1C2TA

New insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid.
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
209
structure length
209
Chain Sequence
MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE
publication title New insights into inhibitor design from the crystal structure and NMR studies of Escherichia coli GAR transformylase in complex with beta-GAR and 10-formyl-5,8,10-trideazafolic acid.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 68
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 1999-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1c2tA00
1RBQA 4EW2A 1MENA 1CDDA 4QPCA 4ZZ3A 4ZYZA 1RBMA 1GARA 4DS3A 1RC1A 3R8XA 1C2TA 2FMTA 2GARA 5CJJA 3KCQA 4IQFA 4YFVA 4Q12A 1MEOA 2BLNA 4ZZ1A 3O1LA 3OBIA 4ZYWA 1MEJA 3TQRA 4ZZ2A 1ZLYA 4S1NA 3GARA 1S3IA 2BW0A 4QPDA 3N0VA 1CDEA 4EW1A 1ZLXA 4ZYTA 1RC0A 3Q0IA 3W7BA 3DCJA 1FMTA 4ZYXA 1RBYA 1NJSA 5J9FA 4TS4A 4ZZ0A 4YFYA 1RBZA 2YWRA 3DA8A 3P9XA 4NV1A 4TT8A 4EW3A 3NRBA 2CFIA 1ZGHA 4ZYVA 3AUFA 4TTSA 3TQQA 4PZUA 4R8VA 1GRCA 1C3EA 4ZYUA 1JKXA 4ZYYA 3LOUA 5J63A 3AV3A 1YRWA
chains in the Genus database with same CATH superfamily
1L4BA 4QVKA 2EDAA 4I1VA 3RSQA 1G8HA 2OHXA 1FSSA 1LRLA 4TXJA 2QXUA 1IY9A 3P19A 1U0TA 2ZT8A 3T7TA 1S1MA 2CVZA 2ZB7A 4EKNB 7ABPA 1IQPA 1XMVA 2FEKA 1ZGAA 3WWOA 3OMLA 4AN1A 1WD5A 2OB2A 2Z95A 3E3OA 2WILA 1OXMA 4QGFA 4AG6A 4BDSA 1B7GO 2PBFA 4NPAA 5KNBD 2A5YB 4OXRA 1XDBA 3C7TA 1VKOA 3ER6A 5E6UA 4P7BA 4BMZA 5HRCA 5DHTA 2EP8A 3AXSA 3HYLA 2JFNA 1WZCA 3TLGA 3ZEAA 1BCRB 1L1FA 1EM8A 4HDAA 3RC9A 1HURA 3LGAA 4Y6SA 4WBXC 2BF4A 2XKAA 1GZ4A 3BH0A 2DHEA 2BWJA 3HA2A 1FC0A 1QRRA 3TSZA 2NZUG 4LXIA 1BVYF 2JHPA 1W88A 4L6AA 5SZJA 1YBHA 3CW2A 3KT8A 4ZA2A 4F60A 2HJHA 1DUIA 4IIUA 1LSUA 3KQKA 3K0AB 3ZD8A 4Z2YA 1P9OA 2VH2A 4AY2A 1NV8A 2Q4DA 3I4CA 1Q0LA 3V7UA 3U4MA 4KNVA 4BO4A 2C20A 1WW2A 2KYRA 3BIOA 2ETXA 3QKRB 1C9JA 1G64A 1OX6A 3ECCA 4TM7A 4F72A 3H17A 5AI5A 1RW4A 4GR5A 4K6KA 2HLNA 2ZIUB 4BKQA 3CLHA 3OAAD 4RVSA 4F2DA 1KKMA 3T9CA 4JI7B 1OKKD 2O8DA 2HLPA 3O83A 4LZZA 2VCHA 1QQTA 4OK5A 1QRAA 1X7HA 2FZEA 1RIFA 1PWZA 1Z45A 2JVJA 1LUAA 2OZKA 2YDXA 4MNTA 4UTZA 1PNRA 4XJTA 4NTZA 1J70A 4HS4A 2VDWB 1R0RE 4AJ1A 5HKKD 3CNQS 4JJ8A 2WNSA 2YDYA 1WULS 1XDZA 1IN8A 5AO9A 4EFMA 3D3JA 2QLMA 3EGEA 4WXEA 4G0PA 2HLDD 2GD0A 2MR6A 3P2OA 5I9TA 5JDIC 1BXRA 1QMPA 5C8DA 1YXMA 1KI2A 2PL5A 4UCWA 3OEWA 4KBFA 5JAQA 3QFHA 2A0YA 3RNLA 4H7JA 1ABEA 3F78A 1Y34E 1BXKA 3FETA 4B6GA 4N76A 1HT1E 1A5AB 1QIJA 3LBHA 1DQSA 1SIOA 1XTBA 3LQFA 5CMLA 1VA5A 2UYYA 4RCZA 3U56A 1TO1E 3U1VA 2ZSFA 3H2YA 2W6IA 4YQYA 3V33A 1Y6FA 2B9EA 3IUPA 3V34A 1K5GA 1KZHA 1W7AA 5EQDA 1K7YA 4DYHA 1ZAKA 2VJYA 1QQAA 3NHRA 5GOZA 1NBMD 1CQWA 2ZPAA 3NPAA 1MABB 4RK5A 3ENWA 3R6GA 2Z4TA 1ODIA 1HGXA 3NB0A 4L74A 3AO0B 3E2IA 3NAQA 4JSRA 2P2CA 4YAFA 5I9LA 2E21A 4CKWB 4W5QA 2XMQA 1DIGA 1N7IA 5F51A 2YHSA 1FTNA 3PFGA 3VTKA 4ZI3A 1GQSA 2IYNA 5IKPA 1T9ZA 4B84A 2VYFA 3TBHA 1GPDG 2RI6A 4ON9A 5KYUA 3L2OB 4CU5A 1YS6A 4EY4A 4UU1A 4N3AA 2CNLA 5FI3A 1JQ3A 1JQJC 2FAXA 1G5RA 2PGNA 4PSVA 5JHGB 4W4TA 4FFSA 3TSYA 4BFXA 2JBWA 3AC0A 2YIJA 4QJBA 2J8ZA 3GZJA 4TXHA 3TWOA 2NO5A 2PSJA 2VQFB 1Y5LA 1RM4A 4IH4A 5HXAA 4H2DA 3V8BA 2F1IA 3BA1A 2C2GA 1N2EA 4Y6LA 2NPOA 4I3GA 2W70A 1YIAA 4NZPA 4W1RA 1W30A 3KQHA 3RUPA 3SZMA 3CMMA 2C9BA 2F90A 2RI0A 1O9BA 3HLKA 3S55A 3CX8A 4GWGA 5DF1A 1BQEA 3IQIX 3VAAA 4M22A 3WIVA 1IK6A 3QE2A 1JEYB 2FFBA 4QJ3A 2VTVA 5TSDA 1RYMA 1GILA 4NLLA 3OJXA 3VXKA 1M8GA 2A30A 1JV2B 2JLSA 4FZVA 4Y98A 1HZZC 1YKGA 2F9LA 1DVRA 2J6IA 3KYCA 3VU3A 4PXYA 2RI1A 4BUJA 5KU7A 2BUCA 3CVXA 2FCRA 2KQUA 1XVVA 2UZ1A 2X2FA 3GUHA 1UODA 4Q4JA 3AT1A 3UJAA 1W19A 1N6OA 1Z4NA 5JZMA 1PHRA 2XGMA 1BMFD 4YUXA 2JA2A 4Z6KA 3OJCA 1XQXA 2AE1A 2W90A 5JYEA 3WY9A 5CXXA 2HTEA 2HA5A 4URHA 2DSNA 2ORIA 2TMYA 4WMLA 1MH1A 2EP7A 4FW9A 1SC4A 4RANA 5BW6B 4WY5A 3U1BA 5FFNA 3T94A 2OHGA 1F8XA 2X0JA 4O8CA 1KMNA 1M33A 1BSVA 2ZI9A 3SE7A 2EEPA 1NVKA 3DE3X 3ZNNA 2ATCA 3EXEA 2J0VA 4UTXA 3WYGA 1FMTA 1NSFA 2LIVA 1ZCJA 2QROA 2WJ3A 1M1YB 3GK3A 1TU4A 4IF4A 4QICA 4XQCA 3RSOA 5K09A 3EF0A 3REOA 4R2XA 3ROEA 1UBLS 1NJSA 2PH1A 1ZBDA 2H2IA 4QXMA 4KWCA 4AC9A 3RCBA 1YDFA 3LP6A 4WNAB 3K1AA 1I4DD 1BDHA 1IG3A 1Q92A 1Z0ZA 5LP6A 1P73A 1TNDA 5SZHB 4Q4HB 3VSEA 4KKXB 3NHUA 4R8KA 3MJCA 4Q4AB 5KOJA 2Y92A 5B1HA 4K9RA 1RPJA 1P1RA 5AM5A 5H02A 4A27A 4C2BA 1RS0A 1XTKA 1M6VA 2RCNA 2V8BA 1EXNA 1G2OA 2ZI4A 3B3GA 3NUGA 4TT8A 3RC8A 5HHTA 1I3NA 5F98A 1AGYA 4S24A 4PHCA 3WK6A 3TFOA 4BWVA 2OGWA 1P62B 5HE9A 3VPHA 4U2EA 2W6QA 1J1UA 1H8HD 3HZZA 3QY9A 1L5WA 1N8TA 1Y9JA 4JUFA 3AR6A 4EHBA 3GG9A 3IMFA 5CXQA 2OKCA 1K7CA 1FXSA 4MUEA 4ZYUA 4EPTA 5K2OA 2CD9A 1OH8A 2OCBA 3PKIA 1WY5A 1FRVA 2OHVA 3ADCA 4N54A 4E5NA 5FBRB 3ACDA 3I4LA 2J41A 2FA9A 2XOXA 4NSNA 1IZ8A 1ZOLA 2DQ4A 2ONZA 1G7CA 3NTQA 5EJMA 2QORA 5ADHA 4TQAA 4JROA 2A9QA 4P81A 2ZB3A 4FFOA 2C9DA 3HO6A 3V1NA 4MV0A 4JUAA 4GI2A 1P2VA 3VPDA 2DT8A 1RYZA 1A9XA 3JRNA 4Y2QA 3FVRA 3WBJA 3DHVA 3V46A 1XTUA 1WA5A 2YYYA 2XGGA 5H59A 4QDKA 2DHDA 3E05A 3HU5A 3JQ6A 3I64A 3KOOA 4LRUA 4GPEA 3L7YA 1UT8A 4C7JA 3FB1A 1AUQA 2I3AA 3CEPB 4RXTA 2HMUA 1OUMA 4Q7LA 2IYRA 3EH1A 3HB7A 3EBLA 4ETIA 4GW3A 1IVSA 3UB2A 1AKEA 2VYVD 3IXLA 4G8JA 2AFIE 4WZBB 3S1LA 5BQ5A 5T57A 4X65B 2ORED 1VG0B 1XXHE 4TMWA 3ORFA 2PNJA 4DQUA 3P27A 4MR9B 2XNKA 1II9A 3I6ZA 2IY7A 3JRXA 3ZY5A 1BE6A 2PX5A 1V48A 1UC8A 2HIAA 3U81A 3IHLA 4JEUA 4EF4A 3D64A 1DFGA 1YZNA 3IILA 5TPZD 1CIPA 2HV8A 3OZSA 5DVZA 2I62A 2FCAA 1QM5A 4TVKA 3PYXA 5LYJA 3V8QA 3FOBA 4XB1A 2YIDA 1G5PA 4GOMD 3DAYA 2QSUA 2B8WA 1BWSA 3DULA 4EZEA 4EI2A 1YA4A 1N2OA 2F3SA 3AVVA 5DEIA 4XLTA 2FHPA 2IKQA 4Z5XA 1KYQA 521PA 2PKRA 4OXQA 3WXMA 5IKEA 3SC2A 1AKWA 1KMIY 1ODCA 3H84A 3HCEA 2H2HA 3CX4A 2REBA 2EG9A 1TGYA 4BBAA 2C9OA 2GYYA 3ST7A 1GNPA 4D6PA 1Y9EA 3DFUA 1N6NA 1X7ZA 4NCXA 6LDHA 1PE0A 2R7MA 2CFRA 2XNCA 4RUKA 5JFOA 3IEVA 3I9OA 4GQBA 2C61A 4GWKA 5BN3A 3ZVNA 4REQB 1N34B 3ICWA 3MS2A 4BCDA 2WUFA 4D9CA 4QPJC 3HNOA 3L1HA 3P9NA 2WIGA 1VYTA 1JU3A 1V1RA 3LC0A 4EEKA 1EXVA 3EXFA 4Z54A 3QNUA 2B1GA 1R9GA 3I76A 5K4GA 5FNZA 2UUAB 5CYGA 5FV7A 1KI6B 4JBXA 1L4YA 2ZT6A 1E1YA 3L3BA 4RV5A 1NXPA 2A5GA 2BGTA 1A9OA 1KO4A 3BJEA 3R3JA 1MRSA 1XDSA 4GM1A 3EIHA 2PKYX 3GZTB 4BMXA 3ZDAA 1PV1A 2AFHA 2Q6VA 3QKTA 3FPHA 3X1JA 4BNIA 1S9DA 2W00A 1UPXA 1SVSA 2FWNA 2RGGA 1Q11A 2V45A 3MMNA 2ZUSA 3B9RA 2BMWA 4ZCTA 4EL0A 2CZCA 2XUZA 3D7MA 2ZIGA 1Z4MA 4HXGA 5BSVA 2YXLA 3GLGA 2ZQ5A 3AOGA 3M1IA 1O5IA 3PEUA 5F1KA 2C77A 3N8DA 1BCRA 1S4QA 3C5HA 3GLHB 4TTSA 4X60A 4IV8A 3LXUX 4ACBA 1J2RA 2PV7A 1JAXA 1KI8A 1XDUA 3CRMA 3KK0A 1LX6A 4R8LA 4EBBA 5L53A 4DV5B 4NOKA 2ZBEA 1YGYA 2RB4A 2GBFA 3WIBA 4Q05A 3EDQA 3U4QB 1JAYA 2JKVA 4QQ8A 3LZDA 4YIKA 3E9YA 1NBAA 1AF7A 2I2DA 4U9UA 1N6IA 3OICA 1N2CE 2Z2YA 3EW7A 3K0AA 4GP6A 2Q5FA 3IODA 4DA6A 1I3OA 2XWBF 2PBRA 1PQWA 4J0IA 4JUBA 2UZ0A 3QHPA 3KTFA 5EWLB 1NF9A 2ZYVX 5IHXA 3JQPA 2VT7A 3QKRA 4B43A 1KY5A 3DV2A 4JCOA 2I71A 3DP7A 1Q22A 4PCAA 3VZPA 2BGNA 4WY8A 4BC1A 2OHFA 3AI2A 2E37A 5AD1A 3BICA 5BWLA 1P72A 1GQRA 3I2HA 1UDCA 5FUBA 3X1XA 5GONB 5CCDA 5U4XA 2YRFA 3INRA 3N6VA 1Z7YA 1BFKA 2C2ZA 2HRDA 4GNKA 3MGCA 3OCWA 4WL0A 3TLBA 3CVVA 1QMGA 2VDWA 1P2GA 2GJAA 3OZUA 3F1KA 4FR0A 3TQFA 5BURA 3U7GA 2FW6A 2EW8A 4OKSA 3UJ3X 1K97A 5AM0A 3WJAA 4YRTA 4DNQA 4HAYA 2R4TA 2ZSEA 3DONA 4Q7KA 4QOIA 3U19A 4Y2HA 1QBKC 1WVGA 3FMPB 3LXMA 1OZ0A 3VFDA 1LI4A 1K5PA 1A95A 4QOJA 4D41A 1GDTA 3CNEA 4MO2A 4URWR 1BFUA 4JHXA 5KJ1A 4PHHA 3E9NA 3LU1A 4I4TF 1X14A 4DT1A 1SB9A 3UJPA 2EFCB 1NJ5A 3C7DB 4ZV4A 2Y77A 1U1GA 4O3FA 3DAPA 2QTLA 3RYTC 1DUSA 3UXYA 4ZEOA 3ZJ5A 3G17A 4US2R 2OK7A 4BVEA 4ZCIA 1VZ2A 4OJTA 1A9QA 3C8UA 4H7PA 4QJ5A 5JEEA 1GQYA 2QAIA 4EG1A 3S44A 3ZE0B 1A27A 4MIOA 2CB9A 4G81A 1GOTA 4YLEA 5BR1A 3NVDA 5CFRA 3DM5A 2WDZA 3LE8A 2HIMA 3FCUB 4Z49A 1Z06A 1ORHA 1GAQA 5AW8A 4YRDA 2WG0A 3QV2A 5ADWA 2D06A 4J1SA 3QEBZ 4XFKA 4CKWA 2Z2JA 4KVFA 3DMPA 4YNBA 2FLKA 1XA3A 4OGFA 4UFPA 2WWGA 5EJFA 4JHLA 2AQHA 3KTDA 1K4KA 1UQTA 2OMEA 1YR1A 3MTIA 4JP2A 3OFND 5EYPB 4M0LA 2OSVA 3ZWQA 3RHZA 3ZHSA 5KHLB 1ICEA 3OZGA 1JFSA 2H0AA 2G4LA 4H0CA 4LBVA 3KQQA 4OHWA 3WO1A 1Q1ZA 3VSDA 3RVQA 4WNCA 4M1QA 5M04A 4U7DA 5DW3A 4BTLA 2PPLA 1ZOOA 2O3SA 3II6X 4XWGA 1RXSA 3QLJA 1VCOA 3UENA 3H1FA 4N41A 1DC6A 1PJSA 2G88A 4QO8A 1I3KA 2CCGA 5IM4F 5L3SA 4EY7A 121PA 2O6LA 2GQ0A 3OURA 5DSZA 1L7QA 2WSSD 5HNKA 3DUFB 3HYNA 2Q3MA 1M76A 4LBWA 1LVGA 1J2TA 1IMJA 3OM9A 2DFTA 5FUQA 1NI5A 3MT7A 1JA0A 8OHMA 2VJKA 3JZIA 1KZ9A 1UADA 1DKPA 3IT3A 3Q12A 4JU9A 3AVYA 2G28A 2Y99A 1D1PA 1S6YA 2VHTA 5I48A 2Q4RA 3D0KA 4LJLA 4JBLA 5CM2Z 1KDVA 5AK0A 4DBLE 4RDHA 3RTDA 4KREA 3CZQA 2WAXA 2GH1A 2QYHA 1DXYA 1JTVA 2QRGA 3PIDA 1GPMA 4G1UC 4PLGA 4RHYA 5EPOA 4CV1A 5CFNA 5JMPA 1UBGA 3AUKA 5DV9A 2R8EA 3K8QA 2C88A 4P4UA 3LCMA 4JYMA 2Q7OE 3WRVA 5I9MA 3U6KA 4LMRA 3IDFA 5K2MA 4IVRA 2FRDA 1GL3A 3N87A 4IWYA 3C7KA 2PE5A 2RIRA 1IU9A 1RBMA 4ZYLA 1SWWA 2ODTX 1MNAA 4PBSA 1ODLA 3DBHB 3STVA 2EKQA 1PS0A 2NZVG 3TTXA 4P80A 1QGUA 2OXEA 4HDQB 1PJRA 5G0SA 4RNCA 1TYDE 4AECA 3SPXA 3ZGOA 5JSKA 4U2FA 5B1SA 2VKTA 3TOXA 3ROZA 4ETNA 1C3XA 1EI9A 4KC0A 1SQGA 3K0HA 4R7ZA 4FOLA 1JDJA 4KSCA 2PX2A 2IFTA 4GYJA 3LDHA 3HRIA 1EAYA 1RWNA 2OORC 4K5QA 4TV9A 3WLHA 3D59A 3MXOA 4DUZB 1RZRA 2PVSA 4WNAA 5ARCA 1SVOA 2RDMA 3EMBA 2O0JA 1OWLA 2YVLA 3GFSA 3O1LA 2PCLA 3ON5A 2QVGA 4FE4A 1LLUA 2YY7A 3F3KA 1JHXA 1P0CA 4Q4HA 3F2VA 4OGKA 3D7SA 1Z2EA 3QG1A 5DXJA 3ZDDA 2QNBA 4HNAB 3LQ4A 2P3OA 4I4IA 1RQNA 1G5IA 1M2OB 2FI1A 4LV8B 2O0HA 5BWNA 1HDCA 3WYCA 2BL4A 2G1KA 1E9VA 1YZVA 5A4AA 3L93A 3VNVA 1CRWG 1DPGA 2J7KA 1TZBA 1M7HA 4P33A 5KJEA 3ZI7A 1TYAE 5KQMA 4ZK6A 2H2WA 1D1TA 4MW4A 1N0VC 4YMIA 1NMQA 1YZYA 2ISCA 1O96B 4QXRA 2FPKA 2AWOA 2B78A 2FN8A 4MI6A 5ALSA 4TUYF 3BFJA 4KSBA 3HJUA 1W34A 3L01A 3PE6A 4PZDA 3GDOA 1HT2E 2PK3A 4RXUA 1DIBA 3BG5A 4IVPA 4CGZA 2LW7A 2KB0A 4GGMX 5EIXA 3AGPA 3T7EA 3CN9A 4D02A 1C4WA 1YDWA 2WTAA 1DEAA 1MKYA 2PKQO 2UVQA 1H2BA 1NW8A 1P18A 5JYCA 2C2XA 3FVTA 4FLEA 2JCBA 4RY8A 2VF8A 3I8SA 2G5GX 4RULA 1E1MA 2P9JA 3COYA 5AVOA 5CT6A 5D3MA 1G20B 3P97A 4E7OA 1BD4A 1NAHA 2A1TS 3COPA 2NUAB 1Q7GA 3EVDA 2GZHA 5D6NA 4V0ME 3RK1A 3BQNB 4B3GA 2ZYSA 2I4TA 4RL4A 1UZLA 4ZOLF 2P5TB 1Q50A 5FBWB 5DNVA 3FMOB 2Q9AA 2Q27A 5AKKA 2NIPA 1AQUA 1Z0UA 5BT9A 5KTYA 5T8KA 4B45A 3G2QA 4OBWA 1CP2A 5HIIA 2QPTA 3ZK8A 4D8VA 1ECGA 1KIAA 3KSRA 4H60A 3ZW8A 1PTJC 1R6DA 2XQGA 2ZAGA 4H7FA 3T0GA 4B3JA 2BHNA 1V8DA 2W6ID 3WNQA 2IP4A 3MWLA 4QNRA 5JROA 3I9KA 4A8JA 4IX9A 1KOLA 3QU9A 1NVWQ 1BOOA 5EN4A 5GPBA 1XWIA 1OASA 3O3NB 4U0KA 4V0SA 1I0LA 5A1JA 2P3SA 3SC6A 2A1UA 2Q0SA 3P71T 3SHTA 2PXAA 3VSCA 4DDTA 4ND8A 3EXIB 2XJ4A 4FDUA 1LI5A 2C83A 4HRVA 5AKEA 3LPNA 3SXUB 4AU1A 4B9EA 5IF9A 2V7BA 3O03A 1TT5B 3UWOA 2MDTA 4Z7QB 5HYVA 2AZMA 3TOZA 4KFRA 1J0XO 2VNHA 4CLRB 2Y9PB 2W0MA 2DZDA 3HKBB 3CPJB 4KVZA 4PX3A 1SN7A 1TCUA 2NO0A 3SKVA 2PXCA 3U37A 3KZOA 3JYPA 4C04A 1VBMA 2BF7A 1FSGA 1A50B 2HRCA 1C2TA 1QH9A 1RADA 2ZG6A 3OO0A 4I3FA 4KYUA 2QR5A 4REQA 2F1OA 3PFWO 4IZ6A 1BWPA 1VPEA 1P0FA 2JW5A 4FOPA 3NX4A 4AI6A 4ZI7F 1EZ1A 1OWPA 1DG3A 1RZUA 2CNWA 1XMOB 4R01A 3EK2A 4NENA 3ZIDA 4EDFA 2E4YA 3GA0A 4IHJB 3L1IA 4QUJA 1QE3A 3TE7A 1U2TA 2EEZA 3GEPA 5JARA 3TLYA 2VLIA 1CEYA 4FK8A 1S9HA 1KMMA 4YJ2B 2C2BA 1E58A 1MEJA 4PYMA 4GKJB 3IPLA 4KAAA 4YPOA 2I9PA 2FE4A 2WJWA 2XLCA 1R12A 1NOIA 5HM8A 3W05A 1Z6TA 1NV9A 1Z16A 3WB2A 3IS3A 4CWAA 3A06A 3GLQA 1J8VA 2ZIVB 3Q7EA 2PGLA 3KVOA 2UUOA 5AVSA 4ALLA 4P58A 1YA8A 1Y4DE 2VT3A 4M1OA 5C7LO 2H8GA 5CVCA 2BT4A 4LZPA 4MB2A 1Z62A 3N7UA 1J4AA 1Z2OX 4GPBA 4LCJA 3EARA 4S0ZA 3TB4A 3DGFC 4YAEA 2CLHB 3WNDA 4ZQGA 4UEKA 3Q0IA 1F8YA 1XEXB 4D3YA 4M83A 1QH8A 2ZPUA 1P3JA 5DP2A 2BEKA 2FPWA 2NO1A 4MS3B 2OILA 1PR9A 3A7EA 4HZUA 3VDQA 5L8VA 3SBOA 5BSTA 3G1TA 3RYHB 2ZRMA 4YCLA 3FNEA 3LQ2A 4PHGA 3CHYA 4MQMA 4N03A 1OJ7A 4FFRA 1HE4A 1R66A 1KE2A 2WKSA 1L5GB 1NMYA 3HTXA 3LL7A 3BWDD 4D8XA 4Q4CA 3ZGZA 5DGXA 3VH3A 3UXEA 2C59A 1UJNA 2LIPA 3AZQA 3C70A 2C3MA 3ELUA 4ZT4A 4DAOA 5KSOA 2QRZA 3DEFA 1E0DA 1Y8QA 4A6XA 5CB0A 1YWGO 2JLQA 2GEFA 1EG2A 1SXJB 2NVBA 1BKSB 2WHXA 3UGKA 1KI9A 4JNCA 3UK2A 4ZKDA 2IX9A 1XZPA 4WN9A 4NRDA 3W5IA 1L3BA 2I6XA 2X8AA 1ZS9A 2Y6VA 3G0GA 3GJ6A 4INJA 3EOBI 3S7ZA 1YL5A 4NKRA 1CY1A 4FGSA 2P4UA 1XN1A 3ZDEA 1A9YA 1JAHA 4HEA1 1G63A 1NT2A 1SKUA 4EWLA 3BQMB 3TW0A 2J3JA 1E63A 2NZYA 1GYPA 4BE7B 2CLKB 4TWJA 1DKRA 5I7OA 1ISHA 3KOZA 4RMGA 4XRGA 5C51B 4C6TB 1DLIA 3ZCPA 1FDUA 2YVQA 2C1EA 1X1BA 2BD0A 2IPAB 2JIZA 3QPWA 4FJ2A 1LTHR 1NJ2A 4NOMA 2H31A 3M1AA 3NW9A 4L3WA 4EL5A 3ZD7A 3ZCUA 1E1CA 2GN8A 1H8EA 4L50A 4KO4S 3RBAA 1RLTA 4O08A 3FWYA 2EQBA 4G0UA 1NQ5A 3SM9A 1K0UA 3OLXA 2QB5A 1G21A 4XD2A 1HE8B 1XKQA 1H0SA 2RONA 1SFRA 3TRIA 3TCXB 4JAVC 3M1LA 3QX7A 1OMOA 1OGYA 4FYIA 4O02B 1SXIA 3EDOA 1RC1A 4PLFA 2A5JA 5WRFA 4TKMA 3JTEA 2JGKA 4DC1A 3OLZA 5IKXA 1F6BA 1U0SY 1TVMA 1DO8A 1PVDA 2XE7A 4JI4B 3C14C 3INGA 3ROXA 5A03A 4OI2A 1GZ6A 1F3LA 2G17A 2DY0A 5B3JA 3H4MA 2FDCA 5H7XA 1YRHA 2FZLA 1XI2A 2YYZA 3AL2A 3MBIA 4NFLA 3VTFA 4C4AA 1G16A 4EUEA 3ROTA 4IKPA 4INAA 3TVYA 4E09A 1J8QA 4WW0A 5JQGF 3PDWA 4QASA 3QE0A 1ZP6A 3CX3A 1KK1A 1SCUB 2LGJA 3CRQA 2ZSAA 2GM4A 3H87A 1TEZA 2PWBA 3H8SA 1TAGA 3D0QA 4G9GA 4URUR 3IP1A 4S0XA 5TXGA 3DUFA 1U9ZA 3K6SB 4LZJA 1PK7A 2WP8J 1QLHA 3EGWA 3LX6A 5EZYF 4YUVA 2C9ZA 1FJHA 3STHA 3CBQA 4V3CA 3L6RA 2LDXA 4PLHA 4Z1MD 5A5DA 1HDIA 1L7VC 1WDKA 1P7VA 1GU7A 4D4HA 1KBZA 2VRWA 1UIMA 3QFCA 4K6OA 1UDAA 4H59A 1Z5NA 2IUUA 2I1VB 4DKJA 3DOHA 4JBWA 1GGJA 5IBCA 1TIKA 2R5WA 2GO1A 4JEMA 4UUBA 5JFGA 4XFDA 4FWIB 4DWOA 4X7MA 1C1DB 1XNJA 3NOVA 3R6WA 5CFQA 4DLWA 2AB0A 2V6MA 4D57A 1DT5A 1JDBC 2F62A 2PEYA 2XUKA 2P75A 4W99A 6PFKA 1NWHA 3RYFB 3TPCA 2A0WA 4MMXB 3TSCA 3B3QA 1KO7A 2IHKA 4P36A 5LXTF 2D2IA 3KAJA 2IZOA 4BAZA 5LP6C 4ERXA 4LPKA 1MO3A 3L9XA 1J97A 2XF8A 4QEKA 1P60A 4DV7B 3QHAA 3K0CA 1KIFA 1YCHA 1WXDA 3KD3A 5CUQA 4Z99A 5ALRA 4ZQBA 3HM2A 3SLKA 3DMFA 3WMEA 4F8YA 4AB1A 2J31A 4X54A 1U94A 1KVUA 4BMOB 1H2EA 1MW9X 3DEHA 1YJXA 2DWCA 3IMEA 4HEHA 3IOMA 3EHEA 3KQYA 4KGZA 4PQEA 3UUGA 4M38A 1Q19A 4UM9B 4L57A 5TNXA 2B3DA 2FSGA 1X9HA 4G4SP 1IN4A 3RVNA 2J08A 3DZHA 4DA0A 3QI7A 4O4IB 5DHFA 4CCYA 1IRXA 3L7KA 4UTNA 4OK6A 3ILVA 3I39X 2CXTA 2HIGA 3IB6A 2WIAA 4HNAA 4AN4A 3DKRA 5AH0A 1TA4A 3VZSA 4KVAA 1EUCB 2ZEJA 4MYUA 3RHTA 1M2OA 1O94A 1U4OA 2PYZA 4IJVA 3SF8B 2P9QA 4LKRA 3EDRA 1N1MA 2ERYA 4LN1A 10MHA 2HXSA 4AQYB 1UBNA 3BSSA 3BK2A 1NYTA 3WLNA 2FWAA 3I2IA 3ONWA 2CV2A 2WU4A 2CBXA 5AJVB 5AXBA 1VPTA 4WEOA 2QX7A 1U8EA 3KXKA 3FY4A 2OENG 2QTVB 4TRMA 4X61A 1NVMB 4TTTS 3SD7A 3MFQA 2A0XA 2SKDA 2WVAA 5TVGA 4BNHA 3S27A 1B8OA 4TYQA 4Y1RB 4ZVUA 4RCYA 2GCOB 2R00A 4R3WA 4BVLA 3A3KA 4KMMA 1NKVA 4GP9A 3AR9A 3AJ9A 3NEPX 4EKGA 3W6ZA 3PX7A 1YVUA 1C30B 4KZKA 1ZCZA 2PFGA 1KSFX 3U6BA 3T95A 3W1WA 3WTCA 7REQB 4IRMA 1KS2A 1G20A 3OIUA 4IP0A 3CKLA 5F77A 4F5DA 2EU8A 2NUAA 1FNDA 4LJ8A 4NCNA 1U8ZA 3I5MA 4FMBB 4DC9A 3A14A 3WSWA 1UBEA 5IAEA 3C8MA 4OL0A 1I8TA 2C5AA 4KQXA 2R97A 2X42A 2RGWA 4DJTA 1XPRA 3WK4A 2CVPA 2OQRA 2XYPA 1KSGA 5IZCA 2GBPA 5KOIA 3MS7A 3I6YA 2Q5CA 4OD0A 3HM9A 2VXYA 3GJTA 4WKPA 3BMOA 2WC1A 4XRRA 1WTAA 4HHEA 4YMWA 4PINA 1IQUA 2QU8A 2AVDA 3GJ4A 3IBCA 4P2BA 1DQNA 5KQPA 1XQ1A 2G09A 1HG0A 1J5XA 2O14A 1L5KA 5EEHA 5JCPA 3CZRA 1M34E 4YHBA 3OD1A 1VHJA 2WEKA 3FNIA 3W5SA 4EA6A 2XYHA 4H35A 3LGXA 1MVNA 3SVZA 5AW2A 5KCZA 4JXJA 3RYCB 2BUAA 1QIDA 4G5FA 5DOVA 3T9AA 4EGFA 2C99A 2V7GA 2YXBA 2II6A 3RAGA 4K8OA 1EFUA 2VRBA 3N70A 3OCXA 2O5CA 3WLEA 3ZBUA 3OWOA 1G5TA 2JGIA 2MMCA 3ZDFA 5BR7A 4DSTA 4J7AA 4E4RA 2J9FB 3BL6A 3ICOA 3M5DA 4HNUA 2O9JA 1GKIA 4XSHA 1TT5A 3CPEA 3F8WA 5JALA 1ETUA 2A58A 2WHEA 4RL6A 1CY6A 1CD5A 4QUAA 1AQJA 2HO4A 4WADA 2FFAA 1O0BA 4D9BA 2Q3JA 3HKBA 4GC5A 2YJGA 4NATA 2FDRA 3GRKA 4QC2A 3BD7A 4RJ2A 4UVHA 3HH8A 4DA7A 4DUGA 4R2HA 1AKRA 4OLBA 2QM3A 4C7KA 4W8GA 3IQEA 4TXNA 4COOA 5LMZA 2G9VA 1SCIA 2WNIA 1N9GB 3KV3O 1MC8A 3Q5GA 4HNQA 4N82A 4F9EA 2QG9A 2RHLA 4U3JB 2UXCB 3WOVA 2FSPA 3DZDA 4MVJP 2ZATA 1D2NA 4P0TA 5F5LA 1UMDB 3ZWYA 2YTZA 1QFZA 3PNMA 4IHJA 2BMFA 3BBPA 1ZD9A 4KFSA 2XWJI 3F3MA 3KKNA 4FS3A 1YI1A 4QRHA 3BN3A 3GGDA 3TUJC 4KNYA 3WDSA 5DBIA 4YJ2A 1J2EA 1XHLA 4H1UA 1N4AA 4DYDA 3IOEA 1Z0JA 2RHTA 2HH9A 2WHQA 5CD9A 3GQBB 2RHHA 4GBED 2ZB8A 1LGYA 3W0LB 4OHRA 3GGPA 3O82A 2BI8A 3Q72A 2E9SA 2XODA 2VHQA 2YV2A 1ZWLA 2C2HA 3I52A 4B3SB 2W2LA 2CD7A 4ROTA 2OOSA 4Q3OA 3FVWA 2WWFA 3Q3HA 3FLMA 5EMKA 3DPUA 3Q3EA 2CDRA 3R0VA 1F2TB 2D5LA 1AN9A 2JL1A 2C58A 4BKPA 5IEJA 4FKBA 4BNMA 1CQPA 1C7RA 2QI9C 3NC1C 4M0CA 5T6BA 3RSCA 5ALPA 1FXUA 4OQPA 4N40A 1ZMXA 2PSFA 3W1VA 2PRZA 2F8SA 4DLNA 2ON6A 3KKOA 1VHWA 8ABPA 1B76A 2WA2A 3IERA 4TSRA 3NGLA 2G6BA 1L8LA 2C4TA 5LIRA 4NDNE 3RKUA 3T4EA 1KAQA 1OAAA 4G5OA 3BJRA 4G4IA 4PN3A 4J0HA 4HLUA 4EA7A 1BDIA 2DUMA 5CFMA 1SQ6A 3LDUA 3ZWCA 2IHNA 4DHWA 2D0OB 3LF2A 4LHWA 5HF5A 5JS6A 2PRIA 3MT8A 1ZMRA 2YZKA 3CLTD 3EZNA 4NNOA 1SXJA 1NUSA 1WPRA 4PQYA 4EVRA 3JVEA 3SLRA 2VA9A 2XMDA 2XITA 1H5QA 1YBFA 3ME5A 4MDHA 5JZBA 3GPCA 3DQPA 4FI3F 2E82A 2RHCA 5FI5A 1KFCB 1OAOA 5ENDA 5ALEA 2VWPA 5K3EA 3KE8A 4LFCB 1EU1A 2QPAA 3TLEA 4NIMA 5DGTA 1CDEA 4D8YA 3AEQA 3NYRA 1V43A 3ANYB 1JG7A 1P80A 2OZLB 2YWBA 4ZEXA 5BSRA 2AHOA 1IE3A 3HU3A 4Z53A 4RKRA 2OO3A 3GJYA 1OGIA 4YX9A 4W5TA 4C6TA 1G2IA 4XEHA 1NDUA 2Q3FA 3A27A 3D1JA 2D1YA 2PGOA 1E5LA 2EYUA 2ZKLA 3DCJA 3I2YX 4FQ5A 2QZ9A 4RLFA 5EMMA 2I65A 4IDEA 5HEKA 1YUNA 4TWZA 4D3ZA 1B4DA 2J5QA 3MHTA 4YDSA 4YUAA 1Q3TA 5IG2A 4P3YA 5EHQA 3REFA 3CRVA 3ICEA 3ZK9A 5T64A 4NH0A 3LY5A 3K3PA 4HB0A 4PZEA 1RP1A 2E89A 4PPQA 2H18A 1D1SA 1KNQA 4BRSA 1OHHA 3FTCA 2XWSA 2HEGA 3H4VA 3KOWA 2O2SA 2ET6A 4HFJA 3O4GA 4R4JA 5F5XA 2ZJYA 2XA9A 1WTCA 2J7PA 3AF5A 2H8KA 3KQSA 5BNTA 2WG1A 3BXEA 1UPCA 2QYOA 2WHPB 3ABIA 2RIPA 3HSYA 4X20A 3PNBA 4AKSA 4ENQA 1K5DA 5DX0A 3FNGA 1XL0A 4MOWA 3AM3A 1IDN1 4R0VA 4GMDA 4QDUA 3ZHOA 4HNTA 1FMLA 1Y8RA 5AK3A 5I7VA 1A9SA 4ER5A 2XZDA 1H6AA 4GSYA 1H2WA 1W85B 5EHNA 2NU9B 3S2SA 4CETA 1IL0A 2HUPA 2EJWA 2MWMA 4FHCA 4PSCA 2QX9A 1ID8A 1EDEA 2K2QB 5TMPA 1JQ5A 2H2AA 3I45A 1NY6A 3M5WA 3PNPA 4RZIA 5YASA 3K2QA 4AMVA 1RABA 2PV0A 4DCMA 4XCQA 3TQIA 3NHLA 3P0EA 3LHDA 1W5SA 3LT0A 1MR3F 4JQOA 4Y3UA 4B6OA 3E3AA 3GO4A 1JG3A 2D4AA 4K0RA 5AVJA 4G0ZA 4KLNA 3MMPA 2HTFA 1SCUA 2VWHA 2FK8A 4CL2A 3G82C 5AT1A 1LJLA 2QZ4A 2YNMD 1THGA 3GRYA 3WNZA 5JCJA 5IC4A 1NQVA 3GMTA 3RFVA 2ATXA 2CL7X 3EVGA 3H42B 3FHTA 3WLJA 1NX9A 3K6SA 4XWAA 3RS0A 2WYVA 2ZJOA 3VOSA 1WUIS 4YJGA 1KRWA 3GLRA 3A4VA 1C1XB 4PICA 4GPD1 4L8VA 4F9FA 3ERCA 1VJCA 4RF5A 1L5RA 2V6IA 3JZMA 3VR1A 4CXMA 4UTVA 2Y67A 3T5TA 3WQSB 1QVAA 4EEZA 1SU6A 1WAMA 4R1TA 2FRDC 4DIFA 1Z2CA 3IIIA 4WJZA 1HDZA 5DH9A 4AJ2A 2X13A 2CXNA 4PZPA 5IH3A 1HDXA 1B43A 1YQEA 3A9WA 3BRWD 1S7CA 1RWPA 2C3OA 3G2LA 3CR8A 3HJHA 5DBFA 1G9XA 3JSAA 4PWYA 4DLLA 2ZRCA 5KHOC 4YAKA 3VU9B 1LZKA 4EATA 5KTOA 1H3NA 1VJRA 1WOYA 4U7GA 5F7JA 5CBPB 1QO0D 2OV6A 4X85A 3SQWA 2JFQA 3GRFA 1XMQB 1CP3A 1R6AA 4W6ZA 5AVYA 3NC4A 2CNWD 3GFQA 4X90A 1H23A 2GERA 1ZH2A 3GLSA 2XGOA 2MT9A 5JSZA 2WF9A 1ZH6A 4XB2A 4R9NA 3CLUC 3NYWA 4DM7A 9ATCA 3CLTC 4PZAA 1IZYA 3HKDB 5EUBA 2RHOA 2CKDA 1TD9A 3UKOA 1EUZA 2EBFX 4ARSA 2GESA 3MVEA 4NBNA 3DNFA 3NDIA 3BSYA 1DQYA 4W5WA 3OZFA 5E8JA 5DSXA 1Q0PA 1YZGA 3DVAB 4XGNA 2R87A 1N2BA 3CE6A 4ZJPA 2ZRPA 1MO6A 3OI7A 1M5TA 3LRXA 4MJXA 2Q07A 4K2AA 4G26A 5SZKB 2IXEA 3HLYA 4UVDA 3K9HA 5JC1A 1T4DA 1GDHA 4RFVA 4KE6A 1Z3IX 4UOEA 2JC3A 4G8BA 3WDLA 3ZHYA 1X9GA 4AUMA 2ZGVA 3N59A 4HNVA 1AK1A 3AM1A 1FVXA 4YDQA 3FNQA 5FV4A 2FZCA 5BYKA 2SKCA 1Z6QA 3SF8A 5KOHA 3GZNA 3UOGA 1N6PA 1U0BB 4RPLA 5J43A 1EK2A 2FWJA 4J0GA 4OI4A 4QYTA 5COAA 1RJWA 1UKBA 3BZUA 3CUTA 2N0SA 1FQKA 3LFHA 4QXQA 4WOCA 4DIOA 4EA8A 5HSGA 3T7AA 2GPWA 1USIA 2PKEA 4LY0A 6NULA 1DAPA 2M98A 3X1ZA 3RJZA 4JI3B 4FU0A 3U16A 3OLCX 2ZUBA 3K0SA 4H7IA 4OXIA 4PR0A 1DKOA 4TRJA 3FBGA 5KQLA 4A1OA 3E1KA 3KUXA 3W7VA 2CLCX 2GCOA 4ZGGA 4ZANA 3QV1A 4LRQA 4YRZA 2BGGA 4ZARA 2XNHA 4BO9A 2PRSA 5JNWA 4O4HA 2QG6A 3C6KA 5T8KC 3HACA 1NBME 1C30A 1TEVA 3N05A 1W9MA 3TVDA 4CKEB 3RODA 4LOHA 4RIEA 4QBHA 4EJMA 5HGJA 1V8PA 1VIYA 5FYDA 3L18A 3TG8A 1F8UA 3C48A 1G5HA 1L5FA 4TTPA 5FA8A 3ZHTA 2R1TA 1GAEO 4A8JC 4C20A 1ZG3A 2YN4A 3AGQA 2FGKA 3PFBA 3R5HA 4JLNA 4LHVA 4AXXA 3BB1A 1AO3A 1EMDA 2BBWA 4INOA 1ZD1A 1LDNA 5HA5A 1MGOA 2JIZD 3WMFA 4QYWA 2HNBA 1QO9A 4GXRA 3Q4GA 4YRBA 2EW1A 1CEXA 5J1SB 5CHYA 1EXWA 3FTNA 3K0BA 4J1TA 2DEUA 3E53A 2QUJA 4A5SA 3PEFA 4FFWA 5ALMA 5IJAA 4BHTA 3OKPA 4X3PA 3LJKA 4DL9A 1Z0IA 2JGJA 4ZK2A 4KN6A 2Q4OA 3ZH9B 1NSTA 3NJ8A 4IKEA 3GWZA 5EC8A 3M4NA 4HFMA 2GZRA 4R2IA 4UBLA 1J5EB 3P5SA 1CVRA 3I5XA 4XLLA 2HEIA 3GJ0A 1VHQA 3DVLA 1SBNE 2WZDA 4LC9A 4MUGA 5EIBD 4N7BA 4EENA 5C18A 3ZUPA 2J9FA 2YHBA 4GXQA 1I7LA 1TW3A 1JLKA 1NMSA 1YS1X 2J6BA 3CF4A 1EX9A 3EVEA 4FDAA 1P5FA 4UJ3A 3K70C 1OXUA 1R64A 3ORHA 4Q3BA 1Q0HA 2C2YA 4YJ3B 2R8PA 3RRBA 1X77A 3A4MA 1KY4A 3P9IA 3IKTA 1A71A 4FCCA 5FUVA 1YMQA 3QE4A 1JJBA 1IFXA 4JLBA 4LJKA 3GJZA 4EW6A 1Y98A 1FFCA 2LVBA 3B70A 3FUCA 3KQPA 3PU6A 5C5EA 3F2IA 3TNDA 4I66A 1I01A 2D7JA 2RH5A 3G6WA 1N9GA 4LCEA 4DLZA 3DLBA 1CUYA 3F96A 1U8YA 4U3JA 3AU8A 4GUAA 2WTMA 2VNKA 3ZE7A 2C00A 3CUSA 4CCSA 5K8UA 1J0CA 1VYHA 1XIVA 3L4EA 4JP5A 2OYSA 4KE7A 2CUTA 5GQSA 2WQ7A 1K3FA 2NSYA 3I8XA 4HXEB 3UK6A 3L6CA 3STXA 1S3GA 2JG3A 3THYB 5BO5A 5JJ5A 4MUFA 4J4TA 2FKNA 2P9FA 3FPEA 2V0NA 3GQBA 3ISJA 1ORTA 4JB0A 3IAXA 3HCRA 3BCUA 1E6UA 2ZRGA 4C6SA 2Z8YA 5IN5A 1CR6A 4EUNA 4BN4A 3W2GA 4V24A 4JLOA 4JYZA 4I1YA 5F23A 4MW7A 1G8SA 5JRJA 1TK2A 4EKDA 1F2TA 2Z8ZA 3MUFA 4TV8B 4IDHA 1SB8A 3G2MA 5JXIA 5LJIA 2WTEA 1QUFA 3JQFA 4WOJA 3LG2A 3BUSA 1MDBA 5CM8B 5KKNB 1ZAYA 4MDYA 3BWXA 1NXQA 2OG1A 3EXG1 5FTNA 1JS1X 3F47A 3QLVC 5JXWA 4G24A 1SCDA 4LHSA 2QQFA 2Y0DA 4P98A 1I6KA 3QEOA 2RMKA 3C85A 4L75A 4UAGA 4CTOA 4J94A 4BMDA 1MD9A 2I67A 4QHTA 4L4UA 3ZU2A 3LHSA 2P90A 3D2BA 3MERA 2ID9A 3RC1A 4BBZA 1A5ZA 1VSQA 1DEOA 3GC6A 4NZMA 2VL7A 3L8EA 3T3EA 3ENNA 2LTAA 3BWCA 4GOND 2B4QA 4KDFA 4A2PA 1YR6A 5I7SA 3C8ZA 2CW5A 1JYFA 1ZIYA 1U7UA 2HIHA 1RDFA 1F4PA 1RJGA 1SEVA 2XCLA 3LYAA 3B3FA 3HVUA 1KR5A 3MTJA 4H08A 5ALZA 5BYJA 4D5GA 3LWNA 1R0CA 3Q40A 4EELA 3KZVA 1NQXA 2Q3HA 1CUVA 1RWQA 3OH8A 1Y80A 2AIRA 1AGXA 2C03A 4TMFA 5TF0A 4YP7A 5BVHB 5LQNA 1T2AA 1VSVA 1KR2A 2RG1A 1L1EA 1AD2A 1UANA 4TS1A 4B7ZA 5FLXA 3E18A 4QBFA 2P30A 1O94D 1JH9A 1IXRC 1ND5A 2ZRJA 3IQXA 3OQHA 4LDZA 4O4LF 4X3CA 4ZRNA 1IIRA 2WWTA 3WGMA 3T9BA 3MB5A 1DP4A 1OXTA 1HSZA 1W48A 2MSEB 3F8SA 4EHNA 1KK3A 3JQCA 2BZGA 1GARA 2PUEA 1RXCA 2XZTA 3DFIA 2ZZKA 1D4OA 3NYIA 3R8XA 4RA6B 4BLVA 2FXVA 3EA5A 5J2TB 1SZJG 4LRSB 2BGLA 1Y5IA 5EKDA 2AVNA 2EBHX 1A2KC 5KUTA 1UINA 4OHMA 5EIBC 3ZWAA 3HB5X 4QTYA 1QR6A 3UWDA 1H0HA 3QE9Y 3B5IA 1LU9A 4ZAVA 3QTTA 4AT1A 5LN1A 3L6BA 4UVGA 1UQUA 2GJ4A 4DV2B 2NQTA 4DKXA 1Y7PA 3BAZA 3GB9A 1GT6A 4TT3A 3PTLA 4FDTA 4W8HA 2W58A 1KVRA 3D3QA 5F64A 4B82A 5B3JC 2BGWA 4DOMA 2BKEA 3NTXA 1LI7A 2Q2QA 4XH9B 1SXGA 3ANLA 3ASVA 3JARB 3LL4A 2PT9A 2WHPA 4BP8A 4D9FA 5K0CA 2D3TA 2EGGA 3ZW7A 1JR3A 4GR9A 2I6TA 4HVCA 3V4LA 3MCAA 5KTRA 2W6NA 3QX8A 5B6PA 3GPIA 4HF7A 1US8A 1JF8A 5ALUA 3IALA 1PD0A 4FVTA 1W85A 1E1DA 3ITKA 1EK1A 5A3VA 4X45A 2VSQA 2NXEA 3AESA 4EW1A 4EJSB 2ZS8A 3TCNA 3WL7A 5EJ4A 1PG2A 1K6JA 4GLOA 2VP0A 4P34A 3TQTA 4CODB 3E8MA 2QTNA 2GMWA 1ZISA 4GLBA 1FY2A 1YQGA 3DDWA 3R74A 2F48A 4GLFA 2QLJA 3ZTTA 1RWKA 3S2GA 4AFNA 4K6CA 1X7XB 2EJCA 3A70A 4RZHA 5JD5A 2AOVA 1M1NB 3T34A 3KVYA 4P3KA 2ZREA 3V8VA 3KG2A 1V0JA 2YV5A 3WGVA 4RACA 5IDWA 2EZ9A 1ML4A 1U6JA 4O2RA 3W2HA 1ZW1A 4YCSA 5IANA 3IR7A 1ZA2A 3PITA 2IXBA 1C1XA 1DXHA 1HYQA 1T3SA 2O2JA 4IIJF 4OHPA 4YDRA 3JPYA 5EPUA 5F2KA 3RBZA 4QOGA 1NXTA 1Q1EA 1XWWA 3AJAA 4OOEA 3IBSA 5CLGA 5F35A 4G5SA 3CVWA 1YQUA 5AI6A 2E85A 2ZYIA 3MM4A 5KWJA 1TB4A 2R5FA 2XDQB 3HWSA 3L8FA 1N1GA 3BJIC 3M6VA 4YAWA 5FLKA 3QWAA 3WWEA 3EC2A 2X0KA 2CZGA 3M34A 1HKHA 3CUEF 4J3FA 4NCJA 3K0CC 4HVAA 1Z4KA 1ZC3A 3D54D 3Q5DA 5CBPA 4XWWA 3M6MD 1HNNA 2XKKA 4MW5A 1IHUA 4MQ4A 5TRTA 5A3RA 2X9LA 2B7LA 1QHFA 3A0UA 4WBSA 3LYUA 3EQ2A 3V1TC 4KQWA 3BCHA 3KLPX 5BSUA 1K8XB 4O25A 3T7JA 1B42A 3OPYB 1X94A 3AHCA 2IS6A 3HKDA 4CHGA 1G19A 4JZYA 1EK5A 3WK8A 3MW8A 5C1IA 4A1FA 7AT1A 3LRPA 1QFSA 1NWCA 1J7KA 3AF1A 3FFAA 1DCMA 2V3WA 3FPGA 3P9RA 4HNHA 5DNWA 4RA9A 4ZAGA 3WL6A 4LCBA 2GSWA 3DD1A 4YUWA 3UYLA 3DVAA 4H31A 4MR7B 4MWSA 1WZUA 4JVNA 3EGVA 5TJ9A 1KE1A 3UBTA 3RNOA 3NASA 4R2MA 2QL9A 3WHIA 1KAOA 3E58A 1I9GA 1W52X 5CYPA 4X8MA 4HS9A 3JY6A 1HLGA 5FOVA 3WWCA 4BLRA 1NQOA 5ERXA 2EGHA 2NQ2C 3I6MA 3ODPA 4H6XA 4PQGA 5SV2A 4PIMA 3MPOA 4DLVA 4D25A 3P4XA 2X40A 7YASA 2CNKA 5BSFA 2EX4A 2PX4A 5AW1A 3VKGA 2AW5A 4RVFA 5FPYA 1NVVQ 3ED1A 3NT5A 4S1VA 3OHMA 4IHKA 2OHIA 3WDKA 3TJRA 2WSIA 4TMTA 2XRZA 4KLCA 3QBEA 2R00C 3UPUA 2VUUA 1E62A 3ZC3A 1I1OA 3O95A 3GD7A 3B9PA 2FUKA 2UYCA 1ZOPA 4XQ9A 4MP8A 2EXXA 5KVSA 2AN9A 2BFDA 2QTMA 3TN7A 2ZRDA 3NANA 3P2MA 3IP3A 4F56A 3ZR4B 1EUYA 2PJZA 2KMLA 3SKYA 2W4MA 2P27A 5F12A 3TQRA 4AMBA 1E4VA 2BPOA 4MGIR 4OFXA 2ZYRA 3LC2O 4B73A 2FUEA 1GM5A 2DETA 1G42A 1N3LA 1SXJD 3GARA 3OEEA 5LM3A 3VDNB 5IZCC 1VL8A 1D4FA 3IQGX 4AUKA 3ESYA 3RS4A 4BQFA 1E77A 1QG2A 3E2PA 1IN1A 1EFCA 4YP1A 3UMRA 1X13A 2W11A 1XRPA 2HA7A 2C5FA 1CDZA 1K5HA 1GUBA 2FFRA 3NNNA 4EO4A 3L9WA 2B3TA 3UH0A 1SELA 4MAMA 5F7XA 2MU1A 5DM70 4TSKA 4NICA 2YCBA 3W7BA 3WGGA 1FYDA 5BPHA 2FE1A 1KGSA 4FCTA 1PYGA 1AB5A 4X1YB 3UGQA 2XB8A 2R7NA 2BKXA 2RC6A 2BFBB 3WYNA 2BOVA 3ER8A 1BJKA 1E4EB 1JSXA 3L40A 3H65A 4XR9A 3R9WA 4M8NE 3VVBA 4CDNA 3BK7A 3L7BA 4RQUA 4F4CA 4BPRA 2QD5A 1Y1SA 1FTQA 4PE5B 1UMBB 1XA4A 1EX1A 3MMSA 3FE2A 2WM3A 1P5JA 1NN3A 3EF1A 4KDCA 2G7ZA 5F4BA 5FHRA 1QLJA 4EYSA 3VNQA 1OHHD 3HK2A 2H1LA 3JAKB 2KSQA 3CEJA 1HYGA 2H3HA 2G9ZA 3D6AA 2J7PD 2HGSA 4PAGA 4BX8A 2VOJA 2BH9A 5C5IA 1V9CA 3CONA 5AJXA 1T9HA 3GHYA 2QJRA 1UXJA 3CNOA 3OIFA 4US0R 2AJLI 2PLNA 2W0SA 3L7NA 3RU3A 1KRXA 1OBCA 3E7XA 2PA0A 3NRBA 2G9UA 5ENVA 3E0QA 3B9QA 2PIAA 3MOIA 2YW9A 3AEUB 4OQYA 3UHFA 5F4ZA 3DWFA 1OBHA 4PLCA 3PHGA 1JP7A 2QD2A 5FH9A 1J99A 5TS3A 1YCGA 1T35A 2JVKA 3MTDA 3D6HA 3CIOA 4YJ3A 4BZPA 5A9TA 3AERA 5IULC 3JQRA 1V2GA 5FDFA 3L0ZA 4QDJA 2WYIA 4BGEA 4MQBA 1MVOA 1UXHA 2CNDA 2QM0A 4Q21A 3RRNA 3COZA 1STOA 3HUDA 3V3KA 3V55A 3WRYA 4F6RA 2F3TA 1W96A 3L77A 4D9EA 4LHYA 3NTOA 2PT6A 2NAFA 4RPIA 2IH4A 1RJ9B 3D2LA 1TKBA 1LBEA 3D4IA 4WHMA 3A1EA 4ZO4A 6ABPA 5ITWA 3L84A 2BE9A 1XF9A 1EP2B 1N5JA 1TKAA 3AIIA 2BTQB 4YQEA 5BN5B 3AHHA 3ZOZA 3OTGA 1G6KA 1Q91A 4OYHA 4MUBA 1YR8A 5DIZA 4IH9A 1AKVA 1L5LA 4P0PB 2F3QA 1U4SA 4G0MA 5G0VA 5HE8A 1GJRA 1PWEA 3T8YA 3TRFA 1WQ4A 2B5VA 1QKIA 1ZGZA 2OFPA 2Z4SA 1XLUA 1IAVA 5ALTA 3DTVB 4B8YA 5E4TA 4UU8A 1SH7A 2INGX 2JJQA 1X1SA 3GMSA 3GP8A 4X71A 4G1EB 5F3RA 5TX7A 2FJPA 3JSXA 4PBTA 3GUUA 4YACA 1XKTA 4GFDA 4JASB 3C6MA 1A8IA 1CUCA 1U0GA 1BDMA 1M73E 2I22A 3GGGA 3LKDA 2DPHA 2XXJA 2CDCA 3DXZA 4ZO7A 1B2RA 3A1SA 4LQCA 3OTHA 2AT1A 4LHXA 4ZCSA 2WJYA 5A5GA 4FJ1A 2I29A 3K30A 2I6QA 4HLUC 1M1UA 2ZWOA 2WF8A 1PZXA 3DF7A 2GZMA 1GPNA 3I3OA 4P4NA 3IO5A 2V3VA 2JGDB 4HPWA 3SJCA 4DSZA 3LBIA 1RLJA 1IJBA 1A9PA 2WG2A 4LXXA 1SXJC 2K2WA 3IFSA 4MS1A 3ZWVA 4A0QA 5LP6F 2P9YA 3DP9A 1NXOA 1IBSA 5KYKA 1U0OC 1XZLA 4HFRA 1LBQA 4RKFA 1L4EA 5CGQB 4A6PA 2POQX 3TB6A 2BW0A 5KNCA 5KVVA 3BFKA 2GEBA 1EWVA 2NV2B 1OAOC 4QYIB 4Y0NA 4XGKA 4KI0A 5IS2A 5IEBA 2Y71A 1KQOA 5BYBA 1KOJA 3IV7A 4UM9D 3DKKA 1MDFA 1PL8A 1FJGB 3JQ7B 5KTMA 2HMTA 1VQ1A 2ZR8A 1VMEA 2VK2A 3D31A 3NWPA 4NC9A 1RHJA 1FFDA 4OMDA 1EKXA 1WZNA 3ABQB 3EIOA 1HORA 3IQHX 2WIBA 1ORRA 1SKBA 4G0WA 2N46A 1SCJA 3Q3JB 3LW8A 4IMJB 2X4IA 3DEIA 2UDPA 1VYUA 2AOWA 3BZBA 4IOMA 1CEEA 3UUWA 1K0FA 1X7YB 2BMVA 2OGUA 1UK9A 2GT1A 3F46A 3LKZA 4FFPA 4HMQA 5FKJA 4JBIA 3OJWA 3PIRA 1NLZA 4DUYB 4JFRA 4EY6A 2I1LA 4YRIA 3BT7A 4LRWA 3H1EA 4LXGA 4IJUA 2X4DA 3PQ5A 3DO5A 3REQA 1EFTA 2W2NA 4Y9SA 5FA6A 3MQ4A 3KFLA 5J2TA 3MFYA 4IQ4A 2O8FB 1HOXA 3ETHA 3PGVA 3NBAA 1MLDA 3TLKA 3WLOA 1EJ0A 5CVUA 4N65A 5TR9A 3ZTYA 2YJZA 1ECJA 4CMJA 3GEHA 2O06A 2W6CX 4LGYA 4AJOA 5ES4B 3OQBA 2PX0A 1TM1E 4MV4A 3LV8A 4BATA 4GBGA 4DXHA 5CT4A 2QK4A 3WJ1A 5DFAA 1XZHA 4LXYA 2SCUB 1GGHA 1T8RA 4C06A 2HBQA 2UAGA 3P9PA 3ZGLA 3JARA 3I1JA 4BQIA 1X87A 3NFYA 4DLAA 2Y1WA 4I8IA 5ESWA 4E2XA 1O0CA 1CUSA 2ZITA 3ZE9A 4TLAA 2HNAA 2IU6A 1R8SA 1Z2AA 3ZJTA 3RUHA 2PS3A 4MXDA 5FI1B 3SJZA 1RBQA 3WE7A 1S2NA 2D54A 4D56A 2PZFA 3LDAA 4DXAA 1U7OA 1JHPA 1PZMA 2HWWA 5LYJF 4KIWA 4JVLA 3U2QA 4EJSA 2O57A 3DG9A 1NNEA 1ZVVA 3SIRA 2E2WA 1L7MA 2WINI 3L5KA 4UVIA 2O5EA 2CVFA 1CUZA 1O54A 3CO0S 3I9NA 2O3JA 3HB4X 1F7VA 3O4VA 1SBYA 3AFIA 1PR6A 2B7CA 3QOXA 4MZXA 4LSGA 5CA0A 5BN4A 4MGKR 2R1UA 5E0KB 2IU0A 5KQRA 3D8RA 1GPH1 4UHKA 1E2FA 1NN1A 3HZRA 2WOOA 2PQ2A 4HAXA 2AUMA 4WSOA 5D85A 1KI7A 1GTL1 2EWMA 3H2GA 3IEUA 2FLWA 1KKUA 2YXNA 4ZO6A 3ZHCA 4Q01A 1XQ6A 2ZBVA 1J25A 3RVPA 1X1RA 3RM3A 4AZ0B 4YK7A 1TK9A 3KRTA 4K9LA 2RKBA 4B2PA 2A9JA 3QVUA 4X00A 5IMSA 4BGUA 1WSBA 4OMFG 2XDQA 3X1KA 1R0XA 4I55A 3BWBA 5FB3A 5E3HA 5I7WA 3G9TA 2XYVA 4PY2A 2ZIXB 1EVEA 3QPDA 4M1TA 4KSYA 4OU4A 1DTWB 4KL8S 5F9MA 2AJ8A 5KTPA 4Q48A 1U2QA 5CX1B 3U9SA 1I33A 2OUKA 3R77A 4CM7A 4RTMA 1GVNB 2YMPA 5CRIA 3QNWA 3QBDA 2XWQA 1FUUA 2VBCA 4HOYA 5JNRA 3ZGNA 1FPMA 4WAUA 4INPA 5J47A 2VBFA 2V3CC 2X5JO 3OPYA 1ZRHA 3IUMA 1ZUNB 4IDFA 1X0XA 1POXA 3IOCA 2AA3A 5B37A 3WFZA 3KAKA 1MAUA 3N0WA 5B4TA 5LBUA 3DGEC 3MCUA 4OP2A 1EWTA 2GXUA 4IJQA 2WWIA 2YY5A 1Y3FE 1RRVA 1Y4UA 1JIJA 1YHYA 2Y68A 1OI4A 2X1HA 4RD1A 5HJEA 1FP6A 1H85A 4YFYA 4AIRA 1GDDA 3BGWA 1EGHA 1V4VA 3NHYA 4MJLA 3UC9A 5JQWA 4YRNA 4G67A 4ZGBA 1F5SA 3DOCA 4NU0A 3FPKA 1UFKA 3DFFA 4XB6B 5JDCA 3HEAA 3L0SA 4N7RA 2P6UA 1JG2A 3EIEA 4NPCA 3WYDA 4EX6A 4MYTA 1MT0A 2QI9F 4UBOA 3JATB 5KNCH 4CQLB 3ID6C 4E1AA 4RFSA 3CTMA 5LDGA 1DMSA 2W43A 4TQGA 3QOYA 1UOOA 4BNTA 1NKTA 1X70A 4IW3B 4AW9A 3P2IA 3PD7A 3UK1A 4WXHA 5EWJB 3DZCA 4B32A 3LPCA 1EFVB 4MVJH 1YZHA 4K9KA 1U2ZA 1D0SA 4AZ3A 1ID1A 2O3TA 2YCLA 2WJ4A 5BMOA 1E9DA 2FFQA 4Y1GA 2JB9A 4CKBB 5BSMA 5L3QA 3WLQA 3T1HB 3BJMA 4GOKA 2MHCA 3FI9A 1RR6A 2A0UA 3FDJA 1ZD5A 3DMDA 2Q7DA 1PWXA 3WWZA 1NW6A 3HR7A 1GPWB 4RGBA 2JLXA 2L17A 2CY0A 4B0OA 2JIMA 3FNBA 5IBRA 3ZDBA 2DUWA 3KZNA 3K9NA 1FYEA 4KQGA 3ICCA 2PD6A 2GN0A 3BVPA 1XKLA 3N2YA 3T5GA 4GDFA 4B3RB 1EVLA 5JPIA 4J1TC 2WR8A 2VPZA 1W5EA 1DAEA 2PO7A 2IYOA 2QT9A 1N3IA 2ZQYA 3KFVA 3LHIA 5F5NA 1WKVA 2HDOA 3R7WB 4TMYA 5CPBA 1W59A 1T10A 3R6TA 4C14A 4BNFA 4X1YA 4HT3B 3J81A 3EPKA 5IUNC 2F1HA 3FLAA 1QH1B 2JJ8A 4MAAA 4MIEA 4Q3LA 3PJGA 1HYHA 4EK9A 2BFBA 1FDSA 2HBZA 2ZRFA 3R40A 4FYKA 4YFVA 2HF8A 1VE9A 3TPFA 4ZN6A 3B82A 1U2RA 3LUHA 1ZIXA 4HGYA 1PFKA 3USZA 4LRYA 1UMBA 4AJJA 3UXHA 4HDMB 2YMQA 1QAOA 2NSJA 3FI0A 2WTXA 3H5AA 4MA4A 4R16A 2WSLA 4M8LA 5E7QA 4QM7A 5H70A 4YUYA 3Q7PA 5C0OE 2A67A 4H9GA 4DR2B 1N9ZA 3JAKA 3VAZA 3TDMA 4LK3A 1I2BA 3VA7A 3OWXA 4GQIA 3VYWA 1WR8A 4PLZA 2NZ8A 3OQ6A 2ZYDA 3DB1A 1GUDA 4GF5A 2BEWB 2ZBGA 2IDKA 1RWOA 3GDWA 2VQDA 2ZYAA 3EEOA 4U00A 4HAVA 1XHEA 2XAUA 1JX6A 3PUXA 5L95A 4P53A 4HNRA 3RJ9A 5D00A 3O0DA 2IOFK 2AMYA 3FUVA 5IT4A 4HGPA 2HJGA 3OMXA 3Q2IA 3HBJA 1V26A 3DVQX 4LYHA 4L28A 3E5RA 3GVIA 5GWXA 4ZFNA 1Y1KE 4JJAA 3IIMA 3V6MA 1WU8A 3QXJA 4BB0A 4EYEA 3ONVA 3RE1A 1D6MA 2POCA 4LVOA 3RLFA 1KPGA 1N2HA 2ZTVA 1LSJA 3JWJA 4JBYA 5AM1A 4EG8A 5JS7A 2UYHA 3QJGA 4DY6A 3C3EA 3JYNA 5AKJA 1EUDB 1E6LA 1VLVA 4RGYA 3X2FA 2DF8A 2R8RA 4HV4A 3L7LA 1YE5A 4LF6B 1GKKA 3O7WA 1TTHA 1ESEA 4MUKA 1W581 4JL8A 4F7WA 4OQQA 1OQAA 5EE3A 2WUVA 5DHSA 2EJBA 3QVLA 1OZGA 1V45E 2BE7A 2AYYA 1HWYA 3BFVA 2GEJA 3MMZA 1T36B 4KJXA 4ZVOA 3VGJA 1F1BA 1TC1A 2WWHA 1DRUA 1I4LD 3E9CA 1GG8A 3JQFC 4HUTA 4B3IA 2ZRBA 1C14A 2PWPA 1TF2A 1NUAA 1U2DA 3DTVA 4KAFA 5U4QA 3T5MA 4RBNA 3CH4B 2I7DA 2IODA 3DXYA 3DAFA 4LZLA 1KVTA 1W76A 3B85A 4Z0PA 3GXBA 1HDGO 4NCHA 3U3XA 2H85A 4TTJA 2OHJA 2E4XA 5A4MS 3RAJA 1EESA 3PUZA 3SZ3A 1R0KA 2RHDA 3A1TA 5C8YA 1NMXA 4EJ6A 4Y1EA 2BCJQ 2E4ZA 1TMYA 1H6CA 1PNTA 2IPNA 2QZPA 4Y9UA 4CLOB 1UKVY 1JU9A 5BRAA 4HDNB 3RVOA 5CB4A 4R84A 4W5RA 4KR2A 5CX4A 2XB4A 4TV9F 9ABPA 1EZ4A 5I7HA 4G5YA 1UBOS 4IV0A 3HR8A 4Q18A 1CJVC 4V0OA 3UJ8A 1DE0A 2DQKA 1JG1A 3CLRC 3IRUA 3NTUA 4IIGA 3AF3A 5A05A 3RVMA 1O4VA 3ZV6A 2B4TO 4ZYZA 3EIXA 4O59O 4QYIA 5G3YA 5FL7D 2JD2A 2VDRB 3LVFO 1QQBA 3FZGA 3NPMA 1NFQA 2IUFA 4BFSA 3A58B 4B09A 3QMMA 4EG7A 1X2BA 1T9GS 2IQ5A 2JBAA 4YP5A 2J4DA 2VXOA 4QHSA 1K3UB 2VC2B 1O6FA 4JJFA 4YRKA 5EUQB 3JR7A 3SHVA 2GARA 1DCKA 3QWBA 4OO3A 2VDQB 2BLNA 2ZLBA 4CF5A 4H7EA 4L72A 3VR5D 2IXTA 3HRHA 3OD5A 4UHDA 2ZETA 3HWWA 4Z9XA 3OE5A 4R1MA 2C78A 5JLJA 1X7YA 4BO2A 1NN0A 3OEHA 2A33A 4UXJA 3IHKA 4D3FA 3GUZA 5FWXB 3KPWA 2FMKA 1U8CB 1QDEA 3KJZA 1NVGA 1P1KA 2Q49A 1R5OA 3H9QA 3RVKA 2Z1DA 2GJ9A 3T9FA 4CFYA 1HI9A 1N5OX 2QQ5A 3KKLA 2YZMA 1DIOB 3AH8A 3STUA 4AYXA 3NDBB 4NYMQ 2QR3A 2REQB 5KVAA 2G63A 1LB1B 2PR7A 3NVAA 3QKIA 3SMVA 4RGVA 4LGMA 4QDXA 2O8FA 1CS0B 3NBFA 5B7QA 2CV1A 2VAXA 4YJDA 1M0SA 1G1AA 3KTAB 1Z36A 5ILGA 1GO2A 2I2WA 3O31A 4XWYA 2ZJ0A 4WINA 5A9SA 4EHFA 1T0PA 3NWOA 3OEED 4OY3A 3KUCA 5AKHA 4BNWA 3LTEA 1U3UA 1LNSA 3OHPA 3CLKA 4JL6A 5E1MA 1QJ4A 3QIAA 3MWGA 1IUNA 1T29A 4HWRA 3PUHA 1CETA 4JNKA 3U7RA 5FFMA 3KHSA 2IHTA 3PNSA 4MAFA 4HB3A 4TROA 1HE1C 2OFOA 2OESA 3SCZA 3SE0A 5J4VA 4Z4GA 3RS2A 4AKHA 1YL7A 1PR3A 3SZUA 4G1BA 2YQ4A 1IOZA 3NKVA 1DO2A 4LYFA 1JB9A 2UZ4A 4F3TA 3ASYA 5I5GA 2FX5A 4MCHA 4FGLA 5EP2A 4NJMA 2B4KA 2JATA 2R6HA 3PQCA 4D81A 3QKWA 3V4ZA 1ELOA 1CSEE 2RGDA 1HX7A 2YWGA 2AZXA 3PR2B 2B6NA 2OA0A 5AXCA 3W8DA 4G0OA 3PNYA 3FF1A 5K0BA 4D0NA 1SU7A 5FAKA 3U39A 3OPYI 4DSUA 3OCCA 5G4KA 1LDYA 3C5EA 1TCCA 2QGZA 3H9UA 4DIKA 3URKA 1IOWA 4IUDS 5K8IA 5HP4A 3P0IA 3W3AD 2VQ3A 3OZEA 2I87A 5EUCA 3HP1A 3HVJA 4YP9A 5SY9A 4C7OB 2GKSA 3F6CA 1MTZA 2EJTA 4W82A 3L8GA 1XMSA 3TQQA 2FZKA 1AV7A 2F1KA 4YLGA 3KQTA 1IHDA 3QW2A 4RAQA 2F59A 5THQA 1YQDA 4MHTA 4TUYB 3M82A 3LOQA 4AKTA 1M8JA 1SQ0A 1NPYA 2XQFA 1MOZA 1BE0A 4DPMA 4QPDA 2HHLA 1QHNA 1NM5A 2DHCA 3JQBC 4WIAA 5EESA 3O47A 4DV4B 1DAOA 2P2YA 4BP9A 4EI8A 2DR2A 1DAIA 2FUCA 3BCSA 4ZDIA 1BN6A 3IEMA 3ENZA 2AC4A 2GD6A 1EZZA 2OP0A 1LPAB 3H9CA 3LBYA 3PLNA 3QFFA 3T7KA 5B57C 1S7GA 2XOKA 4JEIA 2IHZA 3RI3A 3SLGA 1DTWA 4LE1A 4F9TA 3IP7A 1WP4A 1K6EA 1QORA 1QZ3A 3N2GB 2G1JA 3AY6A 3NM5A 3OEYA 5CX1A 1ZQ1A 2XCUA 5DN9A 2AYXA 1WOMA 2GAIA 2C3UA 2QN6A 1JVBA 2GN2A 1L7AA 1RRPA 3LUPA 4RWZA 1CZOA 1G4HA 1ULHA 2DUNA 3PS9A 4OVKA 4RV9A 3MF4A 3I9FA 3NP7A 3NBUA 3WC4A 4LPSA 2I2AA 4E2FA 4IMRA 3PDJA 4W6QA 2SNIE 4XCVA 3O8QB 4UULA 5ALLA 5CDTA 4K88A 1M1YE 2ICAA 4WESB 5JO9A 2PUHA 4Z7JA 5IDXA 1TAHA 2I6UA 3BTUA 3ASUA 3CEAA 1YH3A 3HP4A 3LDFA 4LOJA 1OVMA 4R81A 1AKUA 4OIMA 5K0LA 1WX1A 3B6KA 5ESXA 3ZXIA 4ZGWA 5HZGA 4UCFA 4U8HA 1I1NA 4R54A 2CN1A 1PT6A 3V4OA 1TDJA 1WPQA 2DC1A 5AKZA 1D0IA 2R48A 4AJ9A 4ZVMA 1XZQA 3AUYA 3FCSB 1WSWA 2DFVA 2V9PA 3HYSA 3S4YA 1U8AA 1S2LA 3AY0A 5JFTA 2R8YA 4WERA 1OT5A 1V4NA 2IZ0A 3TD9A 5BWOA 1THTA 3E9EA 3F7TA 4N49A 4EA9A 1GPBA 4ID9A 1D6NA 3FWHA 1P39A 5BOSB 4WZAA 4KITB 2C7OA 4IZHA 3L0DA 1F8GA 4DCGA 4GI3A 4FC6A 3L7IA 4U9IS 5E1DA 5GONF 1CG6A 3CNNA 3WGUA 1D6SA 4ASUD 1NDQA 1GQFA 3ETEA 3KLMX 2D5IA 3JCZA 1SVMA 5I8WA 5DTQA 1E20A 5EWJA 4YRJA 5JY1A 1EFVA 4CBVA 3RG8A 2VH1A 3FCCA 1VCMA 3IUNA 4IICA 3WGIA 3L7AA 3C45A 3TNYA 3KB1A 5KYNA 2NSDA 1QFXA 1ZXBA 1J39A 4CKBA 2FPGA 1SVUA 3BXXA 4ENWA 4MRAA 4GMKA 2X1MA 4ZI7B 1GUZA 3AY7A 1KXZA 1UPTA 5K8JB 1ZEMA 1KDPA 3MNFA 3JXEA 5CFZA 3LFUA 2R2GA 3N0TA 5LZ4A 2VJMA 1QNLA 1AMUA 4UFNA 4Q66C 4QBIA 1A9XB 2AW3A 1MQ8B 2QXYA 4TYPA 1OB5A 4LGVA 1CYDA 1JE0A 1RXUA 4G4SO 3UOWA 4DBVO 4ICIA 4P8RA 2VTDA 2ASVA 2Y0CA 2BFCB 3R7WA 4E5KA 4W7HA 2GI4A 3OFJA 3CVYA 3DHYA 4QVIA 4JELA 4K6MA 1T3LA 2NOAA 1DJOA 3HJBA 5KTKA 2BH2A 1WMEA 2BKUA 1P0MA 4JDPA 2G4VA 2W6JA 4WZBE 4CM4B 3M9XA 5CLJA 4LAFA 2K7FA 3LUKA 2PHZA 2DCUA 1Y9AA 3VHXB 1DC4A 1Q7EA 4CGYA 1KPHA 1UDBA 3JRWA 4N7MA 4PGAA 4K0KB 1V3TA 1UBHS 1R88A 1WB5A 3OE4A 4HDMA 3CPSA 4Y2SA 4OU5A 4J49A 3RSLA 2REOA 2ZWPA 3VZBA 1KJ8A 2XD9A 1RRMA 4ID3A 2I2BA 5JXHA 2WP0A 1Z6AA 3FOAA 1E1QA 3T99A 2QY6A 2VOEA 1FNNA 3CWZA 4ZQCB 1KI3A 3I1YA 2OCIA 3HY4A 2Y66A 3ZUGA 1ADBA 4R5MA 2PCJA 3V2GA 4B87A 1ATZA 3WRYC 2JGFA 2H5JA 3AV3A 5H4GA 1NMZA 2XV1A 2AZ4A 4QDTA 1VBNA 2XT0A 4LNAA 5FBHA 3RIYA 3RSZA 1IWOA 1Z6GA 4TQUS 2DBYA 4ZV9A 4PO1A 4C0JA 3IELA 1Y4AE 4Z9BA 3GJSA 4E5YA 4AJLA 2QTTA 3GCXA 2VDLB 1YOVB 4OGWA 3I58A 1T5BA 1VC2A 2ACWA 2AJBA 3K4PA 3S8YA 1II0A 2XWPA 3N2KB 1YQQA 2CHQA 2JANA 1XAIA 3G5LA 1TC2A 2A14A 2M1XA 4Y2TA 3WMXA 1OWNA 4YV1A 3R8FA 4AY6A 3ZZMA 1LY1A 4IJKA 4V2IA 3HHPA 2CUNA 4FW8A 1UFRA 3D81A 2VNSA 1Q0UA 5FPTA 3NG1A 5DHPA 1KEPA 4GWLA 5DB4A 1B8PA 3DMHA 1SXQA 2V0CA 4XI9A 2V5AA 3VBEA 1N75A 4LX8A 2BY4A 3NHWA 4BO5A 4ODIA 3RYIA 1RFLA 2V4UA 3G9QA 2P5UA 3EUAA 3L49A 3N5KA 4I08A 2GLTA 2V9ZA 4O29A 4KHPB 1VCIA 1VIAA 2NO7A 2AFRA 2F2TA 4M98A 5JSYA 4XJVA 4TS9A 5FOSA 5KMGA 1WZ2A 3PHCA 3QA9A 2EKZA 2VTBB 1F4LA 3LCCA 3N0RA 3ZCRA 4KEAA 2Y0EA 3I9MA 821PA 3CQ9A 4XSVA 1JT2A 2I3ZA 1U63A 5K0TA 2VSFA 4RABA 3DEZA 3GH1A 1ADYA 4GEGA 3DWGA 2F4VB 1VIDA 1V3UA 4UHJA 4P4SB 1XDWA 3BIFA 5KWVA 3PT9A 5B1YA 3GLHE 2PKXA 2DTDA 5ECYA 3O92A 1WF3A 4PLTA 4DMRA 4HEJA 2O2EA 2P69A 1VIMA 2VPPA 4XVUA 2QWXA 3UOAB 3W9YA 2ODAA 1E5XA 4HDNA 3UATA 1PS8A 1T2UA 4JXKA 3ZLTA 1P91A 1NJGA 5A4KA 4WK6A 3MCZA 3DR3A 5GZ6A 1PI3A 4O5OA 1RE1A 1SUWA 3GELA 2FPPB 4FZJA 1PVOA 1DPFA 1LSOA 2IUSA 2ZVPX 1M8PA 3LSTA 5ELLA 5T4FA 1HFKA 4UXHA 1PD1A 2UXBB 1GEGA 3ZU6A 4KLRA 5HIJA 3T06B 5JVDA 3C41J 3ZCVA 4EGQA 1DEHA 3PCRB 5D51S 4CI9A 2HPHA 5KO2A 1T8UA 1P1CA 4XTCS 4LYDA 4CMHA 3UZUA 3QU5A 1AKYA 3UT6A 5C31A 4B81A 2PMFA 1I14A 3QPAA 4ZOBA 5H5JA 1IZZA 2CVHA 3E5MA 4S3MA 3GCGA 4PCLA 2YKGA 3PQEA 4D2IA 3AF0A 4YR9A 4C7XA 4EHIA 2VQSA 3RFFA 4ZV7A 4BNVA 3A4IA 3QUTA 4UAUA 4CEHB 2B61A 1UBFA 3MD9A 4DIUA 2EFDB 3GD5A 2R60A 5ED4A 3G7NA 4X91A 5FWXA 2P6NA 2H54A 3D4NA 3K0EA 3NQ41 2VUSA 1G7TA 4PS1A 4WDQA 3D7LA 3UHOA 3O1HB 2VK4A 4QFDA 4DM4A 1KZ1A 4E5MA 2AI1A 3OPXA 4EPWA 4ETWA 2O8CB 2REQA 3PGA1 5E9JA 3R3XA 1JEJA 4OSEA 5FNVB 3UWPA 1XAHA 2XBLA 5E1BA 1HZJA 1W6RA 2ZUVA 1MXFA 3KDSE 5G1OA 1CS0A 1U1DA 2VP6A 4IH1A 2VJQA 5F7ZA 2MCFA 3ZN2A 3IHWA 4RTNA 1G1MA 2P7IA 3BOSA 5KYGA 1XNQB 1OLUB 1YE8A 2WNHA 3UG6A 3EASA 2GILA 3HR4A 1X92A 3D6MA 4AG5A 5KVCA 3P94A 5CEEA 1ISSA 4EI7A 2OWDA 5L4NA 1JVSA 1TMGE 4I9HA 1U98A 4HAZA 1R4MA 4EJSC 5LQKA 3X2SA 2G5CA 1M74A 2WFLB 2JIBA 1BROA 3QU2A 3MD0A 3CBGA 1XC7A 5CK4A 4BQSA 2JLUA 2BP7B 2CNOA 2FQXA 2CMHA 1T4CA 2VT6A 2WKQA 3DZBA 2G40A 4JLWA 3P9CA 2YXPX 5TE9A 4R9SA 3ZWWA 4BIMA 3B7PA 1KVSA 1XU9A 4JN6B 2JJMA 1T4GA 4UOQA 5AKGA 4AMUA 1JFTA 4UNNA 2PXXA 1Z82A 3DUWA 4IQ8A 4K1LA 5DTEA 3JASB 2GX6A 3L92A 3KOMA 1OJLA 2C7PA 4R2LA 3ICQB 2O7SA 1X1DA 2GHRA 4CG3A 2OV4A 2QVCA 3K09C 1A8PA 4FN4A 4QEZA 2GGSA 2V7VA 3PXEA 2YR0A 3DL7A 3Q3VA 5EJAA 5ES3A 1GYRA 1Z07A 3M6WA 5AKXA 1N0HA 2R86A 2HK7A 2O7VA 3H4IA 4NDAA 4Q9NA 2CXQA 3NO4A 4PW0A 4HLCA 4C7OA 3U1TA 1TZMA 2FPIB 5A4JA 3GW8A 2R4UA 3O8DA 5KNLA 4AD8A 1RZ3A 1B23P 5B5SA 1JR4A 3GRVA 4M9XA 1VL5A 2OCKA 1PN3A 3WP1B 4WCFB 4YCBA 3W5UA 2QQGA 3A25A 4M49A 3OCVA 4UZSA 3ZYCA 5J4KA 4PLVA 3IA7A 4XFJA 5A4FS 3BE6A 1ZK3A 3G2IA 1ZSNA 2ASEA 3RRJA 4HWSA 3H2BA 4IHJF 3G02A 4B8ZA 1DC7A 1FW8A 2O2IA 4CIDA 1E0AA 4C4YA 4BU1A 3OJEA 5IJXA 1CTQA 4HVTA 1VOTA 2PUWA 3UCXA 4YJ2F 4N0MA 1DUVG 3X1WA 6ADHA 3N2GA 4LIPD 1Y7TA 5DYGA 2QUAA 3UV6A 3DYIA 2IYPA 1II8B 5ETJA 5EMLA 1L0BA 2NYVA 4GEKA 1Y6ZA 1HTBA 3MUEA 2AR7A 3HCBA 4YT2A 1HDRA 1IHOA 2H7CA 4MB0A 5G1NA 2B83A 1L7EA 3RB8A 3MQFA 1EA5A 3O8LA 4M0DA 4UVEA 3UWSA 1U5BB 4J0QA 4DWJA 3Q7SA 1Y9ZA 3FD8A 3GJ7A 3A6LA 3DTVD 1KYVA 5JDCC 1Z4OA 4ZOQI 4DHEA 1FFSA 1TZCA 3FFTA 5FPHA 2VZ0A 1I5OA 1YCDA 1EK0A 1Z12A 2B8TA 3AUSA 3HSSA 2LUOA 3PGLA 1WM1A 1R6UA 4FNMA 3KKKA 4GVLA 1OBVA 1I1HA 1T8YA 1C7FA 2GNAA 2NU7B 4UM7A 1GRCA 4MYSA 4NFHA 1YMUA 4QPZA 1MPTA 3HG7A 4ZYYA 4NONA 2QJOA 1M5UA 4NQZA 1HM5A 3WTBA 4BNJA 4YPVA 4KODA 3EAGA 1JIQA 2VXCA 1U8TA 3IV6A 1FE8A 3VM6A 3ND7A 4L6IA 3DBIA 3AUXA 3G88A 1LJUA 1JGTA 3FR7A 4U7FA 3PUVA 3BM5A 3BMNA 3QP9A 5BPFA 1ZK1A 4CTNA 4Z4HA 2R6CA 2FN7A 4NP6A 4JEHA 3W2FA 2OP1A 3S1AA 1O1YA 3R6DA 1A2QA 1WUKS 1ES9A 3AXTA 4NBRA 1NSYA 5A9RA 5JXJA 2FW7A 1FF9A 1VBFA 3QYAA 5T6MA 4AP6A 1OTYA 2G77B 4WPGA 5DLQC 4EZIA 3QITA 2DFLA 3OF5A 1PJ4A 2WJHA 2H9YA 1QSGA 3QRWA 5LCXA 2I54A 3ADOA 3WYBA 1KYTA 4RD0A 3LY7A 5DULA 1O6ZA 4DEXA 1U02A 3HVIA 2ZJAA 1X7DA 3U62A 3VC2A 4H3KB 4EG3A 2YV1A 2A9FA 3IMGA 2G70A 4X1IB 1QYXA 4RX1A 1G20E 3MJSA 2DPLA 5AWFC 3V9AA 5DYNA 3VISA 1VL2A 3WMWA 3ZVRA 1HTWA 1A7UA 2O0MA 2J5XA 1GFIA 4FGZA 1VDZA 2P79A 4HXFB 3UQYS 3FNFA 3IAAA 3RIMA 1RYBA 2VFAA 2G71A 2V59A 2WOJA 2OYCA 1W4RA 3E27A 3HBLA 4GSLA 5EWMA 2NV0A 4JLPA 3LQKA 4YXWD 4JL5A 1GG9A 4H1WA 3QXXA 4CM4A 4HB4A 4GH5A 3GJ5A 4WT7A 1RM5A 3VHXA 1ZVJA 3A1UA 3W04A 3DHWC 1QK5A 3T61A 1EWYA 3Q88A 5IDVA 4IVQA 4WKBA 2IHYA 1BGXT 4AP5A 1PJ3A 4UOZA 4YXFA 2P8JA 5ITZA 4LOKA 4PC6A 5EA2A 1ACJA 3KWMA 3GBPA 4BNKA 1ZY2A 1R0YA 5KB3A 2J0SA 1JTFA 5HF6A 3GX1A 3NATA 4RH3A 1RHRA 3OM0A 2A0KA 3N07A 4KLAA 4BEWA 3RREA 2H06A 5CM9C 1ADFA 5CDUA 2YL2A 2CT8A 2VAWA 5TLSA 1I30A 1OLOA 3SHWA 1MC1A 1GU0A 2VZ9A 4AS2A 2FPRA 1M0EA 2IS1A 3R3SA 2HJRA 4BCBA 5HQ3A 1HNXB 3BGSA 4B17A 1C4XA 1FFHA 1YOVA 4U5QA 5E4JA 2X3FA 3IR6A 4NMXB 3C24A 1FL9A 1UFVA 2ZRKA 3E22B 1WV0A 3SYMA 3VSAA 2Y1GA 1ZINA 1UMKA 2QJWA 1T3TA 4XDZA 4GKAA 2RAUA 3S1SA 5DIFA 4P6VF 1Q17A 3F6RA 4MPDA 3E9RA 5LMNB 2MSDB