y82A 3A58B 4D0RA 3LD9A 4KCGA 1JLSA 1Z56C 2DYKA 3P0EA 5AK0A 4PHFA 1XEXA 3LYUA 3L6UA 1LLDA 1PR4A 1SOUA 4PXSA 3D59A 2V0NA 2G28A 3BWMA 4IMPA 5FLKA 3GG9A 3HBAA 1AF7A 2ZI6A 3I1JA 3K0CC 4OGFA 4QEZA 1HYBA 1NV8A 1V1MB 3H1BA 1XVTA 3DZCA 3ROMA 4PQRA 2J32A 4RKRA 4LY0A 4XPZA 3AV3A 1NSTA 3R7SA 4NJMA 5K2MA 3D6MA 2II6A 5L3RA 1PNTA 1WSWA 2IY8A 3OWXA 2BEVA 1K5HA 4X20B 3TGPA 3VU3A 1XDWA 4LRYA 3BMCA 3T35A 3C1OA 1IEQA 3NVAA 4R2MA 3DFUA 3NKVA 2L0XA 4G65A 2MYUA 3GRPA 3UAZA 4AWBA 4RUKA 3LE8A 4Z6KA 3OD5A 5B12A 3QNUA 4B2IA 4Q9DA 1ZVMA 3V32A 5CIWA 2FUEA 5KYXB 1NQAO 3OJCA 2R5FA 4DKJA 3EN0A 3N1UA 2GJAA 1L9XA 3IBCA 4FFLA 1SC3A 2JCVA 5C35A 1HNXB 4RY9A 1Q3HA 4UPDA 3CH6A 3PA8A 2G1AA 1S8AA 1SC6A 4XIGS 4EHFA 2PYZA 4WCFC 1XXHA 4PQFA 2C7RA 3RRMA 2P9BA 2I34A 2QA5A 2Q3DA 2V74B 4E2FA 3HCAA 4YCAA 5BORA 3TPFA 3A6DA 4MR8B 5FFNA 4AJ2A 1RBQA 5K2OA 1IEXA 3LHIA 4B5KA 1XAJA 5CEFA 1J99A 1SRRA 3QKUA 1QNLA 1RKVA 1N3LA 3K9NA 4II2A 1DO2A 2ADMA 4EG6A 2JH8A 3QMWA 4L6IA 4F2WA 3AL2A 5CA0A 3IEVA 1E7QA 2FSGA 4QICA 3U7RA 3W34A 4CMJA 4PPYA 5DHTA 2QTRA 3KOWA 4YRTA 5T4FA 3RS2A 2WIBA 4N8DA 4ER3A 3GAMA 4QE3A 5BUQA 1K5GA 4CF5A 4PAOA 2JGRA 4NU8X 4P8RA 4RAOA 5E95A 3RUDA 2H9YA 4DR2B 3IIEA 3F67A 4HH3C 2VPPA 3GDOA 1SMKA 3ZWMA 5KQGA 1M10A 1PL0A 3NTLA 4LY3A 5HS4A 3II6X 4QEKA 1TVCA 2H59A 2JFZA 2OFOA 3SDZA 5EXTA 1GFSA 5CTAA 4D79A 4EENA 5CITA 3R7LA 4PR0A 3H2JA 4M7PA 3TIXB 4AQDA 1VLMA 1W2GA 2HIAA 3B5JA 4HQFA 3OEHD 4MVJG 2IJGX 2PZKA 4Q3KA 5DCUA 5TVKA 4KN8A 3S2SA 1Y3FE 2DT8A 1I6LA 2XLCA 3C6BA 1RHQA 3LFUA 3M83A 5SZHB 4CKZA 3SOZA 3B5IA 2I99A 3GLVA 3JATA 2IZ0A 5EERA 4AJOA 1ENPA 2I1LA 3RJTA 1IEWA 1NVTA 1AS3A 4W5JA 1DBWA 1V41E 2G88A 5EWLB 4ZYZA 2R68A 1GR1A 1RP1A 3QXXA 1L5OA 5E3IA 3SHOA 5EJ7A 1TT5A 3AY7A 3PNPA 4X44A 4Y6QA 3TSCA 4OFZA 4DAOA 2OVBA 3OE1A 1EESA 2H00A 3PIRA 1RCUA 1XWWA 3AB8A 3HBNA 1YASA 3KV1A 4QNRA 4RD0A 1ORDA 3KT8A 4D4HA 1OB2A 2NYRA 3KNZA 1C1XA 5JZMA 1DRWA 5DHPA 5T67A 1CU1A 4M8KA 3QIAA 4H6XA 1LBHA 5AVOA 3FIUA 3NBMA 1JR3E 1MVLA 1W73A 1G2IA 3CX3A 4RANA 4B83A 4YR9A 3AFGA 4CLRB 4GDFA 4DMHA 3ST7A 2VHYA 3NRBA 2VLIA 3VH4A 5TRTA 1NMXA 4MLZA 4V0KA 4JNCA 4M21A 2GUGA 3OCYA 1MHTA 3D3WA 4D26A 3PQ3A 5CYFA 5DF1A 1QH9A 3IODA 4RLSA 3WLQA 5L4SA 2CDBA 4EPYA 1LBSA 3LS2A 1ISJA 5EQFA 2GKOA 4CKCB 4FLFA 1UJCA 1XYYA 5IC5A 3EXEB 5JVDB 4OI1A 3WL4A 3WOHA 1U3TA 2YWBA 3EXIA 3M5PA 4MS3A 2BGIA 1N2JA 2EJVA 1WOYA 4FHCA 1SCIA 4JEIA 4MKHA 5CA0F 2PUJA 1EJ2A 4CL0A 2NTVA 2HLDA 1OXSC 1GQOA 1YQXA 1ZMRA 2H07A 5ULLA 1NP6A 3I3SR 4HNRA 1CY0A 3EAQA 2RGAA 5AYVA 3NAQA 5FOQA 3TB6A 1II8B 1O1YA 5ALRA 2BH2A 2PSEA 1O5IA 2BT4A 2VP6A 1NL3A 3ILXA 4DEVA 5B7NA 3L93A 4M9XA 5F7XA 3CG4A 2P6OA 2E87A 1IAVA 2YW2A 3A6LA 2H5JA 3QPDA 4U2CA 1M34B 3OSZA 3T3HA 3UG7A 4UTVA 3KQNA 4JI2B 2B1QA 4OG2A 2WJWA 4IJ6A 3VO8A 1V3QE 1JA1A 3O6VA 1W34A 4F5DA 1BDHA 2NN3C 4U2DA 3UANA 1G5HA 2BF4A 2C82A 4JU9A 2AUNA 5LQJA 1N2IA 2AOVA 3KD3A 4P82A 1ATZA 3K2IA 3BB3A 2D0OB 4H7IA 1HTWA 1L7RA 1N0HA 2Z2YA 1LV7A 1QHHA 3LY8A 4ME6A 1JH8A 3F4KA 3VDMA 3KYDB 1ZXBA 3H2KA 3R6GA 4IIHA 3D4LA 5CP8A 4MI6A 3U7EB 1W5BA 1JTFA 4ZYWA 5AWFC 2P4QA 1DX6A 4URWR 3PEUA 3D5QA 4WZZA 2JZCA 1AK9A 3MMZA 2AFHA 5COAA 4C7BA 1T2EA 1GSIA 2B4RO 1RMQA 3VC2A 3G2LA 1PFKA 4H0CA 4YMWA 3MBIA 4YS6A 1T9AA 5LQUA 3CZRA 3PK0A 3QUSA 1J0EA 1C8KA 1G8GA 2XCUA 3FOCA 4J4HA 3TVYA 4AURA 5J63A 1ZI6A 4F1KA 4L5IA 4ZEXA 1PEKE 3KLPX 6Q21A 5H7XA 2VHCA 3URMA 3EVGA 1IOZA 1WSDA 4K88A 1YT5A 1J5PA 3CRNA 1ZBQA 5HR5A 3X2FA 1TEZA 1BEUB 3RS0A 5KWVA 4TKZA 4L0DA 4P5DA 5DSTA 3ZJUA 3I6YA 2CY0A 2W2XA 3FTNA 1KI3A 3HMQA 2VSFA 4OTZA 2DWPA 1T25A 1YF3A 1N4DA 3HA7A 4F2PA 4FOPA 3MS4A 1RAAA 2XUPA 2VNKA 1ESEA 1XTJA 2C2KA 3M8KA 4WKNA 4L9AA 4KQ2A 3FSEA 3PHLA 1AGXA 5DHFA 5DTEA 1SKYB 2O8EA 4EW6A 4KRXA 2Z4TA 3PDHA 5JD4A 4P6VF 3IQXA 1CSEE 1C4XA 1GPLA 1YWGO 1ZJ6A 5LU9A 4AB1A 1P8JA 3CNBA 3RREA 3BE5A 5K3AA 1GZSA 1MB9A 2I6XA 5KX5A 2O2ZA 4HAIA 2YCLA 3COZA 3HDYA 2IQ5A 2CLLB 5C34B 4MJXA 3E3MA 2ENUA 1N2SA 3E7XA 1I3MA 2C9CA 4PN7A 1VKNA 1E5DA 2FWBA 4Y1RB 2HBYA 3THWA 1R0CA 3ICWA 2CVZA 1QPBA 1DJMA 1NVXQ 4QPNA 2PNFA 2HYIC 1MQ8B 3KQTA 4KN5A 1RRMA 3EHEA 3RHSA 4G89A 4MW7A 1SK8A 5KU1A 2CW5A 4ZQCB 4A6DA 1EJ6A 1FZTA 2GCOB 2QRPA 3HJBA 4P33A 4UUAA 5K3CA 4MAFA 5KTOA 1E20A 2CJPA 1NRXA 3DD5A 1O3YA 4BWGA 5L3QA 5CIYA 5BOVA 5LOVB 2GEBA 3Q85A 2GD1O 2ID8A 4CCYB 1YI1A 1VCOA 2PQ0A 2ZSKA 4IEFB 4JX9A 3UV7A 4DQUA 3OZXA 4AUKA 1DG3A 2JCYA 3JYLA 2R751 3BTUA 3L1JA 2F00A 3MEQA 4PRLA 3TRFA 3GYBA 2UXDB 1TTPB 2UYGA 4KB5A 4POOA 5JLJA 3QRWA 5TV2A 5TC4A 3VPFA 4EELA 5IMSA 1U5BA 1X7WA 2PSHA 1I1OA 2IEGA 1VJGA 2XZDA 1N33B 3D31A 1WU8A 1P61B 4B4VA 5JDCC 4YPOA 4DA4A 4MVJP 2PX4A 1W52X 3OQVA 5DV9A 2P2LA 3FNEA 5DYGA 2XYRA 4WKOA 2PIDA 4DR4B 5EJ5A 4BEJA 4ZKEA 3OFND 1U0JA 3OX1A 1FLAA 2VL7A 3DPIA 3W1WA 1VBFA 2PJRA 1QP7A 5DTQA 1Q0QA 1P7YA 1GPNA 3ORYA 4I19A 4KXQA 5KCZA 3C39A 2WIDA 3JV7A 4AKHA 5AUOB 1I8TA 2OGUA 1Z5PA 2H51A 3ZWPA 3HI4A 1X15A 2QU8A 1FDWA 2PUDA 1ABFA 3D3EA 4BLWA 2RFLA 3N0XA 2TMDA 4IGAA 1QQ5A 3DHEA 3ZHYA 2GR9A 3C3EA 3DA8A 4J7AA 4JUBA 1FU8A 2RHDA 1TFUA 1JIVA 1D4OA 1T6NA 2O7SA 1C0KA 2WM2A 3COVA 2Y1OA 2BZ0A 2WB4A 3ILSA 1THGA 1JHQA 3P96A 3Q6IA 4DLZA 5EIEA 1N8KA 1WB6A 2G5PA 2HK9A 4GVPA 3RT1A 4ZYLA 2ZAGA 1DLIA 4Y0VA 4P58A 3G0OA 4C2TA 1OX6A 4O08A 3C0KA 4MWEA 3LDAA 2QGZA 2X8WA 2XAUA 2WHXA 4KNVA 3TLAA 2PO7A 3GP8A 2GUWA 4LHYA 1YIOA 2NO9A 4G5QA 2IHKA 3MT9A 3TLJA 3ZWWA 4HPJB 4DGSA 4A23A 4ZCSA 3TUIC 5KX5F 1I3NA 2NGRA 3R9WA 4G63A 2D1SA 2NX2A 4CG0A 2MSNA 2R1VA 3ZOZA 3QG5A 1EZ4A 3LVBA 1AKTA 3EQ9A 3KVOA 1ZM7A 3R2JA 3LC1O 1Z08A 4EF6A 3B1ZA 4YJGA 5L3ZA 1JFFA 2HLDD 2VSQA 4IRXA 5EJIA 3RSSA 3OLXA 4Q7QA 1KEEB 3QHAA 3W06A 2YIVX 2BBOA 2IOQA 4EG4A 1CUGA 1GL7A 1A4XA 1M0TA 5HKOA 3QFHA 3DQPA 2K7FA 1WJGA 1HBJA 2ZS9A 4XWTA 5HIIA 3OZIA 3M6IA 1TADA 5F64A 1OWPA 3LHKA 4YP9A 4ARVA 4DSTA 2MSWA 4PLWA 1ZD1A 4FB5A 2PT6A 3HU3A 1LW6E 2OXCA 4I4CA 2HRBA 1YVEI 3DMHA 1PK7A 3JQEA 4Q48A 1ZWLA 1SM4A 1HFWA 1J20A 1MIHA 1XLUA 1RHUA 2EX0A 2FDXA 3WHPA 4BVLA 2PH1A 3CVJA 3BAZA 2XCSB 1GGVA 2QP3A 1P7VA 2HK8A 1ZHOA 2NZWA 2HFKA 2VJPA 3UKDA 1YTLA 1YB7A 2C42A 3MTJA 3IQEA 3QU5A 2VHUA 4MK4A 1HXHA 2XNCA 1Z6XA 4N41A 2ZT6A 4W63A 2AK2A 2HQRA 3LLSA 1KDYA 4D8UA 4WEQA 4C4SA 3HY4A 4EBFA 2EDAA 2X14A 1BMTA 3VTZA 4FE3A 1TJPB 3VR2A 5L7WA 1KQGA 1I7DA 1HNNA 1TA4A 2G83A 2QXYA 3A9UA 2KJQA 1OAKA 1Z68A 1VL0A 3FUUA 3PL5A 5U4QA 3QUQA 3N7UA 3OMWA 3H05A 3RTGA 3SX0A 1DUIA 4NE9A 4U02A 1NOKA 4FS3A 3RFXA 4KBGA 3HKEB 1GTL1 4XIFA 4X7PA 3VYSB 2VJCA 3MAAC 3IB6A 2DQSA 4LTMA 4Q9HA 2W2VA 5KSPA 4YPVA 4MRRA 4AJNA 2VP2A 4GLLA 1E2MA 3TWOA 2X13A 5ICFA 5HGJA 3OP4A 1GU1A 2MDTA 3QIVA 2XE7A 3EXG2 4LHXA 4ASUA 1F38A 4EARA 1COWD 5JSQA 3Q41A 4JXZA 2XMGA 2JGLA 3SYLA 2AD5A 2BGRA 1B0PA 2NW6A 1W581 3KPUA 3MOGA 3JX9A 2BMWA 3G5LA 3HN6A 4H9GA 1BKSB 1JX6A 5KVAA 3FOZA 1H4QA 2HWWA 1ECCA 1SA0A 2VRWA 3LQ2A 3NLLA 5JS2A 2GZAA 1HDEA 2EJUA 4UUOA 3BQNB 1GKYA 4IDFA 1UWCA 2ATVA 4WDRA 4P81A 4EFLA 3MHTA 3BH6A 3NHRA 4JBGA 1ZNWA 1KZGB 4ZVVA 5IKEA 4L4XA 1TTTA 5K05A 3FG9A 1FSZA 4H4CA 4DIBA 4YDQA 2IH4A 1TPZA 1Y3DE 5GM1A 4LE1A 3G8YA 3LCUA 3L9XA 5E38A 1G8JA 3SJ7A 4I1PA 9ABPA 1T5TA 3S68A 5LQSA 4EB0A 1MORA 2R85A 2YIMA 1VSTA 2ZRIA 3CYFA 3GRRA 5EMMA 3V7FA 2BR4A 4UE2A 1IZYA 2JI6A 3I04A 1FFCA 1QCCA 2GXQA 3GLHA 1USKA 3T4PA 3FDZB 5GONB 1Q77A 1O95C 1RQXA 4YH1A 1VJDA 1JDZA 5TB5A 2FNAA 2QWXA 3DOFA 1SBHA 3IDFA 4N7RA 3ZZTA 3TOSA 4DCCA 1JEOA 3AP2A 1JB1A 4MICA 5KYYB 3CY6A 1LK7A 3C6QA 1Z36A 4R68A 5DTIA 4Z7OB 3LDUA 1D2EA 5JSUA 4EUKA 1BYUA 5BURA 1RHJA 3PQCA 3RRNA 1Q11A 2HMWA 2ZTVA 2IX9A 4L7VA 1SCQA 4MYHA 1QKKA 3AUSA 4BFYA 1JI3A 1I7PA 3NIDB 4WTOA 2I3GA 1F2VA 5F21A 2I1QA 4JFAA 3DOEA 4M83A 4XB1A 5DRYA 4URVR 4K9KA 1P2VA 2XTJA 4NCHA 5CFRA 5J2TB 4MWTA 2HRDA 1XTRA 4CMBA 4RM3A 3H2HA 1DAHA 1THMA 1Z7GA 2G5CA 2X3FA 3OTGA 3UB4A 1NASA 1IJBA 3KZMA 2RJ3A 5ENVA 3TIFA 1QHEA 4HK4A 4BNKA 1M34E 2IUYA 4KFSA 5F2EA 3RIGA 1BROA 3SDSA 4FYKA 3JWIA 4NG4A 4Q3OA 4BRZA 1D1PA 1YRYE 1UBFA 3F47A 2L19A 3WRWA 3DBOB 1FDUA 4DWJA 1E79A 1VQ1A 4AMVA 2JI9A 2Z4SA 5BVHB 5G0TA 2XDYA 3N8GA 4LYGA 1TUBA 2VJAA 3K0CA 2OCBA 1M2VA 2YH2A 3CSUA 4PZEA 2HDNB 5EZ5A 2VZEA 2O7VA 1ORHA 1DT3A 1W9HA 1WZEA 3OM8A 3STHA 3KOUA 4E5KA 1LV8A 3K2QA 3U3JA 1EB9A 2P8SA 2WWTA 3LRXA 4PZLA 3ZZNA 4RPJA 4F9GA 2X5NA 1AQJA 2R96A 3O8QB 3ROZA 5L8VA 1VIVA 4GGPA 4MGZR 4R1PA 2AS0A 4L5JA 4U2BA 4IDOA 1TD1A 3NOOA 3R7AA 3TGWA 5DGCA 5SZIA 2VPYA 3B6JA 13PKA 1ZD2P 3FUXA 2A94A 1WO8A 3ISVA 5SY6A 1KZHA 1E3QA 5IHPA 2O3SA 4EABA 4S1OA 4WA8A 2NXJA 5KOJA 1CQIA 4XD7D 4RSGA 4IO0A 3NIGB 1GKIA 3CLSC 5ALLA 2QVLA 3RIEA 2A30A 4BVKA 1VLQA 1IB6A 2GAAA 1JQLB 1CUYA 1XT6A 3EEQA 3NAGA 1QGUA 4PXYA 1JLLB 2WIJA 1GGHA 4ZAFA 3T9DA 3A7EA 2Z9BA 1D2CA 3D1JA 3PXEA 4LMRA 1ORTA 5AW5A 1LEHA 4M9QA 4DMMA 3ABZA 4KPYA 1U31A 2ZBVA 1YJ5A 3HDJA 3HNPA 2ZIVB 1T8PA 3ITNA 5EE5B 3SJAA 3U4AA 1GL6A 3SNHA 4BNUA 2OHHA 3OZAA 1D8TA 3C6XA 4MQ5A 4HLUC 1N25A 1LBEA 1L7PA 5CB4A 1FF9A 2FN3A 4WCFA 3ZDDA 1C8BA 1ZVQA 2VT2A 1K3UB 4P3NA 5L3VA 3T5PA 1X1RA 3GUVA 4MCJA 5DFAA 2R1TB 2D7JA 5IUJC 4EJ2A 4QYWA 1ZVVA 4YO8A 3C3BA 5IDWA 3VI4B 4I4IA 1JIQA 3SXUA 2NSHA 3Q8LA 2P67A 2NP7A 4YMIA 5KSWB 2ZJ8A 1Z47A 3WK8A 3KE8A 5FL3A 3VMMA 3W2EA 4CCSA 2CWWA 2XMDA 2ZSIA 4MPPA 2WZBA 4BNXA 2WP8J 3ISTA 4K03A 1NJ1A 4W4TA 1DOHA 2J0UA 2W58A 4IR7A 1X39A 1V4BA 2FPIA 3TZKA 3SYNA 4URZR 2IF2A 3UPDA 3WMFA 2I80A 4GHWA 3RAGA 2O50A 5BSWA 5DNUA 5K0SA 3W5CA 1N8SA 3NM6B 4AY2A 3ENKA 4ISBA 1WZCA 2I65A 3A9CA 1TW2A 2H65A 3N8DA 4UZFA 4DC1A 4HNTA 5LWHA 5JJIA 1E9AA 1N57A 1OJ7A 4KI7A 1NP7A 2VHWA 2ISCA 1RWOA 2ODWA 2OT3B 2UVQA 4RSMA 4AJEA 1JVSA 3FFWA 4HMQA 2XNDA 4P3PA 3O8OA 2J3LA 3HP4A 4YGYA 1L7AA 1APBA 1JIJA 2J6CA 3THYB 2VXYA 3MRTA 4YMGA 1T5BA 4LNHA 3U1BA 3AHCA 3ZXYA 1YNOA 5JZOA 5IDYA 4QXQA 2E4WA 3BQ9A 3D3JA 3RC9A 5KS2A 2CLMB 2ZYWX 3RHZA 1M2EA 5J4VA 1CDZA 3MJDA 1W1IA 2CNBA 4EB3A 2HF2A 4HZUA 2KQUA 4BS9A 3DZGA 4FFNA 2DLCX 2ODNA 1UH5A 4Q1BA 3H7AA 3KJEA 3SF8A 2OV8A 3TOCA 1G20B 3H6GA 3KE9A 1D09A 4DV2B 5FOTA 3ZDCA 3W4IA 1IOVA 1GQFA 4DPLA 1M73E 1R8XA 2RGEA 4I3FA 1PL7A 1GZ5A 4NHEA 3T12A 2QN8A 2PVPA 3K5PA 1UOPA 1WNTA 3RFVA 4IIFA 4IICA 4OXRA 4QQRA 3C14C 3X1MA 3KEGA 5HIJA 4D3SA 1OR8A 3KHUA 5E8JA 2NVBA 2A4KA 1F0PA 3CGWA 1GPKA 4W5WA 5EYPA 2VUUA 2YDXA 2YHIB 1IDN1 5FPSA 1KWKA 3TLGA 1PR6A 1QTIA 2BLNA 3KJHA 3K9CA 1N4AA 1BN7A 4WFJA 5E4YA 5IFKA 5CB4F 4QTUB 4ZDIA 1COZA 3JQPA 1SBYA 2GF9A 2JZOA 4OP3A 2XTAA 3O9ZA 3MIIA 3VZDA 3T5MA 1UPUA 4TZTA 3VR5H 4A8HA 3DFMA 1ZK2A 4JLJA 4JJGA 4MYRA 4QQKA 1H0SA 3GA0A 5ESXA 4HAXA 2ZE6A 2WSSA 3NC4A 4MVXA 3WK4A 4OUKX 1T26A 2DY0A 4OQZA 4P3KA 4XFJA 3VISA 1V26A 3COPA 1MDFA 3WB2A 1CD5A 1HE1C 3CW2A 5JZVA 2DR2A 1R6DA 1UDAA 4FWTA 3L7MA 2DJIA 2OGWA 2YXEA 3DVAA 2NU9A 2ZGVA 3G0DA 3I1FA 4JFRA 4LC0A 3S8MA 5F23A 4IUDS 4RTQA 2X4DA 4NI5A 2HF9A 5TARA 4L4ZA 3CNNA 1U8CB 1U04A 1W4RA 1Z73A 4ER7A 4DV0B 1W0JD 4NWIA 1D03A 3G0GA 1EWVA 2MYPA 4EPRA 1GCIA 2C0QA 2V6BA 2BWJA 2O4CA 4Y98A 4XJSA 4MGIR 1TMKA 3O3OB 2CHQA 3HV0A 5EE0A 2ZJFA 3H2IA 1QVVA 3ROGA 4I5FA 2D0IA 4NOMA 3SEZA 2X9GA 3NAZA 3TLXA 1SVLA 5I5EA 3I04M 1SIBE 4P7KA 3BPSA 5GVRA 4JAVC 4QPJC 2W11A 2WTXA 2WD7A 2C04A 3HLKA 1ZG3A 5KVCA 3OCXA 1EXVA 4V2UA 2GCNA 2H52A 4EAAA 4C4ZA 1W25A 4JZKA 4TLEA 2IV2X 2H4YA 5JASA 1Z7BA 5EHIA 4B2PA 1CPYA 5MHTA 4BC1A 4Z4HA 1HNZB 1FXUA 2YXBA 3DKRA 3AVVA 1OFUX 1Y4AE 3D8TA 4U3JB 4JASB 2GWHA 3ORSA 4KG7A 4LNUA 2QTVA 5H0IA 2D2IA 3HB1A 1VZ3A 4KNWA 2RSLA 4JI5B 3N2KA 3VUEA 4E46A 5IF9A 1CF4A 1YIAA 2RHCA 2W48A 1IUKA 2BR3A 2XXBA 3LT1A 3EOZA 3NBUA 2IBSA 1ZH8A 2BPOA 2XGJA 1N3BA 2O0JA 2JFHA 1Y7LA 1J8MF 2GYVA 4ESHA 1U9YA 2VQFB 1KMHB 3I0MA 1N1GA 4UBOA 4C3OB 4DSOA 2I6UA 1QLJA 3I5AA 1W85A 2FEXA 1PLJA 4M1EA 4KWHA 1PQWA 3WMEA 3UQZA 4NJEB 2QM0A 1UFKA 1E5LA 1W87A 1EGHA 2CNOA 2R6FA 3UXMA 3WB0A 1LQ2A 2WKSA 3NVKI 5CH5A 3HC7A 1ESNA 3C41J 1I2CA 4ZANA 5A03A 5B5SA 3CJQA 2CNWD 5E7QA 1E2QA 3B1JA 3EDOA 2QV0A 5KMGA 3V8RA 1AKWA 1C1DA 3HDQA 4IILA 4J0EA 1GJRA 2I0FA 4RDCA 3RWMB 3ROQA 1A76A 1X1BA 2A0KA 2ASVA 2VDWB 1C4KA 1ZYUA 3OZFA 1EUQA 4IIEA 1MDBA 1NU6A 2Y05A 4V02A 4GKKB 5AM4A 2B3DA 1QBKC 2YJ5A 5CNIA 3N58A 3A3NA 4DCJA 1I1QB 1B16A 3NONA 1OASA 1QUEA 2LVBA 2Y0BA 2GZHA 3FPKA 1SUDA 5E4TA 5JSHA 1V0JA 2EIHA 4N0EA 1PNVA 1CUSA 1U94A 1QAOA 2SKDA 1JF8A 3D6TB 3L79A 1A5TA 1QZZA 1IXSB 4Q9IA 3A3OA 2JIBA 2GM4A 4AP5A 4AN1A 3I2HA 1MOSA 3UPTA 3NBFA 3MJ4A 3BCUA 4RADA 5JAUA 1Q44A 1RKUA 3FE2A 1QYXA 3HXQA 1M6HA 1T2NA 3WGZA 4BQNA 3QVJA 3BFJA 4WOJA 3ASZA 3AR2A 3V34A 3AIIA 5KDDA 4OI0A 5LNK6 1GVHA 1W46A 1A8IA 2JAOA 4TS3A 4ZPXA 4BWVA 5GINE 2GAIA 3FN4A 4NS4A 4EHIA 3GT3A 4Z0NA 4FFBA 4Q7LA 2WHQA 5K0TA 4KDRA 4KP7A 4DREA 1Q20A 1YAHA 1NIPA 1PR0A 2IW1A 3MBOA 1GL9B 4OQYA 5TQ2A 4DLXA 2DQYA 2WYIA 1NMZA 1K6IA 1UFVA 3ZYZA 2XOEA 1G63A 1PU2A 2AFIA 1EH5A 3DWGA 5CFMA 5JDCA 2ZZKA 4ZQIA 1YK0A 4I1VA 3A9WA 1CTQA 5IC6A 4EY5A 1J9EA 1CY8A 2O2JA 2NUPB 4W8HA 4KRFA 2OORA 4RYDA 3OCZA 1QQAA 1D0VA 4XM2A 3DNPA 1YB1A 3MGCA 4COOA 3ZIAA 3G1TA 3R3SA 2QZPA 3JARB 1HE4A 1R1DA 2CUNA 3M89A 3DVRX 4L22A 4BLTA 1I0ZA 4D9EA 1KWGA 4TKUB 2W2MA 4YV1A 4D8VA 1BXZA 1GDDA 2WVAA 3HG7A 4K9QA 2ADFA 5LQMA 2D7CA 2CHFA 1MF7A 4RTMA 1V1MA 4LHWA 4DF3A 1FEZA 3GAZA 3T1OA 1L4BA 2CNNA 2H5IA 3LBIA 4C6HA 4JQOA 3WYFA 2GERA 3U9LA 4DR6B 3AHGA 3UWPA 2GQ0A 3MQ4A 1E6LA 4BFZA 5COBA 3C3DA 2UAGA 5A0FA 4X20A 4XVHA 3FOBA 3PXDA 5ALQA 2G5TA 1J5XA 2CNDA 1WXGA 2ZIZA 1M7BA 1E6CA 1UDWA 4G1MB 2O8BB 2YWCA 4JP1A 5ILGA 4CG2A 1UK9A 4UHFA 1B1CA 3R3VA 4MCAA 3UBMA 3H7IA 1EZ1A 3W3AA 5KYXA 1P2BA 4BNFA 1HMPA 1I33A 5IUNC 2AKEA 1T8YA 2JA2A 1T91A 3KHTA 4LHSA 1I94B 2V9PA 4MKGA 3FNHA 4WMLA 2K87A 3B52X 2XRYA 4FBLA 2IZ1A 1OZ0A 2PT5A 2CVPA 4GPTA 3OMLA 1XP8A 1H2HA 1C3OA 1VP9A 3HJGA 3D6UA 3INGA 3M2PA 3PHIA 4JVSB 4KO8A 4QOHA 2NO5A 1XTSA 1N5LA 2ZQYA 1BGVA 4FHFA 2OCKA 2TMGA 2GH1A 2BKVA 3K8OE 4I9UA 3ZDZB 4DADA 1UPBA 3C5CA 3V1NA 3VMFA 5EIXA 2HV8A 4X8OA 3BZWA 4MR8A 4NOJA 5BW4A 1K8ZB 4YK7A 3ZWKA 2PGJA 4PLCA 4CLHA 2CV2A 2W6JA 1RU3A 3JZMA 1MVNA 2B30A 4A2WA 3OZVA 2WLSA 4B2LA 1GD1O 3B2EA 4OB7A 4C7XA 4XEUA 3HKDB 5HS6A 4AMYA 1G2PA 1R18A 1YS1X 2FJPA 3OPYI 2PUWA 4M8NE 4YI5A 1MH9A 3WNVA 2HIHA 4OU5A 4PYQA 3GV0A 1X13A 1OBHA 3CC8A 3WYNA 2MSCB 3DM9B 2XT0A 1NPYA 2Z6VA 5CVJA 3BIFA 5EESA 4M0EA 3D2BA 3K9GA 4HRYA 4BNNA 2JCXA 4P7FA 4B2YA 3BSYA 5K8IA 5AHKA 4CM9D 3PGJA 4WDQA 2B6HA 4Z3KA 3HADA 4PG5A 3GEPA 3V3KA 4B71A 3RIYA 2BFFB 4GX0A 5GVSA 1IBRA 4QJBA 3PQ7A 4ARSA 4JR2A 4RY2A 3K70D 4CLXA 3PUYA 3H83A 1NYRA 1NTRA 4YECA 3WTCA 2OFXA 1OQAA 1ESMA 1P62B 1T6YA 3GFSA 3UOAB 3DP7A 3FCCA 4H1VA 5JCJA 4EY8A 2C7QA 1F48A 2FPRA 5HOQA 4MVCA 1RJFA 3D8HA 4KR7A 2WWGA 2PSDA 2Z8ZA 5KTTA 1OW3B 1POXA 3CXRA 4EG8A 2JLCA 2CCJA 3IL2A 3SMQA 1Y8ZA 3I42A 3NEAA 2VH2A 3PTZA 3E3AA 5K7SA 1U3GA 3LSTA 4PQEA 5THKA 5ELMA 2L18A 1XN4A 5ENZA 1GLNA 5A02A 2H4WA 3PPIA 4RPLA 4ZQBA 1Y9AA 2J4FA 3SHVA 5EWLA 3SY8A 4ECAA 2DRIA 2F1IA 4RPGA 2ERYA 2QW0X 4ZYVA 4IOKA 4IFBA 3CUTA 3A1NA 2PDAA 2R47A 5ITWA 2ONKA 1AMNA 4H6WA 2OE2A 4TWJA 4UD2A 1MPTA 2NVUA 4YY3B 4G0WA 1TJ5A 2HU2A 2GDZA 1FFEA 3P9RA 5KWEA 1WR8A 2VSOA 1XA3A 4MW9A 4XAQA 2CUKA 3LLCA 4MRVA 3VR3A 4OXXA 1M6EX 3DMDA 1LGYA 3C5VA 4D4KA 1RADA 4HGZA 1XZ8A 3MT8A 3ML1A 4CLRA 3TTYA 5IT5A 2J0QA 2I55A 2R1ZA 3QVGB 2SNIE 3L02A 1XTQA 2H48A 5CYOA 3T7AA 4CL2A 3FTPA 1UBRS 3RBAA 1PE0A 3DOUA 1EEXB 5DNCA 4J07A 3WGTA 1H9CA 4TKLA 3Q0TA 1KZ4A 4LXHA 4C2BA 3DLPX 4TL8A 4ZFNA 4NV0A 3LLUA 1RWKA 1O95A 1JZSA 2J5RA 2WNIA 3ACDA 1EX9A 3EXEA 3DWIA 3FY4A 3QJYA 4ZVOA 2UZ0A 5HDBB 5JVDA 3V1KA 1TKCA 3ZDEA 3B89A 2JAPA 3G13A 3GT7A 4NBRA 2EZUA 3BXZA 3BD7A 3L07A 4RS3A 3ZHOA 8MHTA 2F3QA 3BJRA 3DHVA 1CF9A 3OU6A 1IM8A 5K0JA 2AT1A 1BS9A 4HNHA 1MAAA 1X86B 1UK7A 4LX0A 3R3ZA 5D01A 3IIIA 2Q4DA 1II8A 2HK7A 4X1KB 5JYBA 4ITUA 1G7RA 2EERA 3QXHA 4BBAA 1RD4A 2W2LA 4LISA 3BRQA 4TWBA 2DHRA 1WVGA 3OWHA 4DJ5X 2PPVA 2A67A 4W9NC 2BCEA 1U2SA 3AESB 1M34A 3GFPA 1A4IA 2A78A 2EIXA 2V97A 1WTAA 2I2CA 1G4UR 4MWBA 3AF5A 3L7BA 4IH1A 4EK9A 3KVYA 3KWLA 3D4OA 5A2QA 5JCZA 1RI5A 4ZICA 1DTEA 3EW7A 3NZEA 4RMJA 5ALOA 2IC5A 4ZEMA 1OI3A 4QRDA 4LOLA 1Y9JA 4MWDA 1KQPA 2O3QA 2GPBA 3E53A 3TKLA 4LRXA 1EM6A 3EZYA 4B8ZA 8ADHA 2DB3A 3KYDA 2FOIA 4BLUA 2XUQA 3WLJA 4CCAA 2CB9A 3EIFA 5EZYB 1VKOA 1R0XA 1TZCA 3GW8A 4CMCA 2H16A 2Y1CA 4L8WB 1FJ2A 1FSFA 1EWYA 5I9MA 2O2HA 2OFFA 1ZIPA 4G5RA 1EG2A 2XAAA 1HDCA 2C9MA 5H82A 4KXLA 2LKDA 2XUDA 2BEWA 4X84A 3A05A 4LJ5A 3L7KA 1E18A 4PTZA 2WTUA 3CA8A 3WG9A 3FKSD 4OK5A 1VECA 2BM0A 5JYCA 5CK5A 2V8BA 4BMSA 2M6KA 3VTKA 4DHWA 5C8YA 1KO1A 2DVMA 3HWRA 5IBRA 1V35A 5EKTA 5FULA 3AR8A 2DQKA 3WL6A 2QE6A 3C8HA 2X4LA 1OA0A 1RM4A 3B8HA 5J2UA 5C3MA 5KQPA 1PEDA 2HMAA 2I4RA 5JVDF 3IH5A 5K8JB 3EGDB 4M1SA 3SQOA 2O20A 4JKIA 2F1OA 3WSTA 2V7PA 1ZC3A 2FSUA 5TVGA 5I7EA 2PKXA 3K8QA 4HLUA 1L7DA 4FFRA 4W7SA 3QG1A 3U4MA 3CVVA 1Z6YA 3CLTC 3GLKA 2JHPA 4Q00A 4Q1EA 4I46A 2YINC 2JLQA 4RV9A 2IOYA 2XBLA 2GK4A 3SC6A 3NCTA 1G4HA 2YS7A 1HA3A 3O2JA 4MRAA 2ABWA 4G5SA 3AJAA 2AK3A 3PX3A 2GN8A 4TMVA 3ZCQA 4HOYA 2ZYSA 4UVDA 4JI7B 1KKUA 1W1UA 4WZAB 2OESA 4HSGA 1W30A 3H8VA 1Q16A 4Y1RA 3T3EA 2ZIUB 3DGFC 3U7FB 3T7TA 3SQWA 3KJNA 3F97A 3FBTA 1BHQ1 1JSXA 3CRQA 2FSSA 3NC0C 4RCZA 1MT0A 1C29B 4GS5A 2EYQA 5I7WA 3OUTA 1JHDA 2AI3A 2GCOA 4NONA 1A71A 4KLZA 4YWHA 1LLQA 1EPUA 1VPDA 2RGXA 1L5YA 2HI0A 4I6GA 2CZQA 4JCOA 1VBMA 4PLZA 3W5AA 1RZUA 1Y3HA 4OXYA 4P1ZA 2Z2KA 3MXOA 1DXYA 5LOVA 4FE4A 4ND4A 5BOSB 1XF1A 4M1TA 4RMHA 4CCYA 3ZYCA 1J0AA 3I4LA 4OKSA 2BMAA 3AT1A 3L0DA 2VO1A 4M55A 3GUYA 3ZI7A 1WTCA 2ZIEA 2ZI4A 4JT9A 2Q1TA 1S2GA 1U1EA 3AB7A 3DQZA 1KORA 3IC5A 1QK3A 4FZRA 4R6WA 1DX9A 2VN8A 4HH4A 1M2JA 3KZNA 1A5BB 3O4RA 4NYIR 3ETHA 3R3YA 4TQGA 1E4EB 1IHXA 4W5HA 3SJCA 2H1RA 2I4TA 4UUPA 3MCZA 2OGSA 2AG0A 3UWSA 4P22A 2QD2A 5C8YF 2DOKA 3WAJA 2FUCA 1KC3A 1R8JA 1U6IA 1XEFA 4AECA 2XJ4A 1BVYF 1VYTA 2WYWA 3PU6A 5MF6A 1WF6A 3T3NA 3AUAA 2EBWA 1QFZA 1T29A 2JD0A 1AB6A 2UZ1B 4PVCA 5J2UF 4MKXA 3SK0A 1DBIA 2QN1A 2GZRA 1Z5OA 4J0KA 4XX1A 2J48A 1XAIA 4N12A 4R1QA 5CHYA 5CYPA 5EKXA 4Z4GA 5KI6A 1A9XB 5AXAA 3ZHVA 4OHOA 3KEQA 4KN6A 2B69A 5A5FA 1PI3A 2QUKA 4R69A 4XWKA 1FUEA 3AILA 3CKYA 3IRUA 1S6YA 5ER6A 1LFAA 3DCJA 2OQVA 3GUUA 5CCXA 3MK31 1AXEA 2HT6A 3P5BA 1CNFA 3PXXA 3SCZA 2YASA 4WY5A 3F6CA 5GZ6A 1R9MA 3R5SA 1O95D 4RQBA 4JT2A 1DKUA 4I66A 4Q4HB 2O4UX 1ZFNA 4B7AA 5HDQA 3LGSA 2FUNB 3P2IA 1X8KA 3ZE7A 4WN3A 4ARCA 4L7QA 2M6LA 4DLLA 1Z83A 3ZDXB 4BJ6A 5K3SA 2QEQA 3DH0A 4DNFA 3PITA 3IEKA 4B6JA 1UC4B 5DM70 1I3OA 4FGLA 1KEEA 4RX1A 1SHLA 3IKTA 1IJKA 1VG1A 2FDCA 1U3WA 4GLFA 1BQ4A 2PLFA 3ZTTA 4XARA 1YB6A 4FSHA 4LK3A 3I12A 2C3YA 1OYYA 2PZGA 2ZBDA 4K6KA 1NE2A 1OVGA 1Z38A 2DM6A 2NPIA 3I6MA 4PN3A 5BR1A 1RWMA 2FWIA 2VQ6A 5KAPA 3TIIA 1D6MA 3Q7TA 4F84A 2OENG 2Q6OA 4ENVA 5HKKA 4YFYA 4NMMA 4KBFA 3CE6A 1W59A 1P80A 3CH4B 1W6UA 2G4CA 2OV3A 3L8ZA 4RK7A 3BL8A 5TE9A 4EGSA 1UK8A 2IPNA 2FEOA 5B1EA 3TRJA 3EDYA 5JMOA 2XEXA 2V9CA 4JUCA 1EHIA 3GDGA 3WTBA 2AMYA 1H23A 3ZLBA 2WT8A 3ZUGA 3DE7X 4KGVA 3U5ZB 3THXB 3ANMA 2Y99A 1V7CA 5LFAA 3GEEA 3PE6A 1G5QA 1T3SA 3K0BA 3ZNPA 2V1XA 2V6MA 3RS5A 3KT3A 4M37A 4CM6A 3I9MA 2WG0A 4BLVA 3ZWXA 3MYYA 3AVPA 1PRYA 1UEIA 3IAFA 2ADOA 1ZMXA 5JBIA 4KTVE 4DA8A 2YYAA 3VHLB 1W0CA 4JLBA 3QPWA 2OKGA 3D02A 1WZIA 1WCYA 2NSJA 3IMFA 4XWGA 5F35A 3KHSA 2QYSA 1DZIA 3CLUC 3JVEA 1CVIA 3CRRA 3SXPA 3HKEA 1Z0ZA 3I5XA 1TUGA 1ZH4A 3E1SA 3H6HA 5DCWA 2GJSA 1LX7A 3ABQB 4JB2A 5AKEA 3H42B 4B17A 1W5EA 1JPNA 2D54A 4JROA 2B9VA 4Y2VA 5AJYA 4ZAVA 3T9AA 4QO7A 4FNOA 2GZ2A 2WSLA 3A36A 2VA9A 2V0CA 4DC9A 3GPBA 4C0BA 1IHOA 4EYGA 1NVVQ 2EL9A 5ARBA 3CLSD 3H86A 3HLYA 1ZM2A 4MKRA 3U1VA 3UMFA 2FEAA 4MUNA 4F9FA 2R3SA 1M7GA 3P9KA 4BVFA 3CPHA 3GFFA 4K6GA 1SVUA 3B1WA 4B74A 3R0VA 3VJMA 3AKZA 1FCJA 3IP5A 3HRHA 3MT7A 2OHJA 4MQFA 3UGTA 4BVBA 1MB3A 1HE3A 1SC1A 1J6UA 5E2AA 4EJMA 1MO2A 3WRXC 1KAGA 1UEJA 1UBMS 5ALVA 1P4RA 1E61A 3D8NA 4FKMA 3ASYA 4RK6A 3S55A 2CL7X 5CBPA 1H5UA 2YICA 1QOPB 3WK6A 1KI4A 2EFCB 1YFZA 5FBQB 3G02A 4AG6A 3CEHA 4XYMA 3K0FB 4QPCA 3G0HA 5T7BA 4FYIA 4L4SA 3G49A 1CJKC 4Z7JA 4GM0A 2IPLA 5BN3B 1S3FA 1TAGA 4QATA 4S05A 3RWOA 2AWOA 3KS9A 2Q3MA 5F51A 2D5BA 5JH7B 1TIPA 3ZWCA 1C3JA 3W7BA 5BSRA 4I4LA 4O4JB 3VTFA 1BX3A 2C8JA 2JZNA 3FDZA 4QUKA 5GONA 2EL7A 3D0RA 1A04A 5HFNA 2EFEB 5D1NA 1QPZA 1T1RA 3UMCA 3GN2A 4J1NA 2QSUA 5HG0A 3VPCA 5HVNA 1QCDA 4BEBA 1TYAE 1GA6A 5GV7A 2ZDQA 4RMGA 3LP6A 5KYYA 1DIGA 2YXLA 2HXGA 4BPRA 4PR3A 2V96A 3AHIA 3KLBA 4V0SA 3PWTA 4Q39A 2OK7A 3P45A 3W6PA 1QKIA 5C80A 1VJRA 2Q2NA 2QN2A 4TQAA 5HF6A 4IJVA 5DYNA 3QF4B 1A9RA 3LSYA 4KN9S 3ICQB 4JJ8A 1IY2A 1QLWA 4PRZA 1JUDA 2FF7A 1CZUA 5F33A 2PMWB 1SHUX 1ZH0A 2G6TA 3FF1A 1KAHA 2W8ZA 3EG9B 4KQGA 4LQ4A 3ZXUB 4ZIRB 3FLAA 3R20A 5J2TA 4HEHA 5AHRA 3OCCA 3FLEA 1XLVA 4AQYB 4OYLA 4NESA 5LP1A 4MVJI 4UCQA 4UAGA 3V00A 1NN0A 1A8HA 2C9BA 5JNRA 3AEXA 3OT5A 5KQMA 2EZ9A 3WR5A 3EGCA 1XVLA 4IVPA 2HXYA 1Z2NX 3HCRA 2NT3A 5HE8A 1SBZA 3K05A 1ZA2A 2BFAA 3LC2O 2PFKA 3ZKAA 2BHNA 1J09A 3IKMB 1KNQA 4S2EA 5GTDA 2A9OA 1RMYA 2GYYA 1BSVA 2PIAA 3AVOA 2I7XA 4PFKA 3O9MA 2O05A 4WKPA 2GFQA 1CUHA 5JUWA 3IBGA 1B0AA 1X0XA 4OJQA 4HRXA 5FL7A 1J07A 4URYR 2ETXA 2IUEA 4J0GA 3HB9A 2VDLB 4XEHA 3VR5A 1X1DA 3WQQA 2YV2A 4KYIB 4IV0A 2ZDHA 4D42A 4EATA 1WMDA 3BL6A 2XWPA 1QP0A 3BFPA 1SFRA 1V9LA 1VIMA 2XF2A 3KEMA 3NT4A 1I30A 1RWVA 1U8AA 3O8QA 3V8VA 2FPMA 3DL4A 4MLCA 1P2FA 1D07A 4IXMA 4KFTA 4QYMA 2FEPA 1XGKA 4U2EA 2ZSDA 1HV8A 3GGPA 3ND5A 3I9LA 4J2OA 1DWUA 2MT9A 3KYBA 1H65A 4Q02A 1YE3A 3A37A 3E2MA 2VZ0A 3FNIA 4J2TA 4X1YB 5LDDC 2IE8A 3BN3A 4K6FA 1WLSA 3RRJA 3LECA 4TSFD 5GONF 4BLSA 1G6OA 3LBHA 1JLLA 2A6PA 2JJ8A 1N7GA 4OJKA 1V2HE 2I22A 4M46A 4U0JA 5IFLA 3CVXA 4GMDA 3W9UA 3C3AA 4HWKA 4MUIA 5IDQA 4RTSA 2WHYA 3HCBA 1Z4QA 4M9SA 1YA4A 2HX1A 3DTVB 1H8ED 1T9HA 1IL0A 3HKBB 1X94A 3EGVA 4G86A 4ZALA 3O5AA 1AURA 4MULA 4ZAZA 1YU9A 1QJCA 2ACVA 2ST1A 1X70A 1C41A 2CVFA 3BTSA 4RAQA 1BEEA 2PGLA 4AO7A 1UT8A 2IXAA 2R1TA 3HJNA 3HKCB 3V5NA 1AGPA 3O8NA 1NXXA 1M8KA 3ODGA 4KLNA 1DARA 4REMA 4JEMA 4IH4A 1JHPA 4G8JA 1BYIA 3KBOA 3QQ5A 2IH2A 3U3ZA 1SHJA 4C22A 2ZYHA 3WAKA 2XKJE 3L84A 3RLFA 2BDUA 4PHCA 5B30A 4QJIA 5CNMA 3RI3A 1J5EB 4B3DA 4D45A 4ENPA 4I1RA 4UASA 3VPDA 3ME5A 3LA8A 3N3AC 2RGCA 3TQCA 5I9LA 1AKMA 4E5UA 3N28A 3SEAA 2Y1WA 2YMQA 3EBPA 4WWHA 2WAXA 5IJZA 1LPSA 5E6UB 1UXGA 1RWPA 1WULS 2W8BA 4IS2A 3V1MA 3ZZMA 3VKUA 4BAUA 3ZS9A 5C31A 2YHAA 2CXHA 3GDFA 2OHXA 3QW4B 4G09A 4MYSA 4QYXA 4DMKA 9MHTA 5M04A 1E89A 4ZGBA 4NCBA 1RABA 4ZA2A 3TZEA 3QYJA 5AVRA 1CUJA 4OSEA 2ZXFA 3FZEA 3B6KA 4GC5A 2JDIA 4KIGA 2CXRA 4PU0A 4L5BA 3MOSA 1KYIA 1D9ZA 3EFOB 5KPDA 5AM1A 1ZAKA 1BH2A 4QG7A 2A9FA 1M75A 1G20A 3ONFA 1JLKA 4TOIA 1U5CA 4KUGA 5D5PA 5FEUA 2F8SA 2WU4A 2G4LA 4GXRA 5BUSA 2DHQA 2C5AA 1RHMA 1IN8A 1T2UA 4PYJA 2NO7A 1G8MA 1EJBA 4P98A 3H97A 4XTRA 1A5SB 4B6PA 3UVEA 5K0EA 3IIMA 1HEIA 3KR1A 2IF0A 4LPKA 3A2NA 4PGFA 1FY2A 5DIFA 4BJ1A 4RELA 1GM5A 2YHIA 3MIZA 2FF5A 1XDUA 1IRXA 4ZU1X 1DCTA 1YS9A 3WMGA 1U1DA 4XOUA 3A2LA 2GZ1A 2YZ7A 5KSYA 2Q3FA 4R3NA 4RGVA 4C5CA 3H5WA 1S3SA 2FSHA 4Y3UA 2RHBA 3KLNA 3RVJA 4QDJA 3KALA 1ZNYA 4ABTA 1X42A 5CXUA 1VI6A 3G2MA 4BNIA 5B6JA 4Q37A 3EPHA 2PRYA 4N7JA 4J7XA 5F12A 4WK0B 1FLVA 4KQXA 3I37X 1U0NA 2AVNA 4MP3A 3SR4A 3K0SA 1DRVA 1X1QA 4E7OA 4CIBA 7YASA 1X8LA 3AY6A 1B23P 3G17A 2FP3A 4RU1A 3A4VA 3N74A 3A31A 4P7JA 2PJDA 2ZB8A 3NBYC 3KZKA 2UVPB 4ZAGA 1LVGA 2DQ4A 3JRWA 5DIZA 2J9FB 2B20A 4ZCIA 4URHA 2VYNA 2ZPTX 3LZDA 4RNDB 4WXRA 2GPYA 4MUBA 2AUMA 3CFYA 4Q4DA 4DJEC 1PGPA 2NZVG 1JEJA 4H0NA 4UE3S 1A7UA 2HBRA 4W9NA 5EE1A 4CU2A 4TYNA 1YOBA 2EWMA 4FGJA 4W6QA 5EC8A 3V1LA 3QVXA 4C20A 1YFJA 1PZEA 2IYFA 2MTBA 2QT9A 2ZPUA 5P8WA 3PZBA 1OXMA 3QY9A 2B3TA 2FPPB 1Q7RA 3QXCA 4QKQA 4ID9A 4YAGA 1NURA 4N54A 3TIGA 1H3FA 3JQRA 2IA5A 1BXRB 1Q5PA 4QA9A 1ADGA 5DEIA 5ALZA 3HLTA 1GSOA 2DLNA 3TZQA 4B09A 1T13A 1VM6A 1Y4SA 4R8VA 3N2IA 4U3JA 3ROKA 1HH4A 1N32B 5AKKA 1JEAA 1CB0A 5ALIA 4GBMA 2BFNA 2W2NA 5FL7D 2QHXA 1JZQA 4NZOA 1RPZA 3RHFA 1ZISA 4GI3A 4AUNA 4E70A 4OQ4A 1BXGB 3UC9A 3FCSB 1QNFA 2GA9A 2KW5A 3QSGA 1I6KA 4LSZA 3C7DB 5AK5A 4CDGA 1VYHA 1IHUA 3PIIA 5KUTA 2WKPA 1IEVA 1NR5A 3OC0A 1KMHA 1LVHA 1EGMB 1NR7A 2E9SA 3TDMA 5KNBH 1ZM4A 4D7AA 2C5GA 2IXDA 1G6KA 2QQFA 4INOA 5CT6A 3WSVA 1T9DA 1GEGA 2QUZA 4CDRA 1GTRA 4KFCA 3OFKA 4NJEA 1GGNA 1SXPA 1A2KC 1SUIA 2PZEA 2W6NA 2WTNA 3H4VA 2O3JA 1NT2A 4ENSA 2E0IA 1JEYA 4HD8A 3H2GA 5FWDA 1AA6A 2LRHA 3D7MA 2VEOA 1N1EA 3PI6A 2QP9X 5DGDA 3MYRA 5EJ2A 2Q7DA 2FR1A 4TSRA 4D92A 4HQ0A 2VZ8A 1Y42X 5FR1A 1NONA 3H3FA 1RE1A 2QZ4A 3TINA 1UDXA 3ZI0A 4BJ5A 5HUJA 4W9MC 1YQWA 4QYTA 4E31A 1XZPA 3J81k 3P2JA 3M6FA 2OUKA 3FOWA 1BFUA 1M1YE 4E1VA 1JA0A 2VDWA 2Z1DA 4PNEA 2GLTA 5HKLA 5BSVA 2D6FA 4QVGA 3L04A 4KPGA 2EZ8A 3RSLA 1RI1A 1NG9A 2XYHA 4F2DA 2C5BA 4FYMA 4GKVA 2IZ6A 4GP9A 4CETA 1F12A 1VHQA 2M6RA 4C2AA 1YR2A 4ZQFA 3TX6A 4WNIA 1KY3A 2IW3A 2XMCA 4D9MA 2VHJA 1BFDA 1W4ZA 2DT5A 2O57A 2OTCA 1D3AA 3IAHA 2G9VA 5ES4B 1GXSB 4FD2A 2R65A 4EO4A 5JZSA 2PM8A 2VR1A 1O4WA 5F5NA 1T4MA 2WF8A 5EJFA 3PJEA 4UDXX 4BGEA 4JODA 3HPQA 1R0LA 1RM3A 4Q82A 1ZKDA 4BO3A 4Z1OA 2Z2XA 3LUJA 2ZWAA 5AJWA 3NHUA 2PV0A 4WPGA 1QU3A 2FPSA 4CIVA 4LVUA 5ADVA 1OA1A 2C1XA 1UAGA 3CRMA 3B2QA 4KQ1A 4UPVA 1KQ3A 4YYZA 5CFPA 1E9BA 4FGSA 3TOZA 1RYEA 3FAZA 5FCDA 4E07A 1HO3A 2QVYX 5JIBA 4IVQA 2NZJA 2BC9A 2C2GA 2ECKA 2R8BA 4N39A 5KYWB 5A5VA 4QBGB 3UV6A 5JDIC 2Y0DA 4ZREA 1YZUA 1QG2A 4R54A 4KQJA 4NFYA 4GNRA 1CP3A 1JHRA 3C43A 3L1KA 4ZEOA 3RJ9A 3PX7A 1MAHA 4KDFA 4Y2HA 5EGSA 4DZRA 2JI8A 1GAQA 2IXTA 2RKWA 1YQ9A 2JDID 4L0QA 5FF9A 3M3PA 4HGNA 4BLRA 3GEIA 2PKQP 1DKRA 1RC8A 3LZ6A 1NMYA 4IMRA 3E7DA 3QA3E 5HJ5A 3ONWA 1J0XO 1S2MA 4ENUA 1TU4A 5I7FA 4OGKA 2NTJA 4EBBA 2NUPA 4EG3A 3R4CA 1TRHA 3JCZA 4XFKA 1RVV1 1VRVA 4YAIA 3FDFA 2JLXA 1E6WA 1DIRA 1SXJE 3FROA 3IVRA 2O2SA 1YR1A 5A71A 3JARA 1XZEA 1RFLA 3NYRA 5G0UA 3V4SA 4TKUA 3O8DA 1R5BA 5AI0A 1YBVA 2PMDA 2OGZA 1V47A 2YHSA 3LYHA 4PSAA 1IXYA 3FNQA 1KHHA 5DI3B 4QAQA 4M0PA 5DISB 3C15C 1XMOB 1G3UA 2MYNA 3H1GA 3KB8A 4Z2YA 4KK4A 3K31A 1PIWA 3WYAA 2ILTA 2VP5A 3TCXB 3CCFA 3CLKA 1N3YA 2KPOA 2WBLC 3O8LA 4D6XA 5G40A 2YVKA 2GASA 4DLBA 3O1JC 4HH0A 1QIKA 3JD0A 1FBNA 3PI7A 3PQ8A 3T52A 3UGQA 2O8BA 1WMEA 3LTEA 5FIUA 1S2LA 1DJNA 2P3LA 1MO4A 1QIGA 2PX0A 3GCWA 4HDSB 4WK4B 5MN6A 3K1JA 4RXUA 2Q49A 3WHLA 2FWNA 4LE0A 3PUKA 4L50A 1Q7TA 2DXIA 1KY5A 4P0TA 3RBVA 5ALFA 3S2YA 4P4TA 4C6RA 1EEHA 4FFPA 2VYND 2PKWA 1EFRA 1XRLA 1ZCFA 1TM5E 4TX1A 4YRJA 2H0AA 2UU9B 1M76A 1QCZA 2WU3A 1AOXA 2O5RA 4FYJA 4I5DA 4DB4A 1TAUA 2ZI3A 1NLUA 2YOGA 3AHEA 3DXYA 1PFUA 1X0VA 3G8DA 3IE0A 1TO1E 5ANRB 5TF0A 4RVGA 3NNDA 5HK8A 2ZRAA 1PK9A 4LJ7A 4DCPA 1NJGA 4JC0A 5I4CA 4ENQA 4F7WA 3FRIA 3MJTA 3UAOA 4CUKA 3IR7A 3OETA 4RKQA 3HKDA 5EXSA 1GNQA 1SC9A 3PC3A 3TQOA 4AW9A 3J7AC 1S0UA 2A14A 2HL6A 1CJCA 1R4MB 2AKAB 4B40A 2O2XA 3TQRA 1DC4A 1KERA 2VATA 3C3WA 3QVTA 5JPIA 2PS1A 2H5LA 3WYCA 3ZWNA 2FSIA 5ETJA 3KOZA 5E7IA 4C4AA 4KH0A 5G0VA 5FPKA 4CQJA 10MHA 5IBQA 5BV8A 3B9RA 1G8AA 4HDKB 3O0DA 4JLUA 4FFVA 2BFFA 1JR4A 1E63A 4MLPA 4A8JB 4ILEA 4X6UA 1WUTA 3OG9A 3UUWA 1W4CA 2JI7A 1XJ0A 1T0IA 1WL8A 4ENWA 1N9ZA 1T3LA 1KSFX 1RWQA 3JQQA 1U7PA 5LB2A 4QGSA 2FHPA 2JCBA 4OIMA 4OPMA 4AXBA 1ECJA 1R0ZA 3ADDA 2CXNA 3E48A 2NQ8A 4CZ2A 4R1UA 2E3JA 1CE8A 1SCBA 3INRA 4JQSA 4OM8A 2X2EA 3E9ZA 2NPFA 5LNK1 5D2CA 4KVAA 4K86A 4PZDA 4V3CA 2YWFA 4Z0HO 1ZSYA 1RPAA 2XIJA 4R0MA 5DSXA 3PCXA 2PQ6A 4HN2A 3SFTA 5JCOC 3GNQA 4PZAA 2WSIA 4UHBA 3WO1A 1V3UA 821PA 2RGDA 5BUZA 3DEFA 3L4BC 3GLSA 2TECE 1SOAA 3U4DA 3K0EA 1RXSA 1FXSA 2ZRPA 3TLCA 1PV4A 2WC1A 1CUCA 3MTEA 2WNHA 4J2HA 4ZAWA 3WRXA 5FWXB 3SVLA 1ZD9A 2WHPB 2OZLB 2PKQO 4GVLA 3EWAA 4LF6B 3Q12A 2OLJA 2YVUA 5DK4A 1SXQA 1LSOA 4TVKA 5KJ1A 2GD2A 3ITDA 1L3BA 3O8BA 3PT5A 5FOUA 2XMBA 3I3OA 3QVGA 2GHTA 4NDAA 3TQIA 2ID4A 2HIMA 2YQ4A 4JLKA 3VH2A 3HCOA 2BFEB 4PRKA 4DCOA 3ICCA 1GTJ1 2XDWA 1C14A 3DB2A 4G0NA 4XZ3A 5JG7A 3TQHA 1HK7A 1VDMA 5EVJA 3FWYA 3I2KA 4C4PA 3HJRA 4CTKA 2FMUA 3C3CA 3MSXA 2M1XA 1KYVA 4Q9KA 1FDOA 2HN9A 3C7KA 1Z75A 2JGAA 2WTBA 4V39A 4Q3NA 5JEEA 2EW1A 3BCHA 1F4VA 4PTLA 1V3TA 4BAGA 3CM0A 4AJLA 3TQTA 2G1KA 3R9IA 4H18A 1XTPA 3KTFA 5J1SB 1E66A 3NDPA 4QJ3A 1I36A 4XWOA 3LVFO 4QGBA 4X1KA 5LOVF 1I51A 2WTAA 3B48A 1IE3A 4HYEA 5BVGA 1KI7A 2VIIA 2FWJA 1TLFA 2ZK7A 4E30A 4JQCA 2RC6A 5EJGA 3OPYB 1MFPA 5IAAA 3GMTA 2BMFA 2OCYC 1FMJA 3UFBA 1PQUA 3AESA 5K3EA 1CT9A 2GRUA 5EMJA 3OWOA 4ALLA 2JLVA 5BNZA 3UEOA 2J07A 1IZZA 1ONSA 2ZAYA 5IP5A 1IBKB 3COJA 1NNLA 2FRXA 3IUPA 2XUGA 3U3XA 1L4UA 2GFIA 3O75A 1GFWA 1L4FA 3TW4A 3M2TA 3UH0A 3X2EA 1M6WA 4D3YA 1UBTS 2QBYB 1JIIA 4H7FA 3T38A 3TAXA 1GPMA 4UCFA 5EUCA 5EZYA 1IVNA 1E32A 5LCXA 1LA2A 1W0KA 2H2WA 3TVTA 2V7TA 4CFSA 4EM6A 1NIJA 3WY9A 2YWXA 4K9PA 1OYVA 1V6SA 2BGTA 5EVCA 3GRYA 4BGIA 4YCLA 3LFTA 4NU5A 4O0LA 1R6TA 2PU5A 1OWNA 2Q5IA 4YEDA 3O4JA 1XL0A 1OX4B 1ZIDA 3UICA 1Q12A 2QR5A 4ALNA 4I2VA 3ZDAA 1ORWA 1WEKA 2WJJA 5K3FB 1K8XB 5EJAA 2ODBA 2VK2A 4UEJA 3DWEX 2WE8A 4JDPA 1SCJA 1J7KA 2HJ9A 1STOA 5DRTA 4WNCA 4Q9NA 5IAEA 1GAJA 2AQ8A 3A6ZA 4LY9A 2B5VA 4X71A 2FH5B 5JI3E 2GAJA 5JRZA 3V42A 1B14A 2XRFA 1D1QA 3KKEA 1PD0A 3IEIA 1P8AA 2WY2D 3TN7A 3WZMA 5A04A 1ZPDA 3BEOA 1IQPA 3Q3GE 2WIGA 4JGBA 2QTHA 3EGDA 1OZGA 1E2NA 2POQX 2WZDA 4LJ4A 5DMHA 4ITVA 1KP9A 3TEMA 5CEJA 3HZRA 1CR0A 3PHCA 4JGGA 4HLCA 4QGAA 5J4LA 1W2HA 5C5EA 1CJMA 4WOPA 1N2OA 2PT9A 3NYIA 5BQOA 1UKYA 1P4SA 3VOSA 4YV7A 1H9AA 1YS6A 3TRHA 2QP4A 4NZYA 5HX7A 4OQFA 3Q8KA 1FS5A 4GMGA 4KITB 3WX0A 1CK4A 1NQ5A 3NGXA 2O0MA 4BKUA 4JYPA 4EGQA 4LS3A 4UHKA 5THXA 3AJ8A 1GZUA 3FMOB 1IBMB 4HB0A 3GR6A 3DW3X 1ZM3A 1ACLA 4KEAA 1VTKA 1ZOLA 3ZD9A 3AU8A 1B0UA 1AG9A 1P4GA 2NYAA 4GMFA 1TPYA 2B2CA 3JVIA 4RO0A 3VBEA 1UAYA 2VYCA 3OX4A 1ZNZA 4N0QA 4MSUA 3OTWA 4XE5A 4MOWA 2Y0PA 7ADHA 4DCSA 4FN5A 2MCFA 3DM5A 3RVLA 2VEDA 3KWFA 2PX3A 3PDIB 5IPFA 1GYQA 1QZUA 2ZJ7A 2V6GA 2ZCVA 2KSQA 3QU4A 5BOSA 4PLHA 3CLUD 2BELA 3C85A 4DA0A 2FZLA 3H1EA 5EZYF 1GOTA 1NJ6A 4PX5A 3B3FA 4C89A 2F4VB 2UZ3A 2QTCA 3LZCA 4F8YA 1Q0LA 4PYIA 2PUVA 3Q72A 2B78A 3TZHA 4G37A 3CMMA 4KWIA 5T8KC 3U26A 5EJ8A 4BYGA 1XD8A 5A9SB 4RWZA 4EVQA 4MYUA 2H2IA 5EGNA 3KSUA 2AA3A 3WLMA 5IVHA 2DERA 4XA8A 1Z0SA 1J1IA 2J59A 2XQVA 3CJTA 3BFXA 4BYMA 1XLWA 2WVJA 1VB5A 4D56A 5AICA 1P2UA 7GPBA 2GCEA 1VLHA 5H3LA 3SF0A 4B0OA 1SUWA 1BZYA 1ZM9A 5FUXA 1QVZA 2UZ1A 1PK8A 3Q2OA 2I62A 2QNIA 4LSMA 2RAPA 2I2XB 3IDQA 4L8VA 1JI0A 1QBGA 1Q1QA 3FMPB 3U7JA 1WY7A 5TGTA 1A9XA 2R8XA 2AG8A 3AIOA 3I2YX 3KZ1E 5JS7A 5F76A 3UV3A 3H1FA 3X1JA 1BMQA 4MQLA 1FTQA 2CMKA 3H11B 3UIEA 3ORHA 1LCIA 2HWYA 4IXNA 4QUEA 5GGYA 2QI9C 1HYHA 1QONA 4Y9TA 4ARUA 3INTA 4IIYA 1JAHA 2MYTA 4EFNA 5I8WA 1TJ4A 5DULA 2P2ZA 3C6ZA 3QA9A 4FFDA 3MMNA 3STTA 1HM5A 3FPBA 1AU9A 3CIOA 1W9MA 3W05A 1NVMB 4RJ2A 5I7RA 1C9NA 5I8PA 2DPXA 1J8VA 2IBTA 4R2XA 1ULBA 1Q0ZA 1AHNA 3DHYA 3A1DA 4Z9FA 1NQXA 1E6KA 1QYIA 1FNMA 1P2TA 3PNSA 3GPIA 3PHGA 3QUBA 4WFQA 4BNDB 5C46F 2O1SA 3FFBA 4V0OA 4RJIA 4BDSA 5BV1A 2NQ2C 1FDSA 3ZJYA 1QO7A 3U4GA 1DCMA 5FLXA 3FMVA 4CG3A 3TSOA 3EXG1 3ZGZA 2H54A 2QLBA 1AV6A 4RGQA 1R3DA 2B4YA 2Q3HA 2HNAA 2OSBA 4Y6PA 1AY0A 2WK1A 5FOWA 1E7SA 5A2GA 4NARA 1ADBA 2O07A 3DONA 3DVQX 1S3GA 4ZXFA 3FCAA 1Z15A 3LO8A 2JEYA 1CDEA 1I5OA 1YQGA 4XSVA 2CV1A 1KOFA 3O91A 2JAWA 3BE6A 1PZGA 3K09C 3OQPA 5B7PA 1P2GA 1R5NA 4YRNA 3RTAA 2DFDA 2G8LA 2ID7A 2BI7A 4L8FA 1K0FA 5FI5A 4UHJA 4EZEA 3DDHA 4LFBB 3ELYA 3K9HA 3RYHB 3S2GA 3THXA 2H2FA 3EF0A 2Z83A 1G5IA 4KLRA 4Y2PA 3SIPA 5KTKA 3HGQA 4G0ZA 4DJFC 4M3NA 4H7DA 4CTMA 1F51E 4RHXA 1TTQB 1KI1A 1VCHA 3LQRA 2WT4A 2V65A 1W0KD 3IERA 5THQA 3KWJA 3RKRA 3WVNA 5J47A 1X1AA 2FG5A 2GX6A 3C5EA 4YRZA 4LFAB 4R9UC 1RI3A 4NBLA 1HT0A 2B61A 4A8JC 2I2WA 4E2WA 4TXNA 3DL7A 2FMTA 3CW8X 3GT4A 3ICEA 3FZQA 1JKJA 2VCHA 1YO6A 3PRHA 4M6WB 1NW5A 1OGIA 2ODTX 2AN3A 2CLKB 3EY4A 4QDZA 4S1TA 2NTYC 4HHEA 3RU7A 1G2OA 3PLRA 2G7MC 5G4LA 4OCZA 2WINI 1HOTA 3I52A 3NW9A 3FZGA 4R8MA 2AFRA 2P1ZA 5CJPA 4B73A 2PXHA 5JMWA 1CZRA 1FYDA 3DMGA 4YCBA 3RVBA 1D5CA 1UJ5A 4CUZA 4EHKA 2XD9A 4Y18A 2X86A 3PCTA 4UDOA 3TXYA 2Y1XA 2YUTA 1TCCA 4KUHA 1XMSA 4M49A 4A0GA 4EY6A 3BH0A 1ZIXA 5LWQA 4WA7A 3IQHX 1RKQA 4E03A 2M6SA 4LMPA 3OC6A 5CFLA 4KRGA 3TBHA 4HNQA 3AZOA 4P0QB 3K9WA 2E18A 1XZKA 4RCYA 4XOIA 2Q1WA 1KMQA 2VA8A 3AUFA 3I9V6 4G1FA 1VL5A 3EIWA 5AHXA 2CXQA 3ZHRA 1F4LA 3W2GA 3QLEA 1CNMA 1NQTA 1QHGA 3KKPA 4TS9A 1JR6A 1KU0A 3UT6A 2R6GA 3AYXB 5BPHA 3PUHA 5F52A 3KV3O 3KOOA 3EPKA 1Q3KA 1UKEA 2OC9A 3TCKA 3K0FA 4AY5A 4ND3A 3NV9A 4PZ0A 3T54A 2Y2UA 3R5KA 4E6EA 5JHGB 4LZWA 1N5JA 3JRXA 5D1HA 5BN3A 4OGGA 4RF5A 4J0JA 5AJVB 2A57A 2PUHA 2PSJA 3LK7A 5JH7A 3L77A 4DIUA 2VRNA 5BXYA 5FA8A 3R0QA 4DCMA 1PQYA 1K7SN 4ZCQA 4YFVA 1G9SA 1X9GA 3KKNA 4PGHA 1FRQA 3BVPA 3L9WA 4OQNA 4B33A 1Q1NA 4DUYB 4ZVKA 1QORA 5JS6A 4E5PA 2FWPA 3H9BA 2DC1A 4IP0A 4L3VA 3STWA 3Q6NA 2H9IA 4PCLA 3LWNA 5D3QA 2WFLB 2O7NA 2DUNA 5DX0A 3O83A 2NTNA 4TMZA 1YZ3A 4F46A 4DMGA 5KJFA 4P9NA 1QFMA 4U1RA 4YJHB 3CN7A 3KTAB 1NUQA 3N7AA 4XM0A 3DPUA 4G1CA 2PUBA 5DHSA 3HJCA 1NJ2A 3BUSA 5A05A 5KNDH 4FFSA 3DEJA 3QF4A 1KI2A 4UBKA 3DE2X 1JQAA 4BGVA 2FWAA 4CM1A 5BSEA 5BWBA 6CHYA 3IAM6 3VTAA 5JDIA 1IJEA 1YC5A 5A4KA 1U0TA 1Q7CA 1J0DA 4JY7A 3DYBA 3EG9A 4ZIRA 2VWHA 1OREA 2Z4RA 3QE0A 4YDRA 5DT9A 5I7AA 3ZU3A 4QM7A 3OF5A 5F5LA 1SXJA 1VLZA 2OB2A 3RG8A 4ZJYA 2VHQA 1HPLA 1YZGA 3PFCA 4HQOA 1ZMOA 2POCA 3UT5A 3QBJA 3GBPA 4IYRA 4MH0R 4LY6A 3NDIA 2QJRA 1E92A 4E3ZA 4TRRA 4TTPA 4LYEA 3CBQA 3QGMA 2XHEA 2R11A 2VYVA 3OTIA 4ND8B 4TVBA 3P2OA 4Y6LA 4B9EA 4BO8A 3UF0A 4DRYA 3DYVA 1QGZA 3O03A 4OGWA 4AF6A 5A4JA 2Z98A 2I3AA 3AFIA 4G23A 1ORIA 2OB1A 5T3YA 1I2AA 3MNFA 3QM1A 2OBNA 2R6R1 1DMSA 1GPH1 3IILA 3L7OA 4KTTE 3RSQA 1QIHA 2XYQA 1W93A 2ZRMA 2CC2A 4EVRA 5BSTA 1TECE 1QLHA 4HVLA 2NV0A 4YB8A 1RNLA 4LF5B 2ZUWA 2IYAA 1LVUA 1ZOOA 5TS3A 2WG1A 1KVRA 2WFAA 2GAOA 3E3OA 1SZPA 4UU8A 3T34A 2PGDA 5TJ9A 4O4LA 4KDCA 1Y9EA 3KYJB 2P2NA 2NUTB 3EH1A 2HSEA 3E9EA 1QQ6A 1DJLA 4Y7DA 3VV2A 3PRKE 1DIOB 2E4ZA 3WJ1A 4UNNA 5IX8A 5JH7F 4KWEA 4X1YA 4DM3A 3FB1A 1U02A 1YJ8A 4KMOA 3HCCA 4RH0A 3S4YA 1FK8A 1JPUA 4LWPA 1GN9A 1XTIA 4MV4A 4O6VA 4P3YA 5DYTA 4YWJA 3FBGA 5H02A 5JALA 1Y0BA 3AF1A 4PC6A 4LRWA 3E3LA 1EE2A 2DWQA 2OO5C 2E4UA 2HGZA 4OKIA 4W1SA 2J7PD 4FINA 3TM5A 5BWOA 4UTNA 1LDBA 4LGMA 4ZI7B 1ONNA 3DTVA 4NE2A 3REQB 3HKBA 1M5TA 1MW8X 1KPHA 5BMVB 4KR3A 2H57A 2QPOA 1JU3A 1CF2O 1QV9A 3A4YA 1NULA 1Z2DA 3ANYB 2GVZC 2IKQA 3LUBA 2P4SA 3MBKA 5LLTA 2Q0XA 3LYAA 4F8JA 3G8CA 1FU7A 1O9BA 3HKCA 3FVRA 3TG8A 1R5OA 3V8BA 2C5SA 2TSYB 2OQ2A 2Q5CA 1B76A 4QXPA 1U7HA 1Y8QB 3GXBA 2J3MA 4ZVRA 4ZOBA 5FI1B 2QW8A 5ECGC 2Q5JA 1P3DA 5EFOA 2XB9A 4C4OA 3LHFA 3M6UA 4QBFA 2HCRA 1H2AS 1QH0A 3RRZA 5CMLA 2WQ6A 2OZKA 3C87A 1FP6A 1AF4A 3HB0A 3HXTA 2HPZA 4MI1A 5IKOA 1EFLA 1XZIA 4RPCA 4TV8B 3K6JA 3AM5A 2OCDA 5SZKB 4KJZA 4MW2A 4WXYB 1UZAA 5B1YA 1AKRA 3DLHA 2VJQA 4Y30A 5E6UA 1NTOA 1T8WA 1VL8A 2Z3ZA 2ZJ4A 2VS1A 3O1HB 3PPYA 4ZVSA 3RS7A 2VUHB 3RS3A 1B0ZA 1C9KA 4LX8A 4RIHA 5FBLB 5TS2A 2OYRA 5A4AA 3VUFA 1KY2A 3GLQA 2W6IA 2VP9A 2B8NA 4UXIA 5HMLA 4ZVMA 3ZBQA 3T5AA 2P5UA 1CLUA 1OT5A 3ZZUA 1UQRA 3DAGA 2Z95A 2VTKA 2Q3BA 4RDHA 3W79A 3S70A 3DAFA 2D5AA 4GW3A 2HSGA 1Z29A 4P4SB 4MW5A 4R2KA 2A1TR 2IUTA 4O4LF 4FDTA 4WGGA 3EFOA 5GJBA 3KETA 4EUFA 1OIWA 4IO1A 1DBQA 3BSWA 1WUYA 5TQVA 3JALB 5DH9A 5JCOA 2QX7A 4WECA 2YJ3A 1PDOA 3B3GA 4ZOLB 4IWNA 1JLRA 3H5AA 1D6NA 2AC2A 5T57A 4EB6B 3PEVA 2O0HA 4JLOA 4K9DA 3OF2A 3Q98A 2DR3A 2MHCA 2GESA 1TX4B 2O1WA 4HQKA 2IEZA 4JBIA 1VKJA 1E8NA 3EXAA 3NQ41 2EBFX 5HILA 1PWXA 4BVGA 4NULA 2DKFA 1FSGA 3KD2A 4LZAA 4RSRA 1O8BA 4XRRA 3MQ2A 2LCIA 1HRDA 1Z74A 3DDZX 3JAWB 3NKFA 4BBZA 4YCNA 1GTMA 1NG1A 5ALKA 3P1JA 5B3AA 3VQTA 2PKRA 1DUSA 3Q1LA 4IM7A 4ZZIA 1B2RA 2P9FA 3IAS1 1TIKA 16PKA 2EATA 3R7BA 3UWMA 2KYRA 3BERA 4MYCA 3E05A 1H3NA 1ODCA 2QU7A 1FFGA 5D51S 2YZGA 3T0GA 4EVIA 1E99A 5CGZA 1W75A 1OI7A 2OPHA 3JQ7B 4JH0A 3W4KA 4BUJA 3ABSB 4Q1DA 1W8IA 4DJTA 5LBTA 5ECYA 1RDFA 2ZSHA 2ZBEA 2OLEA 3ABRB 3AYZB 1UP7A 2UVPA 4UHHA 5F2NA 2Q5FA 2J9FA 2QJWA 1QFJA 4CEHB 1VLVA 3DBVO 3H5LA 1DS6A 1V4NA 2UVDA 3MERA 3MN1A 3KSDO 3OQIB 5DZSA 2ZJ3A 4ZT4A 1W29A 4U8HA 4YRPA 5C4GB 4E3WA 5B2FA 1UODA 4X6LA 1JEQB 1KYWA 3KVRA 4P34A 2G04A 3F0TA 3UCFA 3GFQA 3NKLA 3E1GA 4IIJB 5A62A 4LZOA 3GT0A 5FNVA 3WSWA 4CKEA 1OLUB 3NBQA 3AO0B 1HQCA 4FI3C 4FPXA 1PT7A 3LPDA 3W8NA 3NALA 3CSSA 1FYWA 1QIIA 2FPPA 5T3UA 4JGIA 2JS7A 3F78A 4ZVPA 1XKQA 3L7JA 2NNLD 1U0EA 1RHRA 4IJUA 3EQ7A 3QWIA 4O1MA 1BXRA 4DR7B 4LKRA 4RQTA 1L0BA 2FUG6 4I55B 2C4VA 2QSJA 2AJBA 3MLAA 4TM8A 5FPQA 5LSAA 3GU3A 1UF9A 2EJWA 2RCNA 4R5HA 4ESOA 1OC2A 4L76A 2NYUA 3DGEC 1I5RA 1XJWA 4Y2SA 3IAXA 2G77B 3HGTA 1P75A 2ERXA 4YPFA 3OZEA 4LOKA 4E4YA 1TE2A 4HXEB 5AOCA 3H9UA 4TYWA 1QYDA 1Y7PA 2JFNA 1QM5A 2WDPA 1QIFA 2IYUA 2XGMA 5DNWA 4DDMA 1ISGA 3JYQA 2QS9A 3P5SA 4JVMA 1VBNA 2ZJ2A 3P0FA 1BCRB 2CJYA 2BCGY 5P21A 3V6MA 5JS8A 4B79A 3TBFA 4UKDA 3WOVA 4BIIA 4MVJH 5EKUA 1XROA 1PR3A 2IXBA 2O54A 3HJHA 5LC1A 1QOZA 3VNBA 3F6SA 4N18A 4BTEA 4Q15A 1V9CA 1NFQA 3IEXA 5IVIA 2DTEA 4QVIA 2OEPA 1MTZA 1P6QA 4M36A 2WEKA 2JBAB 3BMQB 3HU2A 4YJ2B 4CNBA 3HXKA 1QF9A 2X7HA 4B85A 4C3VA 1AS2A 5I4BA 3IBSA 3VR1A 3H65A 3Q5EA 1UBGA 4PSKA 1G1AA 1O5OA 1Z0IA 2R25B 3PXAA 3AJRA 3QYPA 4XYGA 4EDHA 3ZE9A 5K5EA 1OBFO 1K92A 1KY4A 1G8YA 4WJZA 2F2TA 1XMJA 3QMVA 4XB6B 2UUAB 1WV0A 5DWVA 2VQEB 2C58A 1JA9A 2JGIA 4YT2A 5AT1A 4Z7NB 4U8GA 1LK5A 1W6RA 3TLYA 4BB6A 2EFDB 1OHHA 3IP6A 3CKLA 5FNVF 3DMFA 1GXSA 2H7YA 2PQMA 4FT2A 4LDAA 1PYOA 4MCHA 3STUA 1RQ2A 3UJDA 3F3SA 3N0WA 4A6EA 3C5WP 1IIBA 3VZRA 5IJ9B 2SECE 1OXTA 1UXIA 2Y77A 3BGVA 1GUBA 4B44A 1YZHA 2ZJ1A 3L06A 4LF8B 2PGAA 3SX4A 4C2UA 3FNBA 1P1HA 4PGAA 2AWNA 2CDRA 2QRQA 3SSOA 3DDSA 1ZVKA 3BREA 2O5EA 4P80A 3W3ZB 4BKMA 3K15A 5KNBD 1WZNA 3PEEA 2R4UA 4ZODA 4E32A 4EHHA 521PA 1KSGA 4FKZA 5EIAA 1P0IA 3LT0A 5IKXA 1U8UA 1ZEJA 4OLAA 3NBXX 4NK5A 1YRBA 1EWKA 1RRVA 4DR3B 3FUVA 5KYWA 3A6HA 3INYA 4HADA 5E7MA 5B4TA 4ZJUA 2G06A 3MTQA 1T5SA 1I4LD 1XELA 1Q1ZA 2ZB3A 3VKWA 3K1ZA 4D9NA 2RC5A 4EOGA 2XCRB 1KJNA 1JT9A 2QL9A 5T8KA 3ILYA 2G80A 2A88A 2C3UA 3OPQA 4MJLA 4RETA 3DCIA 4CEIB 1BQEA 4V38A 1UZNA 2HF8A 3AETB 3AXSA 4RVNA 3UK2A