4I9HA

Crystal structure of rabbit ldha in complex with ap28669
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
331
structure length
325
Chain Sequence
AALKDQLIHNLLKEEHVPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARQLNLVQRNVNIFKFIIPNVVKYSPHCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWILGEHGDSSVPVWSGMNVAGVSLKTLHPELGTDADKEQWKQVHKQVVDSAYEVIKLKGYTTWAIGLSVADLAESIMKNLRRVHPISTMLKGLYGIKEDVFLSVPCVLGQNGISDVVKVTLTSEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment growing and linking lead to novel nanomolar lactate dehydrogenase inhibitors.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords L-lactate dehydrogenase A chain
total genus 106
structure length 325
sequence length 331
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4i9hA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4i9hA02
3ZU4A 5KVCA 3FF4A 3L77A 1P1RA 3RC7A 3HWRA 3E9QA 5T8KA 5CPBA 4L8VA 3QIVA 5IXSA 4RCVA 2DFDA 4MDHA 1P1KA 1Q2XA 4PN3A 4FB5A 2YHIA 2PWZA 4KUHA 3E9MA 4CMAA 5A3VA 3DQPA 5JDCA 2NVUA 5A03A 5CEJA 1X7GA 3CKYA 4JGBA 2Q1SA 5AVOA 1QV7A 3WLEA 2YJZA 3GDOA 3RKRA 5ICSA 2JAPA 3ITDA 3PWZA 1SC6A 3GY0A 2FR8A 4FCCA 4R9SA 5L3ZA 4E12A 3ONEA 4JN6B 1QG6A 3HN2A 2XOXA 4LRSB 2YFHA 3L6OO 1Y1PA 4RF2A 5A5FA 4GVXA 4I5FA 3V2GA 1Y8RB 2ZJ0A 3L4BC 1M76A 5KVSA 1MLDA 3EW7A 2OHXA 2VHYA 4AJLA 3INRA 3UVEA 3WOHA 2ZTMA 2ZIZA 4B7XA 5C7LO 1KVUA 4HADA 5G0VA 1B3RA 3CEAA 3BMNA 1KEUA 4W7HA 3PZRA 4KDEA 3NJ8A 3WMXA 4BO3A 3ZNNA 2IDZA 4RVUA 2A4KA 4CM5A 1C1DB 1EK5A 2EV9A 5DCWA 4D43A 5JO9A 1TT7A 4EUHA 4FN4A 4H15A 3F46A 3W4JA 1VJ1A 5IDWA 2NVUB 3STHA 1I5RA 4Y6RA 4CM9A 1A72A 2O48X 3GNTA 4TVOA 3NT4A 4D41A 4BGVA 1IPFA 2NTVA 3S55A 3U62A 3G0OA 3HNPA 4NFHA 3DFUA 1PZHA 3HFSA 2W2LA 3NT5A 4Q3EA 4GI2A 3HG7A 4BKPA 4MKZA 1T2DA 3DHEA 2DTEA 1I3LA 4BNLA 1C0IA 3QW2A 3GC6A 4J0FA 1QYVA 4NZ9A 1A4IA 3DAGA 2AEJA 4HFNA 5K6AA 2YY7A 4G65A 3IL2A 4R01A 4K6FA 4RVFA 4TZTA 3QWBA 5JW6A 3ZNQA 3BMQB 2PKQO 4ZD6A 1YL6A 5COQA 2A92A 2QRLA 4WCFA 3TFQA 5L7WA 5A5EA 5T67A 3VKUA 3F5QA 1PWZA 1VM6A 2NTJA 1ENOA 3NRCA 3AOEC 4ALJA 3ZWYA 2HK9A 1J5PA 4GGPA 4BKQA 4YT8A 1HDYA 2B69A 3FR8A 3WNQA 2VYND 4OL9A 1Q1NA 5HTOA 3ONFA 4CUKA 2WD7B 3HZZA 5ENDA 1ZFNA 5IZCA 3QVTA 2YDXA 4J7UA 4FC7A 3GMSA 4ZICA 1C0KA 1J4AA 2C5EA 1XU9A 3R3SA 4IINA 4FR5A 1NWCA 3V5NA 1VL6A 3UOGA 1Y81A 3PHGA 1NBOA 1NVMB 2QX7A 4ND5A 4Q3BA 4AJNA 2VT3A 4OQZA 4J7CA 5LC1A 4N5LA 1B8VA 1TT5A 4CQLB 1OBFO 1U4OA 2CVZA 3DZFA 3PVZA 3I52A 4BB5A 4WEQA 1NXQA 1OC2A 3RFTA 3I4CA 1Q7CA 4J91A 3PK0A 4NMHA 3ADPA 1QYXA 3HDQA 3WTBA 4ALKA 2VRCD 3PHLA 1ZXLA 4OKIA 4JIGA 4B4VA 4GMGA 1C14A 2J6IA 2HMSA 1JN0A 1O95A 1YWGO 2NV6A 2G1UA 4PG6A 2RBEA 4BNFA 4WOJA 3B1FA 1E3EA 1NTOA 2VUSA 3SLGA 3UUWA 4AJKA 1UZMA 2E82A 3EC7A 3GH3A 4Q3DA 4TMFA 4JJGA 1P1IA 4YJFA 3QVWA 2I67A 1UAGA 1RPNA 4B4OA 3P5SA 3BHIA 5CG1A 4P4GA 1XDWA 2JD0A 3RUAA 2AEMA 4L75A 2ZJ1A 5BNIA 4GPD1 3RVDA 4LW8A 2ZB7A 2WYVA 4CMEA 4HFRA 4P8RA 3X2EA 4J3FA 4IQ0A 1W0CA 1Y9AA 2CVQA 2GN6A 1N1EA 2CDBA 3ICPA 3E6AA 4CL3A 3Q3CA 1U3TA 3ONDA 4INAA 1OI7A 1P33A 1H6BA 3E5RA 3MWDB 2X58A 4EZBA 3FCOA 3BA1A 1JKJA 4BV9A 4IDAA 1MG0A 3H2ZA 5JSFA 3TZHA 4MPDA 4OAQA 4HX5A 4WLUA 5AXDA 3FI9A 5A04A 4XDYA 3GDFA 1HYGA 2AW5A 4XB2A 3DR3A 2IZ0A 2RAFA 4MJLA 3A9WA 1AUPA 4YQZA 3KSDO 1A7KA 3E8XA 1JAYA 3OHSX 1PGOA 2BFOA 2RCYA 3VHRA 4J49A 3G1UA 3WSVA 5EERA 1E1LA 1BHSA 1GPDG 3W6ZA 3HDHA 4FFMA 3ZNPA 1AHIA 1R4MA 2OZPA 4KWIA 4J16A 1E1NA 1HYHA 1KY4A 2POQX 2Q1WA 3B1JA 3HN7A 3OQBA 4ITUA 4OXKA 3DBRB 3H9QA 1IZ9A 1G0OA 4B3IA 1E77A 1GYQA 1PJQA 3AOEA 4D45A 3GG2A 4YWJA 1G6KA 2XXJA 3GG9A 2WDZA 4II2A 2J8ZA 1VL8A 1E3IA 4LVUA 3GFBA 4NJMB 4RPJA 5H81A 2DT5A 5G4KB 2GF2A 4W7IA 3E9NA 2O3QA 4OJNA 2O3UA 5T8KC 3IUPA 5AYVA 3QY9A 3PLRA 5I7EA 1DC5A 2JL1A 4E30A 4UREA 2I99A 4AG3A 5THQA 1B8UA 2AE2A 4U6QA 1MUUA 1YBVA 3U0BA 3VZSA 4O1MA 1LDEA 1GCOA 4F46A 3EGOA 4IBOA 4OYRA 1JAXA 1MXFA 4DREA 3Q2IA 4Q3CA 4GX0A 1SBYA 4PG5A 4GKBA 3WNVA 4UVIA 4XIYA 4AJ1A 1VKOA 4XGIA 1R16A 3T7CA 2PH3A 4R16A 2Q2VA 4J4BA 2QG4A 1PZEA 2GN4A 1X7HA 4GSKA 4NFYA 4A0SA 3DBRA 5TGDA 1M2WA 1I2BA 3RBZA 3INGA 3DBVO 4HV4A 1DHRA 2YW9A 3FN4A 3ZDFA 2AG5A 3IQDB 5DP2A 1PS8A 1IL0A 2G17A 4CLHA 1YOVB 4KTVE 9LDTA 1OOEA 3SVTA 2I3AA 9LDBA 3SX2A 3RASA 2DTDA 2IEDA 2VQ3A 2O2SA 2Q1UA 3OQ6A 4BIIA 4KDFA 5BQFA 1T4DA 1I0ZA 4H7PA 2FPGA 3TDKA 4E13A 3S2EA 4Z9XA 1D1TA 2BRUA 2IEBA 2BF7A 5JBIA 1D1SA 1U3VA 1R4NB 4RPKA 4CM8A 2FR0A 3SEFA 1LLUA 4CLRB 1LNQA 2Y1FA 1JWBB 4M89A 2PD4A 1GV0A 1PJSA 4MVJD 2NUAA 4XEHA 1DAPA 4QEDA 3TFOA 4CMJA 4J1TA 2IYOA 2DU8A 2YDYA 2X9NA 1DJQA 3LF2A 3P2YA 5B37A 1BVRA 1UXGA 4A10A 3GZ4A 5HWSA 1N7HA 4XQCA 3ETDA 2NQTA 4ZQHA 5DZSA 4CQMB 4C4OA 3NGXA 3OH8A 1QYDA 3KB6A 2HO5A 1PJCA 2HQ1A 4N7RA 4RVDA 2AHRA 1XELA 4IGFA 3PYXA 4LISA 3I6QA 4O63O 1EQUA 1PU2A 1AE1A 2BGKA 4PLGA 1ISGA 2OP0A 5DCUA 6LDHA 3VOSA 3F4LA 1ORRA 4GSLA 1EK6A 4IIUA 5TC4A 1I01A 2CDAA 4QFCA 4DQVA 1H9BA 4ZRMA 2AMFA 3D5TA 5LCXA 3LYLA 4EEZA 5CAEA 4CQMA 1VKNA 1UAYA 3DL2A 2FWMX 4NG5A 1OC4A 2J5RA 1ZBQA 3PWKA 5LDGA 3WICA 3UH1A 3ROQA 4ZQGA 4ALLA 4E2ZA 5EQDA 3WTCA 4L74A 3V2UA 3FNEA 4E31A 3N74A 1E6WA 3DDNA 4GX2A 1HKUA 3GF4A 2WD7A 1C0LA 4DMLA 3DC2A 4MIYA 3WSWA 2Y1CA 2ZQZA 3VH1A 4J9VA 3D3EA 3OA0A 1B15A 3OSUA 1Z82A 4ROSA 1DLIA 1ZSVA 1IE3A 4WOKA 3TNLA 4DVJA 4CR6A 2VNAA 4B4WA 2BFPA 2CMDA 2R00A 3DHYA 3HHPA 4OIMA 3QLJA 4S1VA 2D4AA 4DBZA 2WD8A 3BTOA 3ROKA 2PTGA 3CXRA 1PEDA 3LVFO 5K6AC 2Y99A 4WLEA 4FJ1A 2B37A 1T26A 4YAJA 2O4CA 3TL2A 2ILTA 3AY7A 2W4QA 3VPHA 3RJ5A 4TRMA 1DSSG 4DTIA 1DFHA 1E7RA 3INTA 2J3IA 3M2PA 3FRJA 3LZ6A 4DPMA 4WNCA 4LMRA 3R1IA 2OGUA 2QYSA 4KWHA 3P19A 3KYDB 1Z6ZA 4PZEA 3WGYA 4FGWA 1JA9A 1MV8A 4ID9A 2GZ1A 1PJ4A 1P77A 3AUAA 2IODA 1IYZA 3GUCA 4RVGA 5T5QA 4EITA 4MVJA 4IZHA 3WFIA 2Y67A 4UEJA 5HBRA 2P9GA 1IB6A 4EEXA 3IAHA 1FDVA 2GPTA 4A27A 2JJYA 3H9UA 3RQSA 4OM8A 4K1LA 1R37A 1GFSA 3AY6A 2GASA 1DHTA 4OGWA 2QQ5A 1CIVA 3UHAA 1I2ZA 4YXFA 3WQQA 5CDUA 4NBTA 4FC6A 4CM7A 1BRMA 1R4NA 5EPOA 3VH4A 2ZYAA 4UVHA 1F06A 4Q3AA 2CF6A 2PZLA 4WCFB 3SXPA 1XA0A 1IOLA 1IZ0A 3JQ9C 4YAKA 1SAYA 3H8VA 3KXDA 5EINA 4FD3A 3S1LA 3AK4A 4M8SA 1UXJA 1KVSA 1GL3A 3H9EO 4ZQBA 4IY1A 5JCJD 1LDNA 5HM8A 1P9LA 2IXBA 4D3DA 3MOGA 1DLJA 5KJCA 3JD1A 2BGLA 5AQ1A 1NYTA 5G4LA 1NR7A 1Y8QB 2VHVA 4O59O 4BNYA 3GLQA 4GX5A 1KYQA 4NQZA 4URFA 2BHLA 3NKLA 2DVMA 4J0EA 3WS7A 1JQBA 2QW8A 2ZYGA 2C07A 3JQBC 4E5NA 3JCZA 3VC7A 4QTZA 3WMWA 2IZ1A 4D46A 4PG8A 5F1OA 3U49A 1WZEA 3WYBA 3M1LA 1SZJG 1U4SA 2H5LA 1LC3A 7MDHA 2DBZA 1C3VA 4M54A 3GN1A 4L76A 1BXKA 2VZ9A 4ONEA 1T25A 1QV6A 4TRJA 3NTOA 1VE9A 1ZVMA 1ADFA 3WDSA 4MIOA 4W6ZA 2X0JA 3QE3A 1LLQA 2QYTA 4LRTB 4GWKA 3FNFA 1H93A 2X86A 3OETA 1KY5A 1EDZA 2G5CA 4AICA 4B4UA 4BO5A 4IPTA 1B14A 3ZGYA 2FZWA 2WJPA 4GWGA 1ENZA 3RWBA 1YBAA 4BO9A 1PQPA 4F6CA 2NWQA 1GZ3A 4AJIA 2GERA 2XAAA 1E3SA 3VKVA 1GUFA 2HK8A 3JQAD 1V8BA 1EUDA 5JAZA 1Y8QA 3NJ4A 5JYEA 2PV7A 1DRWA 1VPDA 5F5LA 1LUAA 1P74A 1DBVO 3AI3A 3FTPA 2C82A 2VNSA 1ONNA 3DONA 4PZCA 2GYYA 4Z6KA 1E5LA 1KBZA 1P45A 3GAZA 4KQXA 4MP6A 5TRTA 5JMWA 3LK7A 1U5AA 2BGMA 5G0UA 1K6XA 4K28A 5ILGA 3BYZA 4L9RA 1Y6JA 1EUZA 2C0CA 4BKOA 3DO5A 1I24A 1VL0A 4RLSA 1ZNQO 3ULKA 3ICCA 4NU6A 1E7YA 3GMDA 3UICA 4QT0A 3RUHA 4ALIA 4TSKA 4EW6A 3UKOA 2ZTUA 4XQGA 4OH1A 1NNUA 2JFGA 3OJFA 2YV1A 1QLJA 4NPCA 4XR9A 2G82A 2Q2QA 2YV3A 5DBGA 1EQ2A 4PLZA 3CZRA 1T1RA 5B4UA 3I9OA 3HE3A 3RJ9A 2HMUA 2PNFA 4PIVA 4CMKA 5AXAA 1PSDA 4M86A 4NU5A 4KZPA 3ZWMA 2HLPA 4J2HA 4XYMA 3NT2A 4TWRA 1GUZA 3W1VA 4QFDA 2EGGA 5MDHA 1ZW1A 4CM6A 3VDRA 1YJQA 2HK7A 5JY6A 3JQBA 1X0VA 4FJ2A 4IJVA 5L7YA 4CV2A 4KTTE 3GVIA 3JQFA 3FPLA 3QWFA 4K9DA 4A26A 3T7EA 1F12A 4C7JA 2J3JA 4IXTA 1C1XA 4FFPA 1I3MA 2DFVA 3HDYA 2X1HA 1XLTA 2NACA 3DAFA 1X1EA 2JAHA 5TIIA 5TSDA 2EERA 4CLXA 1LRKA 3MJTA 5C5IA 1NQAO 4UUMA 4PLHA 3G3EA 1ZXBA 3PIDA 4YT4A 1NAHA 3BMQA 4HKTA 1TEHA 2FN7A 5DT9A 1LEHA 3ASUA 4CPDA 3VZRA 4GVLA 3JQ7B 4J4HA 1IHYA 1TA4A 5TS3A 4D44A 4CLOB 4FFOA 3BHJA 4MOWA 1XQ6A 4RVHA 3QWAA 1DIGA 3GUYA 2C59A 3HJAA 1X15A 4LMPA 5C3MA 4WPGA 2V7PA 4JK3A 4X54A 3I4FA 3MWEB 1LDMA 2VUTA 2EJVA 4JXKA 1GZ4A 5GZ6A 3TZ6A 4R3WA 3EVNA 3ZNOA 3DBHB 3NUGA 4D79A 3IUSA 2W2LD 1UZNA 1I10A 3FTNA 1RM3A 3KO8A 3SC4A 3CMMA 3EMKA 3OEYA 1NAIA 2PGLA 5IFLA 1PGQA 4R68A 2ZATA 4A73A 4NBVA 2Z5LA 4FJ0A 2I66A 2PLAA 4AJPA 2P4HX 2JKVA 4WLOA 5U9CA 2VTDA 5T64A 5ICMA 4IJKA 1GEGA 3OF2A 3ZV6A 1FMCA 3D1LA 4MVJM 4BS9A 3Q11A 3W4IA 3LT4A 2YZ7A 2PK3A 2JFHA 1DO8A 3AI2A 3AM3A 3BTSA 3I9KA 2Q3EA 5HS6A 3MTGA 2PGJA 3KVOA 1QKIA 4HBGA 2EIHA 4CLRA 4BO6A 1H6CA 1QXSA 4FOSA 2O7SA 3SJUA 2J5KA 2D0IA 4OQYA 1E7WA 1PTJA 3PHHA 4R1NA 5L7TA 3CZMA 1IY8A 2EWMA 2QZ9A 4F45A 1R15A 5DOVA 2GN9A 1F14A 1TB4A 3DZGA 3GNSA 1B7GO 1I33A 1NFRA 5JNLA 4CLEA 4EBFA 4AFNA 3BTVA 3VPXA 2Y66A 1RYDA 3KZVA 1HZZA 1BMDA 1NVTA 2Y93A 2G76A 4OSOA 3H5RA 4ALNA 2Z1MA 3KV3O 3KYCB 3JYLA 3O4RA 4UUPA 3QWIA 5L95A 2V6FA 2NVWA 3DZHA 3BAZA 3WGTA 1ZO8A 3GZNA 5KIAA 5TT0A 1K6IA 1CJCA 2P91A 1E6UA 4NFSA 4BMNA 2R6JA 3A28A 3AM4A 3GK3A 3VVCA 1SEPA 1NWHA 4XCVA 1WVGA 3C8MA 1YDEA 1J49A 1HDRA 4HNHA 4YA6A 3UW3A 1LSUA 3D4PA 5JAIA 4IDFA 1P1HA 4CM9D 1ZJZA 3GPIA 1ADGA 4BKUA 4PGFA 4JP2A 1H2HA 4BNNA 5I9NA 2E6UX 2I65A 3DEYX 1ISIA 2W8ZA 1E7QA 4GKVA 1MGOA 2ZYDA 3I23A 3BMCA 4QX6A 2VYVD 3MEQA 1ZMTA 4GX1A 4NJMA 2VZ8A 3LSYA 1Z74A 3WJ7A 3RUFA 3TN7A 4E6PA 5G0TA 3ORFA 1ADBA 5JYDA 3PHIA 3DHNA 4QO8A 1ZJYA 3OMLA 3G1TA 2A35A 2Y1EA 1DC4A 4RLHA 3NX4A 4MVJH 2JD2A 3CTMA 3T4EA 1FF9A 5G4KA 1PR3A 2E4AA 4YTEA 3V1YA 4BKRA 4DUPA 1PZFA 1SCUA 3LLVA 4B8WA 1UP7A 3WJAA 1E3WA 1ISHA 2IRWA 4DLAA 2CZCA 1BW9A 2AG8A 4G2NA 2JHFA 1HLDA 5JY1A 5GZ1A 1WMBA 3GVPA 4NK4A 2ZB3A 1BGVA 2I3GA 2Y1OA 3E18A 4IIVA 3UCXA 1O9BA 1O94A 5GZ3A 4DIBA 1UZLA 5C7IO 1V6AA 2AQ8A 1QP8A 4CMIA 3KYBA 5DULA 4XB1A 3ZHYA 2FR1A 3S2FA 3N58A 4IDBA 2GD1O 4R41A 3NAQA 2ET6A 3WFJA 3QVXA 2HMWA 5A3JA 4RV9A 3ANLA 5JS6A 2DKNA 4FQ8A 4IXWA 5FI3A 1RM0A 4O6VA 4E4YA 1V3TA 1MXHA 4OSPA 4TRRA 3W8FA 4CV1A 3A06A 3KSUA 4QQRA 2EW8A 3AU8A 3H2SA 5JC1A 4YDRA 2G0TA 2UUPA 3FR7A 2H63A 3PTZA 3EZYA 1N9GA 3OEWA 4F6LA 1LRJA 2YFQA 2HCTA 3QWHA 4B3JA 2R00C 3RD5A 2DPGA 4R51A 1V35A 4K6CA 3AUSA 1U2DA 2PR2A 1U8XX 3LQFA 1YE3A 1UR5A 2Z1NA 2CDCA 3IS3A 5ILOA 3C1OA 4IDEA 1ENYA 6ADHA 2FPIA 3TL3A 5KWEA 4RDIA 3F3SA 1ENPA 1HXHA 3C7AA 3V1UA 3HQ4O 3T4XA 1GU7A 3KLPX 1DIHA 3IP1A 3JD2A 1SEVA 2HJRA 3BIOA 2I9PA 3KRTA 4DQXA 1I3KA 3MJEA 2OFPA 3VDQA 3WQRA 3JQFC 3NTQA 4Q3NA 1AHHA 1KC3A 1LTHR 3Q2KA 4HXYA 5KKCA 3ZV3A 5ER9A 3F1KA 5B4VA 2P68A 3ON5A 1BDMA 2JD1A 2QZZA 4DQUA 3Q6IA 4N54A 2GUGA 1DFIA 4DL9A 5ER6A 4XRGA 1L7EA 1IPEA 3RC1A 2F00A 3IJRA 5TX7A 3VPGA 4E5KA 3LC2O 4EGFA 1B3BA 2EJWA 1LDYA 4Z3DA 3ZWPA 5ENVA 1XHLA 3DFZA 5JE8A 2PD6A 1NFFA 3GVXA 4YJFB 1XGKA 3G79A 2VOEA 3DOCA 4PZDA 4Z0TA 4E32A 3H5AA 3JQ8B 5JC8A 3D3WA 4NK5A 1ONOA 4KUEA 2FPPA 4XDZA 4NIMA 3WWZA 4BQRA 2FSSA 1N9GB 4OMUA 3BMNB 2D8AA 3PQFA 3TOXA 5EQFA 3BMOB 4FSHA 1W6UA 1WAMA 4YBZA 4FS3A 2X6TA 3LT0A 2YHUA 1PGJA 1EZ4A 2BLLA 1BTOA 2FRDA 4ZGWA 3CSDA 4B3HA 2UAGA 4O5OA 3IOYA 3PQDA 1P1FA 1HDCA 3ITKA 3E03A 1EMDA 2Z95A 1T2EA 2Y1DA 4OOFA 3G49A 4R1TA 4DA9A 2J5QA 1KERA 3GGPA 1HF3A 4WGGA 3PI7A 4E2YA 3IKVA 3BXXA 1MP0A 1AN9A 2GRAA 2VHZA 4I9HA 3DOJA 2AQIA 1Q7BA 3HB4X 1HL3A 4J43A 2OO5A 2O50A 2UUOA 2HRBA 4XR4A 1X14A 3CPSA 4JCOA 4BNWA 4R69A 2P4QA 1ZK1A 3ETGA 3IIEA 2WEKA 4XJTA 5CPFA 3RC2A 3E5MA 2PZJA 1P3DA 3Q9UA 3PQEA 4OHUA 4TZKA 5FWNA 1ZK2A 3AY3A 2GNAA 4YJGB 4BB6A 1EUCA 5IXYA 5IAAA 3IJPA 3L9WA 1NPYA 4AL4A 4WLVA 3KM0A 2HMTA 1JW9B 4ZQFA 1ULUA 2IXAA 1R0SA 4ZN6A 2X23A 4GH5A 1EEHA 5I7VA 2WYUA 1MA0A 1WMAA 3EAGA 1W4ZA 4YJHB 5U4QA 2B36A 5KOIA 3IMFA 3FNHA 5CDTA 3EDMA 1PR9A 4R5HA 1OMOA 2HDHA 2I6TA 1FDTA 2XF8A 1H0KA 2EKLA 1WPQA 2Q4EA 4BQPA 1BSVA 4BUCA 1ARZA 3B20A 1YQXA 4RDHA 4TVBA 2OXIA 3U3XA 5L9AA 3NTRA 4BO4A 4CLDA 1NQOA 4NJOA 1O6ZA 1HRDA 4JNKA 3GFGA 4XA8A 3LDHA 1X7DA 4MIEA 1ZUD1 3CIFA 2PFGA 5ITWA 1E92A 2D3TA 1NPDA 3TZKA 5BSFA 5J23A 2ZQYA 2AE1A 3PFWO 4MO2A 5A9TA 3GRKA 1UDCA 3H9JA 3JYQA 3IDSA 4IS3A 3GDGA 1UXHA 1GUYA 3VPSA 5I7SA 3KOUA 4W82A 3TSCA 3ZW9A 5BR7A 1SO8A 4BGUA 2NTNA 4KOAA 3QJ5A 3FD8A 4R9RA 3CINA 5EIOA 3O9ZA 4ND1A 4Z0HO 1A9ZA 2HMVA 3S8MA 3WG9A 1Y5RA 1SMKA 1X13A 4J1SA 1E7MA 3COSA 3EHEA 2E37A 1M66A 2GLXA 1T24A 1SNYA 1GV1A 4YB8A 3VZPA 1E5QA 4JX8A 1AXEA 1LLCA 4ZA2A 1I2CA 3OJLA 4JLWA 3WIEA 5A06A 3CE6A 1XU7A 3Q9NA 3RUIA 4BOYA 3ZN2A 4MVJF 2CUKA 2GR9A 4XYBA 3QSGA 1PIWA 4NH4A 4U8GA 3VAZA 3DXFA 1DPGA 5TT1A 4J9UE 4AJ4A 3H7AA 1D4FA 2X0RA 3TRIA 4BO1A 1E1MA 2H9IA 4CR7A 1LX6A 2WWRA 2Q1TA 4MVJE 4DIOA 4DYVA 2BI7A 4R1SA 4BNVA 4XYGA 2EP7A 2B83A 3ENNA 1GYPA 1PL7A 5JLAA 4U0JA 1Z7BA 3RAJA 1FJHA 3ZWVA 5JAQA 5IG2A 2X5JO 4YJDA 4YAEA 4FW8A 3JSAA 4RQTA 5A9RA 4D3FA 1HE3A 1YH3A 1V3VA 3ZH2A 5BSEA 3I3OA 4Y9DA 1L7DA 5IN4A 5TJ9A 4YYZA 3K8ZA 1G1AA 3O03A 1QYCA 3BHMA 3K5PA 2PKQP 5JCJA 1KEVA 4IQGA 5DF1A 4CM4B 5ITVA 5H83A 4WUVA 3RBVA 1MB4A 2C20A 4CMGA 1CQIA 1ID1A 2X0NA 4CMIB 3U4CA 2FY8A 3DZIA 2V6MA 5AXCA 3KETA 3GAFA 4D0SA 3AJRA 3OP4A 4RVSA 1P31A 2C2YA 5AXBA 3RUCA 3GA0A 1LU9A 4CUZA 4BNJA 4R1UA 5L4LA 1ML3A 4ESOA 1HWYA 2C29D 2X5KO 4LSWA 3OIFA 5EJ2A 5JCXA 1ISJA 1F0YA 1M75A 3C85A 1FDSA 1DFGA 4LN1A 5CDSA 1LDBA 2HKIA 4Y8VA 1N5DA 3QVOA 4YAGA 1W8DA 1YBMA 1UH5A 5IDXA 4BNKA 3ENKA 3MJVA 1ZZEA 3C24A 4FFRA 1V3UA 3WGHA 1NASA 3JTMA 1G0NA 2CSUA 1WDKA 2D59A 3RKUA 3Q1LA 5CEEA 3KUXA 2Q4BA 4LGVA 1F8FA 2AQHA 3CH6A 1DRUA 4RZIA 5TNXA 1LXCA 1ISMA 5DBIA 2DTXA 5HA5A 3L6DA 1K6JA 3D64A 1EE9A 5DCYA 2C5AA 3OM9A 2VOJA 3GGGA 1ZCJA 2AEFA 4FFLA 5FYDA 3F6YA 3JD3A 4XGNA 1OFGA 1R0LA 1LI4A 2P9EA 5CEFA 4PLCA 1TVEA 5ES3A 3UCFA 1I36A 1SOWA 1H5QA 1HZJA 1DC3A 3AUTA 3JYOA 3M2TA 3VVBA 2IYPA 5B12A 4WCDA 1C1XB 2EKPA 1Z73A 1VI2A 1PQWA 4WKGA 1PZGA 3LLSA 2C2XA 4RF4A 1CWUA 2IZZA 3L0DA 3UFXA 1T2FA 3EK2A 3E48A 3MJ4A 1VRWA 3NGLA 4RF3A 1B26A 3ST7A 4CM3A 4RQUA 1Q0LA 3ZZNA 5F1KA 1MC4A 2B35A 4IJUA 4ZQEA 1LQUA 1I30A 3GRPA 4M87A 4PLPA 2LDBA 3O38A 1BWSA 1JKIA 5B1YA 1IHXA 1KIFA 3FBTA 2B5VA 1BXGB 3AWDA 4TRNA 4RORA 3GN2A 1C0PA 5KVQA 3V8BA 2Q45A 1EVYA 2UYYA 1YO6A 5IN5A 3QHAA 5LDHA 2Q99A 1PJLA 3H5NA 3L07A 1MG5A 2FOIA 2LDXA 3PZBA 4EYEA 4FPXA 2CVOA 1ADCA 4QUKA 1HTBA 1U2GA 3JQAA 1QSGA 4BGEA 1FDWA 5GY7A 1HDOA 3A4VA 1C1DA 2QRKA 2FMUA 3JQGB 1PGNA 4A5OA 4PVCA 4P38A 2E48A 4HFMA 2BELA 3Q0EA 5DP1A 2FZEA 1DB3A 2HU2A 4UAGA 5JDCC 4G81A 3WYEA 1VSUA 3U4HA 4E2WA 3NV9A 3FPCA 1O5IA 3PPIA 1LSSA 3PYMA 4AJOA 8LDHA 4MVJG 2D2IA 3I9JA 3ZWOA 4FGSA 4XQEA 2ZK7A 1GEEA 1N92A 1XQ1A 2XXBA 3AUUA 4BNUA 4II3A 3GVCA 1LDGA 4WLNA 1XR3A 1KVQA 1S6YA 1BXGA 1ZSYA 2V6GA 1KVRA 4RPLA 4PRLA 4E3ZA 3M6IA 1KC1A 5IDYA 3OECA 3V2HA 4EJ0A 2OOSA 3ZHZA 4GL4A 4UVEA 4CMHA 3NDRA 4WJZA 3RU9A 3X2FA 4Y6PA 2YHIB 3AOGA 4BNMA 2X22A 4HFJA 3C1TA 1HLPA 1EFLA 1ZMOA 2V65A 2HRZA 3ZW8A 3TOZA 5DDIP 4Z0PA 4BHTA 3U4DA 1K89A 4EJ6A 3LC7O 3W8DA 5BNTA 1YONA 2FP4A 4XX0A 2PKRA 4UEKA 3U9LA 4RO0A 3PDUA 2NU9A 2PA3A 2GN8A 1Z7EA 1NQTA 3WBBA 5T6BA 3OA2A 1D3AA 1GZ6A 1EVIA 1RWBA 4UUOA 1EBFA 1QRRA 4DYDA 2C7VA 3PHJA 2YUTA 1J6UA 3QVSA 4EI2A 2ZKLA 2WMDA 3MCVA 5A05A 4CR8A 1LBEA 3JYNA 5F1PA 3QV1A 1S7CA 4GBJA 5G0WA 4BO7A 1P0FA 3ZWAA 1M6HA 3E82A 4DPKA 1MX3A 3PFFA 4NBRA 3HDJA 1EVJA 1JKFA 2CFCA 1MC5A 3K96A 5KKAA 4J2OA 4HNGA 2W2KA 4EJMA 2HJSA 5CDGA 4YQYA 4OXYA 5KTKA 1V0JA 1XYGA 1E1KA 1H9AA 5K0ZA 1WNTA 4JBIA 1JVSA 4HUJA 3DBLB 4GLOA 3WGIA 3BMOA 1P1JA 5ADHA 1Y9EA 3WYCA 1V9LA 2HSDA 2AXQA 3H9GA 4TQGA 4UEOA 3OICA 4MVJP 3ANNA 3H6KA 2VCYA 4BO2A 3F1LA 3F4BA 4FFNA 5KJ6A 3PIIA 2Q46A 1Q7GA 2JHGA 1O89A 4ND4A 3TQHA 3ZV4A 4AJEA 2AQKA 1HSZA 4Z9YA 3OJOA 1NX6A 1WW8A 5A4DA 1YB1A 2JCXA 1GY8A 3PGJA 2NLOA 5L45A 2RIRA 1GQYA 1UXIA 1GPJA 2DC1A 2I5PO 3CMCO 4P4NA 3A1NA 2ZCVA 5HS4A 2GDZA 4I8XA 5BSHA 5L40A 1PX0A 4GAEA 3RU7A 2GZ3A 5I9LA 1KVTA 3LT2A 4I5EA 4NR0A 2OBYA 1EFKA 2VWHA 2BKAA 1EE2A 5CP8A 4DPLA 5F5NA 1GCUA 1LQTA 4PLYA 2VUUA 4M55A 1WWKA 3GEMA 3B70A 5CDYA 2FSVA 2NVBA 4ND2A 4ND3A 3RC9A 1R0KA 4E33A 2WE7A 4R3NA 4WASA 4A03A 3UCEA 1RKXA 3AFNA 2YYYA 1O8CA 1U5CA 1LLDA 1DIRA 3GHYA 5IDQA 4D3SA 4J90A 4XRRA 3S2IA 4N5NA 3LC1O 1HE2A 1LRLA 2X4GA 4BNTA 1PL8A 3DMYA 1H94A 4MKRA 5H82A 3H65A 2Y0CA 4NNJA 1YL7A 4I5DA 4L4XA 1LJ8A 3FNGA 3SBOA 2BD0A 5DOZA 2X5OA 3JQ7A 3D0OA 4XQ9A 2GGSA 2H1SA 3K30A 4GLLA 3I6IA 3FSRA 2DQ4A 4BNHA 1XIVA 5K9ZA 3HB5X 1RJWA 2C7GA 4WK6A 2F1KA 3D7LA 1YDWA 5CHEA 4OOEA 3ZHXA 4NDNE 2X7HA 2EXXA 3PP8A 2YV2A 5B4TA 4H3VA 4CL8A 3PXXA 3MJCA 1GR0A 5L4NA 4W9NA 2BFMA 1HE5A 2JCYA 1NHGA 2BFAA 4CQMD 5A1TA 4ZVVA 1K2WA 4CUJA 2X9GA 2O3SA 3I83A 1J0XO 4PFJA 4YCAA 4G5HA 1FK8A 2NU6A 5I7FA 4I08A 3PJDA 1I8TA 4TKMA 2UV8A 1PL6A 2OBNA 1ISFA 2CNBA 2DLDA 3L4SO 5IF3A 2BI8A 3R3JA 1P44A 3IC5A 1E7SA 3DZBA 1XEAA 1B2LA 1TI7A 3C7DB 4I9UA 4U6SA 4J1NA 3TJRA 4B7CA 2VWGA 3DMTA 3PDJA 4BV8A 4IM7A 2O3JA 5FFFA 5A9SA 4U0KA 1CQJA 1HE4A 3VTFA 4ALMA 1K3TA 1TXGA 1XG5A 4MVJI 4UUNA 5FI5A 1XWFA 2EGHA 1CERA 3AM5A 4AJJA 3L9XA 3WX0A 1D8AA 1B8PA 3JQAB 4KMSA 4EUEA 1RM4A 2UDPA 4E0BA 3B1KA 1YXMA 4YJHA 4E21A 3VZQA 4UVDA 3WQSB 5FF9A 5TLSA 2A94A 2SCUA 3PJGA 1O0SA 2PY6A 3JQGA 4E5MA 1ZK3A 2QRJA 1JDJA 2TMGA 4IDDA 3KYCA 3QP9A 2B4QA 3V1TC 5TF4A 4BL5A 5MGBA 5KCZA 1T4BA 5COBA 2GCGA 4DBVO 3H3FA 1K5HA 2DM6A 4Y98A 3DTTA 1R6DA 3TWOA 3R6DA 3O26A 4JJIA 5GMOA 2WSBA 2VZ0A 2O2YA 1ZIDA 5G2OA 3U09A 4Q9NA 3ZU2A 1HT0A 4RPGA 1U28A 3AW9A 4NBUA 3BTUA 4S3MA 2ZTLA 3DB2A 2EHDA 2IE0A 4UULA 2Q50A 5BNFA 3WBFA 8ADHA 1E3JA 2YQ5A 4ZU3A 1H6DA 1DOHA 4MP8A 4BO8A 3NDJA 2JFFA 3C7CB 2UVDA 4RGBA 1QYWA 3ZWNA 4CODB 1OAAA 4M1QA 2NU7A 3K9QO 4YAIA 1RM5A 5I8ZA 3UF0A 3HADA 4N18A 2OMEA 2O3RA 4R54A 5EMHA 4GMFA 5KNLA 1U3UA 1U1IA 2RH4A 2B5WA 3MJSA 4YRBA 3H4VA 1N2SA 3WGQA 3M1AA 4JQCA 4D42A 2R2GA 5KJ1A 3NYWA 3K31A 5L4SA 4B79A 4EDFA 4Q39A 5L51A 3SJ7A 3ZI0A 3OFSA 1NQ5A 2CF5A 4BMVA 4H16A 5I9MA 4DGSA 2B4TO 4DXHA 4J7XA 1EVZA 5TJHA 1ULSA 2X0IA 5U1PA 3PYLA 4E5YA 1NVGA 4FIZA 1GQ2A 4PLTA 3SC6A 3FWNA 3MOIA 1A7AA 4LVCA 1N8KA 1I3NA 4Z9FA 4AVYA 3UAGA 5L53A 3ZHBA 1WLYA 1T1SA 3JQ6A 4BNZA 3ZU3A 4HWKA 5JDIA 4CMCA 5JO0A 2PD3A 1JU9A 3D3WB 3I9MA 2PZKA 4IUYA 4QXMA 3SLKA 2BH9A 1LA2A 1GYRA 3HSKA 3GR6A 1UP4A 2EG9A 5F21A 1ZK0A 1PS0A 3E1KA 1HETA 2YQ4A 4IDCA 3JV7A 4XGKA 5IZCC 4YRAA 4XD2A 2X9VA 4OO3A 2OORA 4I5GA 3P2OA 5C37A 3DTYA 4RL6A 4J4TA 3WB9A 2CY0A 3I9NA 4QO7A 5JMPA 3DMTC 3OIGA 1DEHA 4IMRA 1MFPA 3WIDA 3QQPA 3F9IA 1A71A 2DAPA 4WNIA 4B8ZA 3QRWA 3ABIA 4A7PA 2AA3A 4ZJUA 4I9NA 2RHRA 4KP7A 4NI5A 4DWVA 4WEOA 4DLLA 1Q0HA 1TLTA 2W2KB 3JQCA 3K2EA 4GQAA 5DNAA 4HP8A 3ZU5A 2EF1A 4AJ2A 5KVVA 2GZ2A 3I1JA 5FEUA 3O8QA 1JWAB 2VWQA 1U7HA 1DDOA 2D1YA 3PWSA 4R5MA 4YVFA 2GO1A 2B4RO 2P9CA 3DBLA 3NEPX 4R4JA 4K26A 3G17A 3W8EA 1ZEJA 2EP5A 1Y5MA 1SB9A 1DC6A 4L73A 3ZWXA 3K6JA 1N7GA 1SPXA 4QECA 1AGNA 1NFQA 2PZMA 5EN4A 3RCBA 1U9JA 2WYWA 2DUUA 3PLNA 2VHXA 3ANMA 3GT0A 5I8WA 1Z75A 1HEUA 3OIDA 1ZKMA 4PVDA 4LSMA 2C54A 4UVGA 3VTZA 4YACA 1YL5A 2VRCA 3PJEA 4IDGA 1YKFA 1KETA 3ETEA 1EBUA 3JQDA 3RI3A 1UDBA 2VYNA 1T2AA 4CV3A 1ZH8A 2Y05A 3OBBA 4BVAA 3F47A 4OXNA 1QMGA 4QSMA 4XJSA 2ZB8A 3GQVA 5EL0A 1HSOA 1HYEA 3RBXA 2J3HA 2OL4A 3BZUA 3OQ1A 4XYLA 4LCJA 3LU1A 2O7QA 4HY3A 3FWZA 4JJFA 2VTEA 3AU9A 2DUWA 4M49A 1E0DA 4CM8B 1ONPA 4IJWA 2OUIA 3D5QA 2D5AA 4NHEA 4RPHA 4E5PA 5JXWA 1PJ3A 3RFXA 1BDBA 1BXZA 1SOVA 1BVUA 2NM0A 1YGYA 3KEOA 4WLFA 3UXYA 1YB5A 2V6BA 1R66A 4KUGA 1YS4A 3W6UA 1CEQA 5DBFA 3PGXA 5BSGA 3JQ9A 1T2CA 1K0UA 3EY4A 4LK3A 4W9NC 3RUDA 5CG2A 4PLWA 1B0AA 1XSEA 1A9YA 3GHHA 1Q0QA 4AJHA 5DN9A 2P2SA 4CV0A 1DXYA 3ROPA 3TZCA 4JBHA 4DRYA 1W73A 1WZIA 1GDHA 1KS9A 1N1GA 2BMAA 1E3LA 4BNIA 2WE8A 2NADA 3VPFA 3H3JA 4FOOA 1RYEA 1VC2A 1WDLA 1YRLA 4J6FA 4B7UA 3OJ0A 2DBQA 1WXDA 1LSOA 4JROA 5JDIC 2EEZA 2J3KA 3K73O 4D7AA 5EESA 3PJFA 3GGOA 1DRVA 3D4NA 4PCVA 4Y6SA 2NU8A 3GZNB 1GAEO 2I76A 4P4LA 1YQDA 4EUFA 1XKQA 4YJGA 4ILKA 2ZB4A 1IUKA 1OZAA 1H2BA 2ZTVA 1F8GA 3C3XA 1KEWA 3DWFA 5A9SB 3WXBA 1KEPA 4DC1A 1R4MB 3F5SA 3B6ZA 4U5QA 4W4TA 1AXGA 2FHSA 3CUKA 3KEQA 2ZCUA 2TMDA 1B16A 1SB8A 3GPDG 3K2BA 4PG4A 2VYVA 4ZHSA 1CDOA 1UJMA 2NSDA 4E2XA 2A9FA 3ZCXA 1YQGA 1LC0A 3KBOA 2D5CA 1DIBA 1U3WA 1I32A 3FBGA 7ADHA 3O8QB 1HDZA 4OKNA 3WGOA 3DOOA 1H6AA 1EDOA 3U4IA 4I1IA 4MP3A 2Q49A 3RUEA 1DIAA 1NR1A 3DZKA 5IZ4A 3FHLA 1UDAA 1JTVA 3WGZA 5THKA 3GEDA 3MZ0A 4RJTA 3EVTA 4YPOA 1KOLA 1FXSA 5G0SA 3IP3A 1MFZA 1PJ2A 2VHWA 4FDAA 4YT5A 1D7OA 1U7TA 3LT1A 1WDMA 3I9LA 1Y8RA 5KJEA 4A2CA 1A27A 3GVHA 4N5MA 4CM1A 1VSVA 3KYDA 4YRDA 4ZRNA 1YJ8A 4CLOA 4O0LA 2Y0DA 4BMSA 1IULA 3U5TA 5HRUA 2WM3A 3IKTA 4KQWA 2QIOA 2DBVO 4BNGA 1CF2O 1BG6A 3LF1A 1YVEI 4CMBA 2P5UA 1FDUA 2Y0EA 4IZIA 4WE3A 3VH2A 3KHUA 3ADOA 4IS2A 1DJNA 3WWYA 1PGPA 1PJBA 2QHXA 1VJTA 1JVBA 4L0QA 2P5YA 1PS9A 4YR9A 3OJEA 4PLFA 3PEFA 2H6EA 2RH8A 1GADO 3L4BA 4JBGA 4DIFA 2RHCA 1A4UA 2HAEA 4BO0A 2DPHA 2EKQA 2PGDA 2CD9A 4CMEC 1GQQA 3KTDA 1HDXA 2O4UX 4CJXA 3K92A 3TF5A 1QORA 1GTMA 4BNXA 1ZEMA 4IQ8A 1VJ0A 3WGGA 2WTBA 2Y68A 3PRJA 3QA9A 3HUDA 2PH5A 1NP3A 3L6EA 1X0XA 3EZLA 5BT9A 4DLBA 4PRKA 4XWYA 1YB4A 3ZWBA 4BGIA 4W99A 1DAOA 4XYEA 4C7KA 4CM4A 1HDGO 3RSHA 3JYPA 4L4RA 4Y67A 1NM5A 3AI1A 4NBWA 1CYDA 4TKLA 4FBGA 1XCBA 2B0JA 1NPTO 3N7UA 4WECA 4XKJA 3RROA 3TZQA 4LCEA 3KSZO 1Z45A 1M67A 1JLLA 4DMMA 1E6EA 5COAA 4GGOA 1ZK4A 3C1AA 3D4OA 1L1FA 2VT2A 1NHWA 3ZWWA 1F17A 1TT5B 3HFGA 4CQLA 5A02A 4F3YA 3R0IA 2W90A 2O3TA 4PG7A 4MKXA 4TROA 5JPIA 1PQUA 2GSDA 3TPCA 3JD0A 4PLVA 5CFZA 3ASVA 3P7MA 1PJTA 4RF5A 4JP3A 3A14A 3UN1A 4IGEA 3JQ8A 1U8FO 2EW2A 1M6WA 1QR6A 1UP6A 4MINA 1LSJA 3DZJA 3NDIA 1UXKA 4XZ3A 2X8LA 1VLLA 3DBHA 4XIJA 3RIHA 4YT2A 2E49A 5AOVA 5KJFA 4IMPA 1WP4A 2JCVA 4P22A 2NNLD 2VWPA 2NQ8A 1P0CA 3S2GA 1A5ZA 5TQVA 4D0RA 2VN8A 3GOHA 3MTJA 3W4KA 1CETA 2VRBA 3WLFA 5JFOA 2DBRA 5JAMA 3EYWA 3DAPA 5IJZA 2OP1A 3KLMX 5T57A 3UGKA 1CRWG 3JD4A 5C7OO 5F3RA 4J1QA 3GNQA 3JQEA 4DC0A 1GD1O 3EUWA 1PWXA 1QLHA 4YEDA 3WR5A 1UUFA 2XPCA 2HUNA 1R12A 1X1TA 3AFMA 1Y7TA 1ZSNA 1BW9B 4RZHA 3ZWCA 4Z3KA 2W98A 3VH3A 3ROMA 4U7WA 3BMCB 4WCFC 2O23A 2Y1GA 3I5MA 1E3WB 3ZV5A 4L4SA 1YOVA 2Q2WA 3GEGA 3RFVA
chains in the Genus database with same CATH superfamily
4GYKA 4A23A 3ZU4A 2DWCA 1VLMA 2WUFA 1NVVR 3FOBA 1AKRA 4JR1A 4HH4A 2OKCA 3WNDA 4C20A 3HGMA 4QXAA 4LV6A 1NBIA 4YP7A 1GRVA 1BWQA 3GRVA 4WVFA 2DFDA 3VRHA 2XUOA 2ATCA 3GAAA 4OHVA 3AZOA 3TQFA 2YHIA 3QQ5A 5A4MS 5KDDA 4MUFA 1KR5A 4RKEA 5A3VA 3DQPA 4ER0A 1T5TA 2H4ZA 3PL1A 5CEJA 1X7GA 4ZVOA 4LXIA 3MC1A 1TYAE 2Q6TA 2CB0A 3VA7A 1QV7A 2NPIA 3DFFA 2I9KA 3GDOA 2Y4OA 3O95A 4UTOA 1JEAA 3RKRA 1SXJC 2WF9A 3FB4A 3ITDA 1IWPB 1SC6A 4LXYA 2FR8A 4E12A 4ARBA 5M29A 2WU4A 3U7EB 1KIMA 3HN2A 2FQQA 2Z98A 3L6OO 4G23A 5AKJA 3KAPA 3HN6A 4LSZA 2QTTA 3KD2A 5LQCA 1C4OA 2CMGA 4FOPA 5KVSA 1MLDA 1JEEA 3CG0A 4AF8A 3BS4A 3WOHA 5DU2A 1H22A 3UVEA 2XCTB 2AT1A 5JVDF 1M6YA 2COEA 2B9VA 2QLBA 3WI7A 2BLNA 1B3RA 5ANRB 1F9AA 1FSFA 1V6SA 2F90A 3LRPA 3SU8A 3BMNA 2XYPA 1P7PA 4AS2A 2R7KA 4NS4A 1SVNA 3PZRA 1YI8A 4K03A 3NJ8A 3OKAA 5ADWA 1JLHA 2IDZA 4RVUA 2A4KA 1TMKA 4JDUA 3TIGA 1T9AA 2JEOA 3UMRA 2V74B 4V0QA 5JO9A 1FW6A 2MHCA 2W2NA 1NURA 2WKPA 2IYWA 2IS2A 3R0JA 1CRLA 3JRNA 5M3BA 3IAUA 4WKCA 1RWOA 2IDMA 4LXHA 2GD0A 4Q18A 4Y6RA 3SZMA 1JSXA 4ZV7A 2NU8B 2O48X 2YNMA 3GNTA 4RTMA 1W88A 4D41A 2VSQA 1J5EB 4BGVA 4ZO6A 4KLRA 3U62A 2YWXA 4WRRA 1D6MA 3FBWA 2FEOA 5CNIA 4PE5B 3C5CA 1PZHA 2QW0X 1NI4A 3HFSA 3SBXA 3OC6A 3NT5A 4PYMA 3NOQA 1ZOLA 4Q3EA 3VMFA 3W6NA 4DR6B 4HB0A 4UE2A 1UEJA 4EK9A 3L6UA 2PJZA 2AOWA 1C0IA 2HYIC 1R6BX 2FKAA 2AF3C 1TFRA 1MJFA 2WG2A 2PEYA 3HBNA 5CA1A 1I94B 1QYVA 3B1ZA 3DAGA 2ZT5A 4KO8A 2AEJA 4Y6LA 3T1QA 3ND6A 3RWOA 3IL2A 5K6AA 4XASA 4PZYA 3UUFA 2C7RA 2DFTA 4K6FA 4PC7A 1AF7A 4TZTA 4B74A 2XQFA 5HQ3A 5C5CA 4PU0A 3R8XA 3ZNQA 2J87A 4OHOA 4YMGA 2ZFUA 2QD2A 1J2RA 1YL6A 2VK1A 1RKQA 3SR4A 1UPCA 2A92A 5EUBA 4BZQA 4EQ6B 1O4VA 4KQMA 3FUWA 2DSNA 2DWQA 4BXOA 4W9RA 2IEGA 1Z2CA 2NTJA 2R8YA 4QG7A 1EFRD 2Z8XA 4L0MA 4M1MA 4Y7CA 3EXG1 4Z4QA 1J5PA 3E27A 1SURA 3K7EA 4GGPA 3V9AA 3SSOA 1N1DA 4B2LA 5F3DA 4U39A 4RJKA 2ZI4A 3HZZA 3RVNA 4DHWA 4FT2A 2CSXA 3QVGB 5DSXA 3B52X 3DDSA 2O8EB 2EFGA 3TSZA 3GMSA 4ZICA 3IEKA 2IX3A 1RJFA 5LA6B 1WDTA 2C5EA 5KHOC 1JDSA 1E4EA 3JAKA 1B43A 3L2OB 4ZYZA 2ZSIA 3WAJA 4FR5A 4DCTA 2RSLA 4F91B 1KO4A 1RAAA 2CCKA 2WM2A 3T06B 3PC7A 3VJKA 5CB0A 3MMNA 3DT6A 3W04A 3EEFA 4I4TA 1Y81A 1NBOA 4HI0E 4XSGA 3NEYA 2AZMA 3NP9A 1MRZA 4AJNA 4E5DA 1Q21A 3UANA 1SRRA 1PHRA 3D4LA 1ZUIA 4LRXA 4QBFA 13PKA 1PFGA 1JEQB 1UOPA 2Q4OA 4V3CA 4WEQA 2BISA 4LZPA 2C58A 3B3FA 2JVIA 2R8BA 4TYQA 4QNNA 1Q7CA 3R75A 4D0NA 2NU7B 4ILEA 2V7VA 4TUYA 2JFWA 1T4MA 4B3DA 1V8DA 2BEWB 1JN0A 1YWGO 2FJ0A 2NV6A 3IP8A 4C6HA 3D6FA 1G2OA 4Q4CA 5K0EA 3T1YB 2C0QA 4X7PA 2RBEA 5AOCA 4WOJA 4FLEA 2P4EA 1CDEA 5JEEA 3W06A 4I6JA 2VHCA 3UAOA 4UHDA 3F67A 1WZUA 2SHKA 3KFVA 1E1QA 2QX4A 2VUSA 1D2AA 4H4DA 4JBXA 3TYXA 2DFKB 3V8QA 4AJKA 4RJJA 4FNOA 3EC7A 4Q3DA 4LTNA 1M8JA 3CZPA 2D7CA 3GLVA 1W0KA 3S40A 4CZ2A 4YJFA 3MTIA 3UB3A 1RPNA 5F73A 5AKLA 2H1CA 3BHIA 4YLYA 1ZLYA 1XLWA 4KQFA 4OFXA 4P4GA 3PXBA 3MFQA 3BWBA 3FNIA 3NBUA 5GV7A 3WLNA 2ADMA 2FEPA 4A8HA 3OF5A 4C4AA 5K0TA 3RVDA 2FZVA 1CUHA 4ZAVA 1XTSA 1Q0ZA 5D2CA 4YP0A 1ZNYA 1H8HA 4J3FA 3ZTYA 4MW4A 1R64A 1W0CA 1TJ4A 4QNMA 2GN6A 1A9QA 4IX1A 4MV5A 1GGJA 1F60A 3E6AA 1ZD3A 1ZRSA 2C9OA 2PS0A 1P91A 1U3TA 1YA4A 3ONDA 3S2ZA 1P2FA 1OI7A 1P33A 5I4KA 1H6BA 3E5RA 4LWOA 3MWDB 1CR4A 3TTSA 2QTBA 4EZBA 3UG6A 1JKJA 3LCJA 1N0IA 1QONA 4FZJA 4XSVA 2YVUA 3H2ZA 1G9XA 5KQLA 1AZLA 2JLSA 4F5WA 2VAMA 4ZTUB 1MJGA 4HB3A 4C43A 4Q9DA 2WHXA 3T7TA 4HWGA 1J7KA 1KDRA 2JLUA 4QXRA 3CJTA 5AXDA 3O2SB 3ZZUA 5ICCA 3GDFA 2HXYA 1JG4A 2QORA 3VYUB 5HFJA 1D2EA 3MS4A 1R9MA 4L9SA 4BMXA 5UKDA 4D9HA 1M1NB 4YY3B 2RAFA 4QTXA 4KIWA 1OLXA 1XTVA 2GVNA 4BVHA 1R8XA 1Z8HA 2ZRLA 4Z4GA 4DWWA 1L5HB 2FW8A 2GRJA 4I9GA 1GCGA 5BN4A 2QYOA 3VHRA 1NG9A 1YFZA 3P0IA 1ABBA 1GPDG 2GKGA 3KXLA 3AINA 4Q6WA 2N47A 3LW8A 1G8AA 4QRDA 1OXUA 4UATA 2RHTA 2ZUSA 4G56A 4N82A 1GSOA 3N2GB 4HGNA 5EMMA 4UCQA 2FDCA 2OHJA 5DPMA 2V3WA 1VCMA 2I4MA 1E1NA 3TB4A 1TIBA 3MQFA 3WL6A 4URXR 1G2PA 1BE1A 2XYGA 5DLPA 2ZE8A 3OJWA 2BH2A 1IZ9A 4MCAA 4MKGA 3CX6A 3ES9A 5CT5A 3UXMA 1GYQA 4XVHA 3WGUA 2UYCA 2NXEA 3AOEA 3ER8A 3GG2A 1XZIA 4TLMB 2B4AA 2XXJA 3GG9A 3SYMA 3N6XA 1MOZA 3B3GA 4F1JA 1ZC4A 2J8ZA 2Y8EA 2AIRA 2AOTB 1E3IA 4IQFA 1Z68A 4UXIA 5BYKA 2B8WA 2DP4E 1IU9A 2YRWA 3LXUX 2DT5A 1VE7A 3GRYA 5EJEA 3QKRB 2GF2A 4W7IA 4OJNA 2O3QA 4M0EA 1VMIA 5T8KC 1VSBA 1FSZA 4O2AF 1NOIA 3QY9A 4IJQA 3PLRA 5CYFA 3P9SA 1ZH2A 5IT4A 4E30A 2BKXA 3M4NA 1IZYA 2DH6A 3HJTA 4Q24A 4AG3A 1FRVA 5ULLA 2V8BA 4GOJA 1GN8A 4RVOA 3EIXA 4U6QA 1YSCA 1LDEA 1GCOA 4LRUA 4MW2A 3ZS9A 3EIUA 1IC6A 1O5OA 4DREA 3EEQA 2F2TA 2GM4A 4DXAA 5BOSB 1Q2UA 3VNBA 5C7YA 4LE0A 3QUQA 5CVVA 5AP9A 3WNVA 1THZA 5AM0A 4EFDA 1PT5A 4F72A 5SZJA 1VKOA 4ZYXA 3BCRA 5GAJA 4H18A 4OJYA 3UY4A 3MS2A 1JIUA 3L82B 3U9TA 3H8WA 4IAOA 2I3ZA 1BMTA 4FGZA 3X1DA 3TLGA 3CVYA 4WW0A 3TW8A 2YASA 2P6NA 2VJPA 3OZGA 1DHRA 3MUEA 4OCZA 4BNDB 1DBIA 1U0EA 1N5MA 4GLJA 2ZR9A 5EHNA 1PS8A 1ZN2A 1IL0A 1EQAA 2G17A 2HPAA 1H66A 3QF4A 4LUCA 4YRFA 2PSFA 4DSTA 9LDTA 3TZLA 2E5LB 1GQOA 4D92A 2I3AA 4FW9A 2VF8A 2ZR0A 4YRZA 3RASA 4DY4A 5DSTA 2H17A 5IJ0B 3LL7A 2VP2A 1RWWA 3OQ6A 2B4YA 2TMKA 1T4DA 3IGFA 5JTTA 1XNQB 2FPGA 5J47A 3NW9A 3I1FA 4Z9XA 3VZCA 1MAVA 2IW3A 5E1OA 4Q3OA 1U0NA 3IAAA 3RYFA 4EJ2A 1JFVA 4HAOA 2YUIA 2Q27A 4EVRA 5KNCH 3VBCA 3RFCA 3MB5A 2OCXA 4GKAA 2FSGA 3B5EA 2XZOA 4M89A 5J2TF 2JLZA 3H4TA 3WL7A 4BAGA 1ZDMA 4KQEA 5ALVA 4Z51A 1DAPA 5C2JB 2XTAA 4LHVA 5J3JA 4J1TA 3W9UA 3PFKA 2IYOA 3FRHA 4Q93A 3EC2A 3TRFA 4RCZA 3GRUA 3TECE 1T3SA 2XF2A 3M3HA 4MR8A 3A0RB 3LF2A 1BVRA 5BWBA 1UXGA 1V6CA 4ZT5A 5K7SA 4AAYA 4EG4A 1L1RA 1N2CE 1UEXC 1VCNA 4XQCA 2I2DA 2NQTA 4C22A 2AW3A 1Z0UA 3MD0A 1IN5A 3NGXA 4GZMA 5BVHB 2P9YA 3CLUC 1OGJA 3NORA 1J39A 4C0HA 5D3ZA 2HO5A 4G0ZA 1CUUA 4RVDA 4QYTA 4A0GA 3LPMA 1ELOA 1W2GA 1JI3A 3D8BA 2HA5A 3I6QA 4LISA 3RLFA 3CJRA 1S9HA 3CE9A 4I4IA 4REOA 5IHPA 3B38A 3STYA 3VOSA 3SE0A 4QTYA 4L07A 3KD3A 1KBQA 2BFFA 2H1RA 2N46A 3FFAA 3GJ4A 1GXSA 1AS3A 3V7NA 3WHKA 2VNKA 4QFCA 4DQVA 2BSXA 1H9BA 4ZRMA 4CTKA 3D5TA 4EEZA 2QY6A 4FMDF 5BVHA 1VKNA 1UAYA 2Z8YA 3DL2A 4DW8A 1RYBA 1J0AA 3N2YA 3NAGA 1Z5GA 3OX2A 4KQCA 2CKMA 4E5VA 1PFVA 4TMVA 2BFDA 2Y2VA 3JALA 5CU7A 4C4YA 3KOOA 4OLFA 1JHYA 2UKDA 3OKFA 5EJFA 5BV1A 3E3LA 3PC8C 4N1AA 1AT1A 2JBAA 5J2TA 4TN5A 1P73A 2Z04A 4L74A 3V2UA 3FFTA 2H4HA 4E31A 5ALDA 1E6WA 1PYDA 2XEXA 4NV0A 5BSKA 1U0HC 5IJ9B 2ERXA 4P7JA 3KQOA 4XUDA 4TV9F 5K8UA 4OQ4A 4YCDA 5LVAA 3NOXA 1Y6RA 3D3EA 1NXVA 2ZSAA 3G7SA 2GM5A 3KJNA 3NWJA 1DLIA 5K0NA 5KYWA 4FCVA 3UJAA 4WOKA 2QTCA 5LLDA 4DT1A 1A04A 2E1PA 1MQ8B 2DULA 2GB4A 1Y0BA 2VNAA 3M5DA 4JL5A 3TOCA 4B4WA 4NXNB 1KA9H 4L3VA 5C18A 3IQWA 3PF9A 1DTEA 4HMOA 4DBZA 5HE9A 4ZAXA 5P21A 3ROKA 4ZZ0A 5K6AC 1UOOA 1ZNWA 1NW9B 2Y99A 4FJ1A 1S3FA 4OIFA 3UJBA 3AL0C 3NXSA 4G4JA 4KODA 1R2QA 4D8VA 3UO8B 2O4CA 2GK4A 5C1PA 3VPHA 3AFHA 2Z3WA 2CGEA 2PRIA 1V8OA 3BREA 1TJNA 3E5HA 3INTA 2P2LA 3KE9A 3KYJB 2LW7A 3LUFA 4WCVA 5HMLA 1D6NA 2Q3DA 3QVGA 5CAEB 3R1IA 4ZP1A 2OGUA 3TQSA 1RYHA 5DXJA 1WXQA 4MPRA 4A5SA 3WGYA 2BC9A 4YRLA 4FGWA 1PZMA 2BM8A 4U7HA 2OFFA 3ZOZA 1FSSA 2C2GA 5NLLA 3DVAB 2Y92A 4RVGA 4EITA 4CEJA 2VF5X 4UEJA 3RDPA 3VGPA 1IB6A 2QXYA 3AHDA 5F4ZA 1RXYA 2R48A 3D4BA 1FDVA 1BJRE 1WBDA 3QVVA 4O4JF 1I4WA 2PXHA 4IVPA 4QT4A 3VC1A 1TQDA 4PYLA 4BFSA 3H9UA 2IK8A 3WL3A 4AJ9A 2D0OB 4K1LA 4BBZA 2GASA 3UWSA 5BRNA 1ZINA 4OGWA 4IUBS 1DINA 5CR9A 3UHAA 1Z6XA 1XP5A 3I3SR 2PMEA 3TQOA 1JA0A 2V03A 1R4NA 3IVXA 4PBSA 4UVHA 1QG4A 3R0VA 1MAWA 2NZVG 5HJEA 1Z0SA 1BEZA 1YCDA 1AUVA 2PZLA 3AWIA 5F7JA 2AFHA 1IOLA 4L4YA 4ZMSA 1Y6GA 4AO7A 4TTAA 2ZITA 1B41A 4CCAA 1GSAA 1J2UA 4KHZA 1NBMA 2D5IA 4I6GA 5EINA 1LTKA 2VDVE 4E94A 1TF5A 2HN9A 3SS8A 4CW7A 5KOYA 5SYNA 4M8SA 4ZV9A 1O3YA 3SF0A 3T94A 4C4XA 2Z3VA 4ZCQA 2A0KA 1U0BB 1KFCB 2SKEA 5HM8A 1IHOA 3G23A 2AJTA 3BXFA 1DLJA 2X2PA 4V39A 1HQCA 5JJKA 3S2SA 2QL7A 5AQ1A 3FSGA 1C30B 1K8RA 1NYTA 2OECA 4F93B 1MMFB 1Y8QB 4WXEA 3Q40A 4BNYA 3DUWA 1JTEA 1EDDA 4GX5A 1J8FA 3T5TA 4EEKA 4NQZA 4TVKA 2BHLA 3NKLA 2DVMA 2CUNA 3IQZA 4URFA 4EGAA 4ZV4A 2C07A 4ZOLF 3Q8KA 3DW1X 4JUDX 2MT9A 3N7TA 2IZ1A 3ZXUB 4D46A 4CEHA 3U49A 5F9MA 2O8VA 4LRQA 1BCRB 2NUAB 3WYBA 1UMCA 2O07A 3M1LA 4F38A 2CLSA 3A36A 2G7ZA 1IDN1 2BHTA 2DBZA 1C3VA 1UDXA 1A5BB 5FEMA 4GPAA 3U6BA 3PKZA 3PNSA 4ZYYA 3EVZA 2VZ9A 1EFCA 2VPPA 3EVAA 4KO1S 4ARVA 3GLUA 3KOXA 5IVKA 2HF9A 1ES9A 1VE9A 1GARA 2M6LA 5D1NA 1ZVMA 1ADFA 1ZD5A 3BICA 3VU3A 3OOSA 4MIOA 1E79D 3WDSA 4BC0A 3W5DA 2JG3A 1F0KA 4C0BA 3CVXA 4OI1A 3G8YA 3OWXA 1P5ZB 2QYTA 1KY2A 2J7PA 3COWA 3FNFA 4TKZA 5I47A 2CLDX 1QHHA 4DR5B 3TLBA 4LECA 2YWBA 4PC6A 1ZIYA 1JILA 1OLSA 2GRUA 2IXTA 1B14A 1K8QA 4UU1A 3ZGYA 4AD8A 5L6MB 3A9VA 1DAEA 1PQPA 2NWQA 2J0EA 2GERA 2XAAA 1GPLA 1E3SA 5F76A 2R6R1 3COZA 2I55A 5JZSA 2UVQA 3EA4A 1V8BA 4GOMD 5JAZA 1D6SA 2OCPA 3OQNA 3QE2A 1GU0A 1DRWA 2Q5EA 4O2BB 2DF8A 2PRZA 4GT1A 2WT4A 4TV8A 3NVAA 5IKEA 2C0PA 1CLUA 1FLDA 4J0HA 3KKNA 1Q95A 1R00A 2D0DA 2O6LA 2PX3A 2RI0A 1Z7GA 1FBTA 1ONNA 3DONA 3O2QB 4M9UA 4PZCA 1NW8A 3OZEA 1P45A 3GAZA 4Q1BA 4WJLA 2QT1A 4DS3A 5IMBA 4AIRA 2ESRA 5G0UA 1K6XA 1I6KA 1X3LA 4V0RA 1K7XB 1ZL0A 1OFTA 1VLQA 4FDVA 5G41A 3WLHA 1OV6A 3V80A 4BKOA 3NTLA 1LLFA 1J0DA 4LJAA 1A8IA 2X40A 5DCLA 5H80A 3IAS1 1TAGA 1WXFA 5D6OA 4WBNA 4NY1A 4X41A 4XQGA 1OB5A 1QYIA 3KUDA 4XFDA 1UBFA 2WUGA 1VIVA 2XOEA 3MXTA 1E6CA 1OY1A 3N28A 2RH5A 4NPCA 5HF6A 2Q2QA 4W5HA 1F3OA 3HUUA 4HB2A 1EQ2A 1DQPA 2CNNA 3CZRA 1J0BA 5B4UA 3KKPA 3HE3A 2R62A 4NOLA 2AJDA 2XIQA 4G67A 3IAS6 4N8SA 4BB9A 4EKIA 3OUUA 1XRRA 4DEXA 4YPFA 3R3ZA 4YXWD 3E23A 3FLAA 1K66A 3EMBA 1E2PA 4TWRA 5FWYA 1E64A 1GNPA 4NKRA 3Q7PA 4OEHA 5TV2A 1NV9A 4OK6A 3S8EA 4Y2GA 1J25A 1SXJE 1X0VA 4QDKA 4XIIA 4ZARA 4D80A 4FBMA 1TCUA 4TMWA 4CV2A 5KPJA 4EG0A 3GVIA 3QWFA 3C43A 4E88A 4X62B 1QE0A 1F12A 3BD9A 4C7JA 2H57A 2WBLC 3EIEA 4IXTA 1NM5C 4ML3A 1N2BA 3U19A 2H5EA 3D43A 2Q3MA 1NI5A 1X1EA 5TIIA 1SUPA 4CLXA 5GWXA 3F8TA 4MEJA 5C9ZA 2HT1A 1YB6A 2P3LA 1OAKA 3AT1A 3PQ3A 1NQAO 1LPMA 2E4WA 3B1VA 5A0TA 5DT9A 1USWA 1LEHA 3ASUA 3A6FA 3FCEA 4CPDA 4PYOA 2IOYA 3ED1A 3L40A 4GVLA 4OU4A 3VR1A 1QAMA 4CKEB 4D4GA 3QVUA 1GZUA 4FR0A 1RKBA 2GEBA 3OZAA 4J4HA 5JZMA 2B1IA 5CNMA 2O8BA 4RQAA 4Q01A 4CLOB 3M70A 3K70D 1J2EA 1Y3BE 4AKIA 4WNAA 1T15A 4L5JA 1FOEB 2H11A 4YDHB 4ZKEA 4JI6B 3W9YA 5L3SA 3UV7A 4MUMA 3FTQA 2C59A 3T7AA 2DG2A 5KNDA 4NEQA 5BQ5A 1A9RA 2VJMA 2TECE 1Q0UA 1XDDA 1RLUA 2Q5HA 5LWQA 5FORA 4DMCA 2HHCA 1GLNA 1JLKA 4GOLD 5TR9A 1AKVA 1EGQA 1GZ4A 4PY2A 3OEHD 4R3WA 3FVVA 1I6MA 4DLPA 3ZNOA 3DBHB 2QTGA 1P6XA 4IF6A 2YS6A 1S2MA 3NBAA 3S29A 5EWLB 1U8ZA 2H2GA 3SYNA 1A0OA 1F48A 1TECE 2PGLA 4MWEA 2BUAA 4ZZIA 5IFLA 2EBHX 2ZATA 1JB1A 3BXOA 2NYRA 4HDNB 2JBWA 1UOQA 3NIBA 4FJ0A 3NFRA 1OUMA 2P4HX 4JQOA 4A82A 1RE0A 3HCEA 5DTQA 3IQEA 2VTDA 1P5HA 5ICMA 4WZAE 1FMCA 3FPBA 1SKUA 4AZ3B 3IA7A 3CZ5A 1U0GA 1XZ8A 1YU9A 3QOXA 1ZAYA 3LT4A 1WUYA 4DFDA 4BQEA 1VFNA 2OO5C 1KNXA 3IAXA 5FJIA 5L8VA 1EWQA 1DO8A 2XVMA 4GF5A 4B33A 2PANA 2OD2A 2XTNA 2COUA 3HJGA 4CLRA 3KVOA 4N6OA 1MQSA 4M83A 5E3JA 3PGMA 5KDOA 1UKCA 3R2JA 2XA2A 3LHSA 4HZGA 1W19A 4IWYA 3SFVA 1MIHA 4E03A 1XD8A 2JA1A 2V7XA 2WVHA 5L7TA 1K92A 3V7FA 1GGEA 2XWPA 3EZ9A 5AQEA 1L1EA 4KQHA 5FCDA 2J0UA 5FB3A 4DSOA 3PTAA 1PKEA 1BMQA 2PQMA 3A7DA 5FPHA 5GM1A 1TB4A 1ZCFA 3TVTA 5JNLA 1I33A 2OFOA 1NFRA 2PKEA 4CLEA 3GGCA 4PXAA 1TVKA 3MGGA 4WKOA 3UXEA 3AUYA 3BTVA 5LA6A 1OYWA 1X9IA 4K46A 3KZVA 2ROQA 4OX9Y 3DT9A 1BMDA 4B73A 4JVOA 2E87A 2Y93A 4P7KA 4WH0A 3I6MA 1QHIA 4E1AA 1WVIA 4OSOA 1A77A 4QWMA 4TMKA 3O4RA 1GFIA 3JYLA 4MGZR 4NAVA 3X1MA 4DCMA 3BDAA 4E11A 2Z6AA 2C9ZA 2J3LA 4IW3B 3Q8MA 2IYZA 1E2MA 1K6IA 4NCKA 2P91A 3I61A 4W5JA 1E6UA 5K0JA 3CEMA 4JYCA 3GK3A 3U4AA 3PCTA 4ES6A 3VVCA 1ZMXA 4JQZA 1NWHA 2BL4A 3EDYA 1KAOA 3WYAA 4I50A 4NZZA 3CW8X 1J49A 3BE8A 1BCSB 1LSUA 3SPXA 2VA8A 4IDFA 5JAIA 3DPIA 2JFZA 4BQNA 1L7RA 1Q3TA 3GPIA 3V4PB 4PQFA 4PGFA 2PLWA 1CUGA 5EJ6A 1QHXA 2DJ5A 2G9VA 4V24A 3T3IA 4IVNA 3NPMA 3VYSB 3STTA 3IPAA 3R5XA 3T5GA 4EHKA 5I01A 4HT3B 5CCXA 2D2XA 1OCEA 2IZOA 2VYVD 1W36B 1ZMTA 2PDAA 4NJMA 5JCOC 4UE3S 5EZQA 4EJFA 2Q6IA 4QHYA 2GLTA 3SZGA 1H1LB 3BFKA 3A11A 3IAEA 3MOSA 4C78A 4QO8A 1PAUA 3RV4A 1UDRA 3G1TA 2YY6A 3CC8A 1NP7A 4FHEA 4YR7A 5JYCA 1SUCA 2JS7A 4NCIA 4L8GA 4LYEA 4US1R 1UK7A 3KT3A 3H1AA 2YNMD 1FF9A 4Q37A 5G4KA 5SY9A 3QXCA 4HEQA 4P7FA 2A67A 1JSRA 2OKGA 3V1YA 1IM8A 4YPVA 1MPXA 1EVEA 2PLFA 4QGSA 1JR3D 1BXRA 2BF4A 3LLVA 4FOTA 3ENVA 4XUCA 4MQBA 1W59A 2YWDA 1O96B 1ODLA 1XHEA 3WJAA 2Y1KA 1ISHA 4Q02A 4DLAA 2WHPA 4FDLA 4FI3C 2P9HA 1DBSA 2VPWA 4N6NA 1H2EA 3AP1A 3VU9A 4MA0A 2PUCA 2JHFA 1HLDA 4H1TA 5GZ1A 3AEZA 4DLVA 3A0UA 1P61B 5CVCA 1G98A 1QVZA 4NK4A 4F21A 721PA 1BGVA 1SG6A 2QTFA 4IIVA 3TX6A 3UCXA 1O9BA 1SU7A 1L7BA 2KLHA 3BULA 3KYIB 2FDXA 5SY4A 4DIBA 2F8SA 2BJHA 1C9DB 4TKUB 2AQ8A 1W6RA 2G80A 1N8TA 1EFRA 2H1IA 3OTHA 3PFNA 4I7EA 4ZC1A 2QBYA 4PPFA 3F9RA 3ZHYA 3KLOA 5HPYB 3L4JA 1KE1A 2QTAA 3CH5A 3K15A 2H9YA 4JOQA 3K94A 4BAUA 3AGPA 2DHQA 2RGXA 3WFJA 3QVXA 1Z3CA 1CUEA 2HCJB 3B7GA 3FGOA 5LR6A 4GHWA 3U3RA 2GKOA 3G9ZA 4KU4A 2DKNA 4LZJA 5JS6A 1EUCB 4LHSA 4RYDA 4HTAA 2WHRA 1RM0A 4BKMA 2KQUA 2ZJ5A 3JVDA 3B7WA 3BIFA 3CHYA 3NFYA 4M0CA 3X2SA 3CKKA 3A32A 4RTRA 1CUZA 2GK7A 3C6BA 4CV1A 1YB2A 2ODEA 2RB4A 3A06A 1RHRA 2BGJA 4WJKB 1K86A 5C8ZA 5HJ7A 3T1OA 2CYBA 3KUKA 4TLAA 4AURA 3PTZA 1M1UA 1NT4A 4ZOLB 2N42A 6PFKA 5DGHA 1S2GA 4W8GA 3OEWA 2PWBA 3W0LB 3M49A 3QWHA 2R00C 1U1GA 4JQSA 1II8B 3VPCA 4MITA 4JI4B 1ZGGA 1QIJA 4RQBA 2XVYA 2R4QA 1KAGA 2KW5A 3C1OA 3HKDB 5FAKA 2R1VA 3DDCA 6ADHA 4YS6A 2PVCA 3KQQA 3TL3A 4C2AA 2HPVA 3F3SA 1NUSA 2FRVA 5ALXA 2GX6A 3T4XA 1X7XA 3QX9A 4COOA 3IP1A 3JD2A 1W5FA 4HEA6 1SEVA 1UIRA 1EP3B 2EKDA 5I9SA 3DZ8A 4JSRA 2BFBA 2H00A 4HYEA 5ALHA 3H8SA 1GAWA 4US2R 1KPIA 4RSRA 1LB1B 5FI1B 5LQUA 5IH3A 1BDJA 1LTHR 5KKCA 4HXYA 3WXMA 3ZV3A 3F1KA 2P1ZA 4LRWA 3ON5A 5FOVA 3SHVA 2ZAYA 3A6KA 4F5YA 1QYRA 2WTEA 2AMLA 4RD4A 4DQUA 3HPRA 1I2MA 1YZFA 3Q6IA 1F51E 4JHLA 2GUGA 1DFIA 4DL9A 3DEIA 5ECDA 5ER6A 1IPEA 4WDRA 4V0SA 5CXUA 3ZBQA 1GUAA 3DMNA 3G8BA 5IXJA 3IJRA 2WOOA 4JLVA 4E5KA 5BYBA 3IE1A 4YRCA 3CNNA 2VF4X 4TYYA 3RTAA 2EJWA 1LDYA 4Z3DA 1Q15A 3E53A 3ZWPA 5ENVA 5T7BA 1KO5A 1WZCA 3U48A 3DFZA 1SXJA 1Z25A 1NFFA 1Z7WA 2PXCA 2VOEA 4Q9HA 1NDUA 4Z0TA 3THOA 5JC8A 5E4JA 2QPTA 3DF7A 3EIWA 2AZDA 4US0R 1R9GA 4G8BA 4EYGA 2QF7A 2WABA 3DE1X 5DBEX 1VPTA 2XJ9A 5JJBA 1PT6A 4LV5B 1N9GB 4L95C 4PX5A 2H1FA 3BMNB 3HKCA 3W78A 2XKKA 3MGBA 3L8GA 2XKJE 3BMOB 4FSHA 1W6UA 3HU2A 3LOUA 5BVGB 2JLRA 2W4IA 3QYJA 1JFFA 2X6TA 2YHUA 4LI0A 3ONNA 1IXRC 1K5GA 3JZAA 2FQXA 3OU6A 2FRDA 2NOAA 4JLUA 3FKJA 2W6JA 2UAGA 4OA5A 3AEYA 2R8EA 3IOYA 2EYUA 4O5OA 1UFKA 4TXJA 4B4DA 5DNCA 2P6RA 5KC8A 1HDCA 5FQOA 4PCLA 4WY2A 3ITKA 2OPBA 4M1YA 4ZKDA 2O7RA 2CXNA 2FLWA 4WY5A 5AW6A 3NG1A 2Y1DA 3DOFA 4XH9B 3PNKA 4O2AB 4I81A 4NH0A 1OHHD 5LKAA 4BFUA 4KBFA 1NI4B 4WGGA 1P6UA 1YCFA 3K0HA 3HVJA 4CCYB 2IYRA 1CP3A 3IKVA 3I9FA 1T8RA 1MP0A 2VHZA 2GRAA 3EF0A 3PUJA 2GAAA 3AL3A 4I4TB 3AF2A 4JWTA 1MEJA 3KKLA 1JTFA 1Q7BA 2NN3C 4YXWA 1HL3A 5FFMA 4EVSA 1CS4C 1ULHA 2H8GA 2R8PA 2ZS8A 1SHZA 4GLFA 1YHYA 2O50A 2ZBVA 4NARA 3WIVA 4CDGA 2YV4A 4XR4A 4BE9A 3IBTA 1V3QE 2CK3D 2EZ4A 3HZHA 1J21A 4JCOA 3K9LA 4BNWA 1JBKA 1ZK1A 4BN5A 3HK2A 4IUCS 2R1VB 3IIEA 3VNUA 2QROA 4BPBA 3P4YA 2O8EA 1U2GC 3AYZB 3RC2A 3E5MA 1V48A 2CL6X 3T52A 4LF5B 1N3YA 4OBXA 1ZK2A 3A6LA 2GNAA 1CY7A 3WBJA 2NV2B 3NTUA 2OUKA 4W9MC 3FNQA 2PTHA 2QMUA 4V2IA 4KVAA 5DK6A 4AL4A 3KM0A 3GFFA 5H70A 5SZIA 3P9YA 1TJ3A 5AVVA 2C5HA 1TW3A 1QF6A 1FP4A 4ZN6A 3KSRA 2FFAA 4ZDIA 4EB8A 4FDUA 4XQ0A 3EAGA 4JC5A 1MZPA 4GBMA 5HRUA 1SN7A 2FUCA 4DCSA 1BYIA 1AS2A 2W6IA 4R5HA 3DCIA 3KCNA 1VLHA 3TXYA 5AI8A 1MABA 1W34A 3C45A 1H0KA 3T9AA 4YRMA 2IPAB 1MN6A 2BCEA 1BSVA 1OWPA 3M9LA 2W5UA 1C0EA 5JRDS 3KWLA 4TVBA 4RDHA 4LOIA 2FTKE 4B6FA 4DA0A 3PXCX 1D1QA 3NTXA 2FRXA 5AHXA 3HCCA 4UPVA 4B4KA 2OG2A 5ARCA 5E1DA 4YROA 5L9AA 4Z5XA 4MIKA 4CLDA 3D6NB 1GG2A 5D84A 3V8EA 1O6ZA 4U7PB 3EZGA 2ADOA 4JNKA 5JS2A 4XA8A 4L6AA 4AS3A 1ZUD1 3BVPA 3CIFA 1RXWA 5FTLA 4OGFA 1J2YA 1E92A 2D3TA 1K3FA 3TZKA 2F6RA 1ZIXA 2ZBQA 1L4BA 1J23A 2Q4DA 1X8XA 1PEAA 2I3DA 3G2HA 4LSGA 4GUDA 5J23A 2AE1A 2DFPA 3L0ZA 4MO2A 4DMRA 4B43A 3H9JA 1WW2A 3IDSA 4CCSA 3AHGA 3R4VA 3NVKI 3BJZA 1ILWA 4DQKA 5CCEA 4DKXA 4INJA 2HPHA 3M5WA 5TQ0B 3QG1A 4CIXA 3A6EA 1A88A 2NTNA 4GNKA 4KOAA 4CETA 3QJ5A 2EFJA 2VH5R 4Z8XA 3BUSA 5EIOA 1NRWA 2JFQA 4Z0HO 1A9ZA 1UWVA 4O2AA 1ZGBA 4DKJA 1EINA 3OQIA 3LCMA 1KFKB 1SMKA 2VH2A 3C6XA 3COSA 1ZLXA 3EHEA 2W6OA 3V7YA 1FBNA 3M89A 1M66A 1YVRA 1T24A 4YB8A 1PNVA 3EAQA 4HPXB 3W5HA 2HA4A 1QDEA 1S4QA 1TDJA 3BJMA 4JI1B 4DR1B 2FEKA 3PHCA 3TUJC 4GFDA 1ZX1A 5IJAA 1HT3A 3VR6A 4ZA2A 3Q72A 5EIEA 2PZAA 2C83A 3CE6A 4Y2HA 3Q9NA 4LRYA 4HB4A 1AMUA 4IUDS 4XYBA 5CM9C 3Q15C 1PIWA 1GNLA 1FP4B 4AJ4A 3DE5X 3SQOA 2QR5A 4DJEC 1J00A 5HDBB 1BMFD 1FJXA 2VJAA 3TRIA 3T3OA 2ZWAA 1GTG1 2JLBA 3IAM6 4I1SA 3HGQA 4GE3A 1LX6A 3PA6A 3D6VA 3RUPA 4DQ0A 2WILA 1KQ3A 4MVJE 5E6RA 4GQIA 4BNVA 1IXKA 3ZD7A 1GTZA 4M76B 1W44A 2RGGA 5T3YA 1WCWA 2H4WA 2MOKA 4M2LA 1GYPA 4ZVUA 1PL7A 2VHJA 5AW1A 2C5BA 1Z7BA 4BAZA 3K0FA 2O9JA 2PX5A 4YCCA 1D2CA 2QMOA 3IUEA 1P2GA 4YJDA 4YAEA 1G8PA 3JSAA 1RU3A 3BHNA 2NUPA 1E9DA 1E2HA 1YH3A 2YJ3A 5IBPA 1V3VA 3KZOA 1LI7A 1KBOA 1A8SA 2PZBA 3GYBA 4I19A 1L7DA 3GMTA 4KGZA 5EI5A 2H1WA 3B9BA 1KO7A 1VHQA 1E5TA 1G1AA 4L02A 1GKKA 1XMVA 3WK7A 3JAWB 4PEVA 3A10A 3EZ2A 2C61A 2UZAA 1TUBB 2PKQP 2BMFA 1V95A 1KEVA 4IQGA 4RIIA 3V4SA 4I2VA 5EIFA 5GVRA 2C20A 4CMGA 2X0NA 4AKTA 3ZR4B 2X1VA 2FY8A 3L7KA 1W52X 4M37A 1IOWA 3EIFA 5AXBA 2C2YA 4EZEA 1SQ5A 5HBGA 4KACA 5J59A 4R1UA 1OSNA 3VHQA 4U7JA 2PBLA 1F7UA 3HKDA 5TQJA 2RC6A 1ML3A 2BEUB 3I2KA 4ESOA 1HWYA 2CJYA 2X5KO 5AW9A 3QFSA 5JI2E 4YHHB 3OIFA 4P83A 1WXWA 5EJ2A 3SHWA 3V00A 1W581 2BT4A 2R4UA 3ZX4A 4KYVA 1VG1A 3QELB 1JG6A 4ZAWA 3W9SA 3ZPXA 2CXQA 1LDBA 4OGLA 5IBRA 4R9VA 2RGDA 1NXTA 4KXFB 3OT1A 3E81A 1W8DA 3L04A 1R27A 1YBMA 1KS2A 1ZOIA 1NVFA 5IEJA 5CX1B 2IL1A 3IBFA 5AW5A 2WVGA 1P4GA 3TMYA 1RYNA 3HU5A 3JTMA 3HRHA 2G28A 4H0NA 1A4XA 3RKUA 3HRKA 1W25A 2CHVA 3I8XA 3QNUA 3BX1A 3KUXA 1VXRA 1DJMA 2YC2C 4FP9A 2AQHA 5KDLA 5C5DA 4YI5A 3CH6A 1DRUA 5TNXA 3V8MA 2OZLB 2XX3A 1TZ2A 3H7IA 3V8RA 4HAUA 5JHHB 2CHFA 3NC4A 2Q5IA 3VPAA 1YJBA 2ZWMA 1Y89A 3NTVA 2ISSD 1KJNA 1AGYA 4EABA 1OFGA 1R0LA 2HFJA 2R5WA 1XCLA 2F3TA 2SICE 4PLCA 1V9SA 1XWWA 2JJ8A 3CKLA 5ES3A 3FRIA 4URZR 2PUJA 3BGSA 2XSZD 4KIUA 4P86A 1MNAA 2MJLA 1NKVA 3RRZA 1DKOA 3REQB 3ABSB 3HUFA 5E6RB 4MDYA 3S2UA 1PUJA 1B1CA 1PVOA 4MMYB 4MI1A 5HIMA 4HL6A 4R2JA 4P4SB 5BMVA 1XZFA 1U9IA 2JIOA 1VI2A 1PQWA 3FVWA 4WY8A 2AOVA 3LLSA 4AXBA 4ETNA 2QZJA 4TZ6A 4TTTS 5LXTA 2YR0A 5FULA 1H4VB 1HQKA 4ZJPA 4I4CA 1SUBA 5G1PA 3AZQA 3IPRA 5JROA 1ZRHA 2ZULA 4FN5A 3VDMA 2GEUA 4PNPA 2NZWA 1VRWA 3IQIX 1F4PA 2ZJ6A 3QITA 2HCBA 4RF3A 3W79A 4RQUA 5KYGA 3FHCB 5FWYB 2A0FA 1OLOA 1Q0LA 1E59A 1HFKA 1J0EA 2CLLB 3RVBA 3V7UA 2XH8A 4HDQB 5F1KA 4JL8A 1MC4A 2K2WA 3SSAA 4IJUA 3DAHA 2V7QA 3IVCA 4U2DA 3P9IA 2GBGA 1PWYE 3O38A 1Z39A 1UJNA 1IHXA 1KIFA 1VJ5A 3GUUA 3N8GA 4X84A 2WSYB 4EO4A 4ZYLA 821PA 4LXXA 4TRNA 4YFVA 2VTBA 4RORA 3PUXA 1WTAA 4PF1A 1N2OA 1E62A 4MLCA 3NVDA 3V8BA 4EHAA 3UIEA 2P11A 4EKEA 2PM8A 2UYYA 1W88B 3EGCA 2WKRA 3E7WA 4G1FA 4GI5A 4ZXFA 1TYCA 3CLSD 5LDHA 2MCFA 4JBNA 4OQPA 1PJLA 3H5NA 2RHLA 2XOKA 1MG5A 1C4KA 3EG9A 3L07A 3BAFA 2O5EA 3IT2A 4LQ4A 3FCAA 3PZBA 4EYEA 5CD1A 2WHEA 4FPXA 2HA2A 3RYHB 2O5CA 4QUKA 1ADCA 5AK3A 1U2GA 3JQAA 5K8CA 2L0XA 5ALMA 1YFJA