2WJHA

Structure and function of the feob g-domain from methanococcus jannaschii
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
166
Chain Sequence
MKSYEIALIGNPNVGKSTIFNALTGENVYIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSLTANSIDEIIARDYIINEKPDLVVNIVDATALERNLYLTLQLMEMGANLLLALNKMDLAKSLGIEIDVDKLEKILGVKVVPLSAAKKMGIEELKKAISIAVKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Feob G-Domain from Methanococcus Jannaschii
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal transport
molecule keywords FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
total genus 49
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wjhA00
3K53A 4B47A 1X8LA 3B2EA 1AM4D 2AWNA 5DN6D 2B7CA 4BEBA 3MD0A 4RKEA 4RZUA 4LJ4A 2Z4SA 4UNSA 2ZAMA 3D31A 3BB3A 2QNRA 3CR8A 4DCUA 1CJVC 1R0XA 2Y8EA 5AJVB 5L3RA 4FMDB 5IRCD 2R8RA 5B64A 3UPUA 2VYFA 3P20A 4GP6A 4W7SA 5EXXA 4ZCMA 2OAP1 4AY2A 3B6EA 4NDZA 3UANA 5JWOA 2ZUDA 3RVBA 3SI7A 3GLFA 2ZS9A 4W5JA 4E5UA 4C9BA 2GK7A 4MQBA 1F2UB 1JR3D 2F43A 2FNAA 1KO4A 3AKDA 1N5LA 5FBRB 1W49A 2ZJBA 1KK2A 3U7EB 3BS4A 4N0DA 1Q12A 2CK3D 3CZPA 4LX0A 4NYJR 1N6NA 2BVNA 2X2FA 4WIAA 1IXRC 4WXRA 2O0HA 1VCIA 1SXJB 3LFUA 4TL7A 4MUBA 4OK3A 2QEQA 2DHRA 4Q1EA 5DI9A 5FBWB 4YMSA 1JXOA 1FP6A 1DS6A 2ZRDA 4OK5A 4PZZA 2ZI7A 5F98A 1D6JA 1LFDB 4KFRA 5KDDA 4WZBE 4CIDA 2HJGA 3TSWA 3FVQA 2CHVA 2ZS7A 3QJYA 3GLGE 5FFMA 2QP3A 3DZDA 3L82B 4I4LA 3W34A 1NMZA 5EUMA 3IPYA 1KK0A 1M7BA 3SJBA 1SGWA 3L8YA 1OJLA 1R5OA 2AXNA 5C4GB 2VHJA 2KWIA 4Q01A 4F4CA 5EE9A 3NHBA 4YXWA 4QHSA 2WIAA 2ZRAA 3NHAA 3KQLA 1NLZA 1DG3A 1Z6AA 1G20E 4OQLA 3TK1A 4BASA 4GOXA 2GAAA 2VHUA 5DNYB 2O8DB 4JYCA 2VP2A 1VG9B 2ATXA 3A4LA 1NVVQ 3I62A 3Q7QA 3MCAA 1KKLA 4KBFA 2AKYA 1YZNA 2V8OA 2BWJA 4OL0A 1VYVA 3I3SR 4JSYA 4M1OA 3GJ4A 3IDQA 1QHIA 2RGGA 5FOSA 1LV7A 1WMSA 3ZGXA 3QENA 1A2KC 2FFQA 2IL1A 3OZXA 3P4XA 2RCNA 2VHTA 2IUUA 3CIOA 4MDEA 1CIPA 3P27A 4EFMA 4C0LA 1XZQA 1FMJA 2FPLA 2GJ9A 4LHVA 2ZE8A 3QKSB 1ZUIA 2Q6TA 1E2PA 2O8CB 2PJRA 2A9KA 2ZRNA 4B3GA 4URXR 3PUVA 4NMMA 3CF2A 4C3ZA 3BAFA 4NCIA 5KSOA 1D9ZA 1TMKA 3OAAD 5AUQA 1YR7A 2AK3A 2GZHA 4D4LA 2NQ2C 2CLDX 4KBGA 4M1YA 3T61A 1NLFA 4OHXA 3EPLA 4IVQA 1G5TA 2ZJ8A 1OHHA 2GXUA 1Q3HA 3AVXA 3DM9B 1N0WA 4EFLA 3FKSA 2YWHA 1Z0DA 3KFVA 4P33A 4B75A 1NBMA 4C0HA 2XNSA 4KFTA 2HJVA 2QAGC 2JJ1A 5D3MB 5CB6A 4DLXA 2G83A 4JJKA 4NONA 1N6KA 1ZNZA 4O0MA 1FQJA 4JLAA 2CJWB 2J0UA 2QGZA 4P31A 4DSNA 5FL7D 2V6JA 4OQFA 2ZR0A 1NVUQ 4RD1A 1KSFX 2QL6A 2WWGA 4B3BA 3GFOA 4Q18A 3KUDA 4EQ6A 1JEDA 4OBEA 1NN1A 4BFTA 2QE7A 1US8A 2ZYVX 1SXJC 2QQ0A 3QPUA 1J99A 1ESNA 1P9RA 1ZRHA 4MDFA 4B35A 3QG1A 3SDZA 4AD8A 4YMTA 1N5JA 1Z07A 2A5JA 3A4NA 1G4AE 2XZPA 3WBJA 3IIKA 5D3MA 2LKCA 1P2UA 1Y3AA 3L0OA 4N0EA 4RFSB 5CJ2A 4EPWA 2ZANA 4WA7A 4DEYA 2QM8A 5JEDA 2QMEA 5DH9A 2GBLA 1Q1EA 821PA 1U8YA 5EE3A 4L9WA 5FOUA 2IX3A 2KJQA 5FTNA 3THOA 1Q21A 2ODNA 5JCZA 1Q3TA 2GXAA 3PENA 1E9AA 4KFSA 2VA8A 1YZKA 2F1RA 3F5FA 3CNNA 3Q85A 5JS7A 5DYIA 1SHKA 2P3SA 1BKDR 4D2IA 3X1WA 1CRQA 2BHRA 2FJUA 2EW1A 3K70C 2IYUA 4PPQA 1LB1B 1OW3B 2TMKA 4YDSA 1OXTA 4B32A 4BLSA 2IUTA 5TARA 4F91B 3T5GA 3T15A 3EA0A 3LLUA 3QVUA 5K8LA 5IT5A 1J7KA 2G6BA 2G1JA 1X8KA 4FMDF 1XXHE 1U0LA 3TVTA 4JZKA 3A1VA 4M22A 3ZS8A 3ZVNA 5IK2A 2CLCX 2D62A 3SS8A 1GP2A 2VSXA 4G0NA 1G3IA 1XEFA 1FW6A 3AVUA 3B7GA 3AUXA 4E22A 4DCTA 2IK8A 5E7IA 1ZMXA 1OXUA 2IC5A 3AEZA 3U61B 1KY2A 4A1FA 4BRUA 4POAA 2A78A 1WE2A 2JDID 2EFEB 3RLFA 4KVGA 5FOWA 2N42A 4GP7A 2ZM5A 2WWXA 1DVRA 1QHSA 1CJUC 4Q66C 4I81A 1VG8A 2NZ8A 3K8YA 5KYKA 2FSHA 4UNNA 2IYYA 3HPRA 3PUXA 1RFLA 5L3QB 1NIPA 1Q1QA 1G4UR 1KJZA 1S8FA 1JBKA 3NC0C 4Q9HA 1E1RD 1V43A 2C77A 4IOKA 1AK2A 1W36B 1W7AA 4CRWB 2CNWA 2I3BA 4DLRA 2J1LA 5E95A 3ND8A 4QBHA 1W36D 4QGAA 2QZ4A 4URWR 2A30A 2WJJA 3B13B 1E94E 4UXIA 4C2TA 1P2SA 1AA9A 5F9HA 4RD3A 1KK3A 3A1TA 4C0AC 2BV3A 3ZVMA 2KBFA 3NBYC 1HTWA 5AJWA 3LBIA 3WRYC 3QKRB 3TH5A 3EPHA 4QG7A 4PPFA 1XU4A 4TSFD 4GT1A 3TMKA 3T06B 4B6EA 3R7WB 2CCKA 3SN6A 4TQAA 5LBIA 3RYTC 3ZS9A 3H86A 2OBNA 4ARZB 5LD2C 2VL7A 2GBLC 5E7MA 2PX0A 2ZS8A 4DC9A 2XXAB 2CLSA 1S3GA 5CM9C 2CDNA 1W0KA 3A36A 1G7SA 1W4AA 2QROA 1GWNA 1HEIA 4IOMA 1ZP6A 2YZ2A 4IDHA 3FGNA 1GKYA 4KLNA 4M53A 1E69A 4HSEA 2OESA 1SKQA 2ZJOA 2ZRMA 2WKRA 5LD2B 4LYJA 4FCVA 3K0AB 2JLYA 3BB1A 5JZVA 3W3ZB 5HR5A 1UKZA 4UNPA 2J46A 3U7HB 4R2IA 4Q9LA 4KYUA 1OLOA 3QF7A 4JVMA 4DSTA 5LPNA 1AQUA 2EFHB 4B34A 1HYQA 3I8XA 2R9VA 1GZSA 5JRZA 3W3AA 3RC8A 4JYBA 4DVGA 4KFUA 2WOOA 2DWOA 4ACBA 5A4JA 3EG5A 3VTKA 4CT4B 2WSSD 1DBSA 2OSBA 3PQCA 1A4RA 1OIVA 3RHFA 3DPUA 3OIYA 4B6FA 3DL0A 4OI0A 1VTKA 1PUJA 1WBDA 1EXMA 1ONBA 3A6PC 5TMPA 3P32A 3DOEA 3KQUA 3QKRA 3U3OA 2ZSEA 1IBRA 2ZVPX 3TLXA 4BWYA 2ONKA 2HF8A 1XPRA 1RRFA 4XVQA 3W8NA 1EWRA 1M34E 1VCNA 1II0A 3KFXA 1DE0A 3EC2A 3LX8A 1U2RA 3GLFE 1Z28A 4LY6A 3K0SA 3I5YA 1GVNB 2XTNA 3KXKA 3TUJC 2EFDB 4LHXA 4RCYA 1K5DA 3AP2A 2WAYA 1NY6A 1Z0AA 1MRNA 2GCOB 4UNRA 4CEIA 1IN5A 3T1QA 4GI7A 1W4CA 4P32A 4C2UA 3NBFA 4KO8A 2R6DA 1XTJA 4M0LA 1W44A 1ZNWA 1YR8A 3HYTA 4IXMA 4H9GA 5FBLB 2A5GA 1AKEA 1ZCAA 1E9DA 2W6IA 1UKYA 1DO2A 2HDNB 4LK2A 1DARA 1YU9A 4XIGS 2WHXA 3RC3A 4LBYA 5KHOC 3LXXA 3KQKA 3BIFA 5TY0A 2G77B 4M1MA 2PT7A 5B2ZA 2VP4A 3SFZA 5L3VA 2XB2A 4HATA 1IY0A 4BPBA 3K0CA 1PLJA 3FTQA 1VMAA 2XSZA 4QXAA 4W5HA 3ZQJA 3EW9A 4IDPA 4JT2A 4NCKA 2CE2X 3F0TA 2QAGA 4HDQB 5EP1A 3P4YA 621PA 1KI9A 2G0TA 3T1OA 4DJTA 2O8BB 2O8EA 5EXTA 2FSIA 2YOFA 3TGPA 1E1QA 2ZI5A 3LAWA 1AS0A 5ELXA 4ZDWA 2QRZA 1G16A 3A58B 4ESHA 1Q20A 4A9AA 3IO5A 2O52A 1BS1A 1J70A 2DWQA 3AVOA 4CGZA 4Q4JA 5AUNB 1T8TA 4JVLA 4MRSA 5KPDA 5J4KA 4PC2A 3KJGA 4URZR 3I1FA 3ZQ6A 1O3YA 3SE0A 3SOPA 4M9SA 2GEDA 5AUPB 3OE7A 1RZ3A 2F1HA 3IEVA 1YZGA 3HDTA 3CWZA 1UM8A 1U98A 4JVNA 3B1WA 4X8MA 1OIXA 4LJ5A 3RRZA 3VR1A 4MRRA 3GLIB 1Z6XA 2DFTA 4GOKA 1ANKA 4Q21A 1Z6GA 1OF1A 2GXSA 3CH5A 5JI3E 4BECA 1E2MA 1LVGA 2KB0A 4V0OA 4F4IA 5HZKA 3SU8A 2W2VA 4MH0R 5EP4A 2GTPA 2FEOA 1G7CA 4MRVA 2W2TA 4B33A 2BMEA 2PEZA 4M2LA 1VHLA 4Q7KA 5CDFE 1GNRA 1GKUB 1VYTA 3NTUA 3DO6A 4RJLA 4DUGA 5JI2E 1SXJA 2F9LA 1EFRA 3KKNA 5DLQC 1FTNA 1FUUA 1P61B 2FFHA 4OJQA 3MMPA 4B3FX 2X77A 2JJ2D 1VCOA 1XTRA 4GRAA 4TMXA 1JJ7A 2IF0A 1Z2AA 2WSMA 5FUVA 4HB4A 5HE8A 1U90A 1FZQA 1M7GA 1XTQA 2ASEA 3OIVA 4YMVA 1IAQA 1Q0UA 1ZNYA 2WMOB 4U5XA 4EQ6B 3ADDA 1TEXA 3B82A 2DWPA 1EG7A 4CEIB 3ONWA 2CEAA 4L16A 2YJTD 4L9SA 4EPXA 4NYJQ 2IWHA 1NSTA 2YINC 2D74A 3THYB 3W6OA 2FX3A 4ABYA 2QN6A 4MUAA 3QXXA 2H5EA 1KDTA 2VPPA 1VCMA 2VP9A 5HZHA 1JAHA 1UBFA 3AF4A 1E0KA 1W1WA 5KUTA 2C8VA 2IXEA 4DLYA 4R7ZA 5FBVB 4D4MA 3THXA 2XNDA 1XD2B 2ORWA 4PO8A 1S2MA 4XWKA 2QPAA 3QI2A 1CLUA 1T0HB 1QVAA 3X2SA 1XNJA 1CKEA 2D06A 4NHOA 4U02A 4A6PA 3ADCA 1FPMA 4EAQA 1CR0A 4IXNA 1H8EA 5FOXA 2EU8A 4PC1A 1W36C 4ZI3A 4OHYA 4R98A 1E79D 1TNDA 2VIIA 2GRJA 3GJXC 2HLDD 1KGDA 2UZ3A 4Z8YA 2D2EA 3BC1A 4IHQA 3U60B 3HP1A 1KI7A 1G9XA 1S3SA 1T4GA 1T3SA 1Z6TA 2PL3A 4DKXA 2NOAA 3FHCB 2OLJA 3K9GA 1WP9A 2JLQA 3SBDA 2Q3MA 4HDOB 3CPHA 2AD5A 1VHTA 2JLZA 3IO3A 3BGWA 4TZ6A 3VKGA 1CR2A 1G5PA 3NH9A 3I72A 1W2GA 2CVFA 1CTQA 5JEEA 3D3QA 3B85A 2BCJQ 3MUFA 1PV4A 5EE1A 2IYVA 4NH0A 4M1SA 4EKDA 3ZZUA 3CX7A 1QHNA 4UJ3A 3CPJB 3Q8XB 2H57A 3BD9A 1FP7A 1RRPA 2IYSA 4ZIRA 4FN5A 4C7OB 3T1TA 3L8ZA 3T5DA 2CBZA 1ZCBA 4Z1MD 2J45A 2ZEJA 1GL7A 1QRAA 2B7BA 1KI4A 2Z4RA 2GF0A 3WYGA 2FG5A 2FSFA 1G1MA 4RD2A 2D7CA 2ERYA 4A0FA 2AX4A 2XGJA 2OHFA 5L3SB 4Z54A 4UXJA 3WNDA 2PLFA 4C0SA 1N5IA 2N1BA 3VNVA 1YQTA 3RDPA 1E2IA 1GSIA 5TDHA 3SJZA 2D7DA 2HXYA 5LB4A 4A8JA 1NVVR 2JGNA 2J7PD 1XFAA 5L3QA 3IIJA 1GNQA 2P5SA 4UXHA 4Q1CA 5DHAA 2G88A 2IWRA 1KO5A 4ASUA 2A5DA 4LBZA 3THXB 1TQ6A 2C5LA 4P4UA 4DLWA 4HDCA 1R5NA 2I4IA 3KKPA 3LLMA 1Z22A 3N2EA 4A6XA 3QEJA 2HYIC 2P6UA 4QJ4A 3OEHA 4QBIA 2GCNA 3PEUA 1XTKA 3K09C 3VKWA 2QQEA 3B78A 3I5XA 2QORA 3QXSA 1AQYA 3ASZA 3Q5EA 4PPGA 4TMWA 4CW7A 2YV5A 3HR7A 3PIRA 4XTCS 1B23P 2GF9A 3OIWA 1N6IA 5KDLA 2H17A 4Q1DA 2PX3A 2RGDA 3KXLA 4A8JC 1MO6A 1T5IA 2X8AA 5BYJA 4Q9JA 2RHDA 2BMJA 5AWFC 3S1AB 3C41J 4K46A 2HV8A 5G53C 3R20A 1E9RA 4XOIA 2R6AA 1E99A 1R0ZA 4MITA 3G0HA 2VLIA 1K5GA 5JS8A 1UBCA 2O0JA 4CF7A 3X1ZA 5GVSA 2BCGY 3QBTA 3EIQA 4HUQA 1ETUA 2AN9A 1DAGA 4HAYA 1X3SA 2VTKA 3FDIA 1XMJA 3T34A 5J4HA 4EPTA 4KYIB 3PEVA 2ZRKA 4C7OA 1XCMA 2JIZA 4QM6A 1PLLA 1QVRA 1OKKD 4PO1A 1L2TA 3AKYA 2GNOA 1BH2A 1TEVA 5JBQA 4WOPA 5GVRA 3IGFA 2ZRCA 1I2MA 3UMFA 4D6PA 2QBYB 2CK3A 4G5OA 4F4JA 2YYZA 1XXHB 1Z6YA 3U2QA 2J87A 2ZE5A 2ZRBA 1YZUA 1KO1A 4Q9IA 2XTZA 5AJYA 5G41A 1ZM4A 3MWLA 2XEXA 4NCJA 4NKRA 2OXRA 1XX6A 2GHIA 2V7QA 2RMKA 2ZRPA 2ZU6A 1LF0A 5EZ6B 3RSOA 1E2HA 3UWOA 4TMZA 1AJEA 5CYPA 221PA 3UG7A 4ZCLA 3U3RA 1ZD8A 2HCJB 4WBSA 5CIWA 3GLFB 3UMSA 1XDBA 2F1IA 3BRWD 4AYXA 4DZZA 2XJ9A 3BB4A 4AI6A 2X1VA 1P2TA 3QPWA 1KSGA 1GKIA 4B44A 3PR1A 4BQSA 3HU2A 1I4DD 2CCGA 1UKVY 4MA4A 5EXPA 2OFOA 1P3JA 1VG1A 2BEKA 1M7HA 3AB3A 4Q4HB 4LC0A 1JJVA 4P4TA 1T3LA 1QDEA 2QSZA 1S9HA 1GM5A 1LTQA 2Q3FA 2X19A 4OK6A 2H18A 4ACAA 4LDJA 4OYHA 2NO7A 2EYUA 1ZBDA 2P6RA 3K70B 1I4LD 2WMNB 3AUYA 4KAXA 3ETLA 3BFVA 4V02A 4F93B 1YZQA 4CT5A 1NMYA 4PTLA 1E2GA 4TYWA 4B48A 2GJKA 2B6HA 2IS1A 5FPHA 4QKQA 4LV6A 2WIBA 5GJBA 1SVSA 1GG2A 3QG5A 4ITRC 1UBGA 1Z8FA 3RS5A 2XSZD 5JWRA 3GJ5A 4L15A 1GRRA 2ODBA 2W83A 1UEIA 1N6HA 3ZIAA 3A37A 3C5CA 3KTAB 1KI1A 2SHKA 4D0GA 3FMFA 2OT3B 3X1YA 2RGBA 2PZEA 2BEJA 4DB2A 5IDVA 3QY0A 4V0NA 3KJHA 4DLTA 4XWOA 2ZRLA 4C0JA 1LS1A 1KDRA 4XD7D 1E9SA 3B60A 4E03A 1SKYE 4BFVA 3CNLA 1CXZA 4GZMA 1WA5A 3MWJA 4HLUA 2ZJ2A 4ZKEA 3VR6A 5C18A 4TYPA 3GCGA 2B8TA 2GCPA 2VP5A 2EFGA 1KI2A 3N70A 4DRZA 2GWHA 2JLXA 4MYUA 3KJEA 3ZVLA 3E70C 4LSGA 4Z51A 4MKFA 4A0HA 1PUIA 1DELA 3CF6R 3IKJA 5E4FA 1S9DA 1ZAKA 1QG2A 1TL7C 4RZ2A 3UKDA 5DN6A 3LBHA 2GZAA 4HZIA 2FSGA 3GLHA 1HQCA 4KI0A 1XJQA 3KKMA 1II9A 4BZQA 1YR6A 1E2EA 3CRQA 4LPKA 3F3YA 1SULA 3PITA 5DI3A 1NI3A 3T1VA 5HPYB 1WB9A 3EZ2A 3CM0A 1NVWQ 1E0AA 5FL7A 3CH4B 4B74A 1ZD9A 1R0YA 2DB3A 1TAGA 4CEJB 3LA6A 1JR3A 4JLDA 2F6RA 4K81B 4MYHA 1P2VA 1GRNA 3BH6A 2IS4A 2IS2A 1KIMA 1EGAA 1G291 3ICQB 2V54A 2FFAA 2VH5R 3TRFA 4M8NE 2PCLA 2ZTSA 2ONJA 1AS3A 4XSGA 1HUQA 1D2NA 4KITB 1LY1A 1NLYA 2F43B 4B43A 4DCSA 2EWVA 3FHTA 1XD9A 5JJIA 2ZITA 3LV8A 2PMKA 2BDTA 4P4SA 4OI1A 2A5YB 1Q1ZA 4AKGA 3V9PA 2HYDA 1CR4A 2R62A 4Q48A 5FTMA 4BFZA 4ZDKA 2XX3A 3OESA 4LJ9A 2ZJZA 3EZ9A 4JKYA 4X8HA 1Y63A 2GETA 2IYRA 3LW7A 3NEJA 3VR3A 5D3QA 2GDJA 5EP3A 2DYKA 2WJVA 1E32A 5TV2A 3RRMA 1M6NA 4AC9A 5J4LA 1TUIA 4PAOA 3GJ8A 4AYWA 1XEXB 1WF3A 2B21A 1CJTC 1D2EA 2EQBA 2W6JA 2F9MA 5DO9A 1RVDA 4TLCA 4Q02A 3BWDD 4Q9KA 3ZLJA 3W8RA 2OFXA 1SXJE 2CCJA 4HYYA 3EWAA 3BERA 5HTKA 1JXMA 4IDNA 5CJPA 3X1DA 2BBOA 2ZE7A 2BBSA 3IQWA 2BBWA 2WPDD 3I4LA 2LKDA 4G5GA 2OV2A 4KVAA 1WDTA 3WHKA 3TAUA 3KXIA 1KY3A 3NKVA 4IFEA 5H70A 2OG2A 1PZNA 2ZAOA 3SNHA 1G17A 5CK4A 2XOKD 2REOA 5B30A 1E2DA 2NO0A 4P3YA 1OFIA 5KNCA 3GPLA 1G8FA 4DB4A 3MFYA 1X86B 4XVUA 4KLZA 2NMVA 1FNNA 3GJ7A 4PXAA 3ZVRA 3CONA 2IEZA 1NNEA 1XZPA 2GXQA 2VHQA 3NH6A 1FOEB 3L0IB 3NEYA 4JLPA 4QJ5A 4A8JB 2BIFA 5CK5A 1KMQA 1KYIA 2OM2A 1T6NA 4BRWA 2PT5A 4YXWD 4EDHA 2YKGA 5JJLA 1A82A 1UF9A 3IBGA 1ZM3A 4AKHA 1BMFA 3O47A 2WKQA 4C0BA 4XJXA 2H8KA 4ZV4A 3L2OB 3UMRA 3G5UA 3MJRA 1YZLA 2JLSA 2ZE6A 4OQXA 1E9FA 2UZIR 4OQMA 4XH9B 3NG1A 2OZEA 3F8TA 2OLKA 2ZRFA 5SZKB 1NL3A 5BN4A 4ERNA 2R44A 1S96A 1TPZA 3FB4A 3LH5A 3QXHA 2KBEA 5DE3A 1GL9B 3CO5A 2HF9A 4PC7A 4IFBA 1XD2A 2C03A 3NXSA 3VQTA 4KSCA 1OB2A 2ZJ5A 2CL7X 1UDXA 1R10A 4TSFA 3QKSA 2ZI4A 2YVUA 3WHLA 4A2PA 3N5CA 1JECA 4QGGA 2FGKA 4FWTA 1COWA 2REBA 3GFPA 3KX2A 3QF4B 4PHTA 1G18A 3AF0A 4ZIRB 2B92A 4FI3C 3P26A 3V00A 1UEJA 2QUZA 2PJZA 1D9XA 2OCPA 4KCGA 4D82A 4HUTA 2IHYA 2J0UB 3B9PA 5A0FA 4DLZA 1HT1E 4N3NA 3BE4A 3D6TB 1E2NA 3W6NA 2G3YA 2QE7D 5AK0A 5BQ5A 3P1JA 4ESVA 3U4QA 1H65A 4LOAA 3OAAA 2J0SA 4PX9A 3IBYA 1U0HC 1OXVA 2ORVA 5GADl 1FX0B 1W48A 2NG1A 3OEHD 5J47A 5KOYA 3CUEF 1BYUA 4TLDA 1IN6A 1XTSA 2XITA 4AK9A 3SQWA 3I73A 2C96A 1OB5A 4FMBB 2WWFA 1OHHD 5EXSA 2PCJA 3QXJA 2J3EA 3E1SA 3RWOA 3D7MA 2IHBA 5KNDA 3IILA 4AYTA 3K0FB 3O8DA 5EE0A 3QOFA 3TIFA 2IYQA 3FYHA 3AVPA 2ZSBA 3R9XA 2VSOA 5F2EA 5KSZA 4IJMA 3AVVA 5FBQB 4PHGA 1TQ2A 1UDWA 2ZYWX 1SVKA 1F48A 3CB4A 4QHYA 1KZ7B 2O8FB 4PHFA 2YWEA 3PV0A 5CM8B 2C9YA 3UATA 2IXFA 4A15A 1R5BA 4JVSB 1N3BA 2GCOA 2WKPA 2OE2A 5JWHA 3FFAA 1EFTA 3ZD6A 4O25A 2QMHA 1JNYA 2WV9A 4EJSB 5AUOB 1MO3A 2H1LA 521PA 4E07A 1ZU5A 3DKPA 2D4HA 4DHEA 1CJMA 1P7CA 3U4QB 1CF4A 1PJRA 3CX8A 4DDVA 3ND9A 4JBWA 3SJAA 1XWIA 4OQNA 2Z43A 3OFND 3TAHA 1F2UA 1ZD1A 3FMOB 4RZXA 4ZI2A 4TYYA 1KSJA 4HB2A 4BLRA 4I1OA 4RSGA 4D26A 3W6PA 2GVDC 3MRSA 4F92B 1SVMA 1T0JB 2J59A 3GJ0A 4JLOA 1VDZA 3U3MA 2E87A 2QPTA 4Q47A 4D4JA 1Z83A 3FWYA 4DSUA 5FPSA 4B3XA 2QI9C 3TR5A 3EIHA 4LCBA 3EZ6A 3CNOA 1T91A 3W9YA 1MH1A 1W47A 4MRPA 5B58C 2V7QD 2VP0A 2BJVA 3THWA 2BM0A 1RJ9A 2F55A 4J0QA 2OFWA 3VNUA 3WRXC 3DM5A 4GMDA 2ZU0C 2X2EA 4URUR 1AN0A 4LWZA 2CJWA 4GOJA 1NIJA 2W58A 3GEEA 3RS3A 5JLJA 2AFIE 1VKJA 1W0JA 2E1RA 4PC3A 5HE9A 4HAXA 4QM7A 5IK2D 2YNMA 3QSYA 3TQCA 1S1MA 1J8YF 4LUCA 5JJKA 4B2IA 4TYQA 4XSHA 2XZOA 4ZDIA 3CF0A 4LHWA 3KTAA 4B2PA 1DAKA 4LZZA 1G3UA 2GEUA 2LWIA 5FUXA 2I1VB 2V1UA 4G5SA 3CPEA 2YWFA 1EESA 1NKTA 4QRHA 1TQDA 2JDIA 1P62B 2UKDA 3M1IA 4G1UC 3CRVA 3LXRA 1RPZA 2C95A 2JLWA 2OCAA 3GLHE 2VQSA 3BH0A 3L43A 1X6VA 3SHFA 1U94A 5FUWA 1MO5A 2H16A 3SZRA 1ZIPA 5ANRB 1CULC 3NC1C 4R71A 4OJKA 1IN7A 1E1RA 2ZSFA 4HI0E 2FGJA 4LYFA 2FV8A 3KB2A 2FMXA 5C4MA 1DADA 1PLKA 5FTKA 5DGXA 1ZVQA 4B3CA 2P0EA 1NG9A 1EFUA 2WZQA 4AKEA 3O8CA 1S4QA 4DBLC 1Z08A 4IDQA 4DUGD 1OE0A 3ZZ0A 1SXJD 3KL4A 4OKSA 1D2MA 4EJSC 1KO7A 5P21A 1W4RA 4H1VA 1UADA 2FE4A 5KSPA 3J81k 3TSZA 4LJ8A 1G8HA 2FWRA 1HQYE 2ZSDA 2R65A 2JLRA 3IHLA 2VO1A 2ZRHA 1ZUHA 4XD7A 3A1SA 2H7VA 3LBNA 4JLJA 3GLGA 4EPYA 1HT2E 4XWAA 3ADKA 2W0SA 4FW9A 4AKIA 4D81A 5K8TA 3CW2A 2C98A 3JVVA 3CKLA 2J5XA 1OH7A 1XMIA 2XZLA 3E2IA 4NL4H 1NP6A 2AWOA 1L4UA 1OFHA 4WZAE 4RKFA 3Q7PA 4TT3D 5FR1A 5FPYA 2BC9A 3TUZC 2FZLA 3PEYA 4QNMA 5FTLA 4BLTA 1G41A 1JR3E 1NN3A 1Q44A 1YVDA 1Z0JA 2J0VA 2GAOA 3EXAA 4LV5B 1NMXA 4TWZA 4V03A 2WJHA 3R7WA 1TX4B 1RE0A 3MWKA 3EARA 1MR3F 2WOJA 1SKYB 2R6GA 4MKGA 5EQTA 1L4YA 2CL0X 4IEEA 4TL8A 4M4SA 1CR1A 1GFIA 3GEIA 2HXSA 3UK6A 4XVRA 1EFHA 4P0TA 5FPTA 4A0RA 4F38A 1E2KA 2CHQA 2W6ID 4IVRA 4RFSA 2GK6A 5K8UA 3BK7A 4L8GA 1GIAA 1FTSA 4MGIR 3V4RA 5CITA 3BOSA 4QOSA 4YQFA 2HLDA 1JPNA 2F3RA 2O5VA 1XMVA 4PHHA 5TXGA 1C9KA 3DKVA 1N5KA 4HAZA 5EP2A 2VEDA 3WYFA 1A1VA 421PA 1KDOA 1NBME 2WICA 3QQ5A 2VF7A 2RGEA 4YLGA 3VR2A 4WVFA 3L0PA 4PC6A 1KKMA 4NBSA 3UIEA 3SEAA 4LC1A 4OI2A 4DWJA 2V55B 3U7FB 1N6OA 3HJNA 4EUNA 1QHYA 1IHUA 3GFTA 5L3SA 1YE8A 3UWKA 4RZ3A 5FI0B 5FPKA 1NY5A 1W5TA 2J41A 4JSTA 3U3KA 1KK1A 2LCFA 2YWGA 1OFUX 3QKUA 3QNUA 1MABA 2QT1A 4PZLA 5TVKA 3REFA 1G3RA 1N0VC 1VPLA 3SR0A 1KTVA 3KDSE 1KSHA 3QKTA 4JMPA 1GAJA 1KMHA 3R8CA 5DIFA 3AKEA 5K8IA 2ZYTX 1E0JA 3QVVA 4UNQA 2ZR9A 5BYKA 3DOFA 3PEWA 1UPTA 2NTYC 4PAMA 4A4DA 1OYYA 4US0R 3ZDQA 2YOHA 3C7KA 4NZYA 1CRPA 3GLIA 3LQQA 1WRBA 1TADA 4BZXA 1ZC4A 5CYOA 2K5UA 2BOVA 2OCYC 3ZJYA 4C0QC 1XPUA 4LI0A 1GUAA 1NBMD 1A5TA 3K1JA 4G01B 3C5HA 4HB3A 4M1TA 3K09A 4FMCB 4Q7MB 4Q4AB 4OHVA 3DDCA 4CEJA 4JT4A 3R9IA 4LHYA 4OI4A 2BJWA 3SFVA 2C99A 3EC1A 1DAMA 1E2JA 1V5WA 3IPXA 4WZ6A 4O3MA 1NJFA 2GEVA 3LVRE 2MMCA 2XOKA 1TF2A 4NPHA 1KI6A 1W5SA 4A82A 1FQKA 3DVLA 4N1AA 1R6BX 1W46A 4L5BA 1KAGA 2CMKA 1G6OA 3K9NA 3GEHA 2EVWX 1ZM7A 4HUQB 1I4TD 2WWIA 1BIFA 4IRUB 1IJFA 1BYIA 3QE0A 2HCBA 2BKUA 4DIDA 1E9CA 4TYNA 4Q1FA 1GOTA 3K0CC 1QF9A 1BMFD 3EZ7A 3SJCA 5A5GA 2ZROA 1GITA 3B1YA 2JJ8A 2YHSA 3ASYA 4I1SA 3W90A 4WW0A 2IEYA 1XEWY 3WY9A 1E2QA 4G5RA 1OSNA 3THYA 4DDWA 1DAHA 2AKAB 1ZJ6A 2JJ1D 1P9WA 2RGCA 1Z47A 2IYLD 4JBYA 3WMFA 3GLGB 1JQLB 1P5ZB 1KNQA 1ZU4A 2ZI3A 4FXPA 4ZKDA 2GZDA 2Q3HA 4K8OA 3SBEA 2ZXUA 3RRYA 1OPXA 1YZTA 3HR8A 4JL5A 3RABA 3CRRA 4LHZA 4B2LA 1NN0A 1EFRD 3U7GA 4TL9A 2WVJA 3R8FA 2MMGA 1MKYA 1P6XA 4QGHA 4WXPA 2FFBA 2QTFA 1XD8A 2IYWA 3MLEA 4I99A 5DISB 4BFSA 4CEHA 3BJIC 2AD1A 1LS6A 2I1QA 5FI1B 3JVUA 4ON9A 1QG4A 5EJEA 1E98A 1G3MA 1X1RA 1RKBA 4DT1B 1G21E 4M1WA 1AZTA 1IXSB 1PVOA 3QBVA 3DZ8A 1QBKC 4RY2A 1OH5A 1P9NA 4JL8A 2E9SA 1II8B 5BXQC 1A2BA 3KKOA 5KSYA 3Q72A 2Q0HA 3LVQE 4MGKR 4TMVA 4HZUB 3TR0A 2ZUBA 1KDPA 2XAUA 5GJWC 2UVQA 4BGDA 1Z0IA 3CLVA 2WWHA 5UKDA 2F7SA 1SHZA 2GA8A 3WXMA 1G64A 3LX5A 2RB4A 1YR9A 3LW8A 4OHZA 3UXMA 2F3TA 1IXZA 2Q9AA 2GJSA 4JJZA 1KAOA 5BN5A 3QXCA 4BLPA 2IF2A 1ZYUA 1EX7A 2AL7A 3AVTA 1DO0A 2ZRIA 2KI5A 1XEXA 3Q5DA 1R8SA 3EA5A 1CJKC 1MABB 1SQ5A 1X8JA 1G8YA 1OXSC 2CXXA 2IYTA 3FE2A 3H4MA 4PAQA 2BMDA 3WP1B 4DDUA 2WM9B 5BWMA 1F3OA 2NIPA 3D8BA 2RH5A 1D8TA 4LPSA 4NYMQ 3O8RA 2J7KA 2ATVA 2R6CA 2JLVA 2AK2A 1BO6A 1Z3IX 4UKDA 1TU4A 2ZUCA 1S0UA 2DFLA 1KOFA 1G8PA 4YDHB 4IOJA 3L0SA 3Q3JB 4S2EA 4MGZR 3AQ4A 2NO9A 5KDOA 2CVHA 2KSQA 3WMGA 3OEEA 3BBPA 4AG5A 2ODEA 3A1UA 1AS2A 5HCNA 1HH4A 2VSFA 2QM7A 2C2HA 1GRQA 2QRNA 3R9WA 1FUKA 2RAPA 2IYXA 2C9CA 3B9QA 2ZYUX 4BFXA 2GJAA 3LQRA 3IQXA 3FPAA 4JKIA 3REGA 5JHHB 3PJRA 3CWQA 4D80A 4UQOA 4DLVA 4Q19A 1C1YA 1JQJC 4US1R 4GNKA 5DI3B 4L4UA 1P4SA 2ERXA 2O0KA 2AR7A 3N2IA 3AVQA 5SZIA 1OV4A 2C04A 1N6PA 2JA1A 2C9OA 1BOFA 3FKQA 4DSOA 3LDAA 2IW3A 3AGPA 4GFDA 4Q1BA 4QBFA 2ZREA 2RGNC 4QFMA 3BFXA 1ODFA 2ZSAA 1HY3A 1Z5ZA 4A92A 3VHLB 5JCPA 3ADBA 2G0NA 4BFWA 4TMTA 4BFYA 3FHOA 1R0WA 2NPIA 2IS6A 3ZZTA 2P67A 3WBKA 3EZFA 4KV9A 1TQ4A 2GJ8A 1J2JA 2GKSA 4W5WA 2QGNA 4Q5IA 1G5RA 3TNFA 3ZH9B 3THWB 1RW4A 1MOZA 4GSYA 1OXXK 2GESA 4NCNA 3H1TA 4MRNA 2EYQA 4LJYA 1M8PA 3AM1A 3GQBA 3LWNA 4LJAA 4BUJA 1ESMA 2CE7A 4FMCF 4RFVA 5JSZA 2C78A 3W5IA 2QAJA 1CEEA 1OT3A 2XJ4A 2WJYA 4ZDJA 1X1SA 4PO9A 3B1ZA 5B57C 1E9EA 1AKYA 4TZ0A 5HKKA 4V0ME 4GPTA 5BW8A 3W5JA 1SVOA 2B8WA 3EX7C 3OIUA 3AF2A 3G82C 4FWIB 4LYAA 4DIEA 4GL2A 8OHMA 1XCPA 2VRWA 4F7WA 1NF3A 4M21A 3AVWA 2KE5A 1HE8B 3OHMA 3LNCA 1YJ5A 2A2ZA 1E0SA 4LJ7A 1L8QA 1KHTA 4TTQA 5FH9A 2HUPA 2PEYA 2QY9A 1TTTA 3BFKA 3ICEA 3B8HA 3BORA 1XF9A 4R2HA 3SYLA 2WTUA 1IN4A 1E2FA 3K9LA 5LB2A 3VMFA 3A1WA 4IVPA 4DT1A 1SVWA 2W2XA 2RGAA 2QPOA 2NPFA 1RYFA 2AHOA 3I32A 4YONB 2O8FA 1YRBA 4GBMA 4NYMR 2ZQ5A 4WAUA 4I1VA 2Q21A 5C2JB 5DYGA 2R2AA 2BMFA 1OKKA 4TT3A 1ZNXA 3TW8B 1G8GA 2RKOA 3B1XA 1NRJB 2FEMA 3K0EA 5FL3A 2Q9BA 1IY1A 1NJGA 4QBGB 3NBXX 4HLCA 4M9ZA 3LO5A 3OE7D 5SZHB 1CS4C 4II7A 2OAQ1 2WWWA 4CVNA 4EFNA 1H8HD 2HEIA 1XJ0A 1RJ9B 4NU0A 3AP3A 5G40A 4KSBA 1N25A 1E3MA 1XPOA 5EE5B 5JECA 1TF7A 4M9XA 5H68A 2ZRGA 3K9HA 3PUZA 4U7DA 1OYWA 1LF5A 2FPKA 5L8VA 1EWQA 1JALA 2VF8A 2W00A 3RNLA 4BLOA 1UFQA 3KQHA 5LDDC 4Q00A 4TLEA 4H1UA 1RIFA 2ZIAA 2QP4A 1FFHA 2CNWD 5IF9A 2Q9CA 1KJYA 4MYTA 1Z06A 3WP0A 1OH8A 4GDFA 3KZ1E 5CIQA 4ZO4A 3MJHA 1E4VA 4R9UC 5J4YA 1U8AA 2D3WA 4M1KA 6Q21A 1QHHA 1TU3A 4AWXA 2ZJAA 3QF4A 1OFTA 3H84A 1XRJA 4RD4A 1I2DA 2NGRA 4ZCIA 4LGMA 1JPJA 2OBLA 4PSKA 3M4YA 4FINA 2JJ2A 1F2TA 1Q57A 4IW3B 3NDPA 1J90A 1FL9A 1S1CA 4Q1AA 4X8OA 4MKHA 4MGYR 1P72A 1T3HA 5AR1A 1KMHB 2QMUA 4CYMA 4QNRA 1W4BA 3PUWA 4JBXA 1YHNA 2G1KA 3MG9A 4PQYA 2OUKA 4HEJA 3T12A 3VX3A 2RGNA 3DMNA 3QEOA 2L0XA 5JHGB 5JRJA 2ZVQX 1HV8A 5F9FA 1A7JA 2O8BA 3ZD7A 2FF7A 1QHHB 2PMDA 2P2LA 4QC2A 4D4KA 1W2HA 2PZGA 3M6AA 3RS4A 3GJ6A 2AXPA 1JEEA 5J5CA 2Z6VA 4TTRA 5F3WB 2YC2C 2FU5C 5E3HA 2ZI9A 4P4SB 2EWWA 5GJCA 1K6MA 3EIEA 2JCSA 3I8SA 1AIPA 1G19A 1XCGB 4KJZA 3RAPR 3T35A 1E2LA 3KJIA 2DCUA 1KI8A 2WBLC 3DHWC 5C46F 2QTHA 1XP8A 3SC3A 4BEJA 1IONA 2DFKB 2NO1A 1SVLA 1T5LA 2PBRA 3EPKA 2ORIA 2ZPTX 2J0QA 3I92A 5KNBA 4EPRA 2WSSA 1FX0A 1KZGB 2IUSA 4JLVA 1F6BA 4HAVA 2OILA 3C8UA 3TQFA 3VU9B 1E4YA 5CDFA 1DTSA 2QA5A 3QUSA 2G9NA 4O2RA 5KU1A 1JI0A 4XTRA 2QENA 3SHWA 1JR6A 4PANA 2BKEA 1DOAA 1KO8A 4B76A 1MV5A 5TB5A 2RGXA 3DMDA 3BH7A 3OF5A 5DHFA 3U44A 5E7JA 3FOZA 1C4OA 1NVXQ 1G6HA 2AFHE 2JEOA 1OIWA 2RHMA 4RD0A 1ELOA 4LV8B 3GP8A 3RS0A 5FR2A 2OEPA 1SVIA 1XEWX 4YMUA 4EPVA 2P65A 2PLRA 4E09A 4LRWA 1K8RA 4MYCA 5FOVA 3WMEA 2W0MA 1XTIA 2PH1A 3MGCA 1LW7A 1UJ2A 4Q4LA 3TVDA 3U5ZB 1U81A 3SQXA 1QHGA 2JLUA 2DBYA 4YMWA 3WNCA 4AG6A 1N2CE 1IM2A 3O8BA 4Z1MA 3U6KA 5H1YA 3TKLA 3I61A 3SYNA 1T9HA 1ZM2A 2WJGA 3ECCA 4B71A 3VHXA 1H8ED 3AH8A 3EAQA 3AKCA 3M0EA 4A0GA 2W6JD 1ZM9A 4LJ6A 1E79A 3NBZC 1CBUA 2QMOA 2CHGA 3LD9A 4GMXA 4BE7B 1D5CA 3HU3A 4M9QA 4FIDA 3KB1A 4HLUC 3K0FA 1IQPA 4EIWA 1GILA 1Z0FA 2FZ4A 2WAXA 2ZETA 1B0UA 2WPDA 4Y0VA 1IOZA 5C1BA 1WXQA 5HCIA 3B5JA 3C14C 4IDOA 4TLAA 1EK0A 2VHCA 2REXB 4DXAA 3IUYA 1M74A 2DPXA 4PQFA 4TQ9A 1E1QD 4TQUS 4URYR 1EX6A 3FMPB 2XXAA 3VX4A 4G3XA 2ZI6A 2O8EB 3AF1A 1ZW6A 1XBTA 2V3CC 2A3RA 1VYUA 2QT0A 2O8DA 1Z2CA 1UKEA 4C30A 3V4FA 1JAIA 1R2QA 2MSDB 4C4PA 4HLQB 4IOLA 2FH5B 1G7TA 3AV0B 3TUIC 2QTVB 3KKQA 1N0UA 3PVSA 4IKEA 4Q4HA 4V0LA 4PZYA 5EZ5A 2N46A 4DCNA 4DEXA 4G5QA 5DSZA 1Z29A 4GZLA 2Z83A 4RVCA 5SZJA 1SZPA 2NO6A 3FKSD 3GJ3A 1VG0B 4UJ5A 3VAAA 1F5NA 2VP6A 1W0JD 4LYHA 1FMLA 2EFCB 1KI3A 4US2R 3CRMA 4D0LB 2OXCA 4KXFB 1GDDA 1M1YE 5KO2A 3A8TA 1E96A 1HA3A 3X1XA 1N6LA 4DLSA 4PQRA 3NVAA 1GTVA 4NTZA 2R6FA 3SYKA 1LNZA 3C16C 3AVYA 2PZFA 1F2TB 4ASUD 4URVR 1CP2A 4Q4AA 1KJWA 4HB0A 3GLHB 1F60A 2V4ZA 2OO7A 1P73A 2VBCA 4DCVA 1UAAA 3NDBB 2V1XA 1M2OB 3CX6A 3VR4A 1XXHA 1O87A 1G3QA 3OEED 4O2LA 4PR0A 3U44B 4TTPA 5JMTA 2XTMA 2HT6A 3HYRA 2YC4C 3MAAC 2F1JA 3H2YA 2A7QA 3IIMA 2JIZD 2DR3A 4NYIR 3RS2A 1QHXA 3S1AA 4KODA 5GJVC 3CZQA 2FA9A 3TSOA 2JAQA 3RSLA 1MT0A 1WBBA 4ARZA 1Z63A 4B73A 1NKSA 4AIIA 4ILEA 3RANA 1DAFA 2H92A 4CZ2A 4A36A 4CDGA 4PPNA 1FNMA 3RRNA 3ZYCA 2XB4A 1P75A 4C0KA 1ZC3A 4BZPA 1U9IC 4BFUA 2IYZA 1NSFA 3TBKA 1E6CA 2ZRJA 1VIYA 3TE6A 1T8UA 2XNDD 1QZXA 1COWD 1XB2A 1IN8A 2ZJYA 1R8QA 1XJCA 1HE1C 2V6IA 4PFSA 2A5FA 4JIMA 1TF5A 1ZINA 1GL6A 1Q22A 1U8ZA 1L7VC 3BXZA 3IEUA 1KNXA 4Y0AA 3VR5A 2P6NA 1R4AA 1RRGA 4JLNA 1U99A 1ZUNB 2FPMA 2QP9X 3PFIA 1II8A 4PSAA 4V0MA 1U0JA 3TJZA 4TN1A 3EASA 1DG1G 1J8MF 4FD2A 4Q03A 1VECA 3HU1A 4Q7LA 1AZSC 4EJSA 1AGPA 4ZPXA 4HZUA 3FMIA 4FCTA 2QSYA 4S35A 2OBMA 4Q4JB 1CU1A 5AJZA 1RC8A 2V9PA 2ANBA 4A2QA 5FUYA 2ZR7A 3GD7A 2NZJA 4MKIA 4CEHB 3HWSA 3JZAA 3C4JA 1US8B 1XMSA 5JFGA 4LBWA 3RS7A 4D25A 3LY5A 2QBYA 3VU9A 5HKKD 1Z0KA 3OFNA 1VIAA 2MSCB 4NE2A 5H8WA 2HT1A 2FN4A 1HURA 2QAGB 3KQNA 4JLMA 3GLIE 4DLUA 2Z5FA 1NG1A 4RD6A 3VKHA 5AJXA 4YC7A 2IXGA 2J9RA 2YOGA 1P60A 1DPFA 3NIBA 3HPQA 1DEKA 3NWJA 4D0NA 4JLKA 5JSZB 3ZIAD 1WQ1R 4KU4A 3DEFA 2BBTA 2IT1A 4TLBA 3K70D 4QHTA 2ECKA 2QG6A 2IBMA 2WJIA 3GMTA 3AP1A 3B1VA 4JS0A 5J4VA 3RWMB 4HAWA 1YKSA 4NP6A 3Q9LA 3PUYA 5BN3A 1DAEA 1KI6B 3EWSA 4U00A 4NCHA 2DFNA 4V0KA 3FFBA 4DDTA 4HLDA 3U6BA 3H0KA 2J7PA 1ZIOA 3WYAA 5KPJA 1DAIA 1W0KD 2GVZC 4B3DA 2JATA 4QGFA 1H8HA 5G3ZA 2JASA 3KUCA 4QL3A 4BLQA 1IJEA 3PG5A 2P5TB 1RYHA 3AF3A 121PA 4NYIQ 5J40A 1G7RA 1E9BA 4RCZA 1GNPA 2ODWA 1RRCA 5CLLA 1U9IA 2FDCA 5CB8A 4W9MC 3EPJA 1MRSA 2FOLA 2MSEB 1UBEA 2WWYA 1R7RA 2OCBA 1N6RA 3CRW1 1YRAA 4X8LA 1JB1A 3JZMA 4PSVA 4A2WA 3QPVA 1IY2A 5M04A 5FTJA 1WCV1 3A4MA 5CLQA 2DY1A 2QU8A 2Z0MA 3AGQA 5EUQB 4JL6A 4TL6A 2D2FA 3TW4A 2O8CA 2GILA 4TMKA 3VFDA 1OH6A 2CL6X 3PCRB 721PA 2BM1A 4QJ3A 3MWYW 1AGRA 3MSXA 4FCWA 5FOTA 1Q1BA 3QIAA 5IHPA 4KHZA 3UG6A 1TUEA 2IA5A 3E5HA 4I1UA 3K0AA 4IEIA 4LBVA 3U3JA 4AURA 1NN5A 3C15C 4OHWA 2ANCA 3CBQA 4JLBA 1EFCA 5KTYA 1MO4A 5G3YA 3PXGA 4HAUA 4Q7JB 4Z8XA 3CR7A 3WNBA 3IHWA 3LRPA
chains in the Genus database with same CATH superfamily
4CMGA 4INJA 4MB0A 5JPCA 2W6MA 5HM8A 2RARA 3I1YA 2WB4A 4QQNA 5EMHA 1TLTA 2CVZA 1DIOB 1HR0B 5DN6D 4RA6B 3AI1A 1GUDA 5ALDA 4R2JA 4PZEA 2AYYA 5CU7A 1WB6A 1AVTA 2JKVA 3CR8A 1R0XA 3ESDA 2A35A 4R2MA 1IWOA 3N8DA 2VN8A 4GP6A 3ZZNA 3E22B 4W7SA 5EXXA 1RRKA 1F6WA 4KQXA 4LOLA 5JAMA 5JATA 2ZUDA 2PUVA 3SI7A 4W5JA 3NHLA 1KQNA 3MWFA 2R8EA 2Z56A 4E5UA 3RS7A 4MQBA 3AKDA 3ENZA 4EGFA 2V6FA 3TTUA 1MRZA 3QVOA 1W49A 2ZJBA 1KK2A 4IIUA 1DAPA 1HSOA 2FG7C 4GBJA 4O2BF 1SQGA 3PX7A 3OCWA 1J97A 1GNVA 3QVMA 4L07A 4LX0A 1Q15A 1WSBA 1SG9A 1HBJA 2XH8A 1PVVA 3AWIA 3I01A 3HBNA 4WXRA 3QUBA 4YCNA 2O0HA 4KKXB 1QDUA 3GK3A 4X41A 3WL7A 3TQTA 3ZU6A 2G1AA 4Q1EA 1X38A 3ETDA 5JAUA 3QFSA 3WDKA 3KNZA 1F9EA 2PS9A 1DS6A 4OK5A 4C4TA 3WGMA 1R0LA 4XIYA 1D6JA 4KFRA 1F4VA 1KQ3A 1BKYA 3NU1A 5CURA 3EFHA 1RAGA 4J7XA 1N75A 4FDUA 3TSWA 3OPVA 2CHVA 5KVVA 1R27A 4B7CA 3IPRA 5BUCA 1NUHA 5IJ0B 3GLGE 2ISQA 1PX2A 4YTEA 3L82B 2VHEA 5K0LA 3T52A 4I4LA 4QSHA 3O26A 1NMZA 1Q6ZA 3PGLA 3AJRA 4GU5A 3B5EA 5HTOA 1JPUA 3DBVO 3SJBA 4CL0A 3U3ZA 2IIBA 3AV3A 5BSGA 1HC7A 4QYTA 1X2EA 3L8YA 5ELMA 4MAMA 4QOIA 1U7TA 3DMPA 3UHJA 3BF8A 2C1EA 1OWLA 4GVLA 5JDCC 3WX0A 3AERB 3Q0EA 4N3GA 5ULLA 4AZ3B 2XVZA 1ODIA 2V7EA 3D5TA 3KEMA 1V48A 2ZRAA 3GPCA 3JQ8B 1JQ5A 3NHAA 3SBOA 1XFDA 3BZWA 1W2WB 3ELDA 3EOAI 1DG3A 2PKWA 3OT4A 4OQLA 2EP8A 2HA7A 3FYSA 2DAPA 1FFEA 1I8TA 2D3TA 1CUZA 2GAAA 4GOXA 4ZAYA 4C7VA 1ORRA 1LI7A 2CDRA 1BQ4A 3FCOA 5DNYB 1X1QA 2ZB8A 3O1JC 1DKMA 2P2GA 4MI6A 1AGYA 3ANNA 3OSZA 4HNQA 4HNUA 1JDBC 1VG9B 2ATXA 1NVVQ 1YVUA 2EERA 2VQEB 5EIAA 1DZ3A 2PZBA 4MMZB 4PX5A 5CLIA 1RNLA 2XVXA 1FRQA 3SEZA 5JXWA 5HWSA 1YZNA 1JKMA 2V8OA 3MTGA 2BWJA 3SZLA 1VYVA 3A6HA 4M1OA 4MZDA 1DINA 2I34A 4FBGA 4GR9A 3QBJA 3R7FA 1LV7A 2O1SA 1MTZA 1UP6A 1P5RA 3CE6A 4JUCA 1G20B 3A14A 3KEQA 2RH9B 1F7UA 3CIOA 5AHOA 1LBIA 4NEHB 3D8NA 4ETIA 1XZQA 4BS9A 5K4HA 1D2RA 2CVOA 4EEZA 3QKSB 4U0JA 3M83A 1ZUIA 2Q6TA 3FNEA 3OOJA 4DPKA 4LK3A 3VZCA 2Z1MA 1GPMA 3GRUA 2XBMA 2OGUA 3OQNA 4NMMA 1DG9A 4X9XA 5ADVA 1H9BA 1FPQA 1A9RA 4XIIA 1THMA 3CF2A 2RH8A 3OLVA 4C3ZA 4NCIA 4L22A 2I4MA 1AQIA 3L7MA 3DPSA 3OAAD 3RC1A 5KJCA 1YR7A 1U1FA 1GZHB 1YI8A 4U2DA 5K3OA 3ZX4A 3O7MA 2P4QA 3C74A 4X1KB 3ESQA 3C6KA 2H1WA 1DTEA 5DM4A 3MRVA 1NQOA 3TI9A 4F6RA 2V3WA 5A71A 1W34A 2WLTA 3QXGA 1SKUA 4H17A 3LLSA 1YQ9A 5CEJA 3HB0A 1JJAA 1CNEA 1N0WA 1QQ5A 2CB0A 2WG0A 2JJQA 3FKSA 3FSRA 5EKSA 4DV1B 2BAGA 4B75A 4LZOA 1PW5A 4C0HA 2P40A 1XV5A 3B2NA 4KFTA 2HJVA 4EI7A 1J2UA 2HK6A 2GRUA 2GEKA 4I6JA 3CVYA 1N6KA 1KZYC 4HWOA 4JJIA 3H3JA 4K1XA 2PKYX 2R6JA 3OX1A 2CJWB 2J0UA 2P2NA 2QGZA 4EHAA 3UMJA 3ILHA 3LSTA 4YP6A 5FL7D 4OL9A 1J0XO 2QRVB 4QOEA 4RD1A 3OEWA 1KSFX 4XM1A 3ONEA 1FP4A 3GFOA 1GPKA 4Q18A 2JW5A 3OZCA 3ZU5A 4BQPA 3V2IA 4MOWA 2VZ0A 4C7JA 1B00A 2ZYVX 1OLUA 3QPUA 4ROTA 3OF3A 4REQB 4JB2A 3EXHC 1U8XX 3WQQA 1WXWA 3VH4A 4MVJH 4CI0B 1BS9A 3FZNA 3IIKA 1Y1PA 4IS3A 5TMBA 3H6GA 4EPWA 4KAAA 3ZK9A 4IJ5A 1CRLA 5COQA 1ID8A 1SKBA 4WEQA 5JEDA 2HY7A 4DOMA 1TZBA 1Q1EA 3BMOA 4NAUA 4B7AA 5C80A 1DJQA 4UU0A 4L9WA 3GZNB 2FKNA 1Z35A 2AR0A 4U6NA 3WGTA 4ISCA 3THOA 3P0EA 1YS2X 3OI7A 1EXWA 5THKA 3KELA 3SQNA 4LRSB 4BU1A 4PGMA 3BGOS 5JCZA 5E1OA 3T7DA 2P7HA 2FLVA 3T7EA 1I10A 3UOAB 1WQ4A 2KX7A 4A23A 2HADA 1SHKA 4A5SA 1E3JA 3RUIA 4DIUA 4CLEA 1DFGA 3X1WA 4BDTA 5BNTA 2BHRA 5CB0A 3AUJB 1CZOA 1SB9A 4XQGA 3K70C 4N8EA 1GRVA 3P9XA 1OW3B 2P9FA 3GGGA 3CZAA 1BDMA 1OXTA 1L6RA 5LP6A 4N3CA 5TARA 3GUUA 4JROA 3T15A 2DHCA 1ILEA 2JGRA 1B2LA 1XCJA 2M6RA 2HGZA 2XB8A 2HCTA 3OG9A 3NRCA 3PC8C 1GA6A 1UJMA 2X2OA 4LN1A 2G6BA 1XXHE 3TVTA 4M22A 1P2FA 3NR2A 3ONVA 4OHCA 1NBEA 1L5HA 3GUHA 3WGNA 1XEFA 1FW6A 3AVUA 2R8PA 3ZI7A 4CV2A 1ZPDA 3PB3A 4CTMA 2J3HA 4C76A 1D4FA 1V25A 3HUEA 4K2AA 1WETA 4MI9A 3KT8A 4RL4A 2C59A 1OXUA 4PYJA 5CGZA 4A1FA 3HXOA 1S8NA 4POAA 3OZBA 5TEWA 2P6PA 1LLUA 2A78A 2PYIA 3NS7A 3PFGA 3HXLA 3ZEIA 5FOWA 4I8XA 2Z5GA 2BTQB 3MPOA 2FUG1 3O3OB 1XZ8A 4X1IA 1QHSA 1JWAB 2O3UA 1VG8A 1IPEA 4WUVA 4MP8A 3RNOA 3WO1A 1XMPA 2PUHA 4UNNA 2IYYA 2PFSA 2ONYA 1H0SA 1QYVA 1N3IA 1YOVA 1LH0A 3HPRA 3PUXA 4BAZA 3ODGA 4BX9A 3NC0C 5L3QB 1KJZA 3BGVA 1JBKA 1K6XA 5HQ3A 2CFIA 1ZGJA 4Q9HA 2HQBA 2IUFA 3DAYA 3H1EA 4U2FA 4LFCB 2I2WA 1W7AA 4V39A 1ZK0A 2WE7A 2Q9UA 1ZEMA 3H8WA 5E95A 5KVQA 3G0IA 5K3FA 2PH3A 4URWR 4EO4A 1P3DA 3B13B 2HPZA 1Z34A 1KDYA 2AN4A 3LP5A 4XJVA 1AKRA 3E9QA 2N3ZA 2NACA 5BMOA 2XWBF 2J5BA 3A1TA 3EGDB 3DD1A 4UDOA 4BMPB 1UZNA 1RLMA 1WB4A 5PNTA 2V6GA 3BK1A 4LXYA 3VDRA 2PM8A 3GLSA 3TH5A 2CFSA 4EJMA 4YUZA 4YYZA 5LZ7A 3T06B 4Y2SA 4B6EA 4IWXA 4Y6SA 1UEXC 3B70A 1KMIY 2FWNA 4XE5A 3SHQA 2GRAA 1V4VA 2XE4A 3RAFC 3DDHA 1PTJA 2PX0A 3GRKA 3I9KA 4MVJF 2CLSA 1Y37A 1Z74A 3GIDA 1BEZA 1W0KA 1SO8A 3GNLA 3JQGB 3PWSA 3EQ7A 4IOMA 3X43A 1PR1A 1F14A 2YZ2A 4IDHA 5IVPA 1M2JA 3LKVA 2XECA 3G7SA 1QE3A 4HSEA 2OESA 1SKQA 2ZJOA 1ILWA 2ZRMA 5LD2B 4FCVA 1JIJA 2JLYA 3BB1A 2ZM6B 4CKXA 1YJ8A 4UNPA 2O23A 4FOPA 3C87A 4RPLA 1I4EB 1OLOA 4JVMA 3RW9A 4DGQA 4DSTA 3KPUA 3U16A 2QR3A 4JB8A 3DZGA 4F3YA 4L8FA 4RY9A 3RE1A 2R4QA 2I5PO 4CM3A 1XQ9A 1HYQA 4JJ6A 1E3EA 1GZSA 3M81A 3LDUA 3M5DA 4PTZA 1DBIA 5EIOA 4JYBA 4V1CA 2DWOA 2XT0A 1I2BA 3FYDA 4PVDA 5GQSA 1ZZEA 5TMDA 4QBTA 3VZPA 5F1PA 5LP1A 5JNUA 3VTKA 3HM9A 5F3RA 4BLVA 3ZWXA 2WV7A 3JS5A 1FCJA 4G0OA 4FMPA 4UBNA 2PSDA 3DAFA 3KD2A 3VXKA 4JBGA 5HF8A 1VTKA 2R2GA 3FCEA 4XARA 3SIWA 3VNAA 1ONBA 1CV2A 1Y1RA 2R8OA 2QZ9A 3FTNA 5K4AA 3A6PC 3P32A 1P8JA 3DOEA 3ZV3A 3G8BA 4JYAB 3TLXA 2Y9PB 2ONKA 1RRFA 3BXFA 2F48A 1NQTA 4B0OA 1M1ZA 4DQKA 4X91A 1PO7A 5KWEA 1S01A 5LP6F 3EC2A 1KBOA 4UM9B 3R5TA 4D0SA 3WISA 3NBMA 4TRMA 3D7NA 2XTNA 4RBNA 2BFWA 2BEWB 5GAJA 4YXFA 1JEOA 1XZHA 2Y1DA 3VHQA 3EDMA 3NBKA 4WDQA 3C7CB 2G5CA 5JBNA 2J3DA 3IXMA 1GA4A 4XJSA 1FNSA 2AN3A 3HA5A 1E5XA 1Z0AA 1MRNA 2JARA 1CG6A 3I4CA 4CEIA 2JGDA 3ZDRA 2FQXA 5BWLA 5HVNA 3FYUC 1CQPA 1ZNWA 1GQOA 1YR8A 3HYTA 4H9GA 4RNDB 2RGYA 5HMMA 1GLVA 1AKEA 4BAUA 3TFOA 1UKYA 2HDNB 4X54A 1YU9A 2H07A 2X9NA 3DMHA 1AB6A 2WHXA 2N75A 3AHFA 3PA8A 4PYQA 1KRHA 1PVDA 1Y1KE 3GZNA 4I50A 3KQKA 2PUEA 2DR2A 3DLHA 3Q0IA 2XWJI 2AI2A 3PHIA 4ZTUB 1MTOA 5FBZA 3R0VA 4FYJA 4MQMA 1O9HA 2P9ZA 2F3PA 2OLEA 2VP4A 3A4IA 1UZUA 3EQZA 2VQ6A 1FU4A 3IOMA 2IGBA 3QWBA 2EXXA 4LZNA 4HATA 4JQCA 1R0CA 3TZBA 1Y3CE 2A59A 2IP1A 2EL7A 1U7XA 3DCNA 1NOIA 3EVNA 3TMYA 4JT2A 4NCKA 2CE2X 5LQJA 1YA8A 1I5EA 1IVSA 3BE6A 4DCGA 621PA 1T36A 1KI9A 2BUBA 2WJ3A 3DOHA 1N0IA 4DJTA 3AETB 2FSIA 2YOFA 3H13A 1AS0A 5IF3A 2EG9A 3RBVA 1BX1A 6LDHA 4G5YA 2QSUA 3PDJA 1Y7PA 1SQ0A 3AONB 3AVOA 4NMWA 4CGZA 1V3UA 2X8JA 2XZTA 3N28A 1T8TA 4CUKA 5KPDA 3BGSA 2B20A 2YZMA 4PC2A 2QTTA 1QX3A 2CYCA 3B3GA 4URZR 1JWLA 3I1FA 1G60A 4HQLA 1HFWA 3ZQ6A 2EJVA 4TSRA 3SE0A 2PUAA 3IUEA 2W22A 1U8CB 1XKLA 2GEDA 2J6IA 3K2BA 3OE7A 5IBRA 5BWBA 1UPFA 3OJ0A 5KYGA 4PLZA 2OK8A 4J0CA 1BCRA 1Q0SA 1IOLA 1FDIA 1CNFA 2W2OA 3JSAA 5TJ9A 3WK4A 5IM4F 3CWZA 1EUYA 1UM8A 1U98A 3MJVA 4V3CA 1R6XA 4G4GA 1PDVA 4R0VA 3TLBA 3T38A 3II6X 3GLIB 4EG8A 2DFTA 3CUKA 4XUEA 3RSQA 1TM5E 2DKFA 2C1XA 2UZAA 5AKLA 1KAHA 3BXGA 1FQWA 3LS2A 3O4IA 4KWEA 5FLEX 2HPVA 4B40A 4RV4A 1FNBA 4KBYA 1L5FA 1NYRA 3ANLA 1SD5A 3H3FA 4EATA 3FNGA 1YJCA 4OGGA 1Z38A 3AYXB 4S0XA 2GHQA 2WB2A 3AEUB 4B33A 1Z36A 4QU9A 1O94A 4TVBA 1JDJA 4DIBA 3DAOA 3KSBC 3AJDA 5ICMA 2AFHB 2CFOA 4DUGA 1E5VA 3PHJA 4GO1A 1KEVA 4XB6B 1UAYA 4IV8A 1KPHA 3QEMB 1ZK3A 1EFRA 1NC1A 5DNVA 4Q34A 1FUUA 1P61B 4QOFA 3WGJA 2G9RA 2JJ2D 2PQ0A 2YMLA 1VCOA 1WXEA 1MZPA 4CM5A 2OXEA 1KWKA 3RVOA 1PT8A 3Q7RA 2IF0A 4PG6A 4BP9A 5FUVA 1M2KA 3BF7A 1JGTA 4RZSA 5F5NA 1M7GA 2ASEA 1VLLA 5IKEA 5CG2A 1Q0UA 3EVEA 2WMOB 3CA8A 1TEXA 1NJSA 2JCVA 1RXSA 1ZK4A 3B82A 3H83A 2OTCA 3I1IA 4CEIB 1T1EA 4NYJQ 2D74A 1NQVA 3WSWA 2W2QA 1SUSA 3EYWA 1FUEA 3KLNA 4GC9A 4B8ZA 5IT9A 3THYB 2OO5C 1PW7A 3VI4B 1O95C 2Q99A 1T4CB 1T8SA 2DUWA 4Y6GB 4MVJI 5A62A 2W2PA 3GBPA 4QODA 1KDTA 3N07A 1S2NA 3E9ZA 2IYOA 4QREA 1E0KA 3SSMA 3FDJA 5IKXA 1RZRA 5GV8A 4DLYA 4WI1A 1CP3A 3ZZMA 1WMBA 2FR0A 4IDBA 4MUEA 3UV6A 1LA2A 2XNDA 1X9HA 3HJBA 5CCDA 3U0BA 3UAGA 4PO8A 1WUHS 4XYLA 1S2MA 1J8VA 4Z9FA 3RK0A 1XA0A 3P2EA 3QI2A 1V1MA 3IMEA 4N7MA 4P6VF 1QVAA 2WT8A 5LQUA 1TEHA 1CVRA 1RLTA 1V4NA 2C4NA 4LMPA 4NHOA 3KJFA 1CUEA 3DZIA 4WNIA 5CM2Z 3VTAA 3FOAA 2ODAA 3LPAA 3ZHYA 1G2QA 3D7KA 3VISA 4EAQA 5FOXA 1IL0A 4OHYA 1TYDE 1KGDA 3LTEA 2PKQP 3HBMA 4RKQA 4Z8YA 2DOKA 1BA2A 5DLEA 2D0OB 2HBZA 2IU0A 1NUAA 1YCFA 5BW6B 3DSRA 1S3SA 3L7JA 3HC7A 3EUEA 4TUYA 4NQZA 3RG2A 2VYNA 3I0NA 3SKXA 3CPHA 4KJXA 2I6UA 1V26A 1T8YA 4TZ6A 1J42A 3LYLA 1SIOA 3OP4A 3ZDBA 4FJ1A 4IY1A 2AVNA 3NP7A 4D4GA 1U7HA 3VDQA 2HGSA 3AFGA 3NAGA 3D3QA 5JEEA 2UZ0A 3HKBA 1UPXA 2BCJQ 2IQ5A 2QMQA 3IOCA 2JFHA 2EGUA 4EKDA 5KTOA 1JDBB 3IAEA 3CX7A 4I4TF 4MHSA 3BD9A 2RJ3A 4YJ2B 1NXTA 1EP9A 4ZIRA 2D1RA 3V1UA 1Z2OX 2NXEA 1NMQA 2J45A 2ZEJA 3UM9A 3DDZX 1QRAA 3WA6A 3D6NB 3TO5A 1T9GR 3WYGA 3H1PA 3PUKA 2VNKA 3PUHA 3QLJA 5FWYA 4UD2A 8AT1A 2BHSA 4I4IA 1HDGO 1U2PA 2PV0A 4ZREA 4D9EA 4E12A 4U2GA 1FSFA 1ZCZA 2XXBA 3MLBA 3DBOB 2QU7A 4G5FA 4A91A 4YV2A 5EKXA 4W1PA 3WKBA 4XWYA 3LYUA 2PLFA 1H0KA 3MBKA 1N5IA 1PJ8A 3PQDA 4BBAA 2PSJA 2N1BA 5EMKA 3Q11A 4AZSA 3DYIA 3VNVA 3RUFA 3K73O 3WZLA 2V5UA 1ZBQA 1TKCA 4Y8VA 1E8DA 2DHQA 2D7DA 3WXBA 3E8MA 3WL4A 1Y7TA 4A8JA 1FJXA 4EZEA 1NVVR 3VZDA 2JGNA 2J7PD 2P68A 1V8FA 3EHDA 2ODTX 1C9JA 3PFHA 1O58A 2Y92A 3DWGA 4JNCA 1L1FA 1SHJA 3AFMA 5E8JA 2E5FA 2P5SA 2R11A 4JGGA 3HN6A 2G88A 5EWJB 3EXEB 4X1IB 1A04A 3KLBA 4MVJP 1JZTA 2PWPA 4C1NA 1TQ6A 3RRJA 5L40A 1T0PA 4P4UA 5EWLB 4CKEB 1T3ZA 4A6XA 3N2EA 4EJ6A 1BSVA 4BMZA 3IP9A 3P4UA 1I5OA 1XTKA 2VJOA 4NLLA 5EAIA 3K09C 1ICIA 3VKWA 1T4CA 1ZOLA 3BTUA 3HFRA 2LCQA 3QXSA 4GBED 3PR3A 3Q5EA 3QX7A 4C6TA 3UQZA 3AHEA 4R1PA 4KLRA 2YV5A 3PIRA 1ZHHA 4LDNA 3E1KA 1JQBA 1U80A 3WGYA 2H17A 3DOOA 3HCWA 3QBEA 4WINA 4E7PA 4LVNA 1XNRB 3QM1A 2AG1A 4WKGA 1PFGA 3L0DA 4N6OA 1MO6A 2GBGA 2X8AA 4D9BA 4Q9JA 3MERA 2WIFA 1ZW1A 3L93A 4KE9A 3S1AB 3C41J 1JX6A 3OO1A 3SGLA 1GY8A 4TLLB 5JSFA 2KQUA 3ZWKA 1R0ZA 2OQ2A 1PNQA 1TA9A 1I14A 2G08A 2Z3ZA 4KO3S 5JS8A 2WTAA 2O0JA 2X0JA 3EULA 5IKPA 2BCGY 3QBTA 4EMUA 4HUQA 1ETUA 1L8AA 1FE8A 1QGUA 3EOBI 3UJNA 1UXGA 2BE7A 4M60A 4HAYA 4M1ZA 4OXKA 1TUGA 1WSWA 1C2TA 5K09A 2NUTB 2JCYA 1N34B 5J4HA 1SCIA 1FUIA 3KZKA 4Z9XA 1NXVA 4UZEA 3VR5D 3E0QA 4C4RA 4FE7A 1K9SA 1XO1A 3C3CA 2CNLA 2ZRKA 2WG2A 3PPVA 4G56A 5JISA 2ATEA 3P5BA 3GPBA 3G0BA 4NU5A 5EJ2A 4AQYB 2ODQA 5KIAA 4Y7DA 4UBIA 1PLLA 3LPDA 4JEHA 3DB1A 3REOA 4X84A 2FPIB 4PO1A 7ADHA 1BH2A 4HQFA 4FC7A 5JBQA 4EUEA 2H5JA 5CRIA 3LBAA 1A8UA 2V45A 5FP0A 3IGFA 4PGHA 1N1EA 4EF5A 1MC1A 2PPVA 2VT2A 1O77A 3DAPA 3H2JA 4J76A 4ND5A 3H4TA 4RENA 4NBNA 4KSYA 2CK3A 3FJ1A 4RA9A 2YYZA 5HBGA 1FTWA 1AQLA 3U2QA 4ALNA 3OIDA 1IWPB 2J87A 3IJRA 1HQDA 1X80A 3HEMA 1UBTS 3EDQA 3DL4A 3KBOA 1GPBA 1U8FO 5AJYA 4WK6A 4J16C 6YASA 1SG6A 1JW9B 1NFQA 1NJ5A 4Q3EA 5EOVA 5U1PA 4DIFA 1UPUA 3MWLA 4HCJA 2XEXA 4NCJA 4P81A 1HOXA 1VDMA 2IPMA 4YVFA 4FE4A 4S12A 4HDNA 1M2VB 1TYCA 1WZIA 1LF0A 2L18A 5EZ6B 2O50A 2B36A 3Q3GE 3UWOA 2A0UA 3BGIA 2CY0A 5CYPA 3ORQA 221PA 3UG7A 4MV1A 1VB5A 4DBZA 2HK8A 1PRYA 1YQGA 2GDZA 5CIWA 1HE2A 5BR8B 3FSGD 4QTTB 4IWNA 2QLJA 1IPHA 2FI1A 2XJ9A 5LQSA 3ZE2B 4D97A 3MBIA 4L9AA 4Q05A 1ZH8A 4CIAA 4Q3BA 4B44A 4DPMA 5MFZA 4BQSA 3AHGA 4N40A 5KTPA 1VLQA 3BHIA 3G85A 5JCJA 1VBFA 4W63A 4RH1A 2XMBA 1NLMA 4LYEA 2X3YA 2QTVA 1GYQA 1JJVA 3EA4A 3OOSA 1NR7A 1T3LA 2H5IA 3LCUA 4K7JA 4M86A 2WZDA 3PC7A 1I33A 1SC3A 4L95C 2AMVA 2H7CA 4JITA 3AOEC 3IP5A 4OYHA 2NO7A 1UMBB 3FUUA 4I3FA 1ZBDA 4M6WB 4O4HB 4BVFA 2P6RA 1QR2A 1RWQA 3MQ2A 2Y0PA 3AEQB 4KAXA 5AI6A 5HDBB 2VHYA 4LS3A 4TZTA 3V8BA 1QH1B 2O2YA 4FFNA 3QH4A 1FQOA 1F6DA 4L3OA 1YZQA 4E13A 1N9GA 1NMYA 3NEAA 4GR5A 4OHMA 3T5CA 2XF8A 5B53A 3RHTA 3GYBA 1QIKA 4N65A 2YNMC 4QKQA 5J2UA 1OUMA 4LV6A 2Z6UA 5GJBA 2VDNB 1NURA 4FZRA 2HSZA 3E48A 4HMPA 3W77A 1TA0A 4ITRC 3R7SA 1Z45A 4CIYA 2BFCB 5BYBA 2HHJA 2XSZD 4Z9AA 5G1OA 1NAIA 2DKNA 1GRRA 4J7UA 4XD2A 1NNSA 3HCAA 1SN7A 1M2OA 5DNEA 2ZIZA 3JQ7B 3A37A 4I55A 3UUGA 3KTAB 1KI1A 1XLTC 2NU6A 3RC2A 4BN5A 4TRJA 4BX3A 4HDSB 5AKEA 3FMFA 1TCCA 1EM8B 3FWKA 3AY6A 1KQOA 2BEJA 2CJPA 3ZXYA 4EDFA 3OURA 4DXDA 1RLUA 3R7LA 3GR6A 2UAGA 4I9GA 3G68A 2ES4A 2I2BA 2CDCA 2NV0A 4XWOA 4FK8A 4JCOA 3QLVA 1LS1A 1KDRA 4WXHA 1DKQA 3B60A 4YFVA 4F12A 5JOQA 1T9CA 2Y71A 1RYZA 1C8BA 1RMQA 4Z7OB 4DJFC 3KVRA 1WA5A 3K20A 2ZJ2A 2HSEA 1QO9A 5ICCA 2GCPA 2WDPA 3F5QA 2HW8A 1V7PC 1I4OA 2GWHA 3N70A 4Q9NA 3DQZA 3HLTA 3G2NA 4TPKA 4KXFB 5HS6A 3ROGA 2Z98A 3IQEA 2XYQA 4KXNA 4LQCA 5D1NA 5BN3B 2DUUA 4LSGA 3AO0B 1A88A 4Z51A 5I01A 1N77A 1TT5A 1L7DA 3NATA 3IKJA 1PGQA 1U2EA 2UV8A 3KOXA 1Y6QA 5JZBA 2IEIA 1CF9A 3WWYA 3GLHA 3I9FA 2JFQA 3LY9A 1FYEA 4RJTA 7YASA 4KI0A 1JSCA 3OZWA 3O93A 1WB5A 3RUHA 3SVZA 2P9EA 3MT9A 2GZ2A 3CRQA 3OCVA 3FAZA 1ORIA 2CVQA 4EWLA 3G23A 1SULA 4EMSA 1SBHA 2IBSA 3IIEA 1U0FA 1JYFA 1EFVA 5HPYB 1TMGE 4I36A 5EXEA 3VAYA 1ZD9A 1R0YA 4YQYA 3LA6A 1JR3A 2F6RA 2JC3A 4K81B 3ZWPA 1C4KA 3BH6A 2XADA 3C8HA 1G291 3ICQB 3NYIA 3V55A 5KTRA 2PX2A 3GIWA 4N5IX 3TRFA 4M8NE 3PXEA 2PCLA 2ZTSA 4FE3A 1DV1A 1F4PA 1HUQA 5E9AA 5C1DA 2EWVA 5FYDA 5EMLA 1XD9A 4KOAA 1TK2A 4EG3A 1CUBA 1WSAA 2ROQA 3NI2A 4FFVA 2PMKA 4P4SA 4OTZA 4EGJA 4XYBA 1Q1ZA 2JVJA 4TM7A 3DCJA 1ULSA 3NHUA 2JIBA 3N8GA 4M54A 5FTMA 4B3IA 4B6OA 4OA5A 4ZDKA 1P5FA 1ML3A 3JALA 2VTBB 3CJQA 3OESA 2EBFX 4M38A 4R05A 4KDFA 4LJ9A 4O1IA 4YUYA 4X8HA 3BRCA 2GETA 2IYRA 1XK7A 1Y3IA 3RAGA 3C8ZA 1R16A 1GGVA 1MPTA 1T4DA 3LW7A 4QXRA 3TVYA 2GDJA 3JAKA 3NYWA 3ZCQA 3PXXA 3MTEA 3CX4A 4MV9A 1WIWA 4C43A 4BFCA 1ZUD1 1B1AA 2XRFA 4L85A 3CZ4A 3PXAA 1SHUX 1E3WA 1XEXB 4GUDA 2B21A 4KX5A 2AX3A 4P22A 2GLTA 4DABA 4YV1A 2F9MA 2IE0A 2YZNA 1JQKA 1KC1A 5DO9A 3H42B 5SYAA 5DNCA 4MCHA 5K03A 1U4NA 1S3IA 1E6MA 2A88A 2NYUA 3ZR4B 5HGXA 2O3QA 1A9QA 3H11A 1SXJE 2GARA 2B3DA 3RUEA 2CCJA 1EIWA 1R3UA 1LQUA 1DHTA 4PNZA 3MQ4A 3O74A 1U3FA 3SEQA 3TZHA 4LOHA 3T9FA 1PSDA 2PWZA 3EBPA 3IVXA 4KKVA 4KPGA 4IVNA 4G5GA 4IUYA 1B8OA 4O3FA 5DBEX 5CA0F 4HLNA 3E3NA 3TAUA 2BRUA 4ZJPA 4Z4QA 3LU1A 4M7RA 3V4LA 1K7YA 3W2EA 3IS3A 1PZNA 2VATA 3QPAA 2BFFB 3BXEA 4H31A 5B30A 1E1DA 4FZ5A 5IM4A 3MS7A 1SBIA 1DX9A 1ZCFA 2WFLB 4D99A 1G8FA 1NW7A 2P75A 1SHLA 3D1JA 3PDUA 4ZA2A 4XVUA 4DB4A 2C84A 5CD9A 1N1MA 1FNNA 3R4VA 3GJ7A 1UOPA 3QE2A 4DM7A 4Y6LA 4XR9A 1KFEB 1PP4A 1LDBA 2XCLA 1CUYA 1TTPB 4ZPJA 4Z0HO 3L0IB 3NEYA 4ZVQA 2WQZA 3AIOA 3L49A 1K68A 2OM2A 1J9ZA 1F0PA 3Q7IA 3QHQA 4GI2A 2EQAA 4JT8A 2WILA 3EF3A 2YKGA 2XGMA 4WN3A 1KEEA 2WFMA 2HWYA 3DC7A 3O47A 2O3JA 4C0BA 2H8KA 3VYTB 4WN9B 3IKVA 5ESDA 3UMRA 1BH6A 4BZZA 1UXJA 3MJRA 3QWAA 1M2WA 4KB5A 5F33A 2BN4A 2Z9CA 1WX1A 3VRHA 4EAAA 4OQMA 2HR1A 3D0OA 1LBHA 2FZ5A 2ZRFA 1DRWA 1XHLA 2OAEA 4LY9A 4DAEA 4ERNA 1Q11A 1S96A 2VP3A 2ZUVA 3EF0A 3LH5A 4HP8A 1I7NA 4RIFA 1HZJA 1Q14A 2Y2VA 4IFBA 5K3AA 3W4JA 3NXSA 1Q7EA 2C03A 1YMUA 2F59A 1NW6A 2QD5A 2ZJ5A 2CL7X 1DXQA 1BW9B 4M6WA 4TSFA 4WZZA 1GSOA 4X85A 1JECA 2AEJA 4QGGA 5CIYA 3RGGA 3BJEA 3KX2A 5DGDA 2HMSA 1JTEA 5AM1A 3V00A 4DS3A 5C3UA 2LNDA 4D82A 1D1QA 3DKIA 4OGFA 2J0UB 4RK5A 2AZMA 2RB5A 3SMQA 5K6TA 3W6NA 2FW6A 1QAQA 2WYVA 1LUAA 5E6SA 4AIRA 5KMGB 2SICE 3WKAA 1N5MA 3TX6A 2UXBB 3LKBA 2QOEA 3RYHA 3WL3A 2Y6UA 5HM6A 5LQMA 4HX5A 4MQEA 2J0SA 1FSGA 4PX9A 3Q40A 3ZUGA 3N0TA 1HNXB 3P9ZA 2GX6A 1FX0B 4KIWA 1CSEE 2NG1A 4EVSA 5F2NA 4JUAA 3CUEF 4XOUA 4QEKA 2SCUB 3IR5A 3ZHBA 5DCYA 4D98A 2V03A 4G0XA 3VR6H 2PKQO 3C97A 4E4RA 1J0EA 1Z7GA 2HIAA 4COKA 3L6DA 2BKXA 1RXWA 1OHHD 2NZWA 4QFCA 1KOLA 1Y33E 2H4XA 5KNBH 1GTZA 2PBFA 3V8NA 3AFIA 3OFKA 3RWOA 2H6EA 4QAJA 4KIFA 1UC9A 3O8DA 1Z7YA 4P86A 4PG7A 5TS3A 1B26A 3TIFA 4DA0A 2IYQA 4F4UA 3AVPA 3ENNA 1PJ3A 2VSOA 5AI9A 3HWX1 4EARA 3KSZO 2GAIA 3FW1A 2EHJA 1JILA 3PLNA 2RAFA 1TQ2A 3KRTA 3BMQA 1XGKA 4UE3S 4KQ9A 1SVKA 4FD3A 1ECGA 1F48A 1N1DA 2IHJA 3N3BC 2VK4A 1I1NA 4NABA 1Q2UA 2PGIA 3DZFA 2VRCD 4PHFA 2YWEA 3JQ9A 2C9YA 4B3TB 3H9JA 5ALQA 3NNSA 2O4UX 1JMVA 5F52A 1J5PA 3ROTA 4Z99A 1Q84A 4L4ZA 2OE2A 1YQWA 4PR3A 1XL0A 5CDUA 3ZD6A 3HKDB 3MOGA 5T64A 1YDMA 2WV9A 4JR2A 4V2UA 5BSVA 4BNKA 4YRKA 4JU8A 521PA 2G5GX 3NFRA 3ZK7A 1GNTA 3GAFA 3ZWCA 1ZU5A 3UF0A 4E07A 3DKPA 1CEYA 3AY7A 1AHPA 2D4HA 4BNJA 4IH9A 3Q6NA 3SLRA 3ETJA 5DYGA 1VL1A 4XDYA 3RBZA 4AJEA 1UBMS 1PJRA 4PBTA 5LQDA 1XWIA 4OQNA 6REQB 1KJJA 1SUEA 3OFND 2QD3A 1QZZA 3D6JA 4QGSA 1ODCA 3M9WA 5DM0A 4PO3X 1QSGA 4RZXA 4DNOA 1EBUA 2CDBA 2DQ4A 1G21A 3DFZA 4FEGA 4I1OA 3RFTA 4BVJA 1LSOA 2DPGA 4I6GA 4AJLA 2GVDC 4UULA 3PC2A 4GUAA 1PZMA 3DZBA 1SBTA 2ZQZA 1PU2A 3IHTA 1XZNA 1YB7A 4W82A 3SS9X 5B6PA 3U3MA 2QPTA 4Y1FA 5AJHA 4IR7A 1M5TA 1Z83A 3D0KA 4PLFA 3FWYA 5FPSA 2P27A 3CISA 5M2QA 2QI9C 3TR5A 3EIHA 1YKGA 3VJMA 1YIAA 4ZAVA 2FDXA 4LF5B 1OVMA 3L4EA 5AJUA 2VP0A 5BRNA 3QLUA 2BM0A 3N0WA 4EG0A 3IB3A 1ST3A 3I1JA 1T0IA 1K7XB 2CN1A 3MQFA 1L8OA 4LWZA 2WFAA 3F5MA 4GOJA 5HIMA 3IAHA 3JU3A 2AFIE 3OPMA 2IV3A 3AL0C 2HQSA 1IATA 4HTAA 4HAXA 4HTFA 3T99A 3WFJA 2LIVA 2YNMA 3UPTA 3OU6A 1L7NA 2ET6A 3BXHA 3UHOA 3U7JA 4R1TA 2UYOA 4ALIA 1MJFA 2O8VA 2R47A 4TV8B 1VSTA 2JFVA 5JNTA 5JXIA 1YCHA 2BF4A 4TVKA 4B2PA 3KTAA 4LZZA 2P3LA 1TYAE 2QLBA 4G5SA 4ISBA 1NW3A 3GMDA 1RQLA 1NKTA 5BN1A 1J25A 1ZRNA 2JDIA 3AUKA 3I42A 3M1IA 2Q3DA 3EIWA 3EXHA 2FWMX 1A9XA 2RGUA 3BGDA 1KFKB 2JZCA 1IC6A 3R7NA 5HRCA 1WY5A 2WFZA 1KP9A 4GOND 1X6VA 3SHFA 4E32A 2H0RA 5FUWA 2H16A 1VL2A 2Q6OA 4H4EA 3UTCA 5KQLA 3CY6A 1CULC 2AZTA 1SK9A 2BM8A 1P4RA 2VDMB 4L57A 1I3MA 1IN7A 1E1RA 2FGJA 5C4MA 3KB2A 3PX2A 2YBDA 1EJBA 5FBRB 4B3CA 1GU7A 4HXEB 1NG9A 3FRJA 1WCXA 3UC5A 3TNLA 3WQRA 1JJFA 4MMYB 1YB5A 4DBLC 1Z08A 5A3JA 4DW8A 2CDAA 3C8MA 4BNZA 3N2YA 2B4KA 3ZDAA 1BDIA 1K06A 2DUJA 3QJGA 4OXNA 3S3TA 3V8EA 1D2MA 1KHHA 1KO7A 3L4BC 4ZT7A 3V32A 3D6AA 1OBCA 4M49A 4KR7A 4WJKB 4RDHA 3U37A 4H1VA 3D3JA 2Z8ZA 2X13A 1G8HA 3LZCA 1E4OA 1HQYE 1T0BA 2ZSDA 4QJBA 4TKZA 5TVGA 2JLRA 3QU9A 5EJ6A 4D6XA 2WNIA 4LQLA 3PQ4A 1KAQA 2NYAA 3B36A 1T2CA 3A1SA 2I3GA 4WH0A 5TMEA 4JLJA 1NYQA 1UBJS 3GLGA 4MA5A 1HT2E 4R8SA 3ADKA 4YACA 1Z8DA 5IJ9A 1SUAA 2C1ZA 3P7MA 3QFTA 3CW2A 4C14A