2WJHA

Structure and function of the feob g-domain from methanococcus jannaschii
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
166
Chain Sequence
MKSYEIALIGNPNVGKSTIFNALTGENVYIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSLTANSIDEIIARDYIINEKPDLVVNIVDATALERNLYLTLQLMEMGANLLLALNKMDLAKSLGIEIDVDKLEKILGVKVVPLSAAKKMGIEELKKAISIAVKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
publication title Structure and Function of the Feob G-Domain from Methanococcus Jannaschii
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 49
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wjhA00
5HTKA 2QGZA 2FFAA 2I1QA 3QEOA 4LC1A 4LX0A 4Q1CA 2NO6A 4Q5IA 1AKEA 4BRUA 4W5WA 4CZ2A 4IEEA 3U61B 5TMPA 5E3HA 1Z83A 3X1XA 1R0ZA 3BERA 5CYPA 2WMNB 3NHBA 2W83A 2DFKB 1G6OA 2YC2C 3R8CA 3LVQE 5M04A 1BIFA 1EK0A 5AJXA 1S3SA 2QMUA 2ZR0A 4HZIA 2H17A 4QJ4A 2OBNA 3AGQA 5FTNA 1SKYE 5G40A 4LYFA 2BCJQ 2R2AA 3U44A 3NXSA 3Q9LA 1UBGA 4CEHB 3AM1A 4PPGA 5ANRB 2ZRAA 2FFHA 4HUQA 4EPYA 2XXAB 5GJBA 1SXJB 3U2QA 5KDOA 2GCOB 5FI0B 3T1OA 2NO1A 3D31A 4Q4JB 4C0JA 1ZNZA 2HUPA 4A2WA 1ZD1A 2EWWA 2JLSA 2IK8A 2XX3A 2ORVA 1HEIA 1UFQA 4X8LA 1GL6A 1OSNA 5H8WA 3WBKA 1IXRC 4OKSA 4D4KA 3U7EB 3DOFA 3K9HA 5FTMA 2YOGA 3B13B 4IOKA 5B30A 5B64A 5IT5A 2XSZA 3U5ZB 1WBBA 2WJVA 2O8FA 1VIYA 2B92A 2A5FA 4NCJA 3I32A 3MFYA 5JSZB 3ZLJA 4JVNA 1KI4A 1XTSA 1OH6A 4MKIA 2IHBA 2Z4SA 5EE3A 1T0HB 4ZIRA 2JLVA 4NYIQ 2ZRFA 4MRSA 3TH5A 3UKDA 2XSZD 4BFVA 2KWIA 4LHYA 5E4FA 1DAFA 1Z2AA 4HSEA 1XXHA 1BOFA 2WKQA 3U7HB 4MH0R 3WY9A 1YZKA 3R7WA 3SU8A 3OIUA 2CVHA 1G4UR 3R9WA 1F2UA 4LV6A 5EZ5A 2C78A 4HAUA 2H92A 1SHKA 1YZQA 1OW3B 1T8UA 4UJ5A 3LVRE 2IYXA 3PENA 4DIEA 1U8YA 4FW9A 1CJTC 1G19A 3EWAA 4Z8YA 2IS1A 2ZS7A 1W7AA 1VCNA 3SZRA 4OHVA 3ETLA 3H2YA 1FMLA 5TB5A 2NTYC 2G3YA 2YWEA 1SVKA 1XBTA 2ZE6A 3GLHE 4Y0VA 3RRNA 4L9WA 3BAFA 5A0FA 4IXNA 1YVDA 2ECKA 1VG1A 1L7VC 3QJYA 5FPYA 2ZE5A 4C3ZA 4O3MA 1T5IA 1ODFA 2E87A 3RAPR 2O8DB 1ZM4A 2BMDA 2D7CA 1Z0AA 2VHUA 5FOTA 5BYKA 3H4MA 1T6NA 1E32A 2ATXA 1GVNB 3SE0A 3GJ5A 4NYJQ 5DH9A 2FFQA 4ZKEA 3Q5EA 5JEEA 4Z1MA 4OQFA 1NNEA 1TQ2A 3AKCA 2FZLA 1Q0UA 2DCUA 4RFVA 5FUWA 3AF3A 1NMZA 1ZRHA 4CVNA 2PCLA 2VTKA 3P4XA 2LWIA 4DLUA 3PXGA 4NCNA 3NKVA 3T34A 5K8UA 5CLLA 2QBYB 3RABA 2IHYA 3RS4A 4Z1MD 4LGMA 1ANKA 4LYHA 2D3WA 4B35A 1Q1EA 3LXRA 4F92B 2HCJB 1G1MA 1YRBA 4GMDA 4RZ3A 1G3MA 2OZEA 5D3QA 4KITB 3U4QA 3KTAA 5J40A 2NO7A 2IWHA 1ZD9A 4B3FX 5BN5A 3GLIB 4FIDA 2J59A 4TT3A 1TAGA 2DWPA 4JLNA 1W0JA 4YONB 1ZAKA 4TTPA 4ZDIA 3BB3A 3QOFA 2GJSA 1P7CA 3QENA 2WWHA 2FMXA 4JVLA 5JLJA 5JWOA 4I4LA 1COWA 1VTKA 1T3SA 4NE2A 2FF7A 1NVVR 4TT3D 3T5DA 2GHIA 4HLUC 3THXB 1W0JD 2XZPA 4C0LA 2HT6A 3CRQA 5JBQA 1X86B 1RJ9B 4NKRA 3THWB 4P4UA 1OFHA 2P67A 3BXZA 3RNLA 4DSTA 2JAQA 2YWHA 2F43A 1COWD 2QSYA 1GWNA 1UBCA 3TMKA 4N0EA 2NMVA 5G53C 4B76A 1XU4A 2G0TA 1GL7A 1NN1A 4F4IA 3LWNA 4TMTA 1DAHA 4II7A 4XD7A 5IDVA 2H18A 2WWIA 1ZU4A 521PA 3D6TB 4C2TA 4PO1A 1XXHE 1Z0FA 4A4DA 1G17A 4OQLA 4UNRA 2RGNC 5JHHB 2RGNA 1EFUA 1EWRA 3U3RA 1IJEA 4PHHA 4DCUA 1RYFA 2DFNA 5B2ZA 5F9HA 4E09A 1P73A 3DZ8A 4YMVA 2CBZA 3QVUA 5AJVB 4JLJA 4XD7D 1WXQA 3K0FB 2F1RA 3BFVA 4KLNA 5GVSA 3C5HA 1AGRA 3AF2A 1Z3IX 1TMKA 5SZJA 5FTLA 2FPKA 3LAWA 1JEEA 5LB4A 3SHWA 2HDNB 1QHNA 4HYYA 4OQMA 1CRPA 4LJAA 3H84A 3SBEA 2WAYA 2IYQA 2IL1A 1IN5A 1TL7C 1YJ5A 2QROA 4HAYA 5FR2A 1XD9A 1G8YA 3RS3A 3SN6A 2QP9X 3CH5A 2CNWA 1XD2B 4KODA 4URVR 2JJ1A 1QHHB 2F1HA 4MQBA 3GFPA 4XSHA 3ADCA 3TBKA 4ACAA 4QXAA 2WJHA 4Y0AA 3K0SA 3AVUA 2B7CA 3CR7A 3PG5A 1GILA 2TMKA 5DGXA 3I3SR 2XB2A 1Z6TA 3PUXA 4MRPA 2FX3A 2B8WA 4L5BA 4URXR 2R65A 2IUUA 4QFMA 2CNWD 2NO9A 3AVYA 2JJ1D 4B3XA 3HWSA 2QTFA 1G5TA 3P27A 1VG8A 4AYWA 2FOLA 4A0RA 3SJBA 3K70C 5AUNB 4IXMA 1G3IA 1IHUA 3RC3A 3VR5A 2OSBA 2FSGA 1XDBA 3MWYW 3TRFA 5CK5A 3FMOB 4DLWA 5J5CA 4A92A 2IYRA 2YWGA 4GDFA 4OJQA 2GAAA 1WE2A 3B78A 3K70D 4Q4LA 2FU5C 1P2VA 2CCJA 4PC7A 3AF0A 2P6NA 2JJ8A 2CL7X 4PC3A 1E9BA 4HZUA 1CJKC 3AVOA 421PA 2J5XA 1E98A 4JJKA 2J1LA 1FUKA 1XF9A 3UATA 1TU3A 4PAQA 1E2IA 1VPLA 2ZRKA 2W2VA 1K5GA 2GEDA 1N0VC 3LBIA 4GT1A 2JLYA 5LD2B 1NJGA 1TU4A 2UKDA 2DFTA 4M53A 4XJXA 3QXSA 2OV2A 3WNBA 1DE0A 2A30A 2OM2A 1OIXA 2JATA 4PX9A 1UDWA 3SDZA 4XVUA 4FMDB 1NVXQ 4MYUA 3A4MA 2XGJA 4I1SA 4B47A 5JI2E 3CO5A 5IHPA 2V55B 2VL7A 3CPJB 2ZRMA 4DBLC 3OESA 4U7DA 1L2TA 2QRZA 2HXSA 4Q48A 1B0UA 1U98A 2H57A 2PZGA 1NVVQ 1CR0A 1R0WA 2W2XA 4FN5A 3U3MA 1EG7A 2DFLA 4NCHA 4DVGA 3QKRB 5H68A 2VF7A 1F2TA 4X8OA 2VH5R 5FUXA 2FEMA 1Z6YA 3KQUA 1E0JA 3NDPA 5FBQB 4PZZA 1E2QA 3IPXA 3QQ5A 4I81A 1XJQA 3R9XA 1TUEA 1QVRA 1ZNWA 1G16A 2ZAMA 3UPUA 4A0GA 2Z43A 4HAVA 2VSFA 1S0UA 2QPAA 4A2QA 5CIQA 2Q6TA 1A2KC 5HKKA 5AUPB 4D25A 3ONWA 1F48A 1GNRA 1V5WA 2KSQA 2WIAA 1YE8A 3D7MA 3B8HA 1KO7A 1N0WA 1FPMA 2VO1A 2B7BA 1Q1BA 2CJWB 1DAEA 1JXMA 4W5HA 1VECA 3REFA 4H1VA 3IQWA 5HKKD 2ZYVX 1Z06A 5E7MA 1FUUA 2BKUA 2J7PA 4JIMA 1RFLA 5CB6A 4AYXA 1N2CE 1E94E 4QG7A 1X8KA 1JBKA 4Q21A 4HLDA 4TZ6A 2QI9C 2KB0A 3AV0B 3IIMA 5DYIA 2ZANA 2ZRNA 1SKQA 2QUZA 3DEFA 4B3DA 2BEJA 1TQ6A 1VYVA 1BYUA 4GOXA 2J7PD 4PC1A 3S1AB 5F98A 4KV9A 2NPFA 2WBLC 2B8TA 2RGXA 3A37A 2O8CA 4MGZR 1TUIA 2O0KA 3CRVA 4MKHA 1RC8A 2Q9AA 2WKRA 1I4DD 1DAMA 1HE1C 1WRBA 3PQCA 2QPOA 3T15A 4DHEA 2G1JA 5HZKA 1I2DA 3IGFA 2R8RA 3HDTA 5L3QA 3GLGA 1UF9A 2ZUBA 3MWJA 2PMKA 2NPIA 2W0SA 3T1QA 5J4KA 3JZMA 3LH5A 4UNNA 3DDCA 4KFRA 2ZJYA 4KU4A 1OJLA 1T3LA 2QSZA 3OAAA 1XX6A 3MWLA 5D3MB 4B32A 5AWFC 1E96A 4PSAA 4R2IA 1R5OA 3E1SA 4MGKR 4BEBA 3K09C 1UDXA 4TQ9A 2VF8A 1R0YA 3EIEA 3K09A 4MRRA 1KDPA 3TJZA 1KSHA 3LX5A 4ILEA 3TUJC 2QG6A 2GXAA 2IUSA 1ZINA 3PIRA 4URYR 4CT4B 4V0LA 1NSTA 2D62A 621PA 2MMCA 3OAAD 3TR0A 1KK0A 2AR7A 2OE2A 1Q12A 4MGIR 5AR1A 4FMDF 2BJVA 1Z6AA 4BASA 4BFSA 4D26A 1E1QA 2BBTA 2ZJOA 3BWDD 1Z8FA 2GJAA 3QBVA 4BLQA 1ZYUA 2OFWA 3W34A 4MYCA 1CS4C 4DXAA 1XPRA 3K8YA 5LDDC 4OHYA 2CE7A 1IN4A 3I8XA 1O3YA 1UKEA 1CBUA 2ZRDA 3J81k 4LJ9A 3B60A 3ICEA 3K0EA 3W90A 1OKKA 2Q0HA 3U3OA 1E1QD 4PO8A 1MABB 3CWQA 1EGAA 1A5TA 3Q7QA 4LBYA 3B85A 1RRPA 2GETA 2XITA 4FWTA 3N2EA 2XJ9A 2IYYA 1W4BA 3AQ4A 2YYZA 1E9CA 1ZNYA 4BRWA 5B57C 4BFZA 3ASYA 2ZR9A 1U9IA 5DHFA 1KSFX 1AS2A 4OHWA 2JASA 2QT0A 2IT1A 1OKKD 5FBVB 3KB2A 4Q4HB 2CHVA 5FBRB 1X8JA 4C9BA 5FOXA 1TF7A 1OH8A 4UNSA 1KK3A 1OH7A 2C77A 3LW8A 4BE7B 2OESA 5AJYA 1HYQA 3VKGA 2ZJAA 4CF7A 2WHXA 4KBGA 4OI4A 2RGDA 5F2EA 3B6EA 4C4PA 5EP3A 4C0KA 4DCTA 1XEFA 2QAJA 4ZDWA 2RKOA 3VU9B 2QY9A 1NP6A 4B2PA 3FHCB 4B33A 2GKSA 1RYHA 3B1ZA 1X6VA 3CNOA 2HF8A 5DO9A 4S35A 3MG9A 5HE8A 1HA3A 4QM7A 2UZ3A 3LBHA 1E2HA 4O2RA 4TL7A 3QXXA 4CGZA 3CBQA 4DWJA 4PO9A 4TQAA 2YJTD 2OG2A 4P32A 1E4VA 1GP2A 3QPWA 4JLAA 4PAMA 2F3TA 3TVTA 1US8A 4Q18A 4XWAA 1E9EA 1XB2A 2EW1A 2V9PA 1ZIOA 4F38A 1KTVA 4LJ4A 3R8FA 2PJRA 4LY6A 3RRYA 4PPQA 4AWXA 1Z0IA 3LNCA 1P9NA 3GLGE 3L0IB 1W2HA 4IDHA 1SVOA 4V03A 1U0LA 4GRAA 4E07A 2AXPA 1XPOA 1FNMA 3A58B 4O0MA 4C2UA 3LBNA 3QUSA 1KK2A 4UXHA 2E9SA 2ZPTX 4Q7KA 4B2LA 2IS4A 1OE0A 2BCGY 5CB8A 3PEVA 2AHOA 1VG9B 1U99A 1YR9A 2ODBA 1CR4A 3HU1A 1P9WA 1VKJA 3SR0A 4B74A 1Z63A 1F3OA 2A9KA 1YR8A 1F6BA 2WKPA 1R5BA 3NWJA 4RFSB 3MJRA 4UKDA 3RS5A 2VP5A 1AK2A 5EXPA 4NYIR 2YV5A 1S1CA 2ONKA 1A4RA 2GJ8A 4M9SA 1JXOA 2ORIA 4P4SB 4G5GA 3OE7A 1KO4A 1J8YF 4JL8A 2PLRA 4RZ2A 4QBFA 4A8JC 2JEOA 1SKYB 2OILA 4R9UC 3R9IA 4A8JA 1XZQA 4N3NA 4BLRA 2ORWA 4WA7A 3IO3A 2BOVA 2IF2A 2QM7A 4A36A 1S4QA 2QQEA 1OV4A 4P4TA 5KNDA 4GSYA 2ZRHA 3BK7A 3OE7D 5HCNA 2FNAA 4DIDA 2WVJA 1A7JA 3X1ZA 3KKQA 1J2JA 3HYRA 2P2LA 1G8GA 1KGDA 4TL9A 4A6PA 5CM8B 2ZRIA 3ICQB 3T35A 4MKGA 3EASA 4HAXA 4RKEA 1HT1E 2FE4A 5GJCA 1AKYA 1KI6A 3UG6A 2PEYA 2YOHA 3GJ4A 2ERYA 2REOA 4GP6A 1CR1A 1E0SA 2QA5A 1R0XA 2IUTA 1UJ2A 3SNHA 3AP3A 1II8A 1BYIA 3RSLA 1UBFA 4BEJA 2BDTA 4C0HA 5CITA 4OHZA 1DVRA 2OHFA 3AVPA 1Z47A 4WXPA 3DMDA 3CPEA 4DSOA 3W6NA 3SQWA 4BLSA 1KMHA 1U0JA 1Z5ZA 2V54A 4LHVA 1DPFA 1XCGB 4DEXA 2ZJBA 3NH9A 3QVVA 2IF0A 4A82A 221PA 1M6NA 2RGGA 1XD8A 1MO3A 5FOUA 1M34E 3PJRA 2OEPA 4AG5A 3VNUA 1KJWA 4DRZA 2OT3B 2W0MA 1GIAA 1EFTA 4L15A 2HT1A 1XEXB 2H8KA 2KBEA 4QOSA 4OJKA 3VX3A 1F60A 4EPXA 1JJ7A 4OQNA 5C1BA 2J0UB 2DWOA 4DSNA 1VHTA 4KVGA 4DUGA 3K0AA 4PZLA 5L3SB 3GLHB 2ODEA 4GBMA 4DDWA 4B2IA 2YOFA 4WZ6A 2ZRBA 1QHIA 2P5SA 3K9LA 1KO1A 2GF0A 2HJGA 4PXAA 3KQHA 2VP0A 2ZE8A 4UNPA 1D9XA 2QNRA 3IDQA 3T12A 4Z54A 2BBSA 2ZJ8A 4UNQA 2C2HA 1JALA 2IYTA 4IEIA 4DUGD 4IOMA 5JCPA 2J45A 1SXJC 1SXJA 1YQTA 3BB1A 2GCOA 4WIAA 2AKYA 4Q4JA 5DN6A 1XTQA 4LRWA 3RSOA 1C9KA 1WQ1R 3FYHA 4GOJA 5AJZA 3SJAA 1PV4A 2AFIE 4B3BA 3AH8A 2JJ2A 5BXQC 4Q03A 4IW3B 2VSOA 4M1WA 1VDZA 3U44B 1UAAA 3IBYA 4IRUB 4WZBE 3CX6A 4HDQB 1X1RA 4QL3A 5DN6D 4CEJB 4LBVA 2GK7A 4IFBA 2GDJA 3K1JA 4JYCA 1ZP6A 2JJ2D 3KKPA 3GJ7A 4LPKA 3NHAA 3K53A 2V4ZA 3EPJA 1XNJA 5KNBA 5KOYA 3F0TA 1NF3A 1DAKA 4EPRA 2OCAA 1Q21A 3TW8B 3BJIC 2IS2A 4WAUA 3MGCA 4LHZA 4BFXA 3JVUA 5J4LA 4EUNA 3WYFA 3TQFA 2R6FA 4I1OA 5H70A 1ZC3A 2ZE7A 3D3QA 4LHWA 2ZUCA 4M1MA 1X3SA 1P60A 3HP1A 1JPJA 2PLFA 4EQ6A 3O47A 4UXIA 1M1YE 2CHGA 2QE7A 4B71A 4TYNA 1O87A 2F55A 1Z07A 2O8FB 4BFYA 3FKQA 2Q21A 3OEHA 4OBEA 1R10A 3CF2A 1QHYA 1FQJA 4M1YA 5L3RA 4M0LA 3ZVNA 4PTLA 4R71A 1M74A 3B5JA 4NPHA 1KI3A 3A1VA 4ZIRB 3D8BA 3GFTA 3CR8A 2V1UA 1KAOA 3A8TA 1ZJ6A 2QE7D 4TMKA 5KDLA 1IY0A 3C16C 3O8BA 1KJZA 1P3JA 2VP9A 1EXMA 1XXHB 4M2LA 3OEHD 2IYUA 2R9VA 3R7WB 5IF9A 2C96A 4R2HA 5GJVC 5FL7A 1JECA 2F1JA 5EUQB 1IXSB 1NL3A 4QC2A 4BLOA 2MSDB 3EIQA 3A4LA 4RVCA 4NU0A 2V3CC 1E0AA 2OAP1 2RHMA 4M21A 1N5LA 4B6EA 4QKQA 2WM9B 2WV9A 3GJ8A 5FUVA 5FL7D 4Q7MB 2QGNA 2X2FA 2PCJA 3E2IA 2BC9A 2BJWA 3PVSA 1XFAA 1UBEA 5BW8A 5EP1A 5KPJA 2IXGA 3T1TA 4O2LA 4P33A 3A4NA 1YZUA 2AFHE 1WCV1 2C99A 1MH1A 5DSZA 4D4LA 3GLFA 1T9HA 3H86A 2GRJA 2J0SA 3BC1A 1KAGA 2CEAA 3AP1A 5K8LA 1BMFA 3EZFA 1JI0A 1R6BX 4TTQA 5AUOB 2ZJ5A 2FN4A 3LY5A 2NZ8A 3LRPA 4CYMA 5HPYB 4N0DA 1P2TA 1KI8A 2LCFA 2REXB 4HAWA 1UPTA 2AKAB 1SVLA 4W9MC 2DY1A 1DG1G 3W8NA 1CP2A 5DNYB 1BMFD 3OIYA 1U90A 4XWKA 1MR3F 3NBFA 1SQ5A 2KJQA 3MWKA 4D80A 5KSZA 4CRWB 4JYBA 4IHQA 5BN4A 4A0FA 2J0VA 3SBDA 3ADBA 3ZDQA 3SFZA 5KUTA 5JECA 5AJWA 1E2JA 4HUTA 4HLUA 3KTAB 1NMYA 2EFGA 1MO6A 5EJEA 2ZS9A 1TTTA 1VMAA 1G41A 4LJ7A 3RWOA 2WWYA 1H8HA 2JIZA 3RS7A 3REGA 1PUJA 1PLJA 3FGNA 1IN8A 1N5JA 3L8YA 4MRNA 4J0QA 1E2GA 3SJCA 3WHLA 4F93B 4W5JA 3NEJA 1G7TA 1MKYA 3L0PA 3UANA 1GRRA 5CIWA 5EXSA 4YC7A 4G01B 1H8HD 2JIZD 3BIFA 1JB1A 3SI7A 2OLJA 1IXZA 3ZQ6A 4JLBA 4AY2A 4M22A 3GJ6A 4GNKA 1E2EA 1KIMA 4BZPA 3A1SA 1W49A 3KX2A 1N6IA 1TQDA 2GNOA 1NLZA 2R6AA 2ZYWX 1RPZA 4ZCMA 1UEIA 3DM5A 1GDDA 2F43B 3WMFA 4EFMA 2O5VA 3Q7PA 2QPTA 4FD2A 2X19A 3PEUA 1SVSA 2J7KA 4HAZA 1YR7A 1KDOA 2HLDA 3OIVA 4KFSA 1NN3A 1ZM2A 2CLSA 4TMWA 4DSUA 5J4HA 4PC2A 4CEIA 5JJIA 1TPZA 1JQLB 2R62A 2GESA 2ZJ2A 2IW3A 3KB1A 4PANA 4HLQB 2PX3A 4YDHB 1NY6A 1GSIA 1QHHA 1E79A 1ZUIA 4FXPA 1ONBA 4WW0A 5LPNA 2CL0X 2R6DA 3DPUA 4JL6A 5LBIA 2C9OA 121PA 2WAXA 3TAUA 3I5XA 3AVWA 1HUQA 4JLPA 2P5TB 3DZDA 3THOA 2OO7A 1QHGA 4GI7A 4JBXA 1Q1ZA 3R20A 2G1KA 1Z08A 3I73A 1E79D 2CDNA 2F9MA 3OEEA 1PLKA 3ZGXA 3EW9A 4BECA 5JJLA 1GZSA 5DLQC 1T5LA 4MGYR 3W5JA 4YDSA 1II9A 3U60B 3GLFE 5J4VA 1W2GA 1LVGA 2DBYA 3OIWA 5F9FA 3EA0A 3QI2A 1ZUHA 3CX8A 2GCPA 4Q9LA 2X8AA 4TLBA 3HYTA 3UWKA 2GXSA 3F8TA 2FSFA 3U7GA 1E9RA 3OEED 4RCZA 1W36C 1KNQA 2DB3A 1IOZA 1WP9A 2RGEA 4X8HA 3CW2A 4M1KA 2JLZA 2XOKA 3CUEF 2FGKA 3WNDA 3IEUA 3NEYA 4NBSA 4TYYA 1G8HA 4Q02A 1VYTA 2B21A 4LYJA 4KAXA 3KL4A 4DLVA 3K70B 4AYTA 2QM8A 1RW4A 4NDZA 1VCMA 4KO8A 1W36D 4MRVA 3B1YA 1FNNA 2H16A 2X2EA 3PUVA 2OCPA 5CJ2A 2XZLA 2XOKD 2R6CA 2A78A 5K8TA 3H0KA 1UM8A 1W46A 2MSEB 5LD2C 2ASEA 3U6BA 4Q1FA 3TVDA 1CJMA 3MSXA 1Z6GA 4JS0A 1I4LD 1L4UA 5C46F 3TUIC 4RD4A 1HE8B 3IHLA 2VHCA 1KZGB 3GMTA 4HZUB 2RB4A 4EPVA 2DYKA 4JL5A 5JEDA 4E22A 3SOPA 721PA 2ZRJA 4X8MA 5EP4A 4XWOA 4TLEA 1JNYA 1GG2A 1JJVA 2RGBA 1TNDA 4PC6A 4WZAE 2ODNA 1XJCA 2RAPA 3WXMA 3QKSA 3KQNA 2HYIC 2FEOA 2HF9A 3ZZTA 3CNNA 2GAOA 1J99A 3FTQA 2FV8A 4Q19A 2W58A 2C8VA 1Z28A 1CTQA 2CLDX 3CF6R 3AKEA 4K8OA 1J8MF 5JS8A 2RH5A 3X1YA 2WZQA 5GJWC 5FPTA 5FPHA 3RLFA 2ZM5A 1G8PA 3EX7C 4S2EA 1ETUA 1TADA 4ARZA 5DYGA 1FTNA 4NCIA 2ZUDA 1N6NA 4YLGA 3KQLA 4DC9A 4EAQA 4B48A 4YXWA 1F2TB 2CL6X 3WHKA 1VHLA 2NZJA 2QMOA 1KHTA 4OQXA 4B43A 4M1OA 5KSPA 4MA4A 4C7OA 4TYQA 3ZZUA 4ZCLA 2VHQA 4JVMA 3CPHA 4D0LB 4YXWD 1KI9A 5DI9A 1NVWQ 1L8QA 2HYDA 4IDQA 2N46A 5SZIA 1DARA 2GJ9A 2A5YB 2P65A 1OFIA 2ZEJA 2ZVQX 8OHMA 3V9PA 4URUR 3QE0A 2QT1A 2EFHB 1ZC4A 1ZM7A 2OAQ1 1LF0A 2IC5A 1QZXA 3EZ6A 2CCGA 3A6PC 3GEHA 2ZSBA 1VCOA 5AK0A 2GVZC 3VKWA 3M0EA 1AQYA 3BORA 3K0CC 4JLMA 2FDCA 1FX0A 3K0CA 1QDEA 2IYVA 4TQUS 3SYKA 4TLAA 5KDDA 3RANA 2O8BA 1JR3A 2XNSA 1XCMA 2BMFA 4D82A 4BLTA 4A1FA 3ZS8A 1TX4B 2PL3A 5EP2A 2GWHA 4GP7A 3SC3A 1L4YA 3CB4A 2RCNA 3UXMA 1AM4D 2Q9CA 2O8CB 4A9AA 1OIVA 3VTKA 3I8SA 1KY2A 2C9CA 3DMNA 4HI0E 4M9XA 4KSBA 3BE4A 1XMSA 1JR3D 3KJHA 1OHHA 1HH4A 1OFUX 5J4YA 1X8LA 4LI0A 1AQUA 4GZMA 1II0A 1J7KA 1ZBDA 4IVPA 5L3QB 4CT5A 1X1SA 3GLGB 4AKEA 3ASZA 4KFUA 2F7SA 1VIAA 1DELA 3W3ZB 4E03A 4Q1BA 2KI5A 4M4SA 4Q47A 1GRNA 1CR2A 4LJYA 3Q3JB 1A1VA 4BZQA 1OXUA 1Z0KA 2FPLA 1P61B 1T91A 2GXUA 1OHHD 4ITRC 4LBZA 4TWZA 4V0NA 4DB4A 1P5ZB 4QHTA 1E69A 2VP2A 4CEIB 4C0AC 3E70C 3NIBA 4OK5A 2OBMA 4YMTA 1DG3A 2OCBA 1E2NA 3L0OA 3FWYA 3UG7A 4DJTA 1RRFA 3UMFA 3EC1A 1OFTA 4PHFA 2CMKA 4JLDA 1E2LA 1Y63A 5C2JB 4XIGS 3LFUA 1MABA 3KJEA 4POAA 4M9QA 2MSCB 3IO5A 3F5FA 1G3QA 1Q20A 4HDCA 1U81A 2N42A 3EAQA 3TR5A 2QAGB 1G21E 2IEYA 3KUCA 1LV7A 3SQXA 3SEAA 4FWIB 1T3HA 4DLTA 1U94A 4V0KA 3MJHA 2DR3A 4NTZA 4DLYA 1RRGA 1UKZA 3SJZA 1ZUNB 4DT1A 1EFHA 3A36A 2G9NA 4LV8B 1RE0A 4DLRA 2X1VA 1EWQA 3HR8A 3LA6A 4G1UC 4KXFB 5FUYA 1EFRA 2GZAA 4IOJA 4V0MA 3T5GA 4DLSA 1OT3A 5JWHA 1W0KA 1FOEB 2BM0A 1KO5A 2F9LA 4MUBA 4F4JA 5DHAA 3O8CA 1OYYA 3IKJA 3VU9A 3QNUA 4LPSA 3IPYA 2I3BA 1OPXA 3UMRA 3KJGA 3GJXC 2EQBA 2NG1A 4L4UA 2DWQA 5FFMA 4LOAA 3PEWA 1EFRD 4JKIA 2F3RA 2IWRA 3QSYA 4CW7A 1W0KD 4QBGB 3IIJA 3OFNA 2CK3A 4DCSA 1YZTA 2J9RA 1PZNA 3FFBA 2XJ4A 3FMFA 2ZXUA 2AD1A 5KO2A 2GCNA 3M1IA 2XZOA 2Z5FA 2WTUA 2UVQA 4HATA 1JR3E 4EJSC 3C4JA 2QQ0A 3IQXA 3Q8XB 4EJSA 3KXLA 4IDOA 3OFND 2CK3D 4ZDKA 1NG1A 4NH0A 3WYAA 1S96A 2GILA 1NIJA 3CM0A 4TLDA 5FTJA 3RWMB 3CRRA 3QY0A 1IAQA 5CYOA 4AG6A 1Z6XA 2ZI6A 4K46A 2H5EA 3P1JA 5DI3A 2PJZA 5FOVA 1FL9A 4FI3C 1N6PA 1US8B 3CX7A 1KMQA 5FH9A 2EFCB 2A5JA 1PVOA 4RFSA 2V6JA 3MMPA 2O8EA 1RVDA 4TSFA 3ND8A 2VQSA 3I4LA 4Q1EA 4Q9HA 4AI6A 3TSOA 1GTVA 2DHRA 2ZSAA 2Q3FA 3GD7A 2QTVB 2G88A 2ZS8A 3LX8A 4I99A 1SGWA 1FTSA 1G7RA 3GCGA 1OYWA 1P62B 2WICA 2P3SA 3BH6A 4UXJA 5DIFA 4UQOA 3VR2A 5G41A 3RHFA 1P2UA 3EARA 4JSYA 4IVQA 4BGDA 5F3WB 1XEWY 4TZ0A 4HB3A 4TSFD 2PT7A 3ZYCA 1N25A 2ZU6A 5EXTA 4Q4AA 1KNXA 4H1UA 3DKPA 3QF4A 3WBJA 4EFLA 1TF2A 1IONA 1G3RA 2XAUA 1E2MA 4EFNA 1S8FA 3I1FA 1KO8A 1S9DA 2J87A 4PSVA 1HQCA 2ERXA 4US0R 3KFVA 1P75A 3RS2A 3VHXA 1KOFA 3W3AA 1XMVA 3V4FA 1ELOA 2O0JA 3THYA 3A1TA 1EX6A 1NKSA 3EPHA 1DOAA 2ANBA 4PHTA 3WMGA 2W6IA 4B44A 3WP0A 2IXEA 2PBRA 5JS7A 5KU1A 1XMIA 2G6BA 2GEUA 2A5GA 4FCWA 1GKYA 2N1BA 3G5UA 3ND9A 3ZIAA 1Z0JA 2VEDA 4G5OA 3LO5A 4V0ME 2EU8A 2V1XA 3KFXA 4RZXA 1DO2A 3B1VA 1E9SA 3FDIA 1H8EA 2SHKA 3IUYA 4L9SA 1J90A 3CLVA 1KI6B 2W6ID 3L43A 1M2OB 2B6HA 1MRNA 2GXQA 1C4OA 1N5IA 1EX7A 1D5CA 3ZIAD 3PUWA 4NP6A 2IXFA 1II8B 1W44A 2W00A 2Z6VA 4D0GA 1H8ED 5ELXA 4OHXA 1G4AE 3LQRA 5TXGA 3HPQA 3QBTA 1IN6A 1K6MA 4DB2A 5JRJA 2YHSA 2D2EA 1KMHB 4US1R 1CLUA 4PPNA 3FVQA 3AEZA 1IBRA 5JI3E 4EIWA 1N3BA 3IIKA 2XB4A 5FI1B 3EPLA 4G5QA 2D2FA 2JLRA 3PUZA 3MCAA 4KYIB 5KSOA 3RVBA 3AVQA 4PSKA 4ZPXA 3WMEA 4B73A 5HR5A 3DO6A 3BFKA 3GQBA 4KYUA 4TN1A 3ZVLA 1I4TD 3ADDA 3IILA 1OXVA 3CKLA 4TMVA 1OF1A 3FFAA 5L3VA 3KKMA 4CEHA 1XTRA 1LS1A 4F91B 5E7IA 3TAHA 821PA 4QGGA 2FH5B 2BBWA 3I72A 3K9NA 4M9ZA 5KTYA 1OH5A 2XXAA 4JZKA 4Q9KA 2ZROA 2AWOA 1SVMA 3C7KA 4Q66C 4TYWA 3K0AB 2HXYA 2ZREA 4LC0A 3QXHA 1XZPA 2WPDA 2D7DA 3T06B 3ADKA 2ZITA 4HDOB 4MYHA 3ZJYA 1A2BA 1SXJD 1AJEA 1AZSC 1T0JB 4MDEA 4CEJA 1NI3A 4ABYA 3GPLA 3ZQJA 4HUQB 1PLLA 2X77A 5FTKA 1TEXA 4D2IA 4EPWA 2VHJA 3WP1B 2BBOA 2WPDD 4NL4H 3U3JA 1F5NA 4HB2A 5JSZA 4DDVA 2YKGA 3AVVA 3BD9A 3TK1A 2VPPA 3VFDA 2QP3A 5FOWA 1Q44A 1P9RA 4TMXA 1E2KA 4LV5B 1U2RA 3OHMA 4YQFA 1QG2A 1R7RA 2JCSA 4L8GA 5TVKA 4B75A 3TSZA 1JAHA 1NN0A 4BZXA 1YR6A 1Y3AA 1E9FA 4G3XA 1JAIA 1GM5A 1PJRA 3KJIA 3N70A 3P20A 4LZZA 2ZQ5A 4K81B 3C15C 3HPRA 2QN6A 2OCYC 3W9YA 3N5CA 4C0QC 3AVTA 1GITA 1N5KA 3DVLA 3L82B 3H1TA 3QG5A 3AUXA 2Z83A 4LSGA 3W6PA 5G3YA 4LHXA 4QBHA 4WVFA 3RYTC 2D74A 4OL0A 4Q1DA 2FSIA 4NONA 5DISB 2KE5A 1RKBA 1WMSA 2C9YA 4KLZA 3BBPA 4EQ6B 4A15A 3VKHA 4D6PA 3X2SA 4QNRA 1NMXA 2PZEA 2ZRLA 3RRMA 1ZD8A 5EXXA 3PV0A 1F2UB 4C0SA 3PR1A 3CZPA 1W5SA 3CNLA 2O8DA 3UIEA 1RZ3A 4B6FA 4Q1AA 4ZCIA 1AS0A 2OXCA 3TIFA 4KVAA 1CF4A 2NQ2C 3BH0A 3TNFA 3U7FB 2GVDC 4PQRA 2ONJA 3QF7A 1D2EA 2Z4RA 4PAOA 1HV8A 1DADA 1NN5A 2A2ZA 1S2MA 3NTUA 5KNCA 1M7GA 4Q9IA 3B1WA 3CWZA 4QJ5A 1IY2A 1KZ7B 3MD0A 3SYNA 1BH2A 5KSYA 3ZVRA 2QBYA 1GFIA 3WRXC 2BEKA 3G82C 4CDGA 1ESNA 3A1UA 4MUAA 4AKIA 2YVUA 3AP2A 1T4GA 2P6RA 3V00A 3EWSA 3NBZC 1LNZA 2VP6A 4V0OA 2NOAA 3TLXA 1QBKC 1G5PA 5CDFA 1SXJE 1NIPA 1VYUA 3CF0A 1R8SA 1VG0B 3LDAA 4P31A 4C30A 3GP8A 3GLIA 4TYPA 2QRNA 4XOIA 2HCBA 4ASUA 4ZKDA 5J47A 2QMHA 4JT4A 1NG9A 2WSSA 5H1YA 1FP7A 1GL9B 1I2MA 1D8TA 4NYMQ 1DAIA 4AC9A 5A4JA 4GL2A 3GLFB 2NO0A 5FPSA 1XEWX 2WWFA 5FBWB 3AUYA 3LW7A 1D9ZA 1M7HA 1E1RA 1FZQA 4ZV4A 2AX4A 4QJ3A 2A5DA 1U0HC 3SYLA 4BWYA 3THXA 3U4QB 3QPUA 4ASUD 4AD8A 4CIDA 1RJ9A 2WSSD 4U02A 4BFTA 3THWA 1LY1A 3TQCA 5FR1A 4URWR 3NBXX 4IOLA 3FMIA 3Q5DA 4Z51A 1D6JA 3VR1A 1QVAA 1KDTA 2ZRCA 1E1RD 3BFXA 2P6UA 4PFSA 1TEVA 1GAJA 4RY2A 3LV8A 5EUMA 3EXAA 2GK6A 2RGAA 1GKIA 2PT5A 4Q7LA 2BVNA 4HB4A 1U8AA 3MRSA 2LKDA 1BO6A 2IA5A 1QHSA 1SZPA 4H9GA 3U3KA 1NRJB 1ZCAA 4QNMA 2IYLD 4P0TA 5EE5B 2VYFA 2AK2A 2WJGA 2ZYTX 3PFIA 2ATVA 3DHWC 3QXCA 2EVWX 1Z0DA 3CH4B 4OYHA 2CXXA 3VX4A 3NH6A 4M8NE 1Q3TA 2EYUA 3K0FA 3EG5A 5TARA 5B58C 2NIPA 3I61A 3O8DA 2ZRPA 2GJKA 5EQTA 1FW6A 4C0BA 4RD2A 4URZR 3VR6A 3SFVA 1LFDB 3ZVMA 4IDNA 4U5XA 2VSXA 2HJVA 2IYSA 1IM2A 3L2OB 1XJ0A 4G5RA 1KDRA 4QHYA 3E5HA 1XD2A 2GBLC 3AKDA 3KXIA 2GBLA 3FB4A 5EE9A 1IY1A 3B1XA 5FL3A 5C4GB 3RDPA 4DCVA 4DZZA 4YMUA 1Z22A 3U6KA 1XPUA 2KBFA 2FGJA 3I62A 2HLDD 4N1AA 1G5RA 4D81A 2QENA 3B2EA 5JHGB 2VHTA 3FPAA 1E6CA 1QG4A 3JZAA 1PUIA 4XTRA 1CJUC 3AF1A 4XVQA 3NG1A 4QGHA 4RCYA 5G3ZA 4L16A 1N0UA 2VRWA 3LLMA 1IN7A 1ZW6A 2BIFA 1HY3A 2K5UA 4G5SA 2CHQA 1B23P 5TY0A 3JVVA 3QKTA 4IVRA 4PQFA 1EESA 2G77B 4JMPA 1HTWA 1U8ZA 3AB3A 3GEEA 4MKFA 5LB2A 4I1UA 5CDFE 1HT2E 3MUFA 3PUYA 3GLIE 4DLZA 3EZ2A 2ZYUX 4RKFA 4F4CA 2JLXA 4D0NA 4NCKA 3NC1C 4RD1A 4WBSA 3WYGA 2BKEA 4JBWA 2BMJA 4IDPA 1HURA 2QTHA 1MRSA 1NLYA 5SZHB 4FMCB 2YNMA 2YWFA 4JBYA 1CEEA 3W8RA 3NC0C 1M8PA 4QGAA 2QEQA 3B9PA 1NLFA 3I92A 4F7WA 3X1DA 3BGWA 4RSGA 1DEKA 4RD6A 4Z8XA 3ZS9A 3K9GA 4QHSA 1JQJC 4A2PA 1SVIA 3VQTA 3T61A 2WWXA 5P21A 4MYTA 3QIAA 1W36B 2ZVPX 3TE6A 5CK4A 4JSTA 5GADl 3VMFA 1R5NA 4QGFA 2XTMA 3HJNA 3B82A 2XTZA 1JEDA 4ESVA 1G64A 4DDTA 3EC2A 1R2QA 3KKNA 2CVFA 2ZSDA 4KSCA 1LF5A 2QL6A 2ZRGA 4GMXA 2EFEB 2H7VA 4LCBA 1N6RA 1E2PA 1HQYE 1ZVQA 1G9XA 3VR4A 4TLCA 5JZVA 5GVRA 1AGPA 1YZLA 1YHNA 2ZSEA 4W7SA 2JA1A 2FSHA 2E1RA 2QP4A 2JGNA 4FCVA 5E95A 3FKSA 1LB1B 2J46A 1XTKA 2YZ2A 1AN0A 1GRQA 3QKRA 2W6JA 5SZKB 1A82A 4DLXA 3TSWA 1S3GA 2GA8A 1W4CA 3UMSA 2VLIA 4D4MA 5BWMA 2ZI4A 3P32A 4TMZA 4BPBA 3HR7A 5C18A 3HU3A 1WF3A 3ZZ0A 2J41A 1G6HA 4DCNA 4R7ZA 1G7SA 3C41J 4O25A 3FKSD 1SULA 4Q00A 3GEIA 1W4AA 2W6JD 1E99A 5L8VA 1KI2A 3W5IA 1FFHA 1OB5A 3FHOA 3WRYC 1GNPA 3QKSB 1E3MA 4AURA 4FMBB 1ESMA 1V43A 2CJWA 2C95A 3F3YA 3QXJA 4ZI2A 5KPDA 2W2TA 2IBMA 1CXZA 1K8RA 1MOZA 1ZNXA 4XSGA 1BS1A 3BB4A 2PMDA 4KBFA 4ZO4A 1CRQA 4RZUA 4ERNA 4JLOA 2AWNA 4OI1A 2YC4C 1WDTA 3ZD6A 3FHTA 1MT0A 1Q22A 3BOSA 2OBLA 2OUKA 3Q72A 4ARZB 4AIIA 5JRZA 1YU9A 4P3YA 4RJLA 2J0QA 4KCGA 4QRHA 3B9QA 3RS0A 1UEJA 3KDSE 3HU2A 1S9HA 3S1AA 2QMEA 3UWOA 3EA5A 5BQ5A 2FA9A 1OB2A 1YKSA 1G291 1XP8A 2OFOA 4C7OB 3WNCA 1KJYA 4BFUA 4A0HA 1QF9A 4D4JA 2AL7A 1UKYA 3NBYC 3ECCA 2JLQA 2WJIA 4GPTA 1N6OA 3TUZC 2O52A 4DEYA 2R6GA 3T1VA 5HCIA 4Q4HA 1OXTA 3DKVA 4FMCF 1E9AA 2ZI5A 4GFDA 4TTRA 1WA5A 5EE1A 2Y8EA 3M6AA 4WXRA 5FBLB 5FPKA 2WWGA 1FQKA 1G20E 1K5DA 1GNQA 2BV3A 4LDJA 1DTSA 4LK2A 2Z0MA 5D3MA 4MITA 1XWIA 3QPVA 2DPXA 4Q9JA 3NDBB 2G83A 4HB0A 1R8QA 3LQQA 2EWVA 1P4SA 2IX3A 1NJFA 4E5UA 4JVSB 1FX0B 2NGRA 5IK2A 4ZDJA 5KYKA 4NZYA 2EFDB 2O8BB 1E4YA 2PH1A 3IHWA 2AD5A 1KK1A 3QEJA 1KKLA 3LLUA 2FG5A 2PEZA 2V6IA 1XMJA 2QORA 3CIOA 4BQSA 2ZSFA 2YINC 5EZ6B 1G8FA 1P2SA 3PEYA 1BKDR 2OXRA 2ZJZA 1W4RA 2WOJA 5IK2D 3PCRB 2AXNA 1CJVC 3CRW1 1AZTA 1LTQA 1XTIA 1IQPA 4IFEA 3N2IA 3DOEA 3SHFA 4AK9A 4QBIA 4ACBA 4XTCS 5TDHA 4I1VA 2EYQA 3LXXA 2J3EA 2ZI9A 1DO0A 2UZIR 1N6HA 3KXKA 1LS6A 6Q21A 1KKMA 1P6XA 1CKEA 1D2NA 3AGPA 2C5LA 3KZ1E 3TGPA 1NBMA 4U00A 2QAGC 2QAGA 3OZXA 4BUJA 3GJ0A 4EPTA 4EDHA 2FJUA 2BMEA 1XCPA 2BM1A 4GZLA 4JKYA 2D4HA 1Q1QA 3X1WA 2D06A 5EE0A 2WMOB 4KI0A 2RHDA 2LKCA 2GTPA 4QM6A 2RGCA 1ZU5A 1G18A 3FMPB 1DS6A 3P26A 4PZYA 1Z29A 1DAGA 1LW7A 1MO4A 1E9DA 1ZM3A 2CE2X 4MDFA 1QHXA 2WJYA 1KI1A 1UKVY 2VA8A 2OLKA 2Q9BA 2VP4A 5JJKA 1NBMD 4AKGA 4JT2A 1VCIA 3P4YA 5JWRA 1N6KA 5DE3A 1YZGA 2ZTSA 2A7QA 2C98A 1WB9A 1D2MA 3VR3A 1MV5A 2FFBA 3VNVA 2I1VB 1U9IC 3B7GA 1ZMXA 1AA9A 2F6RA 5JMTA 4FCTA 1NVUQ 1KSGA 4JLKA 1RRCA 2P0EA 3C5CA 1Q57A 1CU1A 1ZCBA 1CULC 5BN3A 4DT1B 3DL0A 1J70A 2REBA 2OFXA 2FZ4A 3BS4A 4B3GA 4TL6A 3O8RA 1NY5A 4ON9A 1G3UA 5FOSA 1KI7A 3OF5A 3CONA 3CRMA 1Q3HA 2L0XA 1OLOA 2GF9A 3GFOA 3MAAC 3EPKA 4OI2A 1R4AA 2IYZA 3UK6A 4US2R 3L0SA 3MLEA 3FOZA 3W6OA 2MMGA 2I4IA 1KYIA 4EKDA 2PZFA 1H65A 1OIWA 4PQYA 5E7JA 1UADA 3Q85A 2WJJA 5K8IA 3BRWD 2WIBA 1Z2CA 2XTNA 5JCZA 1GOTA 3C8UA 4LJ6A 3EIHA 2IEZA 1E0KA 2V8OA 2GEVA 4OK6A 5TV2A 3VHLB 3GJ3A 2H1LA 1FMJA 4DDUA 1JPNA 1C1YA 5BYJA 3EZ7A 1WBDA 1FP6A 2GZHA 4AKHA 2GZDA 2R44A 4LYAA 1YZNA 2V7QA 4LJ8A 2C04A 2Q3HA 2ZI3A 3IBGA 1MO5A 4A6XA 2ZU0C 2JLUA 4P4SA 4EJSB 2IS6A 1W48A 4B3CA 3RRZA 1W1WA 2VIIA 4UJ3A 1E2FA 5CM9C 4BFWA 2WSMA 3KQKA 2O0HA 2WOOA 3EZ9A 1NSFA 1JR6A 2V7QD 3FE2A 5CLQA 2PX0A 5DI3B 4B34A 5A5GA 4M1TA 4OI0A 2ZR7A 4XH9B 2XNDA 2HV8A 1S1MA 2VBCA 5HZHA 4PHGA 2A3RA 2O8EB 2HEIA 4G0NA 2JDIA 5C4MA 3QKUA 1AIPA 4PR0A 3IEVA 1NKTA 2XEXA 4LUCA 4PPFA 4XVRA 2ZAOA 4ESHA 1GUAA 4HLCA 1NBME 4NHOA 4A8JB 5JFGA 3AVXA 2XNDD 3KUDA 2AK3A 1TQ4A 3BH7A 2BHRA 3ZH9B 4Q7JB 5IRCD 1OXXK 4DKXA 1CIPA 1IJFA 4LJ5A 3CZQA 2JDID 3QG1A 2AN9A 4M1SA 3TKLA 4Q4AB 4RD3A 4GOKA 1TF5A 3DM9B 2ZIAA 3KKOA 3QF4B 4V02A 3NVAA 3L8ZA 3G0HA 4IJMA 1GKUB 1SVWA 2Q3MA 4ZI3A 2ODWA 4RD0A 4LBWA 1AS3A 1T8TA 3ZD7A 4KJZA 3PITA 1RIFA 2FWRA 1ZIPA 4LWZA 5CJPA 3A1WA 1W5TA 3C14C 2CCKA 3AF4A 4KHZA 4YMWA 4JJZA 2WWWA 1KSJA 4HEJA 4KFTA 5AUQA 5HE9A 3THYB 1DBSA 3AKYA 2QU8A 2C03A 4NYJR 2QZ4A 4Q01A 2IYWA 5UKDA 2CLCX 3TW4A 2ZI7A 2ZETA 1G7CA 1KY3A 1SHZA 4JLVA 5KHOC 4OK3A 1XEXA 1YRAA 3V4RA 3VAAA 1ZM9A 2J0UA 4R98A 4IKEA 4NYMR 1N6LA 1E2DA 4TL8A 1M7BA 1OXSC 2FPMA 2ANCA 3GLHA 5L3SA 4WOPA 2JLWA 3RC8A 4YMSA 2RMKA 4FINA 1P72A 2G0NA 4NMMA 3I5YA 1QRAA 2F1IA 1W47A 3M4YA 2BWJA 1EFCA 3LD9A 3SS8A 1XRJA 4BLPA 1XTJA
chains in the Genus database with same CATH superfamily
3ER6A 1OLUA 4INJA 5HTKA 2QGZA 1AV6A 5WRFA 1HRKA 2A9PA 1HDIA 2MSNA 3Q3EA 3K5WA 2I1QA 4LC1A 4G9GA 1UBOS 3MZ0A 3TBHA 4Q5IA 5K6TA 3KSDO 4GE3A 1B74A 3FOFC 3RS9A 5IYZF 1OFVA 4IEEA 3U61B 2IOYA 1B8NA 1P45A 1HSOA 1N5DA 1Z83A 3X1XA 1R0ZA 1G6Q1 3PFHA 4XPIB 5CPFA 4RHEA 4AVYA 2ZWMA 4MWSA 2UUAB 2ZT6A 4M0MA 4O2BF 1CIJA 1FVOA 1KERA 1BIFA 1EK0A 3GGGA 3EFHA 3O2JA 4PRZA 2YQ4A 4X90A 5AJXA 4DYVA 2QMUA 2ZR0A 2W6OA 1J09A 2WD7A 2EDCA 3AGQA 4IJWA 1SKYE 4I8DA 3I5UA 4FB5A 3ZXUB 2LE0A 4LYFA 4J94A 3WLEA 5ALYA 3WLSA 3UW3A 3H7AA 3Q9LA 1UBGA 3M1LA 1QZUA 1ISGA 1FVXA 1E6UA 3ZZ1A 4YRBA 3OQNA 4UUAA 3I52A 5KYXB 2I4NA 1JZSA 3Q0EA 4PPGA 4HUQA 1RHQA 3T3PB 4K3VA 3IB6A 4J43A 2P4EA 1O96A 1TQHA 4CF5A 2SKEA 3NHJA 4C0JA 3LY9A 1IPHA 4MUYA 1ZNZA 4MV6A 4J0DA 4ZEWA 3IR5A 5CG2A 1ZD1A 2J85A 3ADPA 3K05A 4MIKA 5F7JA 1A5BB 2XVAA 7REQB 1G5HA 1U9CA 3K2QA 1ILWA 5D8DA 1ICIA 1UFQA 2AI2A 3RFCA 2PRYA 1GA6A 4FSDA 1GZ6A 1ORRA 3KB6A 1JTFA 4Y1EA 2WA1A 1OT5A 5BUCA 5AQEA 2PL1A 3PTAA 3VYVA 1SN7A 3ZDAA 3LC7O 2OXFA 5AIAA 2ZBEA 1ZMTA 4WEOA 2YOGA 4CKWA 2XSZA 2AN3A 1KDVA 5D86A 1FSSA 2BN4A 2I7DA 3H9UA 3WICA 2B92A 2YHUA 4NCJA 3P2JA 3ZLJA 4JC5A 1V3UA 4X94A 4L0CA 3EPPA 1XTSA 3ESRA 5EUCA 4JVOA 5JO9A 4MKIA 4AZTA 3TRJA 2QXYA 3NRCA 2AS0A 2E4WA 2O3QA 4QREA 1OTYA 2XSZD 3E05A 4KMSA 4BFVA 4MWOA 5BRJA 2HA2A 2Q49A 1YC5A 2J9GA 4LHYA 3PIIA 1NUAA 2HMSA 1E8MA 1P2GA 3IUBA 3PQDA 5LP6B 1MQ9A 4QYXA 5DHUA 3D6VA 3DZJA 3OO0A 4MV5A 2J5KA 4C4YA 2OHJA 4W7HA 3SU8A 2V0GA 3OIUA 1JYSA 2CVHA 3WKEA 1BXGA 4MMXB 4LIPD 3EXFA 5EZ5A 1ZA2A 3RB8A 3Q0IA 3C6YA 1QFYA 2RB5A 4UJ5A 4D0SA 4O2AA 3LVRE 4BP3A 4DIEA 4FW9A 4OB7A 3A05A 4I4CA 2YXPX 2XQVA 3EWAA 4FT4A 2PGAA 5JJBA 2IS1A 1YI1A 1DFGA 1AY0A 2DBQA 2XUOA 4HMQA 1VCNA 4IJ6A 5H59A 3WQRA 1UMDA 1A77A 4JI6B 1NXPA 2YWEA 4ZYLA 1SPXA 3CX4A 3BAFA 4HY3A 4IXNA 1GR0A 1JG2A 1YVDA 2JD1A 3JQ8A 4BWGA 3JQ6A 2C7RA 1GGFA 2ZE5A 1DEAA 1LH0A 1Q5PA 1T5IA 2R751 3RAPR 3SBXA 4C22A 2VHUA 1Z0AA 2NYRA 1EVIA 1SOUA 2YCBA 2ATXA 1GO2A 1ZGZA 1GVNB 4JQSA 4MEJA 4OQ4A 5CM2Z 2FFQA 1B8PA 2Q8QA 1YU6A 4GC5A 4LECA 3UV3A 1GNLA 5L7WA 4D92A 3O4GA 1JLRA 1CV2A 1VHWA 2FZLA 4ZEMA 1A4UA 1KFCB 1U7ZA 1Z34A 1U7OA 3IAS1 2PCLA 3R09A 4H7HA 2IYEA 4X97A 3P4XA 4XX1A 5EKXA 2PXXA 1E5DA 3PB3A 2CLFB 1TCCA 3DL2A 3P2OA 4MUMA 1K3FA 2DUWA 4HEHA 5LYJA 4F8YA 2PUTA 1FQWA 4DAOA 4JOSA 5CVTA 3WADA 2C1XA 1V5GA 1E63A 2CKDA 4QE3A 1LFAA 1YCGA 3DKRA 1PT6A 3G8CA 1EFAA 3KAJA 2YY6A 1Q1EA 3LXRA 2HCJB 3WMWA 1R9NA 1EFKA 3K2BA 4NK4A 4KITB 3QLTA 4R31A 2PS0A 4G56A 1U7HA 5D3QA 3VDMA 4D79A 1UCFA 3H18A 3N7TA 4Q34A 3S7ZA 3ZU5A 3ZX5A 4C1NA 3DOCA 2ERCA 3FH0A 2I76A 4PRYA 2J59A 4B3FX 4REQA 5JASA 5CYGA 2PRKA 5C1OA 2WU4A 3TL2A 3JYNA 1ZGBA 1GG8A 3KHSA 4AAYA 2UUCB 5LLTA 2HDOA 4ZGGA 4JOBA 2IP2A 3P8ZA 2WWHA 4KXVA 4QECA 1TIKA 1XVAA 1Y9ZA 1ZIXA 4Z3KA 5JWOA 4YP1A 5LZ5A 3SWWA 4YWHA 1T3SA 2EL9A 1JG3A 2AC2A 1IOLA 1NVVR 3NOXA 4ZXPA 1GPDG 2CEKA 4I3GA 4CG0A 4HLUC 3THXB 4C0LA 3BKXA 3L7KA 3WG9A 3A9VA 3THWB 4P4UA 1F4VA 1UUFA 2WF9A 2WWRA 1ZH6A 2E4UA 4DSTA 3RTEA 1YBHA 3C43A 3F8SA 1M5UA 2UYCA 4N0EA 4N3AA 2J3IA 3KLNA 3KD2A 1PQ4A 4M8IA 2X5KO 3LWNA 1P0FA 1NBHA 5DLEA 3IR6A 4TMTA 5AXAA 3IAM1 4II7A 1SCDA 4FQ7A 5B6JA 4P34A 5AJTA 3DKKA 2H18A 2BF7A 4R8LA 3EPRA 1LJLA 1T4CB 2P9FA 1XXHE 3PD0A 1G17A 3CHYA 5ILGA 1W88B 2RGNC 1TE2A 1NVKA 2RGNA 4KDEA 2GBFA 4PHHA 1USUA 1RYFA 3CF4G 3F4LA 2QSUA 1BKSB 5JALA 3RCBA 1KS2A 2PDAA 1V1MB 3GEPA 4QG3A 3UMYA 1EVKA 4CM7A 2E3JA 5AJVB 3PWSA 2JC3A 6NULA 1EFPA 1XXLA 2EGHA 5KTKA 1WXQA 3K0FB 2VUIB 4IQ4A 4J76A 4KLNA 4ZALA 2Q6LA 4DR1B 4BB0A 1AGRA 2WHRA 1X2EA 1Z3IX 5FTLA 4KPUB 1L7EA 1EDDA 1U4OA 2FPKA 2I80A 4I14A 2EFJA 4PLPA 3E9CA 1VXRA 1JEEA 3AEQB 4D8XA 4RMIA 2H1WA 4BMXA 1HNZB 5C51B 1ZD4A 5TX7A 2IL1A 1IN5A 5E1OA 4D9FA 5JD4A 2Q50A 3RS3A 2QP9X 2DTEA 4M9UA 1RXWA 1WMFA 5HOEA 1XD2B 3WA6A 1TJ4A 3PDHA 2JJ1A 3NANA 4XSHA 2F1HA 1TK9A 2C83A 4H6VA 4WBNB 2ZXFA 2ZVDA 4CIYA 1D4AA 3TBKA 1ZJWA 1EMDA 1L7MA 3BIOA 4QXAA 5AK4A 5EIFA 5BWOA 1DBVO 3CEJA 3ITNA 3LC1O 2Z09A 3LMKA 1JQ3A 2I8LA 1ZCFA 1A69A 2QX9A 3KLBA 4C14A 1D8AA 2O14A 3PUXA 4HBGA 4MRPA 3T7RA 3TX2A 3X3HA 2BM8A 2X9GA 4L5BA 1T1RA 1TYZA 4URXR 1GSAA 1XDDA 1CP3A 2QVBA 2FP4B 1ZJ5A 3DC2A 2JJ1D 3PDIA 4OHFA 5TGZA 3P27A 5TPWB 5LXTF 4HDNB 3U1VA 2E4YA 2FOLA 3U4IA 1DJPA 5B5SA 1HL3A 4K26A 1TAHA 2UVPA 5AUNB 3K4PA 1EUZA 2DT8A 2GZ3A 1UMBA 3JTEA 3M5CA 4KGXA 3TRFA 1EBUA 1N77A 2C3UA 3NRBA 4QFDA 5CK5A 1HR0B 1R0LA 2RKBA 3VI3B 5J5CA 1FYXA 4I5FA 3IT0A 2BGTA 5M3BA 1SB9A 3NEPX 2CLHB 1BDIA 1NWCA 2VATA 4O4IA 1ML3A 1WE2A 3ESDA 3FUCA 2HU7A 1LLQA 4Q4LA 1PSWA 2RGRA 1EQAA 3WMRA 1ZL2A 4WX2B 3O4IA 4JY7A 4NG4A 4PC7A 5J2UA 1XN1A 3N8GA 1M2JA 3BHNA 4PC3A 2Z1MA 3QLEA 4LKRA 421PA 3G9QA 5HFAA 4Z4IA 2G4LA 1M67A 4NI5A 3TKAA 3DS8A 2J1LA 4L2IB 4WLEA 4QELA 3UATA 4TV9B 4PAQA 1B43A 3UXHA 5F1YA 4E7OA 1XZLA 3BVPA 1K5GA 5HA5A 1UL1X 2E4AA 3A6KA 3Q7EA 1BD4A 4UOQA 4GT1A 5EJ2A 3MTAA 4L5JA 1NJGA 1TU4A 3T54A 4NNJA 1X8XA 2DFTA 5ALLA 1PL8A 1NQ5A 3BK2A 4KE8A 3NWBA 4Y2HA 4ZVVA 1KJ9A 2OV2A 2GZMA 3WNBA 1DE0A 4PX9A 5EIBD 4FGKA 1UDWA 3Q3GE 1AXGA 1GCIA 1HKHA 2C0CA 1FY2A 3SSMA 4ZICA 2XGJA 4B47A 2FK7A 4XQ9A 5IHPA 4PZ9A 4TOIA 3COWA 4OQYA 1U2DA 4CKCB 4IUDS 4OP2A 2V7VA 3CE9A 4QQRA 5EMKA 2QRZA 4FT2A 3B38A 5FAKA 3RSZA 2W2XA 2AFVA 3FPFA 3K0KA 4FN5A 4CKYA 1EG7A 2IUYA 2WVAA 5A4FS 1RYYA 2J9FB 1FFEA 1HLPA 4B0PA 5H68A 1KVTA 2V3VA 4FOTA 4MS4A 1VC2A 4BO2A 2FEMA 2FR8C 1C9MA 1ZIDA 3KWJA 1E0JA 2GAIA 2Q2OA 2Z98A 3SMQA 3TINA 3GWGA 3IPXA 4DBVO 1NR1A 4UHDA 4ZOBA 1GGNA 3ZW9A 2BD0A 2QD4A 1ZNWA 3OT1B 5A9SA 1WHTB 2LW7A 1C9NA 2OBYA 1FYFA 1UBSB 1S0UA 2QPAA 3A28A 2EKLA 4RCVA 2Q6TA 3WV4A 4A2QA 4CI0B 5AUPB 1VSVA 3K1ZA 5GZ3A 1NUHA 1H6BA 3OOSA 1F48A 5GIOE 1V5WA 1YR2A 2G6TA 4I9NA 2V5UA 4M60A 1P19A 1YE8A 3HB5X 3OOHA 4QOGA 3DPSA 5JNRA 1XA3A 4M99A 1RKUA 3I05A 1SCNE 5KQRA 3ZN2A 2E21A 1DAEA 5JADA 2PSFA 4W5HA 2Q4TA 3OQHA 2BF4A 3Q9SA 4AW9A 5LNK6 3IQWA 3I8OA 1NJ8A 3DGFC 1ZUWA 2QW8A 4KK3A 4G8JA 1Z06A 4OREX 5ISMA 3IMFA 3WAKA 2BKUA 4KVFA 3TE7A 2YYAA 1RFLA 2D2XA 3DMFA 4AYXA 5M2QA 2K4MA 1KJIA 2ZSUA 4P86A 3KR9A 4QG7A 3SD7A 4C01A 3C39A 4IIJA 3VH2A 3Q0TA 5JMOA 2Z9DA 4KOEC 4TZ6A 2QI9C 2GYVA 1ZOLA 3PQEA 3O73A 5F76A 5TRTA 2ZANA 2ZRNA 4G09A 3PQ2A 3A4IA 2JEYA 4B3DA 1FYVA 2XVZA 1H4QA 1T5HX 5F98A 4GOXA 1EUYA 1WMAA 4KV9A 2NPFA 3VGPA 2I1WA 3A37A 4JR0A 1SKUA 1E7QA 4MKHA 3TLGB 3GRYA 3FVVA 3RROA 3D4OA 3AUFA 2QDXA 1I4DD 3R41A 1HE1C 3CR3C 4GEKA 4MVJP 3RYIA 1GPH1 1OWLA 1W1IA 3TLZA 1K0FA 5HZKA 1TU0A 4E2XA 1I2DA 5KEIA 4Q15A 3EVEA 3GLGA 4GL4A 2JI4A 3WLQA 3MWJA 3DFKA 1MA0A 3S8YA 1VMIA 1J8QA 2GK3A 3G0OA 4JD5A 5C7IO 4Z4CA 1ORDA 1IATA 2FPPA 3OZ7A 5CU7A 3OAAA 4DC0A 3FPBA 4L4RA 1L0BA 1YASA 3J7TA 3B3FA 4R2IA 4BEBA 1TDJA 2Y9MB 3A2MA 4EKGA 4TQ9A 4RBNA 2H0AA 3PXAA 1RPTA 1S2OA 4P7JA 3TJZA 1BDHA 1KSHA 1DQZA 1X13A 4ILEA 4OQQA 4CTKA 2IUSA 5SYAA 2WWVD 1ZOIA 3PIRA 2GM3A 3EDCA 3JD0A 3NJRA 1QR6A 5CDHA 3GBSA 4MI3A 4V0LA 5FP0A 4B7AA 1T9GS 3OAAD 2BH2A 5AR1A 2AR7A 4MGIR 1Q12A 2I99A 3FWKA 1T2NA 4QOIA 1NNUA 3ND7A 3PKJA 4X20A 1Z6AA 4BASA 3KUKA 2WB2A 4Z9FA 2WHQA 3CZCA 4LJLA 5AI4A 4BFSA 1S3FA 1E1QA 5HUQA 3GLKA 5DBEX 5K3FA 3DGEC 4DBLE 2AJLI 3MUNA 1JNXX 1CS4C 2X6TA 3OZVA 1Q7CA 2BZSA 2OHOA 3K8YA 5BOVA 3RBZA 5LDDC 2I4TA 3BIXA 3BXPA 2Y2UA 1FZTA 4A6EA 4N12A 2M6SA 5J58A 5JQGB 3IKTA 3IV9A 1IB6A 2OP1A 4JXJA 1Z5NA 4OU4A 2B20A 1KS9A 1J22A 1SCAA 1YONA 3B60A 3DTVA 4GKVA 4OB8A 1E1QD 2FUEA 5FYDA 4JENA 1JQ5A 3CWQA 3UB4A 4YT4A 2F62A 5KC9A 1ENPA 4LBYA 2RE8A 1VE6A 2XCIA 2XITA 3WRWA 4E5NA 4UMEA 1H0SA 3N2EA 3MOSA 1L1FA 3M7IA 3QKWA 3M83A 1E1KA 5B57C 1SRRA 3HS3A 4FR2A 1U9IA 2ADFA 5JQWA 1KSFX 3AO0B 3QOWA 4YCSA 3K16A 3DTVD 1M1ZA 2B83A 3TD9A 1WUKS 3L3BA 4UNSA 4YUXA 5I51A 1KK3A 5BMVF 1FDTA 4MLZA 2OESA 1P3DA 4I66A 4RFLA 2DPHA 2QL5A 3ETJA 4PHCA 3N0WA 2RG7A 1JDVA 5DPMA 1XTVA 4HN2A 4EECA 1L5YA 1XELA 5IKOA 4C4PA 2Q3EA 2QRJA 3WWPA 1XEFA 3KP1A 1CJSA 4H59A 3TZHA 3E22A 4PF1A 4AROA 1Q0QA 1ZGJA 4RKYA 3CINA 4B2PA 4RDHA 3IMEA 1YHYA 1H1LA 3F6BX 3LKDA 4B33A 2QUKA 3NS7A 3T95A 1X6VA 1T0BA 3UYLA 3FOBA 2CB0A 2Y4OA 2I9KA 3ED1A 3TM5A 4E4RA 4YCMA 4PYNA 2JAHA 4UE3S 2UZ3A 1M34A 1Z16A 3DBHA 1ENYA 4TL7A 5EJAA 1SU8A 2FVYA 5JEDA 3LWDA 1PFVA 4PO9A 3TVYA 3QX9A 4P32A 2GN8A 1GP2A 4JLAA 4K9QA 1RLOA 3SQMA 5BQ3A 3GBPA 4Q18A 3CC8A 2V9PA 3EHDA 2QYTA 2YWDA 2AZTA 1YKFA 2D1SA 1SBQA 2A9RA 3MJFA 1DKLA 4RQUA 4JGIA 4XEUA 3L7CA 1L6IA 5IUJC 1EEHA 4K6OA 1N1MA 5CXSA 3LNTA 3LUGA 3GJQA 3DH0A 4O0MA 4O08A 3QEMA 3LBNA 3QUSA 4OFZA 4UXHA 3FTEA 4B2LA 4IHJF 3D3WA 5CB8A 4WY8A 1O6BA 1Y34E 2Y0DA 4RPJA 5AI8A 1TA4A 4WNCA 4GSLA 1JQBA 3ES9A 4UM7A 4MW4A 3TZCA 4Q37A 1Y8AA 4BVKA 2A9KA 3OY7A 2BT4A 1N3LA 2GZRA 1SZDA 2JFOA 4UU0A 1RFGE 2O23A 2TMGA 2WKPA 4HGPA 3NWJA 2VJAA 3PGJA 4RFSB 4XJVA 5ERXA 4CQNA 4KXWA 4UKDA 1E2BA 3RS5A 2VP5A 1CQJA 3H6HA 2D13A 1U3WA 1UK8A 3A6ZA 4IJVA 3LUPA 2X4LA 4M9SA 3FMGA 2ORIA 3UKJA 2HLHA 3IVRA 3OETA 4IX9A 1VB3A 3H1BA 1J8YF 1XQXA 1KR2A 3O0TA 4RDCA 5GQSA 3E3MA 2JEOA 3R9IA 4A8JA 4R9UC 4UDYX 4Q9DA 4A8JC 1SOVA 1XNHA 2ZCUA 3RU2A 3AJ9A 3X43A 3CUTA 2QIOA 2Y1FA 3IO3A 2QM7A 1L6RA 2PBZA 4AWAA 2DETA 4HXYA 2QQEA 3SHOA 2HIGA 2FEXA 4B7CA 5HBGA 5CCBA 4GSYA 4LDZA 3BK7A 2VRBA 2WTNA 3LA8A 1BHO1 3G2IA 2K2QB 3C74A 3G88A 3OZWA 4JWKA 5HKLA 3KKQA 3INGA 5K0CA 3GY0A 1J2JA 3AXTA 1NDQA 4JN6B 5G02A 1G8GA 2D1TA 4KXNA 3TOXA 1MPTA 1P0CA 1F14A 3AJ8A 1T8SA 4X45A 2JFPA 2XRFA 3LYUA 3EASA 4M8KA 4RKEA 4TYMA 1K8YB 4MR7B 2FE4A 4XD2A 5GJCA 1AKYA 3TX6A 3IDFA 4AJ2A 1LPMA 1KI6A 2A9OA 2CDBA 2FOXA 3I9JA 3KOUA 2PEYA 3SHQA 2HLPA 2JFYA 2X23A 1M2OA 4L27A 2GRUA 1MG5A 4GKJB 2PX6A 3LP8A 3E58A 3TTSA 3ZEIA 3QELA 1BU8A 3DMTC 2CNOA 3BJEA 3DMTA 3KE8A 3W2FA 3WLHA 2PZMA 2OKCA 3I42A 1WUYA 2JRCA 4X61A 2A59A 4R1OA 3K9FC 4LKOA 1COZA 3G68A 3PSAA 1MV8A 3G9XA 3RSLA 1Q91A 4OFXA 4C0HA 4JQCA 4OHZA 2Q3DA 3T6KA 3WQBA 3K94A 1N1GA 3JV7A 4WXPA 2OV4A 5ED0A 3LUDA 4QTZA 1CY4A 4RE5A 4LF9B 4EX6A 5A5VA 1Z5ZA 2VR1A 3EYAA 2P2GA 5EKUA 3IBTA 4LHVA 3UGTA 3V8BA 4B82A 3JALB 3NFRA 1DPFA 3C3YA 3W04A 4QT4A 5BSHA 4EB6B 2I4MA 2ZJBA 4P08A 2IBSA 3QVVA 4QRIA 5A7GA 1RIIA 2IF0A 3PTLA 1IBCA 1JXAA 3KB8A 3LG2A 4BP9A 3GF4A 1LX7A 4JJFA 3V34A 2XT0A 3KKZA 3L02A 1NZJA 3RJ5A 3DHVA 4N5LA 2OEPA 2ONYA 1ITZA 3JD1A 3ZWAA 2AYZA 5KCZA 4HXFB 4KP7A 1CF9A 1N2ZA 3ANXA 1GIAA 5FKJA 1EFTA 3KQPA 3GXOA 1XEXB 2C4UA 4EPXA 3H1GA 4V0QA 2YIVX 4F6LA 4RZHA 3GT7A 2J0UB 5E9AA 1BC5A 4U2KA 4DUGA 1E6EA 3AY3A 1BVHA 5HF5A 1FMCA 1X80A 3JASB 4PZLA 1W29A 4FGWA 1DBRA 2EBFX 3R4CA 1KPGA 2LNDA 5EWJA 4G8DA 3ZBQA 1GAWA 4DMMA 4WCDA 3NIWA 5CNIA 3HM9A 4MPPA 3PJDA 1RRVA 4PINA 1OLUB 5HBRA 2FN3A 4WFQA 2IY8A 1QYXA 2QNRA 2VRNA 3CEAA 5CA0A 3RAJA 2BBSA 5F7ZA 5LU8A 1JALA 3GL9A 4MTLA 4IEIA 4DUGD 3VC3A 4IOMA 3G17A 1Z0UA 4JJIA 3I6QA 4U7WA 5AVOA 1E59A 2IKQA 1YQUA 3DOUA 1XTQA 3V8VA 4AF6A 1APBA 1MTZA 1BXZA 1ZJ4A 3I39X 1DJOA 4MHSA 4MQFA 2AFIE 5AJZA 3VJLA 1FFGA 2CGEA 2Y1OA 4G23A 4ALIA 3AH8A 2JJ2A 1XRMA 3BHJA 3ETEA 4TV8B 4UD6A 4XQEA 4EG3A 2IYFA 2WD7B 3C2QA 5BXQC 5IJWA 2PN1A 5DMHA 2AZDA 4Q03A 4P4LA 3JWGA 4M1WA 2JHPA 1YS4A 2EL7A 3W77A 3UXEA 3ZTYA 1N5MA 2YL2A 1RCTE 2H08A 5LDGA 1FXWA 2VUSA 4LBVA 4WLNA 2FX2A 4D45A 2CLEB 1BTOA 2GDJA 5EQFA 3K1JA 4RA9A 4AY3A 1U9ZA 4NE9A 1O96B 2G71A 2PZAA 2JJ2D 3ZHVA 3KKPA 3GJ7A 4KGVA 3K53A 1DJMA 3CEMA 4LCEA 3IDOA 2V4ZA 3LKBA 3AIMA 5KNBA 5KOYA 3DT8A 1GDHA 5JSHA 2P79A 1NJSA 4FC6A 1YIDA 4IF6A 2IS2A 3HJRA 2YFYA 2IELA 2PUJA 3KCNA 1HTTA 4AN4A 2OQVA 2C5GA 4GF5A 5H70A 3ZEAA 2DBRA 3ENQA 4AX8A 4CKWB 1RTTA 1GKKA 1PVDA 4YRTA 1BCRA 4ZP1A 1GA1A 1OREA 5KNBD 2CHGA 2BGJA 2QJTA 1O87A 2W2OA 3GDOA 3CUKA 1QVVA 2SCUA 3UO8B 3PWKA 2ZUEA 2HCTA 1R10A 2XRYA 4J0JA 2QVCA 3CF2A 1QHYA 3C8ZA 4Y8VA 3ZVNA 1DINA 4J90A 1FVHA 1QTIA 5JH7F 3AUAA 4MI1A 8AT1A 1M74A 3B5JA 3A1VA 4QYTA 1GL3A 3D8BA 1L5MA 5KJFA 2NP6A 1E20A 1NTOA 5KDLA 3O8BA 3C16C 3FPJA 3L7MA 2ZT8A 4M2LA 5AKYA 4PV7A 4AWBA 3H2KA 2DJIA 1TJPB 2C96A 1PSZA 2R1VB 4MJLA 1BXGB 4ZO6A 5B1SA 1QK4A 3EAFA 3EXFB 2J6IA 1JECA 3AYZB 3BWEA 4DXDA 4GZ5A 3C6XA 4O2AB 1UP6A 1FFWA 5HYVA 1ZWKA 3NBMA 3SMVA 1CUCA 1I4OA 1KPIA 3DJFA 4EVQA 4C7XA 3KR2A 3C1AA 4IUCS 3F74A 1LI4A 2RHMA 4A0QA 1RADA 1VLMA 2O2JA 4L4ZA 4DOMA 2DR0A 3W8EA 4CN8A 3C97A 3GVHA 2CFOA 1UMDB 3KT6A 3D54D 4FEEA 3QW2A 1LDMA 2GZ1A 4EJ2A 4EM6A 2QGNA 4Y2VA 4FLFA 5JDCC 2BC9A 5JDCA 1U1IA 1U8XX 4U6NA 4FEYA 2IV7A 4WLVA 2IXGA 3VOAA 4C05A 4F4DA 4Z3DA 3H83A 3JQ8B 4P33A 2AFHE 5FPQA 1MH1A 1YS9A 1YJCA 4RY8A 1NFRA 1T9HA 4P8RA 5GOTA 1UZMA 1CRPA 5DGTA 2XCLA 1OVMA 2CEAA 2Q4BA 3BC1A 3LYLA 4J7AA 4OHOA 2EP8A 4ZT3A 5BSGA 5ILOA 1KC1A 4AN1A 2JKVA 3VUEA 1U2SA 2V8BA 4KI7A 3CGGA 4EF5A 5JPDA 2Y77A 4FOPA 2ZJ5A 3ZDEA 1XDWA 1Y89A 2FN4A 2NZ8A 4CYMA 3EUEA 4B8ZA 2PKRA 1YE5A 3B3AA 3EB9A 3PC2A 4MB6A 1P2TA 1Z25A 2REXB 2VDMB 1PFQA 4MJ3A 2XMRA 4FFSA 3IQZA 3G2JA 5LYJB 1CP2A 5DNYB 1M1XB 2NO4A 2ZJ3A 3OIYA 1U90A 4XWKA 3OZIA 3CZRA 3MWKA 4DWVA 3ZY2A 1PJBA 5HRCA 3FY4A 4IMPA 3OZCA 1JLMA 4XQ0A 1M2FA 1WD7A 1P18A 4JUBA 3T3HA 5DNCA 1QQAA 1IUKA 4IS2A 3NP7A 1YQEA 2R79A 5AJWA 4U2BA 3OX1A 1RRMA 4PWYA 1L7DA 1MO6A 2IEBA 1KMIY 5TR9A 4REQB 5LQUA 2D54A 5TJHA 1LLDA 2BI4A 3RWOA 3H0EA 1H8HA 3DZCA 4XARA 1NMEA 3REGA 3N2KA 1J56A 4G0ZA 3E8SA 3GVPA 3R7BA 1M3SA 1IN8A 1K75A 1JEAA 2Y67A 3SQNA 2H54A 4AUMA 2Y0BA 1BCSA 3SJCA 4NBVA 3RU9A 4ZAWA 1GRRA 1P8JA 3FETA 2F8TA 3NBQA 4LSWA 1FNCA 1TTHA 1EVYA 1J06A 1OD6A 1H8HD 2SKDA 3HBLA 3WGKA 1JB1A 1I4EB 3D8HA 2OLJA 5EHNA 2RBEA 1WVMA 3HVJA 1N7HA 4JLBA 3VOSA 5U9CA 4GNKA 5ITZA 2Q2VA 3A1SA 3BTSA 2GNOA 1TQDA 1U7XA 2R6AA 2W4QA 3KX2A 3AFGA 3IEIA 3QLJA 4ZCMA 2YUIA 5L9AA 1Z5WA 1P6QA 3DE5X 3QWFA 1EE2A 3KT0A 2O5VA 4YK7A 4H1WA 3RO7A 3VZRA 4Q6WA 5JXWA 4PS0A 1SVSA 3VH3A 3P9KA 1JLKA 4KFSA 5F51A 2CLSA 2C9BA 1M6YA 4TMWA 1C3XA 5JJIA 4UHHA 3OQIA 4WKBA 1ID8A 3EUAA 2GESA 1VMKA 4PANA 1U28C 2X5JO 5FORA 4BL5A 1QX4A 2PX3A 2OP0A 4KIJA 1CDOA 1ZS9A 4NIMA 3DLHA 3VDNB 5B3JC 5B3JA 3QPCA 1Y1QA 3KO8A 4JBHA 5JUWA 1QHHA 1X39A 1ZUIA 4FXPA 1ONBA 1ZGGA 4WW0A 5DASA 4E1BA 5KMGA 4GYYA 1O5TA 1EFPB 1SU6A 2C9OA 4C03A 4ETIA 3GAMA 2ILVA 2WHPB 3HFSA 4Z5XA 5AVTA 5ENZA 3H2JA 4AJHA 2AR0A 3ABSB 5BQXA 3O82A 5MN6A 4X62B 4JUDX 5HS4A 2GKOA 1QHGA 2OO7A 3P0RA 4GI7A 4AJKA 4REMA 5HRAA 3Q7IA 5CCXA 3ONNA 4JV5B 4RVFA 1RQXA 2PH5A 1BWSA 4QUAA 2NTNA 1E1NA 1R66A 2E48A 3GRZA 4FYXA 5AVWA 3A32A 1RZVA 2CUZA 4MI6A 4TGLA 4FS8A 2XKKA 3D43A 3U60B 1WB5A 1W2GA 3FBTA 1B6RA 1KP3A 3FNHA 1PR5A 4EL0A 1WUTA 3QI2A 3OY2A 4Q9LA 1KYYA 2X8AA 3HYTA 1P0PA 3PDUA 4DCJA 5THQA 2Q29A 3UWKA 2GXSA 4YJ2A 2ISCA 4DCCA 1Y98A 1PFUA 2WTAA 3K72B 4RCZA 5HP4A 1KNQA 1W36C 1P4RA 1WP9A 3TZQA 4GYJA 2OHGA 3DOHA 4FYMA 1U2EA 1DDIA 2HSDA 3PDIB 2A58A 2G07A 3IEUA 4PVDA 3S5JA 1G8HA 1PWXA 3RG2A 1JU9A 1CF2O 2OV8A 2HAEA 4HV4A 1XZBA 4DLVA 3OCXA 4IJKA 2UVPB 3V8PA 4BFLA 5HM6A 1IWBB 2ZTVA 4PG7A 3SICE 4CIAA 1UMBB 1W25A 1RW4A 1I1OA 1G20A 1W36D 4MRVA 2GERA 3CUWA 3QFHA 1C9JA 1GZDA 2FG6C 1HYHA 2OORC 2OORA 1B0PA 1JP7A 1U2TA 3C3JA 4UUPA 4QOJA 4U39A 1D1SA 1MN6A 5K8TA 5HEKA 3K6SA 3H0KA 5FRDA 1DCMA 1W46A 3VBEA 1FLNA 5DBGA 1Y1PA 3GOQA 3RIHA 2ASEA 1TRKA 1SKBA 4AP9A 1CJMA 1U1EA 3N7AA 1DCFA 1DTWA 3F97A 2PUGA 1L4UA 2KM1A 2PJDA 4JI0B 3KELA 4PTZA 1B1CA 1IN1A 3VYSB 4GWLA 1FYEA 3DB1A 3F2VA 4DM3A 3FI9A 2AJBA 1WB4A 3Q88A 4XQGA 4RENA 4QDTA 4OHCA 2BE9A 4D8YA 1GNSA 4BJHB 4EG6A 1QCZA 2GX6A 3P94A 4F11A 1JUDA 1XFDA 4OUDA 3A6GA 4G0VA 3GJZA 1GG2A 4J0EA 5U4XA 1TNDA 4YUYA 2FQYA 3ZCQA 1UFVA 3ICOA 1BMQA 2O20A 1ZISA 2G1AA 3AMVA 1UPUA 3DLAA 5BQPA 3F3SA 1CY8A 4RX1A 4D44A 2HF9A 3ZZTA 2YFHA 2GAOA 4OU5A 3U1TA 2FEAA 5CW1A 3X44A 2W58A 3CY6A 5JT1A 2IODA 1G0NA 4EGSA 2VYVA 2CLDX 2O5RA 3QUCA 3N2GA 1CC1S 2EZTA 1PR6A 2IYNA 2C7BA 3L6CA 4ZI7F 1HYGA 2AW3A 2BZGA 2D00A 3EX7C 3SF8A 4UBKA 1TADA 2CWDA 3W5SA 5DYGA 1FTNA 3SAJA 2ZUDA 1RQNA 4DC9A 4B48A 3SQDA 2I2CA 4MS4B 4DCGA 1AQLA 1MDBA 3BTOA 2BTOA 2WIDA 4DWOA 5AW8A 5LA6A 4ARIA 4OIFA 2J9XB 3OWXA 1XROA 3HKDA 5DBFA 3NHRA 4RK6A 5FNZA 3DT9A 3NTOA 4OXRA 3UY4A 3WLPA 1PR9A 3QNMA 4IIVA 4BPRA 5A9SB 2WZDA 2RHHA 3FJOA 5A1TA 3H9BA 1UPBA 2LR0A 3ROFA 1PJ8A 1M75A 5LBTA 1M83A 1FS6A 1KI9A 1J39A 4KH1A 2O8NA 1NAHA 4TTTS 3ZCXA 5HJ2A 1L8QA 1R37A 2BUAA 3W5HA 4MV3A 5SZIA 1RRKA 2NNLD 5BPHA 5IVHA 3CG0A 2XQJA 1DARA 2GJ9A 2ZEJA 1GPNA 2FK8A 2ZVQX 3RRFA 2W4IA 1Q6ZA 1EINA 4QIHA 1ZC4A 4CG2A 1K7YA 1LF0A 2EG9A 2FMKA 1SM4A 2VPYA 4YLEA 3WJAA 1K98A 1DEXA 1PWHA 2C4TA 3EDOA 2ZSBA 4XQCA 5C3UA 5SY9A 3SIWA 4A03A 3K9WA 1EUCA 3RFXA 1M5RA 4L95C 3TD6A 3T7EA 1J2TA 1S02A 2XMZA 4TT8A 5A4DA 3VKWA 3M0EA 4PLZA 3K0CC 3AETA 3K0CA 4TQUS 2G4VA 1YDWA 4TLAA 1THMA 3SYKA 1U1GA 3JPYA 4DIKA 4IIJB 3VZBA 5I7HA 2ZCJA 1XCMA 4B2YA 3A6DA 4D82A 2HFJA 2V97A 3DDOA 2V6BA 3SSAA 4MIYA 4PLCA 2PWAA 4Y2UA 2PL3A 3MOGA 4GP7A 1L4YA 4R4JA 1NULA 2AJDA 2RCNA 2YQZA 4MZXA 5TNXA 4Y18A 2FQQA 2WU1A 5B6IA 5LLDA 2OZLA 1PD1A 1A9XA 4HI0E 3N76A 4I5DA 4KSBA 3RYIB 3BE4A 1XMSA 2HJWA 1OHHA 1HH4A 2DE0X 3MMSA 2H2GA 4IH9A 4L6AA 1SEPA 1MHTA 1X8LA 4ZGWA 2LXNA 3QE9Y 1LBSA 2Y1XA 3DE0X 4QO7A 3D6UA 3GLGB 4AT1A 4MWDA 5CPBA 3BREA 2QM0A 2X7HA 4OGKA 3OTOB 4WLOA 1CR2A 2M32A 3OQPA 4GGOA 1PJ3A 4LJYA 1JDSA 2FPPB 4GR4A 1Q92A 4YRIA 1FLAA 1A1VA 4H0NA 2WFMA 1OHHD 5LR6A 4RLHA 3U56A 4QHTA 3HL0A 5J9FA 1I14A 1IAVA 2R85A 3B12A 3TLJA 2JFFA 4I55F 4G4GA 4LSZA 4XB6B 2BEWA 3JQBC 4U0KA 4AM8A 4D9JA 4PN7A 2OCBA 3AFOA 1E2NA 5HZGA 3F4BA 1R9GA 3LM8A 2ZAGA 5IJAA 4AMYA 5GTDA 2WUDA 3OEYA 4ZTUB 4JEHA 4QAJA 3VMMA 5IJ9A 1OFTA 4WESA 3N39C 1IG0A 4WUTA 1R6AA 1T2VA 1EHCA 2B34A 2R5NA 4LDRA 5C2JB 3KJEA 4X20B 3CNBA 5LLSA 2MSCB 2PSDA 3DAHA 4MULA 1HNXB 4NBTA 4ZARA 5BWCA 1YFJA 1PUXA 2I8CA 4HDCA 2N42A 3EAQA 1KBZA 5K3FB 1RABA 3OOJA 4OAPA 1VIDA 1LV7A 1S2IA 5LMNB 3ZDBA 1P80A 3H11B 4I6EA 4JHXA 3AF5A 2JHFA 1Y4AE 4BCDA 1ULAA 3WLFA 4DT1A 3EEIA 2ZQYA 3OF2A 4O3FA 1TKBA 3LUCA 3DTVB 2G9NA 1KRWA 4RGBA 1RE0A 3CT4A 4MP3A 1HOXA 5DN9A 5LN1A 4O59O 2GZAA 2DUJA 2MSLA 1C1XA 2XTJA 2X8LA 2A88A 3DE4X 3MB5A 3GAAA 3QU2A 4KN5A 4E3ZA 1FOEB 3VU0A 4ZC8A 4MUBA 4MCAA 3I5MA 4OV6B 4F4JA 3O8CA 2CNLA 3O75A 3QNUA 2ZATA 2JFUA 3DYVA 2ZIEA 2A7XA 5EHIA 4H17A 4RTLA 1MJFA 1GEEA 1XRQA 3W9UA 3AW9A 5AM4A 2JS7A 4L4UA