2WJHA

Structure and function of the feob g-domain from methanococcus jannaschii
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
166
Chain Sequence
MKSYEIALIGNPNVGKSTIFNALTGENVYIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSLTANSIDEIIARDYIINEKPDLVVNIVDATALERNLYLTLQLMEMGANLLLALNKMDLAKSLGIEIDVDKLEKILGVKVVPLSAAKKMGIEELKKAISIAVKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Feob G-Domain from Methanococcus Jannaschii
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal transport
molecule keywords FERROUS IRON TRANSPORT PROTEIN B HOMOLOG
total genus 49
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wjhA00
4NE2A 2AKYA 2WMOB 4C4PA 1W46A 2J3EA 3GLFA 4AY2A 3C41J 2VHQA 5E4FA 1TL7C 1ZM7A 4QGFA 3VNVA 2QEQA 1W44A 5LB2A 1CJKC 4IOLA 3MUFA 2JJ2A 2CLCX 2CK3D 2OXCA 3K9HA 1JEDA 2MSCB 3K1JA 2VH5R 1G291 4DCTA 2J1LA 1A4RA 2V8OA 2I3BA 1G8FA 4BFVA 2ORIA 2GEVA 3KUDA 4M8NE 4EQ6B 3I32A 4HUQA 4ZDIA 5JI3E 1HUQA 2Y8EA 4DCVA 1MABA 4RD4A 2EYUA 4CEIA 1PZNA 3ZVLA 1VHTA 5L8VA 1II0A 4XVRA 1VCIA 4BLPA 4LBWA 5E7IA 1IXZA 1WRBA 2Z0MA 3LVRE 2O5VA 5LD2C 2IK8A 1EWRA 1W4RA 3CF6R 4OQFA 2E1RA 1BS1A 2P2LA 4RZ2A 4X8OA 2VHCA 3VQTA 3AVOA 1R0XA 1UPTA 3TSOA 4Q9KA 3AVUA 2WJIA 3BERA 4CIDA 1OYYA 3A1VA 1QHHB 1HYQA 4D80A 4ZCIA 2PT7A 3Q7PA 4NP6A 2WWFA 1RKBA 4HEJA 5FTKA 1Z63A 2DB3A 4CT5A 2O0JA 4PX9A 4JMPA 3SFVA 2ZEJA 2AXPA 3WHLA 1XD8A 3GLIE 1DADA 1SXJB 1Z2CA 1UKZA 3B7GA 1VG9B 4TL7A 3ZH9B 2RB4A 1I4DD 2PEZA 4B3FX 1UKVY 3GEHA 1ZP6A 3TAHA 5K8TA 2ZYVX 4TLEA 1VKJA 3VAAA 4TYNA 1R6BX 2IEYA 3EG5A 3ZD7A 3PEVA 4AKEA 4FWIB 5KU1A 4IHQA 2REXB 2WKRA 4FMBB 3VFDA 3O8RA 2I1VB 3RS3A 4A2QA 5FPKA 2XNDA 4Q7JB 1DAIA 2GEDA 5KPDA 2BMDA 4Q5IA 3SBEA 1CULC 3RWMB 3BOSA 5FBRB 4DDTA 2KJQA 4XTCS 3IGFA 1HT1E 2IWHA 2ZI7A 5F98A 3SNHA 4RD2A 4NYJQ 3GFTA 2QENA 4HZIA 1GSIA 4RD6A 5FBVB 1CJUC 4B33A 4R9UC 2QP9X 3NBZC 4I99A 4MGKR 3LBIA 4KV9A 4HLUC 4NBSA 5JRZA 3I61A 4KYIB 5FTJA 2WJGA 4KSBA 3KJHA 4QC2A 4DKXA 4GSYA 4PC2A 1KAOA 4KODA 1NY5A 1E4VA 4OQMA 2IT1A 2YINC 1TMKA 3FKQA 2R2AA 2P67A 3TIFA 4NYMR 2WICA 1XB2A 1CEEA 4NZYA 5AJYA 2Q21A 1NIJA 2YYZA 4TMZA 3U6KA 2BCGY 4C0KA 1PJRA 5FBLB 2F43B 3HJNA 2FGKA 1RJ9B 3ZD6A 3DZDA 4HUTA 3M4YA 2XGJA 3TR0A 4WXRA 4GRAA 4B74A 1TPZA 3P20A 5K8UA 4YLGA 4Q1DA 1OXTA 3BE4A 1F5NA 1LS6A 3GCGA 1KK2A 4A8JB 4ZDKA 5FUXA 3L8YA 4ARZB 4E5UA 4OHXA 3QXCA 1KI4A 3L0OA 1ZM4A 2MMGA 1X3SA 4OJQA 4OHYA 3QKSB 3BORA 2PZGA 3HU2A 4US1R 2O8FB 2WPDD 3ZZUA 4TL6A 3ZDQA 3Q72A 3RS5A 2JLYA 4N3NA 1Z47A 3KZ1E 1R10A 4XH9B 4EFLA 4BZXA 1FTNA 5CITA 2GF9A 4BFWA 3PUZA 2O0KA 1VCOA 2ZANA 3MWLA 4A8JC 2OHFA 5JZVA 2XITA 4M9XA 2YNMA 4ZCMA 3GLGB 1A7JA 1JQLB 1SXJD 521PA 2EWWA 4HAWA 3QY0A 1OB5A 3AVPA 1Z22A 4M22A 3PUVA 4ZIRA 3G5UA 4URWR 4QJ5A 4DVGA 1FZQA 1VG8A 3CRW1 1D8TA 4GZLA 4PO9A 1KK3A 4AYTA 4BASA 2WKQA 3RWOA 1KDPA 1N5LA 3FFAA 1X8LA 4YDHB 1ZYUA 1AS0A 4DWJA 3NH9A 4E07A 4YMUA 1P60A 3FE2A 2OCAA 2J87A 4M1OA 2FEOA 2QM8A 4JVMA 1EFUA 2XB2A 1NN1A 1UDWA 2IYYA 1XTKA 4OI1A 1BKDR 2VF8A 2GETA 2A5FA 4MKFA 2BBSA 3DDCA 2D4HA 2PX0A 3V00A 5CDFE 1ZW6A 1T3HA 2J9RA 4Q9HA 2ZRIA 2GJ8A 2RKOA 3EW9A 2GXAA 2N46A 5JSZB 2LWIA 5KPJA 2C5LA 5JEDA 4AWXA 5HE8A 1T4GA 3GPLA 2R6AA 2RCNA 5JCZA 2J0SA 2BMJA 1XJ0A 5AJWA 3FHCB 2OESA 2PJZA 1BO6A 1G7RA 4B2LA 1P9NA 2BV3A 5EUQB 3R7WB 3OFNA 2CVHA 2H7VA 421PA 1OXXK 3PG5A 2WWWA 3T34A 3U3RA 1NLYA 1XNJA 2I4IA 3ASZA 4LZZA 3AVQA 4FIDA 3UKDA 5FPTA 4A4DA 4EPTA 3SJAA 4V0MA 4ZIRB 1J2JA 4U7DA 1IY2A 1GKUB 2PLFA 3AF1A 3TLXA 3ADCA 4BZPA 1Q21A 1E2NA 2FU5C 1DAEA 4QGGA 1U8ZA 2NO7A 5EP3A 4ASUD 5LDDC 2D06A 1GNPA 2QORA 2BJVA 3D31A 1E1RD 1HQCA 3BFXA 4Z1MA 3U44A 2YHSA 4ITRC 3KJIA 2NO6A 2XJ9A 1ZINA 4LV6A 3GJ5A 3FTQA 3GJ6A 3RS7A 4EQ6A 1R0ZA 1S9DA 4LDJA 5HCNA 3BJIC 2AN9A 3FKSD 1KYIA 2B7CA 2QSZA 3CH5A 4L5BA 1PUJA 3TMKA 3TQFA 4DLVA 1IXRC 1YRAA 2JJ8A 3AEZA 5FI0B 2NPIA 2ZRLA 3C5CA 5JS8A 2ZRJA 3WMGA 2J0VA 2W2VA 3PVSA 1UJ2A 3LXRA 1T6NA 2IUUA 3BAFA 1OFUX 2ZS8A 3OESA 4XVUA 1FQJA 4IVQA 2Z83A 3AKDA 4UNQA 2ZREA 4QG7A 4CW7A 1H65A 2VHTA 4B75A 5CIQA 4C2TA 1TEVA 3EPLA 2CXXA 1HV8A 4IEEA 2Q6TA 2GXQA 3GLIB 2ZVQX 1JR6A 1QBKC 2ZXUA 5DN6A 2OCPA 2ANCA 1G7CA 1Q1BA 2HJGA 4LHXA 3ADBA 3PEUA 4JBWA 1YR8A 1JAIA 2J0UB 3AM1A 1XD2B 4JLJA 1NMYA 3NVAA 3R8FA 1AM4D 1UBCA 4RD0A 1ESMA 1JNYA 1XD9A 3HYTA 3TGPA 2VTKA 2CLSA 2D3WA 2DR3A 3CF2A 1HURA 2WMNB 1W2HA 4TMXA 4UXIA 1D9XA 4AC9A 3BD9A 3EZ6A 2PCJA 3N70A 3PJRA 2WKPA 3X2SA 1CR1A 4MYHA 2CNWD 3H86A 2P65A 5TVKA 5J4KA 3CNOA 1MR3F 1DTSA 1P2VA 2D74A 4MITA 2CEAA 4Q1CA 1BOFA 1G3MA 4EKDA 1P5ZB 4EFMA 2HCBA 2D7DA 4JIMA 1E9SA 2IYRA 3U7GA 4IRUB 2DWOA 4NYMQ 5CM8B 3L0PA 4HDCA 3ZS9A 4QM7A 2FDCA 4PPFA 4EPRA 4MGYR 2OILA 1E2PA 3OIUA 2IBMA 5AR1A 4PC6A 3ZS8A 1CU1A 5LBIA 1SVLA 1US8B 4DB4A 4BFXA 1IY0A 2DPXA 4UJ5A 3GJ4A 1NRJB 4DLWA 5ANRB 4A0HA 1G18A 1ZM2A 4XSGA 4NPHA 1BYIA 4L4UA 5EXXA 4ZDWA 1JQJC 1ZC3A 1J7KA 4QBHA 5KNCA 3GEIA 3N5CA 3SHWA 2NZJA 2F9MA 1Z6TA 1JPNA 3PIRA 1Q57A 1M8PA 1SVOA 2PMKA 1DG3A 1Q1QA 2QN6A 4NCIA 4TWZA 5KOYA 1ZRHA 1BMFD 2JLWA 1KY2A 1HEIA 1E3MA 2A5GA 1KJYA 5BW8A 3CPEA 4DUGA 1ETUA 1XF9A 4MYTA 2Q3HA 1XJCA 2J41A 3NG1A 4EJSB 4DSTA 1RRPA 1OIXA 1J8MF 1XZQA 1AKYA 3CNNA 1XXHE 2W2XA 3CPJB 4GBMA 2WVJA 3IBYA 3N2EA 4KLNA 2BEKA 4L8GA 4MUBA 4LJ4A 2CHQA 4WZAE 1U8YA 3FWYA 4S35A 3T12A 3QI2A 1XMIA 1OV4A 4JKYA 3WY9A 5AJZA 4Q4HB 2VP9A 4OHWA 2QMEA 2V1UA 3A1SA 1LTQA 3B9PA 1ELOA 4CGZA 3PXGA 3UG7A 4KI0A 3ZVRA 1R0YA 2AFIE 4V03A 4HB4A 3O8CA 2ZJBA 1NI3A 4RZ3A 4B3XA 1E9BA 3HDTA 4BRWA 1D9ZA 1G6OA 4P32A 2ZJYA 3MRSA 4OQLA 5FOSA 4CRWB 2CE7A 2WIAA 5FOXA 3D3QA 2CLDX 4XIGS 4A0FA 1IJFA 1W47A 3A37A 1YE8A 2FPMA 3U3OA 1KK0A 3ZQ6A 3KXIA 1GITA 3RANA 2FZLA 3CUEF 2EVWX 3OE7A 2V55B 3CZPA 2QP3A 3EWAA 1XPUA 4LHZA 2H16A 3QEJA 4W5HA 5G3ZA 4DB2A 4HLUA 3WHKA 2FF7A 4GL2A 1NBMD 4GFDA 4G1UC 1IQPA 2ZYTX 1P2SA 3V4FA 4LY6A 3K0SA 2F7SA 4WVFA 4Y0AA 2JATA 1RYHA 3DKPA 3VR5A 1GL6A 3DMDA 2FGJA 3W5IA 1G8HA 1N6NA 2GZAA 1CXZA 2ZJOA 5LD2B 1QHNA 1US8A 4GP6A 2O0HA 4FMCB 4YC7A 3BK7A 2A78A 5B30A 4Q19A 2DBYA 1TNDA 4BLOA 4U00A 1W7AA 4BECA 1UKYA 3X1ZA 4PPGA 3OZXA 4HAUA 4JT2A 4OJKA 1NBMA 3IEUA 1X6VA 3TSZA 2OCYC 3OE7D 3VR6A 721PA 2WWHA 4CEIB 4MYUA 4TQ9A 2IYTA 1TQ6A 1SHZA 1VG0B 4W5WA 5G53C 1RVDA 2GJKA 4CYMA 3W34A 5JBQA 5EZ5A 3DVLA 1L4UA 1XEFA 1EK0A 4G5OA 2ODEA 1Q0UA 2G88A 3EARA 4HZUA 5AJVB 4DLZA 1Z0JA 4ZDJA 2QQ0A 2H92A 1J90A 2DWPA 2AD1A 3BBPA 1YR9A 5C18A 1KTVA 2YOHA 5GVSA 1QHIA 3NHAA 4AG5A 3BRWD 2BKEA 3GLFB 2LKDA 3THYA 3DZ8A 1NLZA 4P4UA 3VU9A 2W6ID 1RYFA 4XJXA 1P7CA 3SS8A 1W5SA 4H1VA 2G6BA 5CJPA 1KKMA 1OF1A 4P33A 3RNLA 3IO5A 4HAVA 3T15A 3K0AB 4XWKA 1X8KA 1W0KA 2WWYA 5GJWC 1XMJA 4QBFA 5CK5A 1DBSA 2CVFA 3OEHA 3PENA 1Y63A 2UVQA 2IHYA 5BN3A 1WF3A 4GZMA 4I81A 1KK1A 1H8HD 1II8B 2FFQA 3K0CA 4MKGA 1EG7A 4OI4A 4PPQA 1N6LA 5D3MA 2QNRA 3M1IA 2X19A 4JYCA 4BLTA 4OYHA 3EA0A 3QPWA 3A1UA 3VHXA 3TUJC 3TK1A 4NL4H 1G5TA 1SULA 2RGGA 3TVTA 4B76A 2ANBA 2NQ2C 2GCNA 1YZQA 1W36D 3CLVA 3QNUA 4E03A 1P75A 2C95A 5KTYA 4KLZA 1T3SA 4RD3A 3CX6A 2QT0A 4D4LA 4BPBA 4W5JA 3CBQA 3J81k 1ZM3A 4RJLA 3GJ8A 3FMFA 3KB2A 4I1OA 3V4RA 1W0KD 2QRNA 5B58C 1RZ3A 2FSIA 4TMVA 1F2UA 3GFPA 4DT1A 2ZRDA 5J47A 2ZR9A 2IYXA 2VHJA 4LX0A 1Z0IA 4OK6A 3W8RA 1E2DA 3B82A 3U3JA 2ZETA 3C7KA 4LI0A 4F92B 2CCKA 4R2IA 1VIYA 2P0EA 1E99A 4MKHA 2GA8A 1TAGA 5JHGB 4OBEA 5L3SB 1Z6YA 1X8JA 5DHAA 2GDJA 2XNDD 4P4SB 4NYIR 2RGAA 3KL4A 1PLLA 3PUXA 1KOFA 2F1JA 4GOKA 4MRPA 4Z51A 3QF4B 4Q18A 5EXSA 1ZU4A 4QHYA 3PEYA 4YONB 1E9RA 3Q9LA 3SJCA 2PT5A 4M0LA 4M1MA 3EXAA 2XX3A 4URYR 1U81A 2IYWA 4M53A 5JS7A 1P72A 1FFHA 3OEEA 5FPYA 2AKAB 5KDDA 2J7PA 2PX3A 4KAXA 3QXHA 5LB4A 4C9BA 2ZSEA 5FTNA 3I3SR 3HWSA 1M34E 3PITA 2R6FA 4LBVA 4JJZA 1YZKA 4PO8A 4TLCA 3VR3A 4NTZA 4TT3A 4BFSA 3E70C 4L15A 1WCV1 5E7JA 5G40A 1MT0A 4GNKA 3SOPA 5L3QA 1Q44A 2XTNA 1E32A 3Q85A 4KFRA 3G0HA 4DIDA 2IS6A 2FFAA 2W00A 1F2UB 2ERXA 3AF3A 5HKKD 2IXFA 1N3BA 2GBLC 4NCKA 1LNZA 3SBDA 1X1RA 2NO1A 1F6BA 2P6NA 2Q9BA 4L9WA 1PLJA 3UWKA 3HYRA 3I4LA 5CM9C 3TVDA 3QF7A 2PL3A 1N6KA 5LPNA 1U90A 5FL3A 3C4JA 2HV8A 2VF7A 1H8ED 3X1DA 3A1WA 4POAA 3GLIA 3WRXC 2OFXA 3TNFA 3SE0A 2WZQA 1U94A 2ZJZA 5DYGA 1KO7A 1E2IA 3QXXA 1GKIA 2REOA 5AUNB 4D26A 3I5XA 1XCPA 1RW4A 1DE0A 4LHVA 4LYAA 1SGWA 4Q1EA 3JZMA 2E9SA 3DPUA 1C4OA 4A6XA 4B34A 1XX6A 3C8UA 4CT4B 4C7OB 3KTAB 2BHRA 2P6UA 4HI0E 4P3YA 4BWYA 1JR3E 2R6DA 1IN4A 4G5GA 5EE9A 3WMFA 4Q9LA 4ACBA 1XDBA 5JJIA 1LF5A 3LW8A 4KYUA 1GIAA 3CB4A 3LFUA 4LYFA 3IPXA 3FYHA 5IDVA 2V54A 3SHFA 2RGNA 4B47A 1KI2A 3ADKA 4EPXA 4DZZA 1A1VA 2D2EA 2OBMA 4CEHB 1DVRA 4JL5A 4KXFB 3EIEA 3T35A 3MFYA 5HE9A 4F91B 2OO7A 3THYB 2QAGC 3AH8A 2ZI3A 2Z4SA 1D6JA 1NLFA 3SYNA 1KO1A 3EX7C 3A1TA 2P5TB 3F3YA 3I8SA 1WP9A 4OHVA 4MDEA 4YMSA 1Z0FA 1L8QA 1KMQA 4NCJA 4QBGB 2RHDA 4TL9A 4HB0A 4I1SA 2IS4A 3UXMA 3DM9B 3H4MA 2YWEA 2RGEA 2Q0HA 2R62A 4DBLC 2B7BA 2F1IA 4LSGA 3EA5A 4U5XA 2PBRA 5EUMA 5FOTA 5EE3A 1YZNA 4QJ3A 5HR5A 2IX3A 1G16A 4LJ6A 2CL6X 1P73A 4UKDA 2FOLA 2YOGA 5FFMA 2OFWA 2CJWB 1VYVA 3GQBA 4DJTA 1UAAA 2AWOA 2RGBA 1TQDA 3W6PA 3B8HA 5F9FA 2FH5B 3K0AA 2WPDA 4C7OA 2CHVA 2WSSD 1Q22A 3DMNA 5BN5A 2VL7A 3NDBB 3NEYA 4F7WA 3FMOB 3LBNA 3CR8A 1AZSC 1U0HC 2WAYA 4URUR 4CDGA 1GOTA 1E79D 1E2JA 1LW7A 4A92A 3ND8A 2JDID 1FP6A 4B3GA 2GK6A 2IYVA 3LLUA 4L9SA 1NMXA 1Q3TA 1SXJA 1VTKA 4HAYA 2VRWA 4Q7KA 4YXWA 1CRPA 3LX8A 3QSYA 121PA 2CNWA 2BCJQ 3DEFA 3IIMA 4G5RA 3EAQA 1G3UA 2CE2X 3VKHA 2MSDB 1E2GA 3GD7A 5J4VA 2O8BA 2CMKA 3CRVA 1QHSA 1Z28A 3AGQA 3H0KA 4M1YA 1ZNZA 4Z1MD 3WRYC 2XXAA 1M2OB 4ABYA 3RVBA 1COWA 2C04A 4FD2A 2ZQ5A 1EFRD 1NN3A 2HUPA 4KFUA 3TBKA 3CR7A 1VPLA 3FKSA 3RRYA 1U99A 4RY2A 2JIZD 3EZ9A 1P2TA 5FBWB 4D4KA 3CWQA 4KVAA 2ECKA 4IXMA 2GAOA 1WBBA 2ZM5A 4ERNA 5BYJA 2IUTA 2DYKA 4B3CA 1VMAA 2MSEB 1EESA 1H8HA 4Q4JB 2WWGA 3EWSA 2CL0X 1Z5ZA 1ZIPA 2YVUA 4JLKA 5FUYA 4ZKDA 1L7VC 3HPQA 4BE7B 3P27A 1GAJA 2ORVA 5JEEA 1SVWA 3K09C 1W49A 5DSZA 3FVQA 5CLLA 3LVQE 4PQFA 3BB1A 2O8DA 2ZE8A 4JVSB 4JYBA 3AP3A 4Q01A 1AGRA 2PZFA 1COWD 1Z2AA 4GI7A 4QFMA 3B60A 3SDZA 3R9XA 1E2MA 5EE0A 4HYYA 5EQTA 1QHYA 2QTHA 2RAPA 4LJ8A 4EIWA 5K8LA 1XMSA 1IJEA 4W7SA 5KSZA 4KJZA 3U3KA 1AA9A 4M4SA 4Z8YA 3TUIC 1DO2A 1OH6A 4TYQA 1PUIA 2RGDA 3FB4A 3M0EA 3MD0A 2VHUA 1NNEA 3RABA 2ZJAA 1OKKA 4R71A 1EX7A 1N6PA 2WSMA 5JRJA 5FUWA 4QHTA 5H68A 2BMEA 5EZ6B 1G8YA 3LO5A 4I1UA 3KTAA 1P9WA 1SKYB 4AYWA 4W9MC 1YHNA 4D2IA 1QHXA 1U0JA 1MO4A 1OIVA 1DAMA 1KDRA 2H8KA 4JLMA 1KI6B 4HATA 3W90A 1T5LA 3QPVA 2JJ1A 5P21A 2GBLA 2XOKA 4O3MA 3LQRA 1II8A 3K53A 1CR4A 2IYSA 4IEIA 4WW0A 2ZRAA 2IUSA 4HB2A 1G9XA 2F9LA 1S1MA 2J7PD 2XNSA 2QAJA 1Z06A 4TSFD 2DCUA 1N5IA 621PA 4HAXA 4LV5B 4GMXA 4H9GA 4WXPA 2A30A 1SZPA 1OKKD 2C9OA 1VYTA 1TU4A 2BDTA 1KJWA 4NYJR 1CBUA 1NVUQ 5CJ2A 3QENA 5AUOB 1NMZA 2D2FA 1W0JD 2ZIAA 3EASA 3RS2A 4AKIA 3BC1A 3UANA 5M04A 1W36C 1Z83A 4PSAA 3I72A 2XOKD 1T0HB 4GDFA 3CO5A 3LW7A 3UATA 2QSYA 5L3QB 3TSWA 4G5SA 2W83A 4Q4LA 1AQYA 4XWOA 5DI3A 1GKYA 1ZD1A 2VO1A 1UBEA 3P1JA 4FMDB 4TTRA 1TTTA 3RYTC 1T5IA 1UBFA 3G82C 1YR6A 4O0MA 2R65A 1G19A 2AK2A 3AQ4A 3NBFA 1U2RA 2ZRNA 4OHZA 4NCHA 3CNLA 3T1OA 5AUQA 1JXOA 1GWNA 2ZSDA 4XWAA 3BS4A 3TAUA 1G3RA 1XEXB 2Q9CA 1UM8A 1N6IA 3UWOA 1KAGA 3NC0C 2HJVA 5FTMA 2Q3MA 2Z6VA 2R44A 2FPLA 2NOAA 4ZCLA 2LCFA 2EYQA 2QGZA 4YMVA 1ZM9A 3X1YA 3B5JA 1PLKA 1WA5A 2F1RA 1Z0KA 3F0TA 1P62B 3WXMA 2JGNA 3EIHA 2L0XA 1GNRA 2ATXA 1E79A 1XTJA 3WYGA 1K8RA 4C30A 1ZNXA 3B1XA 2FPKA 3LWNA 4A8JA 4I4LA 1D2MA 1ZVQA 1W36B 3PQCA 4WOPA 2ODWA 1E2HA 4AK9A 1ZJ6A 2WHXA 4TQAA 4M9ZA 2KB0A 4KFTA 1TQ4A 3D7MA 2VSFA 4LC0A 1LB1B 1QRAA 4LRWA 2BIFA 3LQQA 4OQNA 4D81A 2J45A 2GCOB 5TDHA 3VTKA 1D2EA 1FQKA 2JDIA 4RZUA 4BUJA 1SXJC 2OLJA 2GZDA 1MABB 1OW3B 2OE2A 4PC1A 4BEBA 4LUCA 3PEWA 1NN5A 2VP0A 3B78A 1MOZA 4O2LA 4V0NA 3I8XA 4AYXA 3I62A 3B1YA 5HTKA 1JPJA 5B57C 3VNUA 4M9QA 2WSSA 4U02A 1VHLA 2HLDD 1Z3IX 3QEOA 1G4UR 1XD2A 2RGNC 4Q47A 5CDFA 5DE3A 2ZUBA 1E4YA 3GJ3A 4M1TA 5SZHB 2UZ3A 1ZU5A 3RC8A 1IAQA 4PAMA 2O8EB 3THWA 5HPYB 2WM9B 4LJ5A 1N6HA 5KYKA 1TQ2A 1I4TD 3L0IB 5DISB 1KDOA 2AK3A 4PANA 4ESVA 4QHSA 4B3BA 3OEED 4JLNA 2AR7A 2VP5A 1G20E 2E87A 5EXPA 4TLDA 4DLSA 3R9WA 1QVAA 5SZKB 3T1TA 3KFXA 1QDEA 2YWFA 5JWRA 3QVUA 4C0JA 2ZRGA 2IL1A 4DHEA 3MWJA 1J70A 3TUZC 3W6OA 3LNCA 4QBIA 4YMWA 3SJBA 1AQUA 2BBWA 3FHOA 3IPYA 3JVVA 4Q02A 1R5BA 3PFIA 2AWNA 3K09A 3RS0A 2OAP1 1G7SA 1XTSA 4CEJB 4IDPA 3VX4A 4BLRA 3K70D 1G1MA 2KSQA 2ONKA 1YZTA 1AGPA 2OXRA 2IW3A 1WQ1R 4MA4A 3I92A 1XEWX 2DY1A 1Q3HA 3QIAA 1JXMA 4ZI2A 5JCPA 2ODBA 1JR3A 3C5HA 1OH8A 2BEJA 4G5QA 1Z6XA 5IK2A 1U8AA 2UKDA 3X1WA 4NDZA 1NKTA 3DL0A 2JAQA 5HZKA 1TF7A 1LY1A 5DYIA 2ZJ2A 3AVXA 4PZYA 1E1QA 3N2IA 2V7QD 2QPAA 5C46F 5CB8A 1NG9A 1S9HA 2BVNA 3BH0A 4HB3A 1K5DA 1UFQA 2AL7A 2Z5FA 5KNDA 1W2GA 4FN5A 3U61B 4JT4A 2PEYA 4M21A 4DSOA 3U3MA 1E2FA 1O87A 3OAAA 4EJSC 4UNRA 1PVOA 4MQBA 1WBDA 3AF0A 2DFLA 2ASEA 1P9RA 3SFZA 3A4LA 2WWIA 221PA 3I5YA 5JFGA 4RD1A 1XP8A 1E94E 4IOJA 2C78A 3JVUA 1XZPA 1JR3D 4TZ6A 3KX2A 2FFBA 3AUXA 3LY5A 2CJWA 2ZI4A 4KCGA 4TT3D 3U7HB 1YRBA 4P0TA 4YQFA 4Q1AA 1NJGA 4PAQA 2SHKA 4TMTA 2ZROA 2A5YB 4ASUA 4DRZA 1NSFA 2QMHA 2PMDA 4B35A 3EPKA 1E1QD 4LJ9A 2GKSA 1SQ5A 4B6FA 1XTIA 1LVGA 3MAAC 4HDQB 4MRVA 4BRUA 3ZGXA 1E0SA 2GVDC 1OPXA 3BFVA 3VX3A 1VDZA 1R2QA 3T1VA 4IFBA 1RRGA 2A3RA 2VA8A 1XTQA 5BQ5A 3KB1A 1VCMA 5FL7D 1NVVQ 3A4MA 3V9PA 4A0GA 1EFHA 2A7QA 4IW3B 4B43A 1ZBDA 2V9PA 2RMKA 3SEAA 2WJHA 2TMKA 2AXNA 5KSPA 4M1WA 5L3RA 5FOVA 2J0UA 4DC9A 2QBYB 5FPSA 2QL6A 3E5HA 1ZIOA 4TMWA 1DG1G 1N0WA 4GMDA 4JLVA 4PHFA 4HAZA 3DHWC 2C9CA 1W0JA 5G3YA 1CR0A 4WBSA 1NN0A 2B8WA 1LFDB 1SHKA 2FMXA 3VMFA 5TARA 3AGPA 4PHGA 3NWJA 4HUQB 1E2EA 4DCSA 4L16A 3BB3A 5J4LA 2V6IA 4Z54A 4Q00A 2JLSA 2ZI5A 4QGHA 2IF2A 4V0LA 3T5GA 1UKEA 3O8BA 2GJAA 1V43A 1JALA 1E96A 1XPRA 2QQEA 1S0UA 2QY9A 2IHBA 2NO9A 1RE0A 2ZPTX 1GRQA 4AKHA 1SVIA 1XFAA 3KQKA 1B0UA 3EZFA 3CKLA 3TR5A 3NDPA 4BFYA 5CK4A 3UK6A 3B1WA 5JHHB 1P4SA 3GMTA 4C2UA 2JLZA 1KO5A 1QHHA 4LHWA 1XBTA 1E0JA 1NF3A 3KJGA 1YVDA 2O52A 3F8TA 4AKGA 1H8EA 1OYWA 4QKQA 3U44B 3NHBA 2XTZA 4O25A 3T5DA 5C2JB 1KMHA 1DO0A 2JJ1D 4UQOA 5CYPA 2GESA 2CDNA 5EJEA 1OFIA 1W5TA 1ZUIA 3E2IA 3MCAA 5DGXA 1NJFA 2QP4A 1P3JA 4JLAA 2IYZA 2OV2A 5KUTA 1EFCA 3RAPR 1FTSA 1ZD8A 5JWHA 2EFEB 1W4CA 2HT6A 2ZYUX 2X8AA 1FW6A 3B6EA 1T3LA 4JSTA 1OXVA 1GRNA 3CRRA 1Z0AA 1F48A 2KE5A 1M6NA 2OSBA 4Q9JA 4EPWA 1G64A 4G3XA 2YV5A 5SZIA 2QAGA 3TJZA 1E0AA 1WMSA 1RJ9A 2QPTA 4DCNA 1JEEA 2O8EA 1U9IA 4OI2A 2EFGA 3DO6A 2YZ2A 2OM2A 2ZVPX 3HPRA 5GADl 4NH0A 3WNCA 2WJYA 4TN1A 5DI9A 3TRFA 5K8IA 1YQTA 3Q5DA 3D8BA 3ONWA 4B73A 5JJLA 1N6OA 4TYPA 5TB5A 4P4TA 1E9EA 2DFNA 4UJ3A 1FOEB 3GJ7A 1EFRA 1II9A 2BKUA 5J4HA 4Y0VA 3B85A 4HDOB 1OE0A 5CIWA 2ZAOA 3WNDA 1O3YA 4RKEA 3CRMA 4D6PA 2YWGA 2GCPA 4EFNA 4P31A 3ZQJA 1I2MA 1TF2A 5IK2D 4XOIA 3KKMA 3QVVA 3QOFA 4TYYA 1S4QA 3GLHE 1XU4A 2DFTA 5C4MA 1VG1A 1OXSC 5GJBA 4DSUA 2BMFA 1AK2A 1W4AA 3AVWA 4EPYA 3L43A 1E9FA 3EIQA 5DI3B 1NY6A 2BC9A 3PUWA 1NSTA 2F1HA 5FBQB 2HYIC 1TX4B 1QZXA 2IYLD 1VYUA 1ZAKA 2RHMA 3OAAD 4KVGA 1G41A 3EC2A 1E98A 2ZRMA 3B1ZA 3IQXA 1OXUA 4LJAA 4NHOA 5DO9A 2PJRA 2OUKA 2OEPA 2OT3B 4IVRA 3RSLA 4P4SA 4GOJA 1CLUA 5DN6D 3GLGE 1L2TA 2HDNB 2CK3A 3B13B 5EP1A 2VQSA 5L3SA 5AWFC 3IQWA 4DLYA 4IJMA 1IOZA 1T9HA 1Q12A 5BN4A 1FL9A 4M1KA 3UPUA 4TZ0A 1XJQA 4FMCF 2PZEA 4RVCA 2JIZA 1F2TB 1DELA 5JMTA 3FOZA 1A5TA 3LDAA 3A4NA 4TQUS 5FR1A 2G1JA 2ORWA 2FSHA 1AS2A 1G17A 1R4AA 2GZHA 2GHIA 4EPVA 2GEUA 3K0FA 3REGA 2AX4A 1XMVA 5A0FA 4B2IA 3CZQA 4YMTA 1Z08A 2EFCB 4GPTA 1EGAA 1KZ7B 1N0UA 2DWQA 4WIAA 2XSZD 4GOXA 1KI6A 5EE1A 3TKLA 1MRNA 2P6RA 1GL7A 3EC1A 4MH0R 4XSHA 2XEXA 5L3VA 1RPZA 3PV0A 4TTQA 3H84A 3OIYA 4ARZA 1GTVA 2OZEA 4A2PA 3NIBA 2FN4A 2VIIA 2ZRPA 1JECA 1F3OA 4ZPXA 4M9SA 5KDLA 4Q1FA 1WE2A 1R8QA 4TSFA 3IEVA 2YC2C 4PPNA 1YKSA 3WP0A 3CRQA 4J0QA 5DLQC 4C3ZA 3IKJA 4ZV4A 1KNXA 1OT3A 2F43A 3R7WA 1IM2A 1J99A 4US2R 2F3TA 2ZI6A 1JI0A 3F5FA 4N0DA 2YC4C 2EW1A 2FX3A 5FOWA 2B92A 4RZXA 2R6CA 2FV8A 3QUSA 2J5XA 3SN6A 3AV0B 3OIVA 3QPUA 2BOVA 2QE7A 2PLRA 3KXLA 4NONA 5D3QA 5DHFA 4DDUA 1F60A 2HYDA 5FTLA 1U9IC 4JVLA 2WOOA 3BH7A 4PTLA 3R9IA 4FXPA 1IXSB 1ZD9A 1U98A 2OBLA 2W6JD 2G83A 4C0QC 1CF4A 1GRRA 4URVR 1ANKA 4E22A 3EPHA 2R8RA 2BM0A 4NMMA 5A4JA 1DAHA 3TW4A 4X8MA 2YWHA 4IDQA 3ICQB 1HA3A 4QJ4A 3O8DA 1VIAA 1GFIA 1MH1A 1OJLA 2ZSBA 4JLOA 3BB4A 2WTUA 4PO1A 2BM1A 2NO0A 2Q9AA 1YR7A 5FR2A 2VEDA 1D5CA 3K0EA 4LCBA 1BYUA 2O8FA 2BBTA 3ASYA 4C0BA 1KI8A 3NBYC 1E69A 4OKSA 1ZNYA 2W2TA 1KI3A 3SI7A 3EZ2A 4Q7LA 4XD7D 4LYJA 5J5CA 1IONA 1T8UA 3L2OB 1I4LD 1EFTA 3GEEA 4E09A 3Q7QA 3REFA 4D0NA 3GP8A 2XXAB 2XB4A 4F4JA 4AG6A 2V3CC 3W8NA 4MGZR 1A2KC 2W58A 3GFOA 3QBVA 1OH5A 3P26A 2NTYC 1P6XA 4FCVA 1IN7A 1FPMA 3ECCA 2IA5A 3WBJA 4LC1A 4KBGA 1Q1EA 3ZVNA 3H1TA 5BXQC 4BGDA 1CRQA 2FEMA 3K0CC 3FMPB 3KUCA 3P4YA 1FUUA 1S1CA 4Q4JA 2F3RA 4OI0A 4DLXA 1WDTA 4PC7A 4IDNA 4R2HA 4F93B 2W0SA 2ZSAA 2EWVA 3Q5EA 3U2QA 2ZITA 3IUYA 1FNMA 1YZGA 4LWZA 4V0ME 1M74A 2C03A 2C2HA 3THWB 2XAUA 2XZLA 3ZZ0A 3QKUA 1N25A 5HKKA 1AS3A 1AZTA 3LV8A 3THXA 4B3DA 2BWJA 1CP2A 4DDWA 3U6BA 1CTQA 3KQLA 1GZSA 2W6JA 1OHHD 4HLDA 4NKRA 5FUVA 4H1UA 1MO6A 4LGMA 1BH2A 1T91A 2D7CA 3JZAA 3W9YA 4QGAA 1E9DA 4OL0A 1R5OA 3CH4B 1AKEA 5JLJA 2ZRFA 1XXHB 2CL7X 2GVZC 2ODNA 2WBLC 2ERYA 2WWXA 2UZIR 2ZR0A 4Q4AB 4QXAA 2JA1A 1Z8FA 1KO8A 4C0AC 1SKQA 4MRNA 3HU3A 4RKFA 5JSZA 4FW9A 2GK7A 4IFEA 3RLFA 3VU9B 1S96A 4QM6A 3A36A 1JBKA 4ON9A 2ZI9A 2AFHE 4DLTA 3CX8A 2C96A 3MWKA 1OFHA 4RFSB 4OK5A 1A2BA 1X86B 4US0R 3SQXA 1JB1A 1SVKA 1D2NA 1UDXA 2N1BA 1TU3A 2IXEA 2GILA 3CONA 2FWRA 2G0NA 3GLHB 2C9YA 2FNAA 3FDIA 4KHZA 5TY0A 3T61A 4MKIA 4Q9IA 3KKNA 2CCGA 2GWHA 3BH6A 3KQUA 2HLDA 1W1WA 2W0MA 3SYLA 2ZE6A 4DXAA 5CB6A 3SZRA 5JWOA 3VR2A 5TV2A 4PSKA 4JZKA 4JLPA 3WP1B 2A5JA 3IDQA 2REBA 2VLIA 3CWZA 2FZ4A 3ADDA 1Z29A 3KXKA 4WAUA 1MKYA 1DAKA 3MLEA 2GCOA 2FFHA 2P3SA 5A5GA 1GL9B 1B23P 1YJ5A 2ONJA 2C77A 3DM5A 1QF9A 1FNNA 3BWDD 4UNPA 2O8CA 2PCLA 1XWIA 3BIFA 2J7KA 1JJ7A 4FCTA 3VR4A 5IRCD 2V7QA 3THOA 2GXUA 2G3YA 3Q8XB 4ZO4A 1HT2E 3IIKA 4LHYA 5EP4A 5J40A 1HE8B 4CEJA 2C99A 1OSNA 4KBFA 2D62A 3MMPA 4LV8B 1P2UA 4NCNA 2Q3FA 5KHOC 1IN8A 3NH6A 3BXZA 3P32A 3SU8A 3KFVA 3U5ZB 1V5WA 1NKSA 2QPOA 4JSYA 1Q1ZA 2GRJA 4UNSA 2XSZA 1G8GA 3BFKA 3ZLJA 3KKOA 4M1SA 2H57A 2QRZA 4B48A 1DAGA 2KBFA 3CX7A 1OLOA 3QJYA 1R7RA 8OHMA 1YU9A 2O8DB 2JCSA 4PR0A 1RIFA 3KKPA 1G3QA 3FPAA 2ZUCA 3DOEA 4CZ2A 1XTRA 3K70C 4G01B 4Q7MB 2OBNA 1TUEA 1ONBA 2ZSFA 4B32A 3A6PC 4TLAA 1K5GA 4B6EA 5FPHA 1KSJA 2WJJA 3ZVMA 1ZMXA 5JJKA 2F6RA 4KU4A 2YKGA 1M7HA 2OFOA 2QM7A 4IDOA 2ZR7A 5GVRA 1NP6A 1VCNA 5FH9A 3WNBA 2GJ9A 3ZIAD 2B8TA 1AN0A 1TUIA 2ZRBA 3K9GA 1KO4A 2QUZA 4PFSA 1KY3A 1KSGA 1Z6AA 3UMFA 3W3ZB 3QKRB 2RGXA 3IIJA 4Q4AA 3B1VA 2A2ZA 4DLRA 3OF5A 3RDPA 4XVQA 1KMHB 5TXGA 1X1SA 2QMOA 3CIOA 4EJSA 4C0SA 1MRSA 3I1FA 1TF5A 1KSHA 2R6GA 3U4QB 4S2EA 1GM5A 3AF4A 2WAXA 5B2ZA 1FX0A 1K6MA 5FI1B 4C0HA 3L82B 3S1AB 2JLVA 3PCRB 3AVVA 2NIPA 1FUKA 1DAFA 1S3SA 2ZYWX 1CIPA 1A82A 1XPOA 4Q21A 2IEZA 2O8CB 1KZGB 3FMIA 4LK2A 2IF0A 3KQHA 2NZ8A 1CJVC 2QU8A 3WYAA 1P61B 1YZUA 3ZIAA 1L4YA 4BFTA 1OFTA 2J46A 1NVXQ 1QG2A 1WB9A 5TMPA 2GAAA 1HTWA 2X2FA 1UEJA 2QGNA 2KI5A 3K8YA 2BJWA 3QE0A 5FOUA 4HSEA 4DCUA 5HZHA 2C8VA 4MDFA 1XEXA 4II7A 3GLFE 2HT1A 2JLRA 1KI9A 4UXHA 5FL7A 2G0TA 3VR1A 1AIPA 2NMVA 3QKTA 1SVMA 4TL8A 4DIEA 2GNOA 2QTFA 4O2RA 1NVVR 2XTMA 2QT1A 4TLBA 4F4IA 2IS2A 3AP2A 3QXJA 4JKIA 2EU8A 2C98A 4X8HA 4ACAA 4X8LA 5GJCA 1TADA 3MG9A 3RRMA 4C0LA 5C4GB 4FWTA 3C14C 1JJVA 4LOAA 1KDTA 5UKDA 2FG5A 3I73A 5DIFA 2NPFA 4XTRA 1GILA 1CJTC 821PA 2YJTD 2QA5A 1JAHA 5JI2E 2ZAMA 4PQYA 4AI6A 3A58B 2VP6A 2OCBA 1GDDA 2F55A 3SJZA 1QG4A 2OAQ1 4MRSA 4M2LA 5HCIA 4WZBE 3T1QA 1ZUNB 1KI7A 3LA6A 3HR7A 2HCJB 4G0NA 3MSXA 2J0QA 2QI9C 1FMLA 3QG1A 1NIPA 4EAQA 3B2EA 2ZE7A 2HXYA 2IYQA 1NVWQ 1LV7A 3LRPA 4PHHA 4A1FA 4RFVA 2G9NA 4BFUA 1CS4C 1M7GA 4LBZA 5AUPB 1ZCAA 4A2WA 6Q21A 1ESNA 1GNQA 2JEOA 4IXNA 4HLCA 1GVNB 4JVNA 4KFSA 2DHRA 4IOKA 5JECA 2XZOA 1E1RA 4FMDF 4JLDA 5EE5B 4IDHA 2H5EA 3VKGA 1NL3A 1S2MA 3A8TA 3RS4A 1E9CA 4EDHA 4URXR 2FSFA 4YDSA 3U60B 1SXJE 1XRJA 1DOAA 2V4ZA 4PAOA 1OHHA 3OIWA 1Z07A 1ZC4A 1G4AE 2KWIA 2QG6A 2IXGA 3QQ5A 3TE6A 5H1YA 1ODFA 3KJEA 1TEXA 2P5SA 3IHWA 3AKYA 4DEYA 2WIBA 4BQSA 4WA7A 5BWMA 1NBME 1SKYE 2N42A 2ZE5A 2ZS9A 2A5DA 3IBGA 4KSCA 3H2YA 3LAWA 2NGRA 3CPHA 2R9VA 5DH9A 4Q03A 2O8BB 1FX0B 1E2QA 4XD7A 5AK0A 1HE1C 2RH5A 3CM0A 5ELXA 1G6HA 3K0FB 1HQYE 4TMKA 5E3HA 1MO5A 4Z8XA 1CKEA 2FE4A 2AHOA 1CJMA 2CHGA 4IOMA 3SQWA 2EFDB 3U7EB 2IWRA 3X1XA 1DEKA 3SYKA 4D4JA 1KKLA 2A9KA 3HR8A 4I1VA 1KI1A 4WZ6A 3WBKA 2QAGB 5EP2A 2ZRCA 3AP1A 4AD8A 1IN6A 2K5UA 2GTPA 2ZS7A 1FMJA 3MGCA 2FA9A 4LJ7A 1OIWA 4NU0A 4KITB 3QKSA 5KO2A 2J59A 1G7TA 5DNYB 2ZRHA 1C9KA 1GUAA 1N5KA 4KO8A 2RGCA 5F3WB 1KJZA 3NXSA 1F2TA 2WOJA 4PZLA 3D6TB 3MJRA 1G5RA 3QF4A 1AJEA 4JBYA 4BZQA 5H70A 1RFLA 5AJXA 1E9AA 3GJ0A 3OEHD 4R98A 4A9AA 1R5NA 4OK3A 1FP7A 1OH7A 4K8OA 1MO3A 4NYIQ 4DEXA 1BIFA 4PSVA 1W4BA 3SC3A 3KQNA 3LD9A 1R0WA 1W48A 4GT1A 3RSOA 3K9LA 4K46A 4D4MA 1OB2A 5SZJA 3RRNA 3U7FB 2YOFA 2G77B 1KHTA 4B2PA 1XXHA 2VSOA 1XEWY 1UEIA 1M1YE 1N0VC 3EZ7A 4DSNA 1IY1A 3T06B 5H8WA 3NKVA 2VYFA 4IVPA 3EPJA 1EWQA 4TTPA 3FGNA 2HF8A 4CF7A 4Q4HA 4B44A 2ZRKA 5IF9A 3K70B 5B64A 5G41A 1QHGA 3K9NA 4A36A 1RC8A 3DOFA 1BMFA 2ZJ5A 3U4QA 4JLBA 3OFND 2VSXA 3FFBA 4ZKEA 4BLQA 1N6RA 2X2EA 2V1XA 3THXB 2I1QA 4PQRA 3MWYW 2XZPA 2VP4A 1GP2A 3ETLA 1Z6GA 3LX5A 2VP2A 4AIIA 3ZJYA 1RRCA 4A82A 4DUGD 2QTVB 1G5PA 3ZZTA 2ZTSA 2FSGA 2H18A 5D3MB 4V0OA 1VECA 2VPPA 4TYWA 3R20A 1ZNWA 3RRZA 4OQXA 5C1BA 4A0RA 4N1AA 3LXXA 4F38A 3VHLB 4QL3A 3L0SA 2Z4RA 2WV9A 3KDSE 3IILA 3W3AA 1HH4A 2AD5A 3NC1C 3RHFA 2FJUA 3QBTA 3NEJA 3DKVA 2HEIA 1KSFX 2CCJA 4JJKA 4HLQB 2QBYA 2VBCA 2JLXA 5EXTA 4FCWA 5KSOA 2IS1A 4DLUA 3IO3A 4RFSA 5CLQA 3TH5A 2HF9A 3W5JA 1XCMA 3B9QA 4ZI3A 1LF0A 1KGDA 3VKWA 1KIMA 4PHTA 3W6NA 4PC3A 3WMEA 1E6CA 1XCGB 2XJ4A 1M7BA 1CR2A 4QNMA 1SVSA 1G3IA 2GF0A 2Z43A 3IHLA 4D0GA 4D82A 2PH1A 3E1SA 4V0KA 1ZCBA 3UG6A 4RCYA 4IKEA 2G1KA 1DPFA 2MMCA 3MJHA 4BLSA 4DT1B 5GJVC 5F9HA 3NBXX 3FHTA 4Q66C 1DS6A 2JLUA 4CEHA 2X77A 1N2CE 3O47A 1DARA 1E2KA 4YXWD 3AVYA 1E0KA 3L8ZA 2OG2A 4BFZA 2ZU6A 2B6HA 2HXSA 2ZJ8A 4RSGA 4BEJA 1IN5A 1PV4A 1RRFA 3GLGA 2QE7D 4LPKA 4PZZA 3WYFA 4K81B 1E2LA 4D25A 4A15A 3C15C 3R8CA 2H17A 2QZ4A 2ZUDA 1S3GA 2WJVA 4URZR 4A6PA 3QXSA 2EQBA 1UADA 1YZLA 3AKCA 1UBGA 4FI3C 3Q3JB 4JL8A 2B21A 3LH5A 2IYUA 2CBZA 2JASA 3AUYA 3NTUA 3BGWA 3UIEA 5IHPA 5J4YA 5F2EA 2LKCA 4Q1BA 1I2DA 3SR0A 1LS1A 1G21E 3OHMA 4LJYA 4D0LB 5KSYA 3UMSA 4JS0A 3GLHA 1KNQA 4CVNA 2NG1A 3PR1A 3AF2A 2DFKB 2V6JA 4ILEA 1MV5A 1Q20A 1EX6A 3S1AA 4N0EA 1U0LA 2QMUA 4LYHA 1R8SA 4R7ZA 5KNBA 4V02A 4QOSA 1QVRA 4LBYA 2EFHB 2W6IA 4FINA 4QRHA 1T0JB 4UNNA 1ZUHA 2GXSA 4Q48A 3RC3A 2X1VA 1IBRA 4GP7A 4F4CA 4MYCA 5E95A 5KDOA 4MUAA 4MGIR 3LLMA 4B71A 4JBXA 3AVTA 2BBOA 4RCZA 3QKRA 4AURA 4HZUB 3P4XA 2IC5A 2JLQA 2OLKA 3QG5A 4JL6A 3ICEA 3TW8B 3C16C 2JJ2D 3LBHA 3TQCA 4QNRA 5E7MA 3UMRA 3CW2A 3HU1A 3M6AA 3AKEA 5IT5A 1NG1A 2ATVA 1HY3A 1N5JA 3PUYA 3CF0A 2QROA 3ND9A 1T8TA 1Z0DA 4UXJA 4ESHA 3HP1A 1WXQA 1IHUA 1S8FA 1J8YF 3KKQA 4PXAA 2GJSA 5CYOA 1EXMA 2H1LA 4MRRA 3GJXC 1C1YA 3ZYCA 1Y3AA 1G8PA 1UF9A 4LPSA 3AB3A 2ZU0C 1GG2A 5BYKA 2KBEA 4EUNA 4DDVA
chains in the Genus database with same CATH superfamily
3MTEA 1YK1A 4NE2A 3I6YA 4H7IA 4WBNF 1W46A 4X3CA 1PYOA 2QPLA 3ML1A 3ZY5A 3HY3A 2VHQA 1J2RA 3HGMA 1L4FA 5E9AA 4IJQA 4V0SA 1KQNA 4HDAA 4UPEA 2Y76A 3QFFA 2I6FA 2OAGA 4ZT6A 3LUFA 4KH1A 1I6LA 2I55A 2Q8PA 4OFBA 2MSCB 4EGQA 5DTJA 5AI5A 2PD3A 2R0QC 1UC9A 3PI6A 3NYRA 2GARA 5K6RA 2I3BA 1OVMA 3H6KA 3M6XA 4FFNA 5IVKA 4Z86A 2QKYA 1SZCA 3TLCA 2H1SA 2ORIA 3KUDA 1JLRA 1ML4A 4BFVA 5JI3E 3N86A 4AFNA 2VDJA 4DCVA 2EYUA 1Z73A 2ET6A 3IUEA 3RREA 4CEIA 3O31A 3ZVLA 5MDHA 1F5SA 5LZ4A 1II0A 4HGRA 1HNZB 3RVJA 3LBAA 3DPIA 2AYZA 2GZSA 4BLPA 5E7IA 2G9ZA 2Z0MA 4AWBA 2SICE 1ABBA 1UAYA 2IK8A 2PZLA 1H0SA 3CF6R 2E1RA 1FVFA 1RWXA 2P2LA 4JI6B 4DMRA 4TXLA 5MHTA 3AVOA 4EFKA 4Q9KA 4MMYB 1FRQA 2HIAA 3GHYA 1H5QA 3DEZA 1QHHB 2XUQA 4D80A 3PF8A 3SZGA 1NJ6A 3Q7PA 4X95A 2O3QA 4MWBA 1CUHA 1G2QA 4HEJA 5ES3A 3RSSA 4MR8B 5FTKA 1Z63A 1CB0A 2JFFA 3HFRA 4PX9A 3UXEA 2H0QA 1Z5PA 2JFNA 5CTJA 3WADA 2AC4A 1IBKB 2CMDA 4MUIA 1ABEA 1HLFA 1XD8A 3SR4A 2OXEA 3TNJA 1UKZA 4EVSA 1YHYA 1P77A 4TL7A 2ZM6B 5E8RA 3KV1A 3ZH9B 3GIDA 5F7XA 2PEZA 2WYVA 1CY1A 3DMPA 1ZP6A 1OLSA 3TAHA 3LPNA 5K8TA 1U2TA 4OBXA 4UVIA 2HF7A 3QU4A 2HU7A 2C4TA 4C43A 2IEYA 2P9BA 4ZWNA 2FSVA 4AKEA 4CF3A 3T38A 3S2UA 2IQ5A 3GWGA 3E9ZA 1TCVA 2PKRA 2E4YA 2REXB 2WKRA 1UJBA 4OQYA 1CZKA 2D0IA 1K7YA 3RS3A 3VR4D 4CI9A 1N3IA 4QUBA 2VWGA 3U62A 6AT1A 1F6WA 3HU5A 4OXIA 3HJHA 4BO8A 4Q5IA 3SBEA 1QGUB 1R37A 4B81A 2PMCA 4DYHA 4WDQA 1QZUA 3H7AA 3MAJA 2QL5A 3HWX1 4M76B 4WLUA 4XTCS 4UCXA 5JAPA 3RUCA 2IWHA 5AVYA 1TI7A 5LLTA 4MICA 2JFUA 3SNHA 1XQYA 4AY6A 4RD2A 5F98A 4RHXA 1A1SA 4ZYUA 3HXTA 4UE6A 2QENA 5E4TA 4HZIA 2Q5HA 4B33A 4R9UC 5CHYA 5CEFA 2Q9UA 3TSYA 3JTMA 1MH9A 3NBZC 5EKTA 5B53A 4M83A 1G5IA 4J0FA 3TCXB 2WQ6A 2LIVA 3PUKA 4NY1A 2WJGA 4KSBA 3UW1A 2C3YA 4IDFA 1T2FA 4QC2A 4DKXA 1O9GA 4PC2A 4KODA 1QP4A 4ZZ2A 3ZOZA 5THQA 2PTHA 2CYBA 1PJBA 4LI3X 2IT1A 1ORIA 3EK2A 3UF0A 4ZU6X 4YNBA 1TMKA 3FKQA 1YA4A 4HEA1 4OU4A 4QLBA 1SVNA 2A35A 2ODTX 3A06A 4KK3A 2QTLA 2WICA 1BGXT 2WZCA 4NYMR 1XB2A 4HTFB 3VDQA 5I9LA 5K3EA 3RC1A 4NZYA 2Q21A 4FQ8A 1RE1A 1Y3HA 4DWVA 3KYCB 3LFHA 1AA6A 4G26A 1U2PA 1OZAA 2PGNA 2DWCA 1V41E 3B70A 4REMA 4B6GA 2GFIA 4WXRA 3TR0A 3JRXA 2KHZA 4GRAA 1JEJA 4B74A 4CQMD 4WFKA 1TPZA 2C57A 2CJPA 3QXGA 4D9HA 4CLRA 2PMWB 4XRRA 4X66B 1E3LA 1I01A 1LLCA 1F5NA 2R6JA 1LS6A 3R3YA 4IQGA 3UB3A 2Y1OA 1DC5A 1CE8A 5FUXA 4ARZB 4O2BA 4E5UA 4YRFA 3KVVA 5TE9A 3CE9A 3DKIA 2MMGA 2ES4A 4H3KB 3T3IA 3U7QB 4KE8A 5C53B 4AU1A 2DQSA 1T29A 1U7XA 4MQ6A 3ROFA 1RM5A 2NVBA 4LXQA 1IXKA 2ECFA 5BSUA 5KTRA 2HA6A 1A76A 1PJAA 4KXUA 4TL6A 3SEQA 5CG1A 2P9FA 5IUKC 4M6WA 3VO8A 4TTJA 3RS5A 1SUEA 2XRMA 1Z47A 5IX8A 4WN3A 1FXSA 1PS9A 1YVUA 4A16A 2FHPA 3KZ1E 3MB8A 4AIRA 3SQDA 1OASA 3L8EA 3EGCA 1FE8A 4BZXA 1RZUA 5CITA 3IQDB 5LBTA 4RKRA 5JZVA 2V0CA 5D6OA 4ARSA 4MGEA 5ITZB 1W5EA 2P68A 2Y1CA 1BAPA 2HJSA 2X0KA 1O94D 1TZKA 3PGJA 4CM5A 4KRFA 4RTLA 2BH2A 1SKUA 1XVUA 1IDOA 4FEAA 4IS2A 3PUVA 4KWTA 4M22A 3G5UA 4W9NA 5DEIA 5JS6A 2AMJA 4GU5A 4QJ5A 2HLHA 1FZQA 4PG5A 5HDQA 4KQ2A 4BZWA 4H0CA 1F1BA 2XVXA 4GZLA 4EHDA 2CN1A 3JQ9C 1B76A 1SWVA 2CFOA 2I7DA 1NX9A 3NTLA 3PFBA 4YDHB 3UAVA 3L4BA 3RU7A 4E07A 5FAKA 3AVTA 1XR3A 3MBIA 1U7OA 1P60A 1AXGA 3FE2A 2J87A 1QK3A 5EEGA 1XCBA 1DQSA 3OLQA 3LPLA 3KZVA 2FPGB 3OVMA 5FI5A 1TCCA 3PNYA 1RXIA 4MKFA 4EL5A 1PI3A 1Z5WA 3F9RA 4A8PA 5C7YA 4KYVA 3DC2A 4HD8A 1UZLA 2AQHA 2PX0A 2VK2A 3DEAA 3L6EA 4GF5A 4J0HA 4RDXA 3WL6A 1V26A 3ABQB 2B0JA 1ZN2A 1LBTA 2AEFA 2XGGA 3BXFA 4PLYA 2QZJA 4UUMA 5TGTA 5JSZB 1N36B 1X1TA 4KXLA 4R68A 2WC1A 2FX5A 3DTVD 1ZH4A 5A6SA 4JB3A 1PCXA 4DXHA 3NAZA 3GPLA 4UM5A 1PAUA 4UDNA 3TLGB 2R6AA 3LJKA 4DV0B 2VJBA 2EZTA 5HUHA 1XJ0A 1M1UA 1Y9AA 2PX8A 3FHCB 3PPWA 4HNGA 2RAVA 2PV7A 1GSHA 4G1CA 2FLVA 2TMYA 1BO6A 1G7RA 1XZFA 1IZ7A 2GD6A 2P2SA 5AKEA 3DZHA 3G1UA 4QQFA 4TRRA 3BGOS 4JOCA 5KYYB 2H7VA 5K4AA 5LMCA 5JV5A 1U3VA 2JD0A 2BR4A 3PWSA 2GB4A 1ULBA 3AVQA 4FIDA 5D86A 5FPTA 2CZGA 4ZIRB 1GO2A 1DV2A 2G07A 3PPYA 5IJ0B 1IY2A 1R0SA 1KE2A 3G0OA 1E2NA 2FU5C 1CUAA 4ASUD 3VZSA 5LDDC 1SBYA 3IUJA 1JIQA 5BWNA 2D06A 4D5EA 1GNPA 2VUSA 2BJVA 3BM5A 3AETB 1NLMA 1E1RD 1UWKA 3GAAA 3QI7A 2Y1XA 2NYRA 2PSDA 3BFXA 2I4NA 3QUAA 3ZTTA 3U44A 2V7XA 3SHTA 1D04A 3KJIA 1F20A 4ITRC 4MR9B 4RV9A 1ZINA 4W8OA 1LU9A 1Q7TA 3RS7A 1XZIA 5JYEA 4G37A 1RWMA 1XZMA 2IPLA 3FOBA 1S9DA 3SDBA 1R0KA 4JBHA 2QSZA 3CH5A 3VV2A 3DOCA 5EC8A 3TMKA 2JAXA 3N0RA 2X40A 2ZTLA 4S1NA 2JJ8A 5LXTF 3WYEA 4KH0A 1VXOA 4B6JA 1LLDA 1PR6A 2ZRLA 3C5CA 1JNXX 2J0VA 1N5RA 3T5PA 2E4VA 1CLEA 1YDFA 3RIGA 1RT9A 1T6NA 1CCWA 1OFUX 3PIIA 3OESA 4C7JA 4KQ1A 4DUYB 4BKRA 1FQJA 2Z83A 3FUXA 3IDZA 3KC2A 4RF3A 1DUSA 1ZN8A 3DC7A 5K3SA 4CW7A 1H65A 1ZGJA 3GLKA 4B75A 1WHTA 5EIBC 1R3DA 5COAA 4LNUA 4E5DA 4UMFA 2ZIGA 2QYOA 3D4NA 1JHXA 3GYBA 4B6RA 3ZCQA 4NJOA 2VKTA 3LTNC 2Q6TA 3D2BA 5DNDA 2IU3A 3O8OB 3BMQB 2YBDA 1Q1BA 2VP3A 3K35A 4KK4A 1SHTX 1SN7A 3BHNA 2DBZA 1RHKA 1XD2B 3FTDA 5IH3A 3T0FA 3A14A 1NMYA 3R8FA 1BRMA 1UBCA 1M2OA 3TRJA 5IJ9A 4LDRA 3NHKA 3IOCA 2XKJE 3MXOA 5ERYA 2PZ8A 3N6RA 2R1TA 1GTRA 5JXWA 1WB5A 1IZ8A 4RKWA 3BD9A 2VF5X 3N70A 3L4KA 2Q5IA 4OQPA 2WKPA 1MXFA 1E4OA 3EYAA 4CQNA 2CNWD 4ZC8A 3B6ZA 3BWXA 4P3NA 4RLSA 5EGNA 3CNOA 4HQNA 3A3KA 2Q4TA 3K96A 4EZIA 2D74A 1F3LA 3AM5A 4Q1CA 4WGGA 1TJYA 2XUIA 4KWIA 5DLYA 3PEFA 1VE3A 4EKDA 3BMNA 1UC8A 4DMHA 3F49S 4IRUB 3E4DA 4OBBA 1QKJA 1TD1A 3AEUB 2F8SA 3OA0A 3ZS9A 4G56A 1FXWA 1DT3A 2OILA 3L02A 3PGXA 4MI1A 3HV0A 3KEMA 4TV8F 1U1DA 4LRUA 2IBMA 3MQ4A 4ZQGA 3ZS8A 4QT4A 4HAOA 3NHRA 4YH1A 1R4MB 1PT6A 1SVLA 4GICA 3BMCB 4BFXA 1IY0A 4UJ5A 2HRBA 3RUPA 4CM9A 5KWSA 4DLWA 3D3EA 3MCZA 4A0HA 3EVCA 2YJZA 2V3VA 3R3JA 3W5CA 2QE6A 3R6DA 1T8YA 4L4UA 4ZDWA 4QBHA 4E7OA 1HDZA 3SHWA 1QWOA 2NZJA 1CY6A 4MVJA 1XA0A 3PIRA 4FBMA 2OMKA 3RGWS 1SVOA 5M34A 1JG7A 1EBBA 1WDKA 1DG3A 5D8DA 5FWNA 1N2EA 2QN6A 4PNPA 5AVKA 5KOYA 3CKYA 3G2LA 4K9PA 1BMFD 3VR6D 1KY2A 3C6MA 2PYDA 2ZB3A 3DP7A 1ZEMA 1E3MA 1KJYA 3PHCA 5BW8A 2IZOA 4DUGA 3L9XA 4UHHA 4YUZA 4P3PA 1ECBA 2WU1A 4KPUB 1UJ5A 1XJCA 3M6FA 3NG1A 1VMKA 5B2EA 1ATIA 4DSTA 3GROA 4EITA 1M1YA 1J8MF 1XZQA 5C34B 5L7TA 3RM3A 2WSIA 4KLNA 2BEKA 1TK2A 4C4AA 1X77A 3FWYA 1MX3A 4E4YA 2IZ5A 3D6VA 3WLJA 2P4QA 2ZVDA 3WY9A 3PNLA 4Q4HB 3CT6A 5E6UA 3WL3A 9MHTA 2VP9A 5HNKA 1OTYA 2JGJA 1V4BA 2E3JA 2P79A 2RHLA 4GZ3A 4MEJA 3PXGA 2FW6A 4MWZA 5JY1A 1JVBA 3ZVRA 1G38A 1P19A 1PR1A 2NUAB 1GARA 1NI3A 4OQEA 2PFKA 4RZ3A 1XTVA 3W2GA 1G6OA 2NXJA 3RAFC 1XTPA 1PQWA 2ADFA 1FF9A 3NNSA 1TYBE 1ZICA 2CE7A 2JRCA 2WIAA 3UBMA 3ITDA 1H0HA 1NF9A 3NHUA 4D9FA 5IJXA 2O8NA 4LQLA 3U3OA 2EATA 4PPYA 3ZQ6A 2HSGA 1WCWA 3H17A 4HQRA 1GITA 2XDQA 2QG4A 2FZLA 2Y1EA 1VFNA 2JEYA 2Y3IA 3HKCB 4MTCA 5KVSA 1YDWA 3KVOA 4HYTA 4OSOA 5CB4F 4LHZA 2B8JA 2H16A 5AW1A 2WWTA 4BNWA 3MOGA 1SWWA 5D00A 1HDOA 2FF7A 2VK4A 5E6RA 5B36A 5LR6A 3NOXA 7MDHA 4DV6B 3K9BA 3ZWVA 4GFDA 5DYYA 3AYZB 3T7CA 1IQPA 2ZZKA 1R6DA 3NCTA 3WLMA 1TAHA 5CG2A 4R9RA 3NWEA 4XVHA 2YW9A 5DHQA 3VR5A 2D2IA 1RBQA 3RTEA 5JZMA 3HXOA 4D98A 2W4IA 4FUQA 5ALQA 3CHYA 4HLNA 1W35A 4TS1A 1B6RA 3IMEA 1CY2A 1T2UA 3V4ZA 3VH1A 4YC7A 4Z4CA 1PJ4A 3GAZA 1N0HA 1NQVA 1KZ4A 3B20A 1E61A 3HRHA 4QUIA 4F3CA 4Q19A 4R69A 1C3JA 1ZLYA 2ADOA 2DKNA 4UREA 2Q7OE 1UMBA 3MTDA 4KXVA 1Y7LA 4PPGA 2WSBA 1H3FA 1VGRA 1SUSA 2Q4DA 4P35A 1YCDA 2I3DA 2HI0A 2VYND 2JAUA 3TSZA 3KLOA 3OE7D 1MQSA 2OOKA 3OZBA 2QMZA 3R5XA 1SJ9A 2ZBRA 4GLFA 3VR6A 721PA 2IIPA 4XIYA 3FYTA 5T4HA 3IMGA 3DT9A 2C4WA 4MW5A 1SHZA 4IIJA 1AGNA 1RI1A 2GJKA 4TVBA 1AV6A 1L4UA 1GGEA 1Q6ZA 2HRQA 3FCOA 1TM4E 4PICA 2F2TA 3VOAA 1U2DC 1AKUA 1E4EB 2XYGA 4ZDJA 4TOIA 1ZEJA 3VYSB 2H92A 4RPLA 2DLCX 3KBOA 1KAMA 1Z16A 2OHOA 5C18A 5GVSA 2I4TA 4MWEA 3HJUA 3BHMA 3A05A 1OAOC 3BRWD 4Y9DA 3GLFB 2R48A 3GRYA 4WK0B 2ZB4A 4GMHA 4EYGA 3THYA 3K1AB 1QO9A 1M1XB 3EQ2A 1NLZA 4P34A 1SO8A 2Q5OA 4LRYA 4PZEA 5IAJA 3NVKI 4N76A 4PU0A 2VYQA 4BJ5A 2Z08A 1RYFA 1ISHA 1P7CA 3WSWA 3SS8A 1UKAA 1QNLA 1WXXA 4EJMA 2HHHB 2YRXA 4YV1A 1FMFA 3F78A 4N9WA 2Q7DA 1RPNA 3CEPB 1DX9A 2VDQB 2ATIA 2WV7A 4HAVA 3RNLA 3T15A 3A2LA 4H59A 1TAUA 4AQYB 3IRUA 4G0PA 4K6MA 1W0KA 4OP1A 2PT9A 2OGWA 4QBFA 3ZEAA 3T3MB 3PENA 1F2DA 1V8PA 3QSGA 4DNOA 3U5TA 3D6AA 3A1EA 3IODA 3DAYA 4FU0A 2X0NA 3QYPA 4M1EA 4M7OA 5D3MA 2QNRA 3M1IA 2A84A 3O21A 3WK5A 1ODKA 3W2EA 1KZYC 4OYHA 5H4GA 2IOFK 3NYQA 4IJUA 3PX3A 4OMUA 4PIVA 3M6MD 4ZFNA 5BN1A 4F5EA 1WY7A 3P9NA 3ENKA 3TVTA 1A0OA 2NQ2C 3CLRC 5K3BA 1NW5A 1T2NA 3U4HA 4J7CA 3CLVA 1E1KA 3OSUA 3QNUA 2M6KA 4C6HA 4B7UA 2C95A 5JNTA 5KTYA 1L5MA 4P5EA 1NRXA 1P1BA 3CX6A 3H2BA 4RD3A 4UCWA 5DBFA 3LXMA 2DERA 4Q05A 4W5JA 3Q8LA 2QUHA 5ER6A 2PS0A 2AX3A 2EWMA 5CGZA 1ZM3A 4MS1B 3GJ8A 4COOA 3J81k 3AF6A 4ZCQA 2A7XA 3EUFA 3C6XA 3KB2A 4F3RA 4I1OA 3EUWA 1DTWB 4OH7A 1RLJA 5B58C 3HJRA 3LKZA 2QZSA 4DT1A 2ZRDA 1LK0A 2IYXA 4IF6A 3W8RA 1CS0A 1WNFA 3KZNA 3U3JA 4RK5A 3RVLA 5H83A 1FFWA 3TQQA 1OC2A 1USVA 4GWKA 4JQOA 4E33A 5HIIA 4F92B 2CCKA 2W2MA 1VIYA 2P0EA 4TVSA 5LUBA 2KS6A 5IBCA 1KE1A 3ESBA 3ROTA 4HWGA 2JHAA 3QUTA 5DEOA 4MYDA 4R83A 5KJ6A 5DHAA 3ZV3A 3RSQA 5FV7A 2H52A 1MBZA 2B98A 3WV4A 1KH2A 2CB9A 2F1JA 1UFRA 1T4BA 5IT9A 5EXSA 1T1GA 1X7XB 4QHYA 2DEUA 1IWBB 2O54A 4DQVA 2DZDA 3I52A 3SJCA 5IM4A 3EXAA 2XX3A 2W8ZA 3UA4A 3NWOA 3U48A 5JS7A 1W9HA 4L07A 4HBZA 4IHKA 1EINA 5FPYA 5TPZA 3A3OA 4CL0A 4ZHQA 2L2QA 1XE3A 3O74A 3KR2A 2WJPA 5AKXA 2QX6A 3EVEA 3GVIA 3UB4A 3QXHA 4M1ZA 4C9BA 1APBA 1PFYA 1ODLA 3AIMA 5CBPB 1WKVA 2HBYA 4EAAA 1YZKA 3HB7A 4TT3A 3UT5A 4Q3OA 4WGFA 1JT2A 4JUIA 5E7JA 5G40A 1WR8A 2L42A 3KG2A 1NP3A 4X84A 2G5TA 4L4XA 4GSLA 2XTNA 1E32A 1L7XA 2Y0DA 1NXXA 3TXYA 2P27A 1YVPA 2GM5A 4X71A 2W00A 3EGDA 1Q0PA 3AG5A 1JBEA 2IXTA 3GGGA 4KIFA 2IXFA 1Q91A 2GBLC 4GIBA 3TNDA 2HA7A 1ISPA 4ZHQF 2HHAA 3I37X 2RI1A 3GRZA 5AM4A 3WIBA 3IBCA 5IU6A 3KD2A 3GA5A 5FF9A 4KL8S 1C8VB 3HYRA 1E8MA 4M98A 4G41A 5EEHA 4ZU1X 3UKJA 5JD4A 2AZXA 3F3MA 5NLLA 2R97A 1EHCA 3AUTA 4Q4CA 1N6KA 3WLNA 1U90A 4F45A 5FL3A 4OH1A 3QNWA 2Q46A 4RTJA 2JK1A 2HFJA 3X1DA 4F7DA 4CKEA 4ZAFA 3FYDA 1NQWA 1OU4A 1L4EA 1W1IA 1GQYA 3WRXC 1QH8A 1T36A 3TNFA 4JJ6A 3SE0A 2PUWA 4RHTA 3WGTA 5CIYA 3DZCA 5DYGA 2IYEA 2RHCA 3I5AA 4AUNA 1E2IA 2Z5LA 1Z0ZA 3QXXA 1MX1A 1GKIA 5KWIA 4YCSA 1HM5A 3T9FA 1RW4A 3C6QA 3W2IA 2P9GA 3AF5A 3PRKE 4A6XA 4B34A 4C7OB 1C4OA 3LUBA 1XX6A 2GM9A 5KYWA 4F2PA 4U4AA 3AOGA 4MVCA 4HXFB 4P3YA 3RYIB 3DMRA 3U7IA 3ZWDA 1CR6A 4DRXB 2JHFA 4Q9LA 1Q5PA 4C5CA 1J23A 4JDUA 3LECA 3V8MA 1XDBA 4H4EA 3TW6A 4BMXA 2R60A 1FTYA 2GBGA 5B3KA 5AMXA 5FD8A 3QWFA 3IL2A 5K3OA 1JI3A 1ZI9A 3PYMA 2QDKA 3BF8A 3D7SA 3FYHA 3IPXA 3QLUC 4A6DA 4C4RA 1ABFA 5T3UA 5C5CA 2JCYA 3TLJA 3P2JA 3DDHA 3H97A 4OHOA 1F38A 4F72A 1V6AA 4KXFB 4P0QB 3TIVA 1KPIA 2VHXA 4B3IA 3L4SO 1F1JA 4HDSB 3R1IA 2QRHA 2ZI3A 3AETA 1B4DA 1NLFA 7AT1A 3Q3EA 2A9OA 2NADA 5HEKA 3A1TA 4P7FA 3I8SA 5L95A 3TGLA 4OHVA 1VDMA 1Z0FA 3DWFA 4NCJA 4QBGB 4QRIA 5KWEA 2IS4A 4I1SA 2HJ9A 1Y34E 2ENUA 1WMAA 2YWEA 1XDDA 4KMSA 2R62A 3OE4A 4WPGA 4P7BA 4RMIA 5C81A 2F1IA 4U5XA 4RPHA 5FOTA 1QIMA 5EE3A 4QJ3A 2IX3A 4X62B 2C7RA 4BX0A 1FSGA 1G16A 2BFBA 4HFMA 4WOCA 2RCYA 3JAKA 4YUVA 4UKDA 2M1ZA 2FOLA 4R7TA 3D7KA 1THZA 1RRKA 2AVNA 4AROA 3ER8A 2OFWA 1RQPA 1LVUA 1VLMA 3GQBA 4HWTA 4H6VA 4JC0A 3ZBUA 1R8YA 3ZCPA 4BO5A 4KOAA 3FOWA 1TQDA 2IUFA 3H2IA 3N9IA 3K0AA 1DPGA 5DHUA 4QFCA 1LPOA 3DMNA 1Y3CE 3UAGA 1R4MA 1V1RB 1XG5A 5A3JA 3TN7A 1AZSC 2WAYA 1N8SA 1GOTA 2I0FA 3SXJA 1E2JA 4DEVA 1LJUA 2WK1A 3OETA 5L40A 3ZK9A 5ADWA 1QONA 2NUBA 3AEUA 4OXRA 1FP6A 5KJEA 4TV9F 4B3GA 5AK3A 1I1QB 2O8VA 1DGQA 3L0YA 1VTKA 1Y1SA 2BEVA 2N47A 4HAYA 3ZHXA 5IMSA 2VRWA 4YXWA 2ZQYA 1MAWA 5G3YA 2FZKA 4PS1A 4BQOA 1RAIA 1LRJA 1NW3A 1RC1A 4IG9A 4OQQA 1WB4A 2BCJQ 3P0JA 3IIMA 4ALJA 5K7SA 5ALVA 1EFVB 2GD0A 4H4DA 3CZMA 3SC2A 3VKHA 3KRTA 1L5YA 3PVCA 4FDLA 1C9EA 2BFDA 1Z28A 5DF1A 3OQOA 3PWZA 4C01A 4Z1MD 3L8MA 1AUVA 3FH0A 3WB1A 3ZZNA 2WSYB 3L7LA 2XXAA 4D79A 1PWEA 2NZ2A 1K66A 2AG1A 1V39A 1NV8A 2JI9A 2C58A 2CVZA 2Y77A 3ZDXB 5BSVA 4RCVA 2CDBA 3RRYA 3T4UA 4J29A 3H7IA 5BR7A 2NQ8A 2QQ5A 3AR7A 3CUVA 1EJ6A 4BO2A 3JVEA 2I7CA 3COJA 1ORRA 1MTZA 2PKQO 4EGFA 2ECKA 5IKXA 5K05A 2RHHA 4YJFB 3G0BA 2BISA 3HJTA 5C1PA 3LHIA 3I9OA 3QPCA 5HA5A 1W59A 3BZUA 2D13A 5JVDF 4DE5A 3GH3A 4ZN6A 3EWSA 4R2MA 3DP9A 4ZKDA 2IP2A 3M6LA 1HPLA 3EEBA 1GAJA 3Q0IA 5JEEA 4F3TA 1KYYA 2YWRA 3K09C 1MC4A 1W49A 3KQTA 3MC1A 4OPMA 3I4FA 3E9RA 3LVQE 2FWAA 4PQFA 2WU3A 4JAVC 1MT3A 1NJSA 1U3CA 2FMTA 1E62A 4JYBA 3LY7A 2QUKA 3AP3A 3RNOA 3UJCA 1KQ3A 3A3YA 1Z2AA 3MJSA 3FB1A 4GRDA 4UHCA 3R9XA 1NW9B 1OREA 3LGAA 1HLDA 4HYYA 1K7EB 5EQTA 3L7KA 2D54A 1J8QA 3R76A 3ZHSA 1W25A 4XPZA 1TUGA 2VXYA 4OD0A 3UVEA 3UJPA 4EIWA 2JBAB 2IH5A 1O4WA 1IEVA 1SD2A 2GN6A 4L08A 1BC5A 1J39A 1AQLA 2V5AA 1D2CA 2HH9A 2BLNA 2PJUA 3H2JA 1M6EX 4WZAA 5AP9A 3OQIA 3U3KA 3BGDA 1FJHA 2AVDA 2C5EA 1DO2A 2VTEA 2Z5GA 1IL0A 1I2AA 4J91A 4KAFA 4X6XA 5T4EA 1TTHA 4BHTA 1R6TA 3OZCA 5LOVA 1BX0A 1JA1A 1U1GA 3F98A 4GQAA 3M83A 2VHUA 4KDCA 4UFNA 1NNEA 3UXHA 1Q19A 1JDVA 3GEPA 3IIEA 2BMEA 2YHUA 4PZDA 4J4HA 3MD9A 5EZ6B 4F6CA 4I1UA 5F5XA 3KTAA 1F06A 4FYVA 4NCXA 1AE1A 1ZBQA 5AO9A 4BJ3A 5LQAA 4W9MC 2FUNB 2JI4A 3EF1A 3TRIA 1U0JA 4E0BA 1WZUA 1MP0A 1OIVA 2IHZA 5E2IA 1VB3A 4QLOA 4HATA 2BFFA 2DBVO 2UYGA 3LC7O 2JKVA 3UCFA 1I8TA 1Z4MA 1YTUA 5P21A 3HKDB 3RVKA 4N48A 1Z62A 3RI3A 4MVJD 1SU4A 3LQRA 4RDIA 4XX1A 2EDAA 3K53A 1CR4A 4N5LA 1RI5A 3TKAA 4KWCA 2BI4A 2JW5A 4AMUA 1G9XA 4HS9A 4YRMA 2Z6AA 4IILA 4HH0A 1ZSYA 2FW9A 4GS5A 4BNKA 2FEWB 2I29A 1KYQA 3A25A 2HMYB 1C7FA 2IJGX 4DYDA 2ZBVA 3R44A 4Y2SA 4HAXA 3F7MA 1UBTS 4AN4A 1ZI8A 5CFZA 2PWAA 2M6RA 1SZPA 1TYEB 4M4SA 1OKKD 4V1CB 3RJ5A 3EVTA 1NNLA 1KJWA 1BE0A 2P5UA 1JFFA 1R16A 4WXEA 4CHTA 2H59A 1IFXA 3C6BA 1NMZA 5H3CA 2DC1A 3K1AA 4RHYA 3CUYA 3SX4A 1ZUNA 3LPCA 2PU5A 1Q7BA 4GLOA 1FLVA 1LI4A 4QDOA 4WTOA 2DF8A 4AKIA 3BC1A 5PNTA 3UANA 1Z2OX 4OLJA 4HFNA 3CO5A 1GQFA 1I1OA 3LW7A 3FPEA 2Q41A 3QLJA 3OQBA 4MMZB 3WKDA 4LXGA 1MJ5A 3V1MA 4EFDA 5LP6A 3G89A 2EKPA 4Q4LA 3F6BX 4YBRA 5DM0A 1NXTA 1Y82A 4RY8A 1V8OA 5J2TA 1GKYA 4WLOA 3L7CA 1ZD1A 1PNRA 2FCAA 3WGYA 3DXXA 3JAWB 1AY0A 1M10A 4CM3A 5CVDA 5KC8A 5COQA 3RRFA 1TTTA 2HLPA 2V5UA 2R65A 4J03A 5EHIA 1G19A 1Q17A 4UMVA 4YO8A 4DPLA 5IMBA 4WZAB 4Z2YA 1YCFA 4X94A 3LKDA 1IIRA 4OJYA 1ISGA 4G1EB 3AFMA 1WD7A 4DOMA 2QSJA 1U2RA 3NWPA 2VQFB 5ALSA 3CJRA 5KSWB 4JX8A 3GJQA 5DP2A 1JTEA 3T7EA 2QMYA 3HDYA 1S6YA 1B2LA 5EHGA 2AFRA 3O3NB 3ZHQA 3OE5A 3RIYA 5JAZA 3O2SB 1GTSA 2BFOA 4C5BA 1XEXB 1L5VA 9ATCA 3DCNA 5CB0A 3QLEA 3KPYA 1PG2A 1U8TA 1NXQA 2HPVA 4J9VA 4IIFA 4I9GA 4JB8A 4G8BA 3B48A 2FPLA 2NOAA 4TQGA 4E51A 3DZGA 2EYQA 3RO7A 4WV3A 1ZM9A 1G66A 2F1KA 4EF5A 1KFKB 4F2WA 5K8JB 2MTBA 2IU0A 1M2HA 1PLKA 1WA5A 3C3XA 1P6QA 4RANA 3GO4A 5IKOA 3EIHA 1MFPA 2L0XA 1PR5A 1U0EA 3AZQA 3DEIA 4XIFA 3WYGA 1BWSA 1K8RA 4C30A 2QTRA 1ZNXA 3MWFA 1XVLA 3H8WA 4RIHA 1W36B 3D7LA 2EOAA 3R9XB 1QRDA 1YNOA 2FCRA 1P0QA 2ODWA 1L5QA 3PD0A 4PLZA 4QDTA 1ZJ6A 3QEMA 3HLTA 4F4DA 1M72A 1UBUS 4TQAA 2DJ5A 4M9ZA 3NAGA 3U37A 1LC3A 1YDMA 1EQUA 2WTMA 4LC0A 4LRWA 1LB1B 1QRAA 1M8JA 9LDTA 1SBTA 3B9RA 3LQQA 4NZZA 2DRIA 3SZOA 1NVEA 4D81A 3T7JA 2GCOB 3VTKA 1ZHFA 3WWYA 1MPXA 1EDDA 4KVFA 3IBFA 1SXJC 1YXMA 1THTA 1ES9A 2GZDA 2EP8A 3CRZA 2PGAA 4LK3A 4NZ9A 1OW3B 2PD4A 3GRKA 2I03A 2OE2A 3IJEB 5F52A 2OXIA 4D02A 4TKLA 1MW8X 1QAMA 4LUCA 3T7AA 3PEWA 2J5QA 1MOZA 3NNNA 4D46A 1GGVA 4BNNA 2QL7A 3I62A 5CBPA 2FQXA 2IHTA 4B84A 5J1TB 5B57C 5IM5A 3VNUA 5IDQA 3UT0A 2WSSA 3FF1A 1SU7A 1VHLA 1Y3FE 2CF5A 1D3AA 1XU7A 1I3MA 2HLDD 2WUDA 4FYPA 4TRNA 1O95A 3N28A 4PZAA 5KEIA 1U04A 3QY9A 5DE3A 3R24A 3QHPA 2UZ3A 4RYDA 1T0IA 1FBNA 3T9EA 1VI6A 1ZNQO 1DKRA 4MB0A 1N6HA 1ZR2A 2GN1A 3LHKA 4O5OA 1N8KA 3T4EA 3DE7X 3ZC3A 2X3FA 1I4TD 4XUGB 4RULA 2XCQA 1O58A 5LQRA 2HK7A 2JBWA 2AR7A 3STWA 1V7CA 3PXXA 2EIXA 4TLDA 1I2ZA 4IGFA 3NHLA 4ND2A 4ARBA 3KOXA 3LHSA 3SFTA 4IRXA 1AKMA 1N32B 1HRDA 3DCIA 1DQZA 4WUVA 4IMRA 4WINA 5JWRA 3QVUA 3UKOA 5B4TA 3S3TA 3NBQA 5AI9A 4NWIA 1UK6A 3OFVA 2W6NA 3EQ9A 4ZQEA 4TWIA 4CMCA 4YMWA 4QBIA 5I6DA 2PUFA 1MO2A 1JEQB 3UWPA 1UDBA 1S8NA 1VMIA 4UU1A 2BBWA 3I34X 4AVYA 4QYWA 4LW8A 2AWNA 1ECLA 3AEXA 3RS0A 4CCYA 4Q4DA 5A7HA 4K87A 4YRTA 2R3SA 1AO0A 4ZJZA 1CEQA 3ZWAA 1Y4AE 2Y1GA 3OKPA 1G1MA 1W5AA 2RGYA 5FLKA 2KSQA 3OKCA 1ZXXA 3OPNA 2MIIA 4HEQA 1P7VA 2PLNA 4KMOA 4L73A 3EXIB 1T9ZA 2XYHA 2IW3A 1WQ1R 4MA4A 4QT0A 4KJXA 1J33A 2GZRA 4H16A 4KMRA 5KYUB 4RC9A 1Q3HA 4NBRA 5CVCA 3QIAA 1KYTA 2PVPA 2HTEA 2WA1A 4CF5A 4O63O 3UMBA 5I7EA 1C3LA 3EA4A 1KAHA 1OH8A 3IUMA 1Z6XA 2B4QA 2OGZA 4MWSA 2UKDA 4H27A 5FCDA 1YMQA 2JAQA 1ZGAA 2RJOA 2RHBA 1LY1A 4FBGA 5DYIA 5DW3A 1PZEA 3R3WA 1VBKA 3JXEA 1SHJA 1TUBB 5FHQA 2V7QD 3IUBA 4HH1A 4ZHSA 3KAPA 5CB8A 2JD1A 1UFQA 1VLHA 2BFNA 3SC6A 2O1XA 2HSZA 5JNVA 1XYYA 2H48A 4I2VA 4LWPA 1CY7A 5HF5A 2OFFA 4I3FA 4C4XA 3EFOB 2AJ8A 5E6RB 1XF1A 4BWFB 3I30X 3ZV4A 1QIKA 2JGFA 2F64A 4KEAA 4R1UA 1XWFA 2DHCA 4UU8A 4MQBA 1B6GA 3VPGA 4EUFA 1WBDA 2J4FA 2X2PA 2C59A 2LRHA 3PJDA 4KP7A 1SBIA 1I9GA 2EHDA 3AC0A 4KSYA 4D41A 3A4LA 4X24A 1DO8A 5KYXA 4MDYA 1XP8A 3G6KA 1E94E 3DE1X 1NQTA 5KTKA 4IOJA 3WIOA 4ZOLA 4JI7B 5CYGA 1A8SA 2COKA 4TZ6A 3VYTB 5DN9A 5JSQA 3WKCA 2FFBA 1L8LA 1O54A 2NV6A 1U2QA 2OB1A 2XD4A 4HOYA 5AW5A 4YQFA 3C0KA 2FPUA 4PAQA 4TMTA 2SHKA 5KQLA 1I36A 1IMOA 1JRLA 1XDUA 1Z7EA 2M2IA 2ZROA 4MPJA 3ANMA 4YJKA 5JUWA 3L7YA 3DA8A 4HP8A 4MHSA 1LDNA 1LV8A 1V45E 1GPNA 1OLXA 3LQKA 1YQEA 3ONNA 4LJ9A 4EZBA 3KEQA 2O14A 4R1TA 1IIBA 4L8VA 3ET5A 1XTIA 3G9XA 1F17A 3MAAC 3MJCA 3M3DA 3FOCA 1RJFA 4MRVA 4IP0A 4BRUA 2YVQA 3ZGXA 3LRXA 1O1YA 3FNHA 1E0SA 1ZXBA 2BFCB 4DA4A 1IB0A 2NXEA 4EDFA 3R3VA 1R2QA 1W5BA 2PGIA 4CLHA 5BMVA 4G5FA 3OJLA 1FFEA 3G5LA 1L5NA 2A3RA 4N0MA 4I4NA 4EJ0A 2WAOA 3KB1A 4A0GA 1SNYA 2NZXA 5KYYA 2QB5A 2REQB 1FYFA 4R7GA 3SEAA 5JAMA 3UTCA 4LNAA 4MV9A 4D92A 4EB0A 4M1WA 3IT0A 5FOVA 2J0UA 5L3RA 2GN8A 3T3EA 4PYIA 4EA9A 2QBYB 1MJNA 2QTWB 3OZRA 4RH0A 2QN1A 5ALRA 4PBSA 5FPSA 4YCLA 1DG1G 3N76A 3CZRA 3KV3O 4X20B 1N0WA 4ZJUA 3MRVA 5CFNA 4HAZA 4E1AA 2C9CA 1W0JA 2J9GA 2JGDB 1HDGO 1CR0A 2FRXA 3IB6A 3PP8A 1GYQA