4I9HA

Crystal structure of rabbit ldha in complex with ap28669
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
331
structure length
325
Chain Sequence
AALKDQLIHNLLKEEHVPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARQLNLVQRNVNIFKFIIPNVVKYSPHCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWILGEHGDSSVPVWSGMNVAGVSLKTLHPELGTDADKEQWKQVHKQVVDSAYEVIKLKGYTTWAIGLSVADLAESIMKNLRRVHPISTMLKGLYGIKEDVFLSVPCVLGQNGISDVVKVTLTSEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords L-lactate dehydrogenase A chain
publication title Fragment growing and linking lead to novel nanomolar lactate dehydrogenase inhibitors.
pubmed doi rcsb
total genus 106
structure length 325
sequence length 331
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4i9hA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4i9hA02
4MKXA 5L4LA 2PZMA 1NFRA 2RHRA 4I5GA 4RPLA 1GZ4A 2E37A 3BMCA 3K2EA 3R3SA 3KEQA 4GQAA 3IKTA 1FDSA 3ANLA 2C5EA 2NVBA 4PG8A 4BO3A 2OOSA 3WBBA 1OAAA 1N7HA 1U4SA 1E3SA 2G17A 1LLUA 3UW3A 3Q0EA 3DMYA 3MJ4A 4UEJA 3HUDA 3ZHZA 2EGGA 1I2ZA 3SXPA 3SVTA 4OMUA 1WNTA 5CEEA 3U5TA 1MFPA 1UXHA 3C85A 5JDIA 2IDZA 3D3EA 4WNCA 3RJ9A 2OP1A 3CUKA 5I8ZA 1M66A 5CAEA 1NAHA 2A4KA 1N8KA 4F6LA 5KVCA 3OFSA 5IDXA 3ZHBA 4CLDA 1PJ4A 1EQ2A 2QX7A 3I6IA 4NH4A 1NPYA 4TMFA 3S2GA 3R6DA 3IIEA 1UXGA 4E2ZA 3LT2A 4IGEA 2WYWA 3DAFA 1O8CA 4ALMA 1XCBA 2X7HA 2NQ8A 4RF3A 4I08A 3NGXA 3H4VA 3IQDB 3OJFA 4EYEA 2D5AA 4NFYA 3IP1A 1BW9B 1EEHA 1GUZA 4FR5A 4OAQA 2C20A 2OGUA 5AOVA 1GZ6A 3K96A 1IUKA 4J7XA 4B3JA 3LVFO 1IYZA 3OJEA 4Y6SA 3VOSA 1R66A 1HYEA 1OMOA 4EUHA 2IRWA 1T4DA 1XEAA 5A9SA 3F5QA 3ZH2A 2VTEA 1HE4A 1KBZA 2LDBA 1AE1A 1WZEA 4D45A 2NUAA 2Y68A 1U8FO 4M8SA 4BNMA 5CPBA 4RVUA 4HNHA 2GZ1A 4BNGA 1H94A 3ZWWA 4PZEA 1SB9A 3DOCA 2HMWA 3M2TA 5JO9A 1Q0LA 3QVXA 5DOZA 1HRDA 1XIVA 3D3WB 4FOSA 3JSAA 4WOKA 1SAYA 2ZYGA 1EUDA 4TKLA 4E21A 2ZKLA 3WG9A 1ZJYA 1Q1NA 3QJ5A 4JXKA 3AOEA 2B4QA 4YJFA 5ITWA 3PP8A 4M1QA 2VWPA 3E82A 4HFNA 5CEFA 4CLRA 1LLCA 3RKUA 4QXMA 4IM7A 1DC4A 1LJ8A 4YAGA 1R4MA 2HMTA 3UHAA 4YJDA 4BQPA 2H1SA 1PWXA 1P31A 2Z1MA 1A9YA 4YQYA 5EL0A 3DOOA 1W4ZA 4OHUA 1VM6A 3AM5A 4PZCA 1EVYA 3U62A 2AG8A 1NYTA 3PEFA 5K0ZA 5C7OO 2ZQYA 3R0IA 3OA2A 1DFHA 1C14A 4J1TA 3H9JA 4FSHA 4YT8A 1LSUA 4CR8A 5IDQA 3K31A 1C1XB 4IMPA 2FR1A 1M6WA 3EMKA 1LRLA 3VDQA 4G65A 4RZIA 1VLLA 4ONEA 5TX7A 2IEDA 1KVSA 1MC4A 4E2WA 5IF3A 4Y9DA 1T25A 1G6KA 1QG6A 3EAGA 2QRJA 1C1DA 1OC4A 3L6DA 4E4YA 5K6AC 4CJXA 1LI4A 2C07A 1AXEA 4GGOA 1T2EA 3GRKA 3RFVA 3KYDB 3QWAA 4OOFA 3WIDA 3FNHA 4PLVA 1PJLA 3GUCA 3RU7A 1E7SA 5JLAA 1HXHA 4E32A 1VJTA 4XQ9A 1TA4A 4E5KA 1SMKA 1ZO8A 3ADPA 3Q11A 3MWEB 1I3LA 3OETA 5DDIP 2D59A 2X6TA 3JQAA 5THQA 4KZPA 4BO4A 1MA0A 2C54A 4EDFA 3GG2A 4ESOA 5GZ1A 5MDHA 4Z0HO 4YBZA 1YJ8A 4QT0A 1NQTA 3M2PA 4WEQA 3GQVA 2Y1OA 4ZA2A 3VZPA 2DC1A 4DUPA 2PD4A 5T67A 1XDWA 4YAEA 1FDVA 1LC3A 2P4QA 4PCVA 4GWKA 2ZB4A 1Z73A 4BB5A 5KKCA 3V2GA 2VUUA 2JHFA 3ZNNA 5EERA 1QYWA 4KQWA 2HSDA 5IXSA 5AXCA 2HK7A 1H6BA 1P1JA 3TZHA 1XWFA 3BMQA 2JL1A 3JYNA 3KYBA 1LDBA 2YV3A 3NV9A 4PLZA 4YT4A 3GLQA 4R9RA 3JQ6A 1T2DA 1ZXBA 4XYGA 4DL9A 2JFHA 2Q2QA 3L4BC 3KTDA 4IS2A 4U0KA 2WEKA 1P3DA 1W6UA 4LMPA 1Y81A 1L1FA 2YV1A 3L07A 5I7VA 3WFJA 4XB1A 2YY7A 1E7YA 4NK4A 4S1VA 3BMNB 4XEHA 1J6UA 4IINA 2H63A 2G76A 4OJNA 3MJSA 4GSLA 1WMBA 2ZIZA 1LXCA 3FBTA 4WLFA 1XKQA 3CINA 1FJHA 3NTRA 1IULA 4MKRA 2BGLA 4MIEA 2FOIA 4A10A 3JQCA 4IJKA 2X9NA 1BDMA 4INAA 2NVWA 3L9XA 4J0EA 3PFWO 2PKRA 2YHIA 2PLAA 3PGXA 3TOZA 4YTEA 2O7QA 9LDBA 1FF9A 2GF2A 1H2HA 4Z9YA 1X1TA 2JCXA 2YDXA 2Q49A 3GK3A 4KUHA 1PS9A 3EK2A 4PLYA 5B12A 4GGPA 3GMDA 4YJGA 1KS9A 4ZRNA 5IZ4A 1ISFA 4M49A 5CDYA 2EJVA 2GR9A 4XIYA 5DULA 1ZSNA 4BNFA 4DIOA 2EP7A 1VL6A 4Q3AA 4CR7A 2Z95A 3RBXA 3U09A 4BKQA 1EBFA 4KTTE 4D3SA 3GN2A 4BOYA 1J4AA 3ASVA 1GDHA 4IUYA 3I1JA 4BNUA 1H9AA 3A9WA 4MO2A 4NPCA 3FN4A 4Q9NA 1YL7A 1VJ0A 3BMOA 1E7MA 4BKUA 4RVGA 3SJ7A 4RGBA 3ZU4A 1ZH8A 4WASA 3E6AA 3U4HA 5F3RA 4NR0A 3KVOA 5A04A 3DO5A 3I52A 4CLOB 5DOVA 4Y67A 1EE2A 3GVHA 4II2A 1CF2O 2Q2VA 3RVDA 3ZNOA 4EJ0A 5JCJD 4FFMA 1V8BA 4QFCA 2JJYA 1YWGO 1HDGO 1R6DA 1ZKMA 4DPMA 4IIUA 2W98A 3OF2A 5TF4A 1T2CA 4YRAA 1JQBA 3ZWAA 2ZB8A 4S3MA 3RUAA 4J91A 4BNLA 3H6KA 2NADA 4N5NA 2GD1O 1GQYA 1M76A 4Z3KA 1YBVA 4XB2A 3I4FA 1KVUA 4I9UA 4IZIA 1V3VA 3ZWOA 5JNLA 4KWHA 4TZKA 3ONEA 3VH3A 3UOGA 1IOLA 1ISHA 3E9NA 4HV4A 1LC0A 1XR3A 2P91A 2I5PO 4NJMA 3WFIA 5HS4A 5JY1A 2O3TA 1R0LA 2I99A 1UZNA 5EIOA 1JVSA 2HCTA 5L3ZA 1J0XO 1BG6A 3ZHYA 3RUHA 4YRBA 5DBIA 4XR4A 3WOHA 1UP4A 2VZ9A 5I7FA 4W7IA 1P1HA 2O23A 3FNGA 3JQ8B 1YONA 2HAEA 4EBFA 4N7RA 3FHLA 3GDGA 4GWGA 4BNKA 3QP9A 4IQ8A 1NFQA 2HMVA 1I2CA 4QSMA 3ANNA 3WBFA 1U4OA 4A2CA 4BGUA 4CUZA 3OIFA 2J6IA 1ADGA 2DUWA 3QV1A 1RYDA 4TRMA 3KBOA 2NU7A 3V2HA 5JS6A 1LX6A 3WGOA 2NTJA 3E18A 1PGQA 1NASA 4KWIA 4ZICA 2IODA 3QRWA 5T8KC 1B8UA 2NWQA 4I1IA 4QX6A 4BB6A 2OFPA 1KVQA 1Z82A 3K92A 4DIFA 2CDAA 3TFOA 2JAHA 4GX0A 2XOXA 4DC0A 2FR8A 2DLDA 2O50A 2QW8A 4UUNA 3DHYA 3VVCA 3W4JA 3FR8A 3I5MA 1N92A 3O4RA 4ALKA 3SBOA 4URFA 2P2SA 3AY6A 3RUDA 4B7CA 2GERA 1E3WA 1VL8A 2C29D 3GHHA 4P22A 1UAYA 4WNIA 1KEWA 2D3TA 3OICA 1GV0A 2AHRA 1PJCA 1T1RA 3LZ6A 4FJ1A 5JAQA 4KDFA 1QYXA 2WM3A 5A06A 5JPIA 4EJ6A 4N5LA 4WJZA 2BRUA 2TMGA 4R51A 4FFOA 3MEQA 2GO1A 1EZ4A 3O26A 5MGBA 4DGSA 4BNTA 4CM9A 3Q3CA 5F1PA 1DC5A 3I9JA 4HWKA 2DTEA 3K9QO 2JD0A 3HB4X 4RPJA 4HNGA 4AICA 1NHGA 2P9GA 4PIVA 4QO8A 2GN6A 3AUUA 3PWSA 4HFMA 5DBGA 3FWNA 3C1TA 3U4DA 1N7GA 2W2LD 1Y9EA 1U7TA 2J3JA 1EVIA 2VWHA 1P9LA 5IJZA 4K26A 5F5NA 2DKNA 4CV2A 1R16A 2BMAA 3CIFA 2X86A 1PZEA 1ZSVA 3W8DA 1E92A 3D0OA 1KEPA 4AJ2A 4OIMA 1A5ZA 3K73O 2GYYA 1BXGB 3ICPA 3CXRA 3DBVO 1O95A 2WYUA 3BXXA 3FRJA 4ND5A 2FSVA 5J23A 3ROQA 4E5MA 1NPDA 3E5MA 5B4VA 3IOYA 1B26A 5KTKA 5TC4A 1QORA 1GYPA 4BVAA 2VZ0A 4RLSA 1LLQA 4XDZA 2XPCA 1MG5A 5G0VA 1KEUA 3JQAD 3B6ZA 4BNXA 2BGMA 2TMDA 1DFGA 4BHTA 1NM5A 5FI3A 1Y5MA 3V1UA 4ZGWA 4J16A 2AA3A 2UVDA 2ZYAA 3K2BA 4I9HA 1PSDA 1MG0A 2CNBA 1E7RA 2Y1EA 1EE9A 4BNHA 3JYPA 1P77A 1K5HA 5B37A 3TPCA 3GGGA 3O8QA 1KIFA 3QWFA 2NM0A 2AE2A 4J1QA 3HZZA 2HKIA 5A02A 3ZNQA 1I01A 4L74A 3NT2A 1B16A 3RASA 4J1SA 4Z6KA 1GEEA 2PGDA 3FSRA 2CY0A 2BHLA 3EVNA 3KUXA 3KSUA 3JQ9A 3I9KA 1VSUA 3F1LA 3F5SA 4QECA 4CMCA 2PD3A 2A9FA 2AEJA 3HB5X 3UCFA 3DB2A 4LK3A 4C7KA 1FDTA 5C5IA 3PVZA 2ZATA 4JCOA 4YJFB 5JYEA 2FPIA 4GH5A 2WDZA 5G4KA 5U9CA 4U8GA 4ZHSA 3GRPA 1GEGA 3B1JA 1NQ5A 2PZLA 2VWGA 1VI2A 2I6TA 4CM5A 3K5PA 1U5CA 2QG4A 4OKIA 4C4OA 3ON5A 3LT1A 4XYBA 1O89A 3AI2A 4W82A 1BGVA 4HY3A 1WDMA 4D79A 4JJIA 5ENVA 1MFZA 1DDOA 5IDYA 3HFSA 4BL5A 4GAEA 3H9GA 4W99A 1JKJA 3DXFA 1KETA 3UICA 4CV0A 2BELA 4AJNA 1S6YA 4WCFB 7MDHA 1HLPA 3OHSX 1B8VA 1TXGA 1GD1O 4NNJA 1KERA 5BNFA 1U28A 1VE9A 4D0SA 4P4GA 1A7AA 1YB4A 4OGWA 1C3VA 1WWKA 1NVMB 4B79A 2CD9A 4O5OA 2V6FA 1LRJA 4IJWA 1YS4A 5ER6A 2EKPA 2ZCUA 5TNXA 1J5PA 4HBGA 1P44A 1EK6A 3GGOA 2W8ZA 1VL0A 1UXKA 2G82A 5CG1A 4NBWA 1NTOA 3WWZA 3NRCA 4YPOA 1I5RA 4EUEA 3KO8A 4BO8A 3QHAA 1YL5A 3DEYX 4IQGA 4Q3DA 3OIGA 3PTZA 5G0WA 1SNYA 1Y8RB 2Y1DA 1FK8A 4WLOA 3BAZA 4WLNA 4WKGA 1W8DA 3G17A 4YAIA 4ND1A 3FI9A 3VKVA 4IXTA 2C2XA 2EERA 1UDCA 4IMRA 5KJ1A 3F46A 2QQ5A 1S7CA 4XZ3A 1IHXA 1XYGA 2FPGA 3OJLA 1GYRA 2B0JA 3ZI0A 5I9LA 4J0FA 4XQEA 5DNAA 3W6UA 4DTIA 4LN1A 1LTHR 4DWVA 2EW2A 2ZTVA 1WXDA 1ZNQO 1DIHA 3IUSA 4ZD6A 4FCCA 1O0SA 4XDYA 1N9GA 2RH8A 4MIYA 1V0JA 1E0DA 4XQCA 4Q3EA 4XGIA 1I3MA 2EEZA 2VN8A 5ITVA 4YWJA 2EW8A 4J43A 3UN1A 1I30A 3IKVA 2Q1UA 4O0LA 2R6JA 2CMDA 3FPLA 1I32A 3OP4A 1HSZA 1ULUA 1NP3A 3Q2KA 4NG5A 4EEZA 3DBHA 3RFXA 1BVUA 2B35A 4NJOA 2GGSA 1PR9A 3AFNA 3EZYA 3WJ7A 1JAXA 1YL6A 5ILOA 1GY8A 4AJOA 3HWRA 3ZCXA 1D1TA 2EGHA 3GPDG 3S2IA 3GUYA 1ZVMA 3AJRA 3D5TA 5AXAA 3DL2A 2ZB7A 4XJSA 1Q7CA 5KKAA 1EK5A 3EY4A 1E7WA 1ZW1A 3WTCA 5K6AA 5JMWA 3VAZA 4YJHB 4QTZA 4CQLA 1K6IA 3C3XA 4YDRA 3BHJA 3CPSA 3HHPA 5THKA 4MVJP 3NKLA 1WW8A 3RJ5A 1HWYA 1YDWA 2O3SA 3QVOA 2O7SA 4AFNA 3ZHXA 1GAEO 5CDGA 5L40A 5A5EA 2VHZA 2Z5LA 5A5FA 2E4AA 1ENOA 2J5QA 4G2NA 4H16A 4ZQEA 3ETEA 4A03A 1ZK2A 4U6SA 3SJUA 1ZZEA 1KY5A 3GDFA 1JWAB 3GG9A 4DXHA 3IJRA 4YRDA 1HDOA 2OP0A 1GFSA 4MVJM 4U7WA 4NBTA 3UVEA 1VJ1A 4R69A 4E12A 3EVTA 1X7GA 3ADOA 1XG5A 2W2KA 2GRAA 4MINA 1F0YA 4XYLA 1YJQA 4PG6A 2PZKA 3COSA 3F47A 5L51A 1LU9A 1EVJA 4TQGA 3WMWA 2X0IA 3CSDA 4W9NC 4CM8A 2J3HA 1GCUA 4AJKA 4W4TA 4FC7A 1RM3A 2H5LA 3JQDA 4BGIA 2I67A 1LEHA 3LU1A 1V3UA 2GZ3A 1ISIA 1JDJA 1R4NB 3IS3A 2BKAA 3PJEA 4XQGA 1DAOA 3E1KA 3NEPX 2J5KA 1UDAA 3SLKA 3ULKA 4PZDA 4MVJF 5IZCA 2DQ4A 3UGKA 1P0CA 4ID9A 3WYBA 4Z3DA 1KY4A 4QUKA 1NVGA 3VZSA 1LDMA 4OH1A 1GUYA 1Y8QB 4AJJA 1QP8A 4YR9A 4JP2A 4AJ4A 3CMCO 3T7EA 3VHRA 1NQAO 3H9UA 3VH2A 5EN4A 3BHIA 5GY7A 2EF1A 4E31A 4CM9D 2DFDA 3ICCA 1DIBA 2CVQA 4FC6A 1PL7A 3EHEA 4RVDA 3VH4A 4CLHA 3D4OA 1X15A 1VKOA 5LC1A 4PLWA 1H6AA 2EG9A 1ENZA 1EFLA 2GPTA 4EITA 4ALIA 2NVUB 3DAGA 3RCBA 3LQFA 3LYLA 4RQTA 2LDXA 4QEDA 4YVFA 4L4SA 3ZN2A 1YOVB 3GVIA 4D3FA 1I0ZA 4R41A 2G5CA 4MJLA 4UVDA 4XJTA 5KWEA 4XX0A 5G2OA 4CR6A 2HK9A 1PQWA 2O3RA 5KNLA 3KLMX 1D7OA 3NTOA 5TJ9A 3HDYA 2IEBA 3I9LA 4DA9A 5L53A 4CQMB 1IZ0A 1Y5RA 1P1FA 4NK5A 3VH1A 1NWHA 1Z7EA 1E1NA 2NTNA 3AFMA 2X0RA 1ZMOA 3PQEA 4D44A 2W2LA 1PZGA 1JA9A 1FMCA 2B36A 4BNYA 4P38A 3H5NA 2Y93A 2X23A 8LDHA 3RROA 1WLYA 2UDPA 1GZ3A 4EGFA 4B4UA 3FTPA 1HZZA 2C0CA 9LDTA 3MJCA 4BO6A 4WLUA 3WGYA 3E03A 3L0DA 1NBOA 1I10A 1IZ9A 3BYZA 1HL3A 1HKUA 2D5CA 3GFBA 4ZQBA 3S55A 3UCXA 1B3BA 5IG2A 1E3EA 3QVTA 4HXYA 3WTBA 1B14A 2EIHA 1DO8A 3E48A 3PDJA 4KP7A 4CMEA 4UREA 4YT5A 1QR6A 2HQ1A 3ZV5A 4C7JA 1FXSA 4RDIA 1ADCA 2Q50A 4YCAA 1HE3A 3AUAA 2B4TO 1P45A 1G0OA 1SEPA 4ND3A 2WTBA 4KQXA 3LF2A 3ROMA 5JBIA 2ET6A 1D8AA 3DBLB 2CVZA 4L8VA 4BMSA 3ASUA 1SOWA 3JQEA 1CJCA 4Q3BA 3WGQA 2C7VA 2HJRA 4HP8A 4B4OA 3RIHA 5JY6A 4MP3A 3SLGA 2HLPA 3UUWA 4CMKA 4N18A 1T24A 1I3KA 4E5NA 2QRLA 5JDIC 2I66A 2X22A 1P33A 3OIDA 1PS0A 3G3EA 1YE3A 3N58A 3JQGB 4L75A 5GZ6A 2F00A 4FJ0A 3AK4A 3O03A 1A7KA 1YKFA 2DBVO 2WD7A 3JD1A 4XRRA 3ROKA 3DC2A 4OSOA 1GR0A 2JHGA 3PWKA 1LDEA 1EBUA 3WQQA 1B15A 1HT0A 3GZNB 4KMSA 5A4DA 4BGVA 2FP4A 1Q7BA 4DREA 3PDUA 3WNVA 3PYLA 1N1EA 2BFPA 4YEDA 4GI2A 3R3JA 4E3ZA 1PJBA 1K0UA 4CMBA 3PYMA 4TVBA 2Y66A 4ND2A 1UR5A 1ADFA 3FCOA 4LMRA 2YHUA 2X5KO 1X7DA 1CIVA 1DIGA 2Q1SA 3IC5A 3TDKA 2Q99A 3CMMA 3NYWA 1PZHA 3H65A 4TRJA 1LUAA 5KJEA 3V5NA 3S1LA 2VOJA 4B7XA 5DBFA 4F6CA 1PEDA 1HDYA 4FQ8A 1ISJA 3VTZA 3HNPA 4JNKA 2R00C 1V9LA 4RORA 4FGWA 3H3FA 4JK3A 3TRIA 3WB9A 3WGIA 1JAYA 4BS9A 1IE3A 2D2IA 3KSZO 1RWBA 1NPTO 4JJFA 2NU6A 3ZNPA 5BT9A 3H9EO 3L4SO 3JQ7B 2EP5A 1XHLA 2PK3A 3WYCA 1HEUA 2ZK7A 4RVHA 4DPKA 4MVJI 1DPGA 4TKMA 1U7HA 4O59O 3LT0A 5FEUA 4CM7A 1X14A 3ENNA 3GVPA 4BKOA 1XGKA 1ZXLA 1JU9A 1Q7GA 3JYQA 3RD5A 4H3VA 2Y0EA 1NNUA 4YACA 4HFJA 3LT4A 1NQOA 3I83A 1JTVA 3O8QB 1MLDA 1QYVA 5H83A 4WCFC 3NDIA 1DFIA 3DBRB 1BRMA 1OFGA 2VYNA 3I3OA 5AXDA 4BO2A 1QSGA 3IAHA 3M1AA 4A0SA 5JSFA 1EUCA 1CEQA 5IN5A 2DUUA 4BNZA 1KYQA 3B70A 2VHVA 2VTDA 3LSYA 3TL3A 2IZZA 4E5PA 4E2YA 3GT0A 2FZEA 1SPXA 2X1HA 1Z6ZA 2J8ZA 2A35A 2WSBA 2HUNA 2BFOA 5DCWA 4NDNE 1UAGA 4L4XA 4L9RA 4CMGA 4TRRA 4WLEA 1I36A 2E48A 4MOWA 2RH4A 1BW9A 4Z9XA 3WX0A 4D7AA 3PGJA 4WOJA 4ZVVA 3VC7A 4GL4A 1JLLA 3IUPA 1C0IA 1C0PA 2PKQP 4IDCA 4K6CA 4N5MA 1H5QA 3H7AA 4IJUA 5BSHA 2VT3A 3I23A 4A73A 1T26A 1U2DA 5L45A 1GUFA 4PRLA 4N54A 2SCUA 3QLJA 1NX6A 1O6ZA 2Y0CA 2PH3A 3CE6A 1KC3A 2CDBA 3DAPA 3WXBA 4ZQGA 3D3WA 1KVTA 4XRGA 1UXJA 2AMFA 1VC2A 3ETGA 4J7CA 1SB8A 1ULSA 3BA1A 3TFQA 1TT5B 4DYVA 2JD2A 1E5QA 3TZCA 2HJSA 5CDTA 2VOEA 3DFZA 5I7SA 3MCVA 3KRTA 4CMIB 4CMJA 2Q2WA 4M55A 4Q3NA 3NJ8A 5KCZA 5TRTA 3KHUA 5ADHA 1PGPA 1D4FA 3WLEA 5KVQA 1KVRA 4ZQFA 1U3VA 1GQ2A 2VNSA 4IPTA 3FBGA 1HDCA 1PGOA 3RC1A 1AN9A 4AJPA 2DTXA 1SC6A 1GU7A 5FF9A 4J7UA 3L6OO 3BTVA 4ZU3A 3PK0A 5IAAA 4ND4A 1HETA 1KOLA 3GVCA 3OBBA 2Y1GA 5AXBA 2OUIA 4L0QA 4DRYA 1E6UA 2HMSA 2PD6A 1ZK4A 3U4CA 3K30A 3OECA 5G0SA 3ZDFA 1HLDA 1ZBQA 4DC1A 3PHLA 1AGNA 3KYCB 1SBYA 5COBA 1TI7A 1Y9AA 1PQPA 3TN7A 3I9OA 4WPGA 3C7CB 1LDGA 3KYDA 3STHA 3M6IA 3W6ZA 4AJEA 5B4TA 4DMLA 5KJFA 1ZFNA 3EZLA 4LVUA 2X9VA 2RAFA 4DMMA 5ICSA 5JDCA 4J9UE 3ZV4A 2Q1WA 3F6YA 2ZTUA 1A4IA 4JBHA 5T6BA 4I9NA 3U0BA 2PR2A 1R0KA 3GMSA 3GDOA 3G1UA 1ARZA 3ABIA 2D0IA 2Q1TA 4UUPA 3ZU2A 5HWSA 3JQBA 4PLTA 4FFPA 1I24A 2AE1A 4DYDA 4PLCA 2YJZA 1MX3A 4Y98A 2GZ2A 2Y67A 4X54A 5KJCA 4IDAA 2JKVA 4J49A 2FR0A 5AVOA 3W4IA 3W8FA 3WNQA 4D46A 4DLLA 2PY6A 3H2ZA 3UKOA 1QV6A 2X9GA 1AHHA 4CODB 2Z1NA 5JC1A 3BMCB 5A3JA 3NGLA 4FJ2A 1LSJA 2QYSA 3GN1A 4GMFA 1RM0A 3I9NA 4RO0A 2GDZA 4XD2A 1BWSA 1T4BA 2GUGA 2VHXA 4TSKA 3AUTA 1GL3A 4GX1A 4BNWA 2WE8A 3KETA 1MB4A 4P8RA 3WJAA 2X0NA 2VYVA 2ZYDA 4R9SA 1MP0A 3N74A 1PTJA 3UH1A 1K6JA 4YAKA 3D4NA 5G0UA 3FWZA 5TIIA 4GMGA 4EJMA 4O63O 4JN6B 1BVRA 3BMNA 3KXDA 1X13A 1RM4A 1WPQA 2F1KA 1SZJG 4JX8A 5U1PA 4BKPA 3OJOA 4NBVA 2YZ7A 3DHEA 1ISGA 3A1NA 4WK6A 3WQRA 3HADA 3VTFA 4CM4A 2NACA 4MKZA 4TVOA 4D0RA 5A3VA 4LISA 4IY1A 2UUOA 1HSOA 1N5DA 3GY0A 1PZFA 2NTVA 3A28A 3ZW8A 4RF5A 3DOJA 1DEHA 2QZ9A 2DBZA 1D1SA 3FTNA 3S2EA 3IP3A 1M67A 4RCVA 4HUJA 3AU9A 2EWMA 1Q0QA 4FB5A 5A9SB 3GZ4A 1ENPA 1QRRA 1UDBA 1F8GA 1DB3A 3QWHA 4IBOA 1F12A 1EUZA 2HDHA 4BGEA 4UVGA 2WJPA 3VZQA 1B2LA 1M6HA 1U8XX 4Q39A 3VPHA 5T64A 1UP7A 4J4TA 3FNFA 5FI5A 4NHEA 2WE7A 4XWYA 1XQ1A 1HE2A 4CLRB 3ZWXA 2GCGA 2EJWA 4GKBA 2D1YA 2YQ5A 4E30A 1E7QA 2OORA 3CH6A 1R4MB 3KM0A 4J3FA 4FOOA 3MTGA 1E1MA 1NAIA 3AY3A 4HFRA 5EQDA 1YGYA 4CLOA 4MVJA 1ADBA 4ZJUA 1VPDA 1CWUA 4IDDA 2FZWA 4FIZA 4A27A 4ILKA 5BSFA 2C59A 2B5WA 3OSUA 1T1SA 3PHJA 3ZZNA 1HYGA 1H2BA 2GLXA 3ZWPA 3D64A 1RPNA 4GSKA 4P4NA 2DAPA 4AJ1A 4CUKA 1XA0A 2DU8A 1X7HA 4LRSB 4J6FA 5CDSA 3QWIA 2ZTMA 2BI8A 4E33A 4NU6A 1C1DB 2H9IA 2CVOA 2JCVA 3JYLA 1YRLA 3MTJA 4Q3CA 3QA9A 4RVFA 3FD8A 3GEGA 4CMAA 4CM3A 1E3IA 4W7HA 4BNVA 3G49A 2X0JA 2ZTLA 1PL8A 3F4LA 1EFKA 3ZWMA 1ZK1A 3NAQA 3VPGA 1SEVA 3F3SA 3H8VA 4OXKA 4YB8A 1ZIDA 3Q1LA 2EV9A 4PLPA 4OKNA 2Y1CA 3TOXA 2JCYA 5CPFA 1IL0A 2ZJ0A 3MJTA 4OYRA 4YQZA 3EW7A 3ZU3A 2NSDA 3JQAB 4UAGA 3GNTA 4F3YA 2VYND 2PKQO 3JQ8A 3PHHA 4K6FA 2E49A 1QMGA 4GBJA 4WECA 5ENDA 4DLBA 1SOVA 1P1RA 3BTUA 3L77A 3JQFC 5L9AA 1MV8A 4M54A 1Y7TA 4CMHA 2DM6A 4JQCA 5U4QA 4J2OA 5ER9A 3EGOA 4D43A 3PFFA 4K28A 4DBZA 5L7TA 5T57A 1O5IA 3GH3A 2G1UA 5ES3A 1LA2A 4II3A 1GYQA 1QXSA 3I4CA 2O48X 3GNQA 4OSPA 2OO5A 3AM3A 1DRWA 2PZJA 5COQA 3QVWA 3QY9A 1N1GA 3BMQB 1CQIA 2BI7A 2Q46A 2OZPA 2I3AA 3O38A 4TZTA 2X5OA 4DQVA 1G0NA 4OL9A 5FFFA 1K2WA 3QSGA 5HBRA 5GZ3A 1IPFA 3HSKA 3ZU5A 1QYDA 3P19A 2Y1FA 4ZRMA 1DXYA 2IE0A 2RCYA 4RQUA 1U3TA 1GPJA 1U1IA 1DJQA 3WGGA 4IDBA 1O94A 2CZCA 2FSSA 3PI7A 4R4JA 5CDUA 4UUOA 2YUTA 1CDOA 5BSEA 1FDWA 1CQJA 1DLJA 2BH9A 4E5YA 3T7CA 4J9VA 3WMXA 3PPIA 4F45A 4OXYA 2V6BA 4LW8A 3WYEA 3PJGA 1J49A 4GLLA 2VRCA 3GOHA 4R1TA 3VDRA 3TZ6A 4B7UA 5EMHA 2NLOA 4BNJA 1LNQA 2B83A 2Q4EA 3JCZA 5B1YA 2B5VA 2D4AA 2WWRA 1MC5A 4ALLA 1YDEA 3TL2A 4B4WA 3DZBA 4KDEA 2YHIB 3WGTA 5KOIA 3WGHA 2GNAA 3R1IA 2AW5A 4R1UA 5HA5A 2CF5A 4NZ9A 1PU2A 2OMEA 6ADHA 2CFCA 3EUWA 2YDYA 1ONOA 4LSWA 4YJGB 1LDYA 3EDMA 1KC1A 2DBQA 4R5HA 3S8MA 3VKUA 1YVEI 3PLNA 2YV2A 3AY7A 3QQPA 4UEKA 2V65A 4ZN6A 4LVCA 3PRJA 2UUPA 1BXGA 5JE8A 4F46A 2P68A 3DZFA 1XELA 1MXFA 1R12A 1OZAA 1R0SA 2OBNA 4YT2A 4B8WA 4PN3A 4W6ZA 4DQXA 3VPSA 3BMOB 5TT0A 3PIIA 1H6CA 2XF8A 2ZJ1A 4CL8A 3N7UA 2FWMX 4UEOA 4XR9A 4L4RA 1V35A 2DBRA 5EINA 3H5RA 1P1IA 1NWCA 2E82A 1M2WA 2PWZA 3A4VA 3LLSA 4HADA 1YXMA 3AOGA 1EMDA 3GR6A 3CZMA 1VKNA 5L7WA 2V6MA 2Y99A 3L4BA 3GC6A 3KOUA 4RPKA 3C7AA 1E3JA 1BDBA 1L7EA 1Y6JA 2YW9A 4R1NA 1GCOA 3JD2A 4MP6A 1UZMA 5I9MA 1ISMA 2HO5A 5K9ZA 1QKIA 3HDQA 2B69A 3B20A 2DFVA 3NX4A 2DT5A 1A4UA 1YQGA 3NJ4A 4NI5A 5HM8A 2VNAA 3RC9A 5AQ1A 4NFSA 3INGA 1AXGA 1ZEMA 2R00A 3ZGYA 2NV6A 5LDGA 5C37A 3OQ6A 1RM5A 3WSWA 1NR7A 3CZRA 4OO3A 1U5AA 1F8FA 3OM9A 1ML3A 2VYVD 4NU5A 2AEMA 3RUFA 4NJMB 4CL3A 1U9JA 2AQKA 1EQUA 3BHMA 1LSOA 3D5QA 3DMTC 3MOGA 4BNIA 4FDAA 2IXBA 4FN4A 5JMPA 5JAIA 4A26A 3DZKA 1PWZA 3OQBA 3UXYA 3GFGA 4OQZA 1PJ2A 1ZK0A 5G4LA 3RQSA 1LSSA 3H9QA 4IIVA 3NDJA 3T4EA 4FBGA 3A14A 4MP8A 2YQ4A 1DC3A 1NXQA 4NBRA 3OQ1A 3PHIA 4DVJA 3WS7A 3HQ4O 3PYXA 5L4SA 1DBVO 4CM1A 3OMLA 3MZ0A 3GEDA 2A94A 4OOEA 1T2FA 5G0TA 3QIVA 4I5FA 4JP3A 3TWOA 1OOEA 4ROSA 4AVYA 3NDRA 5DP1A 4WCFA 4PVCA 1DHTA 5I7EA 1RYEA 5DF1A 5JC8A 3DZHA 1A71A 1X1EA 1KEVA 2PNFA 4XA8A 4UULA 1V3TA 1O9BA 1Z74A 3WQSB 4RL6A 1U2GA 3DWFA 2PV7A 1DOHA 1WZIA 4O6VA 3B1KA 3NUGA 3G0OA 3RUCA 2H6EA 4R01A 2FMUA 4Y6RA 2IYOA 2XXBA 3DHNA 4BIIA 4IDEA 4YA6A 1LQUA 1C0LA 1DJNA 4U6QA 3LC7O 1E3WB 3OEYA 2P5UA 1K89A 1Y8RA 5TJHA 3TNLA 5KJ6A 3ETDA 5JW6A 5BNTA 4OM8A 2NU9A 2O4CA 4BO9A 2BF7A 4U0JA 4NBUA 3WWYA 1ORRA 1IHYA 1AHIA 1HE5A 4DIBA 4WGGA 3DR3A 4I8XA 4R3NA 2GSDA 4MVJD 2VUTA 2D8AA 1E3LA 5HRUA 4RZHA 5ICMA 4J4HA 1TEHA 1Z75A 1CETA 2VZ8A 4FD3A 3V1YA 1GADO 3AI3A 2X58A 4R3WA 4DPLA 4D42A 3AW9A 4FFRA 2PGJA 1NR1A 2ZB3A 3DQPA 4IZHA 4JROA 4M89A 1MXHA 2DTDA 3GA0A 5IZCC 1VRWA 5EJ2A 3GAFA 3I9MA 1BSVA 3TSCA 3PXXA 3HN7A 5COAA 3K6JA 5A05A 2HRZA 5L95A 2I65A 4I5EA 2I3GA 3RKRA 1H0KA 2B4RO 4RDHA 5KVSA 3KZVA 3X2FA 1P1KA 2RIRA 2DVMA 4CM6A 1VSVA 4LSMA 1WVGA 5HS6A 3RWBA 8ADHA 4TWRA 5H81A 1JWBB 1PGNA 3PQDA 4GVLA 5F5LA 1DLIA 3AOEC 3WIEA 1P74A 3VVBA 4BO5A 4PRKA 1UH5A 3LC1O 4NFHA 5T8KA 3W4KA 5HTOA 4EEXA 1UJMA 4YJHA 4PVDA 4GX2A 5AYVA 2YFHA 4EZBA 4CM4B 1ONPA 1CYDA 1WDKA 4MVJH 3IL2A 4BO1A 1RJWA 3ORFA 2AQHA 2P5YA 3QWBA 4EW6A 1MUUA 2O2YA 4MIOA 1B3RA 1E6EA 1RKXA 3SC6A 4BMVA 4EUFA 3ZWVA 1EDZA 5JXWA 2CUKA 3EC7A 2FPPA 2I76A 5EQFA 4B3IA 5A9RA 2DPHA 4E0BA 5BSGA 1XQ6A 3LF1A 3RFTA 2AQIA 1HZJA 4JBIA 2AEFA 2YYYA 3BZUA 4ALNA 1Y1PA 2O3UA 1CERA 1EDOA 4FS3A 5DZSA 2WMDA 2NQTA 4PFJA 4BQRA 1PJ3A 1PQUA 4QFDA 2AQ8A 1HYHA 1ZK3A 4K1LA 4PGFA 4UVIA 1XLTA 3ROPA 5T5QA 4YXFA 1DIRA 1HDZA 5B4UA 2VUSA 4MDHA 3AWDA 3JD3A 3LC2O 1R4NA 2ZQZA 3PIDA 5G4KB 4E2XA 5JYDA 2EHDA 3A06A 5F1OA 2C5AA 4CMEC 3U3XA 1E77A 3TQHA 5CEJA 4KUGA 3W1VA 2EKQA 4GVXA 1WDLA 4E13A 5CG2A 3V1TC 2Q3EA 3UCEA 3U9LA 2HU2A 2WD8A 2VRCD 4J1NA 1Y8QA 4RF4A 1E6WA 3ST7A 4YYZA 1Z7BA 5LDHA 1SO8A 1E5LA 3DZJA 3LK7A 4IJVA 1TVEA 1NHWA 4JJGA 4O1MA 4H7PA 1V6AA 2V6GA 2XXJA 4R68A 1G1AA 1X0XA 2HK8A 2O3QA 4J2HA 4GLOA 1WAMA 1R37A 3MOIA 2GN8A 3KB6A 3IJPA 4XGKA 3P7MA 2NVUA 4B8ZA 3BTOA 3Q6IA 4HX5A 2EKLA 3Q9NA 1LRKA 2RHCA 1OI7A 1YOVA 4IGFA 3IMFA 1DRVA 2NNLD 4PG7A 3RBZA 3MWDB 2YFQA 3Q2IA 3VPXA 1NFFA 3CTMA 4KOAA 2ZCVA 3C1OA 4M86A 1IY8A 2OHXA 4CUJA 4CPDA 2FHSA 3HG7A 1YBAA 4MPDA 4CQMA 3Q9UA 3ZWBA 4WCDA 3DFUA 1PJQA 3C1AA 1B0AA 4G5HA 4LGVA 3TZKA 1C1XA 3D4PA 3RBVA 2WYVA 3PJDA 4R16A 3O9ZA 3DTTA 4RVSA 3VZRA 3E9MA 3UFXA 4G81A 1ZMTA 1YQDA 3ZWCA 4AJHA 1PR3A 3QW2A 3HDJA 3S2FA 1ZUD1 2IZ1A 2HRBA 2DPGA 4I5DA 3F4BA 1ZSYA 3ZWYA 2ILTA 4NIMA 3WR5A 1N9GB 5TGDA 3V2UA 1ID1A 3HE3A 3PJFA 3RU9A 3PZBA 5F1KA 1ENYA 5DN9A 4D41A 5CP8A 3EYWA 3PZRA 3TF5A 1PX0A 2QYTA 1PJSA 4P4LA 4PG5A 1Z45A 4AJLA 5IXYA 4CLEA 3GNSA 5L7YA 3DBHB 5CFZA 3QE3A 3IDSA 2AG5A 3JV7A 3K8ZA 3JTMA 3WICA 4BV9A 3FR7A 3KSDO 1QV7A 4A5OA 3T4XA 4FFLA 4PLFA 3DBLA 4UUMA 3SC4A 3JYOA 4GX5A 2PA3A 1BHSA 1IB6A 5C3MA 3FPCA 4L76A 3CKYA 3JD4A 3DTYA 4CLXA 2QZZA 3CEAA 3WDSA 5KIAA 2PH5A 3PHGA 4JGBA 3HFGA 1JW9B 1PJTA 2XAAA 1QLJA 4OQYA 1LLDA 1ZCJA 1DAPA 3INRA 5IFLA 5L4NA 3GHYA 3NT5A 3JQGA 4XGNA 3RUEA 3UF0A 4CQLB 1YH3A 4MVJE 2GN9A 5BNIA 4FW8A 2FRDA 4RJTA 5LCXA 2IYPA 3GZNA 1SCUA 4R1SA 4ITUA 5FWNA 3B1FA 4J4BA 4WEOA 2Y0DA 1DIAA 2VT2A 1XU7A 5F21A 4JLWA 1L7DA 4R54A 1TB4A 2VRBA 3SX2A 3BIOA 4XYMA 1YBMA 2W4QA 2V7PA 3GEMA 4QQRA 2BFMA 5I8WA 3C7DB 5C7LO 1OBFO 4AJIA 2Y05A 3ITKA 2O3JA 2B37A 2W2KB 1PIWA 5A1TA 5JAMA 3JQFA 4CV3A 1XSEA 1PS8A 4BO0A 4NMHA 4BO7A 4UVHA 5IN4A 4L73A 4IDFA 3RAJA 4LRTB 3SEFA 5KVVA 1DSSG 3WSVA 1B8PA 2CDCA 3P5SA 4CM8B 2P4HX 2UYYA 3PLRA 1DHRA 2QRKA 3ONDA 3BTSA 1PL6A 4RV9A 1DRUA 1I2BA 3DZGA 4KUEA 3MJVA 1I8TA 4M87A 1T2AA 3GGPA 1A72A 1U3UA 3JQ7A 4FFNA 4BKRA 4WE3A 1MGOA 3PWZA 4IS3A 5DP2A 1A27A 1Q0HA 1Q2XA 4K9DA 5GMOA 4BV8A 3RI3A 1E1LA 3RUIA 4IQ0A 1I3NA 1ONNA 3RSHA 4KTVE 5JCXA 3D7LA 4ZQHA 2X8LA 1EVZA 4YAJA 1GV1A 1ZEJA 2JD1A 2JAPA 3C8MA 1F06A 1WP4A 4XCVA 3E8XA 2GASA 3C24A 1K3TA 3PQFA 4LCEA 3UAGA 1F14A 3AU8A 4Z0PA 2PGLA 2JFFA 2X5JO 3D1LA 3LDHA 3P2YA 2C2YA 2Q45A 3OA0A 4D3DA 6LDHA 3AUSA 5EPOA 5BQFA 3ANMA 4PLHA 1C0KA 5IDWA 1IPEA 3HDHA 4JIGA 2CSUA 1N2SA 1U3WA 2P9EA 3DBRA 1BXZA 2BD0A 3AI1A 2BLLA 4U5QA 4TROA 3LLVA 1CRWG 4PLGA 2PTGA 4PG4A 2VHYA 4IDGA 1NVTA 5EESA 4MVJG 1HF3A 4GPD1 3I6QA 2Q4BA 5I9NA 1GPDG 3G79A 3H3JA 3OEWA 2RBEA 3RC7A 2QIOA 3GVXA 1I33A 2E6UX 2UV8A 3OH8A 5TLSA 1TT7A 5JDCC 2AXQA 3NTQA 3KEOA 2IZ0A 4OXNA 1W0CA 2W90A 1UUFA 2O4UX 1HDRA 3VPFA 1OC2A 4WUVA 4NQZA 1FDUA 1BXKA 3ONFA 1TLTA 2FN7A 3ZWNA 3U49A 3ITDA 2VQ3A 3NT4A 3JQBC 5TSDA 3ZW9A 5BR7A 7ADHA 3JD0A 1QLHA 4W9NA 3DDNA 2O2SA 3KLPX 2BGKA 2QHXA 3TZQA 3L6EA 3W8EA 4BNNA 3ZV6A 3ENKA 4JBGA 1K6XA 3G1TA 3RC2A 3WLFA 4AG3A 1YO6A 2C7GA 1E1KA 2OBYA 3MJEA 4IXWA 2HMUA 5TS3A 1JN0A 2J3IA 5A03A 1QYCA 3M1LA 4XKJA 4AL4A 1TT5A 5JO0A 1H6DA 4E6PA 1UP6A 1LQTA 2P9CA 2POQX 4Y6PA 1YB1A 1PGJA 3INTA 5DCUA 4CMIA 1W73A 2EXXA 4RPGA 2A92A 1UZLA 4BUCA 2CF6A 2X4GA 5ILGA 1H93A 2R2GA 2VWQA 2VHWA 3L9WA 5TQVA 3KV3O 2G0TA 1UXIA 1WMAA 5FYDA 1YB5A 1H9BA 3H5AA 1JKIA 3E9QA 4Y8VA 1LBEA 4BMNA 1A9ZA 3F1KA 4XIJA 1AUPA 1YQXA 2GN4A 4GKVA 4HKTA 3P2OA 3FF4A 3V8BA 1ZJZA 2J5RA 3GAZA 2PFGA 4A7PA 3QVSA 4RLHA 2UAGA 3TJRA 1F17A 2WD7B 3HJAA 5TT1A 1DC6A 4B4VA 1HDXA 1M75A 3GPIA 3AM4A 4FPXA 5CHEA 5C7IO 3KYCA 3GF4A 2OL4A 3X2EA 4DBVO 4DLAA 3WGZA 2I9PA 5H82A 2IXAA 4DQUA 4CV1A 1X0VA 1HTBA 3DMTA 1LDNA 3E5RA 2JFGA 4QO7A 4B3HA 2FY8A 4WLVA 4J90A 4EI2A 5DCYA 1D3AA 2NU8A 4XYEA 3DONA 1BTOA 3DZIA 1XU9A 5DT9A 4Z0TA 3U4IA 3ZV3A 1JVBA 1GTMA 3FNEA 4UVEA 1B7GO 4H15A 3HN2A 3F9IA 4ALJA 4FGSA 5JAZA 2VCYA 1BMDA 5JFOA 5JCJA 2J3KA 1R15A 4RPHA 1JKFA 4RF2A 1GQQA 4LCJA 4R5MA 5A9TA 3JQ9C 4Z9FA 2C82A 3OJ0A 4TRNA 3H2SA 2OXIA 4CQMD 2BFAA 1P0FA
chains in the Genus database with same CATH superfamily
4ZVRA 3IDZA 3TTXA 3KWLA 4PINA 4RAOA 2GVDC 2PZMA 3BGOS 5C8YA 2EG5A 2V9CA 3TEJA 3HBJA 3EC2A 3THWB 2E37A 3OT5A 1ZQ1A 2IVZA 3QNMA 3NUZA 2ALJA 3DUFB 4G0MA 2O0KA 3BK1A 1JPVA 3BXEA 2YJ4A 3LM8A 2W9XA 3ANLA 2GHTA 3DAOA 2NVBA 5K3FB 4BO3A 2Q3BA 4G1BA 3OJCA 4MV7A 2G17A 1JS1X 1KI4A 2JAXA 2CL5A 2QUBA 3NH9A 4GOLD 4QODA 3FZEA 3Q0EA 2B1RA 2C2HA 3TTYA 5HKAA 1VDZA 3PEWA 2GWHA 2TRSB 3HUDA 4NEGA 2RGNA 4UU1A 2C5HA 2DWPA 3NM6B 2V74B 5CEEA 5J47A 3U5TA 2R60A 2WVAA 2G80A 2J9RA 5AMXA 4FD2A 2WTXA 3U7JA 1QG4A 5TR9A 2WHPB 1VSQA 2QPLA 5I8ZA 1U7WA 4J75A 1NAHA 4QWWA 1PUIA 1X8KA 1U28C 1A2BA 2G7ZA 2GM9A 5HF6A 1UMBB 2D54A 5IDXA 4CLDA 5KVCA 1P9WA 2PJDA 4HQ6A 4LF4B 2ID8A 2QL7A 3IHTA 2GZAA 3K2QA 4YJ3B 1XKTA 2CMFA 5DGXA 1QB7A 3RR2A 3IIEA 2BKUA 1OXXK 1UXGA 1KWKA 1OCEA 5HKLA 1QGAA 1U2TA 3LT2A 2WYWA 2C2WA 2GQ0A 3DAFA 4UHEA 4D4IA 2BH2A 3NGXA 3H2GA 3H4VA 3E8SA 3OI7A 3CRNA 1QE5A 3ZGVA 2NMVA 1NJ6A 2GN1A 5K45A 5JAPA 1DAIA 1X80B 4E88A 4EYEA 1Y48E 3ANSA 3KUKA 3EARA 1A88A 4IEEA 1BW9B 1GUZA 4O2BF 3DS8A 4OP3A 4J0CA 4TX1A 2C20A 4OI1A 2AMVA 2CXRA 4NY1A 4C3VA 4J7XA 4B3JA 1D03A 1IYZA 3OJEA 1CUFA 2PRIA 1HYEA 2A3RA 4JUDX 4DLWA 4D57A 2QTZA 1XEAA 1SBZA 4IIDA 5FH9A 1NGSA 4JEMA 1FLAA 5FTWA 3PUZA 3WADA 4NLLA 4OHKA 5ECWA 4AC9A 1KBZA 4US2R 3RUPA 2FWBA 5JQGF 3TTVA 1H94A 1JAZA 2NAFA 4PZEA 3BMXA 2WSSA 1PVOA 3M2TA 1E9VA 2IYRA 3D3WB 4LOHA 5DHRA 1EUDA 2P69A 2R8EA 1WUTA 1QGDA 1TAQA 1A5BB 1Z56C 1ZJYA 3QJ5A 4IUBS 4NOJA 4YJFA 4DCSA 2HR1A 4XWOA 2PGNA 4FI3F 5I7OA 3D1VA 4OK5A 4AUMA 1RRPA 3GEIA 4ZAGA 1LLCA 2J48A 1VBFA 2QTRA 2CXPA 2FWNA 6YASA 5KQRA 3G1WA 4IM7A 4Y18A 1CF4A 1P9RA 2Z2ZA 1R4MA 4BQPA 3UHAA 4UAVA 2Z1MA 4LZLA 1P31A 1R0RE 4YQYA 2UZ1A 3DOOA 2XITA 4UM8B 1VM6A 3HSSA 4PZCA 2YXLA 1JR3D 2H1WA 4X3CA 3U62A 4ZGGA 2AG8A 1UPXA 1PKEA 3MVEA 1TW3A 4TPKA 1SG6A 4NESA 4EY8A 2D3WA 2RJNA 1I6KA 1ND6A 2DBYA 3DXXA 3ESXA 4IJMA 3ODGA 3WMFA 5AVUA 4WQMA 1KH2A 3H99A 2IZ6A 1C14A 4J1TA 4D4HA 2C61A 5EWMA 1OXTA 2ZUVA 3HKEB 3S5UA 3WMRA 3K31A 1O57A 2GTHA 1QHNA 3SKXA 2H4HA 2P6UA 3AVQA 4BQFA 1COWD 3H6GA 1FP4A 1GKLA 2Y6VA 1S3FA 4BV3A 2KW5A 1VLLA 3NKVA 1MC4A 2QE7D 4QDTA 4TXJA 1CK4A 4KXUA 4E2WA 1T25A 4LNUA 2QRJA 1C1DA 1OC4A 2XUQA 3ZX5A 3GLHE 6CHYA 1NLFA 3O84A 1KI2A 4HNUA 3LD9A 5J2UB 1I13A 2CNNA 4FMCB 3UMSA 2WWVD 4YC7A 1F2TA 5IM4A 4MKGA 2E4YA 4TS9A 1G8JA 5JFTA 1AZLA 3DVAB 2Y1LA 4M0LA 1JYSA 1AUVA 4PLVA 5LL6P 2KBEA 1BDHA 3UV7A 3TAUA 4KNWA 4KR0A 1IN8A 1VJTA 1NA5A 1TA4A 4E5KA 1SMKA 3BRSA 3NRJA 4BLVA 3JRWA 5A4AA 1EZ1A 1U04A 1GARA 1R7RA 3V8NA 3C14C 1I3LA 3MWEB 1U7ZA 4QUIA 3WGNA 4HCJA 4KZPA 1OIXA 2C54A 3R3XA 1MABB 3GG2A 4EDFA 3A2NA 3IOEA 3NJRA 4FLMA 4QT0A 1NQTA 1L5KA 3VZPA 3GQVA 4HGPA 4DCOA 1L5FA 1TF2A 2PD4A 5T67A 2P2ZA 4IG9A 3FMFA 3UWOA 4PCVA 3WZ2A 4TMTA 3QKRA 4MZDA 1V8PA 3NBKA 4PPFA 1AC5A 2Q9BA 4XSGA 2R7AA 4BB5A 3V2GA 1QB8A 3ZNNA 2WOOA 5EWLB 5KNCA 1L3CA 2FQQA 1TZKA 3NR2A 4D2IA 3IHWA 1QYWA 1WABA 4TUYB 1E3DA 1CS0A 3CZ9A 2A9JA 3G2PA 1H6BA 3HRIA 4CDNA 3QFHA 1YHZA 4JL6A 1RAEA 4YRZA 4BRUA 4LY6A 3BGVA 4M0EA 5EP3A 1HC7A 2JI8A 4L8YA 2ON6A 3L0OA 1K0FA 1VDMA 3JQ6A 5BW4A 2UVPA 3L92A 4MDFA 4DL9A 4PHGA 3BBLA 3EULA 2CLCX 3RK1A 2Q2QA 1OA1A 1CDZA 3BJZA 2FSPA 5GM2A 4L22A 3EE6A 4RKWA 2FVYA 2H16A 1P62B 1XZLA 1T0BA 3OIWA 1OFVA 2FEXA 1W96A 1A5SB 3SSMA 2NPIA 5AK0A 3WFJA 1QJCA 4NABA 2YY7A 4NK4A 3NLLA 4S1VA 3BMNB 4Y1GA 2JFZA 3KDAA 4ADSG 2P35A 3IGFA 3NIFB 5GIPE 4OJNA 5CDHA 2JATA 3CA8A 1ZUNB 3EPRA 3HYSA 2BWJA 1WMBA 5BV8A 1SC4A 1H3EA 3SQWA 1XKQA 2AOUA 2A5YB 3W6OA 1PR2A 3FCUB 4GXRA 3NTRA 3T95A 2UYCA 1IULA 3T12A 3HO8A 3D0QA 4HVTA 2HSJA 3S6JA 4MIEA 6AT1A 5A3QA 1GA4A 3FCAA 3GLHA 4ARBA 3OLZA 2ACVA 2V4UA 4PONA 4YMTA 3T0IA 1BDMA 5C2JB 4INAA 2OM2A 3T4PA 5KTSA 5F9MA 3RYHA 2YHIA 4DQKA 3PGXA 4N40A 3VNRA 2O7QA 3EPLA 1ZOLA 1ADJA 5CNIA 2N42A 4NCXA 5ITSA 4QVKA 4TKVB 4Z9YA 5K3EA 3ICVA 2O2XA 2YDXA 3FE2A 3GK3A 3DEJA 4EHKA 1PS9A 1VFNA 2I2WA 3KDPA 1R27A 3P8ZA 3PUWA 4C08A 4YRSA 5FQOA 5KAPA 4YJGA 2QPAA 4ZRNA 1P8JA 2A9RA 2HRRA 2DT8A 2GR9A 2JVIA 1EB8A 3DD5A 1ZSNA 2DJIA 2YYZA 1A77A 4G36A 4Q3AA 3P96A 1OIVA 4BNFA 1N5MA 2VH5R 3RBXA 3UQZA 3U09A 2J31A 4FHDA 4N3BA 1EBFA 2B34A 1G8AA 4BMCA 1P8AA 2BIFA 4MITA 2Z43A 3A7DA 3ASVA 1CRLA 4IUYA 2ROQA 3RS8A 1H9AA 2P1DA 4X44A 1R8XA 2CXUA 2HT6A 3H1EA 4Q7JB 1XYYA 3BMOA 3AR3A 4FZJA 3SX0A 4BKUA 4EDHA 1Q6ZA 1QFXA 3BFVA 5C7YA 4WASA 1WMEA 1DTWA 3HVJA 3T9EA 1O7JA 3EFOA 4DMFA 1GTL1 4LX0A 5E6UB 1KMMA 2UZ0A 2EFYA 5B6JA 2YN4A 3WAKA 5LZ4A 2P8SA 3BC1A 4LRQA 2ZREA 4R2WA 4FW9A 5C80A 2P0YA 4EKEA 1LPAB 2JBAB 5IBCA 5CVCA 2XUZA 4F4DA 1OWNA 5DOVA 4GBGA 2IYFA 1O77A 4KIJA 1EE2A 3ZNOA 5FUWA 3KZCA 4ZAVA 3RVDA 3GFFA 3WYDA 1NBEA 2JFWA 2TECE 3QXGA 4M1WA 3PXAA 4QFCA 1R1DA 3NXSA 1R6DA 4EO9A 3LPAA 5KKNB 3WWPA 1CVIA 3OF2A 3ECAA 1ZQ9A 4RK7A 3SN6A 4MAFA 3VPBA 3EA4A 2IF0A 4BFWA 4C7VA 1VHJA 3U6KA 1WQ4A 3CLTD 4HQLA 5EJFA 3ZW7A 3SDSA 4BNLA 4U2KA 2GM4A 1V5EA 5HQJA 2AL7A 1RP7A 2BTQA 1EWRA 1YBFA 4LHZA 4BVHA 1QU3A 1XZQA 2XYPA 1VXOA 2R65A 3B5IA 5REQB 2HT1A 2WNIA 5DLPA 5JNLA 1UBGA 3NBMA 4Q00A 2OHFA 1W35A 2C4TA 3EY9A 4YPVA 1NMZA 1M2GA 4PZ0A 1T3LA 4A0GA 4NJMA 3BWYA 5HS4A 2BGNA 2GYUA 3TRFA 1FNMA 2OYCA 2XVZA 2I99A 1W581 3MMZA 1YR3A 1ZNWA 1BG6A 3A1WA 4WA8A 3ZHYA 5JJLA 1VP9A 4FYMA 3ZD6A 5EPEA 1LI5A 4WD3A 5FTJA 4L9WA 1E59A 1U80A 4OYHA 3B38A 3FNGA 3QEBZ 3JQ8B 4DCPA 3SVLA 3M4NA 1YONA 3KNZA 1XRNA 1DG9A 5L3VA 1RMYA 1OA0A 2Q5OA 3SF8A 3IUMA 2B0CA 2B5OA 4IQ8A 1KQ3A 5JZBA 1QK3A 2HMVA 3ZJ4A 4QSMA 4P7JA 2XRZA 1M0WA 1QKJA 4F8JA 2C94A 1F7VA 1KO4A 1YVUA 3JZFA 3OIFA 2J6IA 5HFJA 3ELWA 2HLDA 2P75A 3DGFC 4FILA 5L3RA 4L5JA 5ARDA 3KBOA 4KH1A 4I3HA 3CH4B 1IY0A 4ZI7F 3HKBA 2DWOA 1NZFA 4ZOQI 1IWBB 2C7BA 2NTJA 5CB0A 4RS4A 4IICA 4MEAA 1UBEA 5ED0A 4E94A 2CJPA 2P3QA 1XRLA 1WKCA 4YMGA 4H59A 4NWIA 5LM3A 3O3NB 2B8EA 1QC5A 2NWQA 1XMVA 4LQCA 2C3OA 4URZR 1KYZA 4C1NA 4QX6A 4R2JA 4NG4A 1MAAA 5KYUA 1KVQA 4ZCRA 2XTNA 3K92A 4GQBA 5DM4A 2CDAA 1W5FA 4UZSA 1VMKA 4GX0A 3I2GA 2B20A 4MV4A 1QONA 5CA0F 4UUNA 1DQRA 4CFZA 2YS6A 2ES4A 3PFIA 4I6GA 2WSSD 2JH8A 3FR8A 3G2OA 4RW0A 1QGOA 3I5MA 4LYDA 4YJKA 1L3BA 1YQTA 3O4RA 5FULA 4WN3A 5CB6A 4ACBA 2GERA 4LECA 1MV5A 3QM1A 2Z6UA 3K70D 4B40A 4P22A 1RTTA 1UAYA 3QOFA 1KEWA 3U16A 1ODLA 1PVVA 3KQQA 3OICA 4DJTA 1PJCA 1T1RA 1RXSA 4R2XA 4A4DA 4BZWA 1WCYA 2CKDA 3C8HA 4FJ1A 3DEFA 4Y0NA 2WM3A 4F3NA 2RB4A 2GD2A 3EGDB 1L5MA 4N5LA 5D3ZA 3IDOA 1L5ZA 3GFTA 4ZIRA 3EIQA 5BN3A 3DOHA 4EHAA 4S05A 1TFUA 3DYBA 2GO1A 3F8WA 1Q21A 2UKDA 2XRFA 4BNTA 3DOUA 1U0JA 1DC5A 2HF7A 3U7EB 1Q84A 2Z2KA 1V4NA 2NO4A 4LDPA 2OV4A 1OZGA 4YV2A 2J0QA 4WZ6A 3HB4X 1FNCA 1OLOA 3QVKA 2B25A 3KT6A 4H7HA 3MTAA 2GN6A 1Y6RA 3QU5A 2PYIA 5DBGA 1AF4A 3B60A 3KKOA 5EZQA 4CU2A 5A7FA 3HCBA 3VMMA 1U7TA 4HG2A 1JHUA 2FX2A 3QFFA 4FE4A 4OY3A 1BE1A 4TN1A 4W1RA 3W77A 1ECCA 2V9PA 3LJKA 2FE4A 4AI6A 2PM8A 1R16A 1L4GA 1Z8FA 2BMAA 2IYEA 1VLVA 1E92A 5FL7A 1KEPA 2Q6TA 4OIMA 5G1OA 2GYYA 1BXGB 2C5BA 2Q2OA 4YIKA 1Q19A 1L7BA 2WYUA 4NPAA 3THOA 1U81A 2WU3A 4DSTA 4WJLA 2BKXA 4OHYA 3HWSA 1WU7A 1TYZA 2JGMA 7ABPA 4RV4A 1P91A 4RAQA 2JF0A 3IBCA 2FWAA 4WY8A 3N7AA 3TSYA 1QORA 3QYPA 4KNVA 4FZVA 4RLSA 1LLQA 1PJAA 2XPCA 3JASB 4KXYA 3HU3A 3UAWA 4FGUA 3V8VA 2C95A 2BKEA 3FTQA 2HJ9A 3DDWA 3L0YA 2PFSA 1XAHA 2C2MA 3B6ZA 3EXEA 2BGMA 3GNLA 3L8FA 5CXXA 2TMDA 1L8OA 2BUAA 3JYHA 1DFGA 1TD1A 2YASA 3MAJA 4HC4A 3TMYA 2AA3A 3DGEC 2GTIA 4EYQA 1Q95A 3E9RA 3M33A 3JU3A 5AHWA 3MLAA 2G4LA 1CZNA 1PSDA 3LFHA 4L27A 3TZLA 4LFAB 5M29A 3G2MA 2ILVA 1E7RA 2Y1EA 3K20A 3W5IA 5KMGA 5KNCD 3AV0B 4HH3C 4KQMA 3TPCA 3HV2A 3GGGA 5BSMA 4Q4CA 3C45A 3U7QA 4CKWB 5DWDA 5JNSA 3I05A 2JLCA 1FXWA 4J1QA 4BPBA 1FUYB 1M9NA 1WTCA 1Y89A 2AJBA 3RREA 5JHHB 1P0QA 2FSHA 1N0WA 2HFJA 2P3LA 2QRQA 2QX8A 1I01A 1N9KA 3NT2A 5HE9A 1DKMA 5DNEA 4BX9A 2QIPA 1GEEA 4MW7A 4D80A 5DN6A 4TLDA 2ZR9A 3LHSA 2MYUA 1GFZA 4NV3A 3DLBA 2BE7A 2X0EA 3L84A 1VSUA 3RRJA 3F5SA 4QECA 3ZEIA 3ZJYA 4IIGA 1V7QA 3AZQA 1U94A 4X20A 2A9FA 3TTTA 3OC6A 3DB2A 4GI7A 1S5PA 4C7KA 4EHDA 2XCUA 3PR3A 1K98A 2JK0A 2H17A 2ZATA 4JCOA 4HWPA 5KB3A 5U9CA 4BFZA 1MB9A 1L5HB 3D2CA 3KFVA 3B7PA 3IILA 1AQLA 5IT4A 1F2UA 2IVFA 1NQ5A 1BWPA 3W90A 5JS2A 3GI1A 3PWTA 4CM5A 1ZM4A 1JEYA 5FI1B 1U5CA 3A2KA 2WUFA 2X2OA 1Z5OA 3GIWA 2G63A 3ON5A 4M1SA 4W82A 3AI2A 4V24A 4C01A 1BGVA 2QRVB 3NM4A 5ITZB 1SBHA 1Y9DA 4RTJA 3FPEA 4OJQA 1RJ9B 3ANTA 1KDRA 1NN1A 3NVKI 3VR3A 1RQLA 3G2QA 5JUWA 5IDYA 4ZI2A 4GAEA 4JZYA 1ODSA 4W99A 1N6KA 1RI3A 3KALA 2QZSA 4JJAA 1RCUA 5CXSA 1XL0A 2ZTHA 3GLIA 2BELA 3LPNA 1T2UA 3FFAA 5EJMA 4P34A 4F3KA 4QNMA 1V7CA 3FVRA 9MHTA 2PKXA 1JMVA 4M1KA 8ABPA 1GD1O 1IXRC 1KERA 1JP7A 4ASUA 1VE9A 1E2UA 3PD0A 5FOVA 1C3VA 4MCJA 3D8UA 5GV8A 4RTMA 4Z53A 2EKBA 4B79A 1F8XA 2XF2A 2V6FA 1NNI1 3SR4A 2HJWA 1YS4A 3L8YA 5ER6A 6ABPA 4POAA 1J5PA 3D43A 1AY0A 2ZW9A 3Q98A 4G4IA 1P44A 4LZNA 1EK6A 1Z5NA 1G5QA 3MWDA 5BYBA 3T1OA 1WNFA 4R71A 5IKPA 4E5DA 1B8NA 3MWFA 721PA 3KELA 4RKYA 3S44A 1ZN2A 7MHTA 3PQ5A 3IP9A 4CCYB 2IBSA 1S8OA 3UC5A 1PW7A 2QE6A 1XMQB 3P9XA 1RW4A 2YVAA 2K4MA 1Q0RA 2HDWA 2ZYWX 4MQ6A 4MGZR 1MCZA 3PTZA 5WRFA 3UM9A 5G0WA 4UDOA 1OUMA 1FK8A 3FMPB 2R6HA 1EQAA 2VJMA 3BAZA 3QUQA 4OUDB 4WLOA 2NU9B 1W8DA 1U3GA 3PS9A 4KO1S 4YAIA 3EEFA 3O0DA 1R9GA 3A05A 4IXTA 1EG2A 3CZ5A 5CVDA 5JYBA 5AK5A 4C3OB 4RXUA 4B6SA 1WPGA 2A86A 1MEEA 3FDZB 3UMRA 1GYRA 1WXWA 4QICA 3FX2A 3ZS8A 3VSEA 4PY2A 1AQ6A 2AMLA 4JFAA 5FYQA 3JZIA 3O8RA 4DTIA 3B2EA 2JANA 1UM8A 1JPNA 4FYVA 5AW8A 1VL1A 2DY0A 2VDJA 3B7WA 1FFHA 1V48A 3G2JA 2Z1DA 3HXKA 1DIHA 1E5VA 3SKVA 4CG0A 4YRIA 2GMWA 4FCCA 4IJ6A 4YQFA 3HI6A 1O0SA 2ZRCA 4N39A 2F3QA 1RIIA 3WBJA 1TTTA 5KDOA 2IW3A 2VDQB 3A7EA 2X4DA 1WF3A 2AYZA 1V0JA 4Y9TA 1CR6A 4XQCA 3UZUA 2XE4A 4ZFNA 2W22A 1XPRA 2EEZA 1D9ZA 4R0VA 4Q4LA 2K87A 2Q1UA 4MUHA 4O0LA 2R6JA 4QARA 3ZHQA 3IE1A 4EY7A 3AESB 3FPLA 3X44A 1UK7A 16PKA 1I32A 2QRGA 3L0ZA 3V6MA 3UBTA 2QUHA 3NBUA 4MRRA 2BMFA 4LXGA 3BFKA 1J1IA 1BVUA 1JTFA 5L8VA 2ODPA 2W2QA 1Q1QA 2GGSA 3QFRA 3AFNA 1Y5NA 3CW9A 3BE5A 4LVOA 4MPTA 3TRKA 1PK8A 3WJ7A 3A2MA 2M1ZA 4P93A 3UHJA 5B3AA 2XDWA 5AKEA 8ATCA 2O8BA 1Q0SA 4FYIA 4AJOA 3ZCXA 3GPDG 2K7FA 4KYUA 4Q3KA 1KDPA 1X1SA 1XC7A 4RTLA 4A5SA 3GUYA 3CPEA 1J9EA 1NR5A 3D5TA 3WRXA 3T3NA 5EEHA 3UB4A 1AMNA 1UPTA 1DARA 2VPWA 1G8FA 3TIIA 4WBNA 2UXDB 2BFCB 4JODA 4FB4A 2OXRA 5I6DA 5AICA 3EY4A 4JB3A 4K6GA 5JMWA 1MNAA 2G88A 4RK4A 2FOLA 4MW1A 4YJHB 2JDIA 3WNQA 4BQNA 3FOZA 4MR9A 2HZBA 2ZIUB 4O25A 5THKA 1KPHA 3FUTA 2PT7A 2QRHA 5AOCA 5CDGA 1PBNA 1GAEO 5SZJA 1DBSA 3ECCA 4EJMA 5A5EA 3C3YA 1I80A 3R5JA 4GGMX 5A5FA 5BR4A 3ZEAA 3MMSA 3LQ2A 5E4FA 4D8TA 5LP6F 2F55A 1YK0A 4H16A 3GH1A 4B3BA 1TJPB 2C2OA 1ZZEA 2HLDD 2V59A 2IEGA 4G8CA 4MV5A 5DXJA 4EFMA 1JWAB 7AT1A 4AP6A 3RHZA 4HAZA 3IJRA 4L15A 4YRDA 2LCFA 3OQIA 5AKIA 3N3BC 4U7WA 5BSRA 1VJ1A 3KSMA 4HNAB 1FJ2A 1X7GA 2X9LA 3B6JA 4WOPA 5ALDA 1Y7IA 4R05A 3RG8A 3IP5A 3W04A 4XYLA 3HCAA 2PZKA 4QXRA 4QYMA 4NAHA 4C3UA 5JSZB 1YJCA 3FDJA 4HYQA 4W9MC 3OY7A 4C3ZA 1P2SA 3GLRA 3VZDA 2J3HA 1GCUA 1ZNXA 2AUTA 3EXHA 2PS0A 3M0EA 3IULA 4YGYA 4AJKA 4C4RA 1W2WB 2HTEA 2PX6A 1QGUA 4TN5A 4N0DA 1KH1A 3LU1A 3ABZA 3MK31 5IM5A 1ODJA 1JDJA 2Q0XA 4XQGA 5JZOA 3PJEA 3E1KA 1DDGA 4PZDA 4LHXA 4MVJF 2IPLA 4BUJA 2DQ4A 2PX4A 3NHWA 4DN6A 5JAUA 4RGVA 3SIWA 3VSBA 5EG5A 4MVXA 1BIFA 2AOTA 4CDGA 1RADA 3WLLA 1NRWA 5JWHA 3SBEA 5ED4A 3KAQA 3IA7A 2E55A 3JVVA 1FNDA 1XZFA 4OH1A 1GUYA 1XB2A 3ESCA 4MQ4A 3CMCO 3CUTA 1SU4A 3T7EA 2HPAA 1RQNA 2V55B 2DQKA 3H3XA 1SPBS 1J5EB 3EVFA 2EF1A 1SY7A 4IHQA 5C1IA 3SNHA 621PA 3IXQA 1K66A 2DFDA 4UCQA 3HXLA 2VTBB 1S2MA 3RVPA 4NZZA 1DQSA 5K2MA 1X15A 1NBMA 4MW5A 5DYIA 2P6OA 3VJKA 2NO7A 4IJQA 1VKOA 4F86A 5I3ZA 2FKAA 2ZRDA 2JEYA 1EX7A 1DXQA 4NZPA 3SM3A 4R9NA 5EHXA 2D1RA 4WFIA 5F98A 1QHYA 4JT8A 4DRXB 2Q4RA 3HR8A 3LQFA 1OT3A 3LYLA 3OFNA 4UD6A 2LDXA 4YVFA 1L7AA 4ER6A 1YOVB 4R41A 4C4SA 3IUJA 3JR7A 3BT7A 2BV3A 4FFSA 4L3VA 3OOEA 4XX0A 5G2OA 5GONF 2HF2A 2HK9A 5FL7D 3KXKA 1JV2B 4F11A 3V34A 3KLMX 1JBQA 1JIXA 1OBVA 3PNBA 4M1EA 3WIOA 3NTOA 2FU5C 3N0TA 4DA9A 1PQ4A 3EQ9A 2CV0A 3VX4A 4E7PA 4G0VA 4CQMB 1C8BA 3SCZA 1Y5RA 1GGVA 2LUOA 4NK5A 3VH1A 2QYHA 3JS5A 2DKOA 2NTNA 2QAGA 3AVPA 4QQ8A 3AXTA 4UTXA 3WRVA 1ZM7A 4UBJA 1RT9A 1D6NA 2VFAA 1T1GA 4G1UC 1X92A 2G0AA 4AURA 4D6YA 1FNSA 1JA9A 1FMCA 4U63A 3N76A 3ESZA 1N2CB 3UFXB 1QE3A 1YRBA 5JBNA 2WAXA 4RD3A 8LDHA 2BZSA 3E7XA 2AK2A 4EL0A 4GRDA 1AKYA 3ZQUA 3FTPA 2WTEA 1Z39A 1E9CA 4MPJA 3A6ZA 4B4UA 4BRWA 2C0CA 3GEHA 5CGQB 4BO6A 2WUEA 4Q18A 2GHIA 1HLFA 3NAGA 1F20A 1ZOOA 1S89A 3RT7A 2AIRA 1HL3A 1RRVA 3S55A 4CE6A 3K8YA 3NDPA 1C3LA 4N6NA 4RFVA 3A1VA 1E3EA 5FUYA 1ECJA 1R6AA 2Q4OA 3NHMA 4FEEA 4HEHA 4HXYA 3PDHA 4QNNA 4AO8A 5BOSA 1VJ5A 4DWJA 1N0VC 3U0VA 2YZKA 1G2QA 1KA9H 1M0SA 2YBDA 3CF2A 4UEWA 1PZXA 3W06A 4X5OA 3OWXA 3W5BA 3E22A 1G8YA 3QVLA 4GM1A 1YI1A 2Q50A 4FQ7A 5YASA 4Z1OA 1WSDA 1A95A 4GBED 2XCSB 2WTUA 2B4TO 3UJ7A 5DV9A 4WZAE 1GSIA 2LR0A 3CR3C 4ZCTA 1SEPA 4PAMA 1GNRA 3NYQA 2WW8A 4W5TA 3ROMA 5DN6D 4WXMA 2I33A 3N05A 2YOFA 4R1LA 1Y6GA 5ALPA 2JA1A 3ABRB 4NYIR 3N2IA 3OTQA 2C7VA 3N6XA 4HP8A 1I6WA 1QFMA 3V6LA 1EAMA 5JY6A 3OSZA 3VDMA 2HLPA 5KAMA 4ZZ1A 4XVRA 3K9CA 4N18A 2XE8A 4UQPA 3EUAA 1I3KA 5LOVA 1SCIA 2I66A 1VGQA 3BF7A 5JNVA 2XCRB 3OIDA 2ISCA 2UYGA 3VQTA 1YE3A 2HYDA 3FYUC 3JQGB 5FJJA 5GZ6A 1T1JA 1P7YA 4KXMA 3WOVA 1A7KA 2VP2A 2N3ZA 2ZAOA 4OSOA 4D81A 2JHGA 4M9XA 4MTLA 1NJ1A 3G5LA 1KZ7B 4O33A 1HT0A 1SCUB 3TM5A 3WQQA 5HVNA 4Z4IA 2NPOA 4PX9A 4BGVA 3B6KA 3PYLA 2BFPA 3HP4A 4YEDA 4GI2A 1E2BA 4OHPA 1K0UA 2APJA 1ZI9A 2XR1A 4WBXC 3VR3D 5K8CA 2XYQA 3AZPA 4KJZA 4S2EA 3H04A 4ZVQA 3CLUC 3T5DA 3CUVA 1QCCA 1ADFA 3SHOA 4HEA6 5L3QA 1CY7A 2C4KA 1KWGA 2AMJA 4H0FA 4ASUD 3CMMA 1PZHA 3WHLA 2R6CA 1L8QA 5AJVB 3G02A 2WHQA 2AH5A 3CXUA 3QVMA 5KJEA 4YCJA 4B7XA 4J6EA 4MW9A 1HDYA 4YRFA 2PSEA 1A82A 3E81A 2AJCA 1WXQA 4DR1B 1VXRA 1Y1TA 1V9LA 2BMJA 3VYRB 3AHHA 4OI4A 3H3FA 4LK2A 4XWTA 5EMNA 3WGIA 5CTJA 3IUQA 1X1BA 1IE3A 3RWMB 1RWBA 3FDXA 1NPTO 3PT5A 4QU5A 3BIWA 3ZNPA 5CCXA 2VHUA 1WKBA 1AN0A 3MQ2A 4LCBA 4DANA 1E4VA 2EP5A 2FMIA 3NHZA 3VDXA 1T5HX 4MUNA 1NN5A 4F4JA 3THWA 2OMKA 2OZKA 3L4KA 1JLSA 1OTYA 4F8EA 5LP6B 1CUBA 2RMKA 4KSBA 3ZHVA 4DPKA 3DUFA 1WMSA 2XJ4A 3B1ZA 4KIUA 4Z7JA 5BWBA 4HGOA 1HRKA 4O59O 3LT0A 4BNDB 2Q2NA 2XTZA 5K3FA 5B6IA 4TSFA 3I61A 1ODCA 5KU7A 5K05A 1NI5A 5IYZB 2QVZX 1IBRA 4BKOA 1DBPA 5HRAA 3PNMA 2YWRA 4ZDIA 3UB3A 1Q7GA 3JYQA 3RD5A 4KDRA 1NG9A 2DFPA 4OHBA 2ZIXB 2ZBPA 4H3VA 4RQBA 1K27A 4YACA 1PI3A 1HE8B 1EWTA 1JTVA 3O8QB 4C22A 1L4NA 1LK0A 2LRHA 3AF3A 4LWOA 5H83A 1U8CB 2G4CA 2FEPA 2OV6A 1X1DA 2I2CA 2IY8A 4A6XA 3LLCA 4F93B 2F64A 1UMBA 4M76B 4C5CA 3ADDA 2YIMA 1OFUA 4Y2VA 2C8VA 5EXXA 3ZQKA 3IAHA 5CBKA 5FAKA 1YDHA 2OCAA 4BDSA 4Z4EA 2A14A 4QYWA 4YJ3A 2DUUA 1CV2A 3SIRA 4RTQA 1UFVA 4KW7A 3B70A 1KDYA 3W5HA 4E5PA 4I9GA 1OAOC 2BEJA 5H3HA 4F0JA 2YFYA 2C0PA 2WWFA 2A35A 3AF5A 1KQGA 1IJFA 2CHFA 3ABSB 4NDNE 1X80A 1UAGA 4L4XA 4F72A 4EKIA 1I36A 1E9DA 5FUQA 1W93A 2XNDD 1J5XA 1BW9A 4Z9XA 3SF0A 3G2NA 1EVKA 2OSVA 4WOJA 1A3CA 4ZVVA 1CS4C 2E6KA 2Y1KA 3OZ7A 1VGVA 3IUPA 1JJBA 1C0IA 2GB4A 4RVCA 4IDCA 2C3MA 2X1LA 3CNBA 3R3WA 3DM9B 5BSHA 5AJYA 4CF7A 2JDID 3I23A 3BWXA 5CH3A 5JS1A 5BQXA 1KAOA 1AUQA 4XCQA 1Y4UA 2HLNA 5K7SA 1O97C 2Y0CA 1JKJB 4MQMA 3CE6A 5TMEA 3SZ3A 2Z4TA 1KC3A 3ACDA 3PUJA 2J87A 1YDFA 4FHEA 4NJEB 3F4KA 1Z33A 3P5BA 3F5MA 5DWQA 1TX4B 3AG5A 3D3WA 3NXKA 3QOXA 2WC1A 3ETGA 1JB1A 4O4HB 3KSBC 4QXQA 5GOZA 3JPWA 1N5RA 1ZCBA 1BNCA 2VHCA 5GONB 3RU3A 4ERNA 3EDRA 1RWPA 3DV2A 3WHPA 4NE2A 1E5QA 3FFBA 5AKXA 3TZCA 1ZL0A 1NDHA 2HJSA 3AVVA 2WT4A 1GT91 4MQUA 1JF8A 1V1MB 1W29A 1XTIA 3CPJB 4KQKA 3KRTA 3P2IA 4MICA 5I7SA 4CMJA 1BFKA 1IBSA 3L7DA 1AZSC 4ZYXA 1K7CA 3U7RA 2F7SA 4IV8A 1YBHA 5BV0A 1ZCFA 1R6VA 3NALA 2IKSA 2ONKA 5ADHA 1PGPA 1D4FA 4NEHB 3HEBA 1KVRA 4CF6A 2VNSA 4OK6A 4ATNA 2B82A 2IEZA 1PAUA 4QOSA 2A1TS 4AJPA 1LF5A 2H2HA 1GG8A 2ZP1A 1RRFA 2J6CA 3QHQA 1XPUA 1W87A 1WOYA 4MUAA 3SQXA 1E0JA 4LYYA 1V8OA 3MSCA 1ZCAA 3OBBA 4D02A 4O2RA 2Y1GA 2JFOA 2FV8A 4LNAA 4L0QA 2AN1A 3I0NA 5EZYB 2AEEA 1ABBA 1TM5E 4XWGA 1TO6A 1H1DA 1BEUB 1H05A 3C7KA 5G0SA 2VT6A 1JECA 1EWKA 5AP9A 3TBKA 4B48A 4DLRA 5B2ZA 1AGNA 3KYCB 3U3KA 1SBYA 2YOHA 3OM8A 1OZHA 2I2DA 4U2BA 2Q5QA 2PT9A 5AI8A 3T9BA 5J2UA 1CXZA 1PQPA 2ZXFA 1JQAA 3KPUA 2BUCA 2FX5A 1HUQA 3M6IA 3W6ZA 1KE1A 3DVAA 1KJJA 2YVKA 3DZDA 5KJFA 3BULA 2BFDB 3EZLA 2DR2A 3Q9LA 1JDTA 3RW9A 2RAFA 2NXCA 3A4IA 5FBLB 4DMMA 1NBMD 3E7PA 3EEIA 1BS9A 1GHTA 2PA0A 2WF9A 3BIJA 3F6YA 1BROA 5AM3A 2DHEA 1FQWA 3W7AA 1J56A 3MWGA 4Z49A 3IUYA 4PGHA 5T6BA 3VYUB 3MWEA 1F7UA 3RSZA 3JZDA 2PR2A 1ZD1A 4MI1A 1TF7A 3BH0A 4LI0A 3BOSA 2Q1TA 3ZXSA 2JAWA 4H1TA 1DEAA 1KP9A 1MABA 3DF7A 2ZI4A 1QIIA 3OFND 4O4JF 4UUPA 4YHBA 3TXYA 2VJKA 4FFPA 2VDVE 1P4JA 4DYDA 4XDGA 2H11A 1M2JA 2A5JA 2AOVA 5M3BA 3LCUA 2BSQA 2AG0A 4QVGA 1B73A 2YJZA 4Y98A 1FP6A 1K1EA 3OESA 3TI9A 5KJCA 1FYVA 1SQ6A 2W6PA 5DM70 4QFMA 2C77A 5EWLA 3URKA 2NZUG 1UBUS 2HCBA 3VPDA 3LWDA 4XCXA 3IEKA 3U4GA 3UWKA 3H84A 4TUYA 1I1HA 3UKOA 1ZRHA 3CUWA 1QV6A 3KEGA 1QDLB 3R23A 2RGAA 3MHTA 2CXQA 1O87A 3BMCB 5LA6F 1BYIA 2HGSA 4IHJF 5G53C 4QU9A 5FBHA 4FWIB 4XD2A 4P35A 3KR1A 1I4DD 3AV3A 1T4BA 1R88A 2DR0A 1Y1RA 3AUTA 1DAKA 3GGCA 3KC2A 1DV1A 3L7YA 1SKMA 4GX1A 4PANA 3LA6A 4BNWA 5I3CA 3KETA 1MB4A 4CVNA 3CYFA 3CKKA 1HPLA 4PC3A 4RY8A 5KBYA 4K7JA 1JJAA 2O59A 4TLLB 2H9AA 1WR8A 3D4NA 4LPKA 2C5SA 4EH1A 5G0UA 2A8YA 1TZBA 5FFMA 4Q37A 2DSNA 3FWZA 1UKBA 5TIIA 1M6EX 1YZKA 3DVSX 5FBRB 4GMGA 3ILYA 4JVOA 2ZRKA 5CAEB 3BMNA 4DDMA 1W46A 1X13A 2O1XA 1Y33E 3GJ5A 1SZJG 4JX8A 3ZUPA 3IRUA 5ALUA 1TJYA 1NSFA 1ZUNA 2AT1A 4IP0A 4OIFA 1OFTA 2IIBA 2X1MA 1K4MA 4OYYA 5LMNB 1DVRA 1FFXB 3KJHA 3ESYA 3D31A 3GUUA 1F8YA 3CV3A 4HNSA 4P7KA 4JD5A 3HA3A 3HADA 4G97A 5JFGA 1ULBA 4F38A 4D0RA 5A3VA 1SCQA 1GKIA 3DBOB 3PCRB 4LISA 1B1CA 4JC0A 3F8SA 5F2KA 3ZE0B 1ZHOA 2JCGA 4F5ZA 1PT6A 4KPYA 1D2RA 4UFOA 2ZUWA 5J1TB 3A28A 4MI9A 3AR9A 3DMGA 2X7JA 4RF5A 5DTQA 4J29A 4TKVA 1DEHA 3B82A 3OUZA 1NMEA 4G0XA 5EHIA 4JMPA 3I28A 3S2EA 1M67A 3BGDA 2VK1A 3CEHA 3ELYA 3O6VA 3GCZA 3IDAA 4D74A 1M1NB 2H4XA 2XNSA 4EHIA 1ENPA 2V96A 4H9GA 1NMXA 3WLPA 1X9IA 4X1IB 1RKVA 2IUYA 3K7EA 2WJZB 3Q6MA 5IFKA 1K4YA 3PG5A 4Z54A 3B1WA 3QWHA 2AZTA 4IHKA 1J8QA 5AVVA 5HZKA 1A8IA 5FIUA 3WLAA 4EZEA 1EUZA 2OK7A 1F6DA 2Y9MB 5JXHA 3IQHX 1B2LA 3QKUA 3A1CA 2XT9A 1PWYE 1M6HA 3VPHA 2IP2A 5T64A 2LV8A 1M8GA 2G07A 1WX1A 3T06B 3OZXA 4TXLA 2JIMA 4LQDA 3RWOA 5KTOA 1QHHB 3HFRA 4Z9AA 4JH0A 1HKHA 4CLRB 1JSLA 1K97A 1VLHA 1FDIA 2HIHA 4GKBA 2YQ5A 5E6UA 1GZ7A 4ES6A 1DRKA 1OH8A 2OORA 3KKKA 4FOOA 1E1MA 4K81B 3PHBE 5B53A 4LSGA 4G89A 4ZJUA 4CIXA 3EEYA 2HO4A 2FZWA 4FIZA 5EOVA 2NVOA 1YA4A 5JDCA 4LDZA 1T1SA 2HDNB 2QN3A 3IB6A 1CULC 2JIRA 4V1CB 3MCUA 2GLXA 3GCDA 3MMXA 3SJAA 3OG9A 4ZOCA 4PHFA 3D0KA 4GSKA 1T6ZA 2GI4A 3CNNA 3LX4A 3QOYA 4I55B 1IAQA 1XA0A 1CUDA 4EY5A 4AZTA 1Y98A 2O54A 5CDSA 3QWIA 2ZTMA 1UODA 4E33A 5FBQB 5LZ8A 1EX9A 5K8JB 3FF1A 3HA5A 3I34X 3JALB 2JCVA 5REQA 1FL9A 2O0JA 1RXCA 4K5QA 3RS5A 3FD8A 3GEGA 2FRDC 1FQJA 2PZBA 4TSFD 4CM3A 2GNPA 4ENSA 3CVVA 3F4LA 3D8TA 3NAQA 4I19A 3DUWA 5K0TA 1KY2A 1CE8B 1LF0A 1RHJA 1MIOB 1S96A 1ESEA 5LWHA 2UUCB 5E3JA 4JOSA 1I7NA 1TADA 4B3TB 4TYNA 1E4OA 2C5FA 1MDFA 2Y1CA 4M2LA 4OKNA 4F97A 1J25A 3MJTA 5AJHA 2X6RA 3JQAB 4GUDA 3PX2A 1ZMBA 1QX4A 3X3HA 1VYVA 3JQ8A 3UMJA 4GBJA 3ZS9A 4HDNB 1KDOA 1SOVA 3MFQA 3O4IA 4TL7A 3LXRA 1H65A 5G1PA 1WTAA 1ZRSA 2QOEA 5IJXA 1GN8A 2XCOA 5ER9A 5BSKA 3RODA 4YRLA 2VSYA 5L7TA 3JVDA 5T57A 3NHFA 3UB2A 1O95C 1ZGBA