4I9HA

Crystal structure of rabbit ldha in complex with ap28669
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
331
structure length
325
Chain Sequence
AALKDQLIHNLLKEEHVPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARQLNLVQRNVNIFKFIIPNVVKYSPHCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWILGEHGDSSVPVWSGMNVAGVSLKTLHPELGTDADKEQWKQVHKQVVDSAYEVIKLKGYTTWAIGLSVADLAESIMKNLRRVHPISTMLKGLYGIKEDVFLSVPCVLGQNGISDVVKVTLTSEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase A chain
publication title Fragment growing and linking lead to novel nanomolar lactate dehydrogenase inhibitors.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 106
structure length 325
sequence length 331
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4i9hA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4i9hA02
5IN4A 3HNPA 4PFJA 1ZSVA 3D4NA 2Y1CA 4NBUA 1YQGA 3AY6A 3WXBA 1G6KA 2WE7A 1N9GB 5ITWA 3ULKA 4Q3BA 4R4JA 1WDLA 4ZQEA 2VZ9A 1IHXA 1PJQA 4XZ3A 5CG1A 2VWPA 4MVJH 1H6CA 2PD3A 4D41A 2C0CA 3LYLA 3AOGA 3WGHA 2GR9A 1UAGA 2I6TA 2RBEA 4W7HA 4W7IA 3NDRA 3PXXA 3SC4A 1DFIA 1DLIA 2VRCA 5TLSA 3FD8A 4E6PA 3AK4A 5L4LA 3QE3A 1JKJA 3I3OA 3SXPA 4JQCA 5THKA 1V3TA 1QXSA 1DB3A 2Q49A 3KYBA 4EW6A 1LSOA 4N7RA 3OJ0A 1LU9A 1S7CA 3L6DA 1X7DA 1JVSA 4ZRNA 3RUFA 3WGQA 2GN9A 1IPFA 2X86A 2CVOA 4BO8A 4NG5A 4E3ZA 2O3UA 5CDYA 4P38A 4G2NA 2AMFA 4AJJA 4KUHA 3M1AA 3CZMA 4AJHA 1WDKA 2QW8A 4PN3A 4K9DA 3GAZA 3ADOA 1NFRA 2NTJA 1MB4A 3OETA 2BI8A 4ESOA 2A4KA 4R3WA 5A9SA 4FD3A 5BT9A 2O3JA 3DTYA 3JQ9C 3PLRA 2WD7A 2WYUA 3KRTA 1T2DA 2RHRA 4GLLA 4WNIA 3I9JA 5I8WA 2Z5LA 4U6SA 3NAQA 5DZSA 3K73O 3I6QA 1AGNA 4Z3KA 1RM3A 3QWHA 1EUCA 1XR3A 1PJ3A 1X1EA 4WEQA 4NPCA 3GVXA 1GCOA 4MOWA 5EMHA 3F3SA 1PGNA 3JTMA 1BDMA 1M67A 1HE2A 1GDHA 1DLJA 1XA0A 3GG9A 3INRA 4RO0A 2VOJA 3WGOA 5L40A 2NQTA 4WJZA 3IS3A 1K0UA 2PK3A 2BFOA 4ALLA 5GZ3A 2HQ1A 3F5QA 3HFSA 3MOIA 4PZDA 4WCFC 3WGTA 4D7AA 3E1KA 2EG9A 4O5OA 3O4RA 4S1VA 3ZZNA 2VRCD 2VT3A 3SC6A 2VHXA 1TT5A 4CMIA 2JL1A 3WOHA 3KSUA 1M76A 2YUTA 4E30A 1D1SA 1XYGA 2X58A 3D1LA 1A72A 1ZK0A 1LSJA 4CMEC 2POQX 3WB9A 3ADPA 4BNXA 2C7GA 1O0SA 4OL9A 3ZN2A 3U4DA 2Y68A 1XELA 2Z1MA 4Q39A 5GMOA 1S6YA 1XG5A 3ZU4A 2NSDA 2VN8A 4N18A 4BNLA 3WTCA 3IJPA 4CM3A 3RCBA 2HK9A 1EFLA 3OHSX 3PJEA 1RJWA 4IJUA 2G17A 1U5AA 3WSWA 4CMBA 4DRYA 4MVJE 1LXCA 3GVCA 1GQQA 1GQYA 5L45A 5I7EA 2V6MA 1ZEMA 5ENDA 1HLDA 1U8XX 1VL6A 5A9SB 4QFCA 3WJ7A 4YAGA 5FI5A 5I7FA 5CHEA 3SVTA 4L0QA 4F3YA 4NHEA 1L7DA 3VH3A 4XB2A 1CWUA 1HTBA 2AE2A 4OYRA 1IOLA 1DIRA 5L4SA 1U3WA 2BGMA 4IJVA 3TDKA 4O63O 1HSOA 2YYYA 3M1LA 5G0SA 4ALKA 4IDGA 1EBFA 1ORRA 1ZMTA 2W2LA 4E4YA 2QRLA 4CODB 1SMKA 2O7SA 3ZHYA 2YZ7A 4P4GA 3ZH2A 1HE3A 3JQBC 1R37A 4A73A 4DYVA 2R6JA 2XOXA 5G0TA 1KEPA 3KXDA 1E3IA 1V0JA 4EGFA 3I9KA 4ZN6A 4OQYA 4PLYA 1NPDA 3GF4A 4IDAA 2FOIA 4FGWA 2GF2A 1QG6A 3N58A 1D7OA 4GX2A 4ZD6A 5FWNA 3FN4A 1PGQA 4CQMB 5JO0A 4XD2A 1JAYA 1R0SA 3PHJA 4PLWA 4PG7A 4EUFA 1SC6A 1A5ZA 3BHMA 2EKLA 2NV6A 3WJAA 4CMIB 4JP3A 1B26A 2BKAA 3JQFC 1YB5A 1J4AA 4DBZA 5IDXA 1NR1A 5ADHA 3D5TA 3ZWAA 1ID1A 2D8AA 1MG5A 4FS3A 1VSVA 2I67A 4IZIA 4CM9A 4DQVA 2JFHA 1EQ2A 1O94A 4GGPA 4J4HA 4OM8A 2X5OA 1Z73A 4IIUA 1I2CA 1ZKMA 2F1KA 3EDMA 3ASVA 1EDZA 1DHRA 3ZGYA 2FZWA 1J49A 3AFNA 5ER9A 4YAIA 1Y8RB 1BXZA 3ANLA 5K0ZA 1BRMA 1FDWA 1IYZA 1E3WA 3LF2A 1A7KA 4M55A 2Y0DA 1R4MA 3S2IA 1PS9A 4AJOA 1Z74A 5CDGA 4D44A 2Q2WA 1Z7BA 5TX7A 5KJFA 1M75A 3WMXA 4R41A 3WIDA 4CUZA 1H9BA 3M2PA 4JP2A 1ADGA 1EVZA 1ZUD1 1T24A 4I1IA 4RGBA 2C20A 4ITUA 2WSBA 4YB8A 2DPGA 3GUYA 3ZWMA 4QT0A 1E6EA 3DZFA 1IE3A 3ZNOA 2W2LD 3ZWPA 1ISGA 1OMOA 2ZYAA 3BTOA 2C2YA 3OEYA 3NGXA 1KC3A 2E82A 1E0DA 5A3VA 2VZ0A 2B83A 5TSDA 4Y6SA 2NU8A 3I9MA 3MWEB 1QV7A 1YO6A 5JAQA 1XEAA 4O59O 1I36A 1QYCA 4CQLA 3JQEA 4KTVE 4TQGA 5AVOA 3RAJA 3JV7A 5B12A 1C0KA 1D4FA 1NXQA 4JGBA 1YL6A 3UCEA 2JKVA 3WYBA 4UUMA 2Q4EA 1LX6A 1QLJA 3VZPA 3PQDA 1J5PA 4Q3EA 2PA3A 1BG6A 2DUWA 3GVPA 5CPBA 1GYPA 3JQ9A 4DPMA 2WJPA 3IJRA 3PHIA 3W6UA 3BMNA 1TI7A 2PGJA 3BIOA 1LUAA 3G1TA 1N1GA 2R00C 5DCYA 4BO4A 4DBVO 5L7TA 3O8QA 3KZVA 1IZ0A 1YOVA 1ZK2A 1P33A 4XB1A 3C1AA 1JWBB 5F3RA 2R2GA 3IQDB 5G4KA 4J3FA 4OXNA 1GPDG 5EJ2A 1XQ6A 4B8ZA 4D79A 1PJBA 2DT5A 4H15A 4GMFA 4KMSA 4TMFA 2UDPA 5KVSA 2NVUB 1K89A 2WE8A 3L9WA 5KWEA 1SO8A 1U2DA 5EQDA 2RIRA 3KYDA 9LDBA 5TRTA 3LT2A 2GN8A 4R16A 4WCFA 4A0SA 3PQFA 3D64A 2IZ0A 1JWAB 2C29D 5JY6A 5KJCA 3AM4A 4ZGWA 1SPXA 3IDSA 3EZLA 1QORA 3GA0A 3WYCA 1ZJYA 4CMEA 3DOJA 4FQ8A 1HZZA 2VHZA 3ZWOA 2B69A 3NTRA 3HWRA 5G0VA 4GLOA 3LLVA 5BSFA 3W1VA 4PG4A 4XQ9A 4DPLA 1U4SA 3NT2A 4NU5A 4CQLB 4X54A 4B7CA 2JD0A 4B3HA 4D45A 1NP3A 5A04A 4IZHA 1I2ZA 5JSFA 4AVYA 1I33A 2PD4A 4GX0A 2FY8A 2VOEA 1H5QA 3BYZA 4I5GA 4JJFA 4ZQBA 1K6XA 3AUSA 5MGBA 4MINA 2JCXA 4BVAA 1HWYA 3GC6A 3N74A 3F5SA 1IHYA 4K6FA 2VCYA 5C7OO 3RVDA 3UH1A 4BUCA 2P5UA 2CUKA 3BMNB 3RU9A 3ROQA 2H5LA 3DTTA 1PJCA 1GU7A 5FF9A 3STHA 3H9QA 3O8QB 2CD9A 4EYEA 1AXGA 2HRBA 3TZHA 4IPTA 5DCUA 1Q7BA 3UVEA 4DREA 1H6AA 1XU9A 1CDOA 1VJ0A 1YDEA 3EYWA 4XQEA 4BNZA 3A06A 4QO7A 1V6AA 1PEDA 2GO1A 1DFHA 1BHSA 3GK3A 2C7VA 3U4HA 4B7UA 3UUWA 1BDBA 1LRLA 2IYPA 3GHYA 2GNAA 3WDSA 3KYDB 3ZWCA 4RPGA 3JSAA 1LRKA 2ZB7A 2FWMX 4MIYA 2EJVA 3HB4X 3JQAA 1MA0A 1E3LA 3JQFA 1P1RA 1A9YA 2BFPA 4L75A 2O3SA 2QRJA 5AXAA 4AJKA 2QQ5A 4FPXA 3VPXA 4HP8A 4LSMA 3BMOA 2O7QA 4IY1A 1KY4A 1KS9A 4L4SA 1GAEO 1UXJA 4BV9A 3C3XA 3PIIA 2D2IA 1F06A 3DQPA 4BIIA 4ND5A 1I01A 5JYDA 3BMCA 1DIHA 4UUPA 1NNUA 3WGZA 3NTQA 2JCVA 6ADHA 4OSPA 5A9RA 4HUJA 4I9UA 4TRMA 1I10A 3DBRA 1VE9A 4UULA 4QX6A 4BO5A 3TFOA 2IRWA 4RF2A 3QJ5A 4CLHA 1DOHA 1WZEA 2GERA 3AFMA 4JJGA 3TQHA 5EPOA 3PQEA 4PRKA 2Y1FA 1SEVA 4WGGA 3V2HA 1R6DA 5GY7A 3RUAA 1IL0A 4OXKA 5ICSA 3PWSA 1H0KA 2X9VA 3AM3A 1VJ1A 1YL7A 1P9LA 5CFZA 1KIFA 3I4FA 3PJDA 4M49A 5LCXA 1TLTA 4PG8A 5COQA 3AUTA 4C7JA 2V6FA 3MJSA 3GPIA 2CSUA 5JC1A 3DB2A 3E5RA 1GD1O 3OA0A 4J0EA 4Y8VA 5B4VA 2VYVA 3MJVA 2O4UX 1YXMA 3C7CB 4ZHSA 1KVTA 4XYEA 5BSEA 5CP8A 1HKUA 4J7XA 3UN1A 2C07A 4RCVA 4HY3A 4ZQHA 4NMHA 3JQAD 2OGUA 5F21A 4P22A 4I9HA 1GTMA 1MFZA 1UP6A 1I8TA 3ZNQA 4KWIA 3OJEA 3ZW8A 4LISA 2DTDA 4HFJA 4EZBA 3D7LA 1XGKA 2UVDA 3KO8A 1ZCJA 3LC2O 5CEEA 2FR0A 4NH4A 4N5MA 3SLKA 1QMGA 4RQUA 4J43A 1HL3A 3QW2A 1RM5A 4NFSA 4YTEA 5T8KC 4CLEA 3BMOB 2OZPA 3H9JA 4XKJA 2PR2A 3GAFA 5I9MA 1MG0A 5I8ZA 3PDJA 2ZTMA 3R3JA 1VL8A 1QYWA 3GGOA 1R15A 3HSKA 4YVFA 3KSZO 3NRCA 3EK2A 4Z9XA 5EESA 4W6ZA 4JXKA 1LC0A 4MVJM 2C54A 4E5MA 5TJ9A 3DBRB 2QRKA 4IQ8A 3JQ6A 1ISJA 3E8XA 3RSHA 3RUHA 2HSDA 3EGOA 3TFQA 1NVGA 2IEBA 1F0YA 3A14A 4IUYA 2X0IA 5EERA 1E7QA 3TWOA 5TGDA 1XU7A 4EEXA 2HCTA 4XYLA 5FFFA 3FF4A 4CLRB 1MC5A 4XA8A 2LDBA 5EIOA 2DAPA 4WOJA 5U4QA 4BNNA 4BO0A 3A9WA 2IZZA 3RBVA 5AXDA 3OQ6A 1E1KA 3W4JA 3Q9NA 3ITDA 3L0DA 2UUPA 3WX0A 3MJ4A 2VYVD 3PGJA 4JBGA 5G4LA 1PWXA 4RF5A 5TT1A 4DIBA 4IDCA 1V35A 3KEQA 4Z9FA 2P4HX 5HBRA 2TMDA 1IB6A 4CL8A 3DZKA 3HUDA 4WPGA 1B7GO 4WCDA 2VHWA 2W98A 1RYDA 3D4PA 4BGVA 1EDOA 1DC4A 2P68A 1W6UA 2I3AA 4GWGA 4UUNA 3PYXA 1F17A 5GZ6A 1YB1A 4WUVA 3UAGA 1DXYA 1LLQA 3EUWA 4O1MA 3H3JA 3FHLA 4XIJA 3W8DA 4BNVA 4E2WA 1LDGA 1DFGA 2Y1GA 1C1XA 3R0IA 3G3EA 2HMWA 2DC1A 5B4TA 3FNFA 4IXTA 4L73A 2UYYA 1ZFNA 4TRJA 2Q50A 5FEUA 1BWSA 4G65A 3BTVA 1EVJA 4Q3AA 3PFWO 4CLXA 3LK7A 5JMWA 2PGLA 5ILGA 3ZHBA 3UW3A 4QO8A 3A4VA 2GYYA 4UUOA 3PYMA 1E3EA 4I8XA 1LBEA 2BELA 4ALMA 4LRSB 1ZMOA 1EK5A 2HAEA 2NNLD 4GMGA 1VKNA 1O95A 2PKQP 1MX3A 1HDYA 3WYEA 4IMRA 2GN4A 3RFXA 3V2UA 4CMGA 1CF2O 2FZEA 2HU2A 4FDAA 4XYMA 3RJ5A 3MCVA 2IODA 1H94A 2Y93A 3S2GA 3G79A 3GFGA 3K30A 3AU8A 2X1HA 4Y6PA 1GUYA 2W2KA 3OSUA 3ETEA 4RPKA 1PJSA 5DBFA 1JKFA 4A7PA 3H2SA 3FNHA 1H2HA 2GRAA 3KOUA 3PIDA 3JD0A 4DMMA 1AE1A 1CQJA 1DRUA 1UDAA 3DXFA 3U5TA 2AQKA 3U09A 3LT1A 3HQ4O 3UHAA 1KVSA 5GZ1A 5JW6A 5FYDA 3T4EA 4TRRA 2DBVO 5L95A 3EMKA 4A2CA 1X15A 4NJOA 1EMDA 1ZXBA 2C82A 2CY0A 4MO2A 4BNUA 3COSA 3I83A 2JD2A 4AFNA 3VPSA 4B4VA 6LDHA 4GGOA 1BSVA 2RH8A 1U1IA 3B1FA 2ZTLA 3PVZA 4ND3A 4Z9YA 2VUUA 3KLPX 4DYDA 3I5MA 3VDRA 4HV4A 2EKQA 3H4VA 2CDCA 2QIOA 1Q0HA 1PGJA 3GGGA 3INTA 4YCAA 3D3EA 2Q4BA 2ZTVA 1ONOA 1E77A 1C1XB 3PLNA 1GZ3A 4PVDA 4BNWA 3OJLA 4J4TA 2GZ3A 4BNJA 3U62A 1NWCA 3RFVA 4XEHA 4B7XA 4UVDA 1LQUA 2P9CA 1M6WA 2A94A 3H65A 3Q2KA 4YJDA 3VVBA 4YBZA 1V3UA 1R12A 5BNIA 3RUDA 2EERA 4XX0A 2EP7A 3T4XA 1LLUA 4YPOA 2DTEA 1DAPA 2YV1A 4J2HA 3H3FA 3H2ZA 4CLDA 4DLAA 4XR9A 4A27A 5L7WA 1PQPA 4L76A 3LVFO 1P44A 5C7LO 2PWZA 1E1NA 4YACA 1GQ2A 4FFLA 4U7WA 2W2KB 3CEAA 4H3VA 4CM4A 4DTIA 1E7SA 3TZQA 4MKRA 2HO5A 4JBIA 2BLLA 3ZV3A 1QYDA 3VTZA 3DL2A 3DZJA 5DBIA 5T8KA 1XHLA 4TZKA 3WLEA 3CE6A 4YAKA 3DWFA 3U4IA 3IKTA 2CVQA 4OHUA 3Q3CA 2I99A 2QYTA 3ZCXA 3BTUA 2EGGA 2X9GA 4HWKA 5J23A 4Q3NA 4FFNA 1XIVA 4QTZA 5JPIA 3ROPA 2AQIA 2Y1EA 2HK8A 3DZGA 4KQXA 4PLVA 3TOXA 3H8VA 4BMVA 3GDFA 4XCVA 2D5AA 4I5FA 1GYRA 1DIBA 2I66A 4R69A 3LQFA 4WLOA 5JYEA 1H6DA 4U5QA 5AQ1A 1GADO 5F5LA 4IDFA 3ASUA 1E6UA 3TF5A 4CQMA 3HN7A 2OBYA 3GG2A 2X5KO 1TA4A 5U9CA 3FBTA 1AHHA 1CYDA 1Y9EA 3O38A 3H5AA 2GCGA 3HFGA 4A5OA 4D46A 3TZKA 1LI4A 3M6IA 1KEWA 2NWQA 1Y5MA 4MKZA 4UVIA 1GYQA 5TNXA 1I3KA 1Q2XA 2O2YA 3ZNNA 5JC8A 1B0AA 5KVQA 3AU9A 1Y8RA 1Y1PA 4OH1A 4ALJA 2RCYA 1DC3A 1LLCA 3GVHA 3QWBA 2DLDA 4PLGA 1OFGA 2JFFA 2G5CA 2NVWA 1PGPA 3GLQA 4CM4B 3QSGA 1D1TA 1R0KA 3JQ7A 3RC7A 4BKUA 4BMNA 4CV3A 4DXHA 5IZ4A 2G76A 3WGIA 3KTDA 2DVMA 1ISHA 2O4CA 3QHAA 4GH5A 4LCJA 4UVGA 2AHRA 1P45A 1T4DA 4RVDA 4FR5A 2VWGA 3GT0A 2GGSA 4RVSA 1T4BA 4H16A 3UKOA 4BNKA 1W73A 2Q1TA 1PWZA 2ZCVA 3OJOA 3ROMA 3VTFA 3QVSA 4BO9A 2QHXA 1JVBA 4BKQA 1A71A 1NR7A 2VHYA 5ITVA 2CZCA 2OUIA 4BGEA 3IL2A 4Y9DA 1TB4A 3RKUA 5ILOA 4PZCA 4ZQGA 2UUOA 4GAEA 3BHJA 4LGVA 2BHLA 4GVXA 5JMPA 1C1DA 1EUDA 4II3A 3AM5A 4WASA 4CQMD 4J7UA 1ZK1A 4II2A 2J3KA 2H63A 2J5KA 2C5EA 1ZSYA 2QZZA 4ND1A 4BNHA 3GN2A 4UVHA 1PIWA 3G17A 4E2YA 4RLSA 3LT4A 1SOVA 1ZEJA 1PJLA 2Q2QA 1HDOA 2PZJA 4EUHA 2H6EA 4QFDA 2ZK7A 3AOEA 4XYBA 2J8ZA 2YV2A 3C1OA 3QP9A 4FBGA 1E6WA 5B1YA 3VH4A 5HWSA 1EVYA 4YQYA 4FJ2A 5JCJA 4ZICA 3DAGA 2PD6A 4DL9A 4ZJUA 1PQWA 1YB4A 1U3VA 2A9FA 5BQFA 1H2BA 4K1LA 4NBRA 3OICA 5T67A 3GDOA 1GZ4A 2VUSA 3BHIA 3I9NA 4CMAA 2ZB3A 4E2XA 1NQ5A 2WDZA 3KUXA 1SOWA 4MIOA 2AG8A 2FSSA 2I3GA 2FPIA 1YH3A 1N7GA 1H9AA 4GI2A 3JQ7B 4NIMA 1PQUA 4CPDA 2NVUA 3IOYA 1T1SA 2OP0A 3NV9A 3ENKA 4PLCA 3VOSA 2EW8A 4F6LA 4TRNA 3IMFA 3PTZA 2HJRA 1I3LA 3U3XA 3GQVA 3V1UA 4XIYA 3JYOA 3OH8A 3CXRA 4OMUA 4E5PA 4NR0A 4TZTA 3ONDA 3G1UA 3NUGA 4BNTA 4FFRA 1O6ZA 1YBAA 2X8LA 4EITA 2O3RA 2NTVA 4J6FA 3C1TA 3E9QA 1LRJA 3NX4A 2ZYGA 1NFFA 4E5NA 4XRGA 2Q45A 4LW8A 3VHRA 4XRRA 1PZGA 2DFVA 3C7DB 1GZ6A 2DBRA 1O9BA 3K31A 4R3NA 1HDGO 1C1DB 3HN2A 3JQ8A 3OIDA 2I65A 3LC1O 4I08A 2P91A 1FDUA 3JD3A 3G49A 4MVJI 4LRTB 1HZJA 4DMLA 4NDNE 2FPPA 1FDVA 3RC1A 1J6UA 3DHNA 1CERA 1ADCA 3FR8A 5C7IO 4CM9D 2Y67A 1CEQA 4K26A 4R1NA 3OIFA 3V1YA 4H7PA 4OQZA 1KETA 1T2EA 4C7KA 5DP2A 5JCJD 2OOSA 5KKAA 5IDYA 4NFHA 1ENOA 4J90A 2H9IA 1I0ZA 5G2OA 1Q7GA 1QRRA 3KLMX 2WTBA 1FDTA 4FSHA 5MDHA 2WEKA 1UXHA 5AOVA 2ZB4A 4Y98A 4FW8A 3SBOA 1IY8A 2Y1OA 3SX2A 4FIZA 1M2WA 1HE4A 2YHUA 1R4NA 4CV0A 5LDGA 1XKQA 2OMEA 3CMMA 4PVCA 3WWZA 2YV3A 1N5DA 1UAYA 2NU9A 3D4OA 3DAFA 3AUAA 3DMTA 3RUIA 5AXBA 2G0TA 3WBBA 1VLLA 4BOYA 2DKNA 3KYCA 4EDFA 4CMKA 4CUJA 3ZWVA 1YS4A 2OXIA 1WDMA 2D5CA 2P9EA 4DQUA 2NQ8A 3L4SO 4D43A 1P1HA 1MLDA 4A03A 4J0FA 3N7UA 1ADBA 2DUUA 4TVOA 1HDXA 4ILKA 3T7CA 2FSVA 2NUAA 2IYOA 4IINA 3IAHA 3W6ZA 2VQ3A 2J6IA 4CR8A 5C37A 3MZ0A 3JQ8B 3D3WA 4UVEA 3HDQA 2JHGA 1JAXA 1YL5A 3FWNA 4RVUA 3WLFA 1P1IA 3AW9A 5DF1A 3X2EA 1SAYA 4PLZA 1E1MA 3O9ZA 1LSUA 5A1TA 3UGKA 5EL0A 3UF0A 1KY5A 3IUPA 3EW7A 5TQVA 4KUGA 5JY1A 3IP1A 3TL2A 5CEJA 1HT0A 4OKNA 2EJWA 2X7HA 3MTJA 4XR4A 3DFUA 3H9UA 4BNMA 2I9PA 5KOIA 4NFYA 4M1QA 1PJ4A 5F1KA 1EUZA 5A3JA 2E37A 2FMUA 1EQUA 1NYTA 3HDJA 2WYVA 3ZU3A 1MXHA 1Z45A 4QSMA 3UFXA 3FR7A 1DRVA 4L74A 4F46A 4PG6A 1KBZA 3PFFA 3P2YA 1SNYA 1HSZA 3OM9A 2G82A 3GNQA 3KSDO 4MP8A 1R4NB 4KQWA 4AJIA 4DGSA 9LDTA 5T57A 2ZTUA 4WK6A 1TEHA 3GRPA 5IZCA 4RF3A 3IIEA 1LDNA 1D8AA 4N5LA 3JYPA 4FN4A 1JN0A 1OZAA 4HXYA 2I76A 4JROA 1FDSA 3FRJA 3OFSA 4DIFA 3KYCB 1H93A 4D3DA 1NX6A 2GPTA 2Q99A 2YQ5A 1M6HA 2ZATA 3PYLA 3WFJA 3IC5A 2RH4A 5IJZA 1U28A 1XQ1A 1ZK3A 3E82A 5COBA 3E5MA 1E7YA 3I1JA 3UCXA 1LQTA 3C85A 4EJ0A 2ZYDA 2GDZA 3DOCA 4YJFA 3EAGA 1EVIA 2B37A 2BRUA 4R01A 5KJ1A 2D4AA 4IXWA 4HFRA 4U0KA 3D3WB 2AW5A 3TNLA 3WBFA 5BSGA 1ZW1A 1QLHA 3OECA 1KERA 3PJFA 3EY4A 2I5PO 4AG3A 1YKFA 3QWAA 2B4RO 1X7HA 4UEJA 3DFZA 1WMAA 5B37A 3OMLA 4G5HA 4JIGA 4K6CA 4NJMB 4EI2A 1DDOA 3L07A 1BVUA 3JD4A 4BNYA 2HMTA 4LVUA 3NJ4A 3F46A 3OBBA 4HADA 5IN5A 1U3TA 1W4ZA 3I4CA 3BA1A 1ENPA 4CM6A 4KP7A 4GKBA 3WICA 1AHIA 1N92A 2NACA 1P3DA 3NT4A 4D0RA 4CLRA 5JAMA 3PWKA 2AEJA 5H83A 1J0XO 1P1FA 3QLJA 3C7AA 3OF2A 1H6BA 3CZRA 4FFOA 1VPDA 1G0OA 1PR3A 5IFLA 3BAZA 4YAJA 3ZU5A 1E5LA 3S55A 2C59A 2XXBA 3DBHA 4J1NA 3RUEA 3WNVA 2AEMA 4BQPA 3MJEA 3AUUA 4FJ1A 4F45A 3GHHA 2DBZA 5L51A 1YQXA 1LDEA 3NDIA 4BKPA 4J2OA 4BNGA 3UCFA 1VKOA 2EGHA 4DLBA 4I5DA 3ONFA 4O0LA 4W9NC 1C0IA 1HEUA 4L4XA 5HS4A 4BNFA 3MJCA 3W4IA 1QV6A 2EP5A 2QG4A 2X9NA 3LU1A 4PGFA 3W4KA 1XWFA 4RVFA 2X22A 2QYSA 3ST7A 1VM6A 4YJFB 1LC3A 3QIVA 3Q0EA 3B70A 2J3HA 2WYWA 1DIGA 1BXGB 3NGLA 1WVGA 4R1TA 3PDUA 3IP3A 2ZJ0A 3VZRA 3OIGA 2D1YA 5AYVA 5TC4A 3GZ4A 1JU9A 3QVOA 2OP1A 4FOOA 3HDYA 1FF9A 1HDCA 4U6QA 1ZO8A 5ENVA 5IAAA 4PLPA 3DZIA 2V65A 3L6EA 3FPLA 1LLDA 4PLFA 4AICA 3PHHA 4YR9A 1PGOA 3GGPA 4GPD1 2EWMA 4RPJA 2DU8A 2Y0CA 2BFMA 4YRDA 3U9LA 1DC5A 1N7HA 1RWBA 3LSYA 2IXBA 4TROA 4YDRA 4AJLA 3ZV6A 1I3NA 4MPDA 3OEWA 4NI5A 3VH2A 1OAAA 4OO3A 4ZU3A 4YRBA 1KVUA 4DLLA 1KEVA 1SZJG 5I9LA 1XLTA 4P4LA 1QR6A 3VKUA 3JD1A 5L3ZA 1PL7A 2IEDA 2Y1DA 5FI3A 3KHUA 4CM5A 5JXWA 1Y6JA 3DBHB 3VPGA 2DM6A 2A35A 4NBVA 4OOEA 3C8MA 4R68A 5KJ6A 4E21A 2VTDA 3F9IA 4D0SA 1DIAA 3WSVA 1ZK4A 3PJGA 5DDIP 4YJHB 2F00A 1PZEA 3ETGA 1YJQA 2FRDA 4NK5A 3H5RA 5A06A 2SCUA 3DR3A 4AJNA 1GV1A 1UXIA 1GEGA 1X14A 4RJTA 5TIIA 3I9OA 1VSUA 4OJNA 3CMCO 3K92A 5EINA 4M8SA 3S2FA 4IDEA 1LDBA 4Z0TA 3BXXA 3TSCA 4DC0A 1BGVA 4MDHA 1HF3A 1PR9A 4E32A 4MKXA 3KVOA 3DMYA 3PRJA 4DA9A 3RWBA 2PZLA 4MVJA 1B3BA 1D3AA 3GFBA 5JCXA 1VI2A 4AJEA 1T2AA 1KVQA 3B1KA 2OHXA 2IXAA 2HDHA 2IE0A 4FOSA 3AI2A 1QKIA 4R1UA 4RV9A 4WNCA 2PLAA 3U4CA 3GN1A 2AEFA 3ICCA 3CH6A 2JJYA 3H5NA 3EHEA 4BKRA 4INAA 2PZKA 4GX1A 1NHGA 3GVIA 4YA6A 4GVLA 2IZ1A 3SJ7A 4L4RA 1HETA 1F8GA 4U8GA 2ZB8A 3F4LA 4PRLA 3WGGA 1U2GA 4G81A 1T2FA 3WQQA 4YT5A 1OBFO 4OAQA 3EC7A 1L1FA 4LN1A 3FPCA 1FMCA 2O50A 2C5AA 2Z95A 4W4TA 1TXGA 2HMUA 4FCCA 4KDFA 5BNTA 2FPGA 3AOEC 3GUCA 1BXKA 5CAEA 1E5QA 1KVRA 3P5SA 4Y67A 1R66A 5K6AC 3ITKA 4WOKA 2AG5A 4RDHA 5DNAA 4OIMA 2B36A 3ROKA 4M86A 1F14A 3VKVA 5CEFA 1PSDA 2B4TO 1UJMA 2EF1A 2BFAA 1Z75A 2GLXA 4BB5A 2VYNA 3PGXA 3DBVO 4D42A 2ET6A 1E92A 4OKIA 5C3MA 4KUEA 3E9MA 4E13A 4RORA 2YDXA 4E2ZA 4EUEA 4QEDA 3C24A 2PGDA 2YQ4A 5JFOA 1WLYA 1VJTA 1A7AA 4ND2A 1OOEA 4E31A 1UDCA 1PU2A 1PJTA 3AY3A 4XDZA 1MFPA 4MVJD 3VPHA 4J9VA 1DBVO 2UV8A 1C14A 2EW2A 4YJGA 1P77A 3TPCA 3GOHA 3ENNA 4JNKA 1NPTO 1B15A 1SBYA 4BKOA 1B8PA 3GNSA 3KB6A 3VC7A 1BVRA 2PZMA 1GUFA 4GKVA 4B79A 3ANMA 1LNQA 3B6ZA 1UXGA 4URFA 1YE3A 3BTSA 3F6YA 4BMSA 4DIOA 1E7RA 2EKPA 5JDCC 3X2FA 2X0NA 5CDSA 4KZPA 4YQZA 4BL5A 3K5PA 1HDRA 4ALIA 1AN9A 2XAAA 4GQAA 5TF4A 3DONA 1JDJA 5ICMA 1V3VA 1SB8A 1SEPA 2ILTA 4W9NA 3KM0A 1LDYA 1DPGA 1K6JA 1GL3A 5KCZA 1Y81A 2WM3A 3PEFA 4CL3A 2NM0A 3P7MA 1R16A 1EFKA 5L7YA 4ZA2A 2ZKLA 1A4UA 4MJLA 1O89A 3ZI0A 5KIAA 3PP8A 1MP0A 1YGYA 4FC6A 4U0JA 3ZU2A 3TZCA 4CM8A 2VYND 3H7AA 1IZ9A 1O5IA 3O26A 4HFNA 4Y6RA 2X4GA 4KTTE 3VPFA 1X1TA 4TVBA 3ORFA 1I30A 4RLHA 2NADA 4P8RA 5JE8A 3QA9A 3OP4A 3R6DA 3ZNPA 4HKTA 1YDWA 1F8FA 4RQTA 4RVHA 3DMTC 1RPNA 5EN4A 2GSDA 4OSOA 3R3SA 1ARZA 2WMDA 1T26A 3WNQA 1DSSG 4BO3A 2AE1A 1UDBA 4NQZA 3P2OA 2BF7A 3GDGA 1NWHA 3FSRA 1DHTA 2HMVA 1ZZEA 3KV3O 3RBXA 3RC2A 4BHTA 4YYZA 5A02A 4O6VA 3SJUA 5I7SA 4QUKA 4YJGB 1HYHA 3ANNA 2GD1O 3VZSA 4CR6A 2VT2A 3E03A 3DO5A 3JCZA 2CFCA 3W8EA 4B4UA 2PFGA 3FBGA 3CKYA 4B3IA 3GZNA 1DJNA 4M89A 3LLSA 1LA2A 4W99A 3L77A 1Q7CA 3WS7A 3H9EO 1L7EA 4IGEA 1ML3A 2JHFA 3H6KA 3RKRA 4CMJA 3VVCA 2PV7A 5JAZA 1EZ4A 3E6AA 3CSDA 4YAEA 3K9QO 1DC6A 1QSGA 3K2EA 5THQA 3U49A 1U5CA 1AXEA 1YRLA 2PKRA 3I6IA 4I9NA 4DQXA 1ISMA 3A28A 1E3SA 3NJ8A 2QX7A 3MWDB 3MJTA 5I9NA 1GY8A 3ZWXA 1JQBA 4UREA 5A5FA 1GFSA 1NAIA 1UZMA 2C2XA 4GBJA 5KVVA 4PIVA 4RPHA 1Y9AA 4XQCA 1Q1NA 1QYVA 1MV8A 3QVXA 4ND4A 4PCVA 2CNBA 4JJIA 5JNLA 2BGLA 4JX8A 4CM8B 4Q9NA 4BGIA 2VUTA 3RC9A 3V2GA 3SLGA 4CR7A 1JTVA 1W8DA 2V6GA 1ZVMA 2VNAA 4LSWA 1NFQA 2XF8A 1GR0A 3GNTA 2B35A 3B20A 3CTMA 1IULA 1ZSNA 2WD7B 3DZHA 3BZUA 7MDHA 1B2LA 5IZCC 1N8KA 3KETA 4M87A 3CPSA 3HDHA 1E1LA 4IS2A 4AJ2A 4CM1A 3PK0A 4PZEA 1B8UA 1YBMA 4BO6A 2E6UX 2Q1SA 2BMAA 4TWRA 4E12A 3WQSB 2PKQO 2QZ9A 3CUKA 4XGIA 1HE5A 3V5NA 5COAA 2HLPA 1G0NA 3EVTA 4YEDA 3FCOA 2EEZA 3GZNB 1CETA 3WTBA 1WPQA 3FI9A 5K6AA 4ZQFA 3VDQA 5DULA 3QWFA 5DOZA 2RAFA 2PTGA 3LDHA 4IJKA 1EBUA 1HDZA 2J5RA 5KJEA 3T7EA 4FB5A 3TOZA 5L4NA 1HRDA 3JQCA 1UH5A 3V8BA 2BH9A 5LDHA 2LDXA 5CPFA 1QYXA 2AQHA 1KOLA 1X13A 4R51A 3JYNA 1TT5B 3RASA 3QVWA 5HA5A 4BO2A 1E7WA 4YT4A 1Y8QA 5IG2A 4JCOA 3WR5A 3OQ1A 4DVJA 1I2BA 4RDIA 1WNTA 4YXFA 3V1TC 3L4BC 2E49A 3ZWYA 2GZ2A 1P1JA 5BNFA 2W90A 1JA9A 1BMDA 3PHGA 1EK6A 3ZWNA 2VRBA 3W8FA 3DZBA 4J1SA 1ZNQO 1GUZA 3JYQA 3MTGA 2FP4A 4MP6A 4QQRA 3EZYA 4KOAA 4Q3DA 3QQPA 5JO9A 2Y05A 3OJFA 1ZIDA 2G1UA 3F4BA 3RJ9A 3ZV5A 5DCWA 2O48X 3FTPA 4BB6A 1DO8A 1RKXA 4XGNA 5T5QA 1Q0LA 3Q11A 3ON5A 1UP7A 1Y5RA 4IJWA 4XQGA 1WP4A 3H9GA 5JDCA 1PL8A 1WWKA 2E48A 2JAHA 4BO1A 1MUUA 3ONEA 3OQBA 3PPIA 2VNSA 2UAGA 3HHPA 4Z0HO 1RYEA 3HADA 2IDZA 4ONEA 4CLOA 3S8MA 1WZIA 3VH1A 3GRKA 4HBGA 4HNGA 3RU7A 4FGSA 2OO5A 4IQ0A 2HJSA 4Z0PA 4NBTA 4EJ6A 2RHCA 1GEEA 2OFPA 5JBIA 4RZIA 4CM7A 1MGOA 1VL0A 1VRWA 2P2SA 4OGWA 2TMGA 4J4BA 5DT9A 2CF6A 2EIHA 1N2SA 1YONA 2P9GA 3A1NA 3GMSA 4MVJP 4C4OA 3FWZA 2OL4A 4IGFA 1NVTA 4B8WA 1HYEA 2W4QA 3TRIA 1Y8QB 1G1AA 3LZ6A 1C3VA 4YRAA 3GR6A 1AUPA 4FFMA 2BI7A 5DN9A 2JFGA 5IDWA 3VAZA 2X0RA 1X7GA 1E3WB 1A4IA 1I3MA 3K96A 3BMQA 1XDWA 2HKIA 3OA2A 3RQSA 3MEQA 5CDTA 3AI3A 3LC7O 4BS9A 4MIEA 3TJRA 4W82A 1R4MB 2HUNA 3DC2A 3DEYX 7ADHA 3JQDA 1I32A 3RD5A 1NQOA 3KEOA 2PNFA 3IKVA 4RVGA 1WMBA 3D5QA 1X0VA 3UOGA 1PS0A 5G0UA 1RM4A 4TKMA 3JQGA 4L8VA 4DUPA 1ISIA 2B5VA 1ULSA 2YFQA 4I5EA 4NBWA 3D0OA 1UZLA 4ROSA 5C5IA 1SCUA 3Q2IA 4E33A 2CMDA 4NJMA 2EV9A 2PY6A 3WQRA 4K28A 4CLOB 2A92A 1JW9B 1B3RA 1T2CA 4UAGA 4IBOA 5TT0A 5I7VA 2Z1NA 3FNGA 3ZHZA 2AA3A 3RUCA 5IDQA 1HXHA 1CJCA 1KEUA 1YBVA 3NTOA 3IUSA 4L9RA 4TKLA 2DBQA 3P19A 4WLVA 3WGYA 2NVBA 1U4OA 5CDUA 3RI3A 2WD8A 2YHIA 5IXSA 5A4DA 3EVNA 1NVMB 1WXDA 2E4AA 2NU6A 3GPDG 4IIVA 3RIHA 4N5NA 4WECA 1JLLA 5ES3A 3ZW9A 4CMCA 5B4UA 1E3JA 1X0XA 2ZCUA 3INGA 2HK7A 3AI1A 1P1KA 3L9XA 4JK3A 2VWQA 4LCEA 1RM0A 2WWRA 5HM8A 1PS8A 2Y0EA 4AL4A 3E18A 5F1OA 4CV2A 4BQRA 4M54A 3DBLA 4NZ9A 4DC1A 1OI7A 4ZVVA 4MVJF 3GEDA 1YOVB 2JD1A 2EXXA 4J1TA 3FTNA 1ZJZA 2GN6A 4TSKA 3BMQB 3NT5A 5G4KB 1HLPA 5IXYA 3DDNA 3JYLA 4HNHA 3ZWWA 1I24A 2CDBA 2J5QA 3VZQA 3CIFA 3JQBA 4NK4A 1I5RA 1TVEA 3NKLA 1OC2A 3CINA 1ENZA 2W8ZA 3E9NA 3UICA 5HS6A 1HYGA 1ENYA 1NPYA 2BGKA 3DHYA 4YWJA 5L9AA 3RBZA 1LJ8A 1DEHA 1BXGA 1Z6ZA 3JQGB 5H82A 4FJ0A 1NM5A 1NQAO 2D59A 4WCFB 4DPKA 3AWDA 1PL6A 4NU6A 2V7PA 2X23A 1V9LA 1A27A 4A26A 1NHWA 3RFTA 3ZHXA 3LF1A 5U1PA 2Q46A 1EE2A 4MVJG 1WW8A 1T25A 2GZ1A 4WLFA 5JDIC 2PH3A 4IM7A 4XDYA 3GEMA 3AY7A 3K2BA 4CV1A 3L4BA 5KVCA 1DAOA 1MC4A 2DFDA 3HG7A 4JBHA 3HJAA 2O2SA 4BGUA 3ZV4A 4BO7A 2GUGA 1YQDA 3JD2A 4OOFA 5A5EA 1Y7TA 2YY7A 3FNEA 1SB9A 2ZQZA 3I52A 2YHIB 3SEFA 3ZDFA 4EBFA 1NASA 2ZJ1A 4FFPA 1U9JA 4UEKA 1NAHA 1ULUA 1UXKA 1LTHR 4LMRA 5F1PA 1BTOA 3PHLA 4IDDA 1YVEI 1EEHA 2OBNA 4CMHA 1B16A 2JAPA 2NLOA 1PZHA 1CQIA 2DPHA 4MP3A 4F6CA 3ABIA 3DBLB 4YJHA 1C0LA 1IUKA 3NYWA 2O3QA 3NDJA 5KKCA 2J3IA 1ISFA 1P74A 2AQ8A 2JCYA 5DBGA 4XJTA 3M2TA 3DAPA 1ZH8A 2Q1WA 4R54A 1YWGO 4HFMA 3QVTA 1Q0QA 4HX5A 3WWYA 4CJXA 4ALNA 2Q1UA 1LEHA 1W0CA 1K6IA 3U0BA 3QV1A 5L53A 5DP1A 4Q3CA 4YT2A 1F12A 2Y66A 4J9UE 5T6BA 2CF5A 3Q9UA 3GEGA 4EJMA 4B4WA 1FJHA 4XWYA 4GX5A 1FK8A 2ZQYA 3PZBA 2J3JA 3JQAB 4LK3A 3UXYA 2NTNA 1NBOA 4ZRMA 1Z7EA 1GCUA 1U7TA 2X5JO 4JLWA 2HRZA 5IF3A 1ONNA 3QWIA 4IDBA 4PG5A 4E5KA 1OC4A 1PJ2A 2R00A 1XSEA 2VWHA 3GY0A 3ICPA 3B1JA 4IMPA 4AJPA 5DOVA 5K9ZA 4KWHA 4R5HA 1P0CA 1BW9A 3BMCB 3ETDA 3GMDA 4QXMA 4UEOA 3RROA 4LMPA 1N1EA 1UP4A 4J91A 1Z82A 2CDAA 2YW9A 2X0JA 2Y99A 3LT0A 4BNIA 4PLTA 5JLAA 2P5YA 1GV0A 4DWVA 1U3UA 1UUFA 2FHSA 8LDHA 2O23A 3TN7A 3MOGA 3K6JA 5HRUA 2FR1A 3Q6IA 1K2WA 3TL3A 3GH3A 3QRWA 1U7HA 1UZNA 2Q2VA 1VC2A 5A9TA 4J16A 4WEOA 1LSSA 1NTOA 5TJHA 2X6TA 3PZRA 1DRWA 4FC7A 3ZWBA 2VHVA 2B0JA 2ZIZA 1T1RA 2VZ8A 1R0LA 5A03A 1DJQA 8ADHA 1PZFA 4R9RA 4IQGA 5LC1A 2O3TA 5CG2A 1KYQA 4D3FA 4EEZA 5BR7A 2GASA 1ADFA 2NU7A 3PI7A 4WLUA 3O03A 5ER6A 1GPJA 2XPCA 4RPLA 3F47A 4Z3DA 4NNJA 2HMSA 3HE3A 5G0WA 3S2EA 4YT8A 2EHDA 1ZXLA 2FR8A 4GL4A 2YFHA 1YJ8A 3G0OA 4A10A 1B8VA 2B5WA 1V8BA 4WKGA 4ID9A 5BSHA 1B14A 5JS6A 1CIVA 4XGKA 4PLHA 5TS3A 3TZ6A 4GSKA 4J7CA 4R1SA 1N9GA 4QECA 4S3MA 1JKIA 3F1LA 2D3TA 4WLEA 4RZHA 1P31A 5H81A 1NQTA 2BD0A 3HZZA 4GWKA 3Q1LA 4JN6B 4R9SA 4RF4A 2AXQA 2YJZA 5T64A 3WMWA 3E48A 1U8FO 3WG9A 2V6BA 2P4QA 2DQ4A 1M66A 1WAMA 3F1KA 3I9LA 4GSLA 4B3JA 1BW9B 1P0FA 1PX0A 4E0BA 1ONPA 3R1IA 5F5NA 2D0IA 3AJRA 3KBOA 4Z6KA 4CUKA 4LVCA 3QY9A 2DTXA 1A9ZA 1FXSA 4XYGA 2Q3EA 4OXYA 3PWZA 1KC1A 1PTJA 2VTEA 4XJSA 3S1LA 4AJ4A 5KTKA 2FN7A 1E7MA 3NEPX 4N54A 4B4OA 1XCBA 1K5HA 4R5MA 3WFIA 4E5YA 1CRWG 4P4NA 4AJ1A 4RL6A 3L6OO 2PH5A 5KNLA 2XXJA 1K3TA 2CVZA 1LDMA 3K8ZA 4WLNA 1EE9A 5EQFA 1MXFA 2B4QA 4BV8A 2OORA 3DOOA 3HB5X 1ZBQA 3WIEA 5JAIA 4IS3A 4KDEA 5JDIA 1IPEA 4J49A 4D3SA 2H1SA 1QP8A 3DHEA 4J1QA 5AXCA 2YDYA 3I23A 1UR5A 5A05A 5HTOA 1TT7A 4WE3A 1C0PA 1O8CA
chains in the Genus database with same CATH superfamily
1FVXA 1PR5A 3G2QA 4ZREA 3JARB 4LJ8A 3WKDA 5IHXA 5DSXA 2E5WA 2CE7A 1ZSVA 2OBBA 4PFJA 5C81A 3D4NA 3G2KA 4P3XA 1PZNA 2DP4E 3E3AA 3F5MA 2P9JA 2VCEA 2A88A 1ZM3A 3NEJA 3UGTA 3MGGA 4BLSA 2PHZA 5IABA 5LDDC 5F98A 2P6OA 2VJDA 2YOFA 4KQFA 3FRHA 4U3JB 1YJXA 3RE1A 3ULKA 1XAJA 1OXVA 3ZVMA 1WDLA 2VJMA 2BY4A 2GK3A 4X1OA 1JFTA 1E9RA 4MVJH 4C6HA 4Q24A 1P17A 2R6DA 5BSWA 2M1XA 3A4MA 3QFTA 1OX5A 1BCSA 3A4YA 2N9UA 4L22A 5HOQA 3CVJA 3NDRA 4FDMA 4ARCA 3SC4A 4XDGA 1DFIA 4YRTA 5FJJA 4NCAA 1GGEA 2I3BA 4I1RA 2W2MA 2V0GA 3ZU6A 3UT0A 4EKDA 1E4OA 1JKJA 2O2HA 3ROEA 1XD2B 3UOAB 5L4LA 4JQCA 2XJ9A 3KYBA 4QIHA 3NYQA 2ZUTA 1QJCA 4RTOA 1LSOA 4N7RA 2K4MA 1LV8A 3A2KA 1RWXA 3L5KA 5CB6A 4ZRNA 3UWOA 1P72A 3HBNA 3RUFA 5BWBA 3RHFA 4GP9A 1AZLA 4LFCB 4R1LA 4P35A 4TOIA 5K0NA 3L8ZA 1NATA 2DHRA 1QIFA 3KJEA 4IILA 4AJJA 1JMKC 4M7PA 4B8YA 1WDKA 2X5NA 2QW8A 2PGAA 2G1AA 2E7ZA 2Y77A 1N6LA 3GAZA 3ADOA 2D5IA 1RQLA 4GYYA 1NFRA 1QMPA 1X7YA 5AVKA 4LYHA 5LP6B 3ZS9A 5A9SA 1AN0A 2A4KA 5BUCA 1UBTS 2O3JA 5FR2A 1Q22A 3CKKA 3TVTA 3KRTA 5KSOA 1OTXA 4TKVB 3F6RA 2A9KA 3QMVA 3T5MA 3U9TA 6YASA 1QHHA 2Q9AA 3AR3A 1RM3A 1PNOA 3PSAA 4WEQA 5C1IA 1QHIA 4NPCA 4BASA 4YAUA 3GVXA 2QRVA 4QYIA 2O59A 1XXHE 4HOYA 1TQDA 3QI7A 4JKOA 4GNRA 3JTMA 4EMTA 1BDMA 2QTFA 2W2XA 3CBGA 4FW9A 1NG9A 1HE2A 4JASB 4ZIRB 1GDHA 1XA0A 1TO6A 3DLTA 1GG9A 2NUTB 1MABB 2NNWB 2P75A 2X9LA 2XCQA 4H2DA 3WHIA 3OHMA 2NQTA 4MGYR 4K9PA 2C4KA 3W1WA 5EUMA 3IS3A 2CT8A 5K0SA 1K0UA 2PK3A 1CHNA 5E9QA 5GZ3A 1GCAA 4CKYA 2PRIA 1IBMB 4PZDA 1DO2A 5F9HA 4JSTA 3JVEA 4O5OA 1WCYA 3H3XA 1A96A 3O4RA 2C7BA 2VRCD 3RO7A 2ZRBA 1YZNA 3OD5A 13PKA 2R7MA 4LG1A 2JL1A 1IZYA 2NYUA 2NQ2C 3WOHA 1L5HA 3WWPA 3ZXXA 1Z5ZA 4FWIB 3ZX5A 4IOKA 3VVLA 4E30A 2DHDA 2X58A 3WHLA 1G41A 2P9QA 1A72A 2ZE6A 2HHHB 4CMEC 1DQNA 2POQX 3ADPA 2DGDA 3PITA 2C7GA 1FX0B 3WAJA 3UV7A 1XZBA 1XELA 1WUIS 2Z1MA 3CTPA 3NV7A 4MW6A 4RMJA 5HK8A 3TLXA 2DFLA 4D5GA 2VZLA 1LI5A 3FETA 4BN5A 1IIRA 3IJPA 1DUIA 3DTVA 4BTEA 2HK9A 1LFDB 2GKGA 2ETVA 3BFPA 1U5AA 2IXTA 1U11A 3KAQA 4CMBA 5KNBD 2XMBA 4DRYA 3CH7A 2PRSA 3OKCA 1T8RA 2QQ0A 3GVCA 3OE7D 4UHJA 3TQSA 4C04A 5HJ7A 5L45A 5I7EA 1Z17A 1Z15A 2ZZMA 2DKOA 3I5AA 2PX6A 1HLDA 2BR3A 3GO4A 4YASA 2QD5A 2V7WA 1S7GA 2FFAA 2G63A 4HZGA 5NULA 2CBXA 1YZYA 1XFAA 3CEPB 3VH3A 2OCAA 1GGHA 1ZD1A 1IVSA 1YU6A 4QJ5A 5H3CA 1CWUA 1XE3A 1SGWA 1XRPA 5B6IA 1VECA 1J8DA 1DJPA 2AE2A 5FBRB 4CIVA 5BR1A 3WY9A 2O0JA 3LY5A 2FG5A 5B53A 1U3WA 2RK3A 3GPBA 2JDID 2W6CX 1R5BA 3NVMB 1LTKA 1LH0A 3PPWA 3QF7A 1ZGJA 3DS8A 2FQWA 1EDEA 4LTMA 4WGFA 5EJGA 3SP1A 3P9IA 3V4OA 1UJ2A 2ID7A 2GYUA 3M83A 4Y6LA 1DTWB 4CDNA 5I48A 4FMPA 1ZZGA 4LE2A 1FSFA 3QBVA 4EO4A 5JU6A 5K3FB 2HOQA 3PRYA 4P4GA 5FJIA 3JQBC 3MWEA 1R37A 1H4QA 2VBCA 1DX9A 3CE9A 5G0TA 5FUQA 3DL0A 2XXAB 5JCOC 2HY7A 3H8JA 3OZXA 5D7BA 2IYEA 4PLYA 2HO4A 1N2CA 3WI7A 4G26A 2PZEA 3GF4A 3I5YA 5DYWA 3O92A 2PUGA 1ICEA 4GX2A 4MHSA 4KQ9A 3ZJYA 2C4UA 2ATXA 2X1VA 1SVOA 1U0RA 1JAYA 2P9ZA 4X7RA 3X43A 3F73A 5K3DA 1GKKA 3BHMA 1P7PA 4B2IA 2EKLA 4I8IA 4I4LA 3BJMA 1DG9A 1ESCA 3P4XA 4DBZA 4I50B 3NTXA 4NMMA 3U61B 3ZWAA 1IG0A 1ID1A 2VJKA 4Y0VA 2EGUA 4FS3A 1EGVB 3NGMA 4G86A 2QTAA 4IZIA 1L7NA 3DPSA 3HH8A 3ORSA 1XNHA 1EQ2A 2ZBRA 3EXIA 3KTOA 3A32A 2PX3A 2X5OA 1YR2A 2PMWB 5CDFA 2F1KA 3IDZA 5FOUA 2HXGA 4QKQA 3SM3A 2FZWA 1J49A 5ER9A 2O7NA 2NUPA 4YAIA 2P9YA 3ANLA 5K0ZA 2H16A 2Z56A 1F2UA 1IYZA 1KZHA 3TRJA 2BC9A 1Z8HA 1Q83A 1WG8A 2F48A 2WFLA 1T0JB 2Z5VA 3RJMA 1K27A 3MUOA 4UXHA 3KKZA 1UOEA 3CUSA 3VYUB 4AUMA 4N6OA 4JXJA 3HCNA 2GHIA 4AJOA 4EAQA 3B9PA 4YDHB 4ECEA 1IUNA 4AS3A 2Q2WA 5TX7A 1PYGA 1M75A 5A3RA 1NMSA 1TMOA 1Y1LA 1IXSB 2IOFA 1I9CA 2R1TB 2RHDA 1OYVA 2X41A 4TQAA 4W1SA 1ZUHA 1T24A 2O5EA 3BWDD 2B92A 2DY0A 5EYPB 3VX3A 3ZQKA 1ABBA 4ITUA 2AGVA 3LCUA 3E22B 3IOMA 3LCMA 2IX9A 3ZWMA 1MN6A 2IUUA 1E6EA 1QIHA 1W88B 5IAJA 4A2PA 3L7AA 2W2LD 2C3MA 4RMHA 2IH2A 3ZWPA 4B48A 3BTOA 3NGXA 2E82A 1E0DA 2VZ0A 4QYXA 2VRNA 4E4TA 2I2DA 2NU8A 3I9MA 3AFHA 1F38A 2XH8A 5EXDA 1QV7A 1YO6A 3SXUB 4F96A 1CKEA 5EMLA 4DSAA 1I36A 2P3SA 1EXWA 1BEUB 3LK6A 5L3VA 3MTAA 3I5XA 1E3DA 1GLNA 1WKBA 3F67A 3JQEA 4JAVC 4P7FA 4TQGA 4BBAA 1DBQA 3FFBA 3FNRA 4TYYA 1XZAA 1C0KA 1NXQA 1C50A 2IYLD 1S2MA 1M2OB 3AERA 2OXTA 3WRYA 3SYTA 2Q4EA 2ODQA 1AHNA 1QLJA 3T12A 5A5DA 1J5PA 1JI3A 1BG6A 4L95C 4FILA 3ILYA 1V5WA 4KGZA 2CJXA 1JJBA 2ZJZA 2CC2A 1FC0A 4V1CB 2WJPA 4DB4A 3F3YA 1QVVA 4GD3Q 4IVNA 2GCEA 2PGJA 2YC4C 1DCFA 4C9BA 3BIOA 4L6AA 4D0LB 3RVOA 1N1GA 2R00C 3QPVA 4IXMA 2OK7A 4C43A 5AI4A 3QVUA 5D87A 1IZ0A 4YGXB 5AK5A 5DFAA 3RREA 1ECCA 3C1AA 5E6SB 5K3SA 3IQDB 1VLZA 3OZUA 3UXHA 3R7WB 3VZDA 5JZ9A 4OXNA 2GZMA 2ZJ7A 5ARDA 1H5UA 1ZUNA 1M2KA 4JITA 3LXMA 2DT5A 5LM3A 3R8FA 1KEEB 2R8XA 5IJAA 4CIWA 1R9MA 4KMSA 4F5YA 2VP9A 2ECOA 3GELA 5KVSA 1ORHA 3VUFA 1K89A 3LUGA 1Z4OA 1XEWX 5KWEA 3N75A 3GLHB 2NYVA 4WACA 1GNQA 3TZEA 5EQDA 2RIRA 2JKZA 2FEOA 4D8UA 1DOAA 3LT2A 3K1ZA 2JLXA 4YCJA 1P0MA 1M72A 1VL1A 2X3FA 4H27A 2PKEA 1R5OA 3D3QA 5KQPA 4COOA 4ZI7B 4EYSA 2A0XA 3IEUA 3N2GA 4UBOA 2C29D 3GEHA 1P7YA 3GARA 4LXIA 3QF4A 4DCNA 2YWBA 5KJCA 1R6TA 1SPXA 2IOHA 5DNUA 1H23A 3EZLA 4JUAA 3CZPA 3GA0A 4DXDA 3H8SA 4WN9B 4CMEA 2PZAA 3A2LA 4QUIA 4EYQA 2XW6A 4MV9A 3LM8A 2VHZA 1F4PA 4E46A 3NHAA 4EB6B 3DE4X 3PGLA 4HYEA 5LZ8A 4C6SA 4DV5B 5DKFA 4A0HA 5IXJA 3LLVA 4PG4A 1UM9B 1AF7A 3TEMA 2V55B 3BXEA 4YMHA 3RDPA 5CB8A 4MV6A 3RAGA 2H51A 1KI2A 2QTVA 2WSSD 4CQLB 4DMCA 4EG5A 4HH0A 4WBNA 4BWFB 4RY8A 4B3HA 4D45A 1HT3A 3IA2A 1OLUA 2X7XA 3KQKA 4GT1A 2VL7A 1YR8A 3ZWKA 4II7A 3NHUA 4AVYA 1KYZA 1H8ED 3LAWA 4GX0A 2FY8A 2EBFX 1NE2A 3BYZA 4I5GA 5EHZA 3OQIA 1K6XA 1L5RA 3A58B 1VIAA 3L7NA 4MINA 2QYHA 1KK1A 1ND6A 1DC8A 1HWYA 3F78A 3GC6A 4XD7A 1LBTA 2AFIA 2H1RA 3N74A 4JLAA 5A4KA 4K6FA 1IHYA 5TQ0A 1FPMA 5AQEA 2Y27A 2XT6A 4BUCA 3QKSB 2JEZA 4NNPA 3W5AA 1SUIA 1GU7A 5FF9A 3IB3A 3STHA 2BONA 3O8QB 4P2GA 1AXGA 1ODIA 1ZITA 3NVAA 3AR9A 5H0IA 3R7DA 3WYAA 4MPRA 1H2AS 2AMLA 2W6MA 3A1UA 4JQOA 1T0BA 3AEQA 2IS1A 3LUBA 2ZI6A 2H7CA 3I2HA 1VJ0A 4JC8A 1YDEA 1OIVA 3BXOA 4M9ZA 2FMHA 4QO7A 2PQ0A 2D1RA 2H06A 3Q72A 5E9AA 1I7QB 3GYBA 1XMPA 2IZ7A 1CRZA 1M33A 3I30X 3JR7A 2Z2XA 4M0PA 1F2TA 4OXXA 2WV7A 3RUPA 4KMMA 3OX1A 4H7DA 8ABPA 3UUWA 3BJIC 2IYPA 4EY5A 3WGNA 1VPWA 4EKIA 2LWIA 4QVIA 2FPWA 1FYEA 4RPGA 3JSAA 2DE0X 2QE7A 3W04A 2EJVA 2JBWA 1PHPA 3F6EX 2XMSA 3NS7A 1KK3A 2CNKA 4UU0A 4A15A 3VYWA 4E14A 4MQUA 3TQRA 3UWSA 2AWOA 2EZ8A 1A9YA 3I8SA 4GGMX 3BN3A 2H07A 1GTRA 1VIVA 3FMOB 3LH5A 4L75A 1RHKA 1NMEA 4V02A 5DNWA 3DLCA 3VPXA 1TE2A 2BKVA 4MROA 4URZR 4LSMA 4BLTA 1ZD3A 3CF4A 2BEJA 4IY1A 3WBBA 2QRGA 4L4SA 4M99A 3O4VA 1OU0A 1UXJA 4IKPA 3IULA 4RFLA 4KO2S 1O97C 4C4SA 2FFRA 4E7PA 3DQPA 3KLBA 1I01A 5JYDA 3LXXA 3OZSA 4K3UA 3NTQA 1I4OA 1X1SA 1S2NA 2XQIA 3NC1C 4C2TA 4OUDA 3C3BA 3OFVA 2NXCA 2XUJA 3KOMA 2YTZA 5BSVA 1E1CB 4I9UA 4AG6A 2ALJA 3DBRA 2BM8A 1VHQA 1SVSA 2FB9A 2WF8A 3ZHSA 1W85B 3NR2A 3QJ5A 1K66A 5AW9A 4DA8A 1DOHA 1WXFA 2BF4A 1E1QA 4JJGA 5EPOA 2XUDA 2G6BA 4A8TA 4WGGA 2JCBA 4S1PA 1M0SA 3V2HA 3V48A 3HJCA 3ZWDA 5ICSA 5E0KB 3BD9A 5LOVF 3PWSA 1YB6A 1ESEA 2SICE 5FTWA 5I9BA 1C1HA 3G2LA 1N5OX 3EVAA 5CA1B 3ML1A 3I4FA 4MMYB 4EOGA 1H4TA 3MRTA 4KGDA 2EYUA 1XMSA 4RA6B 2GLTA 3CVUA 2DH5A 2KW5A 3KE8A 3JASA 2MSLA 1SQGA 4XASA 6GPBA 4MGEA 1WS6A 5JC1A 1SR8A 1JEOA 2AYZA 1Z6YA 3E5RA 3LCJA 1YS1X 2ORVA 3G13A 3OA0A 4KBYA 3UJ3X 5IYZF 1AY0A 1ST2A 4UD6A 3AG6A 1A1SA 3IO3A 1GP2A 2OHGA 4DMRA 4ZZIA 5BSEA 3PKIA 4XYEA 1Y3IA 1SQFA 4J7XA 3R6TA 2COKA 3IPAA 3RG8A 4DWWA 4EUSA 1JHYA 1THZA 2CLIB 5BWNA 2I22A 3IAS6 4O2RA 4Q1DA 4MWTA 3JQAD 2X8BA 3HEMA 3LHFA 1OXKB 4I9HA 4P22A 4TWIA 2QPOA 1UP6A 3CS3A 4JYCA 5CXQA 5JQGF 1QRSA 4KWIA 4CEIB 3OJEA 3VKWA 2DTDA 2XZDA 1RZVA 3UH0A 4QM7A 2P1ZA 1ZCJA 2GPBA 3VTKA 1U0SY 4HC4A 4DLTA 3E23A 1TZMA 1VJRA 1QMGA 5A62A 2AK3A 3JPWA 2OZPA 1TLLA 1CDEA 3SHOA 4BUJA 1H69A 1AMUA 4XKJA 3IESA 3GLVA 4HUQA 4Q4HA 4YMIA 3PNQA 2G9NA 1STOA 2ZTMA 2DWPA 4MEJA 5IVDA 3UA4A 1R15A 1AA9A 3HSKA 2AKEA 1V11A 3KSZO 3NRCA 2BJHA 2QVYX 2W43A 4Z9XA 5IANA 3PEUA 4MVJM 1P2FA 3V42A 1WKCA 1Y3AA 1Z06A 2N46A 2EP8A 3JQ6A 4XVRA 2DHEA 1ISJA 2X9QA 3RSHA 4J0DA 2HSDA 3AETB 3EGOA 3T7IA 3R0XA 1NVGA 2Z6VA 3A14A 4LFAB 2VG8A 3PNBA 4IUYA 1E7QA 2RGGA 3R0VA 1XU7A 4MH0R 4Q16A 4F92B 3GLIA 3SIRA 1I0LA 2JIMA 4GYWA 3FF4A 5FFFA 2W6NA 3FH0A 4LY9A 4XGRA 3VKGA 5KQLA 1MC5A 2HB6A 1OTYA 1Y3HA 4MDYA 1SFRA 1V5EA 1TJ4A 3B9RA 4HEJA 2EHJA 1O9GA 4BO0A 2V7XA 4HPJB 1Y1KE 4ND8A 4I5IA 5SICE 3PNPA 4HWSA 3WLSA 1QV9A 3K3PA 3Q8WA 2IUYA 5K8IA 2XGSA 3ZJVA 3R9XA 1HH4A 4DILA 3K6SB 3LFTA 3MJ4A 1ULAA 2O2CA 4XWTA 2V7BA 2OWDA 1XA3A 4F5EA 3EUFA 1EDDA 1Q1GA 1V7PC 1AZWA 5B55A 2QU8A 4DLKA 1NXSA 1RAAA 2PZFA 3O5AA 5AUQA 1KO1A 4AZSA 2GEVA 4CL8A 3B38A 4EVSA 2HBZA 1B23P 4WESB 1NF2A 1VG0B 3BQ9A 3JZAA 4WCDA 3VHXA 1UQUA 1RYDA 2L0XA 5CIWA 4Y0AA 3SSMA 1AMOA 1JILA 1NJGA 1W6UA 2I3AA 3G85A 3HVUA 4UUNA 4YMUA 3ZHQA 3LD9A 2OZKA 4DJTA 1F17A 5GZ6A 5IJXA 4A8PA 1E9CA 3GLGE 4Y18A 4GKKB 4WUVA 1QB8A 1TEVA 2BHSA 1RWPA 3HXPA 3TSAA 2WZCA 3HLTA 1VRVA 3GP5A 4K5QA 4YONB 1HO3A 3FHLA 2VDKB 1E8MA 5DLYA 4BNVA 3K9BA 3MLEA 5KWJA 4NP6A 1E64A 3FPEA 3L43A 3QLVC 3U4AA 3UV6A 1IBKB 1C1XA 4QPJC 3G3EA 3K0FB 1YE8A 4PFKA 4ARIA 3MJFA 4GZ5A 1E79A 1XZNA 2REXB 3UWMA 4AKGA 4TRJA 4D9GA 1C3LA 1B1AA 3FLEA 2XUOA 2AXNA 1T3TA 2PGLA 2B4YA 3WK4A 4QO8A 3A4VA 3EFOB 1K5DA 5HE8A 5LXTB 3N7TA 4KPUB 3UT5B 4I8XA 3TLZA 4HDQB 1QRAA 5JVDF 2F7SA 4IVPA 4M8KA 1EK5A 4KIGA 1KR2A 4KN6A 4MGIR 1ZBDA 2P8JA 2PKQP 1G38A 3NRBA 4NXMB 3WYEA 1G63A 1M83A 1N5LA 3GJ8A 3HL0A 2G4VA 4R0MA 2FZEA 5ADVA 3AL0C 2GNPA 4XYMA 4U7DA 3PR1A 1H94A 1PR0A 2Y93A 4M1SA 5LA6B 4OVKA 5KX5B 1XZQA 1QP4A 1IXRC 4ZV7A 4MR9A 3BK7A 1RS0A 3CW8X 3ETEA 1BZYA 4DW8A 3QKIA 5KYXB 5KREA 3OUZA 4RVNA 1T9GR 4LOAA 3KWLA 1H2HA 1QF9A 2XMDA 3QVMA 4ZMBA 1GN8A 5LQKA 2HF7A 3P0FA 5JANA 3I05A 1O94C 3AVOA 1OLSB 2BZSA 4M0LA 2G77B 4MV0A 5FBZA 4YP7A 1CQJA 4DM4A 1DRUA 3R0JA 1GLVA 1CNEA 1XDGA 2WTMA 2YWJA 4UAVA 4C5CA 2HT6A 3U5TA 2HK6A 1A8PA 2ZS8A 3ACBA 3BBPA 4C7BA 1N0IA 2PQ6A 1P19A 2WUWE 2YYZA 2ODNA 3WK8A 4D9FA 4G37A 4PX3A 5FYDA 4TRRA 5JW6A 3K9LA 2WICA 3AEZA 4MRRA 2YS6A 2C82A 2DCMA 4C22A 1RYZA 1I51A 1L9XA 1PFKA 1KKMA 3COSA 4IVQA 4BMOB 3MWKA 4LYYA 3TL6A 4ODIA 4AFNA 3A6ZA 6LDHA 4BWYA 4CKCB 1U1IA 3PVZA 4HL6A 1A9RA 1ZGAA 1N2ZA 3C1UA 2FEAA 4BAZA 3KLPX 4DYDA 4O4LB 2EKQA 3OTWA 2CDCA 2QIOA 3INTA 3O8OA 2A5JA 4UHKA 5K0FA 3LPAA 1ONOA 2ABWA 1E77A 2AN3A 3PLNA 1IN5A 4O1IA 1GZ3A 1A0OA 2GAFA 3D8UA 3OJLA 4LYDA 3SSOA 3TE7A 4IFIA 3ZD8A 4KEAA 1AGXA 4HAOA 5JSUA 1R2QA 3C4VA 1LQUA 1FTGA 2VPPA 2C8KA 3A1FA 1I5OA 3PFKA 4H0NA 3EFBA 4CTNA 1RADA 2QLLA 2A94A 3Q2KA 4YJDA 1W7AA 3VVBA 3C3MA 2ID4A 1V3UA 2ESRA 1M7HA 3O83A 4IIEA 3R9WA 1SBHA 4QTUB 4KACA 3WL6A 4LKOA 1O95D 4A36A 2EP7A 5ALOA 4LI3X 4JT4A 3NANA 1DAPA 1V47A 2PLFA 3HI6A 1T43A 3LQ2A 4J2HA 4BLWA 5C7YA 2IPAB 3H3FA 3HLKA 1DG1G 1XL0A 2RI1A 3H2ZA 4OHKA 4XR9A 5L7WA 3R7SA 3QNMA 1PQPA 3PCXA 1YGPA 5C7LO 2JF0A 3GJQA 2PWZA 5K01A 4AYXA 2ZRJA 1DC7A 4RNDB 5ABPA 1P2DA 2EL9A 3QKRB 1GQ2A 2OGWA 3O6VA 3ZX4A 2IIQA 4D97A 5FBKA 1LB1B 3E84A 2A5DA 2W58A 2OB2A 4C3OB 3ZGXA 5E95A 4KE9A 4MKRA 4A8HA 1UANA 4X62B 2HO5A 4H7IA 2OV1A 4JBIA 1XTSA 1HTTA 2VDRB 3VNQA 4NENB 3ZV3A 1HLFA 1QYDA 3UUGA 5CGZA 4LJAA 2HQBA 3DZJA 3L0YA 1CZLA 3O74A 1XZDA 5JBQA 4W5NA 2RHJA 1PUXA 4YAKA 3DWFA 4Z49A 3SSAA 4N3NA 5CCEA 2CVQA 3EIFA 3Q3CA 1K68A 1LKZA 4EH1A 3IOCA 5ICFA 5MHTA 3WWCA 3KSMA 1DKPA 1RBMA 2GK4A 4FFNA 1MIOB 2FI1A 3TAXA 4OI1A 4XTCS 3WGKA 4YHBA 2AQIA 2I29A 2Y1EA 3DZGA 1QQ6A 4PLVA 3SAJA 2LPMA 3K4QA 5HIKA 4JEUA 4L5JA 4IICA 2IHBA 3H8VA 4OQFA 4XCVA 4DSOA 1F3LA 2IU3A 5EXXA 2VXOA 2AFHE 4XYBA 4POOA 4WLOA 1H6DA 3K35A 3KJQA 1GADO 4NVRA 3KVVA 4CQMA 2P9HA 4CVNA 1JLSA 4QULA 1E62A 3NAZA 1JWLA 2CL5A 4RW0A 1TF5A 3NTVA 2O8CA 1P6UA 3WV4A 5L6LB 3N2NA 2WHQA 4AYTA 4PZ0A 4ZC1A 2CE2X 1LZLA 3HFGA 4FE3A 4UZSA 1LI4A 5LBTA 2CMFA 2VPZA 4LYJA 1X7ZA 2NWQA 1IDOA 5IVKA 1JSXA 4MVCA 3S1SA 1WSAA 1Q2XA 2YWXA 3LC0A 3MTQA 4YUAA 2VQFB 4QDKA 1Y8RA 1Y1PA 4OH1A 4XFKA 4YRPA 2QSYA 3T95A 4ALJA 5IHPA 3IEVA 1OW3B 1LLCA 2BGIA 2F8LA 4UOZA 1FJGB 1Y6QA 4L4UA 5AW3A 4BXOB 5I9MA 4AYWA 3N9IA 1GPKA 1OFGA 3GOQA 3ADDA 4MR8A 2NVWA 5CT4A 4G1EB 1PGPA 4BECA 3PX2A 4L57A 3O7MA 3IAEA 5FI1B 5JSZA 1I94B 4NCKA 1D1TA 3JQ7A 4AWBA 4BKUA 5AHOA 4L16A 3IEKA 4CV3A 5IZ4A 3KTDA 3K15A 5CA0A 3ZE7A 1N6PA 221PA 5DT2A 2AHRA 1NT2A 3EW9A 2CHEA 5I5GA 2CB0A 3QLVA 4UJ5A 4OXQA 5ALGA 3VU9A 5L3SA 3C5CA 1Z7YA 3QVJA 1U7PA 5CR9A 5KNBH 2FLWA 4CGZA 1ISPA 4HDKB 4BNKA 2EJTA 5EJMA 2PSJA 3USCS 3BBLA 4QOFA 2ZCVA 4UHHA 4EKNB 4HGQA 1ULZA 3D8HA 4YC7A 2YXBA 3D6FA 1FL9A 1Z56C 1WZNA 1NR7A 2ATVA 3NFRA 2HPVA 2IF2A 1NMXA 3FHCB 4M1KA 3RG2A 2I78A 1UZUA 5LWHA 3AVQA 2CZCA 5LL6P 4TYNA 5A6SB 3RKUA 1TB4A 3CZAA 2J45A 4GAEA 2X42A 1D2NA 2H0RA 2A86A 2OCBA 3CLUC 3EC2A 4G4IA 4II3A 3AM5A 4EAAA 1SCDA 5H81A 4J7UA 2Y8EA 1ZK1A 3MUFA 3GLUA 4LWPA 4II2A 3BZBA 1OXUA 2J3KA 1XU4A 4BNHA 2HD4A 1ZSYA 2QTNA 3KS9A 2PMKA 4UVHA 4X64B 2QRHA 3DKKA 3G17A 4Q21A 4AAYA 1PJLA 1LPOA 1U28C 2Q2QA 3CGWA 2AVNA 3N3BC 4N76A 2UZIR 4EFNA 2H6EA 4EENA 1JBQA 1A5AB 5KHLB 3QP9A 2YV2A 2HPAA 4ML3A 4NMWA 5EXSA 1KDRA 1SIWA 4GPZA 4EW1A 5B1YA 5K6TA 3VSEA 5JS2A 3FUVA 3K71B 4DV3B 1EVYA 1YACA 2ZUDA 1T4CA 2RG1A 4YQYA 5E7IA 5JCJA 2XE7A 5TR9A 1Y8ZA 4P0QB 2DH6A 1K8ZB 1I0IA 3OFJA 5EE9A 5A4AA 3DTVD 3QU9A 3RWMB 2A9FA 1T9ZA 1J21A 1H2BA 4K1LA 4ZK2A 3KYJB 5B2ZA 2VUSA 3TIXB 3I9NA 5HKBA 1T36A 3EQ2A 3KUXA 4EG0A 1JIIA 3TPFA 1YVPA 1Y48E 1N7GA 1R64A 1H9AA 2ECQA 4P3KA 4DG5A 4GI2A 4K40A 1ATZA 2CCGA 4G8DA 4BLQA 2VBIA 3H1EA 5K5EA 4NIMA 2UU9B 2NVUA 4PLCA 4R9UC 1JGTA 1DJMA 4PGMA 1MAVA 4AKSA 3IMFA 1W5TA 4EIWA 3GQVA 2EQ5A 4NATA 2NVOA 2RGCA 1KYVA 1Y4ZA 4NR0A 1JHDA 4YR7A 3E27A 2QAGC 1X74A 4BDSA 4BNTA 3I6YA 1X39A 1JSZA 2WB2A 2ORWA 3J7TA 1A77A 4TVKA 3EF1A 4QE3A 3F0TA 3E9QA 1LRJA 4CF3A 3UJ8A 3NNDA 2C5BA 5LQRA 2XTJA 3MC1A 4GG1A 2Q45A 3OLXA 4XRGA 2QZ4A 3AIIA 2W9XA 3C7DB 3F98A 1Q7EA 2DBRA 2I2AA 4LECA 5JCPA 1MB9A 4KR3A 4R3NA 2LIVA 3A8TA 2CJWB 5B1HA 3OIDA 2VHEA 1U4NA 2LRHA 5I9IA 1MU0A 5H59A 5ED4A 3FGNA 3JD3A 2BEUB 3EY9A 3SZGA 2Y1KA 4Q9JA 2Z98A 2Q4OA 4J07A 2FPPA 2NN3C 1TX4B 4IO1A 5IAGA 2BMVA 3W06A 1DV2A 4AMGA 3RR2A 3N8HA 4DA0A 3KQMA 3O21A 4L8GA 4M0CA 2FSGA 4K8RB 4I6EA 4NU0A 1T2EA 4C7KA 5DP2A 4C4ZA 3UAVA 4QZVA 4YP1A 4LUCA 2ZETA 3FA2A 2H9IA 3EWSA 3K16A 1QRRA 2YWDA 4WDRA 4TMZA 3FNQA 4KBFA 4ZV9A 3SK0A 5CM9C 1VCNA 1UXHA 2P9TA 2ZRFA 5D7NA 1YTUA 2WZDA 2AK2A 2WZBA 1M6EX 4H18A 3NOOA 5GJVC 3T35A 1FSSA 2ZYHA 2INGX 3PXUA 2VK8A 3SX2A 3ESAA 3VNBA 3WB1A 3X3HA 3CPEA 2MDTA 5KINB 5NLLA 2PWAA 5IPFA 1EFCA 5LDGA 1XKQA 2OMEA 4PVCA 2YV3A 4L0MA 2GFHA 4HDSB 4EABA 4G67A 3UKDA 4N7BA 4EKGA 4D6YA 3CEJA 2OVBA 3E15A 4V0NA 4JDPA 3DMTA 2O5VA 4OA5A 1WUHS 4AS2A 2J31A 1FYWA 2VH5R 2Z08A 4R84A 4RETA 3QKUA 5AXBA 3G68A 3RUIA 2PFSA 3TLMA 1GA6A 4I1VA 1L0BA 1VLLA 1XD9A 1USWA 3OHPA 5H70A 3UXMA 3TLGB 2FFBA 4MMZB 1M1UA 3ZWVA 2OK8A 1YS4A 4CMKA 4CUJA 3ZS8A 1I2AA 3A9TA 2D5CA 2P9EA 3LBAA 2H0QA 1CPYA 4L3VA 2XYQA 3L4SO 4Q03A 4DQUA 1GQRA 5JROA 1OLOA 1XLTC 5EIWA 4A03A 5AK0A 3AZOA 3HYRA 3N7UA 4WXPA 1ADBA 1TM2A 1Y5LA 4O4LF 1T2VA 2QVCA 5DHPA 3T7CA 1Q44A 1E9FA 2H18A 1YQQA 1D2MA 3ANXA 3IAHA 4CEHB 1D5WA 2JGDA 4PHTA 2CKDA 4MA4A 2O5CA 5G1PA 4DR2B 1A7UA 4WINA 3PTLA 3JQ8B 1IEWA 2B5OA 3QXSA 2XODA 3C74A 4FN5A 3TIIA 4V2UA 3HDQA 1YL5A 2I4NA 5FOVA 3AW9A 4NQRA 1TD1A 4I99A 1E1MA 2IIBA 1CD5A 2DX7A 1E6MA 2IIVA 1NT4A 1OPXA 2WMOB 4M0MA 4N65A 4EARA 4C0AC 1GKLA 1M3SA 1KY5A 1GSHA 2IDKA 3U1TA 4RHCA 2NZVG 4R1OA 3RH0A 3IP1A 4UBJA 1RE0A 3LG2A 3TL2A 2NT3A 4M0FA 3VNAA 1M8PA 2Q5EA 1ZAKA 2K2WA 2YXPX 2OV3A 2EJWA 4BNMA 3GROA 5LYJB 3DXYA 2I9PA 4HNTA 2ODPA 4TGLA 3DE3X 4FLMA 1PJ4A 3NIGB 4YI3A 3S27A 5A3JA 2UUBB 4QA9A 2G80A 2GDJA 3OX4A 1VHWA 3PPXA 2BR5A 1KI7A 3E5NA 3HVKA 5B57C 1DTEA 2YS7A 2ZJYA 5CX1A 3ND5A 1AKYA 4YUWA 1FSGA 4UDXX 3Q85A 2Q2OA 4PG6A 4YIKA 3PFFA 3P2YA 4NPHA 5FWAA 4BPBA 2FEWB 2MSCB 3CO0S 2RGXA 1H65A 1YFZA 4TXLA 3X1XA 4MP8A 1AKNA 1CUHA 1XTVA 1R4NB 1NXOA 1JR4A 3R4VA 3X1KA 1F7VA 2VJCA 3BCRA 4BY9E 4ITRC 2M6LA 4QEZA 5DX8A 1QFZA 1QBKC 3JQPA 2EU8A 4I6JA 2NU9B 4YWHA 1TEHA 3GRPA 1H85A 1E2FA 5CLHA 3O8BA 3CLKA 3IIEA 1LDNA 2BFFA 3KEFA 4JR2A 1JN0A 1OZAA 3U4GA 2YZNA 3OFSA 3EPJA 2B2CA 1H93A 3WWDA 1WP9A 4D3DA 4JODA 4QGGA 1PZMA 2VA9A 4KE7A 4QWMA 1CTQA 3BXZA 3IQZA 1M6HA 2ZATA 3KKQA 3MELA 1BE0A 2JI4A 5IJZA 1FQOA 1U28A 1ZK3A 3E82A 3HCCA 4IX1A 3Q7RA 4AZ3B 3FM9A 3G9TA 3NHPA 3ABSB 4MYTA 2AN1A 3C85A 4UTVA 3DOCA 4B33A 3TUZC 2HV9A 2REQB 2VEDA 2GWHA 3FDFA 3IHWA 3WE7A 3ZLUA 3P1JA 4CG2A 5IJ0A 1C4KA 4R01A 1ZGHA 3FUUA 5KJ1A 2H4ZA 4BFYA 4PGGA 4NFLA 2PKXA 4Q4LA 5CLGA 5A7GA 1KERA 1BAPA 3EY4A 3TPZA 1A9TA 3QWAA 4AG3A 2VK4A 3DCYA 3DZCA 4YALA 1Z88A 4P54A 2Q3JA 4F9EA 3L04A 3G5MA 4K6CA 4EI2A 2P3QA 1OXTA 1NJ5A 5DWDA 4ZZ3A 2YOHA 2FJUA 2Q9BA 2QN8A 4LVUA 3F46A 3JTEA 4PU0A 1QE5A 4XD7D 3MM4A 4C21A 2AZTA 2VAMA 2W2OA 1U3TA 5FBLB 1WNFA 2ZREA 3FWKA 4JQYA 5BPHA 4HHEA 2FUEA 5LJLA 3JXEA 1TPZA 1N1MA 4KHPB 3OM8A 1NU8A 2OSBA 5HDQA 4CLRA 3W5IA 2NACA 3NT4A 4RWEA 4YCMA 3A1SA 4Q19A 4Z2YA 2QX6A 1RC0A 1J0XO 4XTRA 5ECGC 1H6BA 1VE7A 4WA8A 2ORED 1IN4A 1VPDA 4RXTA 3UA3A 3U16A 4BGDA 3B3JA 5IFLA 2G72A 2GJ9A 3BAZA 4PXSA 4U7HA 4FE7A 4D8VA 3AVPA 2QVXX 3U9SA 4IXDA 1U7DA 3EJWA 4IV0A 4PHFA 5EZSA 1RVV1 4J75A 2IP1A 2WDPA 5C32A 1ISSA 2F3UA 3RIMA 1ATIA 4TT3D 1CXZA 5EFZA 4Z5XA 1CX9B 2BGJA 4F1JA 4N39A 1P3JA 3S28A 1N2OA 4Z54A 5L51A 2I2XB 3E8MA 3WO1A 3NDIA 3RAPR 5F9FA 2MMGA 1MR3F 2Y92A 1VKOA 4X20A 1HQKA 3UCFA 4KZKA 4PE5B 3KTAA 5DGDA 4DLBA 2H4YA 3DA8A 5KTYA 1NMYA 1YZFA 2BUBA 2OHFA 3UWPA 4AUEA 2PWPA 2JI8A 4FBLA 4I5DA 2XA9A 4KO1S 4O0LA 3V1MA 2AN9A 4S1TA 2DETA 5AIAA 4BNFA 3W4IA 4PGFA 2AYXA 3DHWC 2VSNA 4GFDA 3RVLA 2CNWA 2DUNA 4RVFA 1NVFA 4CIBA 3BC1A 3L46A 1TJYA 4QXPA 4BFUA 1OA1A 5KU7A 2ZUEA 5AP9A 3TKLA 4YJFB 4XM0A 2OGSA 4R05A 1XDUA 1KP3A 3B70A 3Q0EA 3UJBA 4OK5A 2ISSD 2WY2D 1KOFA 4HEA6 3WAGA 4LF9B 2WWXA 3EEBA 3HXLA 1U90A 3HCEA 3HPRA 1PD1A 3A3NA 4UMFA 3L4EA 2BBWA 4F5ZA 1UDRA 4C29A 1FF9A 1HDCA 1AQYA 5ENVA 2OAEA 2PR7A 3CBQA 1KXZA 2FSIA 2Q0HA 1YAJA 2V65A 3DZIA 1LLDA 1VGVA 2ZSUA 3G0GA 1R5NA 1YR1A 2GPNA 4G9EA 3ND8A 4KQKA 4WN3A 2QNIA 1XQ9A 2W8BA 4RPJA 1CJUC 3U3MA 2Y0CA 1MJGA 2BFMA 3PC8A 4YRDA 3U9LA 1DC5A 3U81A 3IT0A 4LZLA 5JTUA 1S8OA 4FEAA 2Z8YA 4IX9A 4B6RA 4TROA 4YDRA 4MITA 3UMYA 3HYNA 3CZCA 3QXCA 1AKTA 1YCGA 2QY9A 4JT9A 1I3NA 1XXHA 1PW5A 4WY2A 2A9VA 4H1VA 3P2JA 1P3Y1 3IPCA 5KDDA 4MICA 3OU2A 5MN6A 3OCCA 1WXIA 1BA3A 5AJUA 1C3EA 4ZU3A 4EKYA 4WNAB 3SGLA 4IGIA 4E5DA 1XLTA 1BFDA 1NVBA 2IC5A 2WTUA 4P4LA 1NBAA 4ZVKA 2XMCA 1TMKA 5BN5A 4FMCB 4G89A 1G7TA 4MCIA 2R8YA 3PVSA 5EUBA 3VPGA 1Q1EA 3NHLA 5LD2B 3VQTA 3G89A 5JAPA 3FROA 1T34A 4R68A 1VLQA 1EI9A 3VZCA 4Z4IA 3PQ3A 4X8OA 2JAUA 1KJWA 1P8JA 1PT7A 1YB7A 4FSDA 5CH3A 4HNVA 4D0SA 2R96A 3TTTA 1C7IA 3E35A 5H1YA 1ZK4A 3PJGA 1JH9A 4YJHB 2O8EB 4X8HA 1QFSA 2QDKA 3ETGA 5FBVB 5K3OA 2QX9A 1H22A 3RAEC 3U4MA 4NK5A 2FPXA 3RGGA 1NVVQ 5FWXA 1UXIA 1NRXA 3OQJA 4RMGA 4RJTA 4XWOA 3U2QA 3DFKA 3U7QB 5TIIA 3I9OA 3OOHA 4NXNB 4B85A 4B09A 3UYKA 1FP4A 1BN6A 4E2FA 1VSUA 4OJNA 1PVOA 3CMCO 2W4IA 1UDXA 2ES4A 3IODA 1D7AA 1ZWKA 4GECA 4M36A 1BGVA 4I46A 5E9WA 4AMZA 2GRJA 2OZLA 3B6MA 2VTBB 2R1VB 5AM1A 3RGWS 4MKXA 3BRWD 3WLKX 3U56A 3SIWA 1YK0A 1K2VN 3MWJA 1ZGBA 2PZLA 1PG0A 1YR6A 2CLEB 2R5NA 3GFBA 3RWBA 3UFBA 4M1EA 4B34A 1TEZA 2CLHB 4AJEA 3TD2A 1VYUA 2IV3A 2IXAA 4WNCA 5H9VA 1D0SA 3GN1A 4MI3A 3ICCA 2WR8A 3CH6A 4M8NE 3VYSB 1DGQA 3LRPA 2JGRA