2WJHA

Structure and function of the feob g-domain from methanococcus jannaschii
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
166
Chain Sequence
MKSYEIALIGNPNVGKSTIFNALTGENVYIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSLTANSIDEIIARDYIINEKPDLVVNIVDATALERNLYLTLQLMEMGANLLLALNKMDLAKSLGIEIDVDKLEKILGVKVVPLSAAKKMGIEELKKAISIAVKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
publication title Structure and Function of the Feob G-Domain from Methanococcus Jannaschii
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal transport
total genus 49
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wjhA00
2GRJA 1CULC 5DN6A 3PQCA 4DJTA 1G6HA 3LW7A 2IYWA 4HSEA 5JRZA 2UVQA 2ZYUX 5FI1B 2RHMA 2HF9A 1GVNB 2AX4A 4Q4AB 3ZGXA 2IYXA 2EFEB 1OT3A 4KLNA 3PEYA 3GLHE 3BAFA 3HR8A 4MGIR 1IAQA 3N5CA 2ZI4A 1YZQA 1YZTA 4G5OA 2VHCA 5CDFA 4F4JA 1BO6A 2F9LA 1T3HA 2QORA 2X1VA 5K8UA 5HE9A 3ETLA 3UIEA 4A6PA 3SBDA 1XXHB 2V7QD 3I4LA 3KQLA 5IK2A 4HAYA 1AKYA 3EZ6A 2NO7A 1FFHA 4RZ3A 1AQUA 4EDHA 5IF9A 2XITA 5J5CA 2F6RA 2VP4A 1IJFA 1LF0A 1N6KA 2VTKA 4LYAA 3WMGA 4EFLA 1TMKA 4URYR 3SYNA 2V7QA 4RCYA 4D82A 5BXQC 1P9NA 4JZKA 1NI3A 721PA 2ODNA 4N0EA 4NBSA 5D3MB 4HDOB 2H92A 1XTKA 5HKKA 3MUFA 2AD5A 2J41A 4HZUA 3E2IA 1MV5A 2D4HA 1C1YA 2DFNA 3MJRA 2KWIA 2OHFA 4V0OA 4HB3A 4DCVA 5IT5A 1XPRA 3FHTA 1UPTA 4A36A 3MD0A 5J4KA 1ZNYA 4URUR 2PJZA 4ARZB 3B8HA 4F92B 1N0WA 2VSFA 2PZEA 5KU1A 3UXMA 2VHJA 4XTRA 2D62A 3ECCA 1N2CE 3L0PA 3PEVA 1W5SA 1IQPA 1GKUB 2B8WA 4LYHA 3ZJYA 1G17A 2EYQA 3GQBA 4NYIR 3S1AA 3QVUA 5KOYA 4DLVA 1S9HA 3VTKA 5TDHA 3W8RA 3QKRA 3WHKA 1QHHA 3DPUA 3CPJB 5BYJA 2A5GA 3CRMA 2QM8A 3NEYA 1LNZA 1FL9A 1U98A 3LQQA 4IDNA 3EPHA 1EK0A 1KMQA 4RVCA 3QPVA 3P32A 4ZPXA 4ZO4A 1IBRA 3HYRA 2BEJA 2PEYA 3EIHA 4Q21A 1TEXA 3THXB 1OFIA 4KVAA 4ZKDA 4JYCA 1CP2A 2AD1A 1SXJE 2QSZA 2VP2A 1DAIA 1W48A 3CWQA 4MKGA 1Z08A 5DI9A 3SJZA 4OI2A 4CW7A 2FGKA 3JVUA 1AGRA 1E3MA 5KPDA 4G5SA 1GKIA 2X77A 5JI3E 1NMXA 3GLFB 2ZM5A 4E5UA 3LXRA 5TVKA 5J47A 4LV5B 2DCUA 2FFHA 3CF2A 1KDTA 5L3QA 3PUYA 2R9VA 4C0QC 5EE1A 2A9KA 4FIDA 5EE0A 1NG1A 2JASA 4E07A 2WSSA 2X19A 2BBWA 1DADA 2GILA 1EFTA 1D2MA 1E96A 1EXMA 5CIQA 4G3XA 4OHZA 4RD6A 4UNPA 5JJIA 1SGWA 3WP0A 3Q3JB 4US2R 2O0KA 5UKDA 1G3RA 1VG9B 4OI1A 1L4YA 2VEDA 3RVBA 1TPZA 3DZ8A 1XEXA 2OO7A 1ESMA 1FUKA 1U94A 4B75A 4NONA 2W00A 1GSIA 4XIGS 3FDIA 2JGNA 3IQXA 3CRQA 3MSXA 2WJIA 1NLZA 2ZRFA 3GJ6A 1SHKA 4RFSA 4OBEA 5FUVA 3FHCB 2QUZA 4H1UA 3ZVRA 2WWIA 1DAKA 1ELOA 2YOGA 3KKMA 4IDOA 4Q1CA 3RSLA 4KAXA 3X2SA 2O8BB 1AQYA 1AS0A 1DG1G 3EA0A 1JEEA 1Q44A 4KSBA 5JFGA 1BYIA 2ZJBA 3AKYA 4DLRA 1G7CA 4NDZA 1CLUA 3QENA 1N3BA 1R5BA 4AI6A 3SJCA 3AF0A 3B5JA 2BMJA 1OKKD 1NBME 4DUGD 4CEJA 2J46A 3TR5A 3QOFA 1E2LA 1AN0A 1NLYA 4NKRA 2JJ8A 1OKKA 2FDCA 4NCIA 3BB3A 1P2VA 3NEJA 4QL3A 1T8TA 3GLGB 3QXHA 4F91B 1GNQA 3I73A 2IYLD 1P2SA 1L7VC 1UEJA 1O87A 4FD2A 3CPEA 1OH7A 3TGPA 3TAUA 3VHXA 3FOZA 2PCJA 1MRNA 1KOFA 4LZZA 2QGNA 1OXXK 3N70A 1WB9A 1N0VC 4G5RA 1XD2A 3KXIA 2W6IA 3QEJA 4HB0A 3NDBB 2BC9A 2VP0A 1TUIA 3BERA 2IYQA 1KIMA 1EFRA 3K70B 1KI1A 3Q7PA 2O8EB 1YR8A 2I1VB 1GTVA 4IDPA 3VR5A 4HLCA 2VF8A 1H8EA 2AXNA 1Z8FA 2OT3B 4QNRA 1Q12A 5DH9A 4YMTA 1SKYB 2WJGA 2WWHA 3RRZA 2VLIA 4NU0A 4EIWA 3LDAA 2QP4A 1P72A 1QDEA 1P62B 1U8ZA 2NO9A 4QBHA 3U3OA 3ICEA 4GPTA 1IXZA 1TAGA 2WKPA 2ZJ2A 3E1SA 4QGAA 3KTAA 3EG5A 3AVTA 3LO5A 1OIVA 1IXRC 5KDOA 3QE0A 1Y3AA 4M0LA 4A0RA 2D06A 1N6IA 2DFTA 3EZFA 4PSKA 3AVXA 2OCPA 1HTWA 5CLQA 5G3YA 4NE2A 3SNHA 1L2TA 3AVVA 3P1JA 4B3FX 1PUJA 3R9XA 1W46A 3I8SA 3Q5EA 1II0A 4XWKA 1A7JA 4PANA 5FUWA 4DSOA 3LA6A 2QMOA 4MYUA 4ERNA 1CIPA 1QRAA 2PZGA 3SFZA 2GAOA 4Q03A 2C2HA 3RC8A 4MKFA 4MQBA 1RPZA 1E9SA 3K0CA 1DEKA 3IILA 2VA8A 1XEWX 2OM2A 5FBRB 3U44A 2VIIA 4OQFA 521PA 5KUTA 4MRVA 2KJQA 5E7IA 3WYGA 2ZRNA 2ZSAA 3BH0A 1VG0B 2RGXA 2ORWA 3PUZA 3RRYA 1N6PA 2ZR9A 5L3QB 2PZFA 5L3RA 1BMFD 1WQ1R 1FX0A 4L15A 2IUTA 3LH5A 3RS5A 1BMFA 2FH5B 3VR6A 5CIWA 1J2JA 1UBFA 4Q7LA 4QGFA 3R8FA 2G6BA 3NG1A 3I32A 4C7OA 3GJ4A 4PZYA 4D26A 4HUTA 4Q4HA 3CF0A 2V54A 1XEXB 5G41A 5ELXA 3TR0A 2MSEB 2CLSA 3P26A 3FFAA 3MLEA 3O47A 3QBVA 3PEWA 4BWYA 2BIFA 3I92A 2RGDA 4IOJA 3B2EA 1JI0A 2EFHB 2ZJ8A 2WKRA 4RFSB 3OFND 1G8HA 3SEAA 2JJ2D 2F1HA 3FWYA 3QEOA 2IYYA 2IUSA 4WZAE 4DHEA 4Q9HA 2AWNA 3VKGA 2ZAOA 1ZUIA 1Q57A 2WZQA 1SXJC 4LK2A 1M74A 1DO2A 4MA4A 5AJVB 2OBNA 2CNWA 5F3WB 4JJZA 1OXSC 4K46A 4MITA 3WNCA 1RRCA 4JBWA 1XB2A 1XBTA 1KJZA 2EWWA 3VR2A 2H17A 5DIFA 4EPRA 5CK5A 3KZ1E 4DLTA 3UG6A 3UWOA 4O0MA 2OBMA 4A8JC 4E09A 1TQ4A 2FZ4A 4GI7A 3TK1A 2IS1A 4TMKA 2DPXA 3HWSA 2GJ9A 2LCFA 2QY9A 2YC2C 1KAOA 1II9A 3L2OB 2O8FB 2GK7A 1ONBA 1E0JA 1Q0UA 4B73A 1EGAA 1GITA 4TMXA 2B21A 5M04A 1XMIA 3AP1A 4OHWA 1ESNA 3W90A 1YZGA 4Q00A 1N6RA 2FFQA 2G1KA 2FFBA 1RZ3A 2IXEA 4LHVA 4B3XA 3CM0A 4BGDA 1F2TA 1U81A 1JBKA 3QKSA 5JHGB 1W4AA 5JMTA 5H8WA 1JAIA 1J8MF 4MYTA 4V0NA 1OHHD 4PTLA 3U2QA 4TYNA 3GLIE 3NBFA 4AKHA 4MDFA 3I61A 1FNNA 1NMYA 1XZPA 4TLDA 2XXAB 4GOJA 4Q19A 4CGZA 1OHHA 2B6HA 2XB2A 3B6EA 4LHXA 3IQWA 4UNRA 3VNUA 2WKQA 5A5GA 1RRGA 2NOAA 3OIYA 4LHZA 3ASZA 3GJ0A 1TTTA 4DB2A 3K0AB 2GXQA 3TQCA 3REFA 3C14C 1KI8A 3RWMB 3U5ZB 2AK3A 4MGYR 5L3SB 3B60A 4QJ5A 2W6JD 4C4PA 3W3ZB 3QY0A 3VAAA 3OHMA 1OE0A 5JCZA 1JEDA 1LY1A 5KNBA 1A1VA 4GL2A 4OHVA 1MRSA 2Y8EA 2ZE6A 1D8TA 4JSYA 1GG2A 3GJ3A 1M34E 4JKYA 2D7DA 4HEJA 4MKIA 3D7MA 2XZLA 5DO9A 3OIWA 3LBIA 3B1ZA 4US1R 5FOTA 4BUJA 4EPVA 3NWJA 1YR9A 1R0WA 1RYHA 4CIDA 4DT1B 2GWHA 3NVAA 5LD2B 1E2JA 4B3GA 3W6OA 5DLQC 3SE0A 3LX5A 2O5VA 4KJZA 1M7HA 1FOEB 2ZROA 2J1LA 1AZTA 1E2DA 2V6JA 2QAGA 3C41J 2IYTA 2YVUA 4NYMQ 5DHAA 2BBSA 2A5DA 3WYAA 4BLOA 1HUQA 4JLBA 3H0KA 3CX6A 2FPLA 3ZVMA 4G1UC 2G1JA 1NJGA 2LKCA 3KJGA 4AC9A 2GVDC 3DM5A 1T5IA 1G5RA 1VMAA 4P4TA 4LPSA 4YMVA 1KZ7B 2J0UA 3EWSA 2QI9C 4M9XA 4BRUA 4HAZA 5FOVA 1SXJD 2IA5A 2W2VA 4JVMA 1Q1ZA 4EPXA 4LUCA 4YDHB 4LJYA 1X8JA 1MO4A 4WIAA 1SXJA 3KB2A 5BN3A 2XEXA 4TQ9A 4TTRA 2GF9A 1W36C 1PVOA 1RW4A 4WXPA 2H8KA 1ZC3A 1G41A 3OEHA 3H86A 1GM5A 2BWJA 1C9KA 4UNSA 3IEVA 4HLQB 2D7CA 3WBKA 3GMTA 1E0AA 3BFXA 5LB2A 4A8JA 4EJSC 3TSZA 2WWWA 3LLUA 5JHHB 1EWRA 1NIJA 4M1SA 2RGAA 4BFXA 1XPUA 4HDQB 1VYVA 3KQKA 4D25A 2QT0A 4JL5A 4QM6A 1OYWA 2OESA 2IWHA 4AK9A 3CBQA 3RANA 1NNEA 3VR4A 1FNMA 4UNQA 3TE6A 4YQFA 1Z0DA 1XFAA 221PA 2W0SA 1IN7A 2ZRGA 3WP1B 2FG5A 2VSXA 4ILEA 4LJ6A 3KJIA 4N0DA 2WWYA 2O8DA 3RHFA 3U61B 5K8LA 4C0AC 1OW3B 1BOFA 3MG9A 4IDHA 2G9NA 3DKPA 4ITRC 5DISB 3RS4A 3L82B 1GWNA 3FFBA 4LWZA 4HUQA 2FA9A 3IKJA 2V8OA 1G3UA 1OFTA 3AF3A 4B76A 4Z8XA 1ZBDA 4MRPA 3TUIC 2BM0A 1E2GA 1JXOA 4RD1A 3L8ZA 1WCV1 4UXJA 3VKWA 4JLMA 1YZKA 3TW4A 1NBMD 5B30A 2ZRLA 4A0HA 3KKOA 1WDTA 4K81B 3NHBA 4YXWA 2QN6A 1CR2A 3SQXA 1IN6A 1GNPA 5DI3A 1NBMA 5C46F 1F2TB 4FMBB 3QKSB 2O8CA 1XP8A 4GZLA 1OXTA 1YRBA 2BJVA 2HXSA 4ZI3A 3AGQA 4AKIA 2FF7A 2V1XA 3CLVA 4MYCA 5L3VA 5DYGA 3R7WA 4IW3B 1K5GA 2QMHA 1XJQA 2XNSA 1GP2A 1RRFA 3IBGA 2E87A 4JL6A 3OE7D 1MR3F 1LV7A 1FP6A 2N42A 2WAXA 4LYJA 4Q7MB 4Q9IA 1ZJ6A 4OQMA 5C4MA 3DL0A 3EZ9A 3CZPA 5FPHA 1SHZA 3OE7A 2ASEA 2B7BA 4MKHA 1E4YA 1NL3A 4KCGA 1T0HB 1GRRA 2C9OA 3HP1A 4MUBA 4W5JA 2HYDA 1AIPA 4HZIA 3BRWD 3T5GA 2IBMA 3RS0A 1CRPA 4RY2A 2ONJA 3SI7A 1N6LA 3DKVA 3FGNA 3U7GA 3T06B 4ZIRB 1Y63A 1W1WA 1Z6AA 4Z51A 3A1UA 2J5XA 2QQ0A 4LY6A 5EP2A 2J0SA 1W36D 2QL6A 1IN8A 4RFVA 1ZM9A 1RJ9B 4HB4A 2Q9AA 2JLWA 4DDWA 5C2JB 1XMSA 2JLSA 2GZDA 1QHIA 4GOKA 1B23P 3DMDA 1SVWA 1ZINA 4EPYA 5FOUA 3CH5A 2IL1A 1VECA 4IDQA 2NO1A 4ZV4A 2QAGB 5JI2E 2Q3MA 3L8YA 1KO4A 1ZCBA 3P27A 2CE2X 3R9WA 3B9QA 1GDDA 3Q8XB 4PHFA 5EJEA 1CKEA 1KI6A 1NVXQ 4P3YA 1CEEA 3EZ2A 2JIZD 2WWXA 1ZRHA 3NBZC 5FTNA 4F38A 1P7CA 4BZXA 1MOZA 4BLTA 2PMKA 2JIZA 1U90A 1DBSA 4NYJQ 3UMFA 1F2UA 1S0UA 2JLXA 4V02A 1D5CA 2ODEA 2W0MA 1US8B 1VG8A 3IUYA 3C15C 3Q72A 1NVWQ 3QIAA 1OLOA 2C98A 2HT1A 3KDSE 2BMDA 4FW9A 3PJRA 1RRPA 4LOAA 4FCTA 2HCJB 2IYUA 2ATXA 1VYUA 1ZNXA 1VIYA 1Q1QA 2ERXA 2QPTA 2UKDA 1NF3A 2GESA 2W2XA 2GBLC 1OIXA 3H2YA 4AD8A 4LCBA 1E9FA 1G19A 2GZAA 4URVR 1FTNA 3TSWA 3AF2A 2LWIA 3BC1A 1WE2A 3EXAA 2VH5R 2ZS7A 2ZYVX 2ZUCA 3PUVA 1E0KA 4XD7D 4DSTA 3HDTA 5EE9A 2ZANA 4TL7A 4GSYA 4Q7JB 1PLKA 3WNDA 1R0XA 4XD7A 4GZMA 2ZE8A 3X1XA 1Z47A 1Z63A 1UKYA 1KK2A 1VCOA 5J4LA 4PC6A 1HE8B 2PT7A 3NC1C 1GRNA 3AGPA 4Q4LA 1KKLA 3D6TB 2J45A 4HUQB 5HZKA 4XH9B 2F1IA 3PCRB 3QXXA 4D4MA 3B78A 3Q7QA 3CPHA 3U4QB 5FPYA 3VKHA 4F93B 3QBTA 2XSZD 3U3MA 4HI0E 2PEZA 1DAHA 1HYQA 1O3YA 3K0FA 2Q9CA 3K1JA 3PXGA 4N1AA 5DGXA 4OK3A 1ZYUA 2XSZA 3BH7A 4D6PA 1JPJA 1Z2CA 3NIBA 4Q1BA 3UKDA 5B57C 2ODBA 2CL7X 2UZIR 4G5GA 1N6OA 4QBFA 4CEHB 2WHXA 1JB1A 2VQSA 4QC2A 3AV0B 1G5PA 1W47A 3R7WB 3ZS8A 3SZRA 1OSNA 2GVZC 1Q22A 3SC3A 2QTVB 4K8OA 2ZI6A 2IT1A 2GJSA 4OJQA 4PXAA 4TL6A 3PV0A 3PIRA 4FCVA 1TL7C 3SS8A 5A4JA 1VPLA 1SVLA 4D2IA 4QNMA 3UWKA 2PLFA 1N5JA 2VHTA 4Z8YA 2O0HA 3DOEA 3NBYC 4OQXA 5KSOA 4A0FA 4IXMA 2GXSA 1ODFA 3A1SA 3Q9LA 2OFXA 4W9MC 2F43A 3GLIA 5J4VA 2BBOA 2VP5A 4Q4JB 4RZXA 1A5TA 5EP3A 5H1YA 3CONA 5AJWA 2J9RA 3Q5DA 2J59A 5SZIA 5JZVA 2OBLA 4G0NA 4OK5A 4QBGB 3OESA 1LB1B 3QXCA 2RGNA 2ZRKA 4TSFD 5JSZA 3TH5A 4JMPA 4KVGA 2RHDA 4A2PA 1A82A 3FPAA 4C0SA 4DWJA 5TXGA 1W2HA 1HQYE 3WNBA 5BWMA 1DPFA 4DCUA 4FMDB 5CJ2A 1XRJA 3TJZA 1J90A 4TSFA 3PG5A 4A9AA 2R8RA 1SULA 1UADA 1GUAA 4IFEA 4JVSB 1UBEA 2FJUA 1IM2A 4L9SA 2OFOA 3SOPA 4IOKA 4QKQA 4ZI2A 3CR7A 2GBLA 4JLNA 4DIDA 2Z0MA 3GJ7A 5LBIA 1KI6B 2XAUA 2IF0A 3LD9A 4LJ9A 1KY2A 2WIAA 1KO5A 2OSBA 3BD9A 3PR1A 3SU8A 5B2ZA 3AF4A 3N2EA 3ND8A 1F2UB 2QU8A 2WVJA 4FCWA 1CJKC 2ZI5A 4JYBA 4WZBE 2WTUA 1ZUHA 1LS1A 1PJRA 1RVDA 4S2EA 4CEIA 1T6NA 1EFUA 5TY0A 2YZ2A 3QPUA 4R7ZA 4A4DA 5IRCD 3CO5A 4GBMA 5LD2C 4B2LA 3CRW1 2CEAA 4RD3A 2DWQA 5JWHA 2C03A 1OH5A 4ABYA 4FXPA 2OFWA 4HAWA 4E03A 3KB1A 3LQRA 3G0HA 3RWOA 1XXHE 2G83A 2GEUA 4IOLA 3QSYA 4TYWA 3WHLA 3O8BA 2D2FA 3ZQ6A 2JDID 5JEEA 5KSYA 3H1TA 2JJ1D 2NO6A 2ZR0A 3V4FA 3SDZA 3LAWA 2JDIA 1PZNA 2GETA 1P6XA 2QGZA 2AKYA 2JJ1A 3L0OA 4GDFA 2AKAB 5AUNB 1UKVY 2XGJA 4DCNA 2PBRA 4DUGA 2CVFA 1E1RD 2GJKA 2MSCB 3P4XA 5JECA 4BEBA 4MGZR 2OZEA 1II8A 1GZSA 2C99A 1AA9A 4F7WA 4MDEA 5KDLA 121PA 1XD8A 3PUXA 4KU4A 3W5IA 4IFBA 4I1OA 1E1RA 1XEWY 1Q3HA 1TADA 3AUYA 3HPRA 3SJAA 4QM7A 3VNVA 5AWFC 3BK7A 4D4KA 2BKEA 2Q9BA 3CZQA 3ADCA 1JJVA 2GCOA 3A36A 4HZUB 5FBWB 5J40A 2OLKA 4V0LA 1KAGA 1UEIA 1CTQA 2ZYWX 5FBQB 2DFKB 2WJVA 1T9HA 3SQWA 1TF7A 5B58C 3AB3A 2Q3HA 3TSOA 4YDSA 1HT1E 3GEHA 1KSGA 3O8CA 4PR0A 3AVPA 4EFMA 2DYKA 1C4OA 1QZXA 1J8YF 1H8HD 1U0JA 2EFGA 2REBA 2RGEA 2C9CA 1HQCA 1KI3A 3I1FA 2HJGA 4H1VA 1KJWA 3BFKA 2QROA 1JPNA 1RKBA 3M4YA 4I1SA 4LJ4A 1H8HA 2J7KA 3GFOA 3DM9B 4OYHA 4FWTA 2QSYA 4Q66C 4RJLA 5FBLB 1S8FA 1AK2A 1R7RA 1Z0JA 2OG2A 2ZRPA 4MUAA 4TMTA 4D4LA 4TYYA 4CT4B 1E2EA 4XWOA 1FW6A 2ODWA 2Q3FA 3GJXC 3S1AB 2YINC 1S9DA 2AFHE 4HLDA 5CM9C 4B3DA 3QKRB 2GF0A 1CR4A 1W4RA 1QHHB 3C7KA 4MGKR 2I1QA 3PEUA 5CYOA 5ANRB 3KQHA 2OCBA 4Q1FA 3AVYA 2QENA 2NTYC 1MABA 3U3RA 3U6BA 3MWKA 4LSGA 4HB2A 1W0JD 1XMVA 2AN9A 1KNXA 4PC2A 4TTQA 1P4SA 3F8TA 1XTIA 3GLFE 1S1CA 1G20E 4TQUS 1QVRA 3RRNA 3F0TA 5EXXA 1W0JA 4BFWA 3B1YA 3P4YA 2HF8A 3CRRA 5IDVA 3CF6R 3NDPA 4XOIA 3GEIA 2C9YA 1NRJB 2GHIA 3KFXA 1P9WA 2PJRA 5FI0B 2CL0X 2QTFA 4H9GA 4B3BA 1EX7A 3LFUA 1G8YA 1CJUC 2OCAA 4JVLA 3UK6A 1XX6A 3JVVA 1RYFA 2OAQ1 4LGMA 5FL3A 4BLQA 2ZUBA 3KKQA 2GTPA 4UJ3A 3NTUA 2P67A 3WBJA 1G6OA 1NP6A 1JNYA 4NCKA 1TQ6A 1BIFA 1Z06A 5EQTA 5JRJA 2R6CA 3OIVA 1UBCA 1GL9B 4R9UC 1ZM2A 3J81k 2XTNA 1ZD8A 2NZJA 4NP6A 5CB8A 5CITA 3ADKA 1E0SA 1CJTC 4A15A 2IYVA 1KNQA 3DVLA 3I5XA 1M7BA 3KJEA 2FPMA 4LHWA 4YMUA 2GKSA 3HPQA 3IGFA 3K0EA 5D3QA 4XSHA 3KKPA 2P3SA 2CDNA 5FPTA 1UKZA 1LVGA 1IOZA 2BMFA 4OI0A 3NKVA 5F2EA 2R65A 1LTQA 1GILA 1T8UA 4WA7A 4RSGA 2CXXA 3RS2A 1NSTA 2LKDA 4UJ5A 1J7KA 2ZEJA 3VR3A 2FPKA 2H5EA 3QPWA 1FPMA 2IS6A 5K8IA 5CYPA 2JLYA 2CL6X 3R20A 1N6NA 2IEYA 2RGGA 3A4NA 4B2IA 4PC7A 2XB4A 5F98A 3K9HA 2QRNA 3RRMA 2KBEA 2Z5FA 4M1MA 3OFNA 4HAUA 2JJ2A 3EC1A 4M1YA 3GLGE 5HPYB 1MO5A 2IW3A 2W2TA 1MO6A 2IF2A 1VKJA 4TL9A 4URWR 1UAAA 2QG6A 3EPJA 2F55A 4HLUC 4DLWA 5KSZA 1GNRA 4CEJB 1U0LA 3UANA 2O52A 3THWA 2G0NA 1EX6A 2ZTSA 1QG4A 2FN4A 3LBHA 4WVFA 1G1MA 4RD4A 4CVNA 1VCNA 5JBQA 2YKGA 4ZDWA 3VR1A 2JA1A 1GAJA 4AKEA 1NN1A 4TQAA 4IVRA 2ZS8A 2A7QA 3GEEA 2C04A 2EVWX 1Z22A 3GLHA 3AUXA 1UFQA 1IN4A 2FMXA 2XX3A 2OEPA 1OFUX 3NBXX 4BZQA 5K8TA 4QHSA 1EWQA 4FINA 1VDZA 4XWAA 2J87A 5EE3A 4A92A 4X8OA 1SKYE 4BRWA 2B92A 1LW7A 3MMPA 4ZKEA 4EFNA 1XD2B 2W58A 1NN0A 4D80A 2ZS9A 3HU2A 5FPKA 1JQJC 4NTZA 4MRSA 2B7CA 4B6FA 2AWOA 1TEVA 2VP6A 1BH2A 1X86B 3V00A 2FWRA 1P75A 2NIPA 1KO7A 2WOOA 3EARA 2ZJYA 2R2AA 3EW9A 1IXSB 1VTKA 4DKXA 3T15A 4Q1AA 2Q0HA 3ZVLA 4PSAA 2VL7A 3FB4A 4CF7A 3LBNA 3M1IA 2NPIA 3KUDA 1Z2AA 2ORIA 3NH9A 1H65A 4S35A 2W6JA 3KTAB 4M53A 1QHGA 2JAQA 3MAAC 8OHMA 3SBEA 1VG1A 5SZKB 5KNCA 1D2NA 2HEIA 2EU8A 3A4MA 4L8GA 4DLUA 4MRNA 2PX0A 1IHUA 4KSCA 1XTJA 1R6BX 3VQTA 4TMZA 1R0YA 3CH4B 2WMNB 2GZHA 1JECA 3BJIC 4I4LA 2N1BA 3O8RA 1YZLA 1U8YA 5JEDA 2ZE5A 4DB4A 1T0JB 3P20A 4DEXA 2MMGA 4WZ6A 1ZP6A 1U99A 2FSHA 2DWOA 3HU1A 1TF5A 2P5TB 1KYIA 1UM8A 1TF2A 1PLLA 1U8AA 4I1VA 3U44B 1WRBA 2EWVA 3V9PA 1E79D 2HDNB 1KTVA 3TRFA 2ZR7A 1VIAA 4L4UA 4D0LB 2ZREA 3NHAA 4YMSA 4DSUA 1E79A 2GEDA 3X1ZA 3FMPB 4QJ4A 4PQFA 3SN6A 1CU1A 4KHZA 1FX0B 2CHGA 1P60A 2GDJA 4Z1MD 1Z0IA 1YQTA 1N0UA 2ZI3A 4IXNA 3WXMA 4DLYA 1KY3A 1KDOA 4EKDA 2BCGY 2CJWA 3BWDD 4M1WA 4C0LA 1S3SA 4Z1MA 3AVWA 3B1XA 1AGPA 4DDVA 3THYA 1I2DA 1RC8A 3EIQA 2CHQA 4C7OB 2VO1A 2IK8A 3LRPA 4HLUA 4EQ6A 3R9IA 3GFTA 2P6UA 3NXSA 1KO1A 3OEED 4Q4HB 1G4UR 2ZJZA 4POAA 3W8NA 3I5YA 1Z6YA 4ON9A 2B8TA 1E2MA 4GT1A 2FGJA 2XNDD 1E1QD 2J3EA 1G64A 3OEEA 3B1VA 2VF7A 1XEFA 5EUQB 4IOMA 3K53A 2HUPA 1W44A 2XNDA 1E1QA 1Z5ZA 2GA8A 3KUCA 2BMEA 5FPSA 1JJ7A 3TVDA 1KMHA 1YR6A 2WV9A 4DCTA 2PL3A 4AG5A 4DDUA 4HAXA 4NCHA 1ZM4A 1E98A 2QQEA 3RLFA 3OIUA 3AKCA 3T1QA 1TUEA 1EFHA 2P2LA 4PHGA 2AK2A 4M1TA 3ZD6A 4QOSA 5KDDA 1FMJA 2YC4C 2REXB 1R2QA 1N5LA 2F1RA 3KXKA 1E9AA 3T12A 3ZIAD 4DC9A 2MMCA 3THWB 1XCMA 4M9SA 2FEMA 1XCGB 1UDXA 3DHWC 4IEEA 3IIMA 2PLRA 2ONKA 3AM1A 1HY3A 3ZIAA 1KI2A 1KK3A 1XXHA 1NJFA 2ZRAA 4Y0VA 2ZSBA 2WMOB 1G4AE 2P6NA 4M21A 3GLHB 4AY2A 421PA 4JLVA 2ZJ5A 1DS6A 1E4VA 2V1UA 4BPBA 4Q5IA 2XZOA 4OJKA 2QEQA 4IVQA 1T5LA 3OF5A 1PV4A 5A0FA 4JVNA 1A2KC 1E2FA 1Z6XA 2C78A 2OILA 4PO1A 4TWZA 4L9WA 4TYQA 2GXAA 3KJHA 4B48A 1OFHA 2VHQA 2REOA 1X1RA 4DBLC 2FX3A 4IRUB 4AYWA 3CNOA 4LJ7A 4NCJA 1OB5A 2BEKA 4C2TA 4NYIQ 4JLAA 1BYUA 4PO9A 4F4IA 2NZ8A 3CWZA 5AJYA 2CMKA 3L0SA 4GMXA 2G77B 4RZ2A 3LWNA 4ARZA 4EAQA 1NSFA 1W7AA 2ZSEA 3OZXA 5DHFA 4OHYA 4I1UA 5FBVB 4BASA 1DAEA 1ZM7A 3EAQA 1OH8A 2OV2A 1G291 1CS4C 2ERYA 3AVQA 1TU3A 5KHOC 4LX0A 3DZDA 4Q9KA 5J4YA 1L8QA 4XJXA 1A4RA 5C1BA 2EQBA 2CLDX 4BFSA 3V4RA 3K9NA 3ADBA 1YR7A 2PMDA 3SYKA 2F1JA 2GXUA 1T4GA 2GK6A 1TU4A 1G8FA 1SQ5A 3B85A 1HEIA 5FR2A 3KQNA 3K70C 1E9DA 2YOHA 1IONA 4LRWA 2ZRJA 4UQOA 3CB4A 1TNDA 1G7RA 4JJKA 1NG9A 1KDPA 2EFCB 3THXA 3D8BA 3I8XA 5FTMA 1Q3TA 2FOLA 4EJSA 2RKOA 3O8DA 1CJMA 2F9MA 1OXUA 3BOSA 2ZRCA 4JIMA 2WIBA 2DY1A 1J99A 2J0UB 2XJ4A 4PHTA 5BYKA 2C77A 3GLFA 1D9ZA 3QKUA 1OJLA 1NN3A 2HXYA 1M6NA 2QPOA 3OAAD 4AYTA 2MSDB 4CDGA 1P73A 1SXJB 4UKDA 4NYMR 2R6GA 1D9XA 2CJWB 3FVQA 3OAAA 1TQ2A 3C5HA 2OE2A 3IHLA 4PAQA 3ZYCA 2A78A 4GMDA 5HCIA 1AS3A 1F60A 2KSQA 2QTHA 4JBXA 4OK6A 1OYYA 4UNNA 4A8JB 5FH9A 2DR3A 3QG5A 3D31A 5JLJA 4CYMA 4OQNA 1P9RA 3A1WA 4CRWB 4QHTA 3VU9A 3SFVA 1V43A 1W0KD 4TT3D 1ZD9A 2FSIA 4DZZA 1COWD 1G3IA 5AUPB 1QF9A 2ZE7A 3SR0A 4TLEA 4B71A 2IS4A 5JCPA 2XOKD 1GRQA 4QGHA 4B3CA 2WOJA 2RMKA 1Z6GA 1W0KA 4TT3A 1COWA 2OLJA 4KV9A 4V0ME 1SZPA 1XTRA 2ZRIA 2O8BA 1E2NA 2XOKA 2ZAMA 3TVTA 1M8PA 2O8DB 3GJ8A 1XU4A 1FQKA 2E1RA 4LHYA 3SHFA 4WBSA 5GJWC 2IYZA 3HYTA 4KBFA 2EFDB 2ZI7A 3K8YA 1DARA 1VCIA 3FMFA 3ZDQA 1EFCA 3RS7A 1IN5A 1SVIA 1RIFA 4W5HA 4M22A 5IK2D 3QG1A 5CB6A 2IC5A 2NG1A 4HATA 1NIPA 5B64A 1KK0A 3AEZA 1KSFX 2H7VA 1UDWA 3FMIA 3MWLA 2AFIE 3GLGA 2D2EA 4OKSA 1XD9A 4NZYA 2ZITA 2XJ9A 4JLJA 3ZD7A 5HKKD 2IYSA 3C5CA 1JALA 5H70A 4B33A 2JLRA 3HU3A 2R44A 4URXR 2JLUA 1KO8A 4HYYA 4LI0A 1G8PA 1ZAKA 5DI3B 2DBYA 4BE7B 2O8CB 3DEFA 2IS2A 3U7FB 3U7EB 2H57A 4B44A 3QVVA 3GD7A 1CBUA 4M9ZA 1E9RA 3K70D 4O3MA 5GVRA 4IHQA 3PFIA 4PO8A 3DO6A 3TAHA 2DB3A 2J7PD 3IO5A 5KNDA 4KFSA 3B7GA 5FUYA 2ZRBA 4EPWA 1YZUA 1ZCAA 2H18A 2IXGA 2R62A 1E9CA 4PPFA 5DSZA 4C3ZA 2O8EA 3UG7A 2IHYA 2J7PA 4LDJA 4PPNA 1FP7A 1JXMA 3X1YA 1P3JA 3PVSA 4GRAA 1I4DD 2WM9B 1P2TA 4XVQA 3IO3A 2OAP1 4D0GA 3K9GA 1GIAA 4FMDF 1ZU5A 5TV2A 1JAHA 2GNOA 2RB4A 3EA5A 1HE1C 3AKEA 1R8SA 1VHLA 2F3TA 2YWFA 2ZRHA 3MGCA 3IIKA 3T34A 1G9XA 5HZHA 1M1YE 1XJ0A 5SZHB 3CW2A 2QZ4A 4A6XA 4BLSA 4M1KA 4C0HA 3WMEA 1WF3A 5F9FA 3IEUA 4RZUA 5KTYA 3BBPA 1I4TD 3EPLA 3LVQE 2NMVA 1CXZA 1W36B 4IJMA 1TQDA 3QQ5A 2WWGA 2Z4SA 3A4LA 621PA 4LBZA 4GFDA 1S1MA 2R6FA 3TLXA 5AUQA 2HCBA 1OIWA 3BB4A 1LS6A 4EJSB 4Q7KA 1XTQA 1WP9A 3T35A 3T5DA 3SYLA 1DE0A 2V6IA 1ANKA 3LV8A 3VX3A 2YWEA 4JBYA 1Z29A 4V0KA 2IX3A 3T1OA 3IHWA 4YONB 1P61B 2XTMA 3AP3A 3C4JA 2ZVPX 1E9BA 5EZ5A 4DLXA 1Z07A 2WSSD 2A5YB 2YOFA 3LNCA 3TBKA 4QG7A 1AJEA 2ECKA 2V9PA 3RS3A 4B2PA 4JLPA 3T1TA 4ESHA 3TMKA 5HR5A 4B47A 1K6MA 3QI2A 4JLKA 4LPKA 2VRWA 1CRQA 4LC1A 5E3HA 4ZCMA 4R71A 2FV8A 2FNAA 4QBIA 2XZPA 5AK0A 1WMSA 5KO2A 5BQ5A 4U7DA 1E99A 2OXCA 1N5KA 1S96A 3CX7A 3K0CC 4DVGA 4C2UA 4LJAA 4JKIA 1G8GA 1Q1EA 2DWPA 1IY0A 4NYJR 1U9IC 5SZJA 2BOVA 2PCLA 2DFLA 4B43A 4JT4A 3VU9B 1QHNA 4KYIB 5HCNA 2DHRA 1DTSA 5G3ZA 1W2GA 5BN5A 2QRZA 2ORVA 3BB1A 4NPHA 1NLFA 4BFUA 4AWXA 4AKGA 1A2BA 1W4BA 3ZZTA 3VMFA 1ZIOA 3AP2A 1OV4A 2GCPA 4RD0A 1W49A 4B32A 3ZVNA 2YYZA 1X6VA 5H68A 4A1FA 4P33A 4PHHA 4BFTA 3AVOA 5CK4A 1AKEA 4ZCLA 3ICQB 1KHTA 4PQYA 1XNJA 4WOPA 4DIEA 3MFYA 2C5LA 3TNFA 2VP9A 4ACBA 1ZNWA 1NVUQ 2GAAA 3K9LA 4LBYA 4EPTA 6Q21A 1FTSA 1RE0A 4DEYA 3AKDA 1KSHA 4Y0AA 3LY5A 1AM4D 1S3GA 2H16A 4RD2A 3WMFA 1WBDA 2BM1A 5FOSA 2RGBA 5L8VA 1E9EA 1P2UA 3B82A 5JS7A 2WJJA 1NVVQ 3BORA 3K0FB 2O8FA 4M8NE 5DYIA 1FZQA 2YJTD 1D6JA 2ZRMA 3AH8A 3RDPA 3TUZC 2WBLC 2Z43A 4XSGA 1N6HA 4BLPA 2FZLA 3FYHA 2PX3A 2W6ID 1E94E 1VCMA 3N2IA 2WWFA 4NH0A 3U3JA 1XPOA 3TQFA 2BKUA 1KGDA 2QA5A 2QPAA 1JQLB 1EFRD 1JR3E 1DG3A 5FOXA 2WJHA 5GJBA 4PC3A 3IDQA 2VBCA 1B0UA 4TLCA 3U7HB 4M4SA 2J0QA 2ZXUA 3KL4A 1H8ED 1V5WA 4AURA 4FMCF 2XXAA 1XMJA 1CJVC 2NQ2C 5FTKA 2CHVA 3K0AA 2IXFA 3WRXC 2ANBA 1RFLA 3K09C 4I99A 4B34A 2QP9X 5L3SA 3K0SA 2QBYA 1Z3IX 4KI0A 3U3KA 5EE5B 3GLIB 2F43B 3F5FA 4WAUA 2ZIAA 4OI4A 3UPUA 3I62A 1HH4A 4U02A 3KKNA 5P21A 1E32A 3CIOA 4E22A 4FMCB 3RAPR 2QNRA 1KDRA 2A3RA 4P4SA 2A5FA 2A30A 2VYFA 3W3AA 5JSZB 1E6CA 4QJ3A 2FU5C 3QNUA 1TX4B 3C16C 4JT2A 4DT1A 1CF4A 2O0JA 3G5UA 1XCPA 4BFVA 1F48A 2Q6TA 2JLZA 2ZPTX 1GKYA 3HJNA 4KFRA 2X2EA 1G3QA 2QMEA 3BS4A 3REGA 821PA 1OB2A 1ZM3A 4LYFA 2IHBA 3LXXA 1MH1A 1SVKA 2KBFA 3CNLA 1CR0A 1U9IA 3BIFA 3QXJA 4PC1A 5DNYB 4PX9A 3A6PC 4KODA 3BXZA 2JCSA 3HR7A 1EG7A 3GFPA 3T1VA 1T91A 1R10A 1R5NA 2I3BA 2ZSDA 4IKEA 4MH0R 1R8QA 1KK1A 5TB5A 3EC2A 2WSMA 1NY5A 3W5JA 5AUOB 5FFMA 5JJLA 1XWIA 3CRVA 3CR8A 4TTPA 5C4GB 2ZU0C 4CEIB 1EESA 5JJKA 4ZDIA 1G18A 1VYTA 2FEOA 4A2QA 4D0NA 1FUUA 4F4CA 4RKEA 1ZUNB 5E7MA 5CDFE 1KI9A 5EUMA 1DOAA 1UJ2A 4B74A 1QVAA 2IEZA 1F6BA 3GCGA 2A2ZA 3E5HA 1E2QA 1U0HC 1Q1BA 2QAGC 3JZMA 2P65A 3M0EA 1E69A 2GJ8A 3EWAA 4GP6A 2YWHA 5BW8A 4URZR 5LPNA 2I4IA 5G40A 2JEOA 1Z6TA 5TMPA 4YLGA 4AG6A 3ONWA 2C95A 5KPJA 4P32A 3U60B 4B6EA 1CR1A 1HURA 2K5UA 4ESVA 2CLCX 3RC3A 5JWRA 1ZD1A 2WJYA 2ZI9A 4DLZA 4KFUA 1T3LA 3D3QA 4Q1DA 3THOA 2CNWD 2HJVA 2W83A 2Q21A 3TW8B 3MRSA 3WRYC 3IPXA 3FTQA 5LDDC 5KSPA 1OPXA 1VHTA 5JS8A 4W5WA 4PAMA 3LLMA 3NH6A 3MWYW 1II8B 4PFSA 3TKLA 4R2IA 3RSOA 1D2EA 4NL4H 2UZ3A 3CNNA 4M9QA 4IEIA 1ZNZA 3MJHA 3Q85A 4LJ5A 2QMUA 1AZSC 3W6PA 3E70C 4D81A 2X8AA 3ZH9B 4CT5A 4Q1EA 2GCOB 2IUUA 2QE7D 1Q20A 2G3YA 3BE4A 5FR1A 2IWRA 3UMSA 4P0TA 3GP8A 3B13B 5FTJA 4DLSA 1NY6A 1XF9A 2F3RA 2QAJA 4KO8A 4L16A 5TARA 3EX7C 2JATA 4V0MA 2FE4A 2QE7A 1WXQA 1IY2A 4PZZA 4XVRA 3K09A 2C8VA 2D3WA 1HV8A 1IY1A 1ZMXA 4L5BA 3BH6A 1UBGA 1X8LA 3SJBA 1HA3A 4BFZA 1U2RA 2KE5A 5LB4A 2HT6A 3A58B 1YJ5A 1DELA 1BKDR 2CBZA 3WY9A 3FKSD 1YVDA 4BQSA 4P31A 2GCNA 3MCAA 4DXAA 1G21E 2V3CC 1E2HA 3WYFA 2OXRA 3FKSA 2G88A 1MO3A 3KFVA 1NVVR 5G53C 4TLAA 3X1WA 1KJYA 4PPGA 1L4UA 1S2MA 2SHKA 1OF1A 1QHYA 4QFMA 3DMNA 3QXSA 4B35A 4C9BA 3GJ5A 3AQ4A 3ADDA 3FHOA 3T61A 2Z6VA 3ASYA 4TYPA 1WBBA 4YMWA 3A37A 1OXVA 4R2HA 3PUWA 4GOXA 3ZS9A 4KFTA 1MABB 1K5DA 3CKLA 3LVRE 2OCYC 2QM7A 3KQUA 4Q9LA 5AR1A 2RH5A 2P6RA 1E2IA 4TMVA 2QP3A 3VHLB 4UXHA 1ZW6A 3KXLA 2FFAA 2QBYB 3G82C 3UATA 4O25A 5CM8B 2R6AA 1FQJA 5AJXA 4KITB 2Z83A 1E2KA 1NKSA 3I3SR 1G5TA 4U5XA 4BZPA 1KI7A 1DAMA 4NCNA 3TIFA 3GPLA 4C0JA 4ZIRA 1X1SA 2NGRA 4I81A 1K8RA 2PH1A 4P4SB 5EXSA 3PENA 2FSFA 4X8LA 3LW8A 2RAPA 1RJ9A 4US0R 1MT0A 1N25A 2ZSFA 3EIEA 4HDCA 4QHYA 2PT5A 4WXRA 3SHWA 1S4QA 2BBTA 2HV8A 4PQRA 1X8KA 2EYUA 4RKFA 1SVMA 3FMOB 2R6DA 1KKMA 4Q47A 4OQLA 4HAVA 2YV5A 1GFIA 4M2LA 3VFDA 2BCJQ 2RGCA 3C8UA 2ZVQX 1PLJA 1YRAA 4TMWA 4A2WA 3A1VA 3RABA 3CX8A 5E4FA 2AL7A 1Z0KA 2VSOA 4BEJA 3TUJC 4MRRA 1ZU4A 4TN1A 1LFDB 2CK3D 3ZZ0A 1DO0A 3QF4A 4NMMA 2ZETA 4ASUD 3RYTC 2BHRA 1JR6A 2CCGA 3H4MA 1N5IA 1NKTA 2CK3A 3FKQA 4ACAA 1XDBA 2QT1A 1R5OA 2P0EA 3OEHD 4II7A 4ASUA 1US8A 5FL7D 4Q18A 5F9HA 2JLVA 4C30A 3W9YA 1GL6A 1YHNA 1YKSA 3JZAA 2CE7A 1E2PA 5EZ6B 5FUXA 5FL7A 3U6KA 1QG2A 1KI4A 3DOFA 4X8HA 1SKQA 2VHUA 1ZVQA 1KZGB 1MKYA 3QF7A 4O2RA 5GJCA 2X2FA 2ZJAA 4Q4AA 4UXIA 1R0ZA 1I2MA 2F7SA 3IPYA 4IVPA 4P4UA 4QXAA 4C0KA 1G16A 4KBGA 2H1LA 4JLDA 3PITA 3L0IB 1I4LD 5BN4A 2KB0A 5GJVC 2WAYA 5C18A 2WICA 4RCZA 2WPDD 4X8MA 5GADl 1DVRA 3M6AA 2OUKA 2HYIC 4O2LA 4BECA 3H84A 5FTLA 1Z28A 4QRHA 2XTZA 5J4HA 3DDCA 2ZYTX 4AIIA 2FSGA 2P5SA 5EXPA 5JWOA 3QJYA 2WPDA 4LV8B 5CLLA 1WA5A 1BS1A 4OHXA 2ANCA 2TMKA 4BLRA 4Q02A 4KXFB 5E95A 5FOWA 3R8CA 5D3MA 1G3MA 2HLDD 3ZZUA 1QHSA 2V55B 2L0XA 4EUNA 1YZNA 2N46A 2KI5A 1OH6A 3U4QA 4PPQA 2HLDA 4TL8A 4FN5A 4KLZA 4YXWD 2D74A 2CVHA 4A0GA 4U00A 1G7TA 5EXTA 4TLBA 1HT2E 4Q48A 1ETUA 4TZ6A 4TZ0A 3W6NA 1ZC4A 2J0VA 4JS0A 4DDTA 3BGWA 2RCNA 2NPFA 3BFVA 2ZRDA 3ZLJA 4J0QA 1ZIPA 4DRZA 5HTKA 3EPKA 4CEHA 1GL7A 4MYHA 3LX8A 3W34A 1Z83A 3F3YA 4JSTA 4LBWA 4DSNA 1M7GA 2CCKA 4R98A 4W7SA 4Z54A 3IIJA 1XTSA 3FE2A 4NHOA 5KYKA 1KSJA 1YE8A 2GEVA 3B1WA 1UKEA 2AHOA 1DAFA 5AJZA 1XZQA 1G7SA 3QKTA 1SVSA 2IYRA 1JR3D 3RNLA 1DAGA 4V03A 3I72A 2JLQA 4WW0A 4M1OA 4D4JA 3ZQJA 5EP1A 1SVOA 5CJPA 4FWIB 1P5ZB 2CCJA 1JR3A 2YNMA 2ZUDA 4PSVA 1F3OA 1IJEA 2EW1A 3ND9A 4QGGA 4GP7A 2VPPA 4ZDJA 4Q4JA 4PZLA 2Z4RA 1XJCA 3X1DA 1YU9A 2BVNA 2G0TA 1UF9A 2ATVA 1LF5A 4AYXA 3EZ7A 2YHSA 4XVUA 4FI3C 2BDTA 1W4CA 1F5NA 3VX4A 2BJWA 1NMZA 4A82A 5GVSA 3CUEF 4LBVA 3EASA 1Z0FA 1J70A 1FMLA 1PUIA 4XTCS 1GOTA 3A8TA 3MWJA 4GNKA 4KYUA 5HE8A 4LC0A 5EP4A 3AVUA 4G5QA 1QHXA 3THYB 3QUSA 4LJ8A 1R4AA 3A1TA 4JL8A 3L43A 4EQ6B 2V4ZA 4G01B 3QF4B 4PAOA 5IHPA 3IBYA 1AS2A 2E9SA 4ZCIA 2A5JA 1NN5A 4YC7A 4CZ2A 4LV6A 4BFYA 4ZDKA 2ZQ5A 3KX2A 1M2OB 4DCSA 2C96A 1QBKC 2RGNC 3B9PA 3NC0C 4C0BA 2ZJOA 2ZU6A 3AF1A 5DN6D 2AXPA 2BV3A 1Q21A 2NO0A 1Z0AA 4OL0A 2AR7A 4Q9JA 5E7JA 1KMHB 2YWGA 1X3SA 1W5TA 1T3SA 4N3NA 4JLOA 4Q01A 2GJAA 5DE3A 3UMRA
chains in the Genus database with same CATH superfamily
2IPMA 3PQCA 3U19A 3QP9A 2YHAA 3LW7A 1UFOA 3FNBA 4CL2A 1TTPB 3W9UA 2OA0A 3SVLA 4WZBB 1OC4A 2EFEB 3GLHE 5M3BA 2WD7B 2ASVA 3SWWA 2F17A 3KOMA 4UHKA 5T67A 3N5CA 1TT7A 5CHEA 1Q0HA 1WKCA 1NNSA 3L04A 1KS9A 3AUJB 5BURA 1U31A 2PPLA 4G5OA 5HIAA 5IJXA 3PQ5A 3RSGA 4F4JA 4M0UA 5CYGA 2UDPA 4DJ5X 2ECQA 1BG6A 3H17A 1VDMA 5T4HA 2P27A 4DWWA 4XGIA 2GPYA 4OG2A 3WGKA 1DHTA 1HL3A 3E4DA 3RUCA 3UIEA 2ZW9A 2W90A 3KZXA 2O7VA 1XXHB 2Q99A 3I4LA 4RPLA 3TJMA 3T7AA 3EZ6A 3KQLA 2NO7A 1FFHA 1NRWA 1U65A 1AQUA 4K9QA 3ZV5A 3QU7A 3BD6A 1YONA 2NWQA 2XE8A 3ENNA 3WA7A 4R5MA 2VTKA 4EFLA 4KWCA 3SYNA 4X00A 2V7QA 3DZFA 3SF8B 1SO8A 3PE3A 4RLSA 1W96A 2NUTB 2PVCA 4JZKA 3M5PA 4EB6A 4YIKA 1TVCA 4N0EA 1IOLA 2DOKA 4W9NC 2H92A 4N3AA 3DE4X 1IU9A 3MUFA 1XFDA 1ODTC 3IEPA 1K27A 4BMXA 4ZVMA 1I6WA 2D4HA 2Z95A 1U5BB 2BFBA 3DLHA 4NBKA 2WYHA 2B4RO 3N75A 4V0OA 4ZCPA 3VPXA 1HLGA 1LTHR 5KYTA 5IT5A 1MX9A 5ED4A 1YK1A 3VR4H 3HKEA 2BP7A 1QIJA 1W85A 1T10A 3MD0A 5C7LO 2OXIA 5DM70 4EELA 2MINB 2H48A 2QVXX 4FSXA 3RSCA 3B8HA 4LYEA 4F92B 3WO1A 4NBWA 4CKWA 3NHYA 4AF8A 3ZDRA 3OO1A 2PZEA 3RK0A 3NHFA 5KU1A 1DXQA 4XQGA 3UXMA 2JAWA 3LP5A 1Q50A 5IN4A 1EUCA 1E89A 1N1DA 2VHEA 1IQPA 3EFOA 3NKLA 1JIJA 4G9BA 5JCJA 2B69A 3GRKA 4FLFA 1OAAA 4M49A 4HGNA 4LYHA 4ZOQI 4FE3A 1X7ZB 1LVUA 2Q49A 1KY5A 2D00A 3ONVA 4NYIR 1T15A 2H51A 4C6TA 2PT9A 2RAUA 4CQLA 3S1AA 4DFDA 5C32A 2ZKIA 5KOYA 1H5UA 4N18A 4DLVA 1JU4A 4L3WA 1U04A 3O1JC 1FJHA 5TDHA 2G40A 3DDNA 3W7VA 5CLHA 3WHKA 3JVEA 5J58A 5MDHA 2XB6A 3DPUA 1SXHA 3CPJB 2VN8A 1PFGA 4G5XA 4U7FA 1LSUA 5BYJA 3CRMA 4AQYB 1RWBA 1LNZA 2GM9A 3NEYA 2ZWIA 4AMGA 5BQ3A 4IDNA 1WMBA 2OQ2A 1EK0A 4WACA 4PY2A 4N6GA 3JATA 3Q3HA 5JW6A 3HA2A 1F8FA 1NWHA 1C0IA 4ZPXA 2GM4A 1GCUA 3KT3A 4QGBA 4WNAA 1OH5A 1E1MA 4Q21A 5LP6F 3THXB 1OFIA 2AFHB 4PZUA 1CEXA 3TZQA 2CV0A 4JI4B 2OM6A 1DFIA 3K1AA 1R15A 2AD1A 2QSZA 5DI9A 1W48A 3SJZA 1Z08A 2BFDA 4NOKA 2HWXA 1X9IA 3VU1A 5JNSA 1L8LA 3NAQA 4UU0A 2CHUA 2WILA 3FH0A 1O58A 4IMIB 2D5AA 1E3MA 3C48A 3WJ1A 4C06A 5JT1A 3FCXA 3ZCUA 2VQFB 1GKIA 4Y7CA 5JD4A 3LO8A 1BEEA 4X6UA 4AW9A 2ZM5A 1UIMA 3LXRA 5J47A 2I54A 3OLWA 2FG6C 4PNHA 1XI2A 2DCUA 1V1JA 2IQIA 2UV8A 3S44A 4B6QA 2OHVA 1WXGA 3PUYA 3OI7A 5EE1A 1LPBB 3KL2A 4FIDA 2VJMA 2Z3VA 2NSYA 3GAAA 4AMVA 4N01A 4KUHA 4NK5A 1BVUA 3BD7A 2C4WA 1PWZA 3DG9A 5B3JC 4ZO6A 3AERB 3EXHC 4BBZA 2G4VA 2N1MA 2QRJA 4FIZA 3UMJA 4NBNA 4RIGA 5FCDA 2O0KA 4LQDA 3RV4A 1OREA 3ZZ1A 1RWKA 4M6WB 3SOZA 3LU1A 2Z8YA 3UJDA 2PQ2A 1JMVA 1TPZA 1ZXXA 3DZ8A 2QN8A 1L1FA 4QO8A 1YDHA 4WMLA 3ZXSA 3AI3A 1PGQA 2OO7A 4K9KA 3O4HA 1U94A 3P9RA 4J9VA 4OX9B 1FU7A 2W00A 1GSIA 2JI7A 3FDIA 1V95A 2HK6A 1IQRA 4C29A 4Y6LA 3KSDO 1V9CA 5HOEA 4FNAA 1G63A 3CRQA 1JHMA 2COKA 2ZRFA 1NLZA 4AMZA 4CV0A 1SHKA 1BWSA 1YXMA 5EKSA 2O23A 4BVFA 3RT1A 4IP0A 2QUZA 3DYIA 3W2HA 1Y6QA 4UE2A 2AGVA 2WWIA 4IDOA 4Q1CA 1CVLA 3GEMA 3RSLA 4B4OA 4KAXA 4LCJA 4W9NA 3UZUA 3RBXA 2GX6A 2VAPA 1AQYA 3EA0A 4LDZA 5CMLA 3WMWA 4EJFA 1RKUA 4A1OA 1QZZA 1BYIA 4TGLA 3DPIA 5DEOA 3TDNA 4AUNA 5BR4A 1NJ1A 2ADOA 1QZ3A 4DLRA 1VGQA 1X80A 5JLAA 2Y1DA 3DTTA 2VH1A 2ZJFA 3IH5A 3V1UA 5AK6A 1FQOA 1OKKD 1SEPA 1NBME 4D9JA 1TD9A 4DUGD 1NJ2A 3AW8A 1TFRA 2CSUA 3L1JA 2J46A 4LAFA 3QOFA 1U2GC 1JFTA 1C7EA 1SUWA 2ECFA 3A31A 5TT1A 2XKJE 4Z4QA 2PJUA 4MMYB 1DC4A 1K97A 3UJCA 4MP6A 3GLGB 1CQJB 1FXWA 3B70A 4A6EA 2B5OA 4LVUA 1GNQA 4CF4A 4FD3A 2IYLD 3WLKX 4KE7A 4FD2A 4MICA 4ZFNA 1D2CA 3TGPA 4DMHA 3I0MA 1VI5A 2I4LA 2V6GA 2QD2A 3DCJA 2IDZA 3IODA 4H59A 5IXJA 2BKVA 2O1EA 2OBXA 1MRNA 2W6ZA 3HZOA 2QGNA 4MDHA 1FP1D 1N0VC 1L5SA 3KXIA 2W6IA 2A84A 2BFBB 3QEJA 3I1IA 4NG5A 2VP0A 4XCQA 3OOWA 4GPEA 2P9JA 3I09A 4QYTA 3U7QA 1P4AA 3HKEB 4QQNA 3OX4A 1W85B 3IJPA 4MHSA 2HSGA 2ZB4A 4DV0B 1OMOA 2QRUA 1Z4KA 3ILHA 1Y7LA 3GT0A 4CKWB 1Y0BA 5JDIC 2R6HA 4YV2A 2AXNA 1Z8FA 2Y6UA 4QNRA 4GP9A 3G5AA 3KVRA 5DH9A 2WAMA 4RH1A 1CZOA 2UZ0A 1EUCB 3EGXA 5CDTA 3OCZA 1L9KA 3EFOB 1TYDE 4YQEA 3RRZA 5JXIA 1K3FA 3JRNA 4AWAA 5ECGC 1V11B 2QW0X 1ODCA 3PGVA 1U8FO 4UEWA 4RVDA 4KX5A 4Y9RA 4C6TB 4QBHA 5JD6A 1YBFA 1YJCA 2P5UA 5I01A 5CT8A 3EUWA 4KAAA 4WQMA 4E21A 2HB6A 2FPUA 3GLRA 3QJ5A 4ENSA 1OIVA 1KU0A 1IXRC 5KDOA 2CJFA 3QE0A 4M0LA 4A0RA 3AUAA 1XALA 2D06A 3CXRA 3IJRA 4ND5A 3ILSA 1YB6A 1VFPA 3FGOA 4NE2A 1L2TA 3IESA 3VVCA 3JATB 1NPTO 1W46A 5B3JA 4RK0A 5FUWA 1T35A 1SUBA 3HSYA 4MYUA 4GPAA 5FBZA 5KAPA 4XYBA 2BI4A 2PZGA 4WNAB 3SFZA 2DETA 3M4NA 2GAOA 4KGVA 1GO2A 5CX1B 2A33A 4AFNA 6LDHA 1NQXA 1F51E 3NTXA 1E9SA 2TMDA 3VVMA 3L9XA 3WO0A 1UEXC 5JVDA 4Z0PA 3ZK9A 3K4HA 2VA8A 2OM2A 5FBRB 3E8XA 2VIIA 3T3IA 4CMCA 1ZN9A 4CTNA 2R68A 3KQMA 1ZXLA 5CX4A 2QM0A 4TRRA 3TPCA 3UTDA 4L4SA 5DHUA 1B16A 1X70A 3KVVA 2HSJA 1EXDA 1VG0B 4ZI7A 4E1VA 2MTBA 1QGAA 3RRYA 3HWRA 1HRDA 1R27A 4O0LA 4OLHA 4R7GA 4YWHA 1JB9A 4I4IA 3ESXA 1WQ1R 2G80A 3FLAA 3PE4A 1QYRA 3ZUGA 4BKRA 1JL3A 5JBIA 3A6JA 1RPAA 3E9DA 3WAJA 3HFJA 1WZCA 2PUTA 2DVMA 2AE1A 4J6EA 1LDNA 1KMMA 2FH5B 3RS5A 1TK9A 4WNCA 2RC5A 3R7BA 3COPA 4BIMA 3AWDA 1J2JA 2A9OA 4Q7LA 4QGFA 5JXHA 3I32A 1DQPA 1OTYA 3GC6A 3T9CA 1CWUA 1C5KA 3BAZA 1WTCA 4RF3A 5ALZA 3WGUA 3CF0A 3M9LA 3MAJA 3BEOA 2QNIA 4QU9A 2BIFA 2R3SA 1F6WA 1UBOS 4YYEA 1JSRA 1CSEE 4Z7JA 4YACA 4DBZA 2ZJ8A 3F7OA 4Q0MA 2EKDA 3E5MA 3KQTA 1J0BA 2I4OA 4IXTA 1EA5A 1AKQA 1EUDB 1TLLA 4FJ0A 4X91A 5IC5A 3V42A 4RADA 1AK9A 3UW3A 1ENOA 1VKNA 1YHYA 1ZUIA 3C3BA 3JARB 3VV3A 1XLVA 4C4TA 1YZHA 1M74A 3C5EA 1DO2A 4G0MA 1W88A 3OHSX 4CQJA 2ST1A 3QWAA 1CEEA 1OXSC 4MITA 1X2EA 3IIEA 3N3AC 3ROZA 3GDHA 3VR2A 2XUQA 3UJAA 3P2YA 1WUTA 2H17A 2HCRA 5CK5A 3KZ1E 2EKZA 5LYJA 4EB3A 4FCCA 3OJFA 2G17A 3UWOA 3FWNA 3QOWA 1N34B 4KE8A 3H3XA 5KYYB 2PUDA 4E6EA 3H4VA 5JDIA 3HNRA 4NZZA 3AINA 2I29A 3FNGA 5KYWA 3ABOB 3U37A 4YAKA 3DMRA 3RS8A 1Q0UA 4B73A 4EWLA 4R01A 3QWHA 1RQ7A 4J0KA 4ER5A 4DV5B 1V7ZA 4TMXA 5M04A 2AG5A 4FFBA 2IH2A 5IJAA 2Y76A 5JC1A 2FFQA 5IAKA 5IBPA 1CNMA 1ND6A 1RZ3A 1S8AA 1NVGA 2HCTA 4LHVA 4X1OA 2ZT6A 3F9CA 3I34X 3OIDA 3TCNA 3TB4A 4BGDA 1U81A 1NP7A 1JBKA 5JMTA 4RZQA 1W4AA 1RHMA 2H1RA 4JWKA 4TPKA 4X20A 4ESEA 2C8KA 3HCCA 5CG2A 5FOQA 4PTLA 2VDWB 3S2IA 3WL5A 4AVYA 2QQGA 4MW9A 4X62B 4KNWA 2ZRQA 4DV3B 1NMYA 2Z1MA 3LQ4A 1J5XA 2VYND 3R0JA 4L85A 2Y0CA 3SIRA 2XXAB 1OHHA 2XB2A 3DEHA 5DK6A 1VIMA 2WKQA 2V74B 3O21A 3ASZA 3GJ0A 1PSZA 1HZZA 3QKIA 3HXMA 2GXQA 4RJIA 3VR0A 1GCIA 3HN6A 4H3SA 1M0EA 5I9IA 1Q0LA 3QY0A 4JQZA 3VAAA 1UFVA 2JI8A 1FJ2A 3RROA 3L4JA 2IBTA 1JEDA 2I6FA 1FC0A 2OP0A 4ZT7A 1LY1A 2HK9A 4QPPA 5EWJB 5AXDA 1OX4B 2HCFA 4IR7A 4D99A 5KNBA 2X5JO 1MRSA 4O1HA 1A1VA 2O06A 4GL2A 1O89A 2PO7A 2ZUUA 5H4GA 3KQSA 4JKYA 1M34E 3A4TA 3DAOA 4GZ6A 2JFYA 3JQPA 4HEJA 4Q15A 1HR0B 3C97A 1UH5A 1G5IA 2GN0A 3RYFB 1M2WA 4FYIA 4BBAA 5FOTA 1JEYA 1XZMA 3NTQA 5EJ4A 3GJTA 3K94A 3WBFA 1NMSA 1SG0A 4ZU3A 2YS6A 4BU0A 1Z15A 1LDYA 3K9CA 3TINA 3U4GA 1UQRA 4AJ9A 5LD2B 3RIMA 1GNTA 1ZSVA 2HQRA 2ZROA 2C2GA 2HO5A 2J1LA 1AZTA 2Q4EA 3CCBA 2IYTA 5HQ3B 4NYMQ 2RHRA 2BBSA 2P4SA 4KMMA 4UUPA 4XGKA 5COAA 4D4GA 4BLOA 3H0KA 3AT1A 4MV6A 4E12A 3ZDBA 4RJTA 2ID4A 1T1GA 4AC9A 3ZU6A 2GVDC 2HK7A 3DM5A 2YFHA 1T5IA 4BP8A 4CMAA 2H1SA 2X3FA 4YMVA 5CLIA 1RZVA 1AVTA 1WXEA 2BZ1A 1NXQA 4X6XA 4BRUA 5FOVA 1C0PA 1YMQA 5LQNA 3DFMA 2FZEA 1LPPA 2GYYA 1RACA 4K7JA 3U4DA 4KIUA 4YECA 5HVNA 3QJGA 3H1GA 3WRYA 4BC1A 2HN9A 5JAIA 4L6AA 1W19A 2YR0A 1XL1A 3KTFA 3ZBUA 5FORA 2DQYA 3PFBA 2HNAA 4JJ6A 2XEXA 4TQ9A 4TTRA 2GF9A 3ANXA 3W1VA 1NZFA 4KL8S 4ZVVA 4AUEA 1PVOA 1RW4A 4OV6B 3SIXA 2H8KA 2A0XA 3DL7A 5FEUA 1JSZA 3OEHA 1NASA 3H86A 2BWJA 4IGFA 4PR3A 4UNSA 4PN7A 3NC4A 3WBKA 4EG0A 1DT5A 2E18A 4CUJA 2YYAA 1GNLA 4LIPD 2HU7A 4YPFA 4YJHA 1U8XX 1NIJA 4M1SA 5JV5A 4GL4A 5B1HA 4G8CA 1XPUA 2XYQA 2YXNA 2FWAA 3LHKA 4XQEA 3HVHA 1N1EA 2OESA 4NE7A 5TT0A 3H2KA 3WK4A 2BFCA 4JLWA 3CBQA 1NNEA 1TK3A 3DSRA 1FNMA 1HSZA 1I01A 4Y2VA 3TE6A 4NSNA 4YQFA 4AMYA 3C6QA 4P3PA 4PS1A 4RUKA 1W73A 2A8YA 4LJ6A 2YVKA 1P7VA 2E49A 2OYSA 2FN3A 3UGJA 1NM5C 1KZ6A 1U0BB 3RHFA 3MXTA 1WMAA 3UCFA 3A1DA 1NW7A 3AEQA 4FYVA 2OUIA 3B3FA 2XVZA 3FPFA 4JYMA 3L82B 3FFBA 4RHTA 5A3JA 4IGEA 1BU8A 1JDTA 3DL4A 1WUJS 2FA9A 3NTVA 4IIEA 5F5XA 5DBIA 3ZE1B 1O5OA 7MDHA 1G3UA 2DY0A 4JDUA 2I22A 4BJHB 3SVTA 4UEQA 1MC4A 7ADHA 2JH8A 4RD1A 1WCV1 4UXJA 3ZCVA 5B36A 2CW5A 2J5RA 1BE1A 1SIUA 4L4RA 3TW4A 1NBMD 5K01A 1AKNA 3U5TA 4IDGA 3N58A 4IQGA 3SLGA 1ST3A 1W1UA 3NHBA 1ZGGA 3H5IA 3ANSA 5CVJA 3VU0A 5IT9A 1ZKMA 1W8IA 2QN6A 4LF7B 1CR2A 3SQXA 1IN6A 4QXPA 3GA5A 3R3ZA 4UUQA 3GHYA 1RSZA 5DI3A 1MF7A 4EFKA 1XP8A 2VC2B 1OXTA 1YRBA 2X5OA 3BKXA 4Y2YA 3UXHA 4EJ6A 4UVIA 5ALVA 1J5EB 3NPMA 4MWSA 1FYWA 4AKIA 1WZNA 1K7SN 4WZZA 5JCOC 1IVYA 5L3VA 1MCZA 1OYOA 5C52B 3OQHA 4LDRA 3AO0B 2WZDA 2AFIB 1ND5A 1E7MA 2C1ZA 5AK4A 5CEJA 3TPZA 3AXTA 4KXNA 4JL6A 4AICA 3DHVA 1HNWB 1Z35A 4JB3A 4K9DA 1FP6A 2N42A 2X1LA 1O5TA 1TT5A 4ZREA 1I3NA 3G1WA 4OQMA 3HXLA 1NQOA 1PDWA 1DIRA 2G4CA 3EZ9A 3TRJA 3UJ6A 1V1MA 2ATEA 3GUUA 4HYEA 2B7BA 2UYYA 2WAOA 5HF9A 3ZCTA 4KCGA 4MS1B 4ZCTA 1LK5A 2C9OA 4W5JA 2HYDA 1L4MA 4HZIA 3BRWD 1Z13A 3T5GA 4DTCA 4L76A 4XWWA 2WYWA 1J0XO 1PKXA 4AY5A 4GRDA 2ONJA 1U9ZA 3SI7A 2H11A 2IU6A 3FGNA 2WG1A 4ZIRB 5JH7F 2J5XA 2PD6A 1JQKA 2I3DA 5EP2A 4CNBA 1W36D 1HYBA 2K4MA 1Q0TA 1NATA 1IN8A 3HFSA 4MQ5A 2B7LA 1YULA 4P34A 4DIUA 4ENQA 5CW1A 1XUOA 3TDMA 5LXTA 4BY9E 3G5TA 4E4YA 3VO1A 3DDSA 4HNTA 2B2CA 1QX3A 1RAAA 3C1TA 3G13A 4HNGA 4GOKA 5EY5B 4A26A 1Y3IA 3OCWA 4H7PA 4CM8A 4EPYA 1CF2O 3NNNA 4G36A 4E14A 2IL1A 2VI5A 1VECA 4IDQA 2WT4A 4P86A 4FGSA 5K3DA 4NENA 4JI5B 4X85A 3G9TA 3RJ5A 1OI2A 1R9NA 3O2SB 3T3MB 2QJRA 1SBCA 3P27A 4F86A 4LXQA 3CEMA 2QG9A 2CE2X 5JH7B 3R9WA 1KAMA 5H83A 2J9YB 1E2UA 2WIFA 3F67A 2Q6KA 3Q8XB 5ALXA 4KE9A 2Q2VA 3N2GB 4AJ2A 3GAZA 3UMVA 2ZZKA 3ZDZB 5JZSA 1ZRHA 2EJBA 4CTOA 3HE3A 1MEEA 1RDFA 1L7RA 1UBKS 2NXCA 4IIBA 2O2XA 5B7PA 1UMDB 2FHSA 1RM3A 2PMKA 4YDQA 2VK4A 1QK4A 1U90A 1DTEA 4E51A 4Y3UA 3PICA 2V97A 1VHQA 4MSUA 2JZCA 3TAXA 3UMFA 1SXPA 2AMVA 3PQFA 1NQAO 4J0CA 3AY7A 3Q0IA 1US8B 4R3WA 4F91B 1EPUA 3QIAA 1OLOA 2IHVA 3HKDB 5CNJA 4L7QA 3W5VA 2DEUA 4KIJA 4IZIA 3P9CA 4FW9A 3CVXA 5CDSA 2OB1A 4N4AA 1RRPA 3OT1B 2MYPA 2QY6A 3EEBA 4ISBA 1YNSA 2AEFA 1KVRA 4KZPA 3LCCA 5LCXA 1XVUA 3FI0A 1JHUA 2HCJB 2W4IA 1EMDA 2GHRA 2IYUA 1GUFA 3H11A 4FCTA 1SBTA 1JVNA 1SXGA 2FVXA 4RE5A 4WKBA 3SC2A 5BYAA 3Q0TA 2QPTA 5K1ZA 1ENPA 1NF3A 2H5IA 4N7MA 5PGMA 5BNTA 5IT0A 2GBLC 1Z4IA 2XDAA 4FUQA 4IJ6A 4I7EA 3VYSB 1M76A 5LQCA 4I3FA 4LCBA 1E9FA 1NOIA 3EEIA 4KGDA 5EQFA 1V5GA 3BJZA 1J56A 4URVR 4NZPA 3BSSA 2JRLA 4HFRA 5B55A 5JPDA 1H3EA 2C8JA 2PXHA 2RHJA 5CTAA 1QB7A 3EXAA 1WE2A 1T5HX 1T8SA 2VYVA 4WY2A 2AXQA 4NAHA 3QE3A 3H19A 3HVJA 2PLNA 4TTVA 5IBRA 5BUZA 1BJRE 4RGYA 4YV1A 5CFRA 4RKQA 4NDAA 1YSCA 1MJGM 3RQSA 3VNAA 1PL7A 1T9GS 2ZANA 3NHPA 4TL7A 2C1EA 4GSYA 2GYVA 3QH4A 4E5YA 1PLKA 3WGQA 4BAZA 2R8ZA 1SBNE 4GZMA 2R1ZA 1BX0A 1LBHA 1Z47A 2ZE8A 3AEQB 4HXFB 4RQUA 3S2EA 3WIUA 1VCOA 4KQCA 3GVCA 1YT5A 3R7FA 3LX6A 1MXFA 1JIQA 2PKXA 4RYLA 1L5FA 2JD2A 3FBWA 5BW6B 4BTEA 3AF5A 3O4GA 2J45A 3I30X 3ZZMA 4WZAA 5LBTA 2QE6A 2R8YA 3AJDA 3FFWA 5L51A 2AX3A 3I2KA 1A4IA 3Q7QA 3CPHA 1XNGA 1BXKA 3QW2A 1VRWA 1SN7A 2BTQA 2FW8A 3DB2A 4HI0E 1HYQA 3HJHA 2OQVA 3T6KA 1PF7E 2RH8A 3H13A 2FRXA 2M9MA 3PGMA 4XDZA 1ZIYA 2ZT5A 1RLIA 3QZUA 1YA4A 2COUA 1Z2CA 4XQ9A 1Y6RA 1J2RA 3AJAA 1ECLA 2Y9MB 3LBYA 3UKDA 1ZN2A 3DAHA 2CL7X 2UZIR 1ZJJA 3G59A 4DREA 1H6DA 1AMNA 1LBEA 3PVCA 3QFSA 3QU2A 4E1BA 2ACEA 1DCKA 5KKAA 2OZLA 5EUBA 3INRA 3RRNA 1OSNA 3AEKA 2GVZC 4CU2A 5CB4A 1HT0A 1L1QA 1THTA 2OKCA 4IH1A 3O4RA 5KJ6A 1Y48E 1DU4A 5AKJA 1DZIA 4EUSA 2ZT8A 4OJQA 4R0NA 3GN1A 1EJBA 3GV0A 1WS6A 2HDWA 2FK7A 1TL7C 2P6OA 2XMZA 4BQIA 1SVLA 1I5OA 3EGEA 4Z8YA 4TTAA 5TGDA 3RHZA 1E7YA 2HXGA 2B4QA 1Z7EA 1EA7A 1AQIA 2V6MA 3DOEA 3NBYC 4OQXA 5AHKA 4ZVOA 4ZHQF 5KSOA 1NBEA 4AZSA 4XDGA 1W5FA 2ZJ4A 2W6QA 1SBHA 2BRUC 2F43A 1SQFA 3HLTA 5K09A 3E5NA 1MHTA 1A5TA 1J39A 4ASUA 5H1YA 1R0BA 3CONA 3L1UA 2J9RA 3L8HA 3DXZA 5SZIA 1UFKA 1VJDA 1YS4A 1INLA 1QV7A 2H5LA 2I66A 1GYQA 3F8SA 4JGGA 4P1ZA 1AGNA 1ZCJA 3W2EA 3WDMA 1A2QA 1KXZA 4N5NA 5JSZA 4ALJA 3M5WA 1JDSA 2RHDA 1HFEL 2D2XA 3DFFA 3EGDA 3L6EA 4Z9XA 2C5FA 5FEMA 3R7AA 1HQYE 3WNBA 1DPFA 4F5EA 2WFLB 2ODAA 2LRHA 3EZNA 4ZHQB 4TSFA 2R8RA 3EDYA 1UADA 2NSLA 1Q2XA 3PKJA 3LBFA 4NENB 2Y71A 3DD1A 4KR2A 2FJUA 3AXSA 3EQ9A 3IT0A 1MC1A 4QKQA 3N6VA 4JK3A 1RPJA 2GBLA 4I08A 1TPYA 4WFIA 5LBIA 1NW5A 1TDJA 1E3JA 1L8AA 4ATNA 1TUBA 4M98A 4F2DA 4U2KA 2XUAA 4ZMSA 5HUHA 4MVJH 1P2BA 1KO5A 1GAWA 2OSBA 2D4AA 1MQSA 3PR1A 4PLTA 4HDKA 3AF4A 2DUJA 1OLXA 4QJBA 4C4ZA 2H59A 1L7BA 2NVBA 4JYBA 4FYMA 1ZUHA 1LS1A 1PJRA 4UEJA 4W99A 2FN9A 3QELA 4P3OA 5LQAA 4CEIA 4NAVA 3GU3A 4BNJA 3FTEA 5EPOA 5TY0A 4MVJI 3NHKA 3F3KA 1RD4A 3FOEC 2CN1A 1N2SA 4I1IA 3RW9A 3QU5A 4MR8B 3GELA 4PLYA 4JOCA 3O84A 2LDBA 3OEWA 4ZAZA 2A1UA 4ZT3A 4CF3A 4IOLA 1OOEA 4CG2A 4N0QA 2JI6A 4B9EA 4JJ8A 4KQJA 2LZ0A 2IPNA 5KSYA 4NCAA 3OCVA 1ADCA 3KPYA 2JJ1D 3SC6A 5B58T 3I6BA 3OY2A 1J0AA 4JN6B 4LQCA 3BCUA 1N5RA 2AOXA 2EIXA 4YJ3A 5FWYA 1XGKA 1Y9DA 2JDIA 2HBYA 2GETA 2GYUA 4PYIA 3D3WB 1WUHS 1L5QA 4NMXB 4D42A 2IP4A 3F5QA 1QOQB 3M33A 3G85A 1YC2A 5LKAA 1KPGA 5BNFA 3Q7EA 2GJKA 4RWEA 1LDGA 2MSCB 2FF5A 1DUVG 4QQ8A 4PGFA 4PM4A 5JECA 2ZTUA 1GZSA 2C99A 1AA9A 4MDEA 3ZWWA 3CU5A 3VNRA 4MAAA 5LQUA 2B36A 3EZGA 1IBLB 1QCCA 4COKA 1D0SA 1XLTC 4KU4A 5CPBA 1CS0A 5CVVA 1XEWY 1TADA 3A14A 2HC9A 3VNBA 4KR6A 2P4UA 3BF8A 3KT8A 3O74A 2BKEA 4LJRA 2Q9BA 1JJVA 3AL2A 4YRKA 2GCOA 5J40A 3U80A 1EAMA 4KR3A 4A8TA 2R96A 1LX6A 3GLUA 5FA5A 1XHEA 2JFNA 1UEIA 5FA6A 1GEGA 5HFJA 3OU7A 3IKTA 1J24A 1X8XA 3ZY2A 4C4AA 5B58C 2Q3HA 1YQWA 3TSOA 3FNFA 4V1CA 2HMYB 3T9BA 2RGWA 4MB0A 1TTQB 4PR0A 4EFMA 4F3YA 2LCQA 2FJ0A 1QZXA 1H8HD 1AV6A 2ISCA 2REBA 2BRUA 2I4MA 4MVJE 3HV2A 1I30A 5ALFA 1G2QA 4RBNA 1JR2A 4Q93A 3M4YA 2OY0A 3G88A 4I1SA 3IULA 3GFOA 4CIVA 4BX3A 2ACWA 4TYYA 3EUAA 4XWOA 1E2EA 4U7PB 1Z5UA 4HBZA 4I5DA 2DKOA 4HC4A 1Z8NA 4XCVA 3SDBA 2NYRA 3JR7A 3JYHA 5KJCA 1RHKA 1RQNA 1CR4A 2FCAA 1W87A 3C7KA 3E1GA 2I1QA 4MGKR 5AHOA 3UGQA 2PX2A 1QP8A 2G7MC 2ZAIA 3EQ8A 3KELA 4Q1FA 2P5YA 1U2EA 1XMVA 4GWGA 2R87A 3HXOA 2JRCA 4TTQA 1P4SA 1RBMA 1AHNA 1GUYA 1RC0A 2AZTA 3JWJA 3MBKA 3T3DA 2PG3A 3GLFE 4TQUS 3LIPA 4X3PA 1PZFA 2H0RA 3TW6A 1QVRA 3WLEA 3B6JA 3F0TA 3ZHYA 5K9ZA 2BT4A 1R37A 1URPA 2HHLA 2IXDA 1RI1A 2HF8A 2Z56A 2YDXA 1NBAA 3DTYA 3N0WA 3NDPA 3P4YA 4FWBA 4KPGA 5IDVA 4E33A 2C9YA 5AM1A 4N82A 1U6KA 3OPXA 4S05A 1SAYA 3KFXA 4ZU1X 4JXXA 3CZRA 2QTFA 5C5IA 2ZSUA 4X94A 4PSCA 4EF5A 4YLYA 1LLCA 5K8JB 5KNDH 5H7XA 5B1YA 5JCXA 3OJEA 1ZEMA 2Y05A 1FX1A 1K3UB 1XX6A 2H29A 2OAQ1 5FL3A 3CVVA 1YL7A 4K9RA 3KKQA 3TRHA 3WBJA 1G6OA 4LXYA 2I87A 4BAGA 2PAAA 1Z2OX 5G2OA 2QLFA 1JFLA 2QJOA 1Z06A 4OUDA 2Y0EA 3LUHA 1RYMA 2I78A 4R9UC 1GL9B 1E8MA 3ZE2B 3J81k 2H2FA 4QULA 3O0TA 2XTNA 3AR6A 1D0VA 2E4XA 3OCJA 4NP6A 1WSDA 3V8PA 2QTLA 2FR0A 3M6UA 1F0KA 5JO9A 1N2IA 3TGWA 1SU7A 3EMBA 1NWCA 4DQXA 3PBKA 4R2JA 3C39A 3T0GA 3JQGB 3TRDA 2FPMA 4YMUA 3HPQA 4K6KA 3D43A 1TUBB 2VDPB 4C03A 5HIMA 5IKOA 3R23A 1UKZA 1LVGA 2I2XB 4IFTA 1IOZA 1H1LA 1G8AA 2R65A 2WHEA 1LTQA 1Y1QA 3T1YB 1Q92A 2OHGA 2IKSA 4WA7A 3QEMB 4GPZA 1S8NA 5DLPA 4NFHA 1JS1X 4YS6A 4EECA 3VR3A 1YUBA 3W5BA 4DKJA 1P4GA 2HLNA 1H93A 1XXLA 4DMLA 3L4BC 3AOEC 1YQGA 2RGGA 1TRKA 3BYZA 3JWPA 1CHNA 1CY7A 3R20A 2AUMA 3RLIA 4PC7A 1ZESA 4IDEA 5DT9A 5EJGA 4X97A 3BREA 2Z5FA 4M1MA 4HAUA 4R2XA 4II2A 2JJ2A 1PK8A 3MB8A 1PT5A 4FBGA 2FMIA 4LNUA 2OV8A 3ZX5A 4X1YA 5DX0A 2XWBF 1MO5A 4OYLA 2I67A 2JHPA 2ZIWB 1MNAA 2R7AA 2NTVA 2IF2A 2WLSA 5DWDA 3ROKA 3TFOA 2ZBEA 4L4YA 1AHIA 2QG6A 1YOVA 2J6BA 3H8SA 3TB6A 2F55A 1Y4ZA 5AVKA 3WG9A 3L4EA 4YUZA 3CMCO 5KSZA 1GNRA 1O9HA 1X39A 4CEJB 2O52A 2RSLA 5JMOA 4UBNA 1JHDA 1GPJA 1GR1A 2ZTSA 3IP7A 2EWMA 4NS4A 1QG4A 1WEHA 1JT2A 3ML1A 4GBJA 2X0EA 3IAAA 2VDJA 3S68A 5LZ7A 3GB9A 3DC2A 5DMHA 3I9FA 3VR1A 2JA1A 4RF5A 3WQBA 5E9WA 5E4TA 1ECGA 4PLFA 2C7RA 4IVRA 1VPTA 2ZS8A 3E3LA 2A7QA 3V1MA 3IOCA 3T4XA 5KU7A 1Z22A 4LXHA 4B84A 4DPKA 1U1CA 1A77A 1SUCA 2W5UA 3AM4A 3ZBTA 4IHJF 1GU1A 1OFUX 3NBXX 4BZQA 2PU5A 1BA3A 4QHSA 4FINA 4QEKA 4ZYXA 5CAEA 2J87A 4EFNA 4BRWA 5F98A 1SKYE 2O19A 1LW7A 3NHMA 5G1PA 4NQRA 3ZLBA 2NZXA 1B3BA 2A9RA 2RI0A 4IUYA 2ZS9A 4OB8A 4CLRB 1PGNA 2DPGA 1JQJC 3ORSA 4KXUA 1YJXA 3DMTC 5IUNC 2AS0A 3C8HA 1PWEA 4FBMA 4UCXA 1TEVA 1LA2A 3LFTA 4V1CB 4EHHA 5E8RA 1EE9A 3PF8A 2FWRA 4UTZA 1KERA 4K8RB 1KO7A 4ZOLA 2CXTA 2PDAA 4G63A 2N9UA 2QJFA 4WD3A 3VHRA 3AILA 3HLYA 1A9PA 4H6WA 1NHGA 1COZA 4WCFB 1XA3A 3TL2A 4GOLD 4DKXA 3T15A 3ZVLA 2Q0HA 3BD8A 4FGZA 4UHBA 3F4LA 4IICA 3ND7A 1OBOA 3UEOA 4D8XA 3KUDA 3GY0A 2ZTLA 1LRLA 2QTWB 5LLTA 3IIIA 4IJQA 2HRDA 1O7JA 3HWX1 2Q5OA 2BGGA 4LW8A 3BWBA 3F7MA 4UBMA 5KB3A 3SXUA 3TLGA 3G2LA 2Q6LA 1LZLA 2PV7A 2WNIA 2ZYDA 5SZKB 2UZ4A 1LNQA 2PUHA 1D2NA 4C78A 1CW2B 3I2IA 2HEIA 4R9VA 3IAFA 5A5FA 4MRNA 1YS2X 2EATA 5FULA 1JKMA 2XDQA 2HWYA 2DTEA 3D81A 1L7NA 1N2CA 5TIIA 1U3GA 3RU3A 3CH4B 4G89A 2WQ7A 3EK2A 3H18A 2GZHA 4L74A 4L9AA 3ELUA 1A7KA 4C4OA 5IN5A 4I4LA 2BM9A 1NBHA 1JTEA 4R54A 5BRNA 5JEDA 5IS2A 5CDGA 1B93A 4QUKA 2O20A 5JYDA 4DEXA 1XNRB 2MMGA 4WZ6A 1ZP6A 3GRZA 1FUIA 1MIOB 1KYIA 1TF2A 1UCFA 3MIZA 3VXKA 2XBLA 4Y2UA 2EWVA 3V9PA 4R2KA 4REQB 1Y8CA 1E79D 2HDNB 4MYRA 3WZMA 2HIAA 4GVXA 3U39A 3U0VA 1ACLA 2ZR7A 4UZEA 2X0DA 5IDWA 3V8EA 4DILA 1A4UA 4D0LB 1QP0A 4EB8A 2X9LA 1BN7A 3NHAA 3M6FA 1QIDA 2C9MA 2GEDA 2LPMA 2BUBA 1JHPA 1QV9A 2NYUA 4HDMB 1RC1A 4PQFA 4XM1A 3VOAA 4B82A 2AG1A 5K3OA 1ZJWA 2W22A 4KHZA 3LPAA 3ZI7A 1RJDA 1Z0IA 1YQTA 3K6RA 3ETHA 1B0ZA 4J8PA 3RYCB 3SIWA 3GO4A 1Q1NA 1JQDA 4M1WA 4BQOA 4C0LA 5EHXA 4IHAA 4Z1MA 2AT1A 3FM9A 4JEUA 1RC8A 3EVEA 1YIOA 4YK7A 3RTEA 2LTAA 3Q87B 3ZCRA 1XWWA 3LRPA 1KARA 3GFTA 1KFEB 4NU6A 1KO1A 4Q4HB 3CCCA 3ETNA 4POAA 2ZJZA 2H54A 1CUAA 2XRYA 2YW2A 2AF4C 3FY4A 3H7IA 3L7JA 4HWGA 3W3AH 4ARAA 1I94B 4GYYA 2FGJA 3O4JA 5G02A 1RTKA 2E5FA 3OEEA 1MEJA 4YJFB 1E92A 3E9YA 2PX5A 1T3TA 3Q3IA 2FRVA 4MPTA 1HYEA 1W44A 2HUPA 1L4EA 1PJCA 3AB7A 5IFKA 1Z5ZA 4FFRA 4HS9A 4RVSA 5FPSA 1JJ7A 3TVDA 4D9EA 4ZXFA 4EL0A 5DTMA 1T9ZA 2WV9A