2WJHA

Structure and function of the feob g-domain from methanococcus jannaschii
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
166
Chain Sequence
MKSYEIALIGNPNVGKSTIFNALTGENVYIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSLTANSIDEIIARDYIINEKPDLVVNIVDATALERNLYLTLQLMEMGANLLLALNKMDLAKSLGIEIDVDKLEKILGVKVVPLSAAKKMGIEELKKAISIAVKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
publication title Structure and Function of the Feob G-Domain from Methanococcus Jannaschii
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal transport
total genus 49
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wjhA00
1DPFA 3L43A 3QI2A 5JJIA 2O5VA 3EIQA 5J4YA 3CUEF 3CNOA 2ORWA 5C18A 1ESNA 4OHWA 2GVZC 2C2HA 2ERYA 1CTQA 1KY2A 2XJ9A 3KFVA 4LYAA 2GXAA 1UEJA 4TSFA 1FTNA 2NO6A 3UIEA 2GK7A 3NEYA 3KQNA 1L2TA 2IYQA 2W6JD 3TQFA 4ACAA 2GF0A 2WKQA 3TH5A 1EK0A 4DUGD 3SOPA 2NG1A 3MFYA 3AVXA 3ONWA 2ZI4A 2GXQA 4EDHA 3CO5A 3BOSA 1G8YA 3DOFA 3OAAD 2WWWA 5B2ZA 1G3QA 3EIEA 1GRRA 2P3SA 2PZGA 2Q3MA 2GBLC 1VDZA 4JSYA 1RIFA 2GZHA 1C1YA 4QGGA 1DE0A 4MRPA 3NWJA 3J81k 2D7DA 2CLDX 4NHOA 5C4MA 1E2IA 1OIVA 4A4DA 1JXMA 2C98A 3VKGA 3WHKA 2YVUA 1G8GA 2RHMA 3HWSA 2QI9C 1OH8A 4C7OA 4U5XA 3RABA 3WNBA 2LCFA 4YXWD 2B8WA 1U8AA 2IBMA 2ZE8A 4BLSA 3TUZC 1FMJA 3SEAA 3VR5A 1MABA 1OXVA 2GCNA 1OB5A 1BOFA 1OHHA 2N1BA 1G41A 4R2HA 1KMHB 1WDTA 4DLVA 1CS4C 4EPWA 3ICQB 5L3VA 1X8JA 3UMRA 1ZINA 3ZZUA 2BBOA 3D31A 3PUYA 3OFNA 2V9PA 3T12A 3U3MA 1S9DA 1AN0A 2OILA 2IHBA 3AKYA 2IS2A 1CBUA 5B57C 2ECKA 3LD9A 3NH6A 5GADl 2WWYA 3LAWA 4DHEA 5CB6A 1FPMA 1ETUA 2WJHA 2V7QD 2XGJA 1CR4A 4K46A 2J7PA 4CT4B 3VNUA 4AIIA 4NBSA 1M7GA 1XTIA 1NG9A 1E2KA 2GCOA 4FCTA 2P5TB 3RRYA 2FE4A 2OT3B 2VHCA 5C4GB 3W90A 4JL8A 1F48A 2GZAA 2O0KA 2SHKA 3HPQA 3K0AA 1IY1A 2A7QA 1G3IA 1ZNZA 1SXJC 2FOLA 1T9HA 3FKSD 3F3YA 5BQ5A 4JL6A 4B6EA 1NN1A 3AVYA 2NIPA 2N46A 4ARZA 2F6RA 4P31A 4MGZR 2ZITA 3UK6A 2E1RA 3WHLA 3AVTA 1EWQA 1YJ5A 3LBNA 3T1QA 2AXNA 1HY3A 4JLAA 4U02A 2IYLD 4EPTA 2QL6A 3I92A 2IX3A 1CIPA 2J0SA 4G5QA 1M6NA 4BZXA 4UXHA 5L3RA 4B2PA 1EFRA 1QHIA 1E3MA 2NTYC 4FMDF 2R2AA 3ASZA 2D4HA 2BM0A 2K5UA 4PC7A 3CPJB 3CH4B 2OZEA 3RNLA 4QJ3A 1U9IC 2YINC 2GHIA 2ZAMA 4EFNA 2IF0A 4JMPA 4LC1A 4M9QA 3CRRA 5CIQA 4DCTA 3CZPA 1U94A 1GIAA 4HZUB 1OW3B 3I73A 2BJVA 4DJTA 4DDTA 1UBCA 2OXRA 3I3SR 1RKBA 1AIPA 3B82A 4TLEA 1EESA 1U99A 1P9RA 2FV8A 1OXTA 1E9EA 4TL9A 1M8PA 1G6HA 4B73A 3PENA 3CH5A 2XZPA 2B21A 2P2LA 4GOXA 3K70C 1TF2A 3MUFA 4Q9HA 2CEAA 1KI2A 3SHWA 3WRXC 1G9XA 3CNNA 1QVRA 4UQOA 5SZIA 4US0R 1TEVA 2G9NA 1XPUA 3GJ5A 2CL0X 3VU9B 2ZRKA 4EKDA 1G5RA 4HAVA 1G16A 1SVIA 1W2GA 1S96A 1RW4A 3KJIA 5HPYB 1JR3A 2IHYA 2ZRDA 3IBYA 3LRPA 3UWOA 4BEJA 2QTVB 4LHZA 2P6RA 3MWYW 2IYWA 1OYWA 3TAUA 1YZLA 1XDBA 2QT0A 3GLIA 1ZUHA 3A37A 3T1VA 1D9ZA 4IKEA 4WZ6A 5SZKB 3UMFA 2QPTA 3WMEA 2VP6A 3X1YA 4IOLA 2WHXA 1R5BA 4KBGA 4YMSA 4EPXA 4NTZA 2HT1A 4TMVA 3U61B 1HH4A 2UZIR 1XCPA 3ADKA 3FPAA 2ZS8A 1YZTA 1Q57A 3FHCB 5FTLA 4AWXA 3QJYA 1W7AA 4LY6A 5KPJA 1QHHB 1UAAA 4C2TA 1GNRA 1ANKA 2QROA 3FMPB 4WOPA 3VMFA 2JLXA 3SJZA 2QPAA 3P1JA 2VYFA 5E4FA 4MUAA 3TW4A 2ZANA 3PVSA 1ONBA 2DFTA 1HT2E 5DSZA 1NVUQ 3P4XA 3W6NA 1IJEA 1M74A 2AN9A 1AZTA 1JR3E 5DI3B 5BYJA 3NG1A 4Q1BA 4ZDWA 4FCWA 2PEZA 4WZAE 3GLIE 2Z4SA 1KSFX 1YZUA 5JLJA 3RANA 4B76A 3M0EA 5A5GA 1E94E 3RS5A 3GEHA 3MWJA 4AKGA 1ZYUA 4A2PA 3K0FB 4PSVA 4NYIR 4XOIA 2H57A 3SYNA 1Q1BA 2V3CC 3SBEA 1J8MF 3TJZA 2A30A 5JHHB 1N5LA 3V4RA 1BO6A 3KDSE 5FPHA 2QGZA 3R7WA 2RGCA 2VSXA 3LVRE 4MRRA 4C0SA 1AGRA 1WE2A 1GDDA 2V4ZA 5AUQA 1KSGA 2JGNA 4MGYR 2FSFA 3MD0A 3WMFA 1ZU4A 4D82A 1CR1A 2CHGA 4HI0E 1KI7A 2KBEA 4JJZA 4P4UA 4US2R 5F3WB 4NH0A 4NYIQ 1G6OA 2ZJYA 5SZJA 5DIFA 5EE9A 4QC2A 2ONJA 2ZPTX 1HQCA 4LUCA 3KXKA 3IKJA 3GLHB 2CCJA 5KYKA 1JAIA 4BFXA 2OUKA 3MG9A 2W2VA 3DZDA 4HUQB 4IDOA 4LYFA 4ZKDA 2O8BA 1XEXA 1R5NA 2E9SA 3SU8A 3AQ4A 3Q5EA 3T35A 4JZKA 2WVJA 1QBKC 4IDNA 1E0AA 1OYYA 1E0SA 2OXCA 1ZW6A 4BECA 2PLRA 2IS4A 3RAPR 2IL1A 3UATA 1GNQA 2O0HA 3Q85A 2ZE5A 1SVLA 4X8OA 3EA5A 2OCPA 1Q1QA 5L3SA 1NVXQ 1GRNA 1T5LA 1YR6A 2DHRA 4KU4A 3DO6A 1Z29A 4F92B 4Q1DA 3QG5A 3B1XA 1E99A 4WIAA 3P20A 2WAYA 2OEPA 2ATVA 3MRSA 2ZVQX 4V0OA 4GSYA 3LVQE 4US1R 1IXZA 1E2NA 2DY1A 3GLGA 1NG1A 2C9OA 3SJBA 5FH9A 2IWRA 2B7BA 2VP5A 2X8AA 3GEIA 5H8WA 1OH6A 2QNRA 3LW8A 4FXPA 5LPNA 2FN4A 4QHTA 3QVUA 2WSSA 2AKYA 2QUZA 5BYKA 1MKYA 4ZPXA 3THXB 2OBNA 1VG0B 4IXMA 3KJEA 1OHHD 1UBGA 3HYTA 3IILA 1JBKA 2O8DB 3QKUA 1HE1C 5BN4A 1Z63A 4A9AA 4UNNA 3KXIA 1S4QA 1JAHA 2XSZD 2ZTSA 4LHWA 3IPXA 3CRW1 1II0A 3ND8A 3OFND 1TF7A 5G41A 1KGDA 2ZRGA 4Q4HA 4HYYA 3EASA 2XAUA 1E2FA 4RD1A 5DO9A 2IK8A 2G6BA 1FFHA 5KNDA 2H17A 2HLDD 3JZMA 5KDOA 2WMNB 1VTKA 4EPRA 2GA8A 2O8FB 4AC9A 4OQNA 5FOWA 3T34A 1GITA 4LCBA 5CYOA 2ZIAA 4D25A 3FMFA 2OV2A 2C78A 3PEUA 1KK1A 1AKYA 2XITA 2Q21A 2QZ4A 1E79A 1Z6GA 2ZJ5A 3HYRA 4K8OA 3HP1A 2NGRA 3FMOB 5IRCD 4O2RA 1KJWA 3BJIC 1T3SA 5KTYA 4PQRA 4TTPA 4JYBA 5BW8A 2BOVA 1AS2A 1PLKA 3ECCA 4GT1A 1XEFA 2OCAA 3KTAA 2CXXA 3QF4A 2BKUA 1A7JA 1E2MA 2ZRNA 3O8BA 3MCAA 4P0TA 5ELXA 2VHUA 4W5WA 1A1VA 1PUIA 3L0IB 4HATA 5JMTA 2W2XA 4QM7A 2F43A 1QVAA 2JJ1D 2VIIA 5EXTA 2C03A 1R6BX 4X8MA 4RJLA 3KQLA 1NJFA 2JLWA 4Q02A 1P60A 2PLFA 1FOEB 4AD8A 1W0KA 1EXMA 2W2TA 1XTSA 2IYTA 4KV9A 1XMSA 4ZIRA 2ZU0C 2QAGC 1XCGB 2ZS7A 2W6JA 2JJ8A 3IBGA 3KQKA 1ZCAA 2WJIA 4DUGA 1IJFA 2XOKD 3CR8A 2D7CA 3AUYA 3AGPA 3LX5A 1K5GA 1P2VA 3BE4A 4DDWA 3VKWA 3KQUA 3FVQA 1P2SA 4URVR 1X1SA 2ZETA 1ZM7A 4MUBA 3OAAA 3R9XA 1NL3A 2GXUA 1OFHA 5LD2C 2NO1A 2FSIA 4QBGB 2IW3A 4LC0A 1E4YA 4MYTA 1LFDB 4FI3C 4BLPA 5FL7D 2QMOA 4F4JA 4M1MA 1CP2A 1XX6A 3K09A 2YOGA 4B3XA 1NRJB 2VSOA 3THYB 5A4JA 3GP8A 2JJ2A 2P67A 3IDQA 4JBWA 4W5JA 1FP6A 1FUUA 4YXWA 3TR5A 1G3UA 5FFMA 3NEJA 3QUSA 1T8TA 4C0QC 1YRBA 2B92A 2CNWD 221PA 3CRVA 1CXZA 5JWRA 5TDHA 1V43A 2NPIA 1IXRC 4DC9A 4GPTA 1Q20A 4RD4A 2FJUA 3QF7A 1KTVA 3WNDA 4U7DA 3H2YA 3LWNA 2R44A 4BPBA 3SFVA 4RVCA 1YU9A 2NZJA 2V7QA 1BMFD 4B2IA 4FWTA 1QZXA 4L4UA 4JJKA 3EPLA 3LQQA 4D0GA 3W3AA 2FFHA 4DBLC 3A4MA 3TAHA 5GJVC 3IHWA 3A58B 3F0TA 5J4KA 3KFXA 3VR4A 2Q9AA 1CRQA 2PT7A 2FWRA 3FKSA 4N1AA 4OL0A 2IUUA 1ZM2A 2W83A 5EXSA 4D0LB 4EJSC 3SQXA 4D0NA 4NCIA 1FX0A 4QBFA 2C8VA 3JVUA 4YQFA 1KNXA 1Z2AA 5CJ2A 2BBWA 4L9SA 3TIFA 4G5RA 2CHQA 4HLQB 4OK5A 2DWQA 1BYUA 4B3BA 3PFIA 2QQ0A 4C9BA 2MSEB 2JDID 1V5WA 2ZS9A 1LNZA 3GFOA 3ZD7A 1T6NA 1VYTA 5G40A 3OHMA 4HEJA 5P21A 4A8JB 5GJWC 3AVOA 3KJGA 2QN6A 4QXAA 1HURA 1L4YA 1VG9B 2VLIA 3AF3A 2ZI6A 4DEYA 3QG1A 1MH1A 2ZE6A 2XXAB 2EU8A 3ZZ0A 4AYXA 2ZRHA 3W5JA 2R6DA 1E69A 3CKLA 1Q0UA 2ZAOA 4POAA 4XD7A 4Z54A 2WWFA 2IYYA 3QKSB 2WICA 3BH0A 4TLAA 4YMWA 1ZC3A 2VP2A 1NSFA 1JB1A 3TGPA 3K53A 3AF0A 3S1AB 5C46F 1D2EA 2ZSBA 3PQCA 1OJLA 2J0UA 4WBSA 1Z47A 5HZHA 3NHBA 1ZUIA 3FB4A 3FTQA 2ZYUX 5FTJA 2WJJA 1ZNXA 1KMHA 3RRNA 5FR2A 2I3BA 5AUNB 2QRZA 2ZYTX 2R6CA 3LNCA 2REXB 1GUAA 4LDJA 2ZVPX 1YVDA 1E2GA 2H7VA 4LV8B 5FBRB 2Z83A 2JCSA 3BH6A 4PSAA 5BXQC 3NBFA 2REBA 5FI1B 1ZP6A 4O25A 2H5EA 3RS3A 2ZRCA 2VQSA 1GZSA 3D6TB 3HDTA 1BH2A 1TF5A 3SZRA 4ERNA 2ZU6A 5GJBA 1LS1A 3QEOA 3GJ4A 4M8NE 4V0NA 1WBBA 1X86B 5JRJA 2QSYA 4YMVA 3ZIAD 2R6FA 1Q1ZA 4Q4JB 3A36A 1BYIA 2HF9A 5FBQB 4HLUA 1ZU5A 5IHPA 3I5YA 2WSSD 3U5ZB 5F98A 4OQFA 4KBFA 3RC8A 2PJZA 3PEYA 1R0ZA 2CHVA 3BERA 1KIMA 1N6RA 3BFKA 3PJRA 2BCJQ 3LA6A 4HDCA 4IEEA 5D3MA 3QBTA 3ZS8A 1WMSA 4R7ZA 4DRZA 2F55A 3WBKA 2OLKA 2CL6X 1KK0A 1VKJA 2J3EA 4HAZA 5EE5B 3SE0A 5HTKA 2YC2C 1LF0A 4ITRC 3H0KA 4DLRA 3RWOA 3D8BA 2XB4A 5TV2A 5JFGA 2IA5A 5CITA 2KBFA 4Q66C 1NP6A 1NIJA 3B78A 5KHOC 1RYFA 3SYLA 1XF9A 4LGMA 1TADA 2J41A 4XIGS 3BIFA 4Q1CA 2GESA 5TY0A 1N2CE 3THWB 1KO8A 3QXXA 3W6OA 1MV5A 1XXHB 2H8KA 4P3YA 4HAYA 1ZNYA 3K09C 3R9IA 4P4SB 4LHXA 4Y0VA 3EXAA 1CJVC 4FW9A 4JVNA 3AEZA 1Z3IX 3ZH9B 3QEJA 2R6AA 4HZUA 4ZV4A 1HV8A 1G4UR 4LJ4A 1CULC 2ZJAA 2EFHB 1L4UA 1M7BA 2IC5A 1OV4A 2X1VA 4FD2A 4IOKA 4F38A 5JJKA 3HR7A 2ZRFA 1YZNA 1J70A 2ONKA 3EPHA 2DFNA 3QE0A 4RY2A 1XMIA 4Q7KA 3VTKA 4EQ6B 1CJUC 3VKHA 4NZYA 2A3RA 1QHGA 4YC7A 3AP3A 4FCVA 2W6ID 2VP4A 421PA 1VIYA 2EYUA 1VHTA 2XNDD 4G1UC 3B5JA 4DSUA 2FFBA 1W0KD 3JVVA 1UM8A 3VU9A 1S2MA 1N6KA 2O8EB 1YR8A 4HB4A 2ODBA 4IDQA 4B43A 5D3QA 3OE7D 3KZ1E 4RCYA 4AURA 1FNMA 4DEXA 1Z6TA 2FZ4A 4PR0A 2GCPA 4A82A 2CLCX 4FN5A 1CU1A 1XD2B 1QHYA 4X8HA 4OBEA 3EZFA 3CR7A 4W7SA 1HYQA 1OB2A 1IQPA 2RCNA 3U44B 2BMFA 2VPPA 3CPEA 4TMKA 5J4VA 3KB2A 4PO1A 1G64A 2N42A 1U0LA 5AJYA 3MSXA 2O0JA 2RGAA 5SZHB 2BV3A 4ZCLA 5E7IA 1GKYA 1CJTC 1EWRA 5FI0B 4XWOA 2FPLA 1QHHA 2TMKA 3N2EA 3B9QA 1S8FA 3GD7A 4LPKA 2JJ2D 5FBLB 4WXPA 1OFTA 1G1MA 3C41J 4PPNA 3CM0A 4LYHA 2GWHA 1GTVA 2PZEA 3GLFA 4A0FA 3C15C 3A4LA 5DI3A 3U6BA 2HYDA 3AF4A 4DLUA 4JLMA 5TVKA 5ANRB 4YLGA 2FF7A 2OG2A 4BE7B 4OHZA 2XSZA 2Z43A 4GFDA 4B3FX 4KI0A 1IBRA 4Z1MD 3K0FA 2YC4C 4PAQA 4CEHB 2ATXA 5JS8A 3C14C 1IN7A 1KSJA 3KKPA 1ZC4A 1KDPA 1OLOA 1GKIA 3SJCA 1E2DA 1W0JA 2HLDA 5KNCA 4XVUA 2GJSA 1US8B 1XTRA 2WWHA 1IAQA 1RFLA 1QHXA 2J9RA 3AV0B 2FX3A 2NO0A 3EC1A 4O0MA 3BXZA 4G01B 4Q1EA 1P4SA 2ZSEA 2WPDD 4CEJB 3K0CA 4WVFA 4JKIA 3OEHD 1AQYA 4Q1AA 5FPKA 3GLFE 5KPDA 1UPTA 1NY5A 1ESMA 4GRAA 4WW0A 1LTQA 1R4AA 2EW1A 3B1VA 3Q9LA 4TYPA 1Z6YA 5EUMA 5FOTA 2CCKA 4KVAA 4DIEA 3GLHA 4NYJR 2WIBA 2BMJA 3OZXA 1ODFA 2H18A 3KUCA 2EFEB 4HUQA 4QOSA 1EGAA 5JSZA 1Z06A 3I61A 1W4RA 2WWGA 3KKOA 1N5JA 1PLLA 4MA4A 1MR3F 2FPKA 5LB2A 3UG6A 3HU1A 2CJWB 3QBVA 1G7TA 2JJ1A 2QENA 4PHHA 1W36C 2RKOA 3L8YA 1T3HA 1XRJA 2WWXA 4MDFA 2G83A 3CB4A 2AR7A 5FOVA 3ZYCA 2GK6A 4CGZA 1BS1A 1HEIA 2QP9X 1S0UA 1KOFA 4NYJQ 3ZD6A 1L8QA 2YNMA 1NI3A 2YZ2A 4LV5B 5GVRA 4B33A 3MAAC 4A0RA 2PMDA 4II7A 2ZSFA 1NN0A 1JR6A 2XOKA 3G0HA 2BC9A 3B7GA 3EC2A 3P26A 4FIDA 5EQTA 3AVVA 4P4TA 3PIRA 2QP3A 1TU3A 3WY9A 1F3OA 1TL7C 4QNRA 1IONA 1SHKA 1SVWA 3GJ7A 2Z4RA 3GLHE 3I4LA 2FSGA 3LXRA 3MWLA 4M1SA 4XD7D 4DCNA 2J45A 4NE2A 3QQ5A 2A2ZA 4Q1FA 4G5GA 3K70B 2G0TA 3ZJYA 2C99A 1KDTA 2WM9B 1S1CA 3L8ZA 4OYHA 4TL7A 4ZCIA 5FL7A 2Q3HA 2HJGA 1R0YA 4WA7A 3PEWA 1J90A 4M9SA 3THXA 2KJQA 4XVQA 4NCJA 1RC8A 3WRYC 1J7KA 2O8DA 2LWIA 3WYFA 1WCV1 1Y3AA 1T91A 4JYCA 3SYKA 5IF9A 5JWOA 5CLQA 1AZSC 4I1VA 1G5TA 2NPFA 4EPVA 1Z0AA 1MT0A 3DM5A 3ZDQA 1AKEA 1TX4B 2E87A 1NN5A 1XP8A 2BDTA 2CNWA 3RLFA 3RYTC 2QMHA 2IXEA 4C30A 1E2HA 2O8FA 4LJ7A 2ZEJA 1DAKA 3D3QA 4XWAA 4JBYA 1IY0A 3GJ8A 4HDOB 2IS1A 3KL4A 5J4HA 1E1QD 5E7JA 4FWIB 1KY3A 4PSKA 1G8HA 3QKRB 1ELOA 2FA9A 4DXAA 3EIHA 3Q8XB 1FL9A 4TYQA 2RGGA 3DKPA 1BMFA 4LJ8A 5KUTA 1NNEA 4D26A 1QF9A 3WP1B 2ODEA 4A6XA 1VG8A 3TR0A 3I72A 3U6KA 1HE8B 2WZQA 1OE0A 2HEIA 3QXCA 4JIMA 3KQHA 4D4LA 4YDSA 4RZXA 4BUJA 3I5XA 3EW9A 2OLJA 4QGHA 5J40A 1XEWX 1E9DA 1SVOA 2OCYC 4ILEA 5LDDC 4ZO4A 1RRGA 4PAOA 4TN1A 5DNYB 1JALA 1ZD1A 3QY0A 4XJXA 4N3NA 3OEED 1I4TD 2CMKA 5L8VA 1LF5A 3BD9A 2VHJA 4DT1B 2GTPA 4JLBA 3VNVA 3A4NA 3LW7A 2Y8EA 3U7HB 1Z5ZA 3MLEA 1KJYA 2D2FA 4IHQA 1X1RA 3CPHA 1IN4A 3IEUA 5FOSA 5FUWA 2B6HA 3PG5A 4NDZA 2JDIA 3B2EA 4DLYA 4LPSA 4ZI2A 2V1XA 1U0HC 2GEUA 4Q48A 4C7OB 4AY2A 1D9XA 5AUPB 3HR8A 4EUNA 3ADBA 1MABB 5JHGB 3FFAA 4MRSA 4PZYA 5DISB 3CX7A 4V02A 2WKRA 3B8HA 4A6PA 4C3ZA 2DWPA 2GEVA 2C9YA 2FZLA 2VL7A 2ZR7A 3AF2A 4NP6A 4PPQA 4TTQA 3TMKA 4QGFA 1NIPA 2RGDA 2V6JA 4F4CA 4DLTA 1E9FA 4NU0A 1N6NA 2HCJB 3EZ2A 4Y0AA 2ZRMA 3AKDA 2PMKA 3LV8A 1RE0A 4YDHB 4AKEA 5KOYA 3THYA 1YHNA 3K9HA 5JWHA 1E0KA 4PQFA 4I1SA 1VCIA 4IFBA 1SKYB 3AP1A 1OIXA 1X3SA 3U3OA 1EX7A 2Q6TA 1RPZA 1QHNA 2C77A 4LJYA 2MMCA 4D2IA 4M22A 4D6PA 1TQ6A 5JS7A 3ZGXA 621PA 3K0CC 3G82C 3LDAA 1HT1E 4CT5A 2YWFA 1HTWA 1Q3TA 3B9PA 2GJ8A 4PX9A 1FP7A 5JBQA 1X6VA 4C0LA 1XPRA 1D6JA 1GL7A 2AWOA 3OESA 4PO9A 2XTZA 4IEIA 1MOZA 4DSTA 4QGAA 1F6BA 3NHAA 3ZVRA 4M1OA 3W6PA 1K5DA 2ZE7A 3TQCA 2ANCA 4S35A 2W58A 3CLVA 4NL4H 1XD9A 1AS0A 4C0BA 2QM7A 3GJXC 1D2NA 3H4MA 1EFTA 3I8SA 5CIWA 4BWYA 5EUQB 4URYR 4WAUA 2WMOB 2BMEA 4IRUB 3ZIAA 3REGA 2FG5A 4JLJA 4BFSA 2AX4A 2PX3A 2D2EA 3U60B 2PJRA 3LH5A 5IDVA 4GDFA 2QMEA 3TSZA 3ZQJA 3EARA 1LVGA 2IXGA 3QVVA 1GWNA 1LW7A 5E7MA 1E32A 2ZYVX 3T1OA 4URXR 5JCPA 1K8RA 5KU1A 4N0DA 4UNSA 1DAMA 1SHZA 2EFDB 2GDJA 4JLPA 4B3CA 2VP0A 4CEIB 5KDDA 3E5HA 2PX0A 3AVPA 3IIMA 1IM2A 1E96A 1GG2A 3ZQ6A 4P33A 1T5IA 1KO4A 4PPFA 5EE0A 4MRVA 1W0JD 3N5CA 3O8DA 3QXSA 1XNJA 3M1IA 4C4PA 4A8JA 3GLGE 1N3BA 2J59A 4MH0R 2PL3A 4A2QA 2WSMA 3RC3A 3DKVA 4BZPA 3EA0A 3UWKA 4F91B 3DZ8A 1ZUNB 1NSTA 4TQ9A 3A1WA 3LO5A 4OI2A 3G5UA 2DWOA 1NMYA 5FR1A 4PC6A 3HPRA 5AR1A 1G8FA 2VHTA 4ON9A 5FTMA 2VRWA 2YV5A 4NPHA 1W2HA 1DARA 3E1SA 5JEEA 1ZJ6A 2XNSA 3B1WA 3QKSA 4L9WA 1Y63A 2GJKA 2ASEA 5M04A 2JASA 1JEDA 4IOJA 3S1AA 2YYZA 3KKNA 4CW7A 4I99A 4FMCB 5DGXA 2EWVA 3OIUA 1DO0A 2BVNA 2D3WA 4EPYA 4XTRA 1KI9A 4DDUA 2W6IA 1RRFA 1Z0JA 3A1UA 3CWZA 1NBMD 3IIKA 2GZDA 3NIBA 4LV6A 2XNDA 5H70A 3RS7A 4DDVA 2QAGB 1VHLA 1KK3A 3AKEA 4JLNA 3VFDA 4RCZA 3OE7A 1QDEA 4C0JA 1Z0FA 4PZZA 3PCRB 4N0EA 4Q01A 2VH5R 3EZ6A 3LLUA 1N0VC 1RRCA 4UXJA 2JLYA 2ZR0A 1E2LA 1R10A 4Z51A 1FW6A 1JPJA 4KJZA 1VCMA 3O8CA 2YOHA 3REFA 4UJ3A 3RRZA 5HKKA 2WTUA 1E98A 1DG3A 2F9LA 4LZZA 5TB5A 5K8LA 5E95A 4UXIA 4P32A 2JA1A 4Q4JA 1UDWA 1Z83A 4Q18A 2KB0A 2ZRLA 2QE7A 2JIZD 3AGQA 1CR2A 3BC1A 3I1FA 4HLCA 3ND9A 4K81B 3SS8A 4A0HA 2WJGA 4GMXA 3CF2A 3OF5A 3GJ0A 4XWKA 1EX6A 2X2FA 5TMPA 1F2UB 2FEMA 3B1ZA 1U81A 2IUSA 2IYSA 5DH9A 3SC3A 3RSOA 2ZJZA 3NKVA 2Q9BA 4EIWA 2NO9A 1HUQA 1XB2A 1XU4A 2IYRA 3P27A 4AKHA 2FH5B 2VSFA 3GQBA 1UJ2A 3SQWA 1E1RD 2IEYA 5FOXA 4GZMA 3BS4A 4NKRA 4C0HA 4Z1MA 3THWA 1QG2A 1ZM9A 4P4SA 1CR0A 1DO2A 2LKCA 2F3RA 2QTHA 1XWIA 4BFTA 4DSNA 4V0LA 3AM1A 2JEOA 3B13B 3X1DA 1W47A 5KSPA 1R5OA 2FDCA 1MRSA 8OHMA 1DOAA 1YRAA 1F60A 2WPDA 2CE7A 4KSCA 821PA 5JJLA 1DVRA 5BN5A 3OEHA 3EX7C 1N5IA 2GF9A 2RGNA 1NMXA 2ZJ8A 5HCNA 1KZGB 4I4LA 4EJSB 1DAEA 4UKDA 2BHRA 2BMDA 2JLQA 2WAXA 4R9UC 4OI1A 3WMGA 5AUOB 4KITB 3EZ9A 3BB1A 4EQ6A 2QTFA 3T1TA 4RD2A 4Q21A 3V00A 4R2IA 2XB2A 1KI1A 2HT6A 2UVQA 3HU3A 3WYGA 1F2TB 4Q19A 2PBRA 3BK7A 1RJ9B 4DVGA 4RKFA 4GZLA 4KAXA 2O8EA 5FUVA 3TSOA 1Q3HA 5AJWA 2JLVA 3U7EB 4WZBE 4M53A 1XCMA 3WNCA 3QIAA 3AKCA 2GILA 4E5UA 3FE2A 3LY5A 4BASA 2YKGA 1JJ7A 1G19A 2A78A 2GJAA 2OESA 4PC1A 2OO7A 1PV4A 3EPJA 3BB3A 5B30A 1NKTA 6Q21A 1XD2A 3O47A 2WBLC 1YKSA 2F3TA 1EFHA 3N2IA 1GNPA 2GBLA 5CM8B 4DB4A 3U44A 1KI8A 1JJVA 2QT1A 3AH8A 1P73A 2C95A 4MGKR 4GNKA 2G0NA 1II8B 1KNQA 2OBMA 2WJVA 1ZD9A 1E2JA 2REOA 1KAGA 1AGPA 1Q1EA 5L3QB 4BRUA 2EFGA 2IUTA 4TMTA 4QJ5A 4YONB 1Z0DA 4L5BA 1PZNA 1KI6B 5E3HA 4QFMA 1A2KC 2ANBA 3RVBA 1DAGA 4TQUS 4AK9A 4RSGA 1X8KA 4A8JC 1D5CA 2IEZA 2QORA 4M21A 1AQUA 2JLUA 1U90A 1R2QA 2AK3A 1G21E 3N70A 1XTKA 4Q03A 5EE3A 4F7WA 4X8LA 5H68A 4UJ5A 5DHFA 4RFSB 3LXXA 4CEHA 1GRQA 2CL7X 4D4MA 1WB9A 2OAQ1 1LV7A 2QBYB 4M0LA 5EP4A 3W5IA 2FGJA 2ZI9A 1IHUA 4TMZA 3TVTA 4B32A 4DCSA 2X77A 1YR9A 1M2OB 1US8A 2JATA 2F9MA 2OHFA 4IOMA 1E1QA 4AYTA 4B2LA 1H8HA 2QY9A 4CEJA 2ZI7A 4I1UA 3KB1A 1P5ZB 3QENA 2J46A 2QEQA 4HAXA 5JEDA 3LBHA 4ZIRB 4FMBB 1KDRA 2QPOA 4L8GA 4GL2A 4MYHA 5G3ZA 4TZ0A 1NY6A 3A6PC 4D81A 4M1KA 1JQJC 1TQ4A 2C96A 5KNBA 3U3JA 2ZJBA 3MJHA 3LQRA 2G3YA 1AK2A 3GFPA 1HA3A 4LBYA 2RMKA 3QOFA 1Q22A 1FTSA 3W3ZB 4BFYA 4LJ6A 1VG1A 2ZUDA 2WJYA 4BLQA 1YZQA 3L0SA 2CJWA 1KDOA 5EZ5A 3OEEA 3SFZA 4H1VA 4TQAA 3PUVA 3ZZTA 2DYKA 2H1LA 1E9BA 1DAFA 2UZ3A 3NTUA 1U9IA 1ZCBA 2RGBA 1W4BA 2OCBA 4OQMA 4DLWA 5LB4A 2DFKB 4HB2A 5CJPA 1MO5A 4BFZA 1C4OA 4LOAA 3CW2A 1G8PA 4QG7A 5AWFC 3X1ZA 4I1OA 4TZ6A 1I2MA 1J2JA 3VAAA 1TTTA 3CIOA 5CLLA 4PHFA 1IXSB 2RHDA 3U3KA 4UNRA 1S1MA 2J0VA 2ORVA 1H65A 1P75A 3MWKA 4GOJA 4KXFB 4RZ3A 3IQXA 4JBXA 4BFWA 3A1SA 1KAOA 3C16C 1W4CA 4BQSA 2O8CB 4GMDA 4URZR 4MYUA 4DLSA 1XEWY 1ZMXA 3VR6A 2OE2A 3AVWA 4CZ2A 4FMDB 2YHSA 4TMXA 3PEVA 1XD8A 2H16A 3RS4A 4JT2A 4QRHA 5GVSA 3BRWD 4DIDA 1NVVR 2RH5A 1HQYE 3CF0A 3FMIA 3NC1C 2J5XA 1JNYA 4QHSA 3DPUA 5CDFA 2IYXA 1TAGA 3VQTA 4OQXA 4L16A 1JECA 2PEYA 2GETA 4E07A 1FNNA 2ZJ2A 3KXLA 1G20E 5DI9A 2P65A 1F5NA 3A1TA 3QXHA 5G53C 1FX0B 3NDBB 1PJRA 2ZRPA 2CK3A 5HKKD 3ZVNA 4JLDA 2V8OA 1MO6A 1NVVQ 1JQLB 1Q44A 1TNDA 3QKRA 1ZBDA 4QBIA 5DE3A 5DN6D 2NQ2C 3AP2A 1N6PA 3SNHA 1DADA 2I4IA 2HXYA 1L7VC 2B7CA 4HUTA 2QE7D 4LI0A 1U2RA 1ZRHA 4ASUA 1JPNA 3H1TA 4C2UA 1E6CA 3L2OB 3NC0C 3OIYA 4M1YA 4YMUA 1G7RA 1VCOA 2FGKA 2HXSA 1QG4A 1GVNB 4BLOA 1O3YA 3TBKA 5BN3A 2EFCB 5CYPA 3MGCA 4J0QA 5CDFE 4CVNA 1P6XA 4NCKA 4MKHA 5IK2D 1R0WA 1CJMA 4OHVA 4NYMR 4DT1A 2OFWA 5FPYA 3K70D 2VO1A 2C5LA 4IFEA 1EFUA 5KSOA 2MSDB 1B0UA 1C9KA 5FTNA 1U8YA 2JAQA 3FWYA 1NLYA 2GVDC 2G77B 1KMQA 2G1KA 4TL8A 3O8RA 4KODA 1NMZA 2BEJA 1ZM3A 4RD0A 1A82A 4BEBA 3SR0A 1U98A 4Q4AB 1Z6XA 3LLMA 4F4IA 3K0EA 2KE5A 3RS2A 3GEEA 3TKLA 3AVQA 3TUIC 2J0UB 4E09A 5DLQC 2C04A 4LJ9A 4IW3B 4NYMQ 2VF7A 3ZVMA 1UKVY 1ZM4A 1KJZA 1ZIPA 2JLZA 4B3GA 4LYJA 5J5CA 1SXJB 1GFIA 5FOUA 4WXRA 1SVMA 3TK1A 2F1HA 1M34E 4UNPA 3VR3A 5JI2E 3KKQA 2OBLA 4Q7MB 1N6OA 1KI3A 5JI3E 2IF2A 3L0OA 4W5HA 4PZLA 3V9PA 2QM8A 2BCGY 3BFXA 4LRWA 4JLVA 4TLCA 4LX0A 2F7SA 2ODNA 1OSNA 4B47A 5CM9C 2A5YB 1UKYA 1W36B 4GOKA 2KWIA 1TMKA 4D4JA 4RKEA 3DOEA 1NKSA 1COWD 1YZKA 3DM9B 3SBDA 5BWMA 2GAAA 4Q7JB 1NBMA 5IT5A 1VMAA 4BFUA 4KSBA 2KSQA 4HLUC 1UADA 3WP0A 4TWZA 5D3MB 4AG5A 3B85A 4H9GA 4BGDA 4B71A 3SHFA 3UANA 1I4DD 2UKDA 4NMMA 2V54A 3QPUA 2AFIE 1ZNWA 5EXXA 1Z22A 4GP6A 3DMDA 1E9SA 1T3LA 2QSZA 2VF8A 2RAPA 4IDHA 4MYCA 1NF3A 4TLDA 2QG6A 3LBIA 2GAOA 1OFUX 1KO7A 1OKKD 1SKYE 3CZQA 4Z8YA 1CF4A 5AJVB 2P5SA 3RRMA 5KSZA 5J47A 1UBEA 4LHVA 4JVSB 3AF1A 1KSHA 2JIZA 3QPWA 4V03A 5F2EA 2WV9A 4PTLA 4OI0A 1NBME 3U4QB 2QRNA 2ZSAA 3F5FA 3KKMA 4JVMA 4KHZA 4LHYA 3T61A 4QM6A 2OFXA 1RRPA 2R65A 4Q9LA 2BKEA 1GP2A 3EG5A 4KFRA 1P61B 1GILA 3RDPA 3T5DA 1XFAA 3FHOA 4CEIA 1OF1A 3BH7A 1IN6A 1DAIA 2HCBA 1DAHA 2ZSDA 1S3SA 5AJZA 1LS6A 1IOZA 4Q7LA 3VHLB 1H8EA 3ETLA 4H1UA 2OM2A 3BFVA 3PV0A 4QNMA 1E1RA 2O52A 2WOOA 1GOTA 2R6GA 1AA9A 4R71A 4ZDKA 5KO2A 3C7KA 4IJMA 3OIWA 3TNFA 3FFBA 3IGFA 1H8HD 4HDQB 1TUEA 1TEXA 2FSHA 2IWHA 1SXJD 3KJHA 4QHYA 1W5TA 4TYNA 2F1IA 2ZREA 4E03A 4EFLA 2QMUA 4KCGA 1Z8FA 1E2EA 4AKIA 3K9NA 2P0EA 2AWNA 2ORIA 2YWHA 2LKDA 4ESHA 4F93B 3EZ7A 4CYMA 4LJ5A 2Q9CA 2MSCB 3MJRA 1N6IA 3DVLA 3P4YA 4BLRA 4GBMA 1OPXA 3I62A 4URWR 4QKQA 3QXJA 3VR2A 1E0JA 1W36D 1MRNA 4TT3A 4PFSA 3CF6R 4M1TA 5EP2A 3CRQA 3R9WA 2PT5A 3B1YA 1VPLA 4PANA 3W34A 3BBPA 4XVRA 1W46A 3K8YA 2HYIC 2Z5FA 3IPYA 2BM1A 2QAGA 2VTKA 1SULA 1N25A 3VX4A 4KFSA 1I4LD 1VIAA 5TXGA 4LJAA 4TTRA 2R9VA 2XZOA 2BBSA 2RGNC 1DELA 4DCUA 4JLOA 1AM4D 1S3GA 3R20A 1LB1B 1YE8A 2DCUA 2ZUCA 3GLFB 2Q3FA 4KYIB 4JL5A 3X2SA 1W49A 4B34A 3PR1A 3SJAA 2AD5A 1OXUA 3L0PA 2HDNB 1E9AA 4KLZA 4MKGA 1P2UA 2GXSA 2P6UA 5FBVB 3U3RA 1G291 2YOFA 3IIJA 2AHOA 2FFAA 3HU2A 3EPKA 1J99A 2ZQ5A 5B58C 5CK5A 4G3XA 3K1JA 2W0SA 3P32A 2Q0HA 2Z0MA 3B60A 4DZZA 5AK0A 1XJQA 1PVOA 4G5SA 2J87A 4A2WA 3C8UA 4D4KA 4V0KA 4B75A 1F2UA 4ZKEA 2GCOB 1VCNA 1P9WA 4PPGA 1NLFA 2R62A 2V55B 3NXSA 4NCNA 3CBQA 2ZROA 3K0AB 5DYGA 4B6FA 2AKAB 2IS6A 4A1FA 4BZQA 1WRBA 4JVLA 3Q7QA 3GPLA 1N6HA 3NVAA 4OK6A 1SKQA 2W0MA 3QNUA 2A5GA 4ARZB 1IN8A 5HZKA 2IYZA 4IDPA 1N0WA 2CK3D 4Z8XA 1U0JA 2WKPA 4G5OA 5JSZB 1WXQA 4LWZA 4MGIR 3UPUA 1D8TA 3KUDA 3CX6A 1UF9A 2MMGA 4TSFD 3GFTA 4NCHA 4L15A 1A4RA 1Z2CA 4ASUD 2L0XA 3CWQA 1XMJA 2ZRJA 1E9RA 3TLXA 1KKMA 3VR1A 3CNLA 4TL6A 2CLSA 1KHTA 1WA5A 1YQTA 2AD1A 1R8QA 3CONA 3EWAA 4EJSA 4W9MC 2W00A 1MO4A 3BGWA 4E22A 1SVKA 4ZDJA 5CB8A 4OKSA 1ZD8A 2GRJA 2A5FA 2AK2A 2CVFA 1XPOA 1Z28A 3GCGA 4CDGA 1F2TA 3NDPA 1W1WA 1RJ9A 2QQEA 1GSIA 4EAQA 1SGWA 2OSBA 1BKDR 1PLJA 2H92A 4GI7A 5UKDA 2I1QA 1Z0KA 2EYQA 2FFQA 1YZGA 2OAP1 4XSHA 1SVSA 2D74A 1II9A 5FTKA 5B64A 3QKTA 4DKXA 4C0KA 2KI5A 3I8XA 3K0SA 3NH9A 3C4JA 2YJTD 1GKUB 4JT4A 4PQYA 4PC3A 3FHTA 3RHFA 1XBTA 2CDNA 4PHTA 4A0GA 2JLRA 5K8IA 4BFVA 1Z08A 3M6AA 4OI4A 3KX2A 4MDEA 1PUJA 3ADDA 1UDXA 1XJCA 2XXAA 4D80A 3TE6A 4TYWA 1II8A 4IXNA 1E4VA 1G7SA 1GL9B 1ZVQA 3DHWC 2HV8A 5L3QA 2CVHA 2RB4A 2CCGA 3T15A 1KI6A 2ZM5A 1WP9A 1AS3A 3I32A 2J7PD 5EJEA 4M2LA 3GLIB 3MMPA 1EG7A 3PITA 3THOA 1NN3A 4UNQA 5K8UA 1R0XA 2FPMA 2PZFA 1UFQA 4RFVA 4Q9JA 4RD3A 1T8UA 3BB4A 4V0MA 4JLKA 1A5TA 4RFSA 3GMTA 5JZVA 3IQWA 2IT1A 4KFTA 2QBYA 4HB0A 2D62A 3IO5A 1U8ZA 2ZR9A 2GEDA 3T06B 5HCIA 2OFOA 3H86A 2D06A 1P72A 2QA5A 3BAFA 3Q5DA 4B35A 2WIAA 3Q7PA 4O2LA 1EFRD 4DLZA 5LD2B 1DTSA 1FMLA 3M4YA 5J4LA 1CJKC 2ERXA 2ZRAA 1B23P 2R8RA 5DN6A 1SZPA 4HAWA 4BRWA 5K8TA 2FU5C 2XZLA 1TQ2A 3B6EA 2A9KA 4QJ4A 1WBDA 1G5PA 4O3MA 4A92A 1ZIOA 2BIFA 2ODWA 4XSGA 2XJ4A 2I1VB 1RYHA 2AXPA 2F1RA 5EP3A 4ESVA 4DB2A 3R7WB 3K9GA 2NMVA 1DEKA 4V0ME 4OJQA 2PH1A 2QAJA 2X2EA 5FUXA 3UXMA 5JCZA 2VHQA 2AFHE 1J8YF 4AI6A 1N5KA 1P9NA 3IO3A 4Q9IA 1VYUA 1W4AA 2GJ9A 1Z0IA 3LX8A 2P6NA 4LBWA 3VHXA 1IN5A 5GJCA 2Z6VA 5IK2A 3W8RA 4U00A 4ZDIA 2CBZA 1KO1A 3EWSA 4MRNA 1RVDA 1H8ED 2FNAA 4AYWA 3U7GA 3R8FA 3NBZC 4MQBA 3AB3A 2XX3A 1OT3A 2C9CA 2QP4A 3TRFA 4Q9KA 1OH5A 2FMXA 3WYAA 1LY1A 1S9HA 1FZQA 1UBFA 1XXHA 2YWGA 3D7MA 4RZUA 2AL7A 5C2JB 4FINA 1NLZA 3AVUA 3TUJC 1FQKA 3TVDA 2O8BB 1XEXB 1R7RA 3ASYA 2VP9A 2G88A 2ZUBA 4PXAA 5JRZA 3U2QA 1Z07A 4TLBA 5A0FA 3EAQA 1NVWQ 1XTJA 4JS0A 5HR5A 1XJ0A 4PO8A 3T5GA 1JR3D 1YR7A 3ADCA 2ZRBA 2ZJOA 4LSGA 3QSYA 4PC2A 1WQ1R 2NOAA 3A8TA 4C0AC 3X1WA 3ZVLA 3LFUA 2ZRIA 1W44A 2O8CA 5HE8A 5L3SB 1P3JA 4JSTA 1QRAA 3OIVA 2ZYWX 3F8TA 1BIFA 4KLNA 4TT3D 5CK4A 2VA8A 1T4GA 4Q4LA 4LBZA 1E2PA 4AG6A 4OHXA 4B44A 1G18A 4GP7A 5EP1A 4ZI3A 5FUYA 5EZ6B 3WXMA 1XXHE 2RGXA 3L82B 1P2TA 4A36A 4ACBA 3GLGB 1Q12A 3CX8A 4HSEA 3JZAA 1SQ5A 2NO7A 4B3DA 1T0HB 4Q5IA 1COWA 2G1JA 1UKEA 3VX3A 1T0JB 5FL3A 5LBIA 1W5SA 2DBYA 2IXFA 5EXPA 1W48A 4HAUA 3CRMA 4M9ZA 1AJEA 3W9YA 2DFLA 1OXSC 3SDZA 4KYUA 2V1UA 1G17A 1GL6A 4QBHA 4YMTA 1Q21A 2A5JA 4OK3A 4Q4HB 1GM5A 5AJXA 3TSWA 1N6LA 4JKYA 5KDLA 3ZS9A 1FUKA 2XTNA 3FDIA 4FMCF 3UMSA 3C5HA 1VECA 1G7CA 3GJ6A 3FYHA 1OH7A 3DDCA 1JXOA 1OKKA 2A5DA 4HLDA 1DS6A 1CLUA 3E2IA 1A2BA 2XEXA 1UKZA 3IHLA 2J0QA 1KO5A 3ICEA 2V6IA 1WF3A 3A1VA 1DG1G 1KI4A 2GNOA 4BLTA 2VEDA 5DHAA 4TYYA 1XZQA 3IEVA 4M1WA 3E70C 2HJVA 3AUXA 4A15A 3R8CA 1N0UA 4DCVA 4RD6A 121PA 1IY2A 3NBYC 3NBXX 4CIDA 3RS0A 3BWDD 2DR3A 3DMNA 3FGNA 1G3RA 3KTAB 2X19A 3BORA 3K9LA 3QF4B 1E2QA 5G3YA 4OHYA 2BWJA 1G3MA 1I2DA 1OXXK 4IVQA 4KO8A 4Q4AA 1EFCA 1MO3A 4MITA 4DLXA 4G0NA 1P62B 3PUXA 3UKDA 1R8SA 3HJNA 1TPZA 2F43B 4MKFA 3SN6A 2BBTA 4XH9B 2NZ8A 2WOJA 5F9FA 1CKEA 4XTCS 1CRPA 2QGNA 4NONA 4RZ2A 2IYUA 4M9XA 2DPXA 5DYIA 1SXJA 3GJ3A 2EQBA 5KSYA 3RSLA 2PCJA 4ZCMA 4DSOA 3UG7A 1M1YE 4B48A 1DBSA 3IUYA 1KZ7B 2DB3A 4TMWA 1VYVA 2CE2X 3Q3JB 1FQJA 3Q72A 2GKSA 4EFMA 2EWWA 1P7CA 1ZAKA 1K6MA 2PCLA 3QPVA 4PHGA 1M7HA 5H1YA 4CF7A 4PAMA 2VBCA 4Q47A 3SI7A 3ZLJA 4CRWB 4LK2A 5F9HA 5TARA 1E9CA 3WBJA 3X1XA 4IVPA 3FKQA 2J1LA 4QL3A 2BJWA 2WWIA 1X8LA 4HB3A 4S2EA 5FPSA 3DL0A 4KVGA 2ZXUA 5FBWB 1XTQA 4HZIA 3C5CA 721PA 3PUWA 5FPTA 1SXJE 1KKLA 4KFUA 2BEKA 3W8NA 1GAJA 2F1JA 1TU4A 2QU8A 2B8TA 2ZI5A 1Z6AA 4I81A 1KK2A 3PUZA 2EVWX 1CEEA 5HE9A 5EE1A 1TUIA 2J7KA 4OJKA 1TQDA 1G4AE 2RGEA 2JLSA 2ZI3A 3V4FA 5C1BA 2YWEA 3PXGA 4ABYA 4URUR 2FEOA 1RZ3A 4M4SA 3FOZA 1XZPA 1QHSA 4Q00A 521PA 1E79D 4B74A 1NJGA 3RWMB 2XTMA 3U7FB 3U4QA 1OIWA 4OQLA 1O87A 3H84A 4DWJA 1JEEA 1OFIA 3DEFA 1UEIA 1XMVA 4IVRA 3TW8B 2IYVA 2HUPA 1JI0A 4LBVA 5JECA 4R98A 4MKIA 1KYIA 1D2MA 2HF8A
chains in the Genus database with same CATH superfamily
2W6OA 3L43A 3FTFA 1DJMA 5EMJA 1JT2A 2O5VA 5I4CA 2R7LA 4GGOA 1ZUWA 3LRTA 5B3AA 4YJFA 1KETA 2FUG6 1NE7A 2ORWA 1DIGA 1P4HA 2QN2A 2VOJA 4I08A 4PIMA 4AX8A 2C2HA 1DX6A 1MAHA 1KY2A 2Z9CA 3GN1A 2VJMB 3KFVA 2PZLA 3M3HA 3QLVA 3CVUA 1FTNA 1MC1A 4PLZA 3TD6A 3NEYA 3PGXA 3KQNA 1QBGA 1RQ7A 2IYQA 4ACAA 1TU0A 3KAQA 3DFIA 1UMBB 4DUGD 4GW3A 2NUTB 3SOPA 3MFYA 2VYVD 4GPBA 3W05A 1SIBE 1VL2A 4PYQA 5CVDA 5EPEA 4DR4B 3E81A 3ONWA 1ZS9A 2LVBA 3ZHYA 4TGLA 1QRTA 5BV0A 4P7BA 1SH7A 3DE5X 3GDHA 1I51A 3LC7O 4EDHA 2QTGA 1JIJA 4I1IA 1ZSYA 1XTTA 1KU0A 3BOSA 3OAAD 4R7GA 3EIEA 2O2HA 1A9YA 3U7QB 4MUIA 5TPWB 1JE0A 5T6MA 3PFNA 1VDZA 1QQ7A 4MWZA 1RIFA 4R1QA 3V8QA 5JALA 3JYOA 1DE0A 2IZOA 1NNLA 1XTVA 4BKMA 2B94A 4X71A 5JU6A 4FYKA 2ET6A 1P8JA 4HJRA 4KLRA 4G85A 3HCDA 3MRTA 3GVPA 1KWKA 1EXNA 1JE1A 1NU6A 2ON6A 3OJCA 3HWSA 2D8AA 2JKZA 3I39X 1OH8A 2YX1A 3WNBA 2LCFA 3B1FA 1AKWA 2B8WA 4BLSA 4QZVA 5H83A 4JJ7A 3TQHA 4CDNA 3VR5A 1OXVA 1T4MA 2OK8A 3DQQA 2X1HA 1ZJWA 1G41A 3CLTD 4R2HA 1KMHB 4DLVA 1CS4C 4TPKA 1NYQA 2IJGX 1PS0A 3ROXA 3CLUC 4H0NA 3SGLA 3OHSX 1J07A 2N9UA 1IVNA 3D31A 3P4UA 1L5HA 3N6XA 3UOAB 1CBUA 2GCGA 4FSHA 3KSRA 1E3JA 2ECKA 5KWEA 4NE9A 3NH6A 5HVNA 2WWYA 1FTGA 2PO5A 1CYEA 3GAAA 2QYHA 2BW0A 5G1PA 3AEKB 2WJHA 1Q19A 2V7QD 2X22A 4QVKA 2J7PA 5LC1A 3JY6A 2IHUA 3RJ5A 4CKEA 1A5AB 1DU4A 1QV9A 5KJFA 2HSGA 2XQIA 1GA4A 3OMLA 4IMIB 5TQ0A 3RVJA 1S6YA 3RRYA 4CFZA 5EWLB 3KZXA 4YYEA 1FXWA 2Q7XA 1F48A 4DV7B 2XBUA 4N0PA 1SPXA 5DXAA 1PL0A 1G3IA 2VJNA 2LBPA 1W87A 2VDUE 3FKSD 2PFGA 4G0QA 3UPTA 1XCOA 3GT0A 3Q3VA 2NIPA 4RK7A 4NEHB 4ETIA 3NAZA 2ZITA 2M6RA 2NTEA 4IGEA 3UK6A 3R7FA 4ZCMA 3AVTA 3BSFA 3DV0A 3T1QA 1TJ3A 3DH0A 4RULA 1TYZA 2AXNA 1NAIA 2OPHA 4P7JA 4R0MA 4D7AA 2IYLD 1HZZA 4WLEA 3LPCA 1NASA 1CIPA 1W4ZA 2LRHA 1GSOA 1ZO8A 2EDCA 3OQHA 5L3RA 3U7RA 2EJUA 3FSGD 3NEAA 2MWMA 5BOSA 4LZJA 5BQOA 1E3MA 4FMDF 1TC2A 4Q6WA 4DM7A 3OQ6A 2VK2A 2AJLI 1WDWB 4MS3A 2QX7A 4PC7A 1HQKA 1E2BA 4A5SA 1L5VA 4NICA 3WE7A 3ZWQA 2JH8A 2O06A 3C43A 5J63A 4RTMA 3VOAA 4LY0A 1U31A 4F9FA 3FRHA 4R1TA 5EA2A 4EFNA 4LC1A 1XZEA 2Q45A 2IXTA 4FX5A 1F9EA 5HDQA 5HRCA 4QVIA 4AQYB 4E14A 1U94A 4O4JF 1QYXA 2YXBA 2IKSA 3TYXA 4AW9A 4L50A 5DNVA 3ANYB 3IQZA 4MEBA 2JFBA 2OXTA 3SQOA 3UAZA 1GCIA 3DNMA 2XB8A 4YQZA 4DDTA 2N0SA 3B82A 4IEFB 1U99A 2IELA 1P9RA 3VPHA 4R8VA 2C5GA 4F8JA 3U4DA 1ZVVA 1VB3A 3BD8A 4B73A 3MLBA 3PENA 4FFRA 2B0CA 3G0GA 3Q5GA 4Y1RA 3GJQA 3F46A 4WESA 4ZQIA 1SHJA 1EVIA 1TF2A 1QZ3A 3RS8A 1XZCA 1QH9A 4Q9HA 2UAGA 2GZ1A 1JHOA 3KOUA 3EVTA 4JEIA 1KI2A 3U62A 3CLSD 5F77A 3EHDA 4YAWA 5IMBA 4G63A 3N2ZB 4OLHA 4LJKA 4BO8A 4M6WA 2HO4A 2VP3A 4RETA 3MK31 1DSSG 4EKDA 4C2BA 3QX3A 1W25A 4QXOA 3PVCA 1WMBA 1IK4A 2XDQA 2C5SA 4ARIA 3SEZA 1JR3A 3PE4A 4GI5A 2C2MA 2QTVB 1U63A 3MWYW 1T5BA 2IYWA 1OYWA 3TAUA 3MXOA 1XDBA 2QT0A 4WZAA 3TLCA 3VYWA 3GLIA 1D9ZA 1I2CA 2FXVA 3MS2A 4LRSB 4EECA 4IH9A 5EHXA 1VL6A 1DINA 5IJWA 3PUHA 3RG8A 1ESEA 1UXIA 2Q07A 1Q3KA 2QD1A 3IJEB 4IOLA 4YLEA 4MJXA 4NTZA 1DRKA 3RIGA 2PGIA 3RKSA 2P9FA 3V80A 1FLNA 1Y7TA 3ND7A 2ZAIA 4N01A 3W2IA 1E3WB 2HW8A 1R66A 3FHCB 3VVCA 1I3KA 3L1KA 3KEFA 3QLVC 2ZIXB 3QJYA 1V95A 1DDIA 2OMKA 1QHHB 3BL8A 1UXHA 4ZQBA 2FPIB 5KPJA 5J5VA 4ZCPA 5JSHA 1A4IA 1DFHA 1Z82A 2IV2X 4UEJA 3VMFA 1DC3A 3SJZA 1UAGA 3P1JA 2I2BA 4HYEA 2FMHA 4RZIA 5E4FA 4U0KA 1DGQA 1L5WA 2DFTA 1HT2E 4EA8A 1NVUQ 3QUBA 4QDJA 4BB6A 5KU7A 4AJOA 2QYTA 1MG5A 1ORIA 2AN9A 5TVGA 1AZTA 5DI3B 4G0WA 4ZDWA 1PSDA 3G0BA 4HGNA 1P2FA 3RBAA 5C4IA 2PEZA 2YJ6A 3HCNA 3NP9A 1UPCA 5HNKA 2CV1A 1KYTA 4RMJA 1KSFX 5JLJA 3EXHC 1UK7A 1E94E 2F8SA 1ZL0A 2QRHA 4AKGA 5EMLA 3CSUA 1A8QA 4U2DA 1A8UA 1DC4A 4J0CA 3WNZA 4XOIA 2H57A 1ACLA 1YGPA 3QVSA 2BR4A 3V8BA 4CMEC 4AN1A 2V3CC 2QTZA 3HCBA 4I6EA 1BO6A 4KN9S 1MIOA 3AHEA 3HXMA 1J8FA 1JX6A 2A9PA 3ZC3A 4E11A 3D8TA 3MGBA 5B6IA 5AUQA 1VSUA 2HLNA 2APJA 5BQ3A 3NNSA 3RODA 1TK3A 2HDWA 4G9EA 4DLAA 1BHJA 3GRZA 2CSXA 1QX3A 4MMXB 1JQ5A 1T35A 1ZU4A 2Q6LA 2CNOA 5AI9A 4ZVRA 4DG9A 5CAEA 4HI0E 4YCLA 1QYVA 1KI7A 2ZIVB 4X60A 1KY5A 1DNPA 4QPJC 5F3WB 5TE9A 4F8YA 4IV5A 3K0KA 1G6OA 2ZJYA 5FA8A 5EE9A 1E3LA 3NTQA 3OPMA 3TDKA 5I5GA 4QTXA 4MB6A 3FA2A 4U6SA 1NQ5A 2KX7A 3PXDA 4PLCA 3HFJA 4KOEC 5KWVA 3GLHB 3HCEA 1UR5A 1RAAA 4PCLA 1JAIA 4F5ZA 4HDRB 4BFXA 3MILA 1V3TA 1QG0A 2L2QA 5K1ZA 2YJ4A 2AMFA 3QWFA 4RK6A 4AO6A 5BNZA 3NLLA 3MN1A 3TO5A 2B5WA 3H5AA 4ZMBA 5KTPA 4CLHA 1ISGA 1WM1A 2Y2UA 2Q0XA 3SU8A 4L7QA 3IAEA 4ZOAA 1E0AA 1OYYA 4RF2A 4CPDA 3L1VA 1T36A 4ER6A 4LYEA 2G5CA 2W5UA 3OP4A 4RKWA 1KBQA 3ZGLA 4D4HA 2POQX 4FNAA 4TV9A 5FOQA 4JI7B 3I37X 2QD2A 1I14A 1UK6A 1JQ3A 2KYRA 1XRNA 4JLUA 4N82A 3ZHXA 1E2UA 1BU5A 2OKCA 5L3SA 4J07A 2H0RA 2Q4BA 4U1RA 3IALA 3A9WA 3GLQA 3OICA 3QE2A 3BQMB 3C3CA 4K1LA 4NEGA 1K6XA 4Q1DA 1D0IA 2WNSA 2Z6AA 3QG5A 3B1XA 3HFRA 1VGVA 2P0YA 1ODIA 2GWRA 1TAHA 1YZFA 3M89A 2AN5A 1HZZC 4V0OA 4OM7A 3LVQE 5ALQA 3QU7A 1SXQA 1IXZA 3R5SA 3GLGA 4E51A 3SJBA 2IWRA 2VP5A 4B3HA 2QSJA 4I2VA 3AEYA 1YRQA 2FZ5A 2R5WA 2BH9A 4G9GA 1KAEA 2COKA 2VJKA 4KRXA 4MJ3A 1TW2A 4QHTA 4UD6A 2QUZA 1JDPA 4XGQA 1GCUA 3O3OB 2Q2OA 4F4FA 5LMUB 1VG0B 2NPOA 5LDGA 1HC7A 3IILA 2FFJA 1D6NA 1JBKA 2V7TA 2O8DB 4A9AA 4UNNA 3FYUB 3AIMA 2ZTSA 2FRVA 2UVDA 3CNHA 3IV6A 1II0A 5DMHA 3H2BA 3JYNA 5I7WA 1IXKA 4Q4HA 1UL1X 4C0XA 2ETXA 3PQ8A 2XAUA 1KP3A 2JD1A 2QMZA 5D01A 3RSFA 3UF0A 1C30B 1FFHA 5KNDA 1P81A 2PUTA 4IIGA 1V11B 2DHEA 4B4WA 1QOPB 2HLDD 3JZMA 3H2SA 3TRJA 2WMNB 1VTKA 3KD3A 3QUCA 4EPRA 2GA8A 5KDOA 1GQSA 5HK8A 5JNLA 4OQNA 1IWPB 2Q9UA 3PA6A 5JYCA 4LCBA 2RHWA 3FMFA 3CRNA 3PEUA 3FAZA 3HB9A 1BEUB 3G1TA 3UM9A 4HUJA 2NT3A 3B6KA 5BR8B 1CUJA 4CN8A 3CG4A 4K8OA 2W37A 3HYRA 1JLKA 2ESRA 3M3PA 2KW5A 4I5DA 2HHJA 2CY0A 5CA0A 5IRCD 1JS1X 3WLQA 3O8OA 4O2RA 1QRRA 3BJIC 4IDGA 5GM1A 2BSXA 2OXEA 2OYRA 4F56A 1JMYA 4PQRA 5BW8A 4HCJA 1UFVA 2XZTA 1PLKA 3ECCA 4ZAWA 3NYIA 3T5TA 2DM6A 1XL0A 2P40A 4FLFA 3LHFA 4KV7A 5H02A 5C5IA 1AUXA 2CXXA 3QF4A 1YC2A 5AP9A 5G1OA 3VDQA 2CXPA 4G0UA 3MCAA 1KIAA 4UBLA 4GBED 3OQPA 5HZMA 1A1VA 2DERA 3L0IB 4P98A 3D3JA 1QVAA 2VIIA 3C1OA 2X4IA 4X95A 1Y3DE 2C03A 4EY5A 4PYMA 3W9SA 2CF5A 3IQDB 2HM7A 2QIPA 2X1MA 1EXMA 3A6GA 1K0UA 4LQCA 1EM6A 5ADWA 2IYTA 4ZIRA 5GGYA 1PW5A 3FCUB 4DBVO 3IBGA 3RE1A 1Q0LA 2JJ8A 5C32A 2Z3ZA 1ZBQA 3DT8A 1IJFA 1LNSA 2XOKD 3E3OA 2Y99A 4A16A 2D7CA 3SG0A 2B25A 3AUYA 3EN0A 1R9NA 3H4TA 5D84A 2ZBVA 1G66A 3BE4A 3BDAA 1VOTA 3VKWA 4EFDA 1OTYA 2O50A 4YJGA 3KUKA 1EIZA 3C7CB 4X1YA 3ZY3A 3R9XA 2QDKA 4NZMA 1I36A 1JR4A 5COQA 1T2EA 4QUKA 4X3PA 4JB2A 2OZLA 4W5RA 1TM1E 1E4YA 1LFDB 4RF5A 3DDNA 4D44A 4HAOA 2J3HA 2QMOA 4I19A 2D4AA 3LK6A 3TIGA 1EUDA 3KLMX 4M1MA 1E92A 3ONEA 3V8MA 3K09A 4Z4EA 3ETDA 4EY7A 3HEBA 1NRJB 1PQYA 4J3NA 4JI0B 3OOEA 1RKQA 1ZK0A 3ANXA 3TX6A 3THYB 3H1AA 4EW1A 2JJ2A 2P67A 3FNHA 3GP8A 4HWKA 4H7FA 2Y1WA 1ZL2A 4ZVOA 4ZTBA 1NBIA 4MQ5A 1SQGA 2GD2A 2HWUA 2ID7A 4QPCA 1Y1TA 2BDUA 4N0MA 1T2CA 4Y6QA 4EMBA 2X9NA 2B92A 2FVXA 3URKA 3D8NA 4YPVA 4CLDA 4EYQA 1SC4A 4JBHA 2AXEA 2CT8A 1FTYA 1C1HA 2I4NA 3T52A 4GPTA 4GXQA 4K7JA 1Y8QB 4JQZA 3RTDA 3U3DA 3MMNA 2FETA 2JGKA 3QF7A 2HWKA 3FUTA 1AKRA 2OWEA 2RGWA 3HU5A 4KRYA 1XZHA 2PVPA 5JH7A 3K71B 5F3RA 4BPBA 2WDPA 5K4GA 1YU9A 5LQUA 5A3SA 1R18A 1GV0A 3WDLA 4B2IA 4MWOA 3PGKA 3I0NA 3QX8A 4NAVA 4UASA 3S5JA 4JJKA 2J67A 3FBWA 3LQQA 3W3AA 3M4NA 1MP0A 2R8XA 5COAA 2PJDA 3I42A 4R1SA 1QCCA 4IHJF 4LGVA 2FF5A 1YCFA 3T9EA 1P0QA 1C9NA 2HLHA 3BA1A 1JHYA 3A58B 2J85A 1Z4OA 5KMGA 2Q9AA 2AOUB 2Q7OE 1NR1A 2FWRA 2VF4X 2Y1GA 1HKHA 5BR4A 4LXXA 3ZHSA 4L95C 2R48A 4D0NA 4AKTA 2ZYSA 3RGWS 1J24A 2PUDA 4W5NA 1JDZA 3DWEX 1LBIA 3SF8A 1Z0ZA 2P3OA 1F0YA 4ZQCB 1GGJA 1ORRA 2FEWB 3DYIA 4GOOD 1AUPA 4HLQB 4WINA 4UM7A 3WWOA 1LQTA 1BYUA 2DWQA 2XV1A 1OI2A 2QQ0A 2GS9A 2C94A 2VHYA 2ZB8A 4I3HA 1V5WA 1V8ZA 3NIFB 5FXMA 5GONB 2HBZA 2ZS9A 5ALPA 1Q1GA 3F7MA 1YRLA 2QLFA 4WBNA 2NV0A 1QH1B 1T6NA 1XVIA 2D1TA 2P68A 3FHLA 3LDUA 5P21A 5C1OA 2PD4A 4DNOA 1B41A 2QN6A 4QXAA 3KR9A 3RT7A 4ZC1A 2H54A 2XKAA 3AF3A 1X7WB 1XWWA 2ZI6A 4LI3X 2CFSA 4BP1A 4MKZA 2ZE6A 3G2HA 3QJGA 2XXAB 2QRJA 3ONNA 2EJTA 5DYWA 2RHHA 3KTDA 5SY4A 3IUBA 3N87A 3TOCA 1NR7A 3ZZNA 1VC2A 1IAVA 1Q0UA 4POAA 3NHRA 5NULA 1WDLA 3C6YA 3LT0A 2DMRA 4H27A 5HX7A 1N8NA 2WICA 3WIBA 3ITKA 2VP2A 3ANTA 1NSFA 3CWCA 1PHRA 3HKEA 1HYHA 1ZGZA 3AF0A 3P97A 5IKOA 3ESAA 1JHXA 3PQCA 3TLYA 2VS1A 4DC0A 4PZAA 1OYOA 4ZYVA 2EW8A 1FC0A 4LXQA 3IEMA 5SV2A 4N7MA 1TFRA 1YC5A 3FB4A 2ZYUX 5JQGA 3X3HA 2WJJA 3DD1A 3RRNA 3B3QA 3GRPA 5FR2A 2YCBA 2I3BA 3C3XA 3O0DA 2P79A 1Y37A 3KU1A 2QRZA 2R8ZA 4BGIA 1SKAA 3YASA 2ZYTX 4GVPA 5MFPA 3DWFA 5CA1F 3FXAA 2VJAA 3Q3GE 1DTWA 4FQ7A 3QFFA 2BUAA 2ZVPX 4IFTA 1NF2A 3ADOA 4OIMA 3WGTA 2EZ8A 4LV8B 5FBRB 3IXLA 2REBA 1IL0A 2JGLA 1MX1A 3KVYA 1PTKA 2IPAB 4PLPA 2H5EA 1L5RA 4NS4A 4ZHQF 1KXJA 3E9ZA 4COOA 3HDTA 2OHXA 3D6TB 2ZB2A 2YBDA 1WPXA 3SZRA 4PO3X 2Q1TA 3LI2A 1G1AA 4OA5A 4V0NA 2O59A 3PQ2A 1X86B 1N2CA 5GZ6A 4RTSA 1NYRA 5IHPA 5FBQB 2CFIA 4HLUA 3U5ZB 2NV2B 4KR3A 1Y9ZA 5FWXB 1V71A 1ZDMA 3LJKA 3MQ2A 2PJZA 4KBFA 3RC8A 1N32B 2O5CA 2CHVA 4IIYA 4JR2A 4D9NA 2BEVB 5AOAA 1KIMA 1MB9A 4ID3A 3WL5A 4JEUA 3QVXA 3LA6A 4I4TA 3ZS8A 1MUUA 3O91A 3QBTA 1A1SA 4DRZA 4FDMA 5L45A 4UMEA 2VAWA 3NONA 4IJWA 3LOUA 2CL6X 3TEFA 1KK0A 2D0OB 2QNIA 3AJ9A 1VKJA 3AUFA 3EGIA 5I45A 3NASA 5HTKA 3IMFA 1ECJA 2DJ5A 3H0KA 3RWOA 1OZGA 5TV2A 2KBFA 1SBCA 3M6XA 2IH5A 1CE8A 3C5VA 4Q66C 5I8WA 3GQBB 5KHOC 1ZWKA 3A32A 4LGMA 2J3DA 1TI7A 2JIQA 4RPHA 4KR9A 2I9KA 1UC5B 2HPHA 3QXXA 4RQTA 4B3GA 3K09C 3LT4A 4WRRA 3Q8MA 5BR7A 4P4SB 2GBFA 5BV7A 1LD3A 1MJHA 3PWSA 2PS3A 4L1KA 4LAFA 3EXAA 1E66A 4FW9A 4JVNA 5BW6B 5J2UA 4GR9A 3PJDA 2BFDA 4B7ZA 1Z3IX 3E1KA 1ZEJA 4LKOA 4NNJA 2R6AA 2GTHA 4HZUA 3GGJA 3ELBA 4JGBA 4ZV4A 5B1HA 5T64A 5JC1A 1HV8A 2FUCA 4XA8A 1ZY2A 4LJ4A 3ABQB 2R7MA 3ONFA 3KDPA 4FZ5A 4IOKA 1M7BA 3TCKA 2BR5A 1OV4A 3NHSA 2IY9A 1Q7GA 4F38A 2QY6A 2E82A 4Q0MA 3CZ4A 2XYGA 3R1IA 4FGWA 5THQA 1W9MA 2YHUA 2G17A 2WYWA 3LT2A 4N8DA 5BRNA 3URMA 2EGUA 2JLBA 4Q7KA 3VTKA 5HFJA 5EKUA 2ADFA 3H18A 1LPSA 4M46A 4IIDA 1B8OA 2EBFX 2W6ID 3UJ7A 3F49S 421PA 4ZQHA 3LKVA 1Z7WA 1GU0A 1K27A 1KPIA 3AYZB 2UYCA 2EZ4A 1UBJS 2FFBA 2PT6A 2JFPA 1RM4A 2GQ0A 1DIOB 2O8EB 1DBIA 2ODBA 5I7VA 4GNRA 2WQ6A 4RVFA 4ZYWA 3IESA 1NTRA 1Z6TA 3PKZA 4MVJP 4DMHA 4RPCA 2CLCX 2FP4A 2SICE 3P9SA 1NZDA 3PVZA 3H05A 4Y2XA 2ZRQA 3CR7A 4DG5A 2WMYA 1HYQA 4DRXB 1FA9A 1IQPA 2IV7A 1E62A 1MC8A 2BMFA 2G5GX 2MSKA 1PL6A 2VPPA 1TCAA 2H08A 4O33A 4R6WA 4ZI5A 4C43A 2Q1XA 1WHSB 3ORFA 3O95A 3MSXA 2RGAA 5SZHB 2BZ0A 1GAXA 1A8PA 5ALNA 4XWOA 5AI8A 1BCSB 3QXGA 1XALA 4QJIA 4OHRA 1IULA 4O2AA 4B0PA 2Q6OA 3UUWA 5L40A 3E05A 2JJ2D 5FBLB 1QFZA 4WXPA 3DQZA 3NR2A 2VAXA 3REOA 5B7PA 1D5WA 2NSYA 2HSEA 3CM0A 1IYZA 2HADA 2PZEA 1TD9A 1U0GA 9LDBA 1C1DA 3EJ6A 3S40A 5AKYA 4D4IA 5CCEA 4RM2A 1ISSA 5ITVA 4Y0NA 4JLMA 3EDYA 1I3CA 2W4MA 3AEQB 4A7PA 5ANRB 4OLFA 4AJIA 2GSDA 1RWPA 3FR8A 3GLTA 5LQCA 1K92A 2YRFA 1FP2A 3KZMA 2VTVA 1N9GB 5REQA 3ESBA 4OHZA 3AHHA 2XSZA 3STWA 1U11A 3IMCA 1IBRA 3HRHA 2GCIA 4Z1MD 3K0FA 1HG0A 4TN5A 5CRIA 4CEHB 3TNYA 2H9AA 1UBNA 3T5BA 1L5YA 3HVIA 4YRSA 1KSJA 1TIPA 3ABSB 1ZC4A 1U8TA 1OLOA 4G8DA 2ISQA 1FSSA 3KQQA 5CYGA 2XHEA 2RH8A 4PLYA 4ZO6A 1C7QA 4HL6A 5K6AC 3K9CA 1IAQA 4UTZA 3CHYA 3AV0B 1HI9A 2EF1A 2FX3A 3EC1A 4O4LA 4YRTA 4CCYA 1VLMA 3BXZA 4G67A 1YR1A 4CEJB 2ZWIA 3MWDB 1H5QA 5A5VA 3OKAA 4DG8A 3BCHA 1EEXB 1AQYA 2Y6VA 2IVFA 3W8FA 3L84A 1SC9A 3DVAA 3IBSA 4WW0A 3WISA 1WZ2A 3Q3CA 5LU8A 3I01M 1BROA 1EQAA 1R4AA 1FNBA 2QD4A 4R8SA 4TYPA 1Z6YA 5F12A 4KVAA 4DIEA 1A9ZA 4HYTA 4NOJA 3VDMA 3GLSA 4NYJR 4W5OA 1HX7A 3OZXA 4QOSA 2EFEB 2RH9B 4YK7A 4KX3A 3D5QA 5JOQA 2PD3A 3KKOA 3DWGA 4JROA 4OBWA 4OSOA 4M0UA 1ORVA 5ED0A 4BKUA 1N5JA 5LFAA 1CNMA 1MR3F 1UMDA 1WDMA 5LB2A 3HU1A 2CJWB 2VR1A 1S7GA 3NC4A 1XR3A 3PNMA 1GZ3A 2P6PA 2Z57A 1RXUA 3SIPA 1WBJB 5LP1A 1A7KA 1BOOA 3HUTA 3B5IA 3P52A 2AR7A 4QPZA 4L4SA 2AQIA 4TTTS 1DOHA 2DBRA 4CGZA 4TVKA 4X94A 1F51E 3F5QA 3OTQA 4FS3A 1S0UA 1NVKA 3R0IA 4NYJQ 1L8QA 4N9WA 2V7EA 1HLPA 4AO8A 4DIFA 4F1JA 3QVWA 3KS9A 2PMDA 2ZSFA 1NN0A 2PS0A 4YJ3F 3U56A 1JR6A 4ER7A 3G0HA 2PUWA 4Z7OB 4FIDA 1QHFA 3KOXA 4IXTA 1MGPA 1TU3A 1F3OA 3P94A 3I4LA 3MWLA 4ZCIA 3LXRA 1KYQA 4WKNA 4F4HA 4U0JA 3RUPA 4PN7A 2EC5A 4EHKA 4NE2A 2Q27A 2G9VA 2A2ZA 4QUEA 1L4MA 1U04A 3CYFA 2G0TA 2VXCA 3EXEB 3U37A 1CY4A 2CB0A 3QA9A 3AQIA 4J29A 2XMDA 2REQA 3ACCA 4WA7A 2VRCA 1KJJA 2I6GA 3EPRA 2J3MA 3EDCA 3JATA 4R51A 1JSZA 3OUUA 4XVQA 1I13A 1BCRB 1S89A 1J7KA 4KQKA 2B4YA 5H80A 1Y3AA 4IDDA 3X1KA 1T91A 2WYOA 3SYKA 1WMDA 1LPPA 3QPCA 5KYVA 1AZSC 1GYRA 4JA2A 4E5SA 4XYBA 3HMQA 3DOOA 1ULBA 3BDVA 3ZDQA 2GPTA 4EK9A 5HF8A 3MGGA 1NN5A 1T5TA 1MXHA 2CNWA 3DB2A 4HNAA 4FHEA 3RYTC 4N12A 5FEMA 4QUDA 2H7XA 2FEPA 2P1ZA 2O8FA 4WVLA 4H7EA 5D87A 3Q15C 3A9SA 4JBYA 5I7AA 1IY0A 3GJ8A 1JEYB 1M2GA 4BBJA 1HLGA 3RJZA 5KWIA 2WEKA 4ZZ3A 4PSKA 2P5YA 1G8HA 1T2NA 2A9QA 4UMDA 4E31A 1NC3A 2FA9A 4DXAA 4MPRA 4UAGA 1ZIYA 3NIWA 3O82A 1BMFA 1DWOA 5KUTA 2G4LA 3WP1B 4JN6B 1YFLA 3TR0A 3IQFA 5D1HA 4MDHA 4BVHA 3U6KA 3HDHA 2WZQA 1MC4A 1B1CA 1CUHA 2HA4A 2HOQA 3UOGA 4AJEA 3N8HA 5AHXA 4BUJA 2OD7A 3EW9A 1LRKA 5J40A 2Y05A 2WTEA 3FY4A 5BN3B 1BN6A 2K4MA 2OCYC 5DNYB 1HG1A 4PAOA 2HBYA 1ZD1A 4XJXA 3OZTA 4N3NA 3ZHBA 5EERA 1QCYA 1M2FA 1RJGA 2O0MA 2B69A 2Q3EA 2X41A 2ZYGA 3EXHB 3A25A 3U4CA 2UZ4A 5I7OA 1N2JA 2X1LA 1P19A 1V26A 4JLBA 1I6WA 3HA3A 4X6UA 2B34A 2Q0SA 4GD3Q 2Y8EA 2PXAA 5AW3A 3HKCB 1Z5ZA 5HHTA 5JQGF 3RF7A 1ZGAA 2D2FA 1X1RA 1NFFA 5DNWA 5FUWA 3IJ5A 3WO0A 4DLYA 4IILA 4U2GA 4DMFA 4C7OB 4C29A 3DEYX 3MTBA 4Z0TA 4H4EA 1CDZA 3FWZA 3GLVA 3ND6A 4H6PA 4C87A 5JHGB 4MRSA 4X7BA 3CX7A 4BUCA 5AI4A 2PGDA 4IIJF 3MJCA 2ZUEA 4C3ZA 1QQ5A 1SAYA 4WY2A 1S2LA 4A6PA 5EZQA 1DUIA 3PSHA 1L7QA 3H04A 2GEVA 2GYWA 2Y6UA 2VL7A 3BPSA 1BXZA 3MJ4A 3PC3A 4KLCA 1LBTA 2YZ7A 5CT6A 1NIPA 3EZYA 2D2VA 1TM3E 2BHTA 2SKDA 5F1OA 1X9IA 2HCJB 1J97A 2ZWAA 2HIGA 2F8LA 1TUGA 3AERB 4MV9A 3V48A 5LIPA 5K0BA 3L02A 1O95D 1SEVA 2WV7A 3WFZA 5C37A 1U0RA 1UM9A 2VTBA 3KPUA 1QVZA 1YHNA 3I2HA 3K9HA 5JWHA 1FMCA 5ALWA 1C3EA 3EPPA 3RI3A 4I1SA 4AMBA 1CRWG 3U3OA 4RX1A 1OIXA 3WL3A 3WA6A 5JG7A 2MMCA 5BNWA 1T2FA 3FLAA 1TQ6A 3KQYA 1AQIA 3RVLA 2YJ3A 4ETWA 1HT1E 2QRPA 4ICIA 3SQDA 4K6OA 3WWYA 1YB6A 1YKGA 3H65A 2YWFA 2VDKB 1JJAA 4B3IA 2QU7A 1K3FA 5EJFA 5H0IA 1DC7A 1T5OA 5BVGB 4PX9A 3C7TA 3PXEA 4QUGA 1MHTA 5KOHB 2O9JA 3E2MA 1XVLA 4PO9A 3V4ZA 3NYQA 4J9VA 4KDFA 1M54A 1NDUA 4OQ4A 4DSTA 4M1OA 3N76A 4LDAA 1R6XA 2RK3A 3SQLA 3K6RA 3W6PA 4DV4B 2JD0A 2ZE7A 1NW9B 3H2HA 4PEVA 2XMPA 2W58A 1OBHA 3ABZA 1AS0A 4FZ3A 2J9XB 2BN4A 1SC6A 1YFZA 1CJCA 1YL5A 2HPAA 2WE8A 1ZLXA 3JWJA 3JZIA 4C0BA 4FX2A 3H4MA 1MN6A 4CLOB 1YIDA 1EZ1A 3E22B 2FG5A 3G2MA 3R0XA 1OOEA 1U5BA 2IH2A 2AX4A 4J0IA 5DGIA 3ZCSA 1IBMB 2PX3A 2D2EA 4HHEA 4BNGA 5G4KB 1Q0TA 1MW8X 2PJRA 3LH5A 1R12A 4QECA 1E5TA 1RMQA 4GP9A 3WQBA 2JARA 3ZQJA 1CUEA 1LVGA 5DLPA 1IHXA 3QVVA 2FAXA 3KKLA 5E7MA 4AWAA 3RO7A 1RMYA 4Q3EA 1K8RA 1V8PA 4RAOA 2NU8A 1X13A 2BKVA 3FZNA 3STVA 3N2KA 5ABPA 3W7AA 4BC1A 3TQIA 3GRKA 3G7NA 1SOVA 3QIVA 4G36A 2QAIA 4JLPA 4L3WA 4QUBA 3VHRA 3ZV3A 4IG4A 4M36A 4CG3A 1A9PA 1PVDA 3AVPA 4KQHA 5CHEA 2WYUA 4IQ0A 1GG2A 4C4YA 3A14A 3EBLA 4HFNA 4ZQFA 4C0WA 3CZMA 4RKYA 1YF3A 4MRVA 1W0CA 1FS6A 3OM8A 4WESB 1W5AA 3M1IA 4RZQA 4OYRA 1N3BA 4YRLA 2BCEA 3X0DA 4C4XA 3GLGE 2WSMA 3FD8A 3RC3A 4KIGA 1JIUA 4RSHA 4F5EA 1MORA 1P44A 3F3SA 3UWKA 1XZNA 1MOPA 1MXFA 3TG8A 1WU8A 1E6EA 3A1WA 3LO5A 3G5UA 2GN6A 2R79A 1LPBB 1H23A 1EGVB 1RI2A 2VOEA 1G59A 1EH5A 3DAHA 3ZU5A 4Q93A 4CODB 2RD2A 4DB4A 2O54A 4NPHA 4BJ1A 1FIUA 3E1SA 2XNKA 1A9SA 5CYFA 4YV7A 3OO1A 3AL2A 3B1WA 3OPYI 2P8JA 3ELWA 4DQDA 5KAMA 2SCUB 4ZOCA 3JQ6A 5H3CA 4EG7A 4EY8A 5M04A 1F12A 2FDXA 2JASA 2G5PA 1IEXA 2WTXA 4K9NA 1CUWA 5AM5A 3FBGA 2QW1A 4H3HB 4PFJA 3VDRA 2I6TA 3W5SA 3HK2A 1IH8A 4FMCB 5TS3A 3NOVA 4RIHA 1M2KA 2EEZA 5FORA 5LQDA 3ETGA 3C8MA 5LXTB 1Z0JA 3L7AA 4MPPA 5FNVF 1KQFA 1U8FO 5ITZA 1B7GO 1AQLA 4KR6A 2XXBA 1YWGO 3GA0A 3ULKA 5JV5A 2PR7A 3QKIA 4CQNA 1KK3A 2AH5A 1AK9A 3I2GA 4N39A 3RTCA 3ETJA 3UGTA 1GA1A 1U7WA 4OTZA 3G13A 3LL4A 3ND5A 3JQ8B 3EZ6A 3LLUA 2HNAA 4EEZA 3N1UA 1RRCA 4TXMA 3B7PA 4ZJZA 4V3CA 1CUCA 4BVLA 4MUHA 3OU7A 4AS2A 1YBFA 4UJ3A 5TB5A 4LZZA 3H2GA 1P4AA 4EDFA 1NA5A 4BKRA 2Y1CA 4F3TA 2Q5HA 4P32A 1U0FA 4Q4JA 3IKVA 4I4NA 3L49A 4HH1A 5FRDA 5GGXA 4Q18A 3IELA 3T6KA 2WIDA 1XZFA 2QE7A 1ZEMA 4L51A 4P54A 3VHQA 1P2DA 3FUCA 4A23A 4EB6B 3LZCA 2FDRA 2ALJA 3MF4A 3I1FA 1GCAA 1F8YA 1PZHA 1Z8HA 3D4LA 3AHDA 3FCOA 3ND9A 4LDQA 4YAFA 3RASA 4A0HA 3PNOA 2N3ZA 4XWKA 4M86A 3A6LA 4KDCA 2GN2A 4RLFA 1F2UB 3QUTA 3ENQA 4TZTA 5DH9A 3ZDZB 4TKVA 4Y2UA 2HWYA 3RSOA 3UMVA 3U7IA 1BRTA 4BNYA 1M2EA 8GPBA 4ZVMA 3LY8A 1HUQA 1XU4A 3OPYB 3RH0A 3EGOA 4BCBA 3N58A 2FH5B 1BGWA 2EAUA 2GYVA 4M37A 1KRHA 1P1JA 4XR4A 3SJ7A 3TTUA 1E1RD 3OZFA 3FW1A 4GZMA 4HWGA 5LOVB 4NKRA 1I0LA 1AF4A 5ICEA 2W2QA 5CW1A 4RTLA 1L4NA 4B17A 1VE6A 4EEKA 3KETA 2O4CA 1HRDA 1U7ZA 4FSXA 2V96A 2LKCA 4WKPA 3RM3A 2HSDA 1IUNA 2NYUA 3LLVA 3QHPA 4RV4A 1WCYA 2WVGA 1NOKA 1CDOA 2A86A 2JEOA 2LP4Y 3D7KA 2GZ3A 1IN1A 3L7LA 1T1EA 5KSPA 4DR3B 2EZTA 4FD3A 1F4VA 2W6CX 5LSAA 2J6BA 5AHOA 1F60A 1W34A 2WPDA 4E5NA 4MAFA 4YIKA 5CB4B 1DVRA 4QSMA 1B3BA 5B7NA 4TV9B 5B4VA 1NMXA 2BEUA 1NUPA 3B53X 3MCZA 5CEJA 1KZGB 4LMBA 5E4YA 1N77A 1WXDA 2BHRA 5AUOB 4F9EA 3WMGA 3F3MA 2C7VA 3EZ9A 3BB1A 2UYHA 1FYEA 1O8BA 2VNSA 3UV7A 2XB2A 2OHGA 3HXKA 4KO3S 1E5VA 2OBBA 4QODA 4KXMA 1A5ZA 1MRZA 4C88A 1U0BB 2GBCA 3K8QA 2LW7A 3HU3A 3MCTA 2PUCA 2H7YA 1F2TB 1L3BA 3WYGA 3BK7A 5I7EA 1WSAA 3M6WA 5BW5A 3N74A 4GZLA 4R84A 4KAXA 2MCFA 2X7XA 3WRVA 3ES9A 5FUVA 2P2ZA 3U7EB 2XADA 3HB5X 3AKCA 5FIUA 2VSQA 4FC7A 3RTGA 2HA2A 3FNBA 1LDMA 4AP6A 3LCVB 1PL7A 1KS2A 4CKCA 3NM6B 2DLCX 2W70A 1JYFA 3S2UA 4B3SB 4L27A 5CVTA 5EESA 5F5NA 1NKTA 3G9XA 5B30A 2ZT5A 1XD2A 1FF9A 1GZDA 1W9HA 2ZBPA 1P74A 4P81A 3V2GA 1PQ4A 5A9SA 3O47A 2WBLC 1YKSA 2F3TA 2J9GA 3GFQA 3PWKA 5CM8B 1KI8A 1WKCA 2FI1A 4GPIB 4IQ8A 3KT6A 3BKXA 1L5NA 5CFOA 4E33A 2C95A 1FLDA 4CQMA 4DRYA 2GN8A 3CCBA 4WNIA 1BN7A 2PTGA 4OQQA