2CJPA

Structure of potato (solanum tuberosum) epoxide hydrolase i (steh1)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
320
structure length
320
Chain Sequence
KKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLRGYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPDKVKALVNLSVHFSKRNPKMNVVEGLKAIYGEDHYISRFQVPGEIEAEFAPIGAKSVLKKILTYRDPAPFYFPKGKGLEAIPDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAHFVSQERPHEISKHIYDFIQKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords EPOXIDE HYDROLASE
publication title X-Ray Structure of Potato Epoxide Hydrolase Sheds Light on Substrate Specificity in Plant Enzymes.
pubmed doi rcsb
source organism Solanum tuberosum
total genus 118
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 3.3.2.3: Transferred entry: 3.3.2.9 and 3.3.2.10.
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cjpA00
5ALGA 3V1NA 1LPNA 1LGYA 2VJDA 4W9RA 2VTVA 1ORVA 5AOAA 4BP8A 4HXEB 4UBJA 1TIBA 3GROA 3GUUA 1QIDA 1R50A 2AJDA 4AZ3A 1CUYA 2XUKA 4G8CA 3G0GA 4AXBA 3R0VA 3KOOA 4M0EA 4LYDA 5AK6A 4NS4A 3JW8A 3QMWA 3D59A 3EQ7A 5DYYA 2IX9A 3ICWA 3QYJA 1XZEA 3STTA 3S8YA 1XROA 4DSZA 1DU4A 3WJ2A 1XQVA 3TRDA 5IVHA 3F96A 1EDDA 3PFCA 5FLKA 4E15A 1JI3A 2J4FA 4OB8A 1DINA 2ZYIA 2GZRA 2DSNA 3CN9A 1XRMA 1BU8A 5CBKA 4UBMA 1MT3A 3G0BA 1CRLA 1FSSA 4DLNA 4CCYA 4QLOA 4DM7A 4ARBA 1JMYA 4BB0A 4UHCA 3K2IA 3WL8A 3H04A 4DTCA 2XQFA 3IUJA 2ACKA 2VJAA 4H7JA 4ZWNA 2CMFA 5K3CA 5AP9A 1CUCA 2HA3A 3I2GA 2I3ZA 3VJMA 2DR0A 2GBGA 3FYUC 2WSLA 4CFSA 4QE3A 2JGIA 4H7DA 2Y2UA 3AZOA 1CUXA 4GW3A 1E8MA 5ALDA 4G5XA 4HS9A 1LZLA 3WKCA 2VEOA 5ALPA 4B82A 4HRYA 5EHZA 4ROTA 4G9EA 4K6GA 4GI1A 3QPCA 5AH0A 4UBNA 1FFBA 2XQJA 2DHDA 1WB5A 5FKJA 4BZWA 5ALLA 1N5MA 1R4ZA 1KU6A 4BTVA 3R3WA 1BEEA 3T52A 3G9ZA 3HZOA 1J2EA 2YASA 3U0VA 4F5ZA 1EX9A 1XQYA 1QIGA 3R40A 1XZBA 4XJVA 3FAKA 5D3KA 5CT6A 1R9NA 4DMFA 4F0JA 3EQ8A 4K6KA 4PV7A 2J4CA 3FYUA 1ZJ4A 2XDWA 3WWEA 1C7IA 2JIDA 3WLAA 3AIKA 4Y9SA 3QH4A 4H7EA 2QVBA 2QOEA 3VVLA 3QMMA 3BJMA 3I1IA 1BROA 1W52X 2VJBA 1ACJA 2GYWA 4TVKA 4FKBA 2ACEA 2D5LA 2J3QA 5BWBA 2HFKA 1XZHA 1MX5A 2H9YA 5FPPA 2OCLA 2P8SA 2X76A 2G63A 1L7QA 2DHEA 2WIKA 3STYA 5JZSA 1ZICA 4G9GA 3WIBA 1BN6A 4HZGA 3DDUA 3STWA 3WI7A 4FMPA 3S2ZA 4QDTA 5A7HA 5T4HA 5DJ5A 1ODCA 3G8YA 4JYPA 2C5GA 1AUOA 4ZV9A 4KE7A 2WJ3A 5ALQA 1CV2A 2QM0A 3CXUA 4I3FA 4C88A 4DIUA 5HCUA 5JALA 2ZYRA 2NW6A 2O7RA 5E4YA 2WUEA 4CCYB 5IVKA 4DNFA 1LPSA 5C81A 1CUIA 4W63A 1XRQA 5EHXA 2HA0A 4XVCA 4X6UA 2PL5A 4Q82A 3V9AA 2H7YA 4KE9A 4LYEA 4QDZA 1XZIA 3B5EA 4A16A 4MYSA 1XLUA 2OCGA 3I6MA 4BC1A 2VA9A 4QA9A 3F97A 4Q34A 4Q1VA 2R11A 1B6GA 3M3DA 5C8VA 1MNAA 3R3XA 5DTJA 1MTZA 2YXPX 5SYMA 3UUFA 4UBIA 3AZQA 1NU6A 4OB7A 1QZ3A 4J0IA 2YH2A 4P93A 4DMCA 3WQHA 3I2FA 3CCBA 3B3QA 4WCVA 1X2BA 1YSCA 5AI8A 2OQVA 5DNWA 2PSHA 3ZI7A 4Q3OA 1W76A 1QGED 3W05A 4B81A 5FRDA 2XMSA 3A2LA 2WFLB 2QRUA 1L7AA 5E4TA 3O4IA 3WWDA 4FBLA 1E8DA 1U8EA 2JGKA 4OD0A 1Q0RA 1CUSA 3DL4A 2PSDA 1WPRA 3V1KA 2XMRA 5JAHA 3V48A 2PSEA 1TK3A 5CH8A 3WIOA 5ALYA 1K8QA 4FLMA 3FYUB 1Z68A 1GPKA 4IH9A 2WIJA 4UHFA 5JD4A 1B41A 2B20A 1MX1A 5AKIA 4WDRA 2OG1A 2XUJA 1UXOA 3WYDA 1XQWA 5AM2A 5E2IA 4BC0A 5LZ4A 2XUHA 3IBTA 2GBIA 3GA7A 4B0PA 4BP9A 1J06A 1CUAA 1QE3A 2G4LA 4PSUA 2OGSA 3BE8A 2Z3WA 5H3HA 1QIMA 1EI9A 2K2QB 3WA6A 1A8SA 1UK8A 4ARAA 1GXSA 5AKJA 4BCCA 5CW2A 1QO7A 3GZJA 1TCCA 5AM3A 1JFRA 3WYNA 3FNBA 3ED1A 1G66A 5JZ9A 1W6RA 3DYVA 4C4ZA 4KAAA 2Z3ZA 4EA6A 2OLEA 4S0XA 1QIHA 1AQLA 3ZV7A 3E0XA 3C6BA 1AGYA 2AXEA 4Y2UA 5K3BA 3GFFA 3BL8A 1A7UA 4YPVA 3WL5A 1A88A 3AINA 4LXGA 4WDQA 1UK6A 4Q05A 1Y7IA 5AM5A 5AKLA 3DJYA 3BJRA 3FVRA 2ZJFA 5CTAA 1TCAA 2QXTA 3D0KA 1VZ2A 4WY5A 5C8XA 1DX6A 1R1DA 3HC7A 1DT5A 2OAEA 4OB6A 5HKBA 2XT0A 3PICA 4U2CA 2EDCA 5A6VA 5A62A 1UT6A 1X2EA 5D6OA 1GGVA 3H2HA 4JUIA 2JEYA 4Y2SA 3MGAA 4ITVA 3G9XA 1ZI6A 4Y2VA 1EH5A 2VAVA 2XMCA 3H19A 5ALTA 5AOCA 1XRLA 4J0KA 4FLEA 1GQSA 4PNZA 3O4JA 5D3ZA 1GPLA 2CJPA 1EA5A 5A2GA 4BCDA 4L3WA 4N8EA 4PQEA 2O7VA 4AO7A 4EY5A 5EIEA 1Q0ZA 1VZ3A 2OXEA 1XKTA 5CH3A 2BKLA 1CR6A 1R9MA 4X71A 4Q3KA 1FFAA 4DNOA 1ISPA 1N8SA 2C4HA 3GELA 1LPBB 4RGYA 3W9UA 2VSQA 3VKFA 4W1PA 1CIJA 1ZOIA 3OURA 3EQ9A 2VT6A 1L7RA 4KJXA 2WTNA 1EDEA 2WFZA 3BDIA 5AM4A 5K3DA 2OGTA 4Y2JA 4ZXFA 1IUNA 5AKGA 2WG1A 2XI4A 4QWMA 1YA8A 2QJWA 3FLBA 2XUDA 4C01A 2WU4A 4MWSA 4FTWA 1OILA 2XMDA 1CLEA 2HA2A 1JJFA 2EDAA 4KAJA 1UFOA 5HF6A 3OPMA 3B12A 4N8DA 3MUNA 4WFIA 1BRTA 1HQDA 1XKLA 1ZD3A 3HACA 1ACLA 2V98A 1QONA 3P2MA 3VISA 3BWXA 3ZLTA 5DYWA 4NVRA 1QFSA 2PSFA 2Z8XA 5ALUA 2JGMA 3L1JA 5AKXA 1USWA 3X3HA 2DQZA 3N2ZB 1YAJA 1EB9A 3FSGA 3JWEA 1UOQA 3HRHA 2ZSHA 1HLGA 1QIJA 4YK7A 5E4JA 4CG1A 2PSJA 1OCEA 3M82A 4L0CA 1IUPA 3C43A 5AOBA 5AKZA 2XMQA 2WQZA 4QDOA 4J7AA 1CUBA 3ZLVA 3R3VA 1ZI8A 5BWCA 4BVKA 3RM3A 4CG3A 1D07A 4HTAA 4P08A 2X5XA 4K2AA 4IHAA 2Y2VA 1CVLA 4AX4A 2FX5A 1ZI9A 1XLWA 1IUOA 2XUQA 3Q0TA 3AIOA 1LPMA 3W9BA 2VATA 4UFOA 1J1IA 1G4HA 4KR0A 5T4EA 2CUTA 5FDFA 1XZAA 1VLQA 3AUKA 1WB4A 4LHEA 3IUMA 5CH5A 4AN0A 1WM1A 2OGZA 2RONA 4AN1A 3D4LA 5BV7A 1MAHA 1HPLA 2WJ4A 5ALJA 5LZ9A 4MXDA 1YAHA 4G8BA 5LYYA 4PO3X 1T2NA 1UKCA 4UHDA 1P0IA 4U2EA 3R3UA 3HYSA 1A8QA 1AC5A 1RP1A 2WFLA 2ZJ7A 2OPHA 5HKAA 1QOZA 1DTEA 1ORWA 4K6HA 4LIPD 4RPCA 1E66A 5HQ3B 2JGJA 5AKHA 3IB3A 4XIIA 2XB6A 3KD2A 4NMWA 3WKEA 2JGEA 3PDCA 5JANA 2BCEA 2WUFA 3KSRA 1EINA 4X91A 3WK4A 4X3CA 5AK5A 3STVA 3WK6A 4RE6A 3LLCA 2ORYA 4JEIA 2Y6VA 2GZSA 1E3QA 1XZKA 4IO0A 4B7ZA 3MVEA 1XZGA 3A70A 5FPQA 2RAUA 4CI9A 1YS1X 4PF1A 1XZLA 1XZMA 4BAGA 3FCYA 3EF3A 4PSDA 3SWWA 5KWJA 3BDVA 3H17A 1UK9A 4F21A 2AJBA 1DWPA 5FOQA 1XRRA 3I6YA 4OYYA 4J0HA 1A8UA 3PUHA 4Y2PA 1G5FA 1LPAB 1MNQA 4B9EA 4X92A 3WA7A 1TRHA 2EEPA 1CUEA 5IVDA 5JAOA 3DNMA 3FLAA 4EZIA 1P0PA 3AFIA 1IVYA 1K4YA 3G0IA 3STXA 2XMGA 1HBJA 1GPNA 1SOMA 4X00A 5AM0A 1VOTA 3WL6A 1JJBA 4AB1A 5FXMA 3VVMA 2ZJ6A 3O0DA 1JKMA 3I2KA 2HL6A 2W6CX 3STUA 5JADA 4QNNA 4C6HA 3IUNA 2BGNA 5HZGA 3C5VA 3G0DA 3KWFA 3WZLA 2BUBA 3D5EA 4B84A 5JAUA 3EIOA 1RYYA 3WWOA 1DQYA 1ZGBA 5LP1A 5D7BA 1U2EA 1QIIA 2HM7A 1IMJA 3WL7A 4FNMA 4OCZA 3OM8A 1T4MA 1R88A 1Y7HA 3I2IA 5FUMA 1O6GA 2VT7A 4FWBA 2ZYSA 2PBLA 4EY6A 3V1MA 2XE4A 4H7HA 5JZBA 4MJ3A 1YASA 2G5PA 3WZMA 5AKEA 4BRZA 4E11A 2WIFA 4FFVA 3VJKA 3O4HA 3JYHA 1DQZA 2QR5A 1PJAA 5DLPA 4HAIA 2RI6A 3LCRA 2GBCA 4LXIA 4Y2TA 3C45A 1AZWA 5HK8A 1ZD5A 1ZD2P 3OG9A 3OOSA 3DD5A 4B80A 2C7BA 1CFJA 2J3DA 4C4YA 4DMHA 5EIAA 4X6YA 3C6YA 3WK9A 4UFNA 1H2WA 5F4ZA 4DNPA 2C0PA 1F0NA 3H2JA 2ZSIA 5BOVA 4KYVA 2IIVA 1FFCA 4BE9A 4EY8A 1DT3A 3WKAA 2C0QA 4B6GA 5ALRA 5EHQA 3HJUA 3R3YA 3ZPXA 1XZFA 3LP5A 3W06A 1VJ5A 3UUEA 3LS2A 7YASA 1YA4A 4U2BA 5CXXA 1MPXA 4ZREA 3D7RA 1QFMA 2QTBA 3WWPA 5HF8A 3N0TA 3PUIA 1MO2A 4U2FA 1WPXA 2XUOA 5T4FA 4BATA 5CURA 4G4JA 5ISMA 5I9IA 4MEBA 5AI9A 4QZVA 2Y6UA 5AKKA 2UZ0A 2RIPA 2VQ6A 1VE6A 4X85A 1M33A 5I7UA 5JD5A 3DQZA 4UFPA 5JIBA 5A71A 1VA4A 5EIHA 2XMZA 1JJIA 2PU7A 4Q3LA 2W22A 5ESRA 3PF9A 2WG0A 3VJLA 4WJLA 2WIGA 4EY7A 5DTIA 2PUHA 4V2IA 2IITA 1F6WA 1XFDA 1EVQA 4J3JA 4JH0A 5JAPA 2QT9A 1ETHA 2WTMA 2XQGA 1H23A 4MEAA 5FP0A 3NGMA 2XQKA 1GQRA 3E3AA 4MQMA 2XMBA 4CCWA 3CCCA 3L1HA 1HL7A 4AMYA 2CZQA 4GXNA 1TCBA 4J0GA 1AX9A 4EHBA 3F9CA 4AZ0A 5CRIA 1LZKA 3QPDA 5CT5A 4UUQA 2PU5A 3QPAA 4BZZA 2FJ0A 3C87A 5IVIA 1WHSA 4KE6A 3D2CA 2RHTA 1G42A 3DYIA 1UKAA 4DGQA 3HEAA 4PW0A 5AI0A 1CUHA 3UMJA 4GEGA 2QXUA 1WB6A 2V9ZA 3GBSA 1FJ2A 5AICA 2HIHA 3Q8WA 1XLVA 4Y2QA 4FDMA 4OU5A 4FBMA 3AIMA 4IH1A 4AQDA 2XUFA 3FVTA 2JF0A 3MUOA 4X6XA 2XUPA 1GT6A 3BF7A 4BAZA 3H1BA 1GKKA 1QLWA 1SCIA 1QTRA 3WKDA 3QZUA 4N5HX 3IURA 1WCYA 4FNGA 5HFNA 4HRXA 3H0CA 4QDXA 3O9MA 5LZ7A 2WUGA 3ZLUA 4W1RA 4BE4A 4U2GA 5ALSA 3O95A 3KXPA 2ROQA 2VF2A 5SYNA 3G7NA 5A7GA 1UOOA 5AI6A 3H2KA 4UHBA 4L9AA 3U1TA 3I2HA 3HLKA 2WKWA 1U4NA 4UBOA 5HQ3A 1LPPA 3RLIA 4BDTA 4BAUA 2V96A 3TEJA 1BS9A 3DKRA 4DMKA 2GYVA 1QIEA 3H18A 5ALZA 5KREA 2FJPA 1CEXA 4Y7DA 2H7CA 3HSSA 5K3AA 3D2BA 4OPMA 2WHPB 3FSGD 4H18A 5K3EA 2YYSA 4FHZA 3C5WP 1DWQA 3NWOA 1CQWA 5K3FB 5ALFA 3C70A 4G4GA 4B83A 4H7IA 4ZRDA 1HKHA 4H0CA 4CG2A 1THGA 4CIBA 3F8SA 3ANSA 3SC2A 2QMQA 3RK4A 1YB6A 1DX4A 1ZIXA 3QITA 3I1YA 3AJAA 4KRXA 1PV1A 3BF8A 3G0CA 2WM2A 3FLEA 2FUKA 1P0QA 2PM8A 3D2AA 2PVSA 3K6KA 3SX4A 5JD6A 5CT4A 2PUJA 1EHYA 2WHQA 2QUBA 3ESDA 3E1GA 1BN7A 2WJ6A 3DOHA 5EGNA 1IZ8A 2HADA 3ANTA 1ZIYA 3IVMA 4QLAA 4WY8A 4A5SA 2HU5A 3QBJA 2PKYX 3RARA 3WMRA 3H2IA 1NU8A 1KU0A 1CUFA 3IDAA 4MWTA 1NX9A 5A7FA 1LBTA 2XUGA 4DSAA 2WU3A 2WG2A 3K9BA 4HXFB 4WFJA 1N1MA 3ESCA 4KAFA 4W1QA 4OYLA 2CKMA 1JU3A 4G8DA 1H2ZA 4IH4A 3OTQA 3RKSA 2Y1KA 5LZ2A 3DEAA 2HA6A 5JATA 4EUSA 4D9JA 1H2XA 3IULA 2AJCA 4JYMA 5LKRA 1CUJA 1ZJ5A 5ALNA 4LXHA 5AJHA 1CQZA 2QKYA 1WOMA 1OXMA 1EB8A 3WK8A 1P0MA 1K5PA 1K63A 4ZGBA 3TGLA 1THTA 1SCQA 5JARA 1XZJA 1E5TA 2QS9A 5KWIA 2WHRA 1VXOA 4INZA 2O2GA 4X95A 5C8ZA 4Y2XA 2ZYHA 3A2NA 4H35A 5CMLA 1O6FA 1BCSA 1MAAA 3QVMA 5AO9A 1ZGCA 3EBLA 2JEZA 4H7KA 4WFKA 5HF5A 2I78A 3BXPA 1Q83A 4GECA 2JGLA 3DCNA 1U65A 5DWDA 3ESBA 4KACA 1BE0A 2QUAA 4QWWA 4X94A 1LBSA 5HK9A 4ZV7A 4ETWA 1XRPA 2E3JA 1JT2A 2BAGA 2HA7A 2PPLA 5J3JA 2VAXA 2XUIA 5HF9A 2Q0XA 4GBGA 4B9AA 3I6ZA 3FYTA 4LKOA 2V97A 4FLFA 4EB0A 4GHWA 2LIPA 4P9NA 5AK4A 4RE5A 5ALHA 3SK0A 1QO9A 5DNVA 3M83A 4BRSA 2DQYA 4OU4A 4K5QA 2AJLI 5AI4A 3DL7A 1H2YA 2HA4A 1XQXA 1QTIA 3KWJA 3H2GA 4GLBA 2ZVDA 2AJ8A 2BJHA 4KEAA 4BBZA 3G9UA 3ZWQA 1CUUA 6YASA 1YS2X 4OUKX 4FFWA 4X90A 3I2JA 4GWLA 4E14A 3AILA 2VJCA 2DCMA 3ESAA 1W75A 5YASA 4M0FA 3QMVA 4G4IA 2ONCA 5CXUA 2JGFA 5AM1A 4YASA 4C89A 3R41A 5T4BA 1K6EA 4A23A 1CPYA 5ALVA 4J0CA 1MN6A 2I03A 1YB7A 4N8SA 1KEZA 2B4KA 5AKYA 1QIFA 4XX1A 5LZ8A 5LKAA 3DLTA 1YR2A 4L72A 4MQLA 3VDXA 2GBFA 2GYUA 2DFPA 3F67A 2O2IA 4TGLA 2CB9A 3WWCA 4CIAA 4N5IX 4IQ4A 3D3NA 1ZD4A 1SFRA 4U2DA 5DYTA 3PI6A 5DNUA 5ALWA 2CBGA 3FCXA 4BVLA 4MYDA 5IKXA 1UK7A 2HA5A 5AIBA 2HHAA 5I8PA 4BYMA 2WUDA 5LIPA 4O08A 1UZAA 3IA2A 3BIXA 1X70A 4JNCA 1MJ5A 1HDEA 4PSCA 1LNSA 2C58A 2QJRA 1FFEA 3W2TA 4UBLA 2WIDA 1XZCA 3A6ZA 1C7JA 2OAGA 4BTLA 1F0PA 3IUQA 1VA5A 4RNCA 5JYCA 3FOBA 1AMNA 3FBWA 1Y37A 1LPOA 3CN7A 1SCKA 1UKBA 3T4UA 1QJ4A 3DOIA 4Y2RA 1EK1A 1Q84A 5AK3A 2B61A 1CUDA 2WHPA 3AZPA 1CUWA 3LIPA 1FFDA 4FOLA 3G02A 1UOPA 3C8HA 2H7XA 1BEZA 3O9VA 2RGUA 5K3FA 1LLFA 3WKBA 4AMZA 1CUGA 3YASA 3ICVA 3WJ1A 4HVTA 4Z49A 1H22A 1YCDA 3HXKA 2ES4A 2BUCA 2HDWA 3W04A 4BVJA 2WLSA 5FV4A 5ALMA 2BFNA 1ODSA 3TJMA 2HU8A 4TPKA 1MX9A 1VKHA 4C87A 1JU4A 4Y2YA 1N5RA 4OSEA 4QEKA 4UPDA 3O4GA 3L1IA 3BIWA 5ALIA 3IIIA 1C4XA 4BDSA 5CT9A 4C4XA 4AO6A 3PE6A 3QM1A 4KRYA 4GDMA 5IH7A 3LIIA 2B9VA 3C6XA 4H77A 2HU7A 2BGRA 4BCBA 2HFJA 3HABA 4YX9A 1IZ7A 3WK5A 2WILA 1GKLA 5ALXA 1DWOA 5AI5A 3V1LA 4F60A 1XRNA 1S8OA 4UHHA 1PFQA 4I19A 2CEKA 2PX6A 1E89A 2ECFA 5ALOA 3PFBA 4G1FA 1ODTC 1W4LA 4KE8A 1UWCA 1JMKC 1EVEA 4X93A 4DNQA 3ILSA 4ZI5A 3FWHA 2XUAA 1I6WA 4NZZA 5ALEA 2HRQA 5EHNA 5EFZA 1XZDA 1TAHA 2BUAA 3E4DA 3VXKA 3DS8A 3OC0A 1CUVA 5KBYA 3I28A 4UBKA 1WHTA 4H7FA 1AKNA 2WFMA 3H1AA 5JASA 5ALKA 2XQIA 3NOXA 3KDAA 3PF8A 1TKRA 4XWGA 2XLBA 2Z5GA 4B0OA 1EDBA 4AO8A 5K5EA 1GZ7A 4J0DA 2RHWA 2R8BA 5LZ5A 2OCIA 2I3DA 4M0MA 2C5FA 2DHCA 4EBBA 5HFAA 3G9TA 1VXRA 2XLCA 5LLSA 3NUZA 2QZPA 5CT8A 3A2MA 1VE7A 1EK2A 2OQIA 4E46A 1EXWA 4P92A 4J03A 1RWQA 2HRRA 2OCKA 4UHEA 1TQHA 3C8DA 1E8NA 5EI5A 1J07A 4X7BA 3F98A 2Z8ZA 3C6ZA 4J0JA 2O2HA 4B85A 2JBWA 1SC9A 1MU0A 3DKKA 3HI4A 2H1IA 1F8UA 5AIAA 1BCRA 1QIKA 4HXGA 2G5TA 4X97A 4QDUA 1R3DA 3WK7A 5C7YA 1AURA 3R3ZA 4DYHA 4I4CA 4W1SA 4EY4A 1CUZA 3M81A 2D0DA 5AHXA 1W1IA 2X8BA
chains in the Genus database with same CATH superfamily
1QX4A 3K1AA 3LPLA 2NAPA 3L7BA 1ZMRA 4HWRA 3V1NA 1HLPA 3PK0A 3IBCA 4YLYA 1VHWA 2QL6A 1CU1A 2VJDA 2COUA 5CLGA 3GP8A 4B3FX 2PA0A 2CNWD 3GARA 1ZVVA 2ET6A 1E7QA 1Y1LA 2Z5LA 1HFWA 3NV7A 4PPYA 4W9RA 5GOZA 2VTVA 4BNYA 1TZCA 4Q4DA 4BV3A 4DQKA 3DKIA 5AOAA 2GLUA 5KOJA 3DWIA 4BP8A 5GQSA 2FDXA 3ED5A 3P9CA 2R65A 3GROA 4HPWA 4LE0A 4WN9B 1C9KA 1OGYA 1QIDA 1R50A 3VJRA 1KTIA 1E6WA 2C2KA 1PT8A 1ZRSA 3PT5A 1C41A 3TL2A 1KH1A 1RYHA 3DOEA 4QUEA 3ZS8A 2NV6A 3O8OB 3PPVA 1CP3A 1K7YA 2DSTA 4IIYA 3UB3A 3DDWA 3FUUA 2G76A 4KAXA 4JR2A 3IE0A 5E2BA 1CYEA 4M0EA 2KW5A 5BSVA 1G20E 1ZD8A 5CYPA 4C0AC 5JPIA 2JH8A 1QNLA 4E03A 2V0CA 5LQUA 2BOVA 4E2XA 3GJQA 1I7LA 2FZVA 2P6UA 3ELYA 3QEOA 1TECE 5BUCA 4BLPA 1R0YA 1SC6A 3D59A 1ZMTA 2DULA 5ITZA 1FDRA 1FDIA 1B0ZA 1QNFA 2HUNA 1HO3A 1ODLA 2QVXX 2XWQA 2BBTA 4KQKA 3ZHBA 3V3KA 1UMBA 3QYJA 4CU5A 1PGJA 5JT1A 1B6SA 3CEPB 3GPLA 1XZEA 3LT4A 2GEKA 4XQGA 5HPYB 3STTA 3MCAA 1AKTA 4YONB 3L84A 2RAPA 5L6LB 5INTA 1EZ1A 4KOEC 1Q0LA 4C0HA 1GTRA 3TRDA 1QFXA 1C3XA 2WF9A 3R09A 1SKYE 1BC5A 3IT2A 1HK7A 5HRAA 2KBEA 5FI0B 3QU5A 3RTBA 4B6OA 1W2GA 4ZO9A 1KXZA 4E15A 4L08A 1JI3A 3WV5A 2BTOA 4G41A 4OB8A 1DINA 2W37A 3CLSD 3GPDG 2FB9A 4NZPA 3NBUA 2I2XB 2JS7A 1ZLYA 2O8CA 1O9GA 2DSNA 2EHJA 3DDCA 2G9QA 1EGQA 1CLUA 1Q7CA 4LQCA 1EE9A 4PVDA 1O3YA 5IVPA 5DCYA 3PVSA 5CBKA 1MT3A 3TQQA 3IKVA 2JI8A 3ZCQA 2VHCA 1DIRA 3EZFA 3ZHZA 1CRLA 4DLNA 4HYTA 1DJMA 1NXTA 5BQ3A 3DR5A 1BW9A 4QLOA 4YUXA 2OZEA 2A5FA 2PGAA 2QZJA 3FBTA 1E0AA 4ARBA 2IOFK 3BBPA 4RHUA 5G4LA 1JMYA 4WGGA 2X9GA 4EG5A 4D4IA 3LOUA 2VNSA 1ISRA 3DH0A 2WPDA 4B4UA 4BB0A 1EXMA 1M2KA 1NY6A 2ZYUX 4OP1A 2O3SA 3K2IA 3FJ1A 2VLIA 5LIRA 1BHO1 1URPA 1TK9A 2RCYA 3FCCA 1PHPA 4CKXA 1YZYA 2EBUA 2PXAA 2IXBA 3ANYB 5CYGA 5JSZA 1YA6A 1MJHA 1GFWA 2ACKA 2VJAA 3Q7TA 1E3EA 5EKUA 1D1SA 1WAMA 3U7EB 4EL0A 2QRPA 4CKZA 3GJXC 4E2FA 2JVIA 2IPXA 1N0HA 4FXOA 2CMFA 4K9OA 4UU8A 4DDUA 1BU5A 2FKAA 1CUCA 1GQYA 4PBRA 3FTCA 3ZCSA 5EUQB 2UVPA 1GYPA 1RAFA 3EMVA 3BAFA 3KOUA 4CLDA 1N9GB 3WGVA 3ZVMA 3VJMA 1XVLA 2DR0A 3KFLA 1SVLA 2B1JA 1GYQA 5IBPA 2AJTA 2MOKA 1VE1A 5BR4A 1SOVA 2HK6A 2WSLA 1FE8A 2RFLA 4EECA 2VDVE 1U0TA 5D01A 3QEJA 3MYYA 4AP9A 2VRCD 4H7DA 2WKQA 4NU8X 5LOVA 3N8DA 4NU0A 2ODBA 3L7DA 4B5KA 1HFEL 1MDBA 4HDMB 3AZOA 2NV2B 3FGPA 2FQ1A 4GW3A 3KVRA 1UWLA 3UGTA 1LZLA 4C20A 4WFQA 3WKCA 4NF2A 2PWAA 2YS6A 3RUHA 1IEQA 3B6ZA 1PQYA 5C1BA 5EHZA 4LK2A 2VH5R 4UVDA 5CGQB 4TQ9A 1TJNA 1D0IA 2P40A 3KVVA 2CDNA 4MIOA 5IM5A 3A31A 1CS0A 3TTTA 4BPRA 2AFHE 3GRUA 4NEHB 3LQ2A 3TKAA 5J2TB 1IXSB 3B7WA 2XQJA 3AERA 3PUVA 2IHBA 1WB5A 4R2JA 4RF4A 4MUEA 1FQWA 2WI8A 4ND4A 5ALLA 1JDZA 4CKBA 1DPFA 1K2VN 3G49A 4GXTA 4BTVA 3RYIB 5KDDA 1G64A 3KR1A 2CK3D 4R1TA 2P78A 5ICGA 4DV7B 1BEEA 3FOEC 3QKTA 2NU6B 2YASA 1DRVA 2WJGA 2ZBVA 2D6FA 5CW1A 2WD8A 4E1BA 3FWPA 4R8KA 4UDYX 1N4AA 3SSAA 3G2JA 5JNVA 5EWLB 3WR5A 4M7WA 1QIGA 1M6WA 1EAMA 1AV6A 1T9AA 3RC7A 3COPA 4Z99A 3I01M 2OK7A 4XJVA 3JV7A 5GADl 2P7HA 3VTKA 4BUCA 3ZDEA 1QSGA 1DMSA 1JEQA 2QY9A 1JE1A 4PHGA 3IB6A 2B0JA 2D2IA 1AH2A 4F0JA 3KLOA 4AJ4A 1G5HA 1QE0A 4D8XA 5K7SA 1GM5A 2PGLA 5E38A 1C50A 1OAAA 1FJXA 1IM8A 2VRCA 3H4VA 1KMQA 3AHEA 1BRMA 2ZYVX 5FIUA 4DEYA 1F2UB 1C7IA 5SZIA 1M3SA 3FTQA 1PN3A 3BFXA 1ZRMA 3HN2A 1OZFA 2ZJ2A 3NYWA 5EY5B 3AIKA 2OT3B 1W0JA 3QIVA 3OTIA 3ND5A 4CMCA 2Q5EA 3HHEA 4QBFA 5ICEA 2Z1DA 4E6PA 3DOOA 5KHAA 3NWEA 4BMNA 2PGDA 4EAAA 2ZYDA 4OQ4A 3BJMA 5F1PA 3T3HA 1WQ1R 3K1AB 5FCDA 4YT2A 5DSZA 4KLAA 4IDQA 2OBBA 2VXBA 5IUJC 4IILA 2VJBA 1HXHA 4CIDA 1F8GA 1JHAA 3SFVA 3NTQA 4UQLA 4MCIA 1K88A 5BN4A 5KOJB 5J47A 3OX4A 2B1QA 2CC2A 3EZ7A 3WLSA 4FNOA 5EQFA 1PK7A 2GAFA 2QK4A 1YQQA 2QX4A 1NSFA 2C3UA 4WX2B 2ACEA 3F9RA 4O4IF 2VYNA 3CZ9A 2J3QA 4D9HA 4GPIB 1CW2B 4PAWA 2ZRHA 3UBMA 2GBLA 5B58C 4LNUA 1W1UA 2H9YA 2JI6A 1Z13A 2XRFA 4NYJR 1L7NA 3ORYA 3CJTA 5FPPA 2IL1A 3GMDA 3JQAA 4YT5A 3VHXB 3PTAA 3ADOA 2J3IA 3QBVA 3QI7A 4EFNA 1MHPA 3KCQA 4HWPA 4FQ8A 2Q2OA 3AY6A 2GK3A 1E60A 5GAJA 4I4NA 5B3AA 3Q8XB 3RAGA 5ITZB 3SMVA 3TTWA 2Y1WA 2Z4SA 2FPMA 1UMBB 5CB4A 4QGAA 3EIUA 2QENA 1IXZA 4EJSA 5J4VA 1OH7A 4GXQA 3DZBA 4UM7A 4R7GA 1FUKA 3F7TA 2B99A 1WSWA 3PCTA 4RKWA 5F5NA 3HYCA 3G8DA 1GIAA 3KU1A 3P2EA 4HAUA 3WI7A 4FMPA 4GT1A 1UT5A 1YFKA 3B36A 3DL0A 4YP6A 5FBHA 3R7SA 3AVTA 2XD4A 1PFVA 1JHUA 2BEVA 5KKCA 3NIFB 1VSBA 2JKVA 1NZFA 1GG2A 4Q3AA 3BWYA 3P0HA 2GEVA 5JS6A 2XYVA 2J8ZA 4JYPA 2PZEA 3A32A 3OKAA 3T1HB 1UJCA 2NZUG 1AUOA 4Q9DA 2J3LA 3K0FB 4RLFA 1QRUA 4N7BA 4EELA 3HBAA 1XF9A 9LDBA 3CE9A 2B2XA 3K53A 2VVTA 6Q21A 1L7DA 4N65A 1P3Y1 5I7HA 1BX0A 1MW8X 5EA2A 5JFGA 1V5EA 4R1LA 4DIUA 4QAQA 5M5BA 4QRHA 1AS3A 1DDIA 4JEUA 4LZJA 4Q9JA 2Q49A 3L0DA 4FGSA 1NNEA 3AO0B 3ISJA 2XBMA 1BW9B 2Q6IA 1J1UA 2ZE8A 4MULA 1YFJA 3FUXA 4RVUA 4YRMA 4FR0A 1OV6A 3ZGVA 1NXSA 1CRZA 1G5PA 4OLHA 3ZEIA 4NE9A 3QIAA 5EHXA 1RVDA 3EXHA 2YRFA 1TOAA 2VDUE 1KEVA 3EDQA 5A0VA 1V37A 4PRZA 4X6UA 2BPOA 1BZYA 2YJZA 4K3VA 5DNEA 2EBFX 3K0KA 2B1GA 3Q7RA 1JF8A 4KE9A 3RDPA 1H3FA 4QDZA 1XZIA 3RANA 1A72A 2XE7A 5JSZB 1G2OA 4F93B 1E3WA 2FSUA 3CYFA 2C4NA 2C9YA 4EW1A 4DIDA 2A33A 3CKLA 4UPEA 4ZCIA 1MFPA 4MPRA 3FZGA 4G0YA 1PGPA 3KL4A 4QA9A 3KPYA 2Q2QA 4FMDF 4Q34A 3S1SA 3O94A 3AY3A 4JB0A 4OHMA 2GUGA 2UVPB 2H92A 3LUKA 3R3XA 4ITRC 3KQSA 1MTZA 3N8KA 1MORA 3KJEA 1OPRA 3DTVD 2V6MA 2CHFA 1G16A 3QVOA 1IOZA 3I9NA 4FQ7A 4I4TF 4U2KA 3I23A 1IPEA 1UC4B 1Z16A 3K6SA 4PIPA 1Z7YA 3I9MA 1SBNE 4MDHA 1XB2A 1QZ3A 5LPNA 3UAXA 1SHJA 3CIFA 5LOVB 3X2EA 3G88A 3G85A 3H8WA 4HD8A 4NE2A 4EFLA 1FOEB 1TM5E 3N8NA 2R8XA 3IHWA 4I5IA 1GZDA 5TF4A 2P1ZA 1AO3A 4D5EA 1FB5A 2J7KA 3C97A 4LCBA 4RXUA 2F4VB 1KORA 1NXPA 2C4VA 1X2BA 3AF2A 1BE8A 4ZK2A 3T41A 4TLMB 4BMCA 1GFZA 4O02B 1CS0B 1MABA 2I33A 3PQ8A 2BF7A 3A6PC 4KLNA 2DUJA 4AY2A 1KYIA 3K2QA 4UJ5A 3AESA 1FK8A 4JZKA 2GEJA 3AERB 5ER6A 5KB3A 2GJAA 1RYEA 1VHLA 1W76A 2FZEA 1QGED 2CXTA 1NVUQ 2FW8A 2VNAA 3NRCA 4GP9A 4KL8S 2H59A 4LKRA 4NTZA 1G3RA 4YQZA 4KG7A 5DBIA 1MENA 3OZAA 2PGOA 1J23A 4E22A 4KXQA 4PE5B 3D0RA 3HCNA 2KE5A 4LHZA 1RPJA 2FFRA 5IULC 3DZIA 4JLPA 1K98A 4O2BA 2JFHA 2PCJA 3B51X 3Q0EA 4J76A 3KKNA 4ZVQA 5KYNA 4QXRA 1NQAO 5TNXA 4LZLA 2RK4A 1CHDA 3DL4A 4J1SA 5KNBA 2JCSA 3V1KA 4F4CA 4BO6A 1U7TA 3JYQA 2IY7A 2Q3EA 2AF3C 3V48A 3T9AA 4CPDA 4DA9A 2JK0A 4YR9A 4B4WA 2XKBA 5CH8A 2WINI 1JEQB 1RJEA 3A11A 4JFRA 5ALYA 2HJGA 2YV3A 1K2WA 1X7XB 4PRYA 4R0MA 1K8QA 1ZX1A 4EKIA 3OZFA 1DDOA 4FGUA 1K4KA 4B7CA 2P62A 3NTLA 4FLMA 2GVZC 4P53A 4PS1A 4QXOA 2PBZA 4EHLA 2H4WA 1PDOA 5BRAA 4RVDA 5AVUA 1FSFA 2FI1A 3KJQA 3NBMA 5AVXA 5JRJA 2G04A 1YVPA 1U7HA 3ZE1B 1JTEA 1Q95A 2E48A 2VJKA 4O4LF 4AJOA 3ME5A 4RORA 5AKIA 4GI7A 4EEZA 3NEPX 4OA5A 1C7FA 2OK8A 1R5OA 4RCZA 4EA7A 3PEWA 2Q7XA 3PITA 4O6VA 3P9IA 1Y9AA 1U94A 4WCFA 5U1PA 4DXHA 3H7IA 4DCUA 1ILWA 3ZHYA 1W1WA 2NXCA 3D6AA 3LDFA 2WJHA 4YAJA 3UWDA 4WEOA 2IVZA 4II7A 4NQZA 2H0QA 1XQWA 4D46A 1VE3A 4OBEA 3OIWA 4DGSA 2I55A 3TKYA 1R6VA 4CE6A 1ORTA 1GJRA 3D3QA 3M5CA 1UFQA 2GBIA 2W6ID 1KIAA 3DHNA 2YV2A 3GA7A 5DE3A 5FORA 3RS4A 1EEXB 4HT3B 4NHOA 2VLBA 1XMSA 1KA9H 3OCZA 4HH4A 2VHWA 4K46A 3TNLA 1CUAA 3ET4A 4DC1A 2G4LA 4EZBA 2QV7A 2HH9A 3JR3A 2Z3WA 3E9QA 1IU9A 2B36A 5TRTA 3K0CA 2X6QA 5ERYA 1AA6A 4KYTA 3G2HA 3WA6A 1UR5A 1XJWA 3DGFC 4L50A 1CCWA 2DBYA 3JQ6A 4KVFA 2CVZA 4BCCA 3EVEA 3GNTA 3QTLA 4PN7A 2HMWA 3JQAB 5AVZA 1M8KA 5CW2A 3GZJA 5KYTA 1M5RA 3T8YA 4ETIA 2ASEA 3HKCA 3WMXA 1TCCA 3E7XA 5AM3A 1HT0A 1P81A 1KYVA 1M2JA 2F9LA 4YP0A 5KYVA 5A3VA 4NBNA 5J1TB 1Z6ZA 4DLLA 1G66A 4LZZA 3HVKA 1KI3A 4PX5A 1ZY2A 1QF6A 3DYVA 3N86A 2HQOA 4LE2A 3VU3A 4C4ZA 3LU1A 4FZJA 5ELLA 4QO7A 1U3WA 5BQPA 5DDIP 1M72A 4WZZA 421PA 2C2XA 4NU6A 4ODIA 3K8OE 4DBLE 1RW4A 3NBYC 4P83A 3ZV7A 2OYRA 5D5QA 1Y8ZA 4F84A 2NT4A 4JHXA 3SQNA 3QY0A 3LFHA 2AF4C 1JTFA 1CIVA 1B8VA 1DAHA 4UAUA 2HHHB 1I7SB 1WSDA 2DBZA 4CYMA 3H2YA 1N3LA 2BEVB 3BL8A 4FC7A 2X6TA 3TD9A 3V00A 3BRSA 2DWQA 1UKZA 4RQAA 4ZDIA 1OX5A 4LY3A 5FX2A 4CBVA 1QRTA 4R01A 3N2NA 4GAEA 4LXGA 3OQBA 3L4JA 1UK6A 1Z08A 1DL5A 1TM4E 1AGXA 1KYZA 3CWCA 4LBVA 2X7XA 4LYHA 3VV2A 1PCXA 1E9VA 5GWXA 1J20A 5KSPA 3ICPA 1E62A 1RM3A 1DKQA 1JR6A 1E92A 1OA1A 5EJAA 1OFGA 1Y7LA 5CTAA 1UPAA 2A9OA 2G8LA 4E13A 4FJ2A 4PC6A 1IBLB 4GZLA 1LLDA 5CAEA 1ABFA 1VRVA 1X7WB 2ZPUA 4G4SO 4EHDA 2JW5A 1QR6A 3TB6A 2DM6A 2GZMA 2ID7A 3RC8A 2PD4A 3SPXA 3FRHA 4A0FA 4NFLA 3WNBA 3ZKWA 4MVJG 4DY6A 1E94E 1T3HA 2JD0A 3EXHB 5DO9A 4Z2AA 4DAOA 3OPXA 1XRJA 1ZQ1A 2RKBA 3L4BA 4OFBA 3SQWA 3UEOA 2PKQO 3TLEA 4DQDA 1UT6A 3ICOA 1Z29A 1KVTA 1GGVA 2ZRPA 4HNAA 1V5GA 3EQ6A 4V0ME 2QBYA 1ZOSA 2XH8A 4YP9A 3PHCA 2ATIA 1ZHOA 3TLXA 2FR1A 1XG5A 1EWVA 4BEJA 1O95C 3MSXA 3LY8A 3RC2A 1UP6A 3GGPA 1FP4B 1K5GA 3H9QA 2A9JA 2CUNA 2C78A 1KY3A 2VAVA 2G4CA 2Y27A 4Y2GA 4CDNA 1LFAA 4YNBA 2XMCA 1JJAA 1I5OA 3MAJA 3PNOA 2R60A 2O14A 3B48A 2YZGA 1T6YA 2FQQA 3H19A 1KZ1A 2I6QA 5ALTA 1ILEA 3T95A 2LD4A 4J0KA 3ZBTA 5JNRA 4W5HA 3N5CA 5JHGB 4MMZB 2FPSA 5D3ZA 2FDRA 2Q8NA 5F1KA 3SDSA 2JATA 4NYMQ 5I7OA 1XBTA 2Z58A 4BNJA 3K4QA 4AJ9A 4L3WA 1SUDA 2J41A 3OZBA 2WR8A 3R2JA 1E3TA 4OL9A 2G4VA 3PC3A 3DFFA 1P1BA 5CP8A 2EG9A 3KC2A 3WDSA 4HFRA 2VC2B 4MKXA 4QXMA 4RFLA 4QU5A 4MIYA 2OXEA 3NOOA 3I3OA 3PRYA 4G4SP 4HRAA 1GL9B 3OCVA 5CH3A 3ZWYA 1CR6A 1F14A 2MYPA 3CUUA 1NRJB 2RDMA 4Q3KA 1FFAA 1MABB 2Q21A 1LVUA 3W5IA 2H0AA 3SR3A 1C4OA 1Y8RB 4CDGA 4WBNA 4NCBA 3MINA 1NJ5A 1XCJA 4P35A 5FQNA 4NZNA 3ENWA 5TSDA 4DNOA 3AESB 4UNRA 3M1IA 1SHZA 2PKQP 1LPBB 3L9XA 4A8PA 4UVEA 4WK4B 2W6NA 4B3XA 3RVKA 3W9UA 4D1YA 1J90A 2PVPA 3QVKA 3S27A 3AOGA 1KMIY 1E79A 1FRQA 1PG2A 3IKMB 4RK7A 1ZINA 1J00A 2FGKA 2OFOA 3EAQA 1P77A 1TD9A 2VUTA 3MD0A 4JVLA 4M89A 3RRBA 1G8HA 1GL6A 3OURA 3LTNC 1DBRA 3IT3A 1Z0KA 1L4GA 2QJTA 2QTRA 4O2BB 4YJ2F 2WFZA 4BLOA 1TJ5A 2GT1A 4GSYA 4ALLA 3BDIA 3U4AA 4G6ZA 4PYLA 4WNIA 4CR8A 1GUBA 1C14A 2IDZA 3PYXA 4RF2A 5SY9A 1KRHA 3W79A 2MTBA 1YOVA 1RIFA 2BEWA 2O3RA 2XNDD 4MRMA 5DI9A 5JJLA 1QP0A 3NAZA 2ZWMA 4GKAA 1D5WA 4S1VA 2CHGA 4Y2JA 3SQOA 4PYNA 1J8VA 2QRZA 3BE4A 5ICCA 3HWWA 1O77A 5FLXA 4FI3F 2ZSEA 4QWMA 2EQAA 1PL0A 2QJWA 2AVNA 3H5LA 4XUDA 4MUJA 3E7PA 5KTOA 1N7JA 4QQ8A 2FR0A 3AHHA 3L8FA 4FTWA 4MWSA 2AX4A 3I09A 3W6OA 1N9KA 2ZFUA 1PTJC 4MICA 2NYAA 3CRZA 3RVLA 3G17A 3DEJA 2HA2A 1N2CA 4AJ2A 4WZ6A 3IQIX 4KAJA 1P2DA 4WCFB 1IJFA 2FETA 3HZHA 3B8EA 1M8GA 4DREA 4MV5A 3WAGA 4LOJA 4ND1A 2B8JA 3DGEC 1LDNA 2PAFA 5BUQA 3B12A 5EEGA 5GPBA 1TYZA 1SKAA 3HPQA 1GTSA 4J8PA 4JLJA 4R0NA 1IQUA 5B6JA 3GLHE 4IXDA 2GERA 3W6ZA 4MSUA 5K05A 2UUPA 5I4IA 3HACA 3O2JA 1ACLA 2BI4A 2V98A 1A1VA 1Z26A 2YVUA 1FEZA 2M32A 3PUXA 4IX9A 5FUWA 3VISA 2PTGA 1YBAA 2BFDA 4NVRA 1IK4A 1D03A 4C7BA 5C5EA 1A9SA 2B35A 3GL9A 3ZU6A 4UCQA 5GY7A 2OORC 4ZOQI 3ZG6A 1IY0A 2EW8A 4LYAA 5JWRA 1NLFA 4WLNA 4I6EA 1O5IA 1EGVB 3E81A 1NP6A 3MJSA 1S01A 1G4UR 1YMQA 2JGMA 2CLIB 2LUOA 2MWMA 5HSGA 3LKDA 1VBKA 3NVAA 4UQOA 3ETHA 2POCA 4I81A 2XNDA 1USWA 2XHZA 3AR6A 4PG7A 4XDYA 4LC0A 1KKUA 4MGKR 4WNYA 1MP0A 5CPBA 4P7GA 1GL3A 4JLKA 5EJ9A 4DC9A 3ZLJA 2R3SA 2VF8A 1GUFA 1I9GA 1NYRA 3TTVA 1YAJA 4A1OA 5GJWC 1YI8A 1AQYA 1UAYA 2BGUA 2D2XA 1X9HA 2IOFA 3OT5A 4I5FA 4M3NA 3V1TC 2Q5JA 3RADC 2Q1YA 1N75A 4F06A 1TLLA 3FSGA 4MI9A 4G2TA 2FR8C 4K28A 5CB0A 1USUA 1D5CA 1V5IA 5EIFA 4CMHA 3IHLA 2JARA 2ZSHA 1QDEA 3FZQA 3TVDA 4F1KA 4CL2A 2XB4A 4KGVA 5FADA 4FFBA 3UOAB 1RWXA 3EC2A 1OCEA 3GAFA 1MB2A 1Q12A 3HCAA 1L7EA 1LX7A 6NULA 1I7NA 4KTTE 3HJFA 4G84A 4HX5A 1TLFA 2QAGC 1UM8A 1C0IA 2MR5A 3KEMA 3T3PB 2XMQA 1SC4A 4EG4A 1DKOA 1OASA 3EG5A 1SD5A 1V7ZA 4QDOA 1LQUA 3FPHA 1BGWA 3DKVA 4RJIA 2QG4A 3GVPA 2ETVA 2PQMA 2BMJA 3ZLVA 3FUWA 2OM2A 2YTZA 1RHRA 1Z6PA 3OM1A 3LC1O 2ZT8A 3KB8A 4UE3S 3ROPA 5DRTA 2ZITA 1X0VA 5BWCA 2W2KA 5REQA 1N33B 1VSUA 1S9HA 2PUWA 4QOEA 1LDGA 3CE6A 4Q4HA 4NBRA 3C24A 3HDJA 3ZDDA 3W5JA 4XARA 4R9SA 2B7BA 1YDFA 5FBKA 3G2IA 2HNKA 5CAEB 4CM6A 1JT9A 3VH4A 1PZFA 3PVCA 3PYLA 5DP1A 1USKA 3RRNA 5IASA 2DB3A 2NU9A 3EXG1 3W3AH 4TZTA 3ZKWB 1SBTA 2WJVA 1E2GA 4PYIA 2QMHA 1ZOLA 3A1FA 2WWWA 4HQOA 5E9JA 4F04A 3SE0A 4W8OA 2IEBA 4IGEA 1SBHA 2WWHA 3DDZX 3HA3A 3DLAA 3O92A 3P96A 1PRYA 4HNAB 4RKFA 1Z0AA 3U9SA 2PUFA 3ESQA 2QBYB 5SY4A 2Q50A 4C4TA 1QCDA 1WMFA 4IDCA 1J5XA 2NZYA 4LOAA 2CYBA 2XUQA 4OFXA 2OBNA 3SD7A 3Q0TA 4KPFC 5B4TA 3PFIA 1Y63A 2IIPA 5DLQC 1LPMA 4RF5A 1COZA 1PGNA 3U3XA 5DX8A 3CVYA 1PF7E 5C4GB 5T4EA 4ZI7A 5LQKA 1H9CA 4P34A 1RM4A 2Q3LA 1FC0A 4JODA 5FDFA 5C53B 1NV8A 2BMFA 2CCKA 1HDIA 5JVDA 2ZIFA 1EK6A 5J23A 3RBZA 1HT3A 5HM8A 4RQTA 3ZN2A 1R6XA 4HXYA 4Z2YA 4Z7NB 2O7SA 4AN0A 1NAIA 1WM1A 2ZB4A 2QTHA 3HB5X 1N6NA 3QK7A 1L2TA 1AXGA 1D09A 1YS9A 2NNWB 3GIWA 4MV9A 3GGSA 3NFRA 4QUBA 2CLLB 3EJWA 3QLUC 2GNOA 3MJEA 5ALJA 3WBKA 4BB9A 5JYDA 2ZBFA 1QV6A 4PHCA 2PQ2A 5LZ9A 4WKCA 4YUVA 1XTTA 1Z5GA 2WVGA 2C96A 1Z4KA 2VUUA 4WBNB 2IHUA 2W2PA 2UYQA 3D6FA 3KT0A 2HIMA 2PZBA 3MINB 4RMIA 1RP1A 3RTDA 2WFLA 3ZD8A 2GXAA 1OVMA 1KQGA 2ZYGA 4POAA 3S4YA 3UG7A 1DTEA 1NE7A 1X1SA 5J43A 2YW9A 3S68A 1NWCA 1Q91A 2XCQA 3LX6A 5FULA 3KO8A 1PSZA 1E3JA 4G5FA 4O4IB 3W5DA 5EZSA 3IB3A 1VLZA 2VHYA 3GI1A 4XIIA 4DRXA 3JQ8A 3C3YA 1NVFA 2YBDA 5GIPE 1SH7A 1VGVA 1WCWA 3OQIA 1E1QA 2Z8YM 5KSYA 3U09A 1X7YA 4IXWA 1PLLA 3JSAA 4HEJA 2A88A 1CZHA 4KOAA 1YUNA 2KHZA 1NUQA 121PA 3NBQA 4YRIA 4CMBA 4OEHA 3NHJA 5CGZA 3PDCA 1FRFS 1YOVB 4YMUA 4FC6A 2BEWB 2NTYC 5JANA 4MRMB 2I54A 4PX3A 1UP7A 2QA5A 3L4EA 2HXSA 1EFAA 1M76A 2P3SA 1P4GA 2A3NA 4TQAA 4YDSA 2OAP1 1GZSA 3F78A 3MWYW 1JKXA 3L49A 4QPDA 1BVRA 2GD6A 2W6QA 3B8HA 5AK5A 5H4HA 3DVQX 4B79A 4NYJQ 4YP1A 3DAOA 4M88A 3ZWAA 5FJIA 4PXAA 3WK6A 3JATA 3QUSA 4WGFA 2JB9A 2G1JA 1SK8A 1RCTE 1JG2A 2O48X 5CFOA 2NZ8A 4QREA 4BB6A 2A84A 2GZSA 1RBZA 1N2CB 3GCWA 2I4NA 1P4SA 2ECOA 2PH7A 1QE5A 3LVRE 1GSOA 1RXIA 2RCNA 4NH4A 4BNLA 2WD7A 3LK6A 2QF7A 3ICCA 3D2LA 1L9XA 5DFAA 3MVEA 5I5GA 3IEMA 3TSAA 1XZGA 4KR7A 1PYDA 1TT7A 1NYQA 2RAUA 1VSTA 1E7SA 1MAVA 2EVWX 3FPAA 2W2LD 4X61A 2ISSD 2VCHA 1B73A 2Z57A 3GCZA 4U3JA 3V97A 4RPHA 5AW3A 1W88A 3GFSA 5JS1A 1UPFA 3DZDA 5EP2A 2FGJA 2BFDB 2A0UA 1DJNA 2A7QA 2C5AA 3HKBB 3CWZA 3SZMA 4N76A 1SCNE 1GEGA 2BGMA 2FZLA 2WNHA 5FTLA 4W8GA 4XW2A 3X0DA 5KWJA 5AUPB 3SICE 3H17A 3TNDA 1FU8A 2W4IA 4BLRA 3AP2A 1XMVA 4RD6A 1DWPA 3QF4A 3VVBA 5FOQA 3AEQA 1QVVA 1WE2A 2CVOA 1A7KA 4OYYA 3IOEA 4UUNA 2XZDA 5L4NA 1XTIA 1FU7A 4M9ZA 3FCOA 3VQTA 1JWLA 5FB3A 3LHKA 5TB5A 1T6BY 1LLUA 4C4PA 1LPAB 1DIBA 2WK1A 1CP2A 2VF4X 2IZ7A 2XVMA 3CZCA 2AVDA 2GAIA 2YWBA 3D8BA 4WKOA 2G71A 4GWGA 4FSXA 4GP7A 4YROA 3RU7A 3U81A 5JAOA 3CZ5A 4DM4A 1KAHA 1S2MA 1M5UA 2V8BA 3FLAA 2PDAA 3RRMA 3SI7A 1P0PA 3TE6A 4EZIA 2PPVA 3SM3A 3MJRA 3O0TA 2IW1A 3R5TA 1ND5A 5A3SA 2F55A 2G83A 3OLVA 5IW8A 3G0IA 4IDNA 4E32A 1KDOA 4EPYA 5EJ5A 3CF4A 3EFOA 3SJCA 4RO0A 3GG2A 5TY0A 1A9XA 1MEEA 1Z3CA 2QX8A 4FFBB 2FZKA 4X00A 1QHSA 4M8NE 4B6JA 3LPAA 3ZI0A 1ABBA 4C30A 2AMFA 1CJBA 3SLGA 2QGFA 4IDBA 1JFVA 1EVJA 2IP4A 3AUXA 1OIWA 3ZUGA 1OAKA 4G37A 2HL6A 1J8YF 5JADA 4J9UE 3WLHA 2BTEA 2Y0CA 4GOLD 2Y3IA 2ZRIA 2BGNA 2XWSA 3LXMA 3C5VA 4DIBA 4F6CA 4YRKA 1PS8A 5PNTA 5EJ4A 2D8MA 1E6EA 3TOVA 1RZ3A 3HDTA 4GZ5A 5REQB 1RYYA 2O3UA 5K8UA 2NYVA 4RA9A 1JLMA 2HNAA 4Q4HB 1P39A 1V7CA 4KPGA 3D8HA 5HM6A 1ZGBA 3RI3A 3F7OA 3HK2A 2BZ1A 3UMVA 4TV8A 4C4OA 2HM7A 1ZU4A 2QTVA 1RLIA 1YJAA 3GFRA 3OWOA 1NHGA 2OO5A 4Q4LA 3CH5A 3LUAA 4S24A 5GONA 2NU9B 4PSKA 3VMMA 3WRXA 1T4MA 1ISFA 1K7XB 1VIYA 1R88A 3INRA 3MLEA 5JCOA 2OD9A 3I32A 5LP6A 2GZ2A 4IEIA 4WXEA 3DE5X 2FZ4A 2ZYSA 4RF3A 1IN5A 4BNFA 1V8PA 1U7UA 1HSOA 4HOYA 4EY6A 4JI2B 4JBNA 3U3JA 1RADA 4H7HA 1ZWLA 1NYTA 2LCQA 5JZBA 2PUBA 3ZVKA 4LV6A 4MJ3A 4NZ9A 3MTJA 1OWMA 1NR7A 4XH9B 4YRRA 4DPLA 3M6XA 2DR2A 1SXJC 1W48A 5AKEA 1I2AA 3UHFA 2WIFA 4FKMA 5J2UF 3VH3A 4AWXA 2R0QC 3OX3A 3UC5A 4D0LB 1NVVR 4AKIA 3M9LA 4FFVA 2GJ9A 2D5AA 3KDSE 3QE0A 4B1FA 2YIVX 4MUBA 3RT9A 3IXLA 4KU4A 1F1BA 5L53A 5DLPA 4ER0A 1BVHA 2BLNA 4WTOA 5F51A 4JJ4A 1GADO 1BOOA 3BERA 4MAFA 4F91B 3B5IA 2TECE 1HY3A 3LCRA 5EN4A 2ZBQA 3B1FA 1EE1A 1X1DA 2BFCA 2UZIR 1XCMA 1JG4A 2YMMA 2NSYA 3M3HA 3FN4A 3N3AC 1KSJA 5K3SA 3WQQA 2A9FA 4A91A 1I7DA 2OBLA 4ZCSA 3WNQA 2MDTA 4JL6A 3CF4G 4EPVA 4DDTA 2VP5A 1HR0B 4K6CA 5TEWA 1V3UA 3OOSA 4LVUA 1DIHA 1ETUA 3HJNA 5D2CA 1MG5A 2B8EA 2MSNA 2X7JA 3DD5A 4FS8A 1YH3A 2HJVA 4BUZA 4CMEC 5I51A 5JW6A 2O54A 1QANA 4Y1GA 5FPKA 2HSGA 3CBQA 3ENKA 2YQ5A 4IUBS 4J4HA 1DEKA 1A8HA 1LA2A 2PYIA 4QTTB 5IYZF 5KVSA 5KTRA 4LISA 2DQ4A 4NABA 5T41A 4OLJA 2D8AA 2IYTA 4RPIA 3DFUA 5EHIA 3ML1A 3GD7A 3RCBA 3FPGA 1RC1A 1H2WA 4M36A 1WWKA 4RTOA 3AEXA 3BIOA 4KO1S 3WLJA 1ADJA 4Y30A 2FE4A 3H2JA 4LVOA 5HKOA 1BDIA 3B5JA 1SUPA 4KYVA 1FW6A 1TC1A 1YB1A 4I6JA 1NBWB 4UTZA 4XJSA 4DRXB 4DV4B 2CUKA 1TJ4A 3JQ8B 4FZVA 1Y3DE 3B38A 1I1OA 4FHCA 3OQIB 1X7YB 4GLOA 1L7BA 3GZ4A 1X86B 1D4AA 1ORIA 2XTAA 3C1TA 3HSYA 3P45A 4QUHA 4TTJA 3VZQA 4AZWA 3ELWA 5FNVA 4DIEA 2IH2A 1D1QA 2X19A 1Q22A 3I9OA 1NUSA 1BTOA 1P3DA 4R2HA 4II3A 2IP1A 1TFRA 3LX8A 3ODPA 1VJ5A 3NHRA 4V24A 3UUEA 4I1SA 7YASA 1C30A 4EQZA 2H2FA 1K0FA 1JQLB 2WSBA 2HK7A 2L0XA 4UNIA 3G6WA 3O3CA 3E5MA 2BRUC 4XYGA 2SKDA 2V4MA 1W59A 2Y8EA 4JP1A 4PNPA 3K15A 1L5HA 1KPGA 2W6JA 1QFMA 3JATB 4ZHQF 2J0EA 2QTBA 1MQAA 3A6JA 2IS6A 3PNBA 3VYSB 4IJKA 1NVDA 1E9FA 4AF7A 1JFSA 3PUIA 1NQXA 3DE2X 4KQFA 4U2FA 2I66A 2XUOA 2RGNA 2G36A 1ECPA 3IMGA 3C7TA 1DI0A 3TX6A 3WLTA 1WD7A 2OFXA 4TTVA 2I5PO 5I9IA 4JI0B 1G5QA 4MEBA 3JALA 3T7KA 5B4UA 3EG9B 2Z43A 2Y66A 1H5QA 3G2OA 4XM2A 3BA1A 3V6LA 2HLPA 3LRXA 3HTXA 2JGAA 1GAEO 3HCRA 3O73A 4RV5A 2UZ0A 1NMZA 2HHJA 1W88B 1CY0A 1G21E 2RIPA 2WHYA 4K2HA 4BLQA 4DBZA 5JZOA 4KQIA 4LY6A 2BD0A 2SKEA 1VE6A 3Q72A 3QSGA 4P38A 1PR4A 1M33A 1NUTA 2VPIA 3FHJA 5JD5A 1GRCA 2CWWA 1AZTA 2Q1WA 2QV0A 2V7WA 1P2VA 3GNLA 3H5TA 3MILA 4MRVA 5A71A 4BWVA 3HE3A 2P0AA 3I0ZA 5EIHA 3QF4B 4AG3A 5TLSA 1A71A 4WNCA 3AEQB 4Q3LA 1ZJZA 4OI2A 1OXXK 4HS4A 2NUPA 4IEFB 3QWFA 3KTFA 4RELA 4DJEC 3LZDA 1ISIA 1L4NA 4UNPA 4K26A 5H0IA 3RH0A 1K5HA 3PE3A 2BSAA 2D2FA 1BDHA 2XA2A 2RH5A 2FW0A 2PMBA 2W8BA 3EVTA 1BDJA 2PKWA 3EN0A 4GRDA 2ADMA 3B13B 2MT9A 2O59A 4JH0A 4O4HA 4FNAA 1KVRA 1XZ8A 1TKCA 4YUYA 2CVQA 4O1MA 4FR5A 3U4CA 2J9ZB 2Q07A 1Q74A 1RRVA 1W2WB 2IDKA 2IOHA 3A1NA 4URYR 1DP4A 1K6XA 1IDOA 1V8OA 2WTMA 3EFOB 3NIBA 4I7EA 1E1RA 3HUDA 3ZZMA 4QGSA 2XQKA 1GQRA 1VE5A 4Z9YA 3UMYA 1NTOA 3BK7A 5FOVA 4TXHA 1QV7A 4QJ5A 3BKXA 5JAIA 3SIRA 1XU4A 4NCIA 1JKJA 4RLHA 1HL7A 4JI5B 4AMYA 3KQUA 2QRQA 3WFIA 3MJCA 1YDMA 4RESA 4XGQA 1Y5NA 3ADPA 1GOTA 3I4LA 4XFDA 1UIRA 5E6UA 4CM9A 3GLSA 4QRDA 2WJJA 4I5DA 2CXUA 2F1IA 1N0VC 3DA8A 1Y4SA 4XUCA 4CL0A 4BO3A 3WS7A 5CRIA 1QK3A 1DDGA 1TU4A 1Z73A 4PGMA 1C3OA 3KB2A 4WOCA 4ZC8A 3GJYA 5CT5A 4CCSA 3W2FA 4IIVA 4RA9B 3PJRA 2ZCVA 2PU5A 3L6RA 3QPAA 3TXYA 3V8PA 3H1FA 5IVIA 3EULA 5JG7A 2Y77A 1KO7A 2DWPA 3MQ2A 1A9RA 4TV8B 5FI5A 4MB6A 4RGBA 3T7DA 4AWAA 1UKAA 2YOGA 5GONB 5ELXA 3IMFA 4YB8A 4UM8B 3RABA 4ENTA 1Z8HA 5LP6B 1A2QA 4MZDA 5AI0A 5BWLA 3PUZA 2LR0A 4ZAYA 5BSGA 1U3GA 1XCLA 2HQRA 3Q9SA 2ZM6B 1G41A 1XMQB 1JDTA 2ZQ5A 4XGRA 2WABA 1KMNA 3UPDA 1H9BA 4XR9A 2UYGA 2B1IA 2GKGA 3EISA 3I8SA 5JIBA 5HR5A 1KP9A 1O96A 3AOEC 1ZMXA 3R9XB 1Q57A 4REQA 5BPFA 2JF0A 3ZW8A 4ZTBA 1EWYA 1NP7A 4X6XA 4AJPA 2J3MA 3HL0A 4F3RA 4A0HA 3KYJB 4FMCF 3PHHA 4P33A 1H3EA 1BWSA 3H1BA 3IVXA 5CNMA 5EZ6B 5G0TA 2CXPA 4PLVA 5C2JB 4ZZIA 1F9EA 2R6R1 4BFCA 1RXYA 3WKDA 2O3JA 1OTXA 4NV3A 1ZK1A 4HI0E 4QGBA 4RABA 3IURA 1L5KA 1YQXA 2WJIA 1KQ3A 3CSDA 2BFCB 4DE5A 1UT8A 4KDEA 5HFNA 1U2RA 3AF3A 3RVPA 4L3OA 4BV8A 4FOSA 1ZISA 1B0PA 4CL8A 2O7NA 2YKGA 3U17A 3NPAA 1VPVA 4MQFA 2V74B 2VF2A 1B3BA 4LX0A 3WLPA 4BX3A 1BFKA 3TR6A 3GFGA 1JIQA 1OXBB 4HKTA 3A1TA 1NG9A 1XQ6A 2Y1LA 4IMIB 1ONNA 2VWQA 3LQKA 1A8PA 2BMEA 2I4RA 3A6FA 4LGMA 3V7YA 3K6RA 2IEAA 4L9AA 2WWYA 4PZCA 2PHZA 2XYRA 3G1WA 4E3WA 5JAZA 2IPOA 1CDOA 1MB9A 4C43A 5HQ3A 5IWAB 1QF7A 1UPBA 1JLSA 1NONA 2CCJA 1F8YA 1J9ZA 1RYMA 4Q48A 3OZTA 1VL2A 4XB2A 4US2R 3CH4B 2OILA 1P4RA 4ARVA 2MSKA 3EARA 3TZCA 1BS9A 1JFFA 1D2GA 3ASVA 3NHYA 2P2NA 4AJKA 5HBRA 3DKRA 2IRWA 4KMRA 1QFYA 4LPSA 4IOJA 2GYVA 2EQ5A 3I34X 1QIEA 3H18A 1TEXA 5F5XA 3JZIA 4LJLA 5JBIA 5LDDC 1RQPA 4WECA 4IDFA 1HE1C 5FNVB 1ESCA 2HU2A 1O94D 1Z07A 5CM9C 1X8JA 5TQ2B 1LBIA 1L8AA 2FWPA 3UJNA 1NBOA 3UXYA 3D2BA 2IVFA 3HB0A 3OCUA 4OPMA 3RVRA 5ADHA 5LQAA 5H8WA 1WUKS 3GPCA 3GLGA 3B70A 1CE8A 1L5HB 1A5AB 2XQVA 2YN2A 3FI0A 3JRXA 1MOQA 1QMGA 4QJBA 4Y6SA 3BXGA 3D6TB 1HQYE 5F77A 3ZWBA 4FWIB 5AJZA 3GHYA 4CW7A 3L82B 1T5BA 4ER6A 5MGBA 1B8UA 3M1LA 1VYUA 3JZMA 3VSBA 3QEBZ 5HIJA 3E61A 2W11A 2G9UA 2VDWA 4UD2A 3F2VA 1V35A 4TL7A 4BFXA 3U44A 2E37A 3GCGA 3LBNA 5GZ6A 1WEKA 2JHAA 3PQ3A 5JSUA 5IS2A 3ZU5A 4CT4B 1ZP6A 4WRRA 5KINB 4H7IA 3RNOA 2XBUA 2G08A 2ZSDA 4BQIA 4H0CA 1N7GA 3DAPA 3ACCA 3JALB 4KFSA 5A6SA 4XCXA 4LYJA 2JLCA 3O91A 2W00A 1K3FA 4A03A 4BV2A 2E85A 4CIBA 1UDXA 4KXFB 4B4DA 4Q66C 3ANSA 2WWIA 4GI3A 2QWXA 3VZSA 4LTDA 1UUFA 4E4YA 1DUSA 4NYIQ 4X24A 1HQCA 2QMQA 3AKCA 2EARA 1NDUA 2WYVA 1F2DA 4MCJA 4IJUA 4NH0A 1Y3BE 4OP3A 3DQPA 3RK4A 3VR6H 4BMZA 1G8JA 2IYOA 1PT6A 2Y9MB 3G9QA 5DHPA 4ARCA 3I1YA 3AJAA 2ABWA 3ILXA 4CLRA 1Z5PA 1FXWA 1GTVA 1MCZA 2WM2A 3PEYA 4ZQFA 1M6NA 3VR5H 1O94A 2YYAA 3LQRA 3A1VA 2NUPB 4BKUA 2OEPA 5E3HA 1DFHA 1SG6A 2PM8A 5DN9A 5FT9A 4RNDB 3ZH2A 2A9QA 4FZRA 1II9A 2I2WA 1MBZA 5JJBA 1Y42X 3J81k 2ZI9A 1QCZA 3LPCA 3SX4A 4FYVA 4EHKA 1FYVA 3CEMA 1GQOA 2W8BB 2XIJA 4QU8A 4A8JC 3SQMA 5JD6A 4YRCA 4ZVMA 1H2AS 5ECYA 2VQFB 5H5JA 2R6GA 2EKBA 2VPWA 1M0TA 4O4HB 4YO7A 3IXMA 4HGNA 1BDBA 2JFOA 3QU2A 4WOJA 3RVOA 1ZKDA 2PK3A 3ESDA 3ZV3A 1W36B 1CBUA 2LZ0A 2EL9A 3L0SA 5LD2B 2AG0A 2WJ6A 2HADA 2A4MA 3U3MA 5HZMA 1I10A 1THMA 2ZBPA 4P6VF 3P26A 2BLLA 1P31A 2EERA 4HY3A 5AYVA 5LXTA 2YZMA 5E2AA 2C54A 4Q9LA 3ORSA 2OWEA 1QHNA 3MBKA 4N6NA 4ZIRA 3GEBA 4EBFA 2WSSA 4K9KA 3H2IA 2AKEA 1NX6A 1FUIA 4WWHA 4YJFA 2WY2D 2Z95A 4F45A 4MKHA 3TDKA 1Y1QA 4DCTA 5E6UB 3H75A 1JWBB 4YRPA 3CLSC 3NALA 4FYHA 1PJ3A 3QEMA 2WIBA 3REFA 5I4CA 2CHQA 4KXUA 1NBMA 2AD5A 3PIDA 2DFLA 1Z35A 1LTQA 3R77A 3CCFA 4RVFA 1Z75A 1ZH6A 2H57A 2VBFA 1ZOOA 4IDGA 4B75A 4C3UA 4DT1A 3PKIA 3P27A 3AF5A 1RCFA 4NBSA 4TLEA 1U7WA 1JU3A 1GDTA 1KI7A 1E1NA 1XYVA 3T3DA 1XU9A 2IPMA 4A2WA 1YDWA 1H2ZA 4RHCA 2YHIA 1Z6TA 3HYNA 4RY9A 3RKSA 4RLSA 2WTEA 3V7NA 3EAGA 3DEAA 4ZOLF 4CM1A 1VLJA 5JATA 2HW8A 3DZ8A 3QQPA 4XB1A 2VSOA 1HE4A 2GTHA 4LEIA 3M6IA 1E1MA 2J33A 5DTMA 2C1ZA 5KO2A 4Q00A 1E69A 4C04A 4XOIA 2DTEA 1GZHB 1DKNA 3GR6A 3UGJA 3ITEA 1SKMA 2MIIA 5C4IA 3HDHA 3SVLA 1KRWA 2WA2A 4REQB 3PEFA 4IW3B 1X14A 3L1KA 1VG1A 4LXHA 4U39A 4BLVA 5AVVA 2YOHA 3A6HA 4YIHA 2PWBA 5D84A 1E2EA 1N1DA 1D0VA 2JVJA 1OMOA 2QW1A 4HNTA 1SELA 5F64A 1EGAA 1Y3IA 2ORED 3KT3A 4FSHA 3RIHA 3T5PA 1MO3A 4G5SA 5E1OA 5TS3A 4ZYVA 1NI4A 3KR2A 1C0PA 2JBHA 3L79A 4NY1A 5EAIA 4EYEA 1KC1A 1V8ZA 3E1KA 3PNPA 4NBUA 5KTPA 3ZIAD 3N75A 4OX9B 4WL0A 1NA5A 3QI2A 3LUJA 1A5TA 2O1SA 5EWJB 3FHTA 1JXAA 3NTVA 2Q5CA 1M6EX 3VR4A 1YB2A 4MQFB 1U6KA 5IK2D 2WJZB 3CTMA 3ORRA 4AJIA 3CINA 2Z6AA 2NSLA 3TSCA 1GILA 5KYXA 4NBKA 3SBEA 1E20A 4IIEA 2ZREA 2QNIA 5FFNA 5DSTA 3OX2A 2O2GA 1EZZA 3LC2O 1Z17A 1M2NA 3NO4A 4QOIA 4Y2XA 2XAAA 5C8ZA 2HYIC 1JYEA 3FR8A 4NDZA 1R4NA 1UC9A 1KK2A 1S89A 1JQEA 3EZ2A 4XTRA 2CBZA 4H7KA 3ZGXA 5AVSA 1YTUA 3EZLA 3CRMA 4GNRA 4JDPA 4A82A 2PL1A 3RVQA 3KAPA 3QHAA 4FWTA 2NU7B 4Q9KA 3IP5A 1SQ6A 2JGLA 4LOKA 4MVYA 3DCNA 4Q7EA 4DLAA 4TMYA 2NP6A 3BJEA 4AY3A 2JIPA 1R9GA 2AUNA 1T25A 2RHMA 2JIRA 4JJ8A 3UKOA 1DLJA 1KBZA 1DO8A 2ORIA 1DV1A 4L7QA 1SO8A 3L7KA 3Q1LA 4LCEA 3MQFA 4QWWA 3KYCA 4HNSA 1JEEA 4F8JA 3IO5A 1CR2A 2IELA 2FPKA 4MB0A 4ETWA 3HY4A 1ZZEA 4ALNA 4FJ0A 3VH1A 2J08A 1P1IA 2G28A 2QP4A 4ND6A 5J3JA 1Z4LA 4YYZA 2VAXA 5AD1A 4ZN6A 5HF9A 2D7DA 3HSKA 2AYXA 4JKOA 1EM8A 3T0FA 4CF4A 4D02A 1QYVA 2Q2VA 3MUFA 2QRGA 3FYTA 3H99A 2ZW9A 2JZNA 5DW0A 1FCJA 2V6FA 3D0QA 3VSDA 4CMGA 2GO7A 2V97A 1N2JA 5DCWA 2VDWB 2HXYA 3U44B 3O8NA 4MROA 3KG2A 1ZFNA 2Z9DA 3QE9Y 4CQNA 2AQKA 3DE4X 3RUCA 5FLEX 1NM5C 2YHUA 3MERA 4MITA 5TPWA 1T0IA 4KR6A 2EWWA 4IAOA 5A6SB 3DLBA 1ESEA 1B3RA 3SK0A 1QO9A 1UBEA 5K0JA 2B92A 4EK9A 2DKNA 2VPPA 4QJIA 1A7AA 2RIRA 4K40A 1TZJA 2BFEA 3I5UA 3KPJA 1RHKA 3M83A 1JW9B 1EFTA 1FQJA 2FMXA 4Z6KA 4NLLA 4MVJE 3KOYA 4JXXA 3W8NA 2CV2A 2V54A 1XTKA 3HWRA 4RMHA 5C8YB 2J9FA 2ADOA 3TN7A 1HX7A 2JFGA 5K45A 1VYHA 5G0VA 3UHJA 3VSCA 2XVYA 5KTSA 4GOMD 4QGHA 4HG2A 4FE3A 4JROA 4LMBA 1CETA 4PO9A 4DLKA 2CXNA 1YI0A 4YRNA 2YXEA 4CLRB 3FKSA 5ILQA 3ZE8A 3NHSA 3GVXA 5A9TA 1Q3HA 3Q0IA 4AZ3B 1G8MA 1PV2A 4ZI2A 2ZUDA 1BS2A 2C95A 3PV0A 4BP3A 3H0EA 5KTTA 2P69A 1XC7A 1LXCA 4CNQA 2ZVDA 2AJ8A 2F8MA 1G6HA 4C1BA 4BX0A 2RHGB 4KEAA 3ZXUB 1DOZA 4Z0PA 1D6JA 4BASA 4UJ3A 1RD4A 2GKOA 2AOTA 1QHGA 4ZO6A 5CDFE 2XKAA 4OUKX 4UM9D 5D6NA 3ZQ4A 4Y98A 3T7EA 4FFWA 4XJXA 3LL7A 4AKSA 1Q15A 2XT6A 4J29A 4Z4QA 2XZOA 2VQEB 2VQSA 4IIBA 2AXNA 4C06A 1YU9A 5CIYA 4QGFA 3P9PA 1SCJA 1Y6ZA 4L5BA 3U19A 2VJCA 3FYCA 1G6Q1 3M6MD 4KQHA 1TGYA 3RG8A 1YRAA 2QX7A 3UANA 1PJZA 2C0CA 3HS3A 3O5AA 3TLYA 3WLOA 3ZI4A 5LXTB 3MMSA 1YJQA 5GMOA 4WPGA 4L8LA 3BXEA 2BMVA 4OMDA 2ONCA 4ZIRB 3PTZA 3TKLA 4ACBA 1SA0B 4YJFB 2DEUA 2JGFA 1KFEB 4RAOA 5BT8A 2PFSA 4GOJA 5CX1A 4C89A 5B1HA 4ZTUB 4I1RA 1KO4A 1BA3A 3QEMB 3CPSA 4XM1A 2V7QD 1UDRA 2V7PA 1UZLA 1E9RA 1DZ3A 3ORFA 4HWTA 4I2VA 1N4DA 5ALVA 4UMFA 3RE1A 1LVHA 3RYTC 1ANKA 1YB7A 4K81B 2IE8A 4N8SA 2B4KA 1XE3A 2OZVA 3C3EA 3VU9A 4RBNA 5E8RA 2CXXA 4DT1B 4ZMBA 2ZZNA 4BQPA 1KJQA 1SBQA 1MC1A 1OA0A 2EFEB 1QIFA 1YCGA 3NNSA 4W5OA 3GLIA 1GPBA 1FMFA 4EVIA 3R5FA 5E1MA 4RL4A 1NT4A 2YHIB 4GPTA 4U5XA 3PUJA 4MQLA 5BQ5A 3VDXA 1GGEA 3R24A 2PGNA 5SZKB 1MDFA 1TM3E 3TNJA 4BMDA 3W2HA 4ZO8A 2DFNA 1V1MA 4BNDA 2FK7A 1X80A 3A6DA 3GX1A 2EGHA 3S81A 4Q9IA 4FHEA 5C5CA 2C9DA 5J4YA 4MCAA 3UUGA 4HLDA 3UJBA 3BULA 4BN5A 1HRKA 3H05A 4XASA 5IAJA 3TTSA 4B5LA 1PK8A 3D3NA 1SFRA 3D31A 3P9NA 3BL5A 1CQPA 1IPHA 1WY7A 3KZVA 3PUWA 4W5RA 5F35A 4JN6B 5DASA 3O8RA 4E4TA 4JUBA 2FN3A 3KJIA 1WXQA 4JLVA 2BFWA 4ZA2A 1N6LA 3BB1A 1Q0TA 1ENOA 1TYEB 2PNJA 1Z2AA 3DFKA 2ZJOA 4QDKA 2XF8A 5H02A 2HA5A 5AIBA 1NI4B 2GESA 1N2XA 2FHSA 4JJAA 4MDYA 1M0SA 3IQHX 3HVIA 3P2OA 4ZHQB 3WLRA 1MOZA 2OLKA 4RANA 1K68A 3IA2A 1OAOC 2A0WA 2R1VA 3GEEA 3UV6A 1MJ5A 2V7QA 1OU4A 2WU1A 3LXRA 2JFBA 4PSCA 2C58A 1V1RA 2NQ2C 1R16A 2VUHB 3LFTA 5ED0A 1RQLA 5KYXB 1AS0A 2E4YA 3WGYA 1RHQA 3AYXB 3IP3A 2HDNB 3LCVB 3CPEA 4ZK6A 2E5LB 3ILHA 4UBLA 1H5UA 3NRBA 2BF4A 4GC9A 2WIDA 1XZCA 4YRZA 2ZIEA 4FYJA 2OXFA 1LCIA 3RQSA 1KYXA 1PX0A 5FF9A 4WN3A 5HKKD 2GPWA 3NU1A 3AC0A 1VPLA 1R4NB 5CDTA 3D3KA 3F4KA 1IM2A 2EJUA 1QZUA 1MJNA 2O0KA 1KKLA 3NCTA 2P9TA 3C1UA 2H5LA 5T67A 1JPNA 2QVYX 3AFHA 3LY7A 4OMUA 5JYCA 4QBIA 1JZQA 1FMTA 2AXQA 4G65A 3AVOA 3LXXA 4EUHA 5B55A 4G86A 4LNHA 4GPEA 1EXVA 3P71T 4TYNA 3KOZA 3JTEA 5EIWA 1Y37A 2J46A 3GJRA 1HRDA 1T4BA 4KV7A 4BX8A 3T7SA 3BWVA 1SCKA 3BHMA 3IDOA 1B43A 1FTGA 2QSZA 4GX1A 2EG5A 3KWMA 4WLFA 5EC8A 3TM4A 4BNHA 1QJ4A 4Z1OA 3RVNA 4HYEA 1A77A 3SY8A 4R1SA 2AKYA 2VKTA 1VCIA 3KYCB 4JDUA 4MVJP 3WV4A 2EQBA 2GNAA 4NE7A 4CFYA 2J09A 1KIFA 3W9YA 1HG0A 1LQ2A 2E4ZA 3L7YA 3RV4A 3RSLA 5DX0A 4HBZA 3G02A 1JPJA 4PZLA 2JJ1D 3ZWWA 2ENWA 2IHVA 2AMVA 2WRZA 3C8HA 5EERA 3T94A 3AWDA 1QXSA 3UK7A 5ITWA 3VKGA 5CDHA 2RGUA 1TE2A 4OXNA 1LLFA 1EM8B 1OQAA 1WSBA 1RVV1 4F3TA 4XYLA 2OHOA 1ECJA 5B30A 1RWPA 2ILVA 3UHPA 3BSWA 1OXKB 4A8TA 3ICVA 4JP8A 3KQLA 1N2CE 4WA7A 1KEUA 1YCDA 1K7CA 4WNAA 2G1PA 2GHTA 3OJCA 4P98A 1UJNA 2BUCA 3JD3A 4YAKA 1ZGZA 3NHBA 3IR6A 4JSTA 3I5YA 2FMKA 5TPWB 3L7CA 3N7UA 4X63A 5ALMA 3C3DA 2D1QA 3NIWA 4H0FA 3AUUA 3KE8A 3U49A 2QMUA 4IS3A 1RI3A 2HU8A 3AJ9A 1VKHA 4JL5A 4ETMA 3OTHA 2BFEB 1P62B 1UZNA 1WU8A 2X4IA 4QEKA 1LBEA 1KZHA 3EOAI 4BBPA 2XYPA 4H1VA 1O08A 3L7OA 3O4GA 3SS8A 3BIWA 2Q6KA 1OT3A 1AB5A 2P67A 4A10A 3ZWDA 3IUSA 1IJEA 2J9FB 2YRWA 2P5UA 3CR7A 3GYGA 1WZ2A 4TZKA 3ADKA 2C5BA 2B21A 3UK6A 4PG5A 3FNHA 4AO6A 1R0CA 3NFYA 1EPUA 1IFXA 2BBOA 4UU1A 3HM2A 2FVYA 3LECA 3D4IA 5DHFA 3T9EA 4F4FA 2O5EA 3PC8C 4MOWA 2B9VA 3C6XA 4U6QA 1CZUA 4XB6B 5J5VA 3VRHA 1F2VA 3HCCA 3IERA 3VNRA 5CEJA 3SLKA 1DTWA 2ON6A 1EFDN 4NEQA 4HAWA 3TO5A 3RUEA 3KZMA 3F49S 2E87A 4PWYA 3FROA 5KCZA 2QTFA 1GDHA 4AS1A 2P6PA 1NSTA 3HGQA 2B83A 2GQ0A 4YX9A 1IZ7A 4LJ5A 1FU4A 2FAXA 1QHEA 3A4NA 3L01A 3X2FA 2WILA 2IPAB 4XI9A 1JDSA 1QAOA 2NVOA 1Q6YA 3QU7A 4ZZ3A 4XAQA 4R8SA 4A0GA 2Q7DA 3DT6A 4I9GA 4BGDA 2C3OA 1PFQA 2XEXA 1GV0A 4TRMA 1IHDA 2ZRLA 4GL2A 3INYA 2PX6A 2M6LA 3HCFA 3U9TA 1EVKA 3KWLA 4KLRA 4BL5A 5TARA 3HRKA 4B3IA 1ZXXA 1D1TA 5ALOA 5JV5A 4KIJA 3PFBA 2ZAOA 2YVKA 3IGFA 3TSWA 1DAEA 2IU3A 2Q41A 3EQZA 3P2JA 4KE8A 4TUYA 4BQFA 4EPRA 1GLNA 4RGVA 1JMKC 2DPMA 2X14A 4P2BA 2JG3A 3FKJA 4H15A 4DNQA 5ICSA 1HNZB 3IAHA 1UBKS 2WAAA 1FX0A 1XF1A 3KXDA 2GJ8A 4ZOEA 3VU9B 4NZZA 4Q37A 5ALEA 2OV3A 3DF7A 3ZW7A 2J0QA 2F48A 5JTUA 1GNLA 1N5KA 2AMYA 1DG1G 3MRTA 1QR2A 4U1RA 1U99A 3S8MA 4RV9A 5AVTA 3GLIB 2H7VA 1T1IA 4EARA 1MA3A 2X3UA 2R8RA 4DHWA 2YZ7A 3CF0A 4I1VA 4JP5A 5CVEA 3TJRA 1BH6A 2PSSA 1EFUA 4KIFA 3V46A 5H81A 4GR5A 1AKNA 2N1BA 1OT5A 4O33A 2C4WA 1F0YA 5ALKA 4JJKA 3EBOA 3U1VA 1CZRA 2PZJA 4LZNA 5E0KB 5JR3A 4PLZA 1H4QA 2B3DA 5LMUB 4YMSA 3AW8A 1NRIA 2XLBA 2C7QA 4YCAA 5AVYA 5DOVA 3P0RA 1M34E 3TTXA 4AQ7A 1F17A 1P1FA 3QOXA 3CRNA 4M1WA 4O29A 1YVRA 4OXRA 5LA6A 4OHCA 1QG6A 4ARIA 4LI0A 1GZ7A 2WMNB 3P9YA 2WF5A 5FTKA 2I3DA 4M0MA 7REQA 1AF7A 1PJLA 3D3WA 4ZYTA 2IC5A 1DBSA 1H66A 5KJEA 3K96A 4CDMA 2R1VB 5HFAA 3DUFB 3PWZA 2BKXA 2R7LA 1ZS9A 3DT8A 1QGYA 2Z56A 3KXIA 1V1RB 4MVJI 5DKFA 5A0FA 2QZPA 5CT8A 3T9FA 2PWPA 3IQWA 3QTBA 4M0PA 4KMSA 1JAIA 5EESA 3MJFA 2FG7C 4MR9A 3WGIA 1KTVA 2OQIA 3IAS6 3RC3A 4C29A 1C3EA 1B0UA 4E46A 5J4LA 5FUVA 1EXWA 5HCNA 4IFEA 4Q7QA 2J67A 3ZY2A 3QA3E 4P92A 3NM5A 3X1KA 1P8AA 1KQOA 1P2TA 4FCWA 4D6PA 3H5IA 4O1HA 2BONA 2N46A 2YJ6A 2O5CA 2OKCA 1R12A 1P7PA 1NF2A 4LAFA 4H08A 2W90A 1BXRA 1S9DA 1DNPA 1YOBA 3TW8A 1N5OX 4RXMA 4URWR 4BEBA 5L3VA 3KQQA 4X7BA 3F98A 3QWHA 2ORWA 2ZRFA 4MUNA 2VZ8A 4KR3A 4DCPA 2A7XA 2WP8J 4XVRA 3WB1A 1MPTA 1YR9A 2I6UA 3NM6B 4B85A 2RGXA 3VPFA 2OECA 1A7JA 3DKKA 2Q2WA 3DVSX 3TMKA 5IT0A 2IYEA 4MPJA 5K0BA 3KX2A 4GOXA 1QDLB