4I9HA

Crystal structure of rabbit ldha in complex with ap28669
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
331
structure length
325
Chain Sequence
AALKDQLIHNLLKEEHVPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARQLNLVQRNVNIFKFIIPNVVKYSPHCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWILGEHGDSSVPVWSGMNVAGVSLKTLHPELGTDADKEQWKQVHKQVVDSAYEVIKLKGYTTWAIGLSVADLAESIMKNLRRVHPISTMLKGLYGIKEDVFLSVPCVLGQNGISDVVKVTLTSEEEAHLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment growing and linking lead to novel nanomolar lactate dehydrogenase inhibitors.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords L-lactate dehydrogenase A chain
total genus 106
structure length 325
sequence length 331
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4i9hA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4i9hA02
4J4BA 4N54A 5A5FA 2QW8A 3NJ4A 4NJMA 1GL3A 4A10A 1YGYA 3Q6IA 4EUFA 1LLCA 1PZHA 4YWJA 2HU2A 1GPJA 3SJUA 4ONEA 2VWPA 3BHIA 1O89A 3TF5A 3TL2A 4AJKA 2O3UA 3MEQA 3PLRA 2OZPA 2ZCVA 1IPFA 2X9VA 1A27A 4B7XA 4NFHA 1C0LA 3RFXA 4CUZA 3NGLA 3WLEA 4R16A 2PKQP 2VYVD 2AEMA 4J4HA 4CL8A 2O7QA 1C3VA 2CDCA 2BGKA 3LC1O 4JP2A 1QYWA 1E6WA 4BIIA 5JSFA 2BELA 3JQDA 1DIAA 2HKIA 5IAAA 1PZGA 4FFPA 3OJOA 1B14A 1IYZA 3QVOA 4AICA 1A4UA 4R5MA 5B37A 2X5JO 1BWSA 4XEHA 1LXCA 4IBOA 1GEGA 3GQVA 4I5FA 4PZEA 3CE6A 2W8ZA 5A9TA 3NDJA 4U0KA 4E33A 4HNGA 4KQWA 2PA3A 4RQUA 3PHHA 5L4SA 4RPLA 3ZDFA 2VYNA 3WNVA 5BSFA 5F21A 1XG5A 1ISIA 2SCUA 4IDGA 5TIIA 2CUKA 3PFFA 2Y1EA 2Y1GA 3OIFA 1EFKA 2DFDA 3ZU2A 3WSVA 2FY8A 2QYSA 2UUPA 2V65A 1PS9A 2EGHA 3OJLA 4E3ZA 4EUHA 4DYVA 4FFRA 3O03A 4MIEA 4YAGA 3KYDB 2HSDA 2YZ7A 1CIVA 4YVFA 2OXIA 3SBOA 3QY9A 5KJ1A 1FDTA 2VRBA 4FJ1A 1X1EA 3GHYA 1X7DA 5THQA 5LCXA 3ZV4A 1I3KA 2VHVA 2PNFA 2J3IA 3ZV3A 1NHWA 3GT0A 3PHLA 5I7EA 4ZRMA 5HTOA 3H2SA 5B12A 1HSZA 4GQAA 4E6PA 4J2HA 2G0TA 1U3UA 1DDOA 1O94A 1I3NA 2EXXA 4IDCA 1MB4A 1R0SA 1XLTA 3VZPA 1WMBA 3Q9NA 4TVOA 4ZHSA 3NUGA 2X6TA 3RKUA 5T67A 4CV3A 4CM9A 3WLFA 5HBRA 1U7TA 3LC7O 4QEDA 4WGGA 3DDNA 4IS3A 1PR9A 1KVQA 3KLPX 1ZNQO 1E3WA 3TZKA 3I83A 4KDFA 3OICA 1ZCJA 1DFGA 4PG7A 3UOGA 2AXQA 3I6QA 1N5DA 2JAPA 4RPGA 2WDZA 3LSYA 2EW2A 4XB1A 4Q3AA 3D7LA 4HBGA 4B4OA 4YRDA 4FPXA 4YQYA 4AJNA 5ENVA 4YAKA 1C1DB 1XSEA 5HS4A 1I33A 3C7DB 2HMTA 3WTCA 4IJUA 2GZ2A 2BFAA 4CLRA 1EDOA 1PQUA 2X23A 1NTOA 4R41A 2DTEA 4IZIA 1GR0A 1YH3A 4XWYA 4WLOA 3FBTA 4OHUA 4ALLA 3PJFA 3E9NA 2VUUA 3IP3A 3WOHA 1N2SA 4MO2A 3S8MA 4XYGA 3HN7A 4YJDA 4A73A 3QE3A 4XQCA 7ADHA 1Z45A 3ITDA 4XIYA 2O3QA 1DB3A 2DM6A 3DAFA 1LI4A 1GUYA 3ZNOA 4J9VA 5EIOA 2G1UA 1XQ6A 2UYYA 2GNAA 2NU7A 4IIVA 4IM7A 4BKPA 3JQEA 2X9GA 2VQ3A 2CF6A 1PGPA 3ASUA 3QRWA 4TKMA 2QHXA 5I7VA 4BNTA 1TT7A 5L9AA 4XGNA 4JJGA 1JVSA 4RVUA 1T4BA 4TRMA 1P45A 4J0FA 3AOEA 4U8GA 3WGQA 4J6FA 4Y98A 1NQOA 3TSCA 2Y0DA 1T1SA 3B1JA 1N9GB 1ISMA 2C29D 3ULKA 3ABIA 3ZZNA 3JQ7A 1BVRA 4BOYA 3KV3O 3FWZA 2D3TA 4DBVO 5EERA 1EE9A 1U8FO 3GVHA 1GYPA 3BHMA 2EP7A 5ILOA 1EBUA 1PSDA 3I9MA 4WLUA 3PVZA 3NYWA 1EBFA 1ZW1A 1BGVA 3TJRA 4FJ2A 2YHIB 1FDSA 4J1TA 4UVIA 1S7CA 4WCFA 1IOLA 5CG2A 3AFMA 1F8GA 4DMLA 4IQ0A 4IXTA 1IULA 1TLTA 4WPGA 3VPGA 2G5CA 5DNAA 5A3JA 3FI9A 4GWKA 4AJJA 4N5MA 3VVCA 1GZ4A 4ND4A 4QUKA 1LX6A 3GVXA 3D64A 4LCEA 5CHEA 5CG1A 3QW2A 3L6DA 3QWIA 1DBVO 4MVJD 1GZ6A 1V6AA 5ENDA 2B0JA 3ZNNA 4BHTA 3JD2A 4R1UA 2Y0CA 3H3JA 2LDBA 3T7EA 4YRAA 3IDSA 4IJKA 2J6IA 1W8DA 4MVJG 3NEPX 3ZWBA 3JQFA 4BNYA 1Z7EA 4OSPA 3VZQA 1GQ2A 4NK5A 5JCJA 1J6UA 5CP8A 1BG6A 4ZJUA 3ENKA 2CFCA 3PEFA 4LW8A 3PZBA 4Q9NA 4O1MA 2CVZA 1YDWA 1HTBA 1AHHA 3LU1A 4GMGA 3KXDA 5JCJD 4DQVA 3PIIA 5JDCA 3U5TA 3JQGB 3WGGA 2QRLA 2DBVO 3OQBA 1BDBA 4GGPA 3VDQA 4BNKA 2G76A 4OJNA 4EJ0A 1BDMA 1GDHA 1LQTA 3KHUA 1LLDA 4B7CA 1Y81A 1AE1A 1A9ZA 1BXGA 2J3HA 2XAAA 5ITWA 4Y6PA 2VTDA 1EVZA 5IDYA 3UCEA 4OM8A 1LDYA 1P1FA 4BVAA 2Q2WA 4IQ8A 4NZ9A 2IE0A 4PLHA 4YB8A 3SEFA 1MC4A 1V8BA 4RORA 3KTDA 3OJ0A 4XR4A 1VI2A 5JE8A 1B7GO 5T6BA 1OFGA 1IB6A 3WYEA 4DQXA 4AVYA 3HNPA 4EJ6A 4R54A 2JHGA 3TFQA 3L77A 1Y7TA 3DEYX 1O0SA 3ENNA 3NJ8A 4R01A 4M1QA 3U4IA 1LRKA 4KZPA 4B8ZA 3QWHA 1YOVA 5C7OO 4BV8A 4PLWA 1OBFO 3ONDA 4CQLB 1FJHA 4I9NA 5L4LA 3ZN2A 4CQMB 4DTIA 3MOIA 2O3SA 2OGUA 2H6EA 4NI5A 2V7PA 2XXJA 5BQFA 1KVUA 1VKOA 4KUHA 1ZMOA 1I3LA 3L4BC 4GKBA 5CPFA 3RBXA 5JLAA 3H9EO 4BNUA 2FR8A 5F1OA 2B36A 3RU7A 1SO8A 1QYCA 4PVCA 5J23A 1GCUA 4WOJA 3GN2A 1GV0A 2BGLA 3R6DA 3C1TA 1K2WA 3AK4A 4R9RA 1HEUA 1E7MA 4ITUA 4MIOA 5KVQA 4CMIA 1E92A 1DIBA 1ISJA 1MC5A 4RGBA 4J3FA 1JKJA 3FBGA 4PLZA 3ZWCA 1H6BA 4B7UA 3DBVO 5A4DA 2HMSA 3CXRA 4K6FA 1HETA 1P0FA 1NHGA 1KVTA 2C0CA 3DFUA 2B83A 1A71A 4HXYA 3E5RA 3LYLA 2AEJA 4A0SA 2B4TO 2X5KO 3KRTA 1WP4A 2HRZA 1P1KA 4FDAA 3VOSA 5LC1A 4B4WA 1DOHA 3CKYA 2FR1A 2EKLA 4UVEA 5IN5A 3U0BA 1LTHR 5T8KC 1DJQA 2HJRA 4IZHA 3PK0A 1U3WA 3RUHA 4MVJP 1AGNA 3EAGA 5EL0A 1OOEA 2GN9A 3V1TC 1TI7A 4RVHA 4BO0A 3D4OA 4OXNA 5DCYA 2Y1OA 2C5AA 3R0IA 1DLJA 3GPIA 5JDCC 3SC6A 4ZGWA 2GLXA 1GD1O 3DBLB 3Q2IA 3CZMA 2NU6A 1AHIA 4JJFA 4HWKA 4YTEA 4AJHA 2XOXA 5KVCA 3NRCA 1GQQA 4WLVA 4ZQBA 2EKPA 2W4QA 4CUJA 3UN1A 4G5HA 4L4SA 1HDRA 2R00A 1IL0A 1ZEMA 4OOEA 1ENYA 3RQSA 4NHEA 2WSBA 1ADGA 1KVRA 3TFOA 4OXYA 2C5EA 2TMDA 3OH8A 5CAEA 3P7MA 1OMOA 3PYLA 3VZSA 3W1VA 2DU8A 4TRRA 5JW6A 1JKFA 2AEFA 2QRKA 2QYTA 3GGOA 3LC2O 1IUKA 3JQAB 3RJ9A 3JQCA 3V2UA 3JTMA 3I4FA 4PLPA 2PTGA 3OETA 4NFYA 4J16A 1E7QA 3DOOA 3BAZA 3WDSA 1MUUA 1YL7A 1DC5A 3ZWPA 2NADA 1X0XA 4R9SA 1UXKA 1VE9A 4WK6A 4D3SA 1LDEA 1T2FA 4RV9A 3JQBC 1PWZA 2QX7A 5TNXA 3ROKA 3Q2KA 1LU9A 4FFMA 2VRCD 1LDNA 2EJVA 3G0OA 3I4CA 1NPDA 5T64A 3Q0EA 5L3ZA 3QLJA 2X58A 4YJHA 5DULA 3DMTC 5KIAA 1PJLA 1GU7A 3LT0A 4FIZA 4K6CA 1KC1A 4AL4A 3JYNA 4J9UE 3PHIA 1O6ZA 3GEDA 2I6TA 2J8ZA 3T7CA 4DLAA 4DC1A 3JQ6A 4WCFB 1JDJA 3AM3A 3FCOA 4J49A 3JQ7B 4G2NA 4LSWA 1I2CA 1R4NB 3K9QO 2HK7A 3DC2A 4I8XA 4RVFA 1R4NA 3WSWA 1X1TA 1BW9A 2BHLA 4PG5A 4RDHA 1UR5A 4GX0A 1LSSA 4BO8A 4E5PA 3C7CB 3HJAA 2JD0A 3WTBA 5L7TA 3FTNA 5TQVA 3N74A 3WQQA 1ONPA 2O50A 4L75A 2B37A 3D3WA 3ZW9A 2JD2A 3ROMA 4WLEA 1K89A 4R1SA 5TJ9A 3RAJA 1ZFNA 1XGKA 3GUCA 4KDEA 1WZIA 4QT0A 3NT4A 5JNLA 4AFNA 3OFSA 2EWMA 2PZKA 4ZRNA 1EMDA 2BI7A 2D2IA 2OBNA 2AQHA 3CUKA 3OF2A 3GHHA 3JD3A 2WM3A 2NVBA 4Y9DA 2DBRA 3RUFA 1S6YA 2Y05A 1PU2A 1JVBA 3VDRA 2YFQA 5TX7A 2WWRA 4DL9A 4FOOA 4CV0A 1HYGA 1EE2A 3QWBA 3MWDB 3ZU5A 5HRUA 3G1UA 4IXWA 1XWFA 2FPPA 3KEOA 3VH2A 1YJ8A 2DBZA 3S55A 4O5OA 1C1XB 3QIVA 1NP3A 3ONFA 3ZWOA 2P68A 2HAEA 4E0BA 4ID9A 4JP3A 3MOGA 4L76A 1IZ0A 1P33A 4U7WA 3VTFA 4UUMA 4GX1A 4Z0PA 1WZEA 4J7CA 1P1HA 4B8WA 2VZ9A 2C07A 1SB8A 3K30A 1P0CA 1J49A 4BGIA 3ASVA 3G3EA 5CDYA 2FZEA 1ONNA 4EITA 4MKRA 3TZCA 4TRJA 4M87A 4PLCA 3ZU4A 4O63O 2HDHA 3WB9A 2HJSA 3MJVA 3GEMA 3I9KA 3ZW8A 1PZFA 1QLHA 3WYCA 1Z75A 3SLGA 3WGZA 3W4JA 3DL2A 4M8SA 1NFRA 3WBBA 2NLOA 5IDQA 2HCTA 4MVJF 4MKZA 2DQ4A 4URFA 1VL8A 3R3JA 2NSDA 4FCCA 2E4AA 1GFSA 4FGSA 3STHA 3Q1LA 3QP9A 3UH1A 3WWZA 4ALKA 4E5YA 2AE2A 3GUYA 3RASA 4XIJA 1F14A 1TXGA 3V1YA 4E4YA 5CDUA 4EJMA 3HQ4O 4EI2A 5AYVA 3PWSA 3IAHA 1X15A 3S2IA 3UAGA 4XRRA 1DLIA 2FWMX 4QFCA 1QV6A 4RQTA 2NTJA 3HDHA 4YA6A 4YJGB 3AU9A 5CDSA 4OOFA 5F1KA 3CH6A 1YJQA 2X0IA 4IJWA 1NR1A 4BQPA 4CR7A 3EK2A 2VT3A 5AOVA 3DAGA 4D79A 1P74A 2X0RA 6LDHA 4IDFA 1WWKA 4U6QA 3KYCB 3UXYA 5TF4A 4ESOA 2PGDA 4WEQA 3FRJA 2DVMA 3H9QA 4RJTA 2H9IA 2AA3A 4BNIA 3B1FA 2O4UX 4IGEA 4L74A 4OL9A 1M76A 4LVUA 4GH5A 1W0CA 3GG2A 4BQRA 4ALMA 1U9JA 4HFRA 3L4SO 1SEPA 3BMNA 3L0DA 2DTDA 1BHSA 3RC9A 1T2AA 1UDCA 4UEKA 5A1TA 1NXQA 1HE5A 3I9LA 4ZQGA 3E03A 2DFVA 1O8CA 1QR6A 1Z82A 4OIMA 3D4NA 4GWGA 3T4EA 3B70A 1DJNA 2RIRA 3MTGA 4CL3A 5K6AA 4XDYA 4CPDA 4DREA 1Y9AA 5C7IO 2Q49A 2R6JA 1PTJA 1ZEJA 1NQ5A 1YB4A 2XXBA 4QXMA 5DF1A 4QFDA 4DLLA 1BRMA 3ZWVA 3JQGA 1VJ1A 2D5CA 5F3RA 1XQ1A 1Y6JA 3G79A 4ZU3A 1XU9A 5T8KA 5B4UA 1GY8A 1R6DA 3JCZA 4U0JA 4CQLA 1NBOA 1HL3A 2OHXA 1X7GA 4CM4A 1T2CA 2Z5LA 1WMAA 1JAXA 3OECA 4GBJA 1X0VA 4RVGA 4A5OA 1JW9B 3BTOA 4MOWA 2VOEA 1EK6A 1K0UA 3IJPA 3ZH2A 2YDXA 1RJWA 1VL0A 1U2DA 1EQ2A 1PZEA 4UREA 3X2FA 1TVEA 3KBOA 5A02A 2A94A 4XGIA 5U1PA 1NR7A 3VH4A 1VC2A 4OXKA 1JA9A 2GASA 2Q1SA 2X1HA 4LN1A 3JQBA 3MJSA 1N92A 1PJ4A 1OAAA 5A9SB 5IXSA 2EEZA 5C7LO 2YYYA 4FFLA 1T1RA 4PG8A 5AXBA 3TQHA 5JYEA 4TZKA 2Q1WA 3HSKA 4KTTE 4PGFA 2JCVA 3TZ6A 3EVTA 3PQEA 4EDFA 2O48X 4R1NA 3BMOB 3GVPA 2C2YA 1XIVA 3QSGA 3UUWA 2BH9A 2WD8A 2X5OA 1Y8RA 2JFHA 4UEOA 1HE2A 1WDKA 2J3KA 4JIGA 4Z9XA 5EINA 4BO2A 2NM0A 4MVJI 1H6DA 3D4PA 1DPGA 1AN9A 4J91A 1UH5A 4J1QA 4CM1A 4OQYA 3GDFA 4A27A 4ALIA 2I66A 4M86A 4E21A 3OA0A 2ZB3A 4CM6A 4AJ4A 2GZ1A 3S1LA 3O8QB 3TNLA 4WE3A 1KEWA 1ZSNA 1HDYA 1NPYA 2EW8A 3HFSA 4RPHA 2VN8A 2EF1A 2D59A 4HX5A 4LSMA 4B79A 1U4OA 1EUCA 4A03A 3F3SA 5DOVA 3IS3A 1G0NA 2RBEA 3NKLA 3HHPA 5G0SA 3JYLA 2GF2A 1DC4A 2V6BA 2YV2A 3ANLA 4GL4A 4HFMA 4KWHA 3ST7A 1E77A 2VWQA 1MXHA 1IHXA 1LJ8A 3E9QA 4NDNE 2F00A 4J1SA 3U4HA 3BMQA 4UAGA 5EQDA 1UJMA 1J5PA 2Z95A 2EIHA 3PFWO 1PR3A 3P2OA 4BUCA 3W4KA 1KEVA 2QG4A 4BO9A 3DZFA 4W6ZA 3AI2A 4W7HA 4Z3KA 4BMSA 4DBZA 4NG5A 1UAGA 3P5SA 4E2YA 4QO8A 4NBRA 4RCVA 4R4JA 4CMBA 4FFOA 4W4TA 2I3GA 2JD1A 4Q3CA 1ZXLA 4CQMA 1ML3A 3ZU3A 1Q7GA 4EBFA 2VNAA 1OZAA 1DXYA 4XDZA 3D1LA 3OIDA 4XYLA 4WCDA 4Z0HO 1UP4A 3FNHA 2GZ3A 3ORFA 2E37A 2IYOA 2IZ1A 2BFPA 4CM8B 1D3AA 2WEKA 1YB1A 3VH3A 4O6VA 1AUPA 3F1LA 1NWCA 4FJ0A 2JCYA 3A14A 3N7UA 1ZK3A 1E7RA 3G1TA 4WUVA 3UW3A 2NVWA 2V6GA 1I30A 1V35A 3OHSX 3JD1A 1Q1NA 2B69A 1NX6A 3DZKA 5I7FA 3GMSA 3OEYA 4DPMA 1PGQA 1FK8A 3H3FA 1KYQA 5G4KB 3ZHXA 3RKRA 1E1NA 3O9ZA 1DEHA 1HYEA 2BGMA 3S2FA 1P1IA 1QV7A 4ND5A 4NQZA 3IMFA 5C37A 1HDZA 1YQDA 3ZCXA 1VRWA 2D8AA 3BMOA 3WFIA 2BRUA 3AOEC 4PLYA 5U9CA 2J3JA 1EUZA 4NBVA 4AJPA 2EJWA 1ZBQA 4BKOA 2C7VA 2HK8A 5ITVA 3WIDA 1PS0A 3DR3A 4IDAA 5G2OA 2WTBA 3VZRA 4BMNA 3WMXA 3KO8A 4BB5A 4A26A 3RBZA 3M1AA 3E5MA 2ZJ1A 4TQGA 2Z1NA 1T2DA 1ZJZA 2Y1FA 3GF4A 4JBHA 3V2HA 3P19A 1H6AA 3L07A 5A9SA 3AM4A 1K6IA 4TMFA 1ENOA 4LGVA 3FNGA 4R68A 3LQFA 5JAQA 2Q99A 4CMEC 1ENZA 3AOGA 1KOLA 3TWOA 4D3DA 2YQ5A 3WNQA 1GCOA 4YPOA 2GRAA 2AQ8A 1ZZEA 2X8LA 2NUAA 1Y8QA 2HMVA 3I9NA 1WVGA 1U3VA 3DWFA 4EZBA 3TDKA 4CM9D 4CV2A 2EP5A 3JYPA 2YV3A 2GYYA 4CM4B 5BR7A 1LRLA 5DBFA 4IS2A 2CD9A 1N1EA 5LDGA 1Q0HA 1V3TA 3LDHA 4JX8A 1DRWA 3ZHBA 4XRGA 4FD3A 3U4DA 5CEJA 3QWFA 5KTKA 4YAJA 3F6YA 4TRNA 1HXHA 3OMLA 1LA2A 3GOHA 3QVXA 5AQ1A 1T2EA 1F8FA 3E48A 1I2BA 1VPDA 1CDOA 2IODA 2J5QA 5EJ2A 4EYEA 2E82A 3RUEA 3FD8A 2RH4A 3C1OA 3M2PA 1VM6A 2XF8A 3QJ5A 3VPXA 2C2XA 4E2ZA 1UP7A 4P4LA 1Q2XA 1ZK4A 1P9LA 4QSMA 3L6OO 1RWBA 5TGDA 4OMUA 4C7KA 4XX0A 4HFJA 4MKXA 5EESA 5B4VA 4MP8A 5JO0A 3BMQB 4PVDA 2X9NA 1QYDA 1Z7BA 3RUCA 3UCFA 3PHJA 2V6FA 2ZTLA 2PY6A 1PGOA 3PIDA 3G17A 3MJCA 1UXIA 5F5LA 5A06A 1BTOA 1GUFA 2ZB8A 4MVJA 4OKIA 1C0PA 4JN6B 1ZSYA 2ZTUA 4YEDA 4CM7A 3DOJA 1JN0A 3PGJA 4K1LA 2AE1A 3HWRA 4RLSA 1JWBB 1PJCA 4BGUA 1PIWA 2W2KB 8LDHA 4CQMD 4NMHA 1TT5B 1NAIA 1EUDA 2VT2A 1ULSA 2VCYA 3MWEB 3SJ7A 4ZQHA 2CSUA 2PKQO 5I9LA 4RF2A 2PZMA 4LMRA 4FB5A 2Y66A 3Q9UA 1NVTA 4M89A 1QG6A 1QORA 3MCVA 5G4LA 3PJEA 4YJGA 2DAPA 1E7WA 4D46A 4QTZA 4BO6A 3OA2A 1U8XX 4PZCA 1M75A 5GZ6A 3DZGA 3NTQA 5DP2A 2ZATA 4YJHB 3K2EA 4Q3BA 4E5KA 2VHYA 1NQTA 5TLSA 3QQPA 1PJQA 4D0RA 3R1IA 3U49A 5ER6A 5A04A 2ZJ0A 1GYRA 2Q4BA 3IOYA 3W6ZA 2G17A 4BO4A 3IC5A 4Q3EA 2BD0A 2PK3A 2FOIA 4NFSA 3WXBA 3GZNA 1CF2O 1B0AA 3O8QA 3ZWAA 1I10A 1EVYA 2B35A 3DBLA 1HDCA 1KY4A 2YY7A 3FPLA 2AQIA 3DO5A 1WNTA 2I65A 3ITKA 3KOUA 2D5AA 3RUDA 3EHEA 5CEFA 1V3UA 2B4RO 4GSLA 4XQ9A 4DWVA 5IFLA 6ADHA 3DXFA 4G81A 3SVTA 3FHLA 2X7HA 1YQXA 3DTYA 3OSUA 2P4QA 4CM3A 1E3SA 3KB6A 3DQPA 3SXPA 3JQAA 1MA0A 5AXDA 3IUPA 5AXAA 5JAZA 5T57A 3WICA 1WDLA 5JAMA 3QVTA 3GNTA 1PJ3A 3F9IA 1QMGA 1EZ4A 4DUPA 2W2LA 4FGWA 2D4AA 1CETA 4DPKA 3CSDA 3FNEA 4C7JA 3WIEA 4XB2A 4XYMA 2JKVA 3GPDG 4KUGA 4NIMA 2RAFA 2FPGA 4ZQEA 4YCAA 1KY5A 4BKQA 4WEOA 1RM5A 1NM5A 3ANMA 3KZVA 3VPSA 4BNNA 2PGLA 5T5QA 1Y1PA 1ZJYA 5L7YA 2UV8A 2JAHA 3NTOA 3WX0A 1ISFA 2WYUA 4QQRA 1A5ZA 3HN2A 3RCBA 2B5VA 1UDAA 4CM8A 1CERA 2FHSA 3PQFA 1E1LA 4K28A 5EQFA 4JJIA 3WFJA 1PGNA 4GX2A 3RD5A 2GR9A 2ZKLA 1ZVMA 1T4DA 3T4XA 5BSEA 2PD3A 4UUPA 4M49A 5KKAA 2ZYAA 3IL2A 4F45A 3LT1A 5L95A 3FPCA 4NPCA 1LNQA 3IKVA 3LT2A 4II3A 2RHCA 2NU8A 3F47A 1C1DA 1TB4A 4EGFA 4NJMB 1U3TA 4R51A 3QHAA 4H3VA 4BB6A 4XR9A 3Q3CA 2P91A 3AJRA 3PZRA 5IDXA 2FZWA 3CPSA 4YYZA 1MP0A 3PRJA 4MVJM 3ZNPA 1QRRA 4A2CA 5KCZA 4RPJA 3AUUA 1MG0A 1HDGO 3ETGA 2VUTA 1HWYA 1O5IA 2HMUA 3C24A 3I9JA 4UVGA 3OQ6A 1FDWA 5FEUA 4MP3A 5DP1A 1XEAA 2PV7A 4K26A 2A9FA 1X7HA 5KOIA 2Y99A 1YONA 4FBGA 5ICMA 3KYCA 1H2BA 5TS3A 3BMCA 2HMWA 1LSUA 3JQ9A 1XDWA 4FFNA 4L9RA 4HADA 3SLKA 3NDRA 1LRJA 2C59A 1U2GA 4FQ8A 1I01A 3HADA 4AJ1A 3DBRA 4ZQFA 4LISA 2P9EA 4J1NA 1L7EA 5DOZA 1QYXA 4UEJA 1R0LA 2C20A 3LVFO 4HY3A 4CLDA 1B3BA 1VKNA 3GC6A 1DAOA 4TZTA 5I8WA 8ADHA 1VSUA 2HUNA 3CINA 1RKXA 2YFHA 5JXWA 4OKNA 5L51A 3C3XA 3B20A 2GDZA 1SOVA 2V6MA 4IINA 5IZCC 4XQEA 2IYPA 1IZ9A 5IF3A 1MXFA 2FRDA 3NTRA 2UVDA 1L7DA 2ZYGA 2Q46A 3ON5A 1KVSA 1ENPA 2I76A 3HDQA 4WOKA 1ISHA 1FDUA 5K9ZA 1I24A 3NT2A 3WS7A 3DBHB 3GDOA 3JSAA 3NV9A 5GZ1A 1A4IA 4BO5A 3HG7A 4FR5A 3RC7A 1H9BA 2OOSA 4D7AA 1E6UA 2DUUA 4XJTA 2P5UA 3RC2A 1HE3A 4N5NA 2YUTA 2WE8A 1T25A 1ZMTA 4D44A 4W99A 5I9NA 5L45A 1CRWG 4RVSA 3NGXA 2RH8A 1R37A 3GVIA 5IG2A 1HZZA 5JAIA 2WYVA 2HK9A 1YRLA 4PFJA 4ZICA 2CY0A 3V8BA 3B1KA 2VHWA 1EVJA 1RM0A 5ICSA 5IXYA 4NNJA 1RYDA 1HZJA 2OBYA 4J0EA 3VKVA 5TT0A 3NAQA 1R4MA 5IN4A 1LDGA 3GR6A 1ZO8A 3DZIA 3CIFA 5KVVA 5FYDA 4KOAA 4N7RA 4OYRA 4DPLA 1VSVA 2Y67A 3F1KA 1ARZA 1PQPA 2QZ9A 2ZYDA 1FXSA 4HKTA 1L1FA 5A5EA 4DYDA 5THKA 4BL5A 1LC3A 2E49A 4GSKA 4PLGA 4DMMA 5MDHA 4IUYA 2Y93A 1I3MA 3H65A 2X22A 4FOSA 4CLXA 3KVOA 1JAYA 3F4LA 5TT1A 1IPEA 4IGFA 5KWEA 1J4AA 5I9MA 1E1KA 3VPFA 2DT5A 1UXJA 1TT5A 3HZZA 4OH1A 3O38A 2IRWA 3QV1A 4B3HA 4YXFA 1EDZA 4XQGA 4WASA 3H9GA 3KSZO 3BZUA 3DB2A 2GGSA 2NQTA 2WMDA 4IMPA 2D1YA 4S1VA 3H5NA 1RYEA 1I2ZA 3L6EA 2XPCA 1SB9A 1YXMA 3S2EA 5FF9A 3IKTA 3DFZA 1N7GA 3A1NA 2I9PA 4W82A 4Z3DA 2AG5A 1B16A 4NBTA 3GFBA 4E30A 5IZCA 1BXGB 4C4OA 3JD0A 5JMPA 3E8XA 1D8AA 3LT4A 4E12A 1DIHA 4INAA 3EZYA 5EPOA 1VLLA 3BYZA 2H63A 3LZ6A 4J43A 2B5WA 3VAZA 4F6LA 4RDIA 1XA0A 1DFHA 4A7PA 3RIHA 4BNFA 4MVJE 5JY6A 3AUTA 3EVNA 2NTVA 4JGBA 1DIGA 4XKJA 4YJFA 2HRBA 4XZ3A 2CMDA 4H15A 2QZZA 5KJCA 1BXKA 2W90A 4JROA 3CMMA 4AJOA 3AW9A 2Y68A 3K5PA 2ZQYA 2VZ0A 4JNKA 4I5DA 4OQZA 2H1SA 1C0IA 3DONA 1TA4A 1P1JA 3UKOA 3GGGA 5G4KA 2O3JA 3VPHA 3O26A 4D45A 1DHTA 2QQ5A 1VJTA 2NACA 3GZ4A 3AUSA 3CEAA 4ZVVA 4P8RA 1QKIA 3UICA 4XJSA 5DDIP 3A06A 4FS3A 4GLLA 4YRBA 1B26A 3RFTA 4ALNA 3GVCA 3ZWNA 1I8TA 3PLNA 3RVDA 1UP6A 2JL1A 3AUAA 5COBA 3SC4A 1PJBA 1X13A 2G82A 3ZV5A 2GERA 3H2ZA 1I0ZA 1YS4A 3PTZA 3PJGA 4MDHA 1DSSG 1E3LA 1FMCA 5GY7A 1U1IA 5H82A 1Q0QA 3GRPA 3QWAA 1EQUA 4OSOA 2VYND 3AY3A 2O2YA 1YWGO 4XYEA 4LRTB 4JXKA 1D1TA 2E6UX 4CMIB 3VH1A 2YQ4A 2Q50A 3LF2A 2X4GA 3RJ5A 2FSVA 4HUJA 1EFLA 2W2KA 2BMAA 1WDMA 4JK3A 4ND1A 4XD2A 1GTMA 1KETA 1MG5A 1MV8A 5G0WA 5K0ZA 3P2YA 3RUAA 1ZUD1 3I52A 4JBGA 4TROA 3OEWA 1SEVA 1QSGA 2NQ8A 4MJLA 1R15A 1ZKMA 3WR5A 4D41A 3BMCB 1M6WA 2Q45A 4DRYA 2PFGA 4NR0A 5ADHA 4N5LA 2I99A 3I6IA 1U5CA 2Y0EA 2JHFA 2BFMA 3EYWA 3GEGA 5BNIA 5MGBA 1SC6A 1XELA 3WQRA 3E18A 3KSUA 2O7SA 1P31A 3A28A 4J90A 1Y9EA 2I67A 2Q1UA 3EC7A 3BHJA 4EW6A 2JFGA 4IPTA 4HP8A 4CMGA 3BTVA 1C14A 3VTZA 1YBVA 3ZWWA 3RI3A 4II2A 1LSJA 4E5MA 4J4TA 1PX0A 4M55A 3FR8A 4JBIA 4Z6KA 1YO6A 3ONEA 1A72A 3GNSA 1Z73A 3GK3A 1PL7A 4GVXA 5DCUA 4BKRA 2TMGA 3PYMA 4WNCA 1BSVA 1H0KA 3IP1A 3RWBA 3AY7A 4BGVA 4E31A 4HFNA 3OJEA 1OC4A 2UDPA 2UAGA 1DRUA 4H16A 4XA8A 2ZK7A 3FWNA 2P9CA 3DZBA 4CM5A 1QLJA 2GUGA 2FR0A 1JU9A 4NU6A 3DHYA 4O0LA 5CPBA 3UGKA 2C54A 2Q4EA 4J7XA 4DIBA 4NJOA 1UZMA 5JO9A 3U9LA 3AI3A 3EDMA 1CQIA 3L9WA 4P4GA 2EHDA 5GZ3A 3PDJA 2DBQA 4O59O 1XCBA 3LK7A 4R1TA 1CEQA 1LEHA 5JS6A 2VTEA 1T26A 4AJEA 4IDBA 3WQSB 1B8VA 3D0OA 3JQFC 2PZJA 4GVLA 2Y1CA 3MTJA 1SAYA 4LCJA 3ZNQA 4BO1A 2FP4A 2VHXA 5A05A 4EUEA 1UDBA 1XKQA 3QA9A 1O9BA 3ZGYA 5DT9A 4EEXA 1ZSVA 1HE4A 3JQAD 1ZIDA 3MJTA 3DBHA 3HUDA 1ADFA 3L4BA 2NNLD 3ZV6A 4NBUA 2NVUA 3D3EA 3ICCA 1GV1A 4HV4A 1LDMA 4Y8VA 3ICPA 4Z9YA 3FN4A 1K6XA 2JJYA 4GLOA 2R2GA 5BT9A 2CDAA 3KYBA 1YL5A 1Y8RB 1LQUA 4CMAA 2I5PO 2O23A 1GQYA 2FSSA 2X0JA 3ETDA 3FTPA 4N18A 2EERA 1Z6ZA 3TZHA 4YR9A 5C3MA 4RLHA 5IDWA 2PH3A 3GAZA 3PI7A 2VZ8A 5JMWA 1NFQA 1E7SA 3ADPA 1CQJA 2OP0A 4R3NA 3OQ1A 3F5QA 3K96A 4BO7A 1C0KA 2YHUA 3RROA 3VC7A 4TWRA 3AY6A 2BLLA 1LLQA 1ZK2A 4NU5A 2PLAA 1I32A 3DZHA 3JQ9C 3HB5X 3DHNA 3RUIA 1SCUA 4Q39A 2A92A 4YAEA 1B2LA 3EW7A 5EN4A 2OP1A 2OMEA 4Y67A 3DBRB 1P3DA 2A4KA 4OAQA 4IY1A 4YT4A 5HM8A 4W9NC 1N1GA 3OJFA 5ES3A 4K9DA 2GN4A 1ADBA 2J5RA 2QIOA 4LK3A 5TJHA 1U5AA 1O95A 3FF4A 4UUNA 3IJRA 3H6KA 4CMEA 2WYWA 3WWYA 4JQCA 1HF3A 1PJ2A 3U62A 1KEPA 3I5MA 2P2SA 3UFXA 1V3VA 4ND2A 2ZB7A 2NU9A 1N7HA 1W6UA 4NH4A 3F46A 3H9UA 1F06A 3MZ0A 1U7HA 2WE7A 2VHZA 3M2TA 3VVBA 3LLVA 2CZCA 4DLBA 2OUIA 1UUFA 3V2GA 5L40A 4KP7A 1P44A 4Y6SA 3EGOA 3FSRA 3TOZA 3PDUA 4U6SA 1PS8A 1U4SA 1XYGA 3CZRA 4GGOA 5DZSA 2WJPA 9LDBA 3O4RA 5H81A 3AU8A 5TSDA 1NWHA 1H93A 3B6ZA 5KNLA 1GAEO 3RSHA 1R4MB 1B8PA 2YW9A 3SX2A 3GY0A 5FI3A 2BFOA 1G1AA 4CLEA 4LRSB 5BSHA 2PR2A 4LMPA 3IQDB 3PP8A 4E13A 2CF5A 3BTUA 5GMOA 4GPD1 4DIFA 1GEEA 3VKUA 1WXDA 3WGYA 1F17A 1H9AA 2CVQA 1ADCA 3KETA 4MPDA 1TEHA 3R3SA 2Q2VA 1UAYA 4BKUA 2B4QA 2ZTVA 4Q3DA 5LDHA 3TPCA 3ZI0A 1MFZA 4IMRA 4W9NA 3PGXA 4XCVA 1I5RA 2Z1MA 3H4VA 1GZ3A 4WECA 3M6IA 4IIUA 4KWIA 1KERA 4CLRB 4RF5A 5DBIA 4AJIA 3JYQA 2DUWA 2EGGA 1CYDA 3M1LA 1Q7CA 4PZDA 4CLHA 2F1KA 2FPIA 4XYBA 3EUWA 1NFFA 1E6EA 2O4CA 4MVJH 1JKIA 5TRTA 3NX4A 2HQ1A 5IJZA 2ZCUA 5COAA 5B4TA 1LLUA 4ZA2A 1BVUA 1Y5MA 1MFPA 2YV1A 3AFNA 3GRKA 3INRA 5DBGA 1G0OA 4L4XA 2DC1A 2P9GA 5CFZA 1DFIA 3FNFA 4KUEA 3LLSA 1R66A 1DC6A 5A03A 1NVGA 2BKAA 1ZXBA 2PWZA 1F12A 3N58A 4BNMA 4UVHA 4MINA 1VL6A 1ID1A 3INTA 4R3WA 1ONOA 2GPTA 3D5QA 1ISGA 1FF9A 1V0JA 1LUAA 3W8EA 3GN1A 5JC1A 4RL6A 3G49A 3OM9A 5JYDA 1HDOA 2DPHA 4I9HA 4NK4A 4CLOA 1J0XO 4UUOA 5FWNA 1KS9A 4B3IA 4GKVA 1WLYA 4WCFC 3H7AA 5G0VA 3TOXA 3ZWXA 1N8KA 3DMYA 1KBZA 2VYVA 2IXBA 4KTVE 4PN3A 5CEEA 3PYXA 1ORRA 3OIGA 4CLOB 3GZNB 1H5QA 4ILKA 3CMCO 1HRDA 1R0KA 5TC4A 4YQZA 4BNLA 1H6CA 3WGIA 1ZK1A 2CNBA 1EK5A 4TKLA 2C7GA 3PQDA 5F1PA 5JDIC 3ROPA 3PJDA 4IDDA 1DC3A 3RBVA 1K6JA 1PEDA 2QRJA 3I1JA 1QYVA 1HDXA 3ZWMA 1ZK0A 1KIFA 4L73A 1AXEA 5COQA 5KJEA 3Q11A 2ZB4A 1E3JA 4J2OA 5JBIA 2VWGA 4M54A 4E5NA 3COSA 1W4ZA 1R12A 1DIRA 4UULA 5L7WA 2UUOA 3RU9A 1A7KA 3PPIA 2GCGA 1GUZA 4ZD6A 1M6HA 1YL6A 5L4NA 1N9GA 4S3MA 5K6AC 1G6KA 3L9XA 4F46A 1GYQA 4I9UA 4PG6A 1ZH8A 2IXAA 5JFOA 1PL8A 2WD7B 3JQ8A 1M67A 3K31A 4DC0A 2IZ0A 2X0NA 3GH3A 3C7AA 1JLLA 5G0UA 3KUXA 1A9YA 1SPXA 4BV9A 4I1IA 4BNJA 1BXZA 3X2EA 3JV7A 5G0TA 3BMNB 4I5EA 3GG9A 4BNXA 5C5IA 3E6AA 2AG8A 5CDGA 5JCXA 4L4RA 3LF1A 1YOVB 4BGEA 2ZIZA 1P77A 2CDBA 1E3EA 3TZQA 3H5RA 4HNHA 2AHRA 5JC8A 1NYTA 4GI2A 5U4QA 3WGOA 1MX3A 2R00C 3MJEA 1B15A 3WJAA 3ZHZA 1RM4A 2RCYA 4IJVA 3WGTA 2GN8A 1PQWA 3HFGA 1DHRA 4P22A 3K2BA 2NTNA 2P5YA 2HO5A 2P4HX 2WD7A 3JQ8B 4BNZA 2Q3EA 3I9OA 2VRCA 1LDBA 1SOWA 3W8DA 5IZ4A 3KM0A 3ETEA 2PH5A 1LBEA 4AJ2A 4Y6RA 4DGSA 5A9RA 4BNGA 4B4UA 2O3TA 4L0QA 2OO5A 1KEUA 1QXSA 3GLQA 2PD4A 2AW5A 4FSHA 3H5AA 4RF4A 4YBZA 4YT5A 1YDEA 3D5TA 4CMCA 2OORA 3UVEA 2AQKA 4PRLA 5L53A 1PJSA 2IDZA 2VNSA 4DQUA 5BSGA 1E3WB 1AXGA 2PKRA 2YJZA 1D4FA 3K92A 1NAHA 1Y8QB 5FFFA 3NDIA 4JLWA 2O3RA 4FC6A 2ILTA 4Q3NA 5CDTA 3PWKA 3C1AA 4W7IA 3K6JA 1HLDA 3OBBA 4RZIA 3GMDA 4NBWA 2NV6A 2PZLA 1YE3A 3EY4A 2IEBA 9LDTA 4TVBA 3JYOA 3PXXA 1PGJA 1CWUA 3IIEA 4RVDA 1RPNA 2CVOA 4JCOA 1XHLA 4WLFA 7MDHA 2Q2QA 1H94A 1Y5RA 4RZHA 1D1SA 5AXCA 2AMFA 2DTXA 1WPQA 2YHIA 4OGWA 4WJZA 4EEZA 4RF3A 3E1KA 2A35A 1HYHA 3WJ7A 4OO3A 2DLDA 2FMUA 1E3IA 4I5GA 1YVEI 3U09A 4YAIA 4MP6A 5HWSA 4R5HA 4BNWA 1UZLA 4U5QA 3QVWA 3WBFA 1MGOA 3INGA 4CMKA 1T24A 3BTSA 4P4NA 3U4CA 1IHYA 1I36A 3GA0A 3FR7A 2JCXA 1UZNA 3ADOA 1P1RA 3KLMX 3VHRA 3ANNA 3JD4A 4YACA 2D0IA 4UVDA 4L8VA 3RC1A 4DA9A 1E7YA 5DN9A 4E2XA 5KJ6A 1SBYA 1YBMA 3CTMA 1WW8A 3WYBA 1B3RA 4PG4A 4ALJA 1SNYA 4Z9FA 4BNHA 4PCVA 1IE3A 1ULUA 2EG9A 2RHRA 3DZJA 1OC2A 4PLVA 3H9JA 1YQGA 3ROQA 4QX6A 1M66A 1NPTO 2EKQA 3OP4A 1X14A 2LDXA 4CMHA 3UF0A 4J7UA 5BNTA 1LC0A 1VJ0A 4F6CA 5FI5A 5HS6A 1H2HA 1WAMA 3GDGA 3TN7A 3H8VA 4PRKA 2DKNA 1BW9B 3W6UA 3W8FA 2ZQZA 4B3JA 3AM5A 1PJTA 1K3TA 3HE3A 5B1YA 1E5LA 3I3OA 4FC7A 1R16A 3K8ZA 4WNIA 4G65A 3A9WA 1IY8A 4QECA 3V5NA 3RFVA 1JQBA 4XGKA 4DVJA 4PIVA 1DRVA 1HKUA 4FN4A 3DMTA 5H83A 5KKCA 1RM3A 1DO8A 4TSKA 1F0YA 2J5KA 1E1MA 1UXHA 3PWZA 3HB4X 4I08A 4CUKA 1GADO 4DXHA 4E32A 1UXGA 1HLPA 2GSDA 4YDRA 4GX5A 3WG9A 5JPIA 3UCXA 1MLDA 1JWAB 2NWQA 4PLTA 4ROSA 4MIYA 5I8ZA 4CODB 2VUSA 2POQX 3K73O 1SMKA 3V1UA 1NVMB 3BIOA 4D42A 2VOJA 3WGHA 2GO1A 3WMWA 1EEHA 5AVOA 4YT8A 3TRIA 3AI1A 4DIOA 1YB5A 2OL4A 3E82A 3MJ4A 4FW8A 2ET6A 5F5NA 5ILGA 2I3AA 4BO3A 1E0DA 4CMJA 4KQXA 4RPKA 1JTVA 1DAPA 1XU7A 4ZN6A 1NQAO 2H5LA 3IUSA 5DCWA 2PD6A 2GD1O 3DTTA 3BXXA 4F3YA 1YBAA 5BNFA 3EMKA 3KYDA 4B4VA 3DHEA 5ER9A 2VWHA 3GAFA 5I7SA 1Q0LA 1HSOA 1K5HA 3C8MA 2W98A 3DOCA 3E9MA 4IQGA 1M2WA 4LVCA 4R69A 5JY1A 3HDJA 4AJLA 3GFGA 2BF7A 4D3FA 2O2SA 1B8UA 4CR6A 3QVSA 1CJCA 1LSOA 1BMDA 1QP8A 3GNQA 3U3XA 1W73A 2IZZA 3S2GA 2BI8A 3C85A 1A7AA 5JDIA 5A3VA 3W4IA 4YJFB 4IDEA 1Q7BA 4WKGA 5KJFA 4AG3A 2IEDA 1YKFA 3I23A 2HLPA 1Z74A 1SZJG 4BS9A 2OFPA 4BMVA 4WLNA 2X86A 3F4BA 2C82A 2NVUB 2W2LD 1NASA 4ND3A 2Q1TA 1NNUA 1PWXA 4YT2A 1GPDG 2ZTMA 2DPGA 2FN7A 2E48A 2PGJA 1HT0A 4CR8A 4Z0TA 4E2WA 3KEQA 1OI7A 3TL3A 4KMSA 5HA5A 3AWDA 2JFFA 1U28A 4RO0A 1FDVA 3DAPA 4CJXA 2EV9A 3ZHYA 1EVIA 3UHAA 4P38A 4GAEA 5EMHA 4CV1A 4PLFA 3HDYA 3A4VA 4H7PA 3NT5A 3F5SA 4X54A 3D3WB 3PHGA 4GMFA 1V9LA 2YDYA 3BA1A 1KC3A 3ZWYA 1C1XA 3EZLA 3KSDO 4D43A 1XR3A 1E5QA 4D0SA 2GN6A 5KVSA 1D7OA 2Y1DA 3GGPA 1PL6A 4QO7A 4BNVA
chains in the Genus database with same CATH superfamily
1ZR4A 1P9WA 3Q0IA 3A3NA 1XMSA 1YD7A 1I4EB 4QBHA 1P0QA 2Z9BA 5AW4A 1S2NA 1YGYA 4CTKA 1DQRA 4YWJA 3FNIA 3HGMA 5DLDA 2R79A 4DG5A 2DUNA 3SJUA 3V3TA 1YBFA 1WETA 4AJKA 4U4AA 4TTJA 3MEQA 3PLRA 2X7JA 1A27A 4LTNA 4G8BA 1C0LA 4JI8B 4JNCA 3NGLA 4EWLA 1YFKA 2VA9A 4C9BA 4M9QA 1WCV1 4X97A 1TYBE 2CDCA 2O05A 3Q12A 3K16A 2I55A 3LC1O 3QEOA 4UFNA 3N0RA 2NNWB 3IE0A 4MWDA 2DUMA 3Q88A 5K51A 3KR1A 5HKBA 4ZHQF 4U9HS 2IYWA 1X7YB 2HKIA 4HLCA 1PZGA 2C4UA 2GEDA 1C30B 5JZ9A 2EDCA 4IJ5A 1P2SA 1Y3CE 4R5MA 3F90A 1UOOA 1ZNXA 2X5JO 5JATA 3HV2A 4UTOA 4A8JA 1KFEB 2PMFA 1QK5A 3ZHOA 3RTGA 2PVCA 4LJAA 4ND7A 5EJAA 4EY4A 3ESCA 2QMHA 4HAWA 4OQDA 3WHIA 4EA9A 4PZEA 3IEXA 2W8ZA 1NLFA 3NDJA 5FULA 3LPNA 1QGED 4WZAA 1C0EA 3W7BA 3BFXA 4RD4A 2J3MA 2QVGA 2PA3A 1SC1A 2BSAA 5L4SA 2XUOA 1U0RA 4Z4HA 2OO7A 3B9BA 3K6SA 5BSFA 1QO7A 2HDWA 3FAZA 3ETJA 2HMAA 2WG1A 3FE2A 5LZ9A 2OZVA 2XX3A 2CUKA 3E2MA 3E7XA 4L3WA 1PEKE 3OIFA 4Q1AA 3Q7QA 3ZU2A 4JZKA 4KLNA 4MK4A 5A4JA 3G8YA 2DGDA 2J9FA 3A6DA 2AR9A 5B3LA 1Q6ZA 2IUSA 2PMKA 3O03A 4KC0A 1UPXA 4MIEA 3L5OA 3TCXB 4YAGA 1G63A 3AYZB 5CXUA 4HDOB 2OXIA 4YVFA 1ADYA 3AEYA 4M0FA 3BGOS 4FFDA 5EWLB 3TOCA 4F56A 5KJ1A 1IXRC 5JAPA 2R8BA 5E1OA 5MN6A 5THQA 5LCXA 1I3KA 1Y82A 1J0BA 2QR3A 3EWIA 1F1JA 2IOFA 3G2LA 4WZAB 5HTOA 2XOEA 4KCGA 4YP7A 5JV5A 2E6KA 3GJ3A 5H59A 2VQFB 1NJSA 3GMIA 5BW5A 5BW8A 2IV2X 1BE6A 2FA9A 4J07A 4BFSA 3QXGA 4UE2A 3QXJA 4PHTA 4RTOA 5AP9A 1DDOA 5IVDA 4DDMA 2EXXA 1ZJWA 3LTNC 4IDCA 1R0SA 1XLTA 4L3VA 4IJQA 3VZPA 3HA5A 3NUGA 1RI1A 3MJFA 4XVUA 5T67A 4JY7A 2WMNB 4QEDA 3WY9A 3DDNA 1ZCAA 4MW5A 1FYEA 1X8LA 3AF5A 4ZVRA 1JTFA 3KLPX 5J5VA 5CIWA 1FTNA 1TFRA 3WDLA 4EGCB 2VXBA 4DSOA 1JHDA 2AC7A 4PXYA 1D2AA 4ZYTA 3W5SA 1ZA1A 4A8JC 3II6X 1ZCJA 3A4YA 1DFGA 4LDNA 1Z18A 4P08A 2HY7A 3MW8A 1N5DA 1P2UA 2QS9A 5AFSA 4RPGA 2WDZA 4LHWA 4JBXA 4Q3AA 3MUFA 4QIHA 2RHHA 3WGJA 5L3SB 1HYBA 3F3YA 2ENWA 3INYA 3JW8A 4AJNA 2ONCA 3KDAA 5EHQA 4YAKA 4TV9B 4N65A 1L5VA 2GBGA 2VH2A 1K4MA 4CCAA 3WTCA 3VBCA 3VO2A 1EDOA 4FS8A 4LBVA 5EZ6B 2W6PA 4DKJA 3ZVNA 3TW4A 5ALTA 4WADA 4IZIA 2G80A 1GR0A 1YH3A 2CJXA 3FGNA 5D8DA 4BLSA 3FBTA 4GBGA 4OHUA 4RH3A 3E9NA 2VUUA 3IP3A 1USKA 1Z4IA 4F5ZA 2FPXA 4ZZ3A 3RQIA 4CN8A 4DLYA 2A78A 1XPJA 4XYGA 1Y4AE 4P1ZA 4YJDA 1VSBA 3NFRA 4LC1A 5JD3A 1MA3A 1SXIA 1Z45A 1K7SN 4KXXA 1YS9A 4UDYX 3SVLA 3FVRA 4DABA 2ICAA 3DAFA 3IDZA 2D74A 3O4FA 4JUFA 4Z1OA 2C3OA 1LI4A 5DMXA 3AY0A 3EOZA 5GOZA 2WZQA 1UBOS 1ND6A 1XQ6A 1XX6A 5EIOA 4Q1DA 1QWSA 1W93A 2NU7A 4N3CA 4IM7A 3W79A 4LJYA 1U8AA 4BKPA 2ORYA 3KFLA 4KXWA 3QRWA 4TKMA 1TT7A 3ESXA 3GGDA 3H5VA 4Q6BA 4JJGA 1JVSA 1KDOA 4RVUA 4ZXPA 2GYWA 2JC3A 2RC6A 1E1RA 3RVJA 3WGQA 4Y98A 1G38A 1NQOA 2EC5A 1NRXA 2Y0DA 3DDCA 5ALGA 5GONF 3ABIA 3H2IA 3DEJA 3TRJA 3W1EA 3WZ2A 3CBQA 1KA9H 3L49A 1U9CA 5AI0A 1DTEA 2D3TA 4DBVO 3B6IA 2XRMA 2GAJA 3FTQA 5AK5A 1U8FO 5DT2A 4OQEA 2VJMB 2EP7A 5ILOA 1EBUA 2ODPA 1IATA 2QJWA 5I9SA 2JFPA 5FBLB 4DVGA 3QVLA 3X1MA 2NZ8A 1EBFA 1ZW1A 4UHCA 1BGVA 1GPH1 4EHJA 2YHIB 3UHOA 4WCFA 4HBZA 1S7CA 3UKDA 1IOLA 3AFMA 3VKGA 1F8GA 2QL6A 1F2UB 1UC5B 4EHIA 3OF5A 4WPGA 1JQKA 5DNAA 3Q8MA 1KK2A 1MO5A 5A3JA 1VG1A 1MJGM 3B9PA 2IHBA 1CRQA 3HU3A 4N5MA 5K4GA 1XVAA 5FT9A 1FPMA 3M6XA 3QBDA 4YONB 1GZ5A 1LX6A 2FPLA 3D64A 4HSEA 3UWMA 3EPJA 5E3JA 2Y0BA 4NCIA 4XVCA 3IEVA 3LKBA 1E4YA 4GYYA 4BHTA 3IPYA 3JD2A 4F3KA 1CUYA 4P32A 3EWSA 2Y0CA 1W30A 3ACBA 4R1UA 3A9VA 3CB4A 3FSGD 3G0IA 3IDSA 3A9RA 3L7OA 3SF8B 2J6IA 4MVJG 1SBZA 3NEPX 2OB1A 4B6RA 1SRRA 2GEKA 2QXYA 3AZPA 4HC4A 2I34A 1NURA 1Z7EA 3ND5A 2AMJA 4QREA 5MHTA 4BMOB 2QJOA 1QYRA 2B4KA 2CFCA 3PEFA 4PQFA 5HF8A 2UYHA 1E63A 1Z8FA 4D9JA 4EVSA 4P81A 2B34A 2W2QA 3KQNA 1G6OA 4O1MA 4XARA 1MW9X 4Y2TA 7MHTA 3AYXB 1NUSA 5C8XA 2PX3A 4MA5A 1E2FA 1XZNA 4GMGA 1ZJ6A 3VYRB 5JCJD 4DQVA 1DDGA 1DXHA 3PIIA 3U5TA 1XJ5A 1M6VB 5MN5A 1BQ4A 4JMPA 3RTCA 5DN6D 2H1RA 4Q1VA 4EJ0A 1BDMA 2MT9A 3RSLA 2YICA 5DNEA 4F9TA 5KQGA 1A9ZA 3LQQA 3ECAA 5AW3A 1EXMA 3ELYA 5HVNA 3TX6A 4WVLA 1CZNA 1QFMA 3BD9A 5DIFA 3V7FA 2Q2WA 1T9KA 2IE0A 3BL8A 4K6HA 4PLHA 2M6KA 3LHSA 4XR4A 4L9WA 1EGVB 2JW5A 3BREA 4ZQCB 13PKA 4GOOD 2GCOB 2OQ2A 3O92A 3EXG2 1GZUA 1CHNA 2NO0A 3U26A 3U7GA 4MS3B 1GLVA 4EFDA 3H99A 2NO9A 1L7VC 2WFMA 1MAWA 2Y76A 1Y7TA 1O0SA 3ENNA 4F5EA 4ZCRA 3GYBA 3NJ8A 2ZJ3A 4R01A 1TK2A 3K9BA 4OEHA 1V6SA 3A4MA 1FVHA 4AS2A 3NPAA 4ROTA 4DLXA 2I1WA 3HS3A 3ZVMA 2XNHA 1OU4A 2V8OA 3H16A 2CT8A 4CQLB 4E46A 3Q3JB 16PKA 2PHZA 4I9NA 1ODFA 1Z68A 3V4OA 2J32A 4G89A 4DTIA 2C77A 3MOIA 1I7DA 5DWDA 3NHSA 2Q3MA 1N0VC 3PKZA 2OGUA 1A0OA 4Y6QA 1UDRA 4FU0A 2XXJA 4LE2A 1U3CA 1GGKA 5BQFA 2I7TA 3D81A 1BA2A 1VKOA 3IMCA 2OCYC 3EFOA 3RR2A 1DOAA 3L4BC 5CPFA 4COKA 5JASA 2V5VA 5JS1A 3L7AA 3THRA 2EZUA 2JBAB 2L0XA 2HF2A 5F1OA 5BUQA 1XMOB 1CVIA 1QYCA 2V59A 1RBQA 1G5QA 4PVCA 1SQSA 3QENA 3DG9A 3WZLA 3R6DA 4LTDA 4X8OA 1U0LA 3C1TA 4RHUA 1U0JA 2W00A 3ANYB 3F8WA 3MRSA 3EG9A 1IDOA 1E5TA 4ITUA 5KVQA 3RWMB 4LF6B 1FPQA 1PR5A 1E6KA 1E92A 5EVJA 4ADSG 3GROA 3CVUA 3C3CA 1L8OA 1OLUA 4TLCA 3REGA 2LCFA 4G37A 3A4IA 3HACA 3P2IA 1NLZA 4MJXA 1H6BA 1SURA 3GMTA 3DBVO 1JG7A 5BN4B 1MIOA 3ZWCA 3PHBE 4MCAA 5EJMA 3HYLA 2YH2A 1QCYA 1JEQA 5KYNA 3QBTA 4BX8A 3E5RA 2JEZA 1ZUIA 2AFVA 3HB7A 1WP4A 4A16A 1XTPA 1P1KA 4IIXA 1EGMB 4RX1A 5IC6A 1Z0SA 1SKYB 2Q9AA 5LC1A 1RCUA 2QGNA 1X39A 2FR1A 1MH9A 2QRNA 2QRVB 1MO4A 1XVUA 2X2FA 4TT8A 4UVEA 3QKRA 3U0BA 4K9RA 1D2RA 1DJQA 3VNRA 3DJFA 2GPAA 2AXEA 4RY9A 3RUHA 1AQJA 1AGNA 4ME6A 4RVCA 5ALWA 3V6MA 1SC4A 3BX1A 3D4OA 4XI9A 2IX3A 1SFRA 2VRNA 2C5AA 3R0IA 1DLJA 1XMXA 4ZGWA 1NIJA 2GLXA 1GD1O 3DBLB 3IMKA 2YJTD 5C1IA 4EI7A 2NO1A 2ZSBA 3ADKA 3T0IA 3NRCA 4ENTA 2EKPA 4J0JA 5KAPA 4KO4S 3I53A 3OIUA 1W36B 1HDRA 3EMDA 5KTNA 1ENYA 3JAKB 5TPZA 2WSBA 8ATCA 3E0QA 4JCCA 5TVKA 2I2BA 2WJ6A 2XECA 3OC6A 2SCUB 2TMDA 2WHPA 4X45A 3P7MA 5K3OA 4I50B 1CY1A 3OTQA 4A3SA 4GDFA 1UINA 2HLDA 2F1OA 3DKKA 4ZDKA 2HHHB 3B9QA 4Z54A 2ZWPA 1A2OA 1JHMA 1YR6A 2AEFA 2B30A 1Y5NA 3WRYA 3AF3A 4BEWA 3GGOA 4ZMSA 2AKEA 3Q3GE 5KSYA 1XDGA 5D3ZA 2VQ6A 3RC3A 2HV9A 1XMIA 3HJGA 3V97A 4JT4A 5AT1A 1V1RB 2PTGA 3OETA 4MITA 5KSWB 3ZBTA 4FLFA 4YRFA 2ISQA 3PNKA 3THYB 2F1JA 2ZAMA 3LBIA 4O4HF 2XE4A 2QTZA 3NWBA 2J9RA 3OZIA 1HEIA 5KNDD 1YL7A 1M10A 2DLNA 1MOPA 1OZHA 3ZWPA 5JCPA 1X0XA 5EP4A 1FYDA 1CIJA 1T2FA 4C22A 2JJQA 3MUEA 2X0KA 1PWZA 5DXJA 2I6UA 3Q2KA 3QMWA 4FFMA 3K0KA 5BY2A 2VRCD 1P5JA 1RZVA 2GAAA 2A6PA 4AP9A 3G88A 3T7AA 4PAMA 3R3WA 4EVIA 4RK5A 3HBFA 4AXBA 3QLJA 1JL3A 3C1UA 1DXQA 3DMTC 4JYBA 2QMQA 1PJLA 4ZVQA 1GU7A 1Y7HA 3IH5A 5BYAA 3IFSA 4ZT3A 4B7ZA 4EHAA 3TOVA 1SIWA 1VCIA 2I4IA 3CX4A 4INOA 3QVKA 1FY2A 4FIZA 3IBTA 3M6VA 1JYEA 2RB5A 4AL4A 4J9UE 5BUSA 4OU5A 1VCNA 5KOJB 1Y98A 2J0UB 2EFHB 4NZOA 1PV4A 2A86A 4MI9A 2PYDA 3RFCA 3VPAA 4DC1A 1JHYA 3AM3A 1I5OA 2XLCA 4J49A 3AG6A 3DT8A 1RWOA 3C15C 4QOSA 4YIHA 2H2DA 3L40A 5BMVB 1N77A 1VYVA 1DAMA 3H1FA 4UZEA 3HLKA 3K9QO 2QD2A 3DC2A 2ZVJA 4A82A 5CYPA 1PEYA 5CFQA 3IBYA 3LP5A 3KNZA 4J0QA 3WSWA 5DNCA 2MSDB 1WF3A 2BHLA 2CBXA 2OG2A 1GAQA 1I3OA 2AXNA 4BO8A 3AJ9A 3UMVA 3C7CB 1NNSA 2JD0A 3PXAA 5HDBB 4QSHA 3WTBA 4AS3A 4B8YA 1P4GA 1S4MA 4ZVLA 5IFKA 5K09A 2XCOA 3OOWA 4YK7A 1OWLA 3WQQA 2QSZA 2F8MA 3PCXA 3M1YA 1P7PA 3B3AA 1KNXA 1V8ZA 1YCHA 4GGMX 5K5EA 4HQOA 2C4WA 3G7NA 1K89A 1Z5OA 4R1SA 5CNMA 3MD0A 4DLVA 2ATXA 4IIHA 1Y89A 2ZTSA 3GUCA 4KDEA 3E23A 3NT4A 5JNLA 2EQBA 3QMPA 1OXXK 1U7XA 2PZKA 1SOAA 1CQPA 2FN3A 4U3JB 3CUKA 2FWJA 1H2WA 3BFPA 4KFCA 3OF2A 1JJBA 1JQDA 3HLYA 2ODBA 2R86A 2WM3A 2XXAB 5E7JA 4ENRA 1ZVVA 2DBRA 1SK8A 1GKKA 2ZBRA 2QE7D 3T5MA 3VDRA 2BGWA 3GLFE 5EGNA 2A9OA 4CV0A 1HYGA 3QWBA 4UJ3A 5HRUA 4RU1A 4M9RA 3BA6A 3ISJA 1YJ8A 1BROA 4MW6A 4AX8A 1JT2A 3W5AA 1FRVA 1SXJB 1Z5GA 2VPTA 2XQJA 4GLBA 5ELXA 2ZG6A 1XTQA 2VQSA 4IYRA 2GMWA 5BT8A 1G21E 2D0DA 3FOZA 1YA6A 1QRSA 1OKKD 4XGQA 4JP3A 3MOGA 5JWOA 4O29A 4UXIA 1L7BA 2QF7A 3R6LA 3UAYA 4OLJA 1K9VF 1KAMA 4PBSA 4H31A 4P58A 4Z0PA 4EJSB 1JR3D 5C1PA 1XEXA 3DLBA 2FK7A 2QAJA 2QVBA 3OQIB 2E2WA 2OFOA 1MB0A 1SB8A 1OBCA 2LIPA 3OQPA 4C5AA 1NVFA 5H16A 5EIFA 3PFHA 1JQ3A 5J63A 4F5YA 1P0CA 1GGNA 1ESCA 2WSLA 3ZGOA 3QXHA 4LDRA 4YREA 4EITA 5CDYA 4MKRA 3X0DA 4DA0A 3KAPA 3QI7A 3OZEA 4RFSB 2VEDA 5DFAA 3S1AB 3U3ZA 4WKOA 3IYLW 3GEMA 3I9KA 3ZW8A 5IWAB 1WO8A 2CD7A 4PWYA 2I9KA 1VRCA 4B85A 3WGZA 2VYCA 1NKTA 1RJ9B 3TQFA 5JTUA 2CDNA 4HEA1 4JB2A 5GONA 1X87A 3GJ7A 2X5NA 1NW5A 3R6WA 3GLIA 4F5DA 3GRCA 3ND7A 3AHDA 4MWBA 3N7AA 5IP5A 4MKZA 1R50A 4KQFA 4URFA 2FLWA 1JB9A 2C9ZA 3BSYA 4BVBA 1MF7A 1BVYF 4ARAA 2QTAA 3V4PB 1GFSA 3UH1A 3Q1LA 3QP9A 1AX9A 4D6XA 4HWGA 4ND8B 2WJZB 1P1CA 2VJDA 5EYPA 3H1AA 3RASA 2KLBA 4EJMA 1IXSB 1TVCA 5IBQA 3WL5A 4WBNB 1E4VA 4E1AA 4GC5A 3N8HA 1USIA 2ZVDA 3LHFA 2P9QA 2OV3A 4UCWA 4XRRA 3PE6A 4JIMA 4YJGB 1H1DA 1URPA 1DX6A 5CDSA 4OOFA 3VPBA 2VAXA 3BKWA 1UK8A 2OE2A 3C5CA 3T6KA 3T9AA 2LV8A 2O2ZA 4IJWA 1CUDA 1GUBA 1USUA 4QLAA 3Q87B 4N9WA 1Y4ZA 1NNEA 1SULA 1FFGA 1PRYA 5J5CA 3RIEA 5AOVA 5KWIA 3DAGA 2ZIFA 1QCCA 3P20A 4L1KA 2B78A 3HZOA 2VPPA 3BSWA 4ZEOA 4MROA 5DU2A 3UAZA 3HTXA 2V1UA 2FJ0A 2Y6UA 1AQUA 4FYPA 4NVRA 5TF4A 3W2FA 3BGSA 4HDKA 4ESOA 1GARA 1OGYA 4PN7A 5K0FA 3D6JA 2C3PA 4RJTA 4Q15A 1OBHA 1PDOA 2AA3A 3B1FA 2QZPA 2RHTA 2SICE 4L74A 4LNUA 2CDRA 3KB2A 4OL9A 4XWOA 1M76A 4LVUA 3ENVA 3KQQA 2W22A 3R24A 4E1BA 2GFQA 1MRNA 1YT5A 3PDIA 4I3GA 2V4MA 4OHPA 4BQRA 4CRWB 2WT8A 1JEAA 1OT3A 2YXBA 3TH5A 3WRVA 4OX9Y 5JLJA 5BOSB 3SDSA 2UKDA 3M82A 2DTDA 4B5LA 5KTYA 3KR2A 4NENB 3O2NA 1FNCA 3RC9A 2V54A 4EUNA 1VHWA 1Z2DA 1T2AA 3DBIA 3E2IA 1L7AA 2H1CA 5A5GA 1EBBA 1OW3B 2W48A 3PIRA 3G0DA 3KG2A 4G0ZA 4UEKA 1YZNA 5EUCA 3SIXA 5BQXA 2PUDA 1HE5A 3I9LA 1AU9A 4FIDA 4LC0A 4X85A 1Q0ZA 1O8CA 1KJYA 4HOYA 1NVVQ 3ZDZB 1UJNA 1Z82A 4OIMA 3DPUA 1EFDN 1RZ3A 2IHUA 2ZS9A 4FFBB 4FZRA 1EX6A 4URZR 4CL3A 1FDOA 5TQ2A 3NAZA 4XASA 5AKZA 5K6AA 3KOZA 3Q2OA 4XDYA 2Z2JA 5KTRA 1GT91 1TO6A 1V8DA 2R6JA 2WNHA 3V8EA 4DGQA 3C3EA 4BB0A 1ZEJA 4H6WA 1YB4A 4LXGA 3EDQA 1IUNA 3PNSA 5KI6A 5K6TA 3P9XA 5DF1A 3T3OA 4FXOA 2X9LA 1U7DA 4ENPA 4DLLA 3G2QA 1OXTA 3DKVA 2H59A 2Z2YA 5SZIA 2BOVA 2D5CA 1E9VA 1L7XA 2QUZA 2G28A 3G79A 4RCZA 1L5YA 5BVHB 1U2GC 3JPYA 1W44A 1Z17A 3ID6C 3LUPA 4ZVOA 1S3IA 3HRKA 1YRWA 4PINA 4MDEA 3JVIA 3T12A 1RYFA 4CM4A 5HUHA 1RWVA 1D8TA 4CCYA 3MMNA 2IPAB 1I7PA 1JAXA 1ZD5A 2QUKA 3KJFA 1P80A 1VXOA 1X0VA 3CRQA 4HB3A 1D0VA 4QUAA 3OPYB 2CXNA 3LUAA 3BWBA 3KS9A 1AKWA 2JZOA 4C7OB 4XWWA 3QEMB 5BN3A 1TVEA 3BS4A 3L04A 2AOWA 3HY4A 3WLMA 1M1YB 1QE0A 1QPBA 1Y1LA 4OXKA 1IVSA 1YUMA 1JA9A 3ZKAA 3KQMA 2GASA 2PKWA 2Q1SA 2PG3A 3S8YA 4LDPA 3UH0A 3CEPB 1KMIY 1N92A 1PJ4A 2BPOA 1N0IA 1RNLA 1MO2A 4BBPA 5C7LO 5KZMB 2ZBUA 4ND8A 2CLOB 3F67A 3TQHA 4TZKA 3HSKA 5F35A 4URUR 4Z1MA 1UBTS 2JCVA 3RB8A 4EDFA 2GOYA 2DWOA 2VXYA 3HBAA 3BMOB 2OK8A 5GP1A 2C2YA 4GRIA 1IM8A 5H4HA 4HDAA 1GRRA 2X5OA 2QLLA 2JFHA 2ZJ7A 4KAFA 4YROA 3CH5A 3H1TA 4E7PA 4WAUA 4UEOA 4ENSA 3M9XA 3AVOA 1GG9A 1HE2A 1CR0A 4PCUA 2XNSA 5JI2E 4C5BA 5M2QA 1QOQB 2NM0A 4O2LA 1H6DA 5I4KA 3QPCA 2IK8A 1XVIA 4J91A 4Q7KA 4RZ3A 1SHTX 1ZRNA 3RARA 3MIZA 4E5UA 1RKVA 2YY6A 3T3EA 4EARA 4TXNA 4UBKA 4ALIA 1O4WA 2I66A 3Q5GA 4E21A 3IPLA 2IYRA 2IZ6A 2ZB3A 4KIFA 2GZ1A 3O8QB 3B7WA 4EP1A 1DIOB 2O2EA 1DL5A 5DHSA 8OHMA 1HDYA 3RYCA 4XB6B 3OZXA 2EF1A 2D59A 1U4OA 5CJPA 3TCNA 3MLAA 4H7HA 3B1WA 1U28C 3F3SA 5CLFA 1EEXB 1X9IA 1ZGHA 3A2LA 4OQFA 2H7XA 3STXA 4PZZA 5DM4A 3N8KA 4F21A 1DC4A 4TWZA 4ETNA 2ZM6B 3BXGA 4GL4A 1IHPA 3ST7A 2C98A 3VJKA 1E77A 2VWQA 3R5FA 4L08A 9ATCA 4HEHA 4KV9A 2B9VA 4U8HA 2XA9A 3K0AB 3STUA 2YWRA 1LJ8A 1FRNA 3L18A 4NDNE 2O06A 5E9QA 2HO4A 2WAXA 4EJSC 3LUJA 4KFTA 4AWXA 1UJMA 2GM9A 1BH6A 4KGDA 2M2IA 2JLWA 3PFWO 2QY9A 3QUQA 2LP4Y 1S01A 1E1YA 3P27A 5ABPA 1H8HA 3GO4A 5BSWA 1A8UA 3OTHA 4GL2A 3PJRA 3IVGA 1ABEA 2FW8A 2BEWA 1U8CB 4Z3KA 5ARBA 4DBZA 4I6JA 4NG5A 5D51S 1PKXA 3A6HA 3MTBA 1RQPA 5JI3E 2IIPA 2NZYA 5LQCA 1RP1A 3COYA 2G83A 3FZNA 4R4JA 2PSSA 1DBPA 1N5RA 1ST3A 4TQAA 4YRTA 4O4HA 4W6QA 4CQMA 2PWBA 8ABPA 1L4BA 4EBFA 3W5CA 3K05A 4WKNA 4PHGA 1IN8A 2NU8B 1IJKA 1DBRA 4XYLA 4WCDA 3U4GA 1XD9A 1UP4A 2YVUA 4Z0HO 3S7ZA 3VOTA 3UTDA 4O4JB 1UC9A 4RTNA 3WIBA 2H11A 2HA5A 3KLBA 4G4GA 2C5SA 3SR3A 4MQ6A 3L6RA 4FTWA 4XEUA 1Z2AA 4KRXA 5EPUA 3WKCA 2BYTA 1O9HA 2UVPA 3ORHA 4WFIA 1NWCA 2YCBA 4P35A 4QGGA 4ZKEA 3H4IA 1ZK3A 4RA6B 4Q1CA 2HTEA 3UW3A 1D09A 3FDIA 2H0AA 1Z2CA 5HIJA 2BC9A 1C8VB 4Z86A 2PIAA 2JGMA 4BP8A 2JI9A 3MT7A 1AA6A 2HU7A 2BGNA 4P93A 3PNBA 3FTFA 1BWPA 1BN7A 1WHTB 2GBLA 1KYQA 3OU2A 4NECA 1UBFA 2B0CA 3CM0A 5G4KB 3QNUA 3ZHXA 2P3LA 4FNAA 2BGMA 5K03A 1NTRA 2BUAA 3QK7A 2XUQA 1HDZA 3EFBA 1YQDA 3BMOA 2EQ5A 2BRUA 2RONA 4F04A 2VIIA 3FYUB 3ZDYB 2J3JA 1B0ZA 4NBVA 2LR0A 2EJWA 1DPFA 1ZBQA 2AYYA 2NW6A 1AC5A 1Y3IA 3DJYA 3EC1A 4BKOA 1FFEA 1BD3A 1TAGA 2FJPA 2JEOA 4JSYA 2F17A 2Q6VA 2ZRGA 3NH9A 3IEMA 1L3IA 3U61B 1FRFS 4IDAA 1RAEA 2HSJA 3GNLA 3WMXA 3MWLA 3MJHA 2WD9A 3P9YA 5F77A 1AGXA 3RBZA 4A26A 4ER0A 3OFKA 1T0PA 3LV8A 4IEEA 2PX6A 2HNBA 4U9UA 5HF9A 4DIKA 4DSZA 5TMPA 1J8MF 1T2DA 1D4ZA 1H6AA 4WKCA 5A9SA 4H7IA 1KU0A 3QG5A 4TMFA 3T1TA 1JQLB 3K9FC 1G5RA 2IZOA 2JLBA 1CB7A 3KKMA 1YBHA 1BNCA 5FBKA 3WRYC 4XUEA 3T7DA 5FAKA 4BQIA 3TWOA 3U6KA 2XNJA 8MHTA 4YPOA 5FRDA 2ZRBA 1Y8QA 1AQNA 3QOFA 1WVGA 4MQFA 2ZZMA 1IXZA 2WJHA 4JLUA 1M73E 1U3VA 3A6PC 2G8LA 2IF2A 4GNRA 5F9HA 5EE3A 3SYTA 4OIFA 5K0BA 2HWYA 1C7JA 3CCFA 4XWTA 5HZHA 4KREA 1HH4A 3LDHA 3SSOA 1UBSB 2BDUA 3LXMA 5IAKA 2RAUA 3LYUA 3QFFA 4TX1A 4XRGA 2W6QA 4U9IS 2IIVA 3TIGA 1TDJA 2NO6A 2ZFUA 4PZAA 4KL8S 4YAJA 3F6YA 4TRNA 4DILA 1HXHA 2XEXA 3OMLA 1MN6A 2H85A 4DFDA 5B58T 5CVJA 5CP8A 1T9ZA 2XB4A 2GD6A 5AQ1A 3U19A 1I2BA 1SD2A 5T4FA 1OZFA 1CW2B 2OZLB 2E82A 3H4MA 1TZJA 5I7OA 3FD8A 4ZGBA 4JI3B 5K8LA 4IRXA 3RUIA 1EH5A 3HUUA 5LOVA 3Q72A 4DW8A 3M2PA 1VM6A 4TYWA 3G02A 4FYKA 3VUFA 2Q62A 2DP4E 2C2XA 3ICOA 3L8CA 1WB9A 4E2ZA 4P4LA 1PR4A 2BEVA 2ZT5A 1RBMA 3C16C 1P9LA 3CWCA 4QSMA 4W7SA 3UFBA 2XKAA 3FVWA 4C08A 1RWBA 5LQUA 1JH9A 2Z2XA 3SKXA 4XX0A 3VOBA 2PU5A 4OLBA 1LV7A 3ZD9A 2C0QA 5CB0A 4WY8A 5JO0A 4QPPA 3BZBA 3PGMA 1QYDA 2JGEA 3R9KA 3UCFA 4YAOA 3OKFA 5KPJA 2G71A 4XAQA 2FMHA 3H0CA 2VLIA 4B7AA 2HQOA 3H1BA 2ZJOA 1JMVA 4WBXC 4ARZA 1BTOA 4RZXA 5BSVA 1V6CA 3ZGNA 1FFYA 3Q8KA 1N33B 2PUFA 5IJWA 1CT9A 3DOJA 3PGJA 2YJ4A 3ILYA 3HWRA 4K1LA 4BB9A 4I4NA 1CUHA 3C74A 4Y1GA 4ER5A 2IS1A 4F60A 4KODA 4CQMD 1JDNA 3AL0C 2CXUA 5ISMA 1GPWB 4MV5A 3UEOA 5A4FS 3BH6A 2YXDA 1I9CA 3EYAA 5D00A 4RJKA 5FQOA 3KZMA 2WIDA 1EYZA 2DFNA 1ABFA 3SJ7A 1W48A 5FBWB 1VE1A 1Z0FA 3GLGB 1EK1A 1FUUA 2PKQO 4Q7EA 1RQ2A 2ZE6A 3UIEA 5HCUA 4J3NA 4BZXA 3IHKA 2YZ2A 2PZMA 2LBPA 4WK4B 2Y66A 1K8YB 2VXOA 3KQVA 1QORA 4M89A 3EXG1 4ZVUA 1I94B 5LQMA 1GSIA 1GXSA 3Q98A 1E7WA 1BJKA 3EIEA 3V7WA 1KH2A 2EZTA 1U8XX 5JBQA 1DAGA 2HQBA 5KNCA 4IWYA 2G9RA 3NTQA 3OHPA 4GM0A 4PE5B 5K8VA 4M0CA 3TM5A 3FH0A 4GYWA 2W37A 4KO1S 4OYYA 1EG2A 4P4SB 3VR3A 4D0RA 1A8HA 4XW2A 2P27A 4M7PA 1U9IA 1FSGA 1SKYE 1G55A 3GT4A 3W6ZA 4D8WA 2G17A 2QN1A 5FLXA 4OJKA 4ZOAA 1ZL0A 2G4VA 4L4UA 1B0AA 2W93A 4C0JA 3FCUB 3DBLA 3I0NA 3ICQB 5AW0A 4BLTA 1FL9A 1KAOA 2O8EA 1BXRA 1H8EA 1R4AA 4RKEA 3X1XA 3EUFA 3ITKA 2I2AA 1AKRA 1F6BA 1E2PA 1GTZA 1Z47A 3KOUA 2GEJA 2NOAA 3EHEA 5IAJA 5LLSA 1CG6A 4XQ9A 5LP6A 1E6LA 1L6RA 3D2BA 3SVTA 3PEYA 4G81A 2X7HA 2YFKA 3VJRA 1OROA 3VGPA 3RVKA 3L8HA 3NVDA 3IBSA 5TEVA 1E3MA 1THMA 3MK31 3QPUA 4TLEA 2V5UA 4JUCA 3GD7A 2BKXA 1YRBA 3DQPA 3MFQA 3H4TA 3WP0A 1MA0A 3PA6A 5DB4A 2Y2UA 3C7KA 1AS2A 2BP7B 3IUPA 2WU8A 3E9ZA 2DT8A 4H0FA 1TQHA 4LJ8A 5KYXB 1PT5A 1SU7A 3TRKA 1PJ3A 1CUIA 1UJ4A 3C5HA 1CR6A 3F9IA 4HXGA 1EZ4A 4ITVA 1XCLA 4EY5A 4FGWA 1V9CA 2D4AA 5JZMA 3ZXXA 2F3QA 4DPKA 3KZ1E 3HU2A 2D54A 4JUBA 2QW0X 4MUKA 5FB3A 5P21A 3PUVA 4TQ9A 4XYMA 3NNSA 3E9CA 4WTOA 1YHYA 3GPDG 4KUGA 6GPBA 1V5IA 3A4NA 4CIYA 1A4RA 3FFBA 1A9XA 1KJWA 1KY5A 1MT3A 2IEZA 4MVYA 4WEOA 4C6RA 3AVTA 4R98A 3ANMA 1IN1A 1CUFA 1J2YA 5K3FA 2WRZA 3VPSA 2PGLA 1AQ6A 5T5QA 4PM4A 2WU0A 4BTVA 4Z4QA 3VISA 3G2IA 2F43B 3WNDA 3T7IA 4KXVA 4DCCA 4EG6A 1QPZA 2JAQA 2W11A 1ISFA 9GPBA 1Y6FA 2NO7A 3HN2A 3IQGX 3RCBA 3SG0A 2QJFA 3AGQA 2FHSA 3FGOA 3ZQKA 5EIBC 5ERYA 4CM8A 2JLYA 4TLDA 1OI2A 3IVXA 3OE7A 1PGNA 2D6FA 3RD5A 2UUAB 1TYEB 3PC7A 1T4DA 4D25A 3OUZA 4X0EA 2A9VA 1TKRA 3RUPA 5FOUA 2VDVE 1NKVA 2BE7A 3KT6A 1XCPA 4X20A 4XD7A 1WDWB 3RYFA 4ZFNA 2BGTA 5KKAA 2ZYAA 1RHMA 4F45A 5B55A 3IL2A 1N2EA 1J2JA 2G08A 5BSRA 5BUZA 5AK4A 1GUAA 3FPCA 3HNRA 4PZ0A 3SK0A 4BVFA 1LNQA 3IKVA 2NXEA 3KXPA 3LT2A 4DR6B 4QTUB 2WJ4A 2FWAA 3IKLA 3M8KA 4JJKA 4N5IX 1C1DA 1TB4A 4BE9A 2R8EA 2QAGA 3REQA 5JMOA 4IH9A 3S81A 1CKEA 3FJYA 3R9XA 3JPWA 4H3VA 3E9RA 4UUBA 1W5AA 1II9A 4OP2A 2JA1A 2P91A 5IASA 5K6RA 5IDXA 3CPSA 1R7RA 2ZI3A 3L02A 5AW1A 2RCNA 3PICA 1AT1A 3IXQA 4NMLA 2NZXA 4ZOQI 3QPVA 4D9BA 1QIFA 1VI6A 3T7TA 3SIPA 1W2GA 1OAOC 3VFDA 2QTVB 5TGTA 1JSCA 1MG0A 4WNYA 1HWYA 1O5IA 4PS0A 2Q0XA 3CZCA 4D5GA 1VL1A 2VC2B 2XTZA 1XEAA 2PV7A 2IXGA 1Y8AA 3LAWA 4CIDA 2HGZA 2Q28A 2W2XA 4S1NA 5BMOA 1KZHA 5BV1A 5C4IA 5A1JA 1OYYA 5F23A 1YONA 2XNDD 3KYCA 4CKEB 5ALVA 5FIUA 2QW1A 3W9BA 3DH0A 4BRUA 2EATA 2JJMA 4KQ6A 3VHQA 2ETVA 3AR4A 3H6GA 2FLKA 3PNQA 4BU1A 5HOQA 4Q47A 3U60B 1VMEA 3VR5D 1DKOA 4UNIA 3UMYA 1DXOA 1UF9A 2C59A 3BCUA 4X63A 1U2GA 5CLQA 3U9SA 3VYWA 5TLSA 4AJ1A 4IXMA 2HQRA 4JEMA 5DYWA 1O0CA 3OX1A 4ZZ0A 4UEJA 2C20A 1F4PA 4O8CA 4HY3A 3ROEA 4Q4AA 2ZSKA 3ILVA 2C5LA 3IP5A 3ZGLA 4X1IB 2QM7A 3KZXA 1SVIA 1IU9A 3EGDB 1B3BA 1U4NA 1DAOA 2HPHA 2ZE8A 1VIYA 4KQJA 1AA9A 1MRZA 3DSRA 5I8WA 4BYGA 1RKXA 4ETMA 4BEVA 2I29A 3ZIAA 1FB5A 3NHMA 5AKGA 3CUUA 5KO2A 5NLLA 3FMOB 1BO6A 1G5PA 3CNBA 4IINA 2IYPA 5IF3A 1TLLA 2JI6A 2FRDA 1CXZA 1HG0A 1MXFA 1ULTA 2GZAA 2G9UA 2UVDA 1O96A 3NTRA 2OQRA 2VFAA 4JP8A 3T3IA 4CWAA 3IBGA 1TJ4A 1JE1A 4C2UA 1QB7A 1ENPA 1DQNA 2XVAA 5GWXA 2FMIA 5FWDA 4LGYA 5FWXB 2E4WA 4YHHB 1Y48E 1IC6A 3GDOA 3NV9A 1ZI9A 4G1EB 3PKIA 3HG7A 4XLLA 5KVAA 5E4FA 4D7AA 1QGOA 4H08A 2XKJE 4BQSA 2Q5LA 2P5UA 5E6UB 3T1OA 4BVGA 1HE3A 2BFEB 1U0NA 2IUFA 2PZ8A 5L45A 2Q3HA 1QHIA 1AF4A 1MEOA 4EL0A 1EFTA 5D3MB 2VI5A 3HI6A 3I12A 4RVSA 2Z6VA 5B36A 4DN6A 1A3CA 4FR0A 3X1WA 2C2KA 2WSMA 3QYJA 4HGZA 1P2FA 1R37A 1A9PA 3R40A 1W96A 1UCFA 4IDOA 5CLGA 1YRLA 2ZIXB 1QOZA 4EKEA 2VO1A 1JEQB 4Z4FA 4PTYA 2A67A 4Z4IA 4Z1MD 3O75A 4HNVA 4P0QB 1JR3A 3A6EA 3LCUA 2R5WA 5HKLA 2ZREA 2EYQA 3DC7A 1J39A 1M2FA 3C3WA 2WOJA 5JALA 2ZYHA 4MSUA 3NAQA 4MH0R 4Y2YA 1EVEA 4L5BA 1G7RA 5ANRB 3B3FA 2OBLA 5IKXA 5T3UA 1YS7A 2HXYA 3CIFA 4AKIA 2I2XB 3AESA 5D6NA 3BIWA 1R0BA 2FSHA 4OYRA 3K32A 1Z2NX 3D43A 5KC8A 2QZ9A 3BL5A 4HKTA 1OU0A 2QVLA 4PCLA 1EM8B 2RAPA 1AKQA 3O83A 1WDTA 1W0JA 1YJAA 2WA1A 3CKLA 4BL5A 1E0AA 3NDPA 1AQIA 4PLGA 5E4YA 4M22A 4DMMA 2QTGA 2H4FA 2CJYA 3ORYA 3H65A 2X22A 4FOSA 4IG9A 2MU1A 3KVOA 2QR5A 3PFNA 3OIYA 5TT1A 3VYUB 1NBHA 3CO0S 1EFUA 2XMQA 1M2VB 3ED5A 3CISA 1RTKA 1W4BA 3PXGA 4DV2B 2GF9A 1KZGB 3D5EA 2BHRA 5HFNA 1TT5A 4JOQA 4LF4B 3HL4A 3HZZA 3IAUA 3FUXA 3PHCA 4RK7A 1C7FA 2IRWA 5DYNA 4CFYA 1PR1A 3BXPA 5E6RA 3HXPA 1S2OA 1KGDA 2XT9A 4CKWB 1KOFA 4OHWA 1O94C 2FZ5A 2GCEA 5FYQA 4ZK6A 5BR1A 2PUTA 1VGVA 3RYHB 4G4SO 3SM3A 2GGSA 1T36B 3KUDA 2V45A 2I33A 4GLJA 1CSEE 3LNTA 3H5NA 1RYEA 2QDKA 3T06B 3NRBA 2LWIA 1ILWA 1KEEA 3IVMA 4HNSA 4JYMA 1YXMA 5CH3A 2H0RA 4ODIA 1V2HE 3PX2A 2VT7A 3O4IA 4Q1FA 2B9EA 4US2R 5I01A 2F4VB 1N7GA 1W4CA 3PEEA 3IUBA 5HG0A 3TXXA 4W82A 4Z3DA 3I2YX 3LECA 5DHTA 5LU9A 4E4TA 2OPBA 4X1YA 2Y92A 3GFBA 1ECBA 2WIBA 4ZTBA 5IMBA 3FVQA 1D8AA 5KHAA 3G2JA 5LOVF 2FEOA 2KMLA 4EENA 1VLLA 4Q6WA 2H63A 2J6BA 3NIDB