2CJPA

Structure of potato (solanum tuberosum) epoxide hydrolase i (steh1)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
320
structure length
320
Chain Sequence
b'KKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLRGYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPDKVKALVNLSVHFSKRNPKMNVVEGLKAIYGEDHYISRFQVPGEIEAEFAPIGAKSVLKKILTYRDPAPFYFPKGKGLEAIPDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAHFVSQERPHEISKHIYDFIQKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPOXIDE HYDROLASE
molecule tags Hydrolase
source organism Solanum tuberosum
publication title X-Ray Structure of Potato Epoxide Hydrolase Sheds Light on Substrate Specificity in Plant Enzymes.
pubmed doi rcsb
total genus 118
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 3.3.2.3: Transferred entry: 3.3.2.9 and 3.3.2.10.
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cjpA00
3IUJA 3LP5A 4L9AA 3G7NA 4C4XA 1J07A 5AM3A 1GKLA 1XKLA 4BZWA 1CUSA 4KYVA 3WKCA 3RLIA 4GEGA 1MN6A 1WHSA 4B82A 1FFBA 4U2DA 3W9BA 5EHZA 1GPKA 4OYLA 3DEAA 2JGMA 3KXPA 4YX9A 1HLGA 3CN9A 4ROTA 1EVQA 3PDCA 5K3DA 4PQEA 4QZVA 3I1YA 3PFCA 4IH1A 1CUUA 4BRZA 2G4LA 4BATA 3LIIA 4PF1A 2AJLI 5AJHA 1LBSA 3H2IA 4HTAA 4MYSA 2JEZA 2J3DA 5AKHA 1TK3A 3E1GA 1LPOA 2XMRA 5IVHA 4NMWA 4Y2PA 3O0DA 4ZV7A 2OCKA 1QONA 3BE8A 1ORVA 4Y9SA 5DNUA 4W9RA 1UK6A 3EIOA 4X91A 2WM2A 1XRMA 3SWWA 1FFCA 5HQ3B 3ESCA 5DYTA 1XZJA 4MEBA 3WK8A 3ZLTA 3Q8WA 3H17A 3CN7A 2JGFA 5FPPA 4BVKA 1XZIA 4X3CA 3RARA 2AJ8A 3HEAA 2HU7A 3STTA 4X71A 7YASA 3A70A 4BDTA 3WKBA 2AJBA 5CXUA 3JWEA 1UOPA 5CT6A 3IIIA 4BRSA 1CUIA 3OURA 1LPNA 2XI4A 4H7HA 4GDMA 4D9JA 2RIPA 3WWCA 5DTJA 3WWOA 1XZEA 5AI4A 3WI7A 4X6XA 4E11A 2H1IA 3L1JA 1DWQA 2ZJ6A 2ZJ7A 2J3QA 1NX9A 5EHXA 1GQSA 2YXPX 4X7BA 1QO7A 3DDUA 1L7RA 4PSUA 1XZLA 4N8DA 3PICA 4WCVA 3H19A 4J03A 5ALZA 5C7YA 2WJ3A 4FFVA 5EIAA 1CUYA 3IUMA 4I4CA 1IZ8A 1ETHA 3EF3A 5DYWA 1XRQA 3WYNA 1AGYA 1MPXA 4UHCA 1CRLA 5DYYA 5JYCA 1XKTA 3F67A 4M0FA 3DNMA 3KD2A 4MWSA 2VAXA 2IITA 5T4EA 1YAJA 4A23A 5C8ZA 3L1IA 5I9IA 2OCLA 4LIPD 4MQMA 1XZKA 4YK7A 4BC0A 4X97A 4H7FA 3AIOA 2UZ0A 5FLKA 5JD5A 1EINA 3OOSA 3QMVA 1TCBA 4E46A 3U1TA 1QO9A 1KU6A 1E5TA 2WTMA 3FVTA 1DWPA 5DJ5A 2OGTA 5T4BA 4XIIA 3DJYA 5D7BA 2VA9A 1DT5A 2XLCA 3K6KA 3DL7A 2EDAA 3QPDA 4LYEA 4UBJA 3WK4A 1Q0ZA 2H7YA 3C6ZA 3G9TA 4JH0A 5AM5A 5CH3A 4UHEA 1CUXA 5HQ3A 4DNFA 2PSJA 3C8DA 3WQHA 3H1AA 3IUNA 5IVDA 1LPAB 4KRXA 1GPNA 4Z49A 3TGLA 2O7RA 5ALIA 4FBLA 5ALSA 3KWJA 3D2CA 4UHFA 1EA5A 2XUHA 4H7KA 4F0JA 1GQRA 2VQ6A 1QIFA 2XMDA 4WJLA 4Q05A 1JJBA 2FUKA 1CQZA 1BROA 1GT6A 3I2IA 1EB8A 4MEAA 2PL5A 4JEIA 3OTQA 3FCXA 4BDSA 2VJDA 3BL8A 4BC1A 3M82A 2D0DA 1QOZA 1E66A 3C5WP 2DHCA 4OSEA 1QE3A 1QJ4A 3G0GA 3VKFA 1TCCA 5ESRA 1QIEA 3WA7A 1WPXA 2Z8XA 4UFOA 3FVRA 2CEKA 2VJAA 4FNMA 5LKAA 1XQYA 2OPHA 1XRRA 3FSGD 4ITVA 5CBKA 4IQ4A 4HS9A 3C43A 2HADA 4QNNA 3R41A 4HRXA 3K9BA 3GELA 4LXHA 1EX9A 4W1RA 2HIHA 4ZWNA 1SOMA 1W75A 1FFDA 3WK6A 3HXKA 3WKEA 5FDFA 3A6ZA 4OUKX 4OB8A 4B81A 3O4GA 2XB6A 4X95A 3WZLA 3D4LA 1QIIA 4KE8A 4OD0A 1ACJA 4EY8A 2BUCA 3HSSA 1XRNA 3KWFA 1XLWA 1QIHA 5FUMA 2WSLA 4GW3A 1OILA 2CMFA 4ZV9A 2OQVA 3BIXA 1EI9A 5JALA 3H18A 4EBBA 1XZBA 4J3JA 5LLSA 3V1LA 4L0CA 1K8QA 3FNBA 4LXIA 2WUFA 1WOMA 2WU4A 1EVEA 1MX1A 3GROA 2GBCA 1VJ5A 5LYYA 1NU6A 4P92A 5A71A 3V1NA 3MVEA 1UT6A 1P0MA 4OPMA 2QUBA 2RI6A 5AIBA 4BCCA 2WG1A 4KE7A 3X3HA 1XZCA 2QRUA 4HZGA 4UHDA 1JMKC 2QZPA 2HA6A 2DSNA 2W22A 3CXUA 3H1BA 3AZOA 3BF8A 3VJLA 1YAHA 3NUZA 2PU5A 5A7HA 5EI5A 2HRRA 4QWWA 1CUHA 2XUAA 1W4LA 3OM8A 1G42A 5AM2A 4WY5A 1CUEA 3A2LA 1LZKA 5T4HA 3DS8A 2XUGA 2FX5A 1LNSA 3M83A 3AINA 2YH2A 4JUIA 3PI6A 4C01A 4O08A 3O4JA 3QZUA 1IUOA 2EDCA 5AM1A 2VTVA 3R3YA 4P93A 5E4YA 2PU7A 4N5IX 5CH5A 2JEYA 2O7VA 4FLMA 5JADA 2PM8A 5ALLA 1A8UA 1E8NA 4HRYA 4FKBA 1ACLA 4RGYA 2R11A 3BDVA 3W9UA 5FV4A 1XLUA 4L3WA 1ZD3A 3HI4A 5AI8A 1HDEA 4UBOA 1HBJA 1CR6A 3FSGA 3B3QA 5BV7A 1MU0A 2QR5A 2XT0A 2BJHA 1SFRA 2BFNA 3ZI7A 4FNGA 5ALRA 5BWBA 1VXOA 5AICA 1VLQA 5E4JA 2WIDA 2WHPB 3AILA 4CIAA 4GI1A 3C5VA 3GA7A 1CFJA 3VJMA 1ZD4A 4XWGA 1M33A 3HZOA 1VKHA 3F98A 4CG2A 3WL8A 4BCDA 1QFMA 4PSCA 2O2GA 1LPBB 5D3KA 4U2BA 1AKNA 4MXDA 2HA7A 3STWA 2PSFA 1L7QA 1XRPA 3STYA 1C4XA 2VAVA 3H04A 1YR2A 4J0JA 5E2IA 5I8PA 3E3AA 4DMHA 5AOBA 4LHEA 3FOBA 4J0CA 4N8EA 3QBJA 3G0BA 1OCEA 2C7BA 1UFOA 3I6ZA 2J4FA 3OG9A 3T52A 1H2YA 4WFIA 1SC9A 4G5XA 2I78A 3OPMA 2B4KA 3MUNA 5SYNA 5F4ZA 1YA4A 2B20A 5ALKA 1QIDA 3ED1A 5EHNA 2DHDA 1L7AA 3N2ZB 1X2BA 4ZI5A 4QDOA 4RPCA 4Y2YA 3C45A 1XQWA 1UOQA 2HA3A 4B0OA 3G9ZA 5ALJA 1ZJ4A 3AFIA 4W1QA 4QA9A 5AKEA 3KSRA 2PSHA 1AC5A 3I28A 1UKCA 2GBIA 1H2ZA 2X76A 3I2KA 3SC2A 3ANSA 3KOOA 2BUAA 5DNWA 3BJRA 3O9VA 3M3DA 1DU4A 2OG1A 5A2GA 3ZLUA 2O2IA 4G9GA 4HAIA 1TQHA 4HXGA 4KJXA 3ICWA 1Y37A 4C4YA 1EK2A 1WB5A 5AKJA 2WFLB 3KDAA 3I2JA 4HVTA 3G9XA 4M0EA 2IX9A 2WIKA 1FSSA 3F8SA 4ARAA 3VXKA 4ZRDA 3E4DA 5EHQA 3PUHA 5DLPA 5HZGA 4Y2JA 3SX4A 2PKYX 4PO3X 5FRDA 4Q1VA 1XRLA 1UK7A 1J06A 1U65A 3G0DA 1QLWA 1R88A 4TVKA 4RE6A 2XUPA 4BE9A 5AH0A 1N5RA 1W52X 1XZMA 1G4HA 3RK4A 1HL7A 1XQXA 5FP0A 2GBGA 4DYHA 5AI9A 1BU8A 1YA8A 3DQZA 1K63A 4Y2SA 4B83A 1Y7HA 2HFJA 5K3AA 4BVLA 5HF9A 2DHEA 3UMJA 5HF6A 3W04A 2OQIA 1LPSA 3FLAA 4EA6A 1USWA 3R3WA 4MQLA 1VE7A 1R1DA 4L72A 3ZLVA 2DQZA 2Q0XA 4QDTA 1G5FA 4ZXFA 2WG2A 3WL6A 1QTIA 4AMYA 5A6VA 5AKZA 4UFPA 1XZFA 2WUGA 5AM4A 2H7CA 3EQ8A 4TPKA 1UKAA 4G4JA 4PW0A 4WY8A 5JIBA 3WZMA 4IH9A 4KE6A 4P9NA 4YPVA 2QM0A 1CIJA 1XFDA 4U2FA 2Z5GA 5LZ9A 5JATA 3I2GA 5CT5A 1R50A 2WIGA 1ZI9A 5C8XA 4Y2RA 2ORYA 4J7AA 3IDAA 1LPPA 1VXRA 3EQ9A 2C0QA 5AKXA 3FBWA 5EIHA 4H77A 4QDUA 4BBZA 1DTEA 1TKRA 3UUEA 3M81A 3LLCA 4X93A 1FFEA 2Y2VA 5JD4A 3PF9A 1EXWA 4LKOA 1VA5A 4DNOA 1UK8A 3ZV7A 2PVSA 2I03A 1JU3A 1ZGCA 4C88A 1LZLA 2XUFA 4Y2TA 3T4UA 5ALWA 5E4TA 4GECA 1GGVA 3R3VA 1H2WA 5LZ2A 2WHPA 3OC0A 1WPRA 2JGIA 2WU3A 2XUDA 2PX6A 3IURA 2IIVA 1CUZA 4YASA 2YASA 2X5XA 1D07A 1KEZA 4N5HX 2XMSA 3C70A 4NZZA 3NGMA 4G1FA 4H7JA 1N8SA 3WYDA 4X00A 2VATA 4X90A 1HPLA 4F60A 1AX9A 5ISMA 3WJ2A 5KWIA 5AI0A 1GKKA 3E0XA 5BOVA 2G5TA 5AOAA 1U4NA 3V48A 4CCYA 3ICVA 2VJCA 3HLKA 4G8BA 1DQZA 3FLEA 4AB1A 4B0PA 2XUJA 4N8SA 4OYYA 2BGRA 4Q82A 1JJIA 5ALEA 1P0IA 1XZDA 4W1SA 2XQFA 4Y7DA 5AKYA 5ALHA 2RHWA 5HK8A 2OGSA 5JD6A 4Y2UA 4GXNA 4Q34A 1BS9A 2NW6A 4JYPA 3WMRA 4BP9A 2CJPA 5J3JA 2ACEA 1J1IA 4QEKA 1CUBA 3H2GA 2ACKA 1EHYA 1ZOIA 2VF2A 1EDEA 4MYDA 3W05A 2ZYRA 1ZICA 5AK4A 2JF0A 1YCDA 3NWOA 5HF8A 2HU5A 4DMKA 4BB0A 5K5EA 2WILA 2VEOA 3D0KA 2XLBA 4B80A 5ALMA 3WKDA 4K6HA 1YS2X 1T2NA 4FBMA 3I2HA 5LZ7A 1JT2A 1VA4A 3H2KA 2JGEA 3FYUA 3G9UA 4QLAA 4MWTA 3GUUA 3C6YA 4U2EA 4INZA 4H7DA 5CXXA 4HXFB 1ZGBA 4H0CA 2WUEA 1A8SA 2GYUA 4FFWA 2PUJA 4K2AA 5JASA 4H7IA 1N5MA 1CUCA 4KR0A 2V96A 1XLVA 5LZ4A 2OAEA 2Z3WA 5AIAA 2WFMA 4AN0A 4BE4A 1G66A 4UHHA 2GYVA 1X2EA 3TJMA 6YASA 4BVJA 1XZHA 3BDIA 1VE6A 4B7ZA 3F96A 4Y2QA 3S2ZA 4WFJA 1E8DA 1VZ3A 2WFZA 2HA5A 3IA2A 5LP1A 5I7UA 1KU0A 4EUSA 4ETWA 1ODSA 1EDDA 2O2HA 3DYVA 2R8BA 1EK1A 4FOLA 1F0PA 5HK9A 3V1KA 3H0CA 5AKIA 1S8OA 1ZI6A 4X6UA 4F21A 2WQZA 2ZYHA 3WK5A 1DX6A 1K5PA 1ZJ5A 2GZSA 1MTZA 3EBLA 4AO8A 1TIBA 2XUIA 3VISA 3Q0TA 1FFAA 4WDQA 2P8SA 4J0KA 5AKKA 5CT4A 4QE3A 4AO7A 1EDBA 4NVRA 4DTCA 1CVLA 2Z3ZA 4B9EA 4K6KA 1DWOA 4Y2XA 3G0CA 3LCRA 5DTIA 5LIPA 5AP9A 1BCSA 2XQIA 2HA4A 4GHWA 2XUKA 2Y2UA 5IH7A 2J4CA 1UOOA 5K3CA 2XQJA 1H22A 2RONA 2V9ZA 4KACA 4NS4A 3HYSA 3DD5A 5AO9A 3FCYA 1MX9A 1Q83A 1ODTC 3WWEA 4DLNA 3HJUA 1HKHA 1MAHA 5K3FA 5AK5A 4AZ0A 1THGA 1ZIYA 1HQDA 1EB9A 3STXA 4AXBA 2BKLA 5DWDA 2QXUA 2K2QB 3DCNA 1K4YA 4KAFA 3TRDA 4CG3A 4IH4A 3WIBA 4DMFA 3FWHA 4AN1A 3O9MA 1QIMA 1YASA 2DFPA 1WCYA 2WIFA 3PE6A 4AMZA 5AKLA 4J0IA 4RNCA 1R3DA 1JKMA 1QGED 2WIJA 4F5ZA 1YS1X 3LS2A 2QVBA 3ZWQA 2WJ6A 1EH5A 3AIKA 4P08A 3FYUB 4IHAA 1N1MA 2JGLA 4U2GA 5JARA 2H9YA 4ZREA 3WIOA 1TRHA 3B5EA 4QWMA 1B6GA 2V97A 3IULA 4E15A 5ALOA 3AUKA 1VOTA 2B61A 3CCCA 4UPDA 2QJWA 2YYSA 2ECFA 2ES4A 2VSQA 4G4IA 2JIDA 2Z8ZA 2OGZA 1U2EA 2ZYIA 1WM1A 2LIPA 3G0IA 4LXGA 1J2EA 1LBTA 2HU8A 4UBIA 1R9MA 4X94A 3BJMA 1A88A 4UBKA 4QDXA 3VVLA 4UUQA 5ALQA 1QZ3A 3U0VA 4GLBA 1PJAA 1F6WA 3O4HA 3WLAA 2WUDA 4DSZA 2FJ0A 1UK9A 1JJFA 4UHBA 2XUQA 4TGLA 4DNQA 5AI5A 4BCBA 2VT6A 2WLSA 5ALPA 2HA2A 1RWQA 2HA0A 1IVYA 1X70A 3QITA 1MNQA 4BYMA 5IVKA 1R9NA 1AQLA 5YASA 4C89A 4FTWA 1MJ5A 2JGKA 2XMQA 2CUTA 1JMYA 5ALVA 2X8BA 5JZ9A 3IVMA 5LZ5A 1BEEA 2QUAA 4Y2VA 3AZQA 3ESDA 4IO0A 3AIMA 5CURA 5EIEA 1AURA 2H7XA 3IUQA 2I3ZA 1QIGA 2DR0A 3D2BA 5T4FA 3FYUC 2WG0A 1I6WA 5JAHA 1BN6A 2XMCA 4FLFA 3HACA 3DOIA 4EHBA 1RP1A 3BF7A 4MJ3A 5JAPA 2QMQA 1IUNA 2QJRA 3R3UA 3BWXA 2ZSHA 2GYWA 5AOCA 5JZSA 4CCWA 5HFAA 2RGUA 5D3ZA 4KAJA 1R4ZA 4CCYB 4EZIA 3A2MA 2JGJA 3WWPA 3WKAA 3RM3A 5A7GA 3QPCA 1OXMA 2W6CX 3EQ7A 4BAUA 3GZJA 2QS9A 5HFNA 2G5PA 5JZBA 4EY4A 1BN7A 1CUGA 5HF5A 1GZ7A 2C58A 5AK3A 2ZSIA 2HRQA 3DL4A 5FXMA 3SK0A 3WWDA 1Y7IA 1Z68A 3D7RA 2CKMA 4FHZA 3DLTA 5AI6A 4UFNA 4J0GA 3CCBA 2BUBA 3HC7A 1T4MA 4A5SA 3VDXA 3QMWA 2QTBA 4RE5A 4OB7A 1CUWA 1QIJA 1CUAA 5CW2A 2JBWA 3WJ1A 4I3FA 1QTRA 5JAUA 5ALFA 5ALYA 1CPYA 2C5GA 3G02A 2DQYA 4KAAA 2CBGA 4JYMA 3QVMA 3K2IA 3I6MA 2WJ4A 4H35A 4EB0A 5H3HA 2WHRA 3BIWA 2VJBA 1LPMA 3DKKA 1XROA 5AHXA 4ARBA 5FKJA 2C0PA 2QT9A 2BAGA 3QH4A 4BTLA 1CQWA 4KEAA 5CTAA 1IMJA 3HRHA 4FDMA 1MX5A 3BXPA 1E89A 4U2CA 1BE0A 4Q3OA 5KBYA 1SCQA 2PPLA 1GPLA 2I3DA 3WL5A 4OB6A 5JANA 3JYHA 1CUDA 3D5EA 2EEPA 4UBLA 5EGNA 3PFBA 4GBGA 4Q3KA 1SCIA 5HKBA 5CMLA 3B12A 3ESBA 4DNPA 1P0PA 3VVMA 4OU4A 5JAOA 1E8MA 5AKGA 3WK7A 4B9AA 3S8YA 2C5FA 3GFFA 2XMZA 4XVCA 3F9CA 1XQVA 1FJ2A 2FJPA 2D5LA 1AMNA 2WKWA 4CG1A 2OXEA 4BAGA 1CV2A 3V9AA 1ISPA 3QMMA 4OCZA 1P0QA 1SCKA 3D59A 4E14A 1O6FA 1BRTA 4QDZA 1C7IA 1H23A 1W76A 2ZJFA 4DGQA 4DM7A 3GBSA 5C81A 4K6GA 4BAZA 3I1IA 3STVA 4I19A 5BWCA 2Y6UA 5CRIA 1JI3A 1Q84A 3PUIA 3D3NA 3FYTA 3VJKA 3FLBA 5FPQA 4XX1A 3JW8A 4X92A 4X85A 5A7FA 4V2IA 1E3QA 2XQKA 3O4IA 2HM7A 1O6GA 1AZWA 5AK6A 1RYYA 5ALUA 4K5QA 2AJDA 2OCIA 4A16A 1MO2A 1MT3A 1NU8A 2E3JA 5CT9A 5FOQA 2QOEA 3P2MA 3ILSA 1W6RA 3C6XA 2XMBA 3DYIA 3R40A 1QIKA 3G8YA 2WHQA 3I2FA 2VT7A 3W2TA 5ALTA 4G8DA 4EY7A 3ANTA 5ALXA 3WL7A 1DX4A 5ALNA 1ZI8A 4EY6A 3RKSA 2BCEA 3PF8A 1F8UA 2CB9A 2OCGA 1B41A 4DIUA 2XMGA 3C87A 2GZRA 3W06A 1YB6A 4J0HA 3ESAA 4W1PA 4G9EA 1ODCA 3STUA 1ZD5A 2HHAA 3NOXA 4AX4A 5IKXA 1K6EA 4DSAA 2PUHA 5K3BA 2QKYA 1UZAA 1XZAA 2XE4A 1PV1A 4BP8A 1WB6A 3L1HA 1WB4A 2BGNA 1F0NA 1VZ2A 4LYDA 2XUOA 2OAGA 2XDWA 1ORWA 5A62A 3HABA 2ZYSA 4ZGBA 3YASA 4UBNA 2ZVDA 1LGYA 1LLFA 4GWLA 5IVIA 1GXSA 3LIPA 2C4HA 4AQDA 2DCMA 3C6BA 2Y6VA 1DT3A 2G63A 4HXEB 4B84A 2RAUA 4OU5A 3H2HA 3QPAA 4FWBA 4JNCA 2WTNA 3MUOA 3R3XA 5CH8A 5KWJA 3IBTA 2GBFA 3AJAA 2PSEA 5ALGA 4B85A 1DINA 3N0TA 2XQGA 4CI9A 3H2JA 1U8EA 1A7UA 5KREA 3C8HA 4WFKA 5HCUA 3DOHA 5EFZA 2RHTA 1A8QA 4X6YA 1CLEA 4Q3LA 2PSDA 3TEJA 1MAAA 1JU4A 2HFKA 5LZ8A 4M0MA 5CT8A 4J0DA 4UBMA 1H2XA 3ZPXA 1PFQA 1CEXA 4C87A 3D2AA 4KRYA 2CZQA 2AJCA 1THTA 4C6HA 1UXOA 1YB7A 5HKAA 1WHTA 4CIBA 4QLOA 3V1MA 4PV7A 2PBLA 2WFLA 4AO6A 4XJVA 5AM0A 2Y1KA 1Q0RA 4FMPA 4DMCA 5ALDA 4BTVA 3WA6A 5K3EA 1CUJA 3FAKA 1TCAA 4BZZA 1DQYA 1YSCA 1UWCA 4PNZA 4H18A 1W1IA 4G4GA 2ROQA 4FLEA 1MNAA 4CFSA 3I6YA 2QXTA 1TAHA 2AXEA 3DKRA 1UKBA 4AZ3A 4EY5A 2ONCA 1ZD2P 4W63A 1C7JA 5K3FB 2V98A 2OLEA 1BEZA 1CUFA 3UUFA 3MGAA 5C8VA 3R0VA 4S0XA 1IZ7A 3QM1A 2HDWA 3IB3A 3A2NA 5LKRA 1BCRA 5DNVA 4PSDA 4B6GA 2B9VA 3F97A 4H7EA 4C4ZA 3QYJA 2HL6A 4WDRA 4G8CA 3AZPA 4KE9A 1CUVA 3R3ZA 1XZGA 1QFSA 5SYMA 1ZIXA 1IUPA 1JFRA 3O95A 5D6OA 3WK9A 1AUOA
chains in the Genus database with same CATH superfamily
2NYRA 3LP5A 1T8SA 3A1NA 1N9KA 1SXJA 1OAAA 2XADA 4R3UC 4L76A 3SICE 3TW0A 3ZU2A 1AH2A 2EX1A 3F8TA 1NRJB 1OFUX 4KLRA 4AKTA 3RJTA 3NPAA 1GKLA 2QRVA 4UQPA 2QMYA 1CF9A 1RKVA 1E1KA 3D8BA 4LJKA 4GSLA 4MB6A 3IR5A 1KPIA 1MBZA 4LC1A 4UD6A 2ZIUB 2W6PA 3NYWA 1H2AS 4CQMB 2R25B 2ZAGA 4OFXA 4PZDA 4UAJA 5BR7A 4BZQA 3GEBA 3WKCA 3K6RA 1YR3A 3ORHA 2HHLA 1HI9A 2O2CA 2AW5A 4QG7A 4AWBA 4YXWD 1SKQA 5EQTA 5DOVA 3M1YA 5E0KB 1C1XB 3KQNA 4N7BA 2IUTA 3R9IA 3UT6A 3W9BA 3Q8KA 1NX6A 1WDMA 2V7UA 4GI7A 1DAGA 4BKUA 5JMOA 2IPXA 1SELA 1KDOA 3R7DA 4ZJZA 3TZKA 4AJEA 1J22A 2CXQA 1JIQA 3TSYA 4AF7A 4LSMA 1MV5A 2EZ9A 3DR5A 5E9AA 3IO5A 2OOSA 4DDMA 1DBPA 1HLGA 3HJRA 4Y0VA 5J4VA 2HIGA 4KQCA 1U8FO 2DAPA 4C4OA 421PA 6ABPA 1VP9A 2RGNA 1FPMA 1D0IA 4WERA 4O8CA 1IM2A 1I8TA 2GCEA 3T6KA 4IH1A 2DBQA 2XYVA 3H87A 2ZTUA 2JLVA 4YCBA 4HGZA 4BATA 4D82A 5B58C 1IMOA 3OX4A 4FOOA 4JXKA 4QXMA 5AJHA 4HRVA 4YRPA 4JI8B 3C7DB 5CHEA 1LBSA 3H2IA 4TRJA 5JAOA 1VSUA 1WEKA 1R4MB 2P6OA 3TFOA 1M7BA 4MYSA 3CX3A 5CB0A 3EEYA 3IXLA 2JEZA 2P7HA 4M98A 5FUWA 1XPRA 3K8OE 2G1KA 2ZQYA 3AJRA 5B7GA 2I6FA 1N75A 2E9SA 1SKMA 3Q7TA 1TK3A 4F3CA 3Q7PA 3EH2A 1I5EA 1I33A 1IQRA 1H6DA 1PNTA 3IQDB 2XMRA 2V6MA 2IOQA 2AOUB 5JSZB 3E9CA 1QH8B 2W2LD 3O0DA 4KLZA 3JAWB 3UXHA 3MOGA 3VYWA 4K8OA 2OCKA 4D81A 1UJCA 4WUVA 1M2WA 1X1QA 3CISA 1MW9X 4C7MA 5DNUA 3GJRA 3KWMA 3E58A 3KOUA 3UYLA 3ZY4A 3QPUA 4G5QA 4W9RA 4FU0A 4BEJA 4RHXA 4YAUA 3EIOA 4OX9Y 3NPMA 1TJPB 4OOEA 3DDSA 3JQ6A 4FE4A 3V4RA 3ZGVA 4UUPA 3E22A 4RVOA 3BTOA 3KUXA 6GPBA 2ASVA 2HJWA 2XOKA 3LWNA 4WKNA 2VSXA 2NTYC 1MENA 1IJKA 3ENWA 3JYNA 3BZUA 4J94A 1H9BA 3R8FA 1ILWA 4TS4A 3EZLA 3V8MA 4P34A 5J5AA 1WMBA 2JGFA 3WYCA 3GMIA 1N4DA 1P18A 1XVUA 2QA5A 2HSJA 3RBZA 3WYAA 4P81A 1GT91 4OQEA 3HFSA 1XTSA 1XOIA 4E4TA 3RARA 3GJ3A 2ASEA 2Z9DA 4EHAA 1C3XA 1YFKA 3A70A 1LDMA 3OQIB 4Q48A 3L4BA 4EUFA 2WMOB 4WZ6A 5HOQA 2AJBA 4IIHA 3OX2A 1UOPA 3ON5A 2QLLA 3MRSA 3PQ2A 2FW1A 3IOEA 3T3DA 1QHHB 4BRSA 3EG9B 2PRJA 1LDGA 4EHIA 2P6PA 2X1VA 3W5AA 1LPNA 1NVUQ 5M29A 2NO7A 3BCRA 1BHQ1 2OTCA 4HNAA 4RTQA 3C24A 1S8AA 3QV1A 4HNTA 2DFTA 1L1FA 3JQ7A 4YUWA 1D09A 3ENNA 3HA2A 4UPVA 3O21A 3DVQX 3N8HA 3WWCA 1A9TA 4R1OA 3OE1A 2RAVA 1KWKA 5AXDA 4FZ5A 4JC0A 3WI7A 1IHUA 4X6XA 2RHGB 3H42B 3K20A 4R1NA 2WJGA 3PSAA 3HU5A 2REQB 4TUYA 1TZBA 5E0OA 5ERXA 4D6YA 1C8VB 3HB5X 2IPAB 2VDOB 1VMEA 3LHFA 2ZJ6A 1E0SA 1NPDA 1YH3A 3QKTA 4GMXA 1V1RB 4YR9A 3JALB 1LCIA 3ASYA 5F12A 3IAAA 4C5BA 4MUMA 4Q0MA 1GQSA 1GLGA 5SY6A 2JBAA 2PNFA 1LK7A 2IXTA 1F3LA 3GGDA 3MW8A 3IDSA 3IH5A 5JI3E 3DDUA 1POXA 1DCFA 2RK3A 2GKGA 1XZLA 4N8DA 3TEMA 4BBAA 1O6ZA 2ZBRA 4LF5B 1ZS9A 4WOPA 1RRPA 1S6YA 2RHDA 3H19A 3WGJA 1NRXA 1T6YA 1M2FA 3F6BX 3OFKA 2QTNA 4V3CA 5TQJA 4Z9YA 1ZHFA 4J03A 1FTQA 3MPUA 3R3HA 4KIGA 3V4ZA 2RGDA 2AA3A 3DMGA 1U5BA 1WDLA 1A2BA 2ECOA 1FQOA 3GEPA 4DUGD 5HR5A 2VTBB 4K8RB 1QHNA 3DHEA 3HBJA 4ZHQF 2Z6AA 2W6JD 1NXTA 2Z1DA 3SZLA 1RIIA 3OJ0A 4I4CA 4JVNA 3DUFA 1IZ8A 4FYMA 1H0SA 1ETHA 1IM5A 4ENPA 5CX4A 2I55A 1PR9A 1BX3A 1KQGA 4YRKA 1XRQA 3WYNA 4K9MA 3L8CA 2X2FA 4IQFA 2W6QA 2FVYA 1FP1D 1I2ZA 1NNLA 1PS9A 2YFKA 4IDBA 1K8ZB 1X0VA 5JYCA 4RMGA 3DNMA 2RGGA 2VAXA 3JAWA 3VH3A 3HEMA 1QH8A 4XTRA 2IITA 3WYFA 4F6LA 3MMNA 1C3EA 3VI3B 1WD7A 4YJ2B 2YZKA 1RE1A 5I51A 3FZQA 3PPVA 5C8ZA 4XFDA 2YMMA 1ZYUA 2OCLA 1KC1A 3FN4A 2RGNC 3KQYA 3JAMA 1EDZA 5TMPA 1D2GA 3K8YA 4F7DA 3TW8B 3X1XA 1UEJA 4X97A 1PGQA 2QTTA 3JVIA 1VSVA 3FCAA 4PYIA 1QRSA 2W90A 1T4BA 4ICIA 4E88A 1TKCA 1K4KA 1KHTA 3FNHA 5DNEA 3RS4A 4BX2A 4Q12A 2JJ1A 3QMVA 1TCBA 3WRYA 3K5HA 3EYWA 5ENZA 2QYOA 3L8HA 1J9EA 4FT4A 1UDWA 1U7DA 3AG6A 3ZGLA 1XDZA 4MLZA 1TTHA 4G5GA 1QO9A 3GCZA 2QUKA 2IIQA 4IF4A 2WTMA 4X5OA 2QW1A 5DJ5A 4P3YA 3GO4A 4TMYA 3U09A 1B7GO 2OGTA 1YUBA 1NVAA 3I4FA 1IDOA 4RH1A 1KYYA 4DBVO 5C35A 3DUFB 4KR2A 1BFKA 2VJKA 4RPKA 5T4BA 4XIIA 4LOHA 3LYUA 5JV5A 3PCRB 1TK9A 1Z2PX 4CUZA 2F43B 1DT5A 4WNYA 1T9GS 4PRLA 5FWXB 5J4YA 3DL7A 3PUWA 3QPDA 4XVQA 3WGMA 3HE3A 1N7IA 1NURA 2RHOA 4D5EA 1SHZA 1Z2AA 4UBJA 3O4RA 4OSOA 3WK4A 4ZEOA 3AV3A 1VYHA 4JH0A 1RLTA 4ARZB 4CW7A 5HQ3A 5LXTF 4KNWA 1DUVG 3GGCA 4DIKA 1XA4A 1QVAA 3R24A 2H29A 3RO7A 4DNFA 5GONF 2Q7XA 1F7UA 2H1WA 3UWOA 4OSPA 2PSJA 1M76A 3NGLA 4S1OA 2LR0A 4QYTA 4TQGA 3WQHA 5I4IA 3R9XA 5DWQA 3GI1A 4IUDS 1FYDA 1GPNA 3AKEA 3K6SB 1T3SA 2TRSB 3SZMA 3Q3CA 4P3NA 1KRWA 4P7KA 2E6UX 3H4TA 4PS0A 1X86B 4TYPA 2E5LB 1PUXA 3COSA 3QLUA 2IBSA 2AHRA 3VHXA 3RIXA 2OFXA 3Q10A 2LKCA 2PRSA 4QBIA 4UHFA 1G2QA 3SU8A 2VCHA 2PD4A 1EVLA 2B37A 4ND1A 2WE7A 5FI0B 4E09A 4DV1B 3FY4A 4X7PA 2PAFA 1L5ZA 2XMDA 5KQPA 5AVTA 2M1XA 1Z6GA 2R6FA 3KOYA 4A26A 4WFQA 4Q7QA 4DCMA 3IS3A 2FUKA 4LQDA 4MI6A 3BWVA 1CQZA 2ETXA 1JIUA 3H97A 4C03A 2A1UB 3JARA 4Q4LA 2IH2A 1EB8A 1QHHA 1VLHA 3P4UA 4HQLA 3HEBA 2IEAA 4N12A 4ILEA 4ND6A 4U2KA 3VUEA 2KX7A 1TAGA 2XYRA 2PL5A 4P3OA 2QZJA 5FLEX 4HQFA 2Q2VA 3FYSA 3OTQA 3ESYA 2Y1XA 3OT5A 3OZBA 2IGBA 3FCXA 5HGJA 1DV2A 2G83A 4DF3A 2Z4TA 4RUKA 4O4LF 2PNJA 3SJZA 1ULBA 1BMFD 1MKYA 1VMDA 2O1EA 1QCYA 3B9PA 1X7XA 2X0RA 3EFBA 3I34X 4A8HA 2P3OA 3SXPA 3OJCA 3WLTA 1W0JA 1QOZA 1G5PA 3BXFA 1E66A 3CC8A 2ZZKA 1NF2A 1DAHA 4WXHA 3EISA 2DHCA 1NUHA 2AQKA 2HWXA 3ECCA 2IYSA 4KGZA 1XJQA 4LBYA 2O4UX 4XM2A 3V1TC 4AY2A 3LT4A 1YIOA 5EIFA 1SOWA 4R8SA 2WM3A 4KZPA 5ESRA 2E1PA 2XD4A 4R9UC 4TM8A 4XWAA 4ZVSA 5JCOC 2V7EA 3R4VA 3TVDA 5LXTA 1WPXA 2L19A 4C2BA 2DPYA 4FKMA 3CYFA 1DRWA 3HGTA 1JHUA 2GD6A 1EUDB 2QV7A 1EFLA 2VJAA 1WG8A 1X8LA 3CB4A 4CMKA 1A9QA 4WKPA 2NUPB 3U4MA 3DTVA 5L53A 3ZW9A 5KNDH 2DETA 2ZTLA 3E1KA 3HUTA 2C97A 4RKYA 2P1RA 1PV4A 1T5LA 4Q3CA 1KR2A 4UVGA 2FOLA 3R41A 3IDZA 5TEWA 3E3OA 1Q0LA 2AC2A 1AHPA 2CLFB 2Q29A 3GELA 1NDHA 5DI3A 5ECYA 3QA9A 5TJ9A 1PK7A 3K30A 4ZWNA 4WXRA 3P27A 4I4IA 3I09A 4NPHA 2FJUA 3T1OA 3ZD8A 3B3FA 4BVGA 4WESA 1NTRA 2JAQA 3HXKA 5FDFA 2HT6A 3ZIAA 4P4NA 1YR6A 2IPLA 2IZ1A 5F2EA 4B81A 1H2BA 3O4GA 5FI1B 3NIFB 4QGFA 2NUTA 4QYWA 3WZLA 4ZZ3A 2YY7A 3I45A 4I1OA 3RQSA 3UMCA 4KE8A 1R4MA 1ACJA 1YQ9A 2IYWA 4OBBA 3SXUB 2NQ2C 3EQZA 1BYUA 4PPFA 5EJFA 5G0VA 3TTVA 4EVSA 4EY8A 3DL0A 4ZO8A 5IASA 2BUCA 3NB0A 1THZA 3UF0A 1UPFA 1QLHA 4R9VA 4JLAA 4RD4A 1TVKB 1RPNA 5BNZA 1Y1QA 4ZT6A 1SUDA 3B70A 4BLVA 2VNJA 3G2IA 1QE0A 2ATEA 2RAPA 3DAHA 4WXPA 1KSJA 1MIHA 1OILA 4YPFA 1O0SA 1J6UA 2UXBB 2BV3A 3AI3A 4IV5A 4ZV9A 4P0QB 3NDJA 1KI3A 2JFUA 2ZBEA 3C74A 3EPRA 1QH9A 2IU4A 4HBZA 4JI3B 2QP3A 3LL4A 1PLKA 4EUHA 5LOVF 3X1ZA 4F6RA 5B2FA 2JLBA 5HUJA 2JLRA 2P9YA 2Q2WA 3OOYA 1NVVQ 3TB6A 1EI9A 2QTCA 1IG3A 1ZNQO 3H18A 4MVJP 4NMMA 4XB2A 5I6DA 5LDHA 1KKLA 4IUBS 2GFHA 4UE3S 1FFWA 2O1SA 4JWKA 4QTYA 1MQSA 3L5OA 3H0EA 1JEQA 3HY4A 4QGHA 2AVNA 5LLSA 4L0CA 3V1LA 4LFAB 4LXIA 4V02A 1R8SA 4CIXA 3RTCA 2Q4DA 1P7CA 1TUBA 1NHGA 3FPBA 1RVV1 4TRNA 3VR5H 2C1ZA 1GTJ1 4EJSB 1FFYA 2RARA 1DAEA 3KQVA 1ECJA 2CWDA 3OCCA 4GI5A 4MGKR 4CBVA 5A71A 5IAJA 3F4LA 2WWFA 4AICA 5LQJA 3ZNPA 4C2TA 1X38A 1XQ6A 4EZBA 1WXFA 2FPOA 4HYTA 1L4YA 3JQ8B 4WGGA 4EPRA 1QORA 1Z29A 1ZWKA 4J75A 4LEIA 2ZSFA 4CEJA 5DRYA 2R1TB 4YS6A 4ZVPA 5AW1A 5F1PA 5BSUA 5HDBB 4X1YB 4A0QA 1XZCA 3LLSA 1B1AA 3S44A 4C7OB 1OLSB 1W25A 3ANNA 3OA2A 1MW8X 2QRUA 3HU1A 4DA4A 2WEKA 5EJ8A 1D8TA 3ITNA 2HA6A 2OV1A 3VUFA 2W22A 4KK3A 4YJ2F 2FOIA 4KOAA 1HDXA 1JQBA 2H9AA 1U8ZA 4Y1EA 5KHOC 1RNLA 5G53C 4EG6A 3NATA 2JLYA 3RFUA 1SH7A 3CH4B 1SZPA 4ID3A 4QFBA 4CM9D 4FXPA 5GONB 5EI5A 1OMOA 1E2KA 3OBBA 2H17A 4L95C 5FI3A 3QSYA 4Y67A 4NEGA 1P74A 3HJGA 2MSDB 1P8AA 4L6IA 3QU2A 1QPGA 3WGZA 4BMOB 1EESA 3GN2A 3QI2A 3W77A 1CUEA 1J2TA 5CFRA 4QYSA 2UZ4A 1VIYA 2VWQA 2FEPA 2QY6A 2P5YA 2OLKA 2C1XA 2ZUTA 2FX5A 4F4HA 5BQXA 2UYYA 4WZZA 1ARZA 3KYCB 3M83A 4EL5A 3AINA 3RAFC 3WXBA 3KJFA 3PI6A 5IM4F 3TOCA 4N47A 1TYCA 2G36A 3I9MA 4U0KA 3QZUA 3THWA 1IUOA 4RVCA 2G1AA 1YOBA 2AB0A 2VTVA 3L0CA 1UADA 1JDZA 5REQA 2OO7A 3G3EA 5AR1A 5KCMA 3WLHA 4YMGA 3PXCX 1VB5A 5CH5A 4BV2A 1Q50A 4DTIA 4EKGA 2J5QA 1VCOA 2K4MA 4FHCA 4A6EA 4RK5A 3ZCRA 1E2QA 2GF0A 2PM8A 2ATIA 3DR3A 3EXHA 3P9KA 5THQA 4CMHA 3JZAA 2HJSA 2GJ4A 2CLKB 2ZJ5A 4HRYA 4Q4JA 3RABA 3O6VA 3EIQA 4RK1A 1ACLA 1DJOA 2A1IA 2LVBA 4RGYA 2I80A 4P38A 5K3OA 4YO8A 4HZUB 5FV4A 3K0SA 4HNQA 2IZ7A 1XPOA 1ULSA 3HJHA 3OJEA 3QNMA 4LJ8A 4AU1A 1ZD3A 5A03A 1IUKA 2ALJA 3M9WA 4UXIA 4UBOA 4FMDB 3HJAA 3PL5A 2FK8A 2P5TB 4DJTA 3CZCA 2N46A 3GFSA 2JC3A 4DJEC 4BPBA 5CVTA 1DJPA 3KKPA 4KKVA 4B2LA 8ADHA 1PFGA 1CR2A 3IBCA 2PBFA 1P1HA 2BJHA 4MDYA 3WFIA 1R8QA 3KQLA 1SFRA 1E5LA 1FS4A 1RRFA 1XL0A 3BDAA 3DMNA 1A5BB 3MYRA 1E6KA 4FNGA 2Q7OE 3ZI7A 4BQRA 4BHTA 3WGQA 3ES9A 1Z6XA 3NRJA 4NC9A 4M83A 5FBWB 5BWBA 1CB0A 1Q2UA 1VXOA 4RZ2A 3TQTA 4C7VA 1KBQA 2FWPA 2BM1A 2ZYVX 3GCWA 4MB0A 5DK6A 1JKFA 2PS9A 4J49A 4OI2A 4Q9KA 3R74A 1XE3A 3UTDA 4BO0A 821PA 2ZIVB 3GXBA 2Y0DA 3H8JA 4GI1A 2PEZA 4BO7A 1MB0A 1ULUA 4HL6A 3EVZA 3I01A 5EZYF 3INTA 3PXXA 1MJNA 5KNBH 1PS8A 3IDFA 3ADCA 4J1NA 4PSAA 4YV0A 3V7NA 1UZMA 4D9MA 1WBDA 2Y27A 3QEAZ 2QW8A 2DPHA 3A1UA 4JGIA 2F7SA 1M33A 5GWXA 3HZOA 3PFKA 4MROA 3IVRA 4LOIA 4HEHA 3HA3A 1KMCA 2ZWIA 3M4JA 2YC2C 2TSYB 1RXYA 7MDHA 2XB2A 3NT2A 4NMLA 3ZK8A 5EFOA 3USCS 2FLVA 2V65A 1U3DA 3P9SA 1GZ4A 3LDHA 3F1LA 2O2GA 1LPBB 3SHFA 1PYDA 4G09A 4HDOB 4AS1A 1JWBB 1NBMD 4C7XA 3KAQA 1QNLA 2NVOA 4FINA 4MXDA 4TTAA 5F78A 2FB9A 5A5EA 3DZHA 1A2KC 2RCNA 5TARA 2ODPA 3G2PA 3UQYS 3F7NA 1TEXA 3WGNA 3WLMA 5KKCA 2QTAA 2PCLA 1DLIA 5D3MA 2IDZA 3T5GA 3VSCA 3CUYA 4YQEA 2ZKLA 3FTNA 2O8VA 1ZUD1 3DMYA 4I1SA 4I50F 3IEKA 4M0LA 3CVXA 4YFVA 2ZJAA 3GLGB 1JDBC 3GL9A 4P98A 4P53A 2AIRA 1E6EA 2YNMC 1TQDA 3IPLA 4I14A 1IH8A 1J23A 3OLWA 2QRVB 4MW9A 1IXRC 3U49A 1JR4A 1PL7A 5H5JA 5C1DA 1J0CA 4Y8VA 2EL9A 3MJFA 3MTBA 5JH7B 3FOBA 3OSZA 1GNRA 1XEXB 3G5LA 4IILA 4J0CA 5FL7D 1CF2O 4GPTA 4D4HA 5ELXA 2I65A 3NR2A 2IUYA 3ZZ1A 1BDBA 4LBZA 2YYZA 2D4AA 3O2JA 3I6ZA 4ZZ0A 3NUGA 1RAEA 2ZT5A 1ZFNA 3UWKA 2GFQA 2Y68A 5AYVA 4OQ4A 3MUFA 4YJKA 3TZCA 2QXYA 5CDFE 5BSRA 1SOUA 3TZEA 3WHLA 4I46A 4ZOLA 1I2CA 3Q8LA 3GUHA 4W8GA 3UW3A 5P8WA 3ENVA 4FUQA 3C3XA 1I3LA 1LB1B 2B4KA 1OROA 3EAFA 5JSQA 4FDAA 1KEPA 3EXAA 1A71A 3GVIA 3OKPA 4TN1A 1YA4A 4N7RA 3NM4A 5SYNA 1OGYA 1D2CA 4BMXA 1O0CA 1WKVA 3B36A 4FNOA 4NCNA 4ZZ2A 3KTAA 5EJMA 4FFPA 1BA3A 4O4HF 2B34A 2EYUA 4MYUA 4EB6B 2V0NA 5JFGA 2NGRA 2B82A 4O1MA 2A57A 4ACAA 3K0BA 4QDOA 3C48A 3C45A 4OJQA 3GJ4A 2VJYA 4IEEA 2Z3VA 2V0GA 5H3LA 2JFVA 3K0AA 1DI0A 4QRDA 4UEJA 3ZJ4A 4N03A 4KH0A 2D06A 4YO7A 2ORED 4B6RA 4Z2AA 3G9ZA 4RAQA 4CLEA 3AL0C 1NR5A 3BFJA 5B3JA 4IVQA 4LE2A 4QA9A 1SXJC 1TMOA 1II8B 2YTZA 3AGQA 3EXEA 1PG2A 4NESA 5JU6A 1R8YA 1T2FA 2A5JA 4KWTA 1QKKA 3TKLA 2FDRA 3LFHA 5BW6B 3HG7A 3MWDA 3BWCA 2FCRA 4KTTE 3TPFA 4QU0A 4EEXA 1P3DA 4REQA 3T99A 3AR4A 3RYHA 5BR1A 4QD3A 3VU9A 2BN4A 5J2UA 4GR4A 1NJSA 5ILQA 3BJRA 4DZZA 2OG1A 4NKRA 3L1KA 4ZJPA 3ZLUA 2OR3A 4NNJA 3FMGA 5KU7A 2F8SA 4E5MA 3A05A 1IVSA 3TM4A 2BFEB 2JCBA 1E4EB 1Y7TA 3QYAA 4J1SA 1ATIA 1QE5A 1WXDA 1PI3A 2E4UA 3EGXA 4TLAA 4HQ0A 5GIPE 3VPAA 4DR3B 1KEUA 2IDJA 2CL0X 4M9SA 4B35A 5AVWA 5GTDA 5KTOA 3CZ9A 4BVEA 4NG5A 3EDRA 2HQOA 3MB8A 4O4LB 1QOQB 3M6UA 1EK2A 2QDKA 2GGSA 3PNYA 2CFSA 2F67A 3N1UA 1QSGA 3HN2A 4XQ9A 1JALA 5IAEA 4F8YA 3QUSA 4W5WA 3MTEA 4F7WA 3W2FA 3R4CA 2PL1A 4JBIA 2A7QA 3OECA 3ZJUA 2ZUFA 2JAPA 2XZTA 1GPYA 1P7VA 2IX9A 1OI3A 4A91A 2WIKA 4HVCA 2E18A 2P40A 1TL7C 2QT0A 3QLUC 3DMRA 3SQNA 2R48A 4ARAA 2JB9A 2X3FA 4NBRA 4ZRDA 4ZZ1A 4DA8A 3CONA 4G1BA 3OZEA 1GYRA 4LNUA 3DV0A 2PCJA 4ZVUA 3KZCA 1H3NA 3MD0A 1KPHA 5KAPA 5FWDA 2D1SA 3FHOA 4HCJA 2ARKA 3T9AA 4KQJA 1O97C 2BPOA 4PO3X 5KYWB 5EWLB 4YRMA 1LQ2A 4Q1VA 1ID1A 4YREA 4F97A 3OTOB 4FMDF 4MV3A 2FZKA 4PRZA 4ND7A 5IZCA 2AZMA 2ESRA 3UA4A 2Q5CA 4AL4A 5T67A 4EX6A 2J3MA 4RE6A 4ZCIA 3MJRA 2P75A 1KQPA 2XUPA 2FP3A 3HFGA 5JZMA 4M1WA 5HE9A 4LE0A 5KJEA 1QYDA 3V34A 3JQBA 2PT6A 4R8RA 1YL6A 4EHJA 3AVVA 3VYSB 3QSGA 3I9KA 2H0RA 4KQHA 4GVLA 4D3DA 4YAOA 2ZTHA 3DHWC 1MAUA 2BGUA 3EGOA 5IUJC 3H5WA 1E2GA 4HAUA 5IPFA 2PV7A 1TUBB 2DPLA 4BJ5A 2PL9A 2FMUA 3BA1A 5HKKD 3N70A 3NU1A 3T4PA 1WVMA 1HL7A 1I7PA 1Z7YA 1Z36A 4L4SA 2PWZA 5C4GB 4C9BA 4BUJA 3MCWA 1GDTA 4NYJR 2DKNA 2FX3A 2JFPA 3DAPA 4EB3A 1E1RA 1TYZA 3WICA 4XZ3A 2LCIA 3QX8A 3K3PA 3V2HA 4DYHA 1NUSA 1KE2A 2A5FA 4AROA 2IYEA 1S1CA 4QJIA 5C8YB 2RKBA 4W6ZA 2OKCA 1Z88A 1N9GB 4PTZA 2C3MA 1XMOB 3W5CA 5DW0A 2OV2A 4LJAA 1KY2A 1Y7HA 4BKQA 4DVJA 2ZBQA 1SA0A 1ZLXA 2D0IA 3SKYA 3TSZA 2DHEA 3UMJA 4MHTA 4QPPA 3A9CA 4DXAA 1W7AA 3KKLA 1VJCA 3EVEA 3NV9A 4BB9A 1XTTA 4NNPA 3DE3X 4RIIA 3RV3A 1USWA 4RPJA 3ZU4A 4EA6A 5BO5A 2YX1A 1J25A 2IQIA 4GU5A 4RNDB 5B6JA 5BSGA 3BHIA 1C7EA 1RIFA 3IHLA 1VE7A 4ZQFA 4JI5B 3A4VA 3AR3A 3E15A 2FPSA 3BWEA 3GYGA 1FLDA 1CR1A 4RLHA 3RAGA 4CKCB 2J45A 2I9PA 5DHSA 4WBSA 1RWBA 3ZLVA 4JN6B 1P19A 1MEEA 2Q0XA 1ISJA 2W2NA 4XX0A 3HUEA 1U1DA 4OMCA 5KTMA 5MF6A 1DUIA 4OJKA 9LDTA 2MT9A 1G5FA 2V54A 3AF0A 4MR7B 1U11A 4GP9A 4LHSA 4XPIA 5EZYB 3EGVA 5CFPA 4ESEA 2YZNA 3C5EA 2C0CA 5EC8A 1ORTA 4AMYA 2XX3A 5A6VA 1DGQA 2PZBA 3NEAA 4MW5A 3F3SA 1E1MA 4UFPA 1SUIA 4K9RA 2K6GA 1NW4A 3O74A 1PK8A 3H9UA 2YZ2A 1PJQA 4L9RA 3K09C 5KOYA 2W5UA 1HT0A 4LJSA 3P2KA 3ZVRA 1O8CA 3WLIA 1K6MA 2AQHA 4G4JA 3H5OA 4IWXA 1YKGA 2HUPA 4WY8A 1YE8A 3L0ZA 3CURA 4JB2A 3WV4A 1ZCAA 4LWOA 4DA9A 2QM0A 5B1SA 4EABA 4B4UA 1G20B 2XA2A 4U2FA 1FJHA 1QAMA 2FZEA 2I6SA 3HCRA 1ULZA 3Q8XB 3I2GA 3TBHA 1DMRA 2CWWA 4PC6A 1Z7WA 5CT5A 1JF8A 1II0A 2BD0A 3T0GA 2N75A 3OLVA 3IDAA 4Y2RA 2PRKA 3GFGA 1Q92A 3LKBA 2V1UA 3TRKA 1UBMS 4HWSA 4OQYA 4CGZA 2Q4BA 2J30A 5FWYA 5M5BA 4QDUA 1C0EA 5FA8A 2XCUA 4JGBA 1C9MA 2YS6A 1VJTA 3OCJA 4Y0NA 3OT4A 3GJ5A 5CB4B 4LDJA 1JDSA 3BMNA 4MKIA 2QSUA 1E9FA 3PRYA 3W5IA 1JAYA 5GGYA 1TB4A 4Y6LA 4ARCA 1KVRA 3MJHA 3PS9A 3SN6A 3PF9A 5JYDA 2RJNA 5IX8A 4ZEXA 1YMQA 2QG9A 3M2PA 3WIUA 2EGHA 4LKOA 4E4YA 1KO1A 1UK8A 3N8IA 1LTHR 4OQPA 4R51A 3ZV7A 1UKZA 2WAOA 1VPTA 3K1AB 1RLOA 3Q6NA 5LPNA 3Q7IA 5SYAA 1PVVA 4PYLA 3M4XA 5DIFA 5EXPA 2EATA 2X2OA 5PNTA 5ALWA 5E4TA 5JCPA 3DBHB 3R3VA 3M1LA 4HVLA 3PX2A 2NSYA 4U4AA 3TRFA 1OB5A 4F4DA 5CBPB 1N6HA 2CJXA 3S40A 3IQGX 2GO7A 3I39X 1N6NA 3WWZA 1KDTA 2J6IA 3Q2OA 3HYCA 3IO3A 1M5RA 3GHYA 1WXIA 2O8NA 2BFPA 1SK8A 4DQDA 3GAMA 3NBMA 3IPCA 4YT4A 2NSJA 3C70A 1NVEA 4X54A 1M8GA 3IIMA 4H7JA 4F4CA 5CDHA 1B14A 3DLIA 2Y76A 2MR6A 1P4JA 3HHPA 4FE7A 1WV1A 4KUGA 3WQSB 2GILA 4MS4A 3NNNA 4NU8X 3PZRA 3KHSA 3EAQA 3GZNB 4QPNA 4RSGA 4OGKA 1GPJA 2WTAA 2ZRMA 3A7DA 3H7AA 1PX2A 4X90A 5HEKA 3RW9A 4ASUA 1NN3A 4BV3A 2IOFK 3E35A 2QX9A 4P3KA 3ENZA 1M67A 3BRCA 4EENA 3GCGA 3GBPA 4BASA 1I0ZA 1N57A 2C9MA 3GAFA 1CZKA 2O54A 1OFGA 2RB5A 3KKOA 5ER9A 4RJKA 2P68A 3RT7A 3L4JA 2CFOA 2QX8A 2BF4A 3IAS1 1OI4A 5BOVA 5K1ZA 1YDGA 4J16C 4EYKA 4R81A 3V48A 2VJCA 1XTIA 3COVA 4YRRA 4QO8A 3JYLA 4DWOA 3LG2A 1KAQA 1WZIA 4NXNB 2G17A 2EARA 1DQZA 4OYRA 1T2AA 1HQCA 1C5KA 3HDJA 1T9GR 4D4MA 4B47A 4OUDB 4V2UA 4B0PA 2XUJA 4G86A 2OBFA 3BBLA 4MS3A 4OGGA 5CDGA 2O8CB 1NXVA 4IVNA 3NI2A 1IQ0A 1XDDA 4P82A 3DBRB 5FADA 1P7PA 2B4TO 2O52A 3VYTB 3I01M 1DEHA 4PYNA 1G55A 3IE1A 3CEPB 2ZS9A 1H6BA 1R6DA 2RH9B 5FPTA 3TR5A 4ALNA 1XMQB 2D0PB 2NTVA 2PX0A 3ZD9A 2VL7A 1Y0BA 1T6XA 2PFSA 3OQPA 4PLZA 3S5UA 1K7FB 4IXTA 4W1SA 5B7NA 1Q5PA 4R2LA 1EU1A 1QK4A 3K8ZA 3FJOA 5AKYA 3HXTA 5IT0A 1UT5A 1SXPA 2XT6A 5TSDA 1HSOA 4KHZA 5ALHA 5E6RB 2AX4A 2RHWA 1C41A 2GWHA 4DJAA 1NOIA 5HK8A 1XL1A 4F86A 3K2QA 2CCKA 1FDTA 2D13A 4F4JA 5ADWA 1K08A 4F9TA 3H1EA 4Y2UA 2JGRA 2XDAA 2C4WA 3GFTA 1STOA 3EA5A 3WMRA 1WJGA 4BP9A 1ODJA 2WA1A 1XRSB 1GVNB 1U5BB 2HMVA 5JS6A 1Y6ZA 4U63A 1R0CA 3NDPA 1QH1B 4CG0A 2ACEA 4Q93A 4XSVA 5DHRA 1M2VA 2D1FA 3CWCA 4PYRA 1EX1A 4QEKA 1CUBA 4B3CA 1H9CA 2ACKA 4D74A 4GM4A 4YEDA 4GX5A 2B4AA 1BDMA 5CJJA 3VYVA 1BKSB 1EDEA 2JCYA 2FXVA 5ADUS 5IHXA 2NU6B 4PHGA 5L3SB 3IELA 4H6XA 3W05A 1D9XA 1VHTA 3FTFA 4TTIA 3PEEA 4A6PA 3PDHA 5I7RA 3B6EA 3CPSA 4HH3C 4O2AA 1XNRB 1A5ZA 1TZ2A 2P69A 2X4DA 1G38A 1E60A 1G8FA 3BXOA 2FRVA 3W8EA 1E3EA 2JF0A 2OY0A 3UJ8A 4BNKA 3QVVA 5FBZA 4CTOA 4DMKA 1SGWA 1U2GC 3R7WB 2WM8A 2VEOA 4Q9DA 2DBRA 5DBOA 4CL2A 4E4RA 1AG9A 1Z75A 1SWVA 1JN0A 3B7GA 3E18A 2R00C 2O7QA 2EIXA 2PWAA 1Y5IA 2OQ2A 3L8GA 4ECAA 1I4OA 5FFMA 1M1YB 1W5TA 1LW6E 1TMKA 1RRCA 2CE7A 3GQVA 4F5YA 1W88A 3MMZA 4FBMA 4WJZA 5GVSA 1KBOA 2E37A 3I2HA 5LZ7A 3B13B 4L7VA 5CYPA 1NJ6A 5FAKA 2XCRB 4RDXA 3O7MA 3UOGA 1AN9A 4OQXA 4CEIB 3CNNA 1WXWA 5KC8A 1Z4LA 1I3NA 4MWTA 3GUUA 4MS3B 4Z0HO 5IJXA 3OOHA 2IF2A 3FWZA 3FR7A 1ADCA 2HF9A 4PLYA 1U1GA 3MGGA 3IE0A 1GUBA 3AF2A 5K01A 2BEVB 3IT3A 5CXXA 3HDQA 2H1VA 5K8CA 4HXFB 4IUYA 3SDSA 3A4IA 4A1OA 1S0UA 1FB5A 1EFRD 1I32A 3R5TA 4L22A 3HNOA 3I12A 4NLLA 2PUJA 3OFND 2WDZA 3VKVA 3U1BA 3HKEB 4V0QA 5GQSA 5KVQA 3RSGA 3LCMA 2X5OA 3ZTTA 4FEGA 2Y1FA 3ZHOA 1T5TA 3AP1A 2J85A 3K71B 1UBNA 4DUZB 5H8WA 1J5XA 3KTFA 2H0QA 2ZLBA 2M98A 1RI4A 5AIAA 2WB4A 2XNSA 3U4GA 1DE0A 2XGMA 3GCXA 2IXGA 3IEUA 3LY9A 5E3JA 2D00A 1G66A 3W2GA 2ZUCA 4AN0A 1QU3A 3T0IA 3SP1A 5LU9A 2NXNA 1SAYA 1NVBA 1X2EA 3GEEA 5DFAA 1JG2A 1G19A 2ZBFA 3QEMA 4HWPA 4L6AA 1JKIA 4O02B 2PPVA 1R12A 1UC9A 1XZHA 4RDCA 4K9QA 4FOPA 4KQWA 2ICAA 4FC7A 3TX6A 3HVUA 2V4UA 3S28A 1KVUA 4S3MA 1SRQA 4CV3A 4Y2QA 3TQHA 1T9DA 4ES6A 3AVYA 1HETA 2ILVA 2RI1A 5HUQA 5DMXA 1I6MA 3CO5A 3K15A 4XIJA 4ZCPA 5BN5A 4JQZA 4A82A 4INJA 2YV1A 1ZNYA 5FNZA 1EE9A 5CAEA 1IY9A 4Q4DA 1E8DA 1U7OA 4P8RA 4B3FX 2OXFA 3IA2A 1KQ3A 4JXXA 5LB4A 2AXNA 4AZVA 4ZDKA 1LH0A 1ZBDA 1P5HA 4NX2A 4QFMA 2JW5A 3FXAA 1U8UA 3O3OB 2O0KA 2WW8A 5SZKB 4DABA 1Y5LA 2R6AA 3C15C 3H9JA 2WFAA 1NXQA 2OXCA 2Y4OA 4N3CA 4CT0A 4IOLA 2R7KA 2O2HA 3LUAA 4YMWA 3EQ6A 2C5EA 4KV9A 5IJAA 4PLPA 4DBZA 1NBEA 2R8BA 3VMFA 721PA 2P9EA 4YRDA 4Z99A 4E5PA 5IZ4A 1TAUA 1KMQA 1UBLS 1F0PA 4CMCA 2IP4A 4G0PA 2WKRA 5GGXA 3B6KA 3N39C 1EXMA 4LVNA 1RWMA 1SG6A 3CKKA 4DQUA 3FOFC 2PMEA 2HHHB 1UC5B 1L6RA 1JWAB 4F21A 5JVDB 3DDCA 3U7HB 5JFTA 3FPJA 3GNSA 3L01A 3PDIA 3ROGA 2G0AA 1TECE 5JC8A 4XJSA 3R75A 3WK5A 4FHFA 5DHAA 5KX5A 1DFGA 2EBWA 1RP7A 2I22A 2VOJA 4X7MA 2CF5A 1W5FA 3TWOA 2C7VA 1OLUB 4H15A 1VPVA 1CB7A 3GD5A 1W19A 1R6BX 2OFPA 1QGYA 1OI7A 3CRZA 3OIYA 3DEYX 4HSEA 4Z9XA 4EW1A 1WAMA 3IEVA 3PT5A 4BNMA 1EVKA 2J0UB 3MD9A 1Z34A 2BKVA 1NNSA 2WHEA 4KDRA 3LUKA 4J0KA 2ADMA 3BD9A 3ONNA 5AKKA 1P44A 2WDPA 2OMKA 4QPDA 1R9GA 2BDEA 1X92A 5CT4A 5ULLA 1KPGA 1DO0A 1P81A 3N05A 3IBYA 4GKBA 5H4GA 3SMQA 4DM4A 1M7HA 2W43A 1EX6A 2JI4A 1IY8A 2DLCX 4UQOA 4YHHB 1GGEA 2R84A 4EF5A 4NV0A 3E48A 4JUCA 4JLSA 4DTCA 5JJLA 3K9QO 2Z3ZA 5DGDA 1DOZA 3D1LA 1W59A 4K6KA 1DWOA 1VMIA 4JITA 2H4WA 2XYQA 2I5PO 3G0CA 3LCRA 4JJ6A 3WXMA 3AB3A 4EI9A 4J07A 5DTIA 1Y1RA 5J1TB 4HDCA 5AP9A 4OF4A 4UZEA 5HTKA 5TMDA 4BO3A 3AUFA 3GLHA 3AUAA 1WSWA 4LMPA 4PYMA 3A2KA 1IIBA 3PQ7A 4MR8A 4QHSA 2Y2UA 4JLPA 1YQUA 3CH5A 4C2UA 5EJGA 5IH7A 4MW4A 3GZTB 4KBGA 1FSPA 3B1FA 3BD8A 1JXQA 5BV1A 1UOOA 1EIWA 4K3UA 5K3CA 4EJFA 2XQJA 3P0HA 4EGSA 5ENVA 3LQ1A 2RONA 2V9ZA 1VIDA 2GN9A 2QUZA 4L7QA 1Z13A 2C8VA 3VDNB 1WVIA 3DD5A 3SAJA 3A9TA 2WM9B 2FW6A 2YNMA 1LBEA 3FCYA 4JC4A 4O0LA 4X6LA 1Q1BA 5B3KA 2AR0A 5JDIA 1EUQA 5TVKA 1UXJA 3FI0A 1QO0D 3N9IA 2JI9A 3F7TA 3CEHA 4PCUA 4QSHA 5DN9A 1Z0UA 4G0WA 1QHYA 1HKHA 1JTFA 3RC9A 1MAHA 3WLPA 1JV2B 5B3LA 1HT3A 4HDNA 1RKUA 2Y1CA 2Z6UA 1OZAA 1TQ6A 3JVDA 3NNDA 4G85A 4KFSA 4E2ZA 3EEFA 3KK0A 3EC1A 1O5TA 2IW1A 4RQUA 2QVYX 4TL7A 3MAGA 3UCXA 5DPMA 3BCSA 4AXBA 1GL6A 4X24A 1HORA 3UBTA 4FS3A 3ASUA 2WTEA 2COKA 5J47A 2O5RA 3RFTA 2G76A 5K0EA 2P1DA 3DCNA 1Q7EA 2YR0A 4Q21A 5DGCA 4A8JA 1G1AA 2IYTA 3O31A 5CNMA 1YRYE 2G7ZA 4W6QA 3U17A 2CLIB 4L4RA 4RFSB 3PCTA 1SD1A 3A4YA 3KJZA 3E9MA 2EWWA 2AEMA 3IUPA 1W0CA 1QGDA 3IKVA 1ZK0A 1X8XA 2IQ5A 5K2MA 2DFPA 3OI7A 5KSZA 2A30A 2ATXA 1T8TA 2IYPA 1WCYA 3I9V6 3N7UA 4G1CA 3HKEA 4BLQA 4RTJA 1JDBB 2B5WA 1BYIA 4MUFA 2EFHB 4ZOLF 2CNWA 1KYVA 2BHLA 2X3UA 3B8HA 5AKLA 4QUBA 3OOWA 5KMGA 3IAS6 3AVPA 4C30A 1P2TA 3BHNA 1LLCA 3GUCA 1CJCA 1GO2A 2GEJA 4IICA 4BEBA 3THYB 4B87A 3AI1A 1NL3A 1K6IA 1GUFA 3FZNA 3ZGOA 1JQEA 4F5ZA 3ZHYA 3G8CA 2IODA 1VGRA 3PI7A 1WUHS 2VWGA 2VXYA 2H63A 4XOIA 3M4NA 5D86A 1WW3A 3BQMB 2QVBA 1XVVA 3DM9B 3A6KA 4R3NA 4U7HA 2VC2B 4XWYA 5I8ZA 4DLBA 5CEJA 4DKJA 4QQRA 2VHYA 1KERA 1PT6A 3IP7A 4P08A 4DRXA 1X6VA 2QU7A 5BWLA 1PNRA 4LNUB 1SKAA 2HMSA 4U2GA 4C1BA 2GPAA 2FN7A 1T1EA 1QTQA 1BA2A 2A78A 4GX2A 1E3SA 4BB6A 1FYWA 1Y1LA 5DISB 5EN4A 3WIOA 1EBUA 4A10A 2DWOA 1GPDG 1TCVA 3R5XA 4J0FA 2YHUA 4XOUA 3P5BA 3VQTA 1M9NA 1BGXT 1TRHA 3H3JA 4UHKA 2PH1A 1VM6A 4FYXA 3SJCA 1RYHA 5JXHA 1LTKA 3UFBA 3FGOA 1S7GA 3IULA 3W4JA 3NBXX 3FM9A 3AUKA 3CW2A 1T8PA 5FOWA 4BUCA 1NAIA 2B61A 3CCCA 2FZVA 3ET5A 4K26A 4LI3X 4WACA 3RIHA 5IG2A 1YXMA 1C4OA 3TDNA 4BLRA 2ES4A 4ZICA 3SKXA 2YMLA 1T9ZA 3B3JA 1CEQA 1UPAA 1QH0A 5C34B 4YT8A 2V8BA 4C78A 3DOEA 3TUIC 1BVRA 4DCTA 1IY1A 4KRGA 1U2EA 1YZHA 3SS7X 4JROA 4RADA 2ZYIA 2P67A 4BLUA 3G0IA 3K0EA 1HRKA 5F98A 3C85A 1URPA 1JDPA 2PSSA 3CJRA 2FCAA 4KGXA 4LXGA 2GHIA 4F3NA 2ZW9A 5CITA 1LBTA 2DU8A 3CXRA 5DHPA 4UBIA 3LFUA 4X94A 3WZ2A 4H4CA 5AJTA 3ZDDA 1FDRA 1M1NB 3FWKA 1P7WA 1R0WA 1P3JA 2YWJA 3V7WA 1OIXA 1RI2A 1V16A 3HVJA 3KQTA 3MCVA 3NRCA 3O2SB 3R6DA 4QDXA 4RQTA 3X1YA 2QR2A 1EKXA 1KNXA 2Q2NA 2Q6LA 3F6YA 4IEIA 3I1FA 4BV9A 1WUKS 3AYZB 2VQ3A 3ZX5A 4JGGA 4R2HA 4OVKA 1XN1A 1C30A 2ZP1A 2FV8A 3KHKA 3VR6D 2FRDA 2P3QA 1SQ0A 3NHJA 2BTEA 2FJ0A 2PD6A 5HILA 1N32B 1UK9A 4G36A 3IE2A 4UHBA 1RSZA 3TI7A 3ZCVA 4DNQA 3ZVNA 2NXCA 4YV1A 1OIWA 5F1OA 2DFKB 3T8YA 5KYYA 4CXMA 4BCBA 1C9DB 2IZ5A 2Q1TA 2WLSA 4M8KA 3GX1A 3P7MA 4TWRA 5THXA 3GRRA 2HA0A 1GCIA 1Y9AA 4AF8A 1UC8A 4MUYA 4KXLA 3I9FA 1EK6A 1TF7A 3KR2A 4ZANA 3VU3A 2V3CC 3UPDA 1H2RS 2DPGA 1X70A 1FE8A 4YMSA 4IGEA 5A9SA 2HXYA 4GX0A 3IQEA 1NSTA 3GDHA 1RQRA 1V35A 2PBRA 2GBPA 1MJ5A 3DH0A 3RS0A 1S8FA 3KSBC 4JCOA 1I1QB 2AT1A 1CBUA 1JMYA 1UPXA 2VDWA 3CVOA 4S1TA 3F3KA 3AKZA 1NP3A 1UJBA 1BEEA 5JECA 3B6JA 1T6BY 3QEBZ 4P5EA 2GEKA 1T9CA 2HRCA 5KJ1A 1HY3A 3OQ1A 2O9JA 4Y2VA 3B7PA 3X43A 3O2NA 4MV5A 2FRXA 1BTOA 2GZ1A 2YIJA 1J2UA 2VXCA 3IP3A 2BFCA 1LC0A 2CLSA 2OVFA 3ZX4A 1I0IA 2BHNA 1D4OA 4IO0A 4D41A 4WBXC 2H57A 1AV7A 3ZQUA 1KDVA 1V0JA 4R9SA 4YDRA 1IBCA 2A14A 4XYEA 1AURA 4XSHA 2H7XA 4I36A 1OZHA 4C05A 4F56A 1OWMA 1RI5A 3WJ7A 1TU3A 3RF6A 4IDQA 3W2IA 2DR0A 2NO4A 3S6JA 4WSOA 1O95A 3KXKA 4XRRA 5T4FA 2HJ9A 1CDZA 1P4SA 2PMBA 3RB8A 5JAHA 1SEVA 5KVSA 5J1SB 3HACA 5U4QA 1PNVA 2HRZA 3DOIA 1A9SA 2A0WA 4OM7A 1U0FA 2ZE7A 2CDNA 3IV6A 5DX0A 4WZBE 2DUWA 1Q3HA 4RVGA 3D6UA 1SC1A 3BF7A 3QKUA 3NTRA 3W6UA 4MJ3A 4DLLA 4LCEA 2NMVA 1C14A 1P62B 3AETA 1Y5MA 3VR2A 5KQGA 4TYNA 3HCOA 1JEYA 4GYYA 1ELOA 1FU4A 2E85A 2QJRA 2X2PA 4F2DA 3VR2D 4FC6A 1XTZA 1AZTA 2ZSHA 3JVUA 5FJJA 3ZWBA 2GYWA 4FQ5A 2JJ1D 4HHEA 3E0QA 5AOCA 3TGWA 3DT6A 3MFQA 3MMSA 2VSYA 2A9JA 3H1FA 4FZJA 2FZCA 2C94A 3ZBTA 3GJQA 3MT0A 2UXCB 2ZB8A 3HZRA 3IJPA 1EUCB 3NVAA 1GWNA 1Y3CE 4IIDA 4MS1B 1GIAA 4IF6A 2D5BA 2HJVA 3ER8A 3TSAA 3WTCA 1VL2A 1RM0A 2QD4A 4JL5A 4KQKA 1NVKA 2DHRA 1DAFA 2O2YA 3RM3A 3WIVA 5L3ZA 3COJA 1VSTA 1W87A 1NMQA 3NBYC 1CVIA 4UM9D 4DE5A 3AFGA 4TSFD 2D5AA 1Z5VA 4NENA 2ZS7A 3TDKA 1UMCB 3VU1A 4GI2A 2XB4A 1USUA 5LA6A 1FNNA 2FN4A 1T5DX 4GBJA 1SKBA 2IU6A 5HF5A 2CYAA 2OCAA 2EAUA 3WL3A 4C0WA 2WWWA 4E2YA 2ZSIA 4HT3B 2D59A 1H0RA 2F9LA 2HRQA 3DL4A 1Y3DE 3MS2A 5H80A 3TX2A 4ARUA 1G2PA 1S2NA 1ZK2A 2HMAA 4PZEA 3SK0A 4PWYA 3WWDA 2H5IA 2QN6A 1FL9A 4L57A 4AMBA 4MRNA 1FP4A 2A6PA 3NBKA 3FBGA 3D7RA 1ZW1A 2VDUE 4RZUA 3H5AA 5AVJA 4FHZA 4JT8A 5H9WA 5F9FA 2VHZA 2J0EA 1U0LA 3KQPA 3BFVA 1VE1A 3PEWA 3ESZA 4KN9S 5KB3A 4UZFA 2BM8A 4D56A 1R16A 4TLCA 4Z0PA 2MIIA 1T4MA 4OJTA 2W2TA 2OHOA 3WMXA 3ZZMA 4IW3B 5DLEA 4RE5A 1L5FA 5FBHA 4DB2A 2ZRPA 2E87A 1UQUA 3D6AA 1JXAA 3UKDA 3T1TA 5AVKA 1CUAA 3C1AA 4GOND 4O5OA 4IIJF 5DULA 4JQYA 1Y7PA 4D46A 3RYIA 3V7YA 2ZB3A 3K96A 4AJLA 2C9ZA 5KSWB 3WJ1A 2P91A 2WWGA 1E1YA 4RS4A 1A4XA 3W2HA 2X40A 2DTDA 1FDIA 1IDN1 1JQKA 3P0RA 2WYUA 5G0SA 5A5FA 5CDFA 3BTVA 5A9RA 1RRKA 4UOQA 2G9QA 4L02A 3X2SA 3Q85A 4HNGA 1XG5A 2HZBA 1BMFA 3RSFA 1IQUA 4IS3A 4ATNA 4W8HA 5IT5A 4PFQA 3CRVA 1NW6A 1Z7EA 2ONYA 4FIDA 3U48A 4DUPA 2CBGA 4ZYUA 5K8TA 4F84A 3HDTA 1ADGA 2YWXA 4MR8B 3QVMA 1Z0FA 2G1UA 2N0SA 3BD6A 3I6MA 2VHXA 3K2IA 3R6WA 4H35A 3BSYA 4ONEA 4P0TA 5IMBA 3TYXA 3H3FA 5H3HA 4DPMA 3KXIA 4HMPA 4UD2A 3DMTA 2XNHA 3FCUB 1KEVA 3ZQ4A 4CT4B 3FF4A 2VJBA 1LPMA 3PWSA 4NULA 1VRCA 2IHKA 1IPHA 1U80A 2X58A 2XE7A 3DBLA 2CUNA 3DKKA 4I81A 4MCIA 1PP4A 2XTMA 1DHRA 4PG4A 5AHXA 1GUZA 3SSMA 2QW0X 4US1R 1BKYA 1SHTX 1BDJA 5FKJA 4AQ7A 3V8BA 3EIUA 2A88A 1E5DA 2ZJBA 3KFXA 3WX0A 4D79A 1B26A 2CL6X 3L1UA 1QZZA 2M32A 3TAUA 5ER6A 3ZC3A 4GMHA 1CQWA 1R0SA 1EG7A 2X4IA 1QCDA 3P9RA 4LTDA 5GZ1A 3CJTA 5LM3A 1ZIOA 3LC2O 5DXAA 3RAPR 1QU2A 4KWCA 2CCGA 3UOWA 3LQFA 3OX3A 3GEHA 2PGLA 4GMFA 4MVWA 2GDJA 3KKMA 2FGKA 2XSZA 1SULA 2XITA 1FNBA 3E9RA 2JGNA 4HFMA 1J7JA 2HBYA 2A9VA 3UY4A 3ZNNA 3RODA 1RD4A 1RHJA 3UV6A 4EKYA 5BQFA 10MHA 1RS0A 1LBHA 4U7JA 3I04M 3UIEA 3WL5A 3UM9A 1FMJA 4OB6A 4LJ4A 2WWVD 1NI4B 2AFVA 3OM9A 4YB8A 5EWLA 3TAHA 1AKQA 4AZTA 3GJTA 1EUZA 1J70A 2LV8A 1BC5A 1FC0A 1EZZA 3CY6A 4UBLA 2FW0A 5EGNA 2H2GA 5HA5A 3KG2A 3VBEA 3QVSA 4FDLA 2W7TA 3B53X 5DX8A 1HLPA 1TUGA 4G5YA 3H1TA 3ZWCA 1VG8A 5TIIA 4PQRA 3CG4A 4ZRNA 4PE5B 4PYQA 3VVMA 4OU4A 1GKIA 1IHYA 2UVDA 1DXOA 3IP5A 3OZIA 4O2LA 4RPLA 4V0RA 5BN3A 5C46F 1Y6GA 3QU9A 2ZM5A 2A92A 2OBYA 4ZPXA 4A3SA 3CRRA 4M9CA 1QG6A 2RC6A 2WABA 3I4LA 4R5HA 3RSLA 3S8YA 2IXAA 1YHNA 1JAZA 5CVCA 5JEDA 2BKEA 3F9CA 3S0JA 2C4TA 1XQVA 4KBYA 3OLQA 1FZQA 2PS1A 3ZDFA 5AW7A 2N1BA 3P4YA 4E30A 5L8VA 3LDAA 3J81k 1ZESA 1NKSA 2D5LA 3UAXA 4DG8A 1U8AA 5KHAA 5F7XA 1QUFA 2FPPB 1G3RA 1NY5A 1AA6A 1XHLA 3WGYA 3KQHA 1P80A 2F1KA 4BAGA 4D4JA 1CV2A 5EWMB 3UGTA 5ERGB 2DSTA 2NO9A 5ECDA 5BSMA 2P9FA 1US8B 3QMMA 2WZCA 3UTCA 1AMOA 4H6VA 1SVKA 2BZ0A 3LAWA 1YNOA 3SQMA 3UAZA 2AZXA 3AP3A 3CF0A 1SCKA 1AU9A 1H6AA 2G1PA 1BRTA 4EH1A 4ZI3A 1NASA 4UTPA 4R8VA 2JNWA 3TVYA 3COYA 1E9CA 7ABPA 4YAGA 4AY3A 2E5WA 3G49A 4K3VA 3WO1A 3ORFA 2QIOA 1A97A 4YI3A 4RA6A 1KMHA 4URHA 5DTQA 5A1TA 5BVGA 4E5NA 3L6RA 2Z4SA 4JKOA 1HUQA 1U0EA 5I47A 3Q87B 4B3RB 1Z6ZA 3T7KA 5CFQA 1TK2A 4CHTA 1HYBA 1ZOLA 4K6GA 4YJHB 4BAZA 3B85A 1T1RA 3OEYA 5BWCA 3KB2A 5AHOA 4KHPB 5HKLA 4RVNA 1YJBA 5I7SA 1MLDA 2FUG1 3L0IB 2R8EA 4GOXA 1HZZA 2QLFA 2RGEA 2HQRA 1JI3A 2YWCA 3M6XA 1AXGA 3EXIB 4BGUA 4K2HA 1KYQA 1HFJA 3FNIA 2P27A 1YK1A 3OEWA 4XX1A 4GBED 4Z86A 2B1RA 4FYPA 4YMTA 4DQVA 1GSIA 3WAKA 4ZAXA 2ZRLA 2D5IA 3L8FA 3DA8A 1U3GA 3BQ9A 1VPDA 2DR2A 3ULKA 3FH0A 5G4LA 1RYYA 4XCVA 1DCKA 4K5QA 1ZG3A 2QRKA 3S1SA 3BQNB 3V5NA 3AHHA 1SOVA 2C98A 2CLMB 2GAIA 3X2EA 2D3TA 2OCIA 5E7JA 2AE2A 1MO2A 4Z0TA 3HA7A 3AM3A 3FDZB 4LN1A 1MT3A 2HRBA 1C3OB 2GAJA 3LT2A 4L5JA 1D1TA 1A69A 3EXFA 4OK3A 4QQNA 3LBYA 5DK4A 4ER3A 1NYQA 3EULA 3NOQA 4NZMA 1XEXA 4Z4GA 3TQSA 2OD9A 1XA3A 2BFFA 1OLSA 4M1TA 4V24A 2XMBA 3DYIA 1HT2E 5CPFA 1QIKA 2WHQA 4I5EA 4UULA 3QGMA 2GVDC 4FR5A 3TE7A 2J5BA 2ODAA 3DE7X 3CUEF 4EY7A 4YBZA 2NZJA 3WL7A 4D44A 2GJKA 4W9MC 4LRWA 4BJ3A 1E5XA 3LF2A 1ZI8A 4EY6A 1CE8A 4LRSB 2QM8A 2Q3LA 2GJ9A 3B5JA 3NKFA 2GPSA 1MGOA 2QK4A 3AUSA 3D8TA 1G6Q1 4OP2A 1FEZA 1ZM9A 2XKBA 3IUEA 3DE0X 4O4IB 1ZJJA 4QU8A 1VKZA 1ZU5A 2AQ8A 2GZRA 2QBYB 3SG0A 3U7RA 1ZAYA 1GA1A 1X1TA 4IDGA 5C37A 4IXWA 1W85A 1HNZB 4MDFA 2KW5A 2GZ3A 4G9EA 3TIFA 1OFIA 1VHQA 1YGPA 2HXGA 2VK8A 3NOXA 3AXSA 3MT8A 5FFFA 1CFZA 3FDZA 3ZDRA 5CPBA 3LT0A 2JCSA 3H11B 5IKXA 2YS7A 1XTVA 1DELA 1K6EA 3S5JA 4DSAA 2PUHA 1SCUA 2C9OA 2XBUA 1XD2A 2WYOA 4FQ8A 5K3BA 5JO9A 1AB6A 2SECE 1WHTB 1WZCA 1D2AA 1Q44A 1UZAA 3KC2A 4XGQA 3ADOA 3JU3A 1NTOA 2AN1A 4YCLA 1UBCA 2GZDA 4AJ4A 4BP8A 3EGEA 5EIOA 3L1HA 4ALJA 1EAYA 2ANBA 5HBRA 3IAFA 4XW2A 4FQ7A 4XR9A 2A3NA 4ZHQB 1F0NA 2E48A 4L0QA 2NZXA 1LJLA 1U90A 4U00A 4U6NA 4LYDA 3REQA 4DJDC 4QOGA 4KAXA 1RYNA 1G5HA 3CNLA 3ZDCA 2QENA 1Q16A 1VB3A 1NUQA 1LXCA 5CA0F 3C7CB 5JWRA 3PPIA 5GINE 1GZ3A 3KJXA 2F00A 1H0HA 1VYTA 3N5KA 3M70A 2NUTB 3QXSA 4YJGA 4IDAA 4YJDA 1KAMA 1VMAA 5IVIA 3WDMA 1BXRA 1K7XB 2GN8A 4MYCA 3ISVA 4PEVA 5FEMA 1I14A 3C6BA 4TMKA 3AX6A 3LA6A 4K81B 2N3ZA 1G9SA 4V39A 1U1CA 4YXWA 4HXEB 4B84A 4E03A 1ZUHA 2Z09A 4OU5A 3H2HA 4YRJA 4ZYVA 3S70A 3OLYA 1PKEA 3L0DA 3MUOA 3SPXA 4RW0A 2FN9A 4K28A 4S1VA 5IW8A 1BXZA 1KNQA 5JNVA 1FDOA 2KLHA 4Z2YA 3I2YX 1P72A 2OPBA 5JXGA 3KCQA 2NYVA 4ZEVA 2GBFA 1I6KA 3KKEA 4RL6A 2JAXA 1KI9A 2Y77A 1UBFA 3K5WA 4CI9A 3H2JA 1NMZA 3OE5A 4NYMQ 3C8HA 1U7TA 3F6PA 3KPYA 4KODA 4WFKA 4WW0A 2Z58A 3MNFA 3T9BA 2ID7A 1DIHA 2RHTA 1A8QA 3RGGA 4RULA 3GFRA 5TXGA 4WEQA 1XXHB 3V2GA 1DAKA 3VZQA 1H4QA 1ZJZA 3M0EA 3RC8A 2NSDA 1V2GA 3AWIA 5F77A 4Q3LA 4L8FA 4O4JB 4I5DA 3VZDA 4QRHA 3IVCA 2P2NA 1CQPA 1Y6RA 2IHYA 3LNTA 4AJIA 2OT3B 4OLJA 3Q3HA 2G07A 3IOMA 1MAVA 2UDPA 2P2SA 3DKIA 3LA8A 5JDCC 5KYVA 1S9DA 1WKCA 3DZIA 4AM8A 2HLDD 2OBLA 3FETA 4QOIA 4YJGB 5DCYA 2J7PA 5DXFA 2FDCA 4B32A 1Z07A 1SCJA 1Z2NX 2B9EA 4DR1B 3FJYA 3RG8A 1XD2B 2I99A 2QTLA 5E8JA 2XKKA 1CEXA 2RBKA 3E27A 1TQ2A 2PUBA 3UAOA 1TU4A 2W2LA 4KRYA 4MWCA 3L46A 1MZPA 3ESQA 4WIAA 3A14A 4PG7A 1QO0A 2AJCA 3AF6A 4CM1A 2GEBA 2GNOA 5AT1A 1JR3A 4D92A 1TPZA 3DC2A 3GUVA 3T95A 4FB5A 1YR1A 1BVUA 1GQOA 1P6QA 1REQA 3V1MA 1SCUB 1SIBE 2G40A 4PV7A 4J2OA 3LVQE 4BV8A 4O4IA 2F17A 5BMVB 2IKSA 2BELA 2WFLA 4MAAA 4RD3A 4OP3A 4V3BA 3LUCA 1NR1A 1FP6A 2LWIA 3NM5A 5AM0A 2JLQA 1QCCA 2EJVA 1BMTA 1QVVA 3FAZA 1BE8A 4PNPA 5CUQA 4GVXA 1Q7GA 1SVSA 3EZ6A 3GRCA 2FPUA 3JTEA 4W9NC 4OXKA 3VX3A 5BYAA 3N0XA 3AVTA 1CUJA 3ORSA 1YULA 3IAUA 2YQ4A 3EOBI 4XUEA 3RUDA 3SYMA 5BYBA 3EA0A 1G21A 5IYZF 1UWCA 4BNIA 2A86A 4H18A 2YJNA 5EWJA 5LMZA 1XCPA 2GPYA 2LBPA 1MNAA 4MRSA 4MA0A 3OU6A 3U7GA 2G1JA 2BI7A 3P94A 1IEXA 1TAHA 4AJNA 3EXFB 4BFUA 3U3OA 1OH6A 3SD7A 1V2HE 1M2EA 1UKBA 3FPGA 3TD9A 4LF9B 4AZ3A 3HVHA 1R4AA 2H2DA 2ONCA 4MJ7A 4IFEA 4WNIA 5K3FB 1SBHA 4JEHA 4R2XA 4YVFA 1OASA 2YV3A 3G2MA 1IWOA 3NETA 5BVHB 4ZCSA 3OLCX 2OGUA 1RZUA 2BFFB 1CUFA 3UUFA 5IS2A 1H4TA 5KNCH 1JS1X 3IAEA 2IJGX 3QM1A 1T34A 1PDWA 3A2NA 5KCZA 4CDRA 3FHLA 3KP1A 5BRJA 2IHJA 5CEEA 5LKRA 1BCRA 1FNDA 1N6RA 1UMKA 3V8RA 4GE3A 4Z0NA 1DEAA 1E79A 2B9VA 1OREA 1GSHA 2OWDA 4UKDA 3ZUGA 4WCDA