2H1VA

Crystal structure of the lys87ala mutant variant of bacillus subtilis ferrochelatase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
309
structure length
309
Chain Sequence
SRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLAHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Amino Acid Residues His183 and Glu264 in Bacillus subtilis Ferrochelatase Direct and Facilitate the Insertion of Metal Ion into Protoporphyrin IX
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
molecule keywords Ferrochelatase
total genus 120
structure length 309
sequence length 309
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2006-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h1vA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h1vA02
2QD2A 2AC4A 2QD5A 2XWSA 2QD3A 3AQIA 2XVXA 4CCSA 2HREA 2Q2OA 2XWPA 4KMMA 2HK6A 1L8XA 2PO5A 2XWQA 3M4ZA 4F4DA 2C8JA 3HCNA 2AC2A 2Q2NA 2QD4A 2H1WA 4MK4A 2PO7A 1QGOA 2DJ5A 2H1VA 3W1WA 3HCRA 1N0IA 4KLAA 1LD3A 2Q3JA 3LYHA 2QD1A 2JH3A 1C9EA 3HCPA 1C1HA 2PNJA 2HRCA 1LBQA 2XVYA 4KLRA 2XVZA 3GOQA 1DOZA 1HRKA 3HCOA 4KLCA 1TJNA 1AK1A
chains in the Genus database with same CATH superfamily
1EVIA 2JGAA 2OGWA 4TRNA 2AOXA 1UBNA 3AJDA 3KZOA 1DJMA 2XLCA 4M60A 4EKEA 3ZWNA 4KE7A 1SQ6A 3M2PA 3R6TA 4WESB 3GBSA 4I9GA 3BTSA 2VKTA 2EFHB 1PDWA 2XB8A 1DJLA 4M7PA 5COBA 1XEXB 2P8SA 2VH1A 4FZRA 5F33A 4A9AA 2CNKA 4CKZA 1QF6A 4FLMA 1QO0A 3G0BA 3CLSD 1SUBA 3PCXA 2YVLA 3FZYA 3EGWA 3KAPA 1U2TA 3CS3A 3MLAA 3ENKA 1Z8FA 3MCWA 4F6RB 2FZLA 2QSJA 5IVDA 3VVLA 2RHMA 3TGPA 2PX6A 3HEBA 4GVLA 5BP7A 2KW5A 4L5IA 4R9VA 1A2OA 2NO5A 4CM9D 5KYWB 4AKSA 3E7DA 4PLVA 1BD3A 3UGQA 1JEAA 4KXUA 1UF9A 3QVGA 4LKOA 4RZUA 2XQIA 3OZUA 4N7RA 1NPTO 1B8VA 2A30A 4YT5A 2A3NA 4GOND 4NDNE 4QQKA 3ZS8A 3ZGZA 2F4NA 2C77A 3C8HA 3UIEA 5BNZA 1RQ2A 3MCVA 1I1NA 2DULA 4TYWA 2VJCA 3LGSA 3NDIA 2XZLA 1NIPA 1A96A 1Q6YA 2FEKA 2WFZA 5H3HA 5CM9C 3ROPA 5KHOC 3ZOZA 2L82A 2ZIAA 1I94B 4A0HA 1TRHA 4X95A 1FFAA 1IZ9A 1KKMA 3C4VA 3AR3A 3FHJA 5JSYA 3NV7A 3TKYA 5KNDD 3RVNA 2UUCB 4G1UC 2PSFA 1LK5A 2WPDA 4LDJA 5CA0A 2RG1A 2OHVA 4JYPA 1UMDA 1XCOA 5DK4A 4EEXA 2VYND 4FFRA 4UFNA 5GOTA 2HGZA 1TVKA 2PZBA 2QRLA 1BE1A 4OB8A 3EGDA 5E4YA 5A1TA 3GEGA 3UXEA 3GLFB 2QL6A 1RYZA 1ZISA 3NWPA 4G24A 2FSHA 1TAGA 3ZE0B 1YL6A 2HK7A 5LOVB 1DIRA 1XV5A 1X2EA 4II2A 4HZUB 2V4UA 3WNCA 4BO1A 1TLLA 5L3VA 4ODIA 4OQLA 2X5OA 2OBYA 5ANRB 1M2OB 2O0JA 2PT7A 5A3SA 2DPXA 2VI5A 3G9ZA 2VRCD 4ZVMA 4DLRA 3BBLA 4EY3A 3VPBA 4P7FA 1EVEA 3F71A 4KPFC 2WTAA 3I2JA 1SPBS 2CHGA 4PSKA 4TUYB 2RHCA 1P9LA 4EM6A 5I7RA 5FLXA 3VNVA 3HA3A 4CEIB 1HI9A 4XEHA 3R4CA 2BFNA 3EYWA 5EMLA 3Q3IA 4PX2A 5BQPA 2HPZA 4INPA 1W85B 3AU8A 2GTIA 2I2WA 3TZBA 4A92A 2JHAA 4BWYA 3IBFA 3T7AA 5EIFA 4DGQA 3FNHA 4JYBA 2O2GA 4KDFA 3P52A 4QBTA 3GJQA 5TIIA 3BDIA 3HCNA 4MGHA 4ZDJA 2J45A 3MA0A 4G5YA 1IZ7A 2BTQB 2OUIA 4K6KA 4WZAB 3VTFA 2V7UA 2A9JA 4GWLA 4ND8B 5TQJA 3VH1A 1FF9A 2D1YA 1TMGE 1L7AA 3AOEC 1L1EA 5L7WA 1NNLA 3B9RA 1O6GA 4R8VA 3FYSA 2PCJA 4COOA 3NR2A 2WKRA 4XWAA 4CN8A 3PWKA 1EFRD 3VRHA 3CLSC 1M8JA 1R0LA 3K2IA 3KHUA 3PEEA 2EQAA 4FHCA 3ZY3A 2VNAA 2VG8A 3VKVA 2GVZC 4HAWA 1AD2A 3ZHZA 1WXGA 1XKXA 1BRTA 3RU9A 3I6ZA 2BMAA 5IJAA 1M6VB 1FP4B 5IZCC 1E0SA 5CPFA 3UOAB 5I9BA 2QU8A 2ADFA 1NMEA 5AI0A 3KT3A 1GD1O 3O1IC 1A5BB 2OMEA 5EP3A 4BMCA 3TGLA 3O9MA 2G88A 2A35A 1HE4A 2BE7A 3PGJA 1N2HA 1Y9ZA 1TQ8A 4AJEA 4PGHA 4DSUA 4UFOA 1T10A 1UBCA 4DMKA 5B57C 4PG4A 4WV3A 3AHHA 5F5LA 5KREA 1MDBA 4FGJA 1G64A 3D3WA 2DFNA 2GZAA 1G4HA 5MDHA 3EPRA 4A2CA 2V3CC 3DTTA 2HU8A 3JQ9A 3IEXA 4BX8A 2QGFA 3Q0EA 5KWSA 1TRKA 3X1MA 3P2YA 1SM4A 3D6JA 2CVPA 4JGBA 4OVKA 3JQ9C 1E1QD 4P4NA 4ZI2A 3JARB 1HETA 1NRIA 2VZ0A 1IHYA 3K35A 5ALXA 1XJ5A 4INOA 5LP6C 3L6BA 2JFFA 5F51A 5M3BA 4Q1VA 3Q8XB 1R7RA 1ZR2A 1OH6A 4TZ6A 4KFRA 2Y4OA 1XMQB 1ZZGA 3FHCB 4U02A 2PUTA 1AUXA 1JHDA 1I9GA 2YC4C 4WCDA 1IPEA 1GTSA 3ADDA 3ZCVA 1PJSA 3T7KA 1RTKA 3BZBA 4JQCA 1W7AA 1DX4A 3GFFA 1J2YA 2GPYA 1VLMA 1IJKA 4DDKA 3LTNC 2F3PA 2IIVA 2D6FA 4TYNA 1TM4E 3SHVA 3GA5A 1H42A 3P9IA 2R11A 3LQ1A 2AS0A 1PJBA 4P2GA 1J6UA 3B6MA 1U7XA 4HTFB 521PA 3V2UA 3WIEA 4DV1B 2BR4A 3NCTA 2PKYX 3MCAA 3CNLA 1I7LA 1L4FA 1QR6A 4G6ZA 1MHPA 4PIVA 5CNKA 4A6DA 3EC1A 4LYEA 3QK7A 2AMJA 3MAJA 5FFNA 4LHZA 4KXMA 3RU7A 4ZC8A 1Y6JA 2GB4A 4V24A 3WK7A 3U44A 4ZDIA 4D42A 1J97A 3Q7IA 4AY3A 1XNHA 2GF9A 2NU6A 4YRLA 4F72A 2WJHA 1ECFA 1G5PA 1O89A 3I45A 3Q2OA 3TSCA 4AG3A 1AKQA 2AG8A 3KR2A 3L77A 3ZUPA 4C0LA 4BNXA 4RCZA 1QFJA 2QQ5A 4L5CA 4GHWA 4UARA 3ZHQA 4D92A 5IT5A 3RFFA 1IQRA 4N54A 1XXHA 4M21A 3H11A 3EWSA 2JATA 4PZDA 3R0JA 4PVDA 1P18A 2Q62A 3KVRA 3LX8A 3OT1B 4C4TA 3SZRA 1XL0A 4KVFA 2B69A 1RXWA 4UJ3A 1XRSB 3WNDA 4OHCA 2PSHA 4KQMA 2LNDA 4DIOA 1FSGA 1XN1A 4EYEA 1VBNA 2HUPA 3LHSA 4YRZA 2PO7A 4RGQA 4DJEC 1DRWA 3IXLA 3GEPA 3PQCA 1XAHA 4IM7A 3BDAA 3LPNA 2LV8A 2PH1A 4LJ8A 5BVHA 5IBCA 1EX1A 1TEZA 3LYUA 1FYVA 1N2BA 2VCYA 3CPEA 3G2JA 4V2UA 5CGQB 5CPBA 3WBKA 2ZBEA 1UK9A 3GELA 3N28A 1PVDA 5EC8A 3FIJA 4JBYA 3H2KA 3LOUA 3OQVA 4B6RA 2MR5A 2Z9CA 5KSOA 1X42A 3CE9A 1A0OA 4OHOA 1DGQA 1LPSA 3IDFA 3KYBA 3LPCA 1RKXA 1XYYA 4NTZA 4LXIA 1GAXA 1WEKA 4F3YA 4J2OA 1T2FA 2IU0A 1C0IA 3H05A 3GT7A 4IIJF 3OF2A 4N7BA 1MABA 3IPRA 4IVPA 3ORFA 4JC4A 3E0QA 1BX1A 2YJ6A 4WH0A 3K15A 5I8ZA 3MM4A 3VOAA 1KK3A 4PLCA 2D59A 4B4UA 1SKYB 9MHTA 5IN5A 1UJMA 4RLFA 5IM4F 2JGLA 2UZ0A 1VB3A 2DQSA 2HXYA 2WTUA 2VRCA 4XGRA 4MRAA 2WA2A 3A4TA 5AICA 4Z0NA 2BI4A 3NM6B 2PWZA 3LV8A 1YKFA 4Y6GB 4Q01A 2AC7A 2B3TA 3T9FA 3WGYA 1P7VA 4BFZA 2Q5FA 3QEMA 4HFRA 3GJRA 2QI9C 4WERA 1MX5A 3ZIAD 3S3TA 2Q7XA 3TPZA 4Z4QA 2H07A 1IUPA 2WDZA 4B83A 1FTGA 4OI2A 3ADBA 5JS2A 3COYA 5K5EA 2DFPA 4JP8A 5KX5A 3KKNA 3TQFA 1H1LA 1Q95A 1KMIY 2FSPA 4PU0A 4N18A 2VLBA 1EH5A 1H4TA 2Y66A 3JAWB 3QEKA 1RPZA 1PLKA 1RE1A 4RDIA 2CYCA 4RTOA 5B6IA 2ZRIA 1YS7A 1QHXA 2C4WA 3FI0A 1U7ZA 1ENPA 1C81A 1UWVA 2FOLA 3AEQB 5KQSA 1XKQA 3M49A 2XUJA 3HNPA 2Z3VA 4HNGA 4O2AB 3I6QA 3NW9A 3L79A 3PUHA 2F59A 4R31A 1BMQA 4TGLA 4X6LA 3CKMA 4BRSA 4HVTA 5HA5A 4DRZA 1XR3A 4RHCA 4CF5A 5LBTA 3SYNA 1SBQA 2J9XB 5C8YF 2QM0A 3SZ3A 1QOZA 5TLSA 2VHXA 2EYQA 1KNXA 3C4QA 3ET5A 1GKYA 2WIDA 3HUUA 3OU2A 4IFBA 4JLAA 1QYIA 2P9GA 4E88A 4EB0A 2J7KA 1N36B 1A7KA 4GP6A 4L6IA 2W37A 4JI6B 2AUNA 3H83A 1RXIA 4MTLA 4PO8A 3VR0A 2R7LA 1F7VA 1YHYA 1P7PA 2CMHA 1L7VC 2VHQA 4HLNA 4QBKA 1NYLA 4H60A 1D1PA 1YULA 4YXFA 2AXEA 2CV2A 2GTPA 3UK2A 4CKWB 3N8KA 4NJEB 1JJBA 4URFA 1QYCA 4KU4A 2Y3IA 4JCCA 4RZ2A 1OWOA 1JHUA 1GPJA 1GYPA 1XFAA 2E21A 3I0ZA 4UTOA 2JGKA 2IXGA 2JEYA 2E18A 3HI6A 2O2YA 3U5TA 3BJZA 5LP1A 2C5BA 2GN8A 3HL0A 3FNBA 3ADOA 3EQ8A 3FCOA 1KAHA 1QHIA 3FAKA 4CV0A 1IXRC 1PS0A 1GV1A 3FYUC 1II9A 1Q1ZA 5DJ5A 3JQ6A 1ZVKA 1T5LA 4L5JA 5B6JA 3MLEA 1NVFA 2XRMA 3MJVA 5DI3B 3EVFA 1E66A 3EPPA 1QKIA 2CJFA 4W63A 4D4IA 4DC9A 4DCUA 5B12A 2ZYDA 4Y2SA 1C7ZA 5HZKA 1GGMA 1KC1A 4P08A 4K40A 3F8WA 2BHTA 3LC7O 5FOSA 1U6IA 1SXPA 2B78A 3IIMA 4QGHA 5HILA 3CVUA 1T0UA 1NQWA 1B00A 1QMGA 4LXXA 4BC1A 1WUKS 4O2AA 5T8KC 4IDCA 4MRVA 3TBFA 3UT5A 5IAKA 2VJLA 4MEAA 2XRZA 2O8EB 3W7AA 1X92A 1PQ4A 3FR8A 4A2WA 4DB2A 4WN9B 2CL7X 4JMLA 3OZGA 4NENA 3T7RA 3DBLB 3URMA 4ZGBA 4QM7A 5T41A 3ANYB 1GPYA 2HNAA 5TQ0A 1U0SY 2C88A 5A4MS 2F2TA 4RESA 2MSEB 2R6R1 2GKOA 3EQZA 4FFBB 4OTZA 4KXXA 3K5IA 4GQBA 3ZIUA 1NJ5A 2I2BA 2Y0DA 3PENA 3SJUA 4AG5A 1P44A 1T1IA 1UZNA 2HA6A 3A1VA 2BFEA 1FDVA 3W06A 2ZTHA 1CLUA 3F9RA 3QPDA 3CCFA 3ZI0A 2UXDB 1I7DA 1T0BA 1VKNA 2PQ6A 1W59A 4NOLA 4C3UA 4OLBA 2R4QA 4TSFA 4S1VA 4JQYA 4QTTB 2Y1CA 2WINI 3PVCA 4C7OA 1KPGA 4RUKA 2AG6A 5KJFA 2W2PA 3GLGE 3RVLA 2DSTA 4Q9NA 3BJRA 3PSHA 2JLRA 2NUAB 3AP3A 1R4NA 3TPFA 3UV6A 1O1YA 3N8HA 4GKVA 1L5NA 1UOOA 2W22A 2Y68A 2PWPA 1OI4A 4QPZA 1COZA 2OHXA 4ZOAA 3CZRA 1FFDA 2ZIFA 3MGGA 3ND9A 1B0ZA 1Z9BA 4X8MA 3BSWA 3H84A 5M7EA 2VQFB 2YNMD 1HX7A 4II3A 3H4VA 3EGCA 3L4EA 4K9RA 3RWBA 1P2BA 2IJGX 2H0RA 3AGPA 1GNLA 4F6RA 4FQ7A 4EHBA 1S5PA 3W3AA 3RLIA 4I08A 2W8ZA 1UBEA 3EC7A 5AI4A 3TVDA 4LRQA 4W8GA 1C3OA 5ERGB 4B6GA 1VLHA 1N9GA 3B1VA 4MGEA 4GI2A 3CUVA 1WXFA 4CCAA 4ZKDA 1V26A 1GNQA 2J0UA 5BVHB 2CJYA 5CFMA 3BFPA 3EQ2A 3WO1A 2PLFA 3G17A 4C7XA 2J9YB 1NJ1A 2FUG1 1R64A 1CQJA 2MINA 1NVKA 3BH7A 1MCZA 3KQYA 5G41A 2P69A 2HQ1A 2VK8A 2P7IA 3VKWA 1CZNA 4WK0B 4B85A 2C9BA 4CG0A 4EKDA 1ODFA 1ZCBA 3RASA 1MUUA 5FAKA 2V9ZA 5K3FA 2P65A 1R5BA 1T9BA 1JJ7A 3A27A 3VKFA 2FPOA 3SDSA 5A03A 3L7YA 4XXHA 5FH9A 4JY7A 1LV8A 3CX8A 4KXNA 3SHQA 4WD3A 3UW1A 1N8KA 4GGOA 2BYTA 4HT3B 1E94E 2XD4A 4AZWA 3VR5A 2A0WA 5JRJA 1NXPA 3MW8A 2Z04A 3K73O 4N3BA 4IGAA 2RKBA 4OIMA 4G4JA 2JAQA 2SNIE 4IS2A 4XIYA 5ALIA 1J0CA 5EN4A 1BX0A 2OKGA 1B8OA 3G9UA 1A9ZA 3G2IA 1ULTA 3ZWQA 1L5RA 4NEGA 1FX1A 5IM4A 4ZU1X 4D4KA 5GP1A 1IBLB 3NTVA 2I34A 2QSUA 4RABA 4AJNA 4N6NA 4BZPA 1VFNA 1NC3A 1KO4A 2ODEA 2QZ4A 3TB4A 5I9SA 3N39C 3GLUA 3UJHA 1BSVA 5CM2Z 5A02A 1NF8A 3BXZA 3LJKA 1CWUA 1IMJA 1BVRA 2KB0A 2SCUB 3PXEA 3SSOA 4AJ2A 5EJEA 3W5DA 3OZDA 1EJ6A 3BE8A 1RYDA 2RCYA 4TWJA 3EEFA 4XH9B 5LQJA 2KLBA 2CL6X 1OF1A 5DSTA 1P2SA 4DY6A 4EB6B 1XCPA 1P0MA 1HURA 3K8OE 4H35A 4Z4GA 2Y76A 2QSZA 2FDXA 1TQ6A 2IEBA 2YHSA 5DM2A 5GV7A 4O8CA 2HEIA 3WGZA 1CUVA 1QK3A 1SD1A 1A9TA 2BHLA 2VAWA 1BDMA 1LRKA 4FE4A 3T4PA 3V4PB 2IOFA 2WWWA 4K1LA 4E5VA 2H5LA 1W0CA 2GFQA 3PWSA 4RQTA 2QE7A 2Z3WA 3VJMA 4K9DA 2WKPA 4S04A 1MT0A 3LHFA 5FOVA 3SLKA 1JEYB 5A7GA 4D9IA 4FX5A 5A3JA 2ZETA 4KREA 3L7LA 5TNXA 1N5IA 1RNLA 1T3HA 4NDZA 2UZ1A 4U8GA 2X2OA 2P6RA 3GEIA 2NQ2C 3IRUA 2AOTA 3G5TA 3JV7A 3HKEB 4MGYR 4OJMX 5LCXA 5JYEA 1DCKA 4MI9A 1KH1A 4ZVLA 2ZVJA 3M4JA 5I4IA 1LPBB 2P1RA 1Z0JA 3ELBA 4M0DA 4MWSA 3G85A 3H8WA 1PT9A 3PQ3A 2VJYA 2JGDA 1V35A 1U9JA 3ED1A 1EDOA 4BMSA 5CR9A 5G0TA 5HJ7A 4H6WA 2AV6A 4D9BA 2V7QD 1V6SA 2EWWA 4DXAA 1MJGM 3WK8A 1K5PA 1KEPA 4Q9DA 1VLJA 3FYHA 1T1EA 4IQFA 3BWYA 2W48A 3CNQS 2JCYA 3OBBA 5FL7A 2Q9UA 3UAZA 5LMZA 3NYWA 1UKCA 2IS2A 1M1NA 1MAAA 3H2JA 1L5QA 2EW8A 1P7WA 3ZY5A 4C22A 3BXGA 2WAAA 2IZ1A 3IIIA 4IXMA 1FU4A 1V1RB 3PWZA 1ZU4A 5BNTA 1K06A 2B2NA 2X1HA 1GLNA 4TMWA 4U2DA 2ECKA 3CEJA 1U9IA 3LLMA 4QO8A 4XGIA 5ARDA 3TZKA 4CNQA 1CFZA 1SVLA 1H6BA 2JH9A 4HL6A 4I5GA 4GLBA 4ND8A 1O95A 4WASA 5ALLA 5E7JA 1G21B 4LGCA 4IEEA 4ZEXA 4B7UA 3BMQB 1YRYE 1U2GC 5HX7A 4OQ4A 2NUTB 4GP7A 4G1EB 4M9XA 1U8FO 1K63A 3ZWOA 1XZFA 4GC9A 2QAIA 2H9YA 5DSXA 3V4RA 5EXPA 5EWJB 4R9UC 4D9JA 3NWJA 1FS6A 3OSZA 2JLAA 2V7WA 5I4KA 4BVBA 3R20A 2NUBA 1T43A 3DBIA 2FSVC 3AI3A 5AKHA 1CZRA 3RK1A 1CR6A 2C59A 2R9VA 1U2EA 3RSHA 5EJ2A 4GLJA 1W76A 2EBUA 2PVSA 3JWIA 3X1WA 1EWTA 3VPHA 3CEAA 2E9SA 3KHKA 3DHYA 1R88A 1Y3AA 3HKBB 4B3CA 1DC3A 1X7WA 5JEDA 2J1LA 3LOQA 4YLYA 3PNPA 1EXWA 1QKKA 2R5NA 4OQYA 4QQFA 2P6UA 3HR7A 3U2QA 4D0RA 4F46A 5JYBA 2WB2A 2P0EA 1OLXA 2ZP1A 4UFPA 4YREA 2HNKA 3LC2O 5CXXA 5H5JA 1SHZA 3U1TA 2VPWA 4P7GA 4YRCA 3PX2A 3GBVA 3DGFC 3GW8A 1KZYC 3A6EA 1JBQA 4QBFA 4TVKA 3RAEC 3DEFA 4IH9A 1U9ZA 4NNPA 2IZ7A 3RO7A 3T52A 1JIKA 1SU4A 4PZPA 3HCOA 2OESA 3I01M 1ES9A 2VDRB 3DB1A 4QELA 3CE6A 3KQNA 3HYRA 3O0TA 4LSMA 4EGCB 3EG9B 5T3YA 4FMCB 4F3RA 4BYGA 1ZSNA 4ZCTA 1NJSA 3AK4A 4BNGA 2Z0MA 1CZHA 1NVTA 4TSRA 3ANLA 4MK4A 2QTZA 3FPJA 1FP7A 5JXIA 1M1YB 4FE7A 3U39A 4H17A 2E6KA 3I1FA 2IUYA 2RGNA 4P32A 5J5VA 2DUUA 4IO0A 3TIGA 1UPFA 2NU7A 1NKTA 2B6HA 2W11A 4YO8A 4BNMA 4EUKA 5IX8A 4HAVA 4EPYA 1FVFA 5CURA 2FVXA 5LYJA 1THZA 1E9VA 2XJ4A 4JKYA 1UJ5A 2PR7A 4O4JF 1HG1A 4QDJA 4ISBA 1N0HA 2YWEA 2XMSA 2AMFA 2J3JA 3SF8A 3AFHA 3U7JA 3ER6A 1CY2A 1Q7CA 1AZTA 4LXYA 3A1SA 2WIKA 4MB0A 3W7VA 3W6PA 3WJAA 5AW3A 3DXZA 4HY3A 2I3DA 5F78A 3A9WA 1GQ2A 1N6RA 4KWCA 3GLRA 1RPAA 2ILTA 1D2AA 3DDUA 4ILKA 1X1TA 4EJSC 2TRSB 1QIJA 3IAAA 1IMOA 3LLCA 3GG9A 4IINA 1MC4A 3A25A 5GGYA 2ETVA 1IXKA 2VXYA 2VDLB 3QUSA 3UMGA 3UJ3X 2P77A 2QWXA 3L1HA 2G6TA 1KVQA 2FQYA 3SG0A 2Q4EA 2G06A 1EJ0A 2EFDB 4MPDA 5BN5B 5HRAA 5F98A 2ZI9A 3FUWA 4UHBA 1AXEA 3WRYA 1S1CA 3FROA 3R3VA 4AY4A 1BJTA 5SY6A 3ZKWB 2AR0A 1CY4A 2ZJ4A 3P9PA 4DCVA 2AJ8A 5HP4A 2XB2A 1UZLA 1QANA 4C0SA 3AERA 3LVQE 1N0WA 1LV7A 5FWXB 1VIAA 1F2VA 4LX8A 1PEKE 3EQ6A 4RHFA 4EHDA 3NBAA 4F3NA 4HDOB 1YJBA 4IMRA 5FDFA 1VSBA 4RZHA 1L5LA 4N9WA 3HXOA 3HBAA 4DLVA 2CEAA 2JFNA 1N7GA 3LGXA 1KYZA 3MCUA 3RVRA 4AKGA 5KYVA 1IB0A 1LBHA 3PHHA 2AI1A 4E03A 2QF7A 1H9AA 3L4BC 4JEMA 1ZJWA 2GWRA 1Z2AA 2XYGA 3C6QA 3QKSA 2O8CB 2GNPA 4TN1A 3E1KA 3HXQA 1N78A 1W29A 5KOYA 1O3YA 1ESCA 2OO3A 1JLSA 3KELA 5K51A 4M37A 3SF8B 5I7OA 3OOWA 1AGXA 3MPOA 1QTIA 2PMKA 3LNTA 3GVCA 4B74A 5CB0A 5C9ZA 4RY8A 5AIAA 1CDOA 4INZA 5LA6A 1ZJZA 4AMUA 4FR0A 1V3UA 3EGVA 3QKTA 1IULA 2REBA 4IKEA 4AWAA 3DNMA 4EDHA 1CR1A 3V9AA 2QENA 3ELYA 2FK7A 2NZVG 2XDYA 3L0PA 1I6MA 1UJ4A 1VLLA 2I1WA 3O2NA 4HJRA 4JUAA 3R8XA 4KITB 3CC8A 4XPIB 1Q1BA 3GHYA 4CLEA 2NUPB 4W99A 1T3ZA 3IVGA 1MX3A 3FRIA 4RHUA 2OB1A 4N47A 1TW2A 2HSEA 2YJ5A 3UW3A 5C53B 3CSSA 1D2CA 1QFMA 2B1IA 2IKSA 4XDZA 5DM1A 2XVZA 1PLLA 1SEPA 2OHIA 3O26A 4B8WA 1QIGA 2QTMA 3FOCA 1KDYA 3NZEA 5TMPA 3LBFA 2AE1A 1G8MA 2PUVA 4TRJA 1J5EB 4J7AA 3JQFA 4K86A 1V71A 3RRYA 1RJ9A 3ZY6A 4E7PA 1UZAA 3IOMA 4B45A 4OHYA 4JSYA 1M2VA 4R0MA 1SKUA 3JASB 1NPYA 3CLRD 4RQBA 1KAQA 4JT2A 3KVVA 1ZY2A 4ARBA 4BGIA 3PHCA 1VHDA 4MQEB 5KOHA 3RJZA 3NAGA 3K9WA 2WV7A 3AY3A 1CT9A 4J0EA 2JHGA 4PHHA 3UFBA 2WE8A 2CDRA 3P9KA 2QE6A 2IBTA 1DG3A 3T3IA 3A9UA 3U7HB 4UE3S 1B4DA 5SZJA 1Q0UA 1IJFA 3DR5A 3MNFA 1J7KA 3HP7A 1NUHA 3EK2A 4J76A 4CT5A 4EGAA 2GD6A 2BFFA 2QS9A 2RDMA 4JEUA 2O23A 3H65A 3RM3A 3SOPA 1DADA 4FGSA 4X84A 4HXFB 4DR4B 4OXQA 4XOIA 5IJ0A 1O7JA 2Q50A 2EFEB 2QJTA 2ZIEA 3BMXA 3N6XA 4LSZA 4UNSA 1DINA 4F3KA 5JZSA 2C8JA 5A7HA 5DYTA 3M7IA 4JROA 4ZYXA 1ZC3A 5BSUA 5I4BA 2XUKA 4JSRA 5CT8A 3BWCA 2H48A 4IVQA 4J0IA 1AUVA 1K9SA 3N86A 5TY0A 3WK6A 4C4PA 3BF7A 4DF3A 2POCA 2OQ2A 3LBAA 4WX2B 5K8IA 1UXHA 4MW6A 1DC4A 3WGHA 1JI3A 5EIHA 1CJKC 3IEIA 3THOA 1Z5GA 4F5YA 5C34B 5CITA 3BIJA 4TL8A 1KRXA 1CQJB 2MINB 3CRNA 2CY0A 3IE2A 3IT0A 3QNUA 4W1QA 2CL0X 5C31A 3H13A 2AYXA 4N6OA 4JL5A 4B9EA 1YI1A 1WXXA 3AWDA 5IF3A 4RJLA 4MITA 3RRBA 2O57A 2E6UX 2NU7B 2QTVB 3PIRA 5I8WA 1FDOA 5LXTF 6YASA 1I8TA 3DGEC 1U5BB 2VRWA 1L8OA 3PQ5A 3BMQA 2WWVD 5BV7A 2WJWA 4QXRA 4GUDA 3TW8A 3D81A 5BW4A 1KEEA 3MIZA 4MP6A 4P4LA 3DXYA 1FMTA 1ZD9A 3L84A 3RVPA 1EDEA 2QX7A 1HH4A 5I4CA 2AE2A 1VMKA 2GNAA 3O74A 1URPA 2DBQA 3ANXA 4TPKA 2ZJAA 4IH4A 4MR7B 4H0CA 1S3GA 1K66A 3JR3A 4IIYA 3AIOA 2JKVA 3TH5A 5EZSA 1TEHA 1VQ1A 3ZV7A 4XGQA 3P19A 2AWOA 3VDRA 3AVPA 3VR5D 1XZLA 2R25B 4YPOA 1T9GS 1SQ5A 1M8GA 1YRBA 2NT3A 2RJNA 4OF4A 2O1EA 2OL4A 3A9VA 2D4AA 5AFSA 1FP6A 2FYTA 3A1EA 5HRUA 4GMXA 2OT3B 4L4YA 4ZAXA 5DTMA 2KWIA 2Q1WA 1W94A 3HPRA 1AQUA 5H9VA 2V8OA 2OBXA 3U1BA 1XYGA 2QT1A 3D7NA 1KJJA 1QGUB 3HVJA 1ZJ6A 4QODA 8LDHA 3Q8LA 4P3OA 4PX3A 4C2BA 1JL3A 4XYGA 3SQXA 3LUHA 4KGVA 2GK3A 4Y2QA 4RFSB 4FYVA 2GHIA 4TQGA 5CEEA 4C0BA 1XN4A 1A5AB 1GXSB 3DMHA 4Y1FA 4YP0A 4RWEA 5CDFA 4EFLA 3PSAA 1VLQA 4CIDA 4C6HA 2BFWA 4DIDA 1IY1A 4QPCA 4ECEA 2M6KA 1MG5A 5KTTA 4MUKA 4U7FA 3REFA 4PQFA 3B5JA 3SOZA 1XOIA 3ZEAA 2RAVA 1K7EB 3K0AA 4XE5A 4NJEA 4BEWA 1A9XA 4WN3A 4LJYA 4Z2AA 1SCBA 2O48X 1RBYA 4LVOA 5ALUA 3SGLA 5K8VA 1PNRA 2WZQA 1HE1C 1QRAA 3A1TA 3EEIA 3D2LA 1WLSA 3GLSA 3P9ZA 4ADSG 2J7PA 1KJWA 4JVOA 3A05A 5TPWA 1XRJA 1SEVA 5KVCA 2NYVA 3U4QA 2JCSA 2VL7A 4X20A 2BFDA 4MVWA 5AVSA 4CEJB 3VYRB 4CODB 4EUFA 3FM9A 1GTMA 3R7LA 3L6EA 4YRSA 4M9ZA 1FUYB 2SCUA 1KI4A 2YOFA 3AUSA 1J8QA 1XSEA 3DF9A 1DQRA 3EVCA 5IMSA 2H1LA 2VSOA 1SIBE 3IERA 3NIGB 4RPIA 5HKOA 2FK8A 1F48A 2CFIA 4OHZA 1SCAA 2WMDA 3PNLA 5K3FB 5TGDA 4AS1A 1PJCA 2FRDC 4RXMA 1ZIPA 1OX4A 1OFIA 1E9SA 1RWWA 2YQ4A 1HFWA 3CSDA 3P26A 3R5HA 2ANCA 4HDMA 5EUCA 2C9CA 5BO5A 1AK2A 2OO5A 2I4IA 3RUHA 3WYAA 4BNUA 2GEKA 3QPVA 1RBMA 1Q0PA 2V3WA 2JFGA 1E9DA 3L7KA 4QBHA 4C7MA 1XMOB 2ZTLA 3X0DA 4YMVA 1ZI8A 2FEXA 3DT8A 3N1UA 4NMXB 1VG8A 3PC8C 4IDEA 4IHJB 4FYKA 2HSDA 1Y3CE 1T8TA 1XTVA 2HMSA 3K16A 1Z2EA 1W46A 2B4YA 2UZ1B 4JP1A 4XJTA 1M74A 4RJKA 3K3PA 3FCSB 3GFOA 3EDMA 1YZLA 2OV6A 4LNUA 3FLMA 4BB5A 5CB4A 1H2WA 4Q03A 4QU8A 4U7GA 3M3PA 3OUZA 3PRYA 1VIMA 3GP5A 2X0FA 1BG6A 1YHZA 2HQOA 3AY7A 3H2GA 3LPAA 4UASA 1KY4A 2Z8YA 3HVKA 1JFFA 2IGBA 4CQMB 3LOPA 1U1DA 5F2NA 3IUBA 3TOXA 5FL3A 1GCAA 2R6JA 2ZAGA 2ZJ3A 3ESYA 1ZVJA 3O8QA 3ZQKA 4N76A 3NP7A 3N8IA 3H1GA 4NR0A 1AGPA 3V1MA 1ZOOA 3Q0TA 3QX7A 2OZLA 2WMNB 4HWKA 1UP4A 2BEVB 2C4NA 2APJA 2OZKA 4O2BB 4HB3A 5IABA 4CR6A 3MF4A 5FPHA 3OBIA 4DDVA 1X15A 3QLVA 2FPIA 1KY3A 4FFMA 2BRUC 5LFAA 2BOVA 1A04A 1HLGA 4B5KA 5KDLA 3K9BA 4WT7A 2V59A 1U5BA 3BQNB 2HTEA 3H04A 4RVUA 3WLKX 2M98A 5FTLA 1Z0DA 1HRDA 1V7ZA 2IIPA 2P40A 1LSSA 2L17A 3WKBA 4QLBA 1PV2A 3NDJA 3IDOA 1CY6A 1UC8A 4ZICA 1NN0A 2HH9A 3U56A 3SIPA 5EZ5A 2YVQA 4ZN6A 2PV0A 1OE0A 5KSWB 1UADA 3GFGA 1ZP6A 5IN4A 5KQLA 4LA4A 3NC0C 1SUDA 4B2IA 3IJPA 3C3BA 1T5OA 3I9V6 3L92A 3HB1A 2GK6A 1UXKA 3KUKA 4DKJA 3RUFA 2CFRA 2VSXA 3HDTA 5NLLA 4J49A 2QMEA 3H11B 1A2BA 2WM3A 3CX7A 4GICA 3KQWA 1Y5MA 4PTZA 3QMWA 4WJLA 5AVYA 1AF7A 3WISA 5A4IS 4EF5A 1JQJC 3LNCA 2Q46A 2WZBA 3PT5A 1KARA 3UYKA 1U2QA 4HFMA 2AMYA 2CFOA 4R4JA 1OZ0A 3WIBA 2R6ZA 4CTOA 5LUAA 2NU6B 4HDQB 2FWIA 2IF0A 2NPIA 2OAEA 3RSQA 1M1XB 5JNUA 5FWYB 2RKOA 3SJ7A 1OLXB 2H1HA 3GGDA 3DO8A 3KKPA 5E38A 3RBZA 1E5QA 5AXCA 5GONF 1ZGJA 3HCBA 2IPXA 3IVCA 3NBFA 3W1VA 2BGRA 4J0FA 2RBKA 4Z9AA 3S5JA 4GDFA 3QW4B 1MEEA 5KSZA 2P91A 2VOEA 3KXIA 1EG7A 4X7BA 5DW3A 5ABPA 4YDQA 4E46A 5EZYB 4BNDB 1NN1A 3H1PA 3FX2A 1W19A 2AJTA 4MO9A 4XM2A 2BUBA 4G0OA 4UEKA 4EJFA 4WXMA 3ITEA 1NXVA 3GLHB 4WA8A 2ZR0A 3CF4G 3H5WA 5EWJA 4DLWA 2P67A 1YFZA 1Y8AA 3K4QA 1HT1E 1R4ZA 4MXDA 4Q1DA 3AGQA 1J0BA 3LYHA 5BURA 1YS9A 3STWA 1KH3A 3RC7A 4B2PA 4GVPA 5JD4A 1Z0ZA 1BQEA 1XRPA 4MQ6A 5GJWC 1ZLXA 2JFVA 1ZD2P 4Y2HA 2OSVA 3CLKA 1DAIA 5DTIA 2Y99A 3OM0A 2YWCA 1NONA 1T4MA 1XWFA 2EARA 1NBEA 3HRIA 1R9MA 5WRFA 5EHZA 3PI6A 3TMAA 4BMOB 4CM3A 4ZV4A 3CZ4A 1DOHA 4JWKA 1N5MA 3MWDB 1RRVA 2FWPA 1TW3A 5AVZA 5JSZA 1NC1A 3F90A 4YAJA 3DZCA 3O8BA 3WGUA 1BDJA 1AUQA 3OEHA 1W2WB 2D3WA 3UY4A 5KX5B 1PR9A 3GMTA 1RXSA 5REQB 2VNJA 1SRRA 4ZVRA 1JHXA 3Q41A 4YR7A 3ASVA 3BJIC 5DV9A 2ONJA 1TKRA 2F1OA 4OUDA 4Z9XA 3B5EA 1K6IA 1QWOA 2GMWA 2XI4A 2XF2A 4C88A 1QG0A 3E35A 2F8MA 2FQQA 2Q8NA 4JFRA 4Q6BA 3SXPA 2O2IA 3ZU4A 4LF4B 1M8FA 3BD8A 3PFWO 3DWGA 4V0MA 1QZUA 2ZPAA 5DCWA 4YP7A 3EIEA 3ZBQA 4BTVA 5HYVA 1CVLA 1HDYA 1RQ7A 2W6JD 4MWCA 4GLLA 1IM5A 1LGYA 1CP2A 2CBXA 4PYOA 4IEIA 4OK6A 1V8FA 3HRHA 5E1BA 3DZKA 4UUBA 5ESWA 1KFJB 3EFHA 4MIOA 4EG4A 3PCRB 4Q7MB 1KYIA 1OAOC 4UEQA 4WOJA 2CK3D 3I6YA 5CBPB 4UEJA 2IXAA 1QRUA 2O7VA 1L5ZA 3TLYA 3JW8A 4O8ZA 3LFTA 2XZDA 3ZZUA 4PZUA 2WC1A 1HY3A 2OG2A 5FOUA 3KOYA 3OFSA 4RPCA 2AG0A 4X1IB 2PZAA 4AQYB 4OP1A 3NXSA 1U0EA 2I8AA 4KFSA 2I66A 3A9RA 4LE0A 1DT3A 1DO0A 3IXMA 4LDPA 3BQMB 3Q7PA 2A1UA 2WYOA 4P92A 5EUMA 3WLLA 1W6UA 3X44A 5E95A 4CM7A 3ZZMA 3ZE7A 4KH1A 4LXHA 1MNQA 5COAA 3T5GA 1PL6A 1W35A 3UJ8A 3HHPA 4EY4A 4A7PA 3DAGA 2A5LA 3TAHA 2ATCA 3N2EA 2WUFA 3PTLA 2Q1XA 1U0LA 1JBKA 2PR2A 2V98A 4IG4A 4A0RA 2X8AA 4Z4HA 4ZAYA 1SBIA 1N0VC 2CJWA 2WPNA 2XYPA 1EBFA 2QLLA 4INAA 4JUCA 3ZXUB 4RULA 4D82A 1V8PA 1E4YA 4GM1A 3W79A 2P9HA 1IQ0A 4O4IA 4DA4A 1D0VA 4Z0TA 2HPAA 3WP1B 4PZYA 2VPYA 3P0EA 4Z9BA 3H7AA 1YJ5A 3AYXB 3FZEA 4IKOA 3EFOA 3QHAA 4IOMA 1AKNA 2YZ7A 3O95A 4KOEC 2CVZA 3ZWWA 5EJ9A 2NVBA 1EMDA 4O02B 4M8SA 5DLEA 3INRA 3MJSA 4FONA 4IAOA 3WJ7A 4AJ9A 4ESEA 4ZIRB 5BSEA 3T1YB 4Q4DA 1HMPA 1I7NA 1V9SA 3GVPA 4BX0A 4DT1A 3LQ2A 3N75A 3EA4A 3HO6A 1QHYA 1F3LA 1NQTA 1R8SA 1ZJ5A 2AZ4A 4TKVA 5CBPA 5K8TA 1WY7A 3DZJA 4KIFA 2WZCA 5C8YA 1KE1A 3LQKA 2C31A 3II6X 1KJYA 2UUAB 4H1HA 4L9RA 1ISMA 3SIRA 4BGDA 2XH8A 4OQXA 3IL2A 4KRYA 1C29B 2YXPX 3B1KA 1E63A 3KOUA 3PFGA 2UZ4A 1IBRA 1Z74A 1XX6A 1SUCA 5KU1A 5TQVA 1XF1A 1AURA 4XQ9A 2N46A 5DYWA 2ABWA 1DJOA 2OD7A 1GQOA 4OHPA 1RQLA 3SQOA 3UH1A 1APBA 3KTDA 2ZRAA 4W9NA 1OWLA 2XCUA 2GHRA 1CBUA 1H2XA 1LTQA 2OZEA 4NARA 3PKIA 4UVIA 2PYIA 3QVGB 2OBMA 4KAAA 4BKOA 3A1DA 3KYDA 5CVTA 3C3PA 3IXQA 1RJGA 2GCPA 1PFGA 2QUHA 2HA0A 4RK0A 1KEWA 2R6HA 5IC5A 3OPYI 3VYWA 4YLEA 2GJ8A 3KNZA 4IIUA 1SVUA 1IOVA 4DAOA 4P7JA 5JMPA 3IEVA 1KEKA 2B4AA 1JE0A 4C2AA 1XZDA 4JLNA 4G5FA 4B3FX 5E7QA 1PUXA 1MEJA 1TJYA 3R09A 1MU0A 3OWHA 2Z8XA 4N1AA 1P2UA 4XRRA 3T1QA 4O2BA 2XKAA 3MJCA 3NHSA 3DKPA 3P9CA 3AUAA 3COSA 5JTTA 3T7EA 5LQDA 1XNQB 1Z2NX 3RLFA 1ZXXA 4Q4HB 3SE7A 4AYXA 3WLPA 1RI5A 2WF8A 5HW0A 4RE6A 1Z4PX 3D3WB 1LX7A 3PXCX 3STYA 1IIBA 2QUKA 3OO0A 1P1KA 2BTOA 3BTVA 2GPWA 2SKEA 1PNTA 2ZBRA 1TUBA 1LNSA 1SG9A 1SVNA 2P5SA 3V4VB 3L8FA 5JS7A 1IOLA 2I65A 4YQFA 3TUJC 2WD8A 4WKBA 4CZ2A 1IBKB 4C21A 1BGXT 1IRIA 1U7OA 4YCSA 2BFEB 3KRTA 2AW3A 3WDLA 3FDJA 2RONA 4OUDB 1GZ4A 2JBWA 3B3JA 1EP9A 4QDTA 1RC1A 3V3KA 2YWRA 1FZTA 2VJMB 2B9VA 1K0FA 1Y3HA 2HZBA 2R6GA 2VBCA 2GETA 3BZUA 4BUCA 1FRVA 3CPHA 3H9QA 4E0BA 4V1CB 3DMDA 3DYVA 1IN1A 2VJNA 5C1IA 2Q9BA 5B3JA 4WFJA 3LUPA 3HPQA 1RZ3A 2C2BA 2AEMA 2O7SA 3OCCA 1BHSA 4IDDA 4F92B 1CRQA 3JYNA 5GJCA 1NF2A 1SQFA 3WX0A 3AL0C 1Z8NA 2VFAA 1JKJB 3DVSX 3RYHA 3UAYA 4Z7OB 3LPLA 4G1VA 4PG8A 1YR8A 5AHOA 1UBSB 4BY9E 3VISA 5AOBA 2J85A 4MWTA 2CXXA 3MOSA 1YFJA 3AIIA 3SD7A 4EL5A 1YQXA 4CQJA 1UAYA 3E48A 3DD1A 3IR6A 1QIDA 1BFDA 1JJAA 1Y6RA 2QVZX 3AXTA 4EMSA 4P0TA 4D0LB 2R1TA 3DYBA 3O90A 3QH4A 4EY7A 2E49A 5K8JB 4G0WA 1U7WA 4UE6A 2PXHA 1M54A 4PFQA 3B20A 4BV9A 5ALSA 1R9GA 2GBCA 2YNMA 4GOKA 3TLGA 5B3LA 3HCDA 4PR3A 2JG3A 2PK3A 4YJFA 2JFPA 2ADMA 5JAHA 4HDMB 3NCHA 5KYUA 4BFXA 4QFDA 3AC0A 3O91A 3PIIA 4P54A 4PCVA 4OQFA 4BC0A 4C0XA 3KM0A 4LJLA 4MPPA 4C20A 4GXQA 8GPBA 1XFDA 4LZWA 3H9UA 2OCIA 3NKVA 4LOHA 1EVKA 3NWOA 3PU6A 1DV2A 1QE5A 2RH4A 1YJCA 2Q99A 4BO4A 2I6GA 1OXKB 2FWMX 5C8DA 1TC2A 1NI3A 1T1JA 3HB4X 2EVWX 2VP9A 4J2TA 4UW9A 1KYQA 4RD3A 4IZ6A 2A86A 3V32A 2PJRA 1I6LA 3T12A 1NR7A 1KQPA 1DXYA 2RJ3A 3E53A 1D6JA 1U80A 2QDKA 2Z08A 4Q1AA 2DHEA 4Q18A 5BOSA 2OY0A 3FWHA 3D5TA 1U0BB 4F60A 3A4MA 3TGWA 1BHO1 1OTHA 4QDKA 3TL6A 1WNTA 4EABA 2L0XA 2VPPA 5GPBA 1XEWX 2A92A 2VXOA 4DXDA 5CNJA 4Z49A 5L51A 3ICQB 3OCUA 4Y6RA 2FQXA 5D3MB 4NYJR 2Y1KA 5BXYA 1F20A 5JCOC 1NVGA 3UKDA 2IDKA 3A9SA 3IMFA 3WRYC 1F4PA 4HZUA 5L45A 3BXEA 1NU8A 1UPUA 5LMUB 2G71A 3K9NA 4V0OA 4OBXA 3OLXA 4KE6A 1AK9A 1EK5A 1TUGA 4H3SA 2YHIB 4PGAA 4DREA 5EA2A 4KQ2A 4YJ3B 4YDRA 3N7AA 2OLJA 4K81B 4JI3B 5TS3A 2FI1A 3OLQA 4C4AA 5I7SA 1G8KA 1NVEA 1R6XA 4QDUA 1P3Y1 4CDNA 1VBMA 2LE0A 1QMPA 2XCSB 5EL0A 4ENTA 3C8UA 3MTQA 4ZCRA 3ETCA 3NEJA 2O20A 4O4IF 3S27A 4HMOA 1E2NA 4KRXA 1RW4A 5EFOA 5AJHA 2HV8A 2I6QA 4BKQA 3AF2A 4KQEA 3B60A 4GYWA 5IAEA 1PWZA 1SY7A 2JGRA 1D4FA 3T7SA 4M86A 1TCVA 2ZS8A 4GI3A 3S44A 4EYKA 5I47A 5K03A 4YJDA 1EHYA 2GEUA 4A5SA 4BE7B 2E5WA 1MMFB 3VJKA 2HJVA 4TL9A 2EF0A 5CD9A 1TD1A 1UFVA 3TOZA 1U2PA 1KSJA 3LUCA 2MMCA 1DBVO 2ZPTX 4UOEA 4D96A 2AI2A 5HOQA 4B73A 4E1BA 3EPKA 1VPEA 4RGYA 4KPEC 3OM1A 5E6SA 5KYGA 1KEEB 3I9OA 3CUUA 3INGA 3AVWA 1HNNA 3LFHA 4BX2A 3NGLA 1ANKA 5KYUB 4BFYA 2WJPA 4L95C 1NGSA 5TDHA 3CR8A 3G1UA 3TMYA 3F9IA 5A5VA 3KR1A 4IF4A 3P0FA 1QGYA 4YUVA 3IUQA 2C2HA 2RGEA 4V1CI 1W5BA 1JWLA 1CPYA 3F6CA 4A26A 5JJBA 2GF0A 2OHOA 4N7JA 4QL3A 3WLOA 4XI9A 4B3SB 2C4VA 1J39A 1WXQA 2QL7A 2HOQA 2IHZA 3IR5A 1QP4A 5CLHA 5DX0A 1UKBA 5DNVA 2G07A 4UU0A 3KJHA 2VZEA 2RHJA 1NX6A 4GBGA 4KFUA 3LFUA 2R00C 3MD9A 4Q3AA 4TKZA 4UM5A 1BFUA 2WOJA 2ZWVA 3I32A 4ZPXA 3AQIA 3VSBA 3U16A 3ICOA 4Q15A 3G9XA 5KOHB 2GK4A 4COKA 1MFZA 1SG0A 2ZJFA 3QFRA 4FR2A 4QOHA 4R1OA 3TBHA 4OKSA 1UBKS 4IFIA 4U8HA 1KSHA 1JHQA 3DJYA 4D9FA 1Z6ZA 1LS6A 1FFSA 2JLBA 3E70C 2AYYA 1UBUS 4AJ1A 3S7ZA 3T61A 1V7QA 1TF5A 3OQHA 4DWOA 3J81k 1E2MA 3C14C 1ZMRA 4HGQA 4P81A 4PAGA 2UYCA 1M5RA 1NW9B 3UB4A 4QDXA 4IPTA 1T2DA 3NIWA 1OZAA 2II6A 2JD1A 1T2VA 2HFJA 3GFRA 4OQDA 4PX5A 3D6UA 4GNRA 5KCZA 2XUHA 2A7QA 1CUGA 3UOWA 2B4KA 2XA2A 3SHOA 1ZKDA 1C5KA 1ZD3A 5JEEA 3EA5A 3DUWA 4JEIA 4ZEOA 4TLCA 2ZKIA 4HFNA 1KMMA 3WNQA 4H16A 3EGIA 3IESA 3P9RA 2XUZA 1C7QA 3MQ4A 4BO9A 3WBBA 2PLNA 1N32B 2ZZKA 1P4SA 2IPMA 3LY9A 5KAPA 1FFXA 3R7FA 4DQUA 4Z4IA 1E9EA 5IM5A 4J91A 2NP7A 3O4FA 3E9YA 2OBNA 4TMFA 5FBHA 5LPNA 4E32A 3AOGA 3R3XA 4EHFA 2INGX 4I66A 4Y2YA 1G5QA 1XDDA 1SHUX 4M9SA 4Y6SA 3RTDA 1RMQA 3VGPA 5HSGA 4CM5A 3OMXA 2FNAA 3LO5A 3W9YA 2PJZA 3RB8A 4BEBA 3A2MA 4I81A 3NAZA 2H57A 2VAXA 3NM4A 1X1DA 2PX4A 1ONBA 1PP4A 3JQPA 3NTLA 1XZQA 1ECLA 1U7HA 1ADYA 2GFIA 4I9FA 5CMLA 3VR3D 2RKWA 1WU8A 1I10A 2AFIA 1HZZC 2HWWA 1SCQA 2IXEA 2O14A 3DZBA 1CJVC 3IAM1 4NAUA 2A84A 4YUYA 3KB1A 2R6DA 4B9AA 4O6VA 3ILYA 1PR5A 3RVQA 1KR5A 2WICA 1JTEA 1V39A 5JANA 1QP0A 1DRUA 1DWOA 2DOKA 1F8UA 4ARSA 5ER9A 3RIMA 2YWGA 1JLKA 1WHSA 3P2JA 1DAHA 1DI0A 3VHRA 2YBDA 1ZMOA 1A95A 4OXRA 1O94A 2QSYA 3UPDA 3FAZA 4TWZA 1CP3A 5EERA 2WIGA 4DEYA 5KQMA 3DZIA 1WZEA 2D0OB 1XB2A 2X5NA 3NETA 3O82A 2FGKA 1SWWA 3Q0IA 1XZNA 4JDPA 5CK5A 1TYZA 4EA9A 1X8LA 1O03A 2W6MA 4RKYA 1JI0A 5KZMB 2WABA 3C39A 3PZBA 2IZ5A 4ZU3A 3RGGA 2AC2A 1FTQA 2JAOA 1MQSA 1X19A 4K8OA 4MIKA 2P1ZA 4ZD6A 4WRRA 3W04A 3ZJYA 1VMAA 2CVOA 4W5RA 4DHWA 4CETA 2VUHB 4R68A 3Q8KA 5CFOA 1HE8B 1ZGBA 2FFBA 3RR2A 1P2TA 2CHVA 5DXFA 2EX0A 2HCTA 2JIZA 3B48A 2C03A 3IUNA 4LXQA 5JNLA 1RWMA 2HDHA 1MD9A 1SC4A 1N57A 3D6VA 2Y2VA 3ETEA 4AF6A 2VSQA 5JASA 2EXXA 2DKNA 1QFSA 4AVYA 5LU8A 4PIMA 2J33A 1RABA 1JEDA 1LNZA 3PC7A 3U17A 1C1XA 4PPNA 3TZLA 1J8VA 4XWTA 5DHRA 2ANBA 4B32A 2ZR8A 3VH3A 4JFAA 5CYPA 1GRNA 4YQYA 1CF4A 2ET6A 4MVJE 3ZLTA 5C52B 1Q91A 4M1SA 1EFLA 2PLAA 2JK1A 4J94A 4JHLA 2Q5EA 2AHRA 5KOIA 2HCBA 3GJ4A 2AJCA 2ISQA 1PR0A 3NWEA 1R3DA 3CY6A 4K28A 4R2KA 3U3MA 1G3QA 2X6TA 1QCDA 1QO0D 2NXNA 1O95C 3DBRB 3OPVA 3OT4A 4J16A 1XAIA 2W70A 3UGTA 1QIIA 2TMYA 3AF5A 3LXRA 4YRRA 4EBBA 4URYR 2N9UA 4H1TA 2R1UA 3VU9B 3PPWA 3WA6A 1E1CB 1OXBB 3CEMA 1BXZA 3MTGA 3U13A 2HBRA 3QELB 2XMCA 4KC0A 2J8ZA 1A2KC 1SO8A 3MOGA 2B8EA 3H5NA 1BA2A 2BCJQ 4WKCA 4BV3A 3BWXA 4Z1OA 3S2ZA 5LQSA 3ZHUA 4ND4A 1KBOA 2ARKA 5JSFA 1NVVR 3IOYA 3HACA 3FPAA 1Q0RA 4ER6A 3JR7A 4WW0A 4L6AA 1H9CA 5H9WA 3DBLA 1VLZA 1ML4A 4R8LA 1YH3A 1HNZB 1FU7A 1K2VN 2X5XA 3IAXA 2D1FA 1X7WB 4M0CA 4EJSB 4WNCA 3KEFA 1YSCA 4KAJA 1Z7YA 3ZCQA 1PK7A 5I51A 3IHKA 1VKZA 3PQEA 1KOGA 2B35A 1CRPA 1AA6A 2FZEA 2IHUA 2K5UA 2YN0A 3TI9A 3Q8MA 1FXWF 1FFYA 4DSOA 3A37A 4QJIA 5H59A 4RU1A 4S35A 3TX6A 3VU0A 1POXA 4G5HA 1HEYA 3ZDEA 1CQIA 3HVIA 1Q1GA 821PA 3M34A 1BROA 1T34A 1U11A 1T26A 2PT6A 3G1TA 1Q57A 3HDYA 1QF7A 3NI2A 2X14A 1GQSA 5INTA 1P1BA 4JOSA 5EXDA 1ILWA 2FU5C 3P9XA 4HDAA 5SYNA 3PEWA 3QJYA 4I4IA 1NY6A 5CJPA 4C4SA 1OIWA 5A9SA 2XNJA 1WMBA 4C78A 3BS4A 3QKRA 1LZLA 5HWSA 4K26A 4WXHA 2ECOA 4DIFA 1YAJA 2RHDA 4NPHA 3ITDA 3OFKA 4O4JA 2X19A 1GG8A 1TM7E 1HNWB 3IGFA 4C04A 2W6QA 3SYMA 5JC8A 1EXDA 5FUBA 1OX6A 1JDZA 3QWHA 4REMA 4RZIA 2VQ6A 4XKJA 2NU9B 4RVFA 3R4VA 1M83A 2XB6A 3AEYA 5L6LB 1ODJA 2LR0A 2QRZA 1QP7A 2VC2B 1Z38A 3F7TA 3WYEA 1L5SA 2WU8A 4C4YA 2QUJA 3A0UA 3WZ2A 4DE5A 1OH8A 3CUWA 2JGJA 4ZARA 2EKDA 3U3JA 1ORIA 4JMPA 4DAEA 1PDOA 2FUEA 2ZRBA 3FWZA 4RXUA 5LLTA 2UUPA 2SKCA 3ACBA 2EJCA 3NM5A 1GUBA 2GYUA 4JT8A 5BW8A 3K6RA 2OHFA 3PFKA 4O1HA 3RRFA 1QC5B 3T38A 4BQNA 1EAMA 2YJGA 5CVVA 1CJMA 3NH9A 5DFAA 2QMHA 2M1XA 4RA6B 4G2NA 1Z35A 2GAAA 3WK5A 5BMVF 2H2GA 2I1QA 1KFCB 1QYVA 3FCCA 3PDIB 2B37A 1ID1A 2FW8A 4FLEA 3W3AH 3W6NA 3VZCA 3NHZA 4ZJUA 1YB2A 4G97A 1SCKA 4UHCA 1NBWB 3AT1A 3EHDA 2YHIA 5EP4A 5ITVA 2BM8A 4S1WA 1ZJ4A 3T1VA 1KO1A 3ZGVA 4M1KA 1ULAA 4W1PA 3GH1A 3WIOA 4B6FA 1PEAA 2FR0A 2Q3DA 3U6KA 2X4GA 3IHLA 5FOTA 4YMTA 3NVDA 4M9UA 3OTOB 1CR2A 4WXPA 3C48A 6NULA 1CQZA 4RBNA 4Y9RA 3QJGA 5D00A 1UT6A 3QI7A 3MS2A 1F0NA 1GZ3A 5EIOA 1DOAA 4LC9A 5AQEA 5LC1A 1RVV1 2WVGA 5LXTA 1W4LA 1GPNA 2BZ1A 4E1AA 3TNFA 3D54D 1YZUA 4RYLA 2VXBA 3GGSA 4AK9A 3K6KA 1LJ8A 4ID3A 4WKOA 4WXRA 3NKLA 1K3UB 3VO2A 1I36A 2YASA 5A06A 4XJSA 1G8FA 2CZQA 2CKMA 4NJMB 1T9DA 2WR8A 3TQSA 4R3UC 3GD5A 2ZSBA 2ZXUA 2P2CA 4BX9A 1SOAA 2BTQA 1A71A 4GR9A 1SKBA 3HU2A 4J1NA 2ZUBA 3E5RA 3RARA 3KSMA 3UJCA 2P9ZA 5DHFA 1Z68A 1FPQA 4L1KA 4M2LA 3QX9A 1JWAB 1E20A 3GGCA 5P21A 3E84A 4UTNA 1SVWA 5JMTA 3JQDA 3FDZB 1AB6A 3FB4A 3HDHA 2HHHB 1DX6A 2X4LA 4NCIA 4L8VA 3WOHA 4IJMA 5D3ZA 1M1NB 3VPGA 2WA1A 2XCIA 4TLBA 1YBHA 3QE9Y 4U3JA 3KJZA 3ZTWA 3E2MA 1U2DC 1L7OA 1N6PA 4O0LA 4RZXA 5J2TF 2G40A 5A9RA 1RHUA 4FK8A 4P22A 4DL9A 4DV2B 2W2TA 2B5VA 1Z6YA 3QA3E 4TT3A 5LQUA 3SICE 5JAUA 1U3GA 3EGXA 2DFLA 3WQBA 4G41A 4EUSA 3G68A 2GZ2A 5EKXA 2Q07A 3QYAA 1E3JA 1ECGA 5JR3A 4PRYA 2RAUA 1Q0ZA 2K87A 2R1ZA 4F11A 4FGZA 1U0NA 2E1RA 1PDVA 1AV7A 3F0TA 3I0NA 3JAKB 4FEGA 3T5CA 5AVXA 1JALA 2C1XA 3THXA 4ARZB 1B74A 1DXHA 2RB4A 2CFCA 3KT8A 4P4GA 1QDUA 1JKXA 2AOTB 1IYZA 2GILA 5DTRA 5F1YA 3T41A 1YXMA 3HA2A 1EP1B 1GTL1 1LF5A 1N4DA 3F74A 4AXXA 4EX6A 2BP7A 1C7IA 4EWLA 2JFZA 3REOA 3FCAA 1IWBB 3ZD6A 4REQA 1W30A 1K1EA 5MN6A 1CB7A 3PE4A 3ESZA 2QD5A 4MEJA 4RORA 5G4KB 2ZAYA 4YV0A 1V6AA 3DEJA 4M99A 1VKOA 4Z1MD 1RYBA 3I01A 2WZDA 4KVZA 3H3JA 4HJXA 1GCGA 5J4KA 1Y6FA 1RZVA 1VXOA 1T3SA 2CSUA 3WSTA 3U7FB 1PFWA 3U81A 3B8EA 1Y34E 5DGXA 3ZGOA 4WBNA 2RHBA 3P4UA 4TMKA 5L3RA 1TCBA 1F5SA 2MJLA 1LBEA 1V0JA 1KDRA 3CTPA 1J5XA 3E7FA 5DRTA 5JU6A 4LF5B 1K5GA 2A33A 3D1JA 1ENOA 4F4IA 2W5UA 2F64A 2GJ9A 2IHJA 1XP5A 3C74A 4G0PA 3DVAB 2BH2A 1V1JA 4MAMA 4D3SA 3MSCA 3EE6A 5C0OE 1EE1A 1FBTA 3P94A 1CUFA 1SBHA 5DT2A 1H2YA 4CIWA 2GN4A 4ZYVA 2GK7A 1DC8A 1QONA 2CXPA 2IE0A 4KMSA 2CLOB 1YR2A 1XTBA 4TV8B 1KZGB 1YCFA 3IDAA 3OZXA 4TV9B 4YRQA 5KYKA 1AG9A 3P9QA 1Y33E 3L1IA 4WLFA 1NXXA 3KR9A 3L7AA 4NG5A 4TTTS 5ALJA 5BMVB 5M5BA 3HDVA 1N2OA 4FGUA 4O4HA 4ND5A 4XQCA 5E3IA 3TTWA 1CNMA 1P77A 1G19A 2QTBA 2OO7A 4H3KB 3RT1A 1BU5A 3RS0A 3AO0B 2IYUA 4NG4A 4QXMA 3BK2A 3F5SA 1PX2A 2AJBA 2J3MA 4G85A 1QOPB 4FZJA 1N4AA 4PFJA 3E7WA 3N6RA 3I72A 3B78A 4AECA 2CHEA 1H1TA 2X0DA 2WOOA 1QH1A 5JROA 2O5RA 1A9YA 4KGZA 4MJ7A 1V5GA 1Z12A 4HWOA 4G89A 4MI6A 4LY0A 3N2GB 1GNSA 2QD3A 2ZWMA 1DS6A 3STXA 3HP4A 1BHJA 3TW4A 4AMVA 1M72A 2YXEA 1RLIA 4XYMA 4QNMA 1H9BA 2BW0A 4P31A 4UNQA 4EGFA 2EJWA 3Q15C 1R4AA 5BR4A 2EZ9A 4MS1A 2C2XA 3AHEA 4KLAA 5FP0A 2B8TA 2F8SA 3K1AB 3PJRA 2YYAA 4ZV9A 1F4LA 1O2DA 4RH0A 2VH2A 4WUTA 1K7XB 3GRFA 4GQIA 4ND3A 4X6XA 1W581 2WJYA 2YNMC 2YRWA 4CDMA 6REQB 2NTEA 2JHCA 4OLAA 2C4TA 4P4SB 4RF4A 4PZZA 4ROTA 1HLFA 5IDXA 2YS6A 2C8LA 3LRTA 4S12A 2UYYA 3HBNA 3FZNA 1DEOA 3ZYCA 1I2ZA 2WI8A 4OYLA 6PFKA 2WF7A 4L72A 4PSDA 3NAMA 3R3JA 1Z5OA 3P9YA 4I6GA 2ZRFA 4QYXA 3JZFA 3VPAA 3WLHA 5CLIA 1T2UA 1OZGA 2QZSA 1MC5A 2PGOA 1II0A 4FXOA 4OGFA 3RHZA 4EH1A 1E1DA 3L0YA 3PNMA 2UV8A 2F90A 4G56A 2X15A 2EW1A 2C97A 3FPSA 3QU9A 1EFVA 2OCLA 3PE3A 3FRJA 4JJGA 4Y6QA 4YRMA 2QY6A 2ZSDA 4YUZA 1ESDA 4YV7A 4KRGA 1M3SA 1X13A 5H81A 4Z3OA 1YONA 5CK4A 1UDBA 3D3NA 4M98A 4XTCS 4G26A 2DTDA 4TWRA 3HVRA 4DIEA 4Q3KA 4PAOA 4OJQA 1JPUA 4C9BA 1TFUA 1YHNA 2ZWPA 5BQFA 4ZTBA 1P9WA 1SH7A 2VF8A 2J32A 3E2PA 4C30A 2YV4A 3DOCA 4C0HA 4ZTUB 2ZTVA 2VBGA 3N70A 1Z29A 2BC9A 4UUOA 4RJTA 2OLKA 2W4QA 4J6EA 3UEOA 1SXJB 2VYCA 2VJMA 1DXOA 1N0IA 1XEAA 5EHIA 3SS8A 1XMSA 2A9OA 2H4HA 1V2HE 4ZOBA 3RADC 2B98A 2H3HA 4FMDF 3ZVKA 5FADA 1E77A 2DETA 1C7FA 2H2IA 2QW1A 1O6CA 5F9MA 3ZHCA 4G1FA 4M36A 3KPJA 1RI1A 1XDBA 1Z88A 3HB0A 4QXQA 3OOEA 4PZ9A 4NOKA 1W88A 2CUTA 1YBMA 3H2SA 3RHFA 4JI7B 2CZCA 3ZE1B 1IUKA 3PDCA 4KO3S 2XE8A 2I7VA 3BX1A 4WSOA 1VA4A 1XE3A 3TKAA 2O3UA 1ECCA 4XGNA 4CIXA 4DMUB 4EHJA 3CGWA 4N48A 3UO8B 3KQLA 2V6GA 4L76A 2LZ0A 3CB4A 5BSRA 2ORYA 3X2FA 4BHTA 4YRAA 5BV0A 2ZVQX 1JQ5A 3A06A 4UMFA 3TZEA 2R7NA 3VHXA 3GJTA 1CDEA 1GYQA 1GUAA 2P30A 2JLYA 1IZ8A 2ZS9A 2G5CA 1GRQA 1P73A 4AI6A 4MWEA 4A2PA 1FQJA 3O7WA 3T7TA 1P7ZA 4LJRA 1IHXA 2ZRPA 3ICCA 3L1VA 2ZSHA 2OZLB 3CRW1 2X58A 2I22A 5B4TA 1QUEA 3THXB 4OYHA 5B58C 3K70C 2C5SA 1UEXC 3CF4A 3GBPA 3QE2A 4L0MA 4XASA 2GGSA 4ZI5A 3ZH9B 4AJPA 3PJGA 1JR6A 2O1SA 1EB9A 4J0JA 1K68A 1GLGA 3BIFA 1C80A 2LWIA 1BMTA 1NJGA 1CNEA 5AMXA 4A73A 4ZJYA 2DWPA 3IP6A 2W42A 3OVMA 1G7RA 1DB3A 2AZTA 3KWJA 4NBRA 1DQYA 3FSGA 2X8JA 4F45A 4CF4A 2NO0A 3FKJA 1LQ2A 3BGIA 3JVEA 1BWQA 1KI9A 4A0SA 1KS9A 3NIFB 2Q1UA 1Z4MA 4BTEA 2HA5A 3KJXA 1A9XB 2W6ID 5C1BA 8ABPA 1DIGA 1OFUX 3CONA 3MTBA 1I30A 4LFBB 1KP3A 2HK9A 3ITKA 3LF1A 2JPDA 1UK8A 3DMYA 3O83A 3O2JA 4MV0A 5AP9A 4Q4LA 5DHQA 4P4UA 1Z56C 1JKFA 4KBGA 2GDZA 2XIJA 2Z5VA 1OV4A 1E2GA 4IV5A 2GCNA 1SZJG 1QZ3A 1Q1NA 1ZIYA 2JF0A 4JS0A 5EKSA 1LPPA 2JI6A 3CF6R 3JCZA 4J07A 2H59A 4JJEA 4RGBA 1G3IA 1E1YA 2OGZA 3BHIA 4RY0A 3GLIA 2Q27A 5FCDA 3WIUA 4FR5A 1OWPA 4IRUB 3T3HA 4UM9B 1G8JA 1ZBQA 1VG9B 1W75A 2O06A 1C8BA 4HRYA 421PA 4R1SA 2F48A 4JYZA 1Q1QA 2ZI5A 1RVDA 2FY8A 4BNZA 1CCWA 3ENZA 2ZROA 4MUIA 4R1NA 1VPDA 1XU4A 5T4HA 3AU9A 3VPXA 4DWWA 3KOZA 5EXXA 5JO9A 4GPEA 3RNOA 1CK4A 1EWVA 3UTDA 1BXRA 4MLDA 3UUGA 1R4NB 1C3EA 1P2FA 3AG5A 1EXVA 3QWAA 4BNIA 3HU3A 5A5FA 3SKVA 1VMIA 5BSFA 1S4MA 5BR7A 4DMFA 2CCKA 2VDOB 1SAYA 4ALKA 2C58A 3D4BA 4A5OA 1X1AA 3JD1A 3RD5A 5IFKA 4EVRA 4QGGA 3AKEA 1T6BY 4D81A 2MIIA 4TTVA 2IUUA 5A5GA 1PJ4A 4ALIA 1WF6A 3KVNA 1L5HB 3QKIA 5K20A 5FUVA 1XZ8A 5PNTA 3QVTA 4RAQA 5IUJC 4QECA 5H7XA 3DTVB 3KKZA 3PXGA 3L1JA 3THRA 4EBFA 5JT1A 4LF9B 121PA 2OK7A 2ATEA 3A28A 4KMOA 4PSAA 1GNVA 2W00A 4LOIA 3G49A 4XM1A 5KAMA 1MR3F 1C0LA 2WAMA 5DHPA 3W3AD 1FJXA 3QBDA 5AJYA 3ROFA 4TSKA 1YT5A 2HK8A 4EFNA 4WQMA 1U5CA 4MUFA 3DE1X 1FDRA 3RV3A 4CGZA 3I6MA 5FUWA 2WB4A 1FRQA 1V8ZA 1XRMA 2HO4A 3HWSA 1NKVA 1R5JA 1FVHA 4M49A 2H4JA 3V80A 4F97A 2QJRA 4YP5A 4LAFA 1LD3A 5ITWA 4CQNA 2W4MA 2NMVA 1JQBA 3TLXA 1BVYF 2ZUEA 5LQNA 1RWBA 2PUBA 4HUQA 5SY9A 3HU1A 4JD5A 3ZY2A 4H7HA 2WHYA 3FSRA 1K88A 1W5SA 2BDEA 2XNCA 1QAMA 2AFVA 3Q2IA 1CR4A 5C35A 1A9PA 5JSUA 4QYWA 1WETA 1GNPA 4ITVA 3THYB 1RWQA 4FDMA 5FI0B 2HADA 4PPGA 2EKQA 4ZV7A 4QJBA 1L5KA 4P3YA 1L5YA 4ZQCB 4E4RA 4CIAA 2RGXA 3QW2A 3ZDCA 2A3RA 1CRWG 1WP9A 1G98A 1KI8A 1MJ5A 1EVQA 1MNAA 1UMBA 1WQ4A 1AKWA 1ZD1A 1O6BA 2VDJA 2A0UA 2QYSA 4ZOCA 3V4OA 1QG2A 1IZ0A 2PKWA 4UPDA 1V41E 3JRWA 3W05A 2UKDA 1EGHA 3H1TA 3SQDA 2H4XA 2R1VA 2BFDB 3P32A 2RHTA 1UT5A 5CYFA 5ER6A 2VDUE 2FLVA 1T5DX 3TDNA 1GFSA 1KTIA 2CV0A 2FHPA 2C07A 4GPAA 1P0IA 3LUBA 5IAGA 1Y6QA 3R9IA 4F2DA 4X8LA 1YQWA 5DTJA 1GPUA 2I1VB 3CIFA 2BD0A 3M4YA 5DHAA 1OT3A 2ZB3A 1KQFA 2DY0A 1XDSA 2XRYA 4D2IA 1THGA 4JR2A 1MW9X 3LVRE 3NHAA 3O7MA 5I7HA 1V11A 2CN1A 2I0FA 2QM3A 3O3OB 4IJUA 2G09A 3PLRA 4M8LA 1C8LA 3HJCA 4CBVA 5FAXA 4KB5A 1ILEA 3ZWMA 1CEQA 2BGMA 1NWHA 2HXGA 1Z34A 4X1KB 3RWOA 3WYCA 1TVKB 1YDHA 3M6WA 4LHSA 5ALRA 3OWOA 2HDOA 2PVCA 4MMYB 3AI2A 1R4MA 4PYRA 1CUCA 2OFPA 4EG0A 4DV6B 4ZDWA 2HPVA 1DJPA 4BAUA 3SMVA 1EFRA 1UC4B 1R50A 2ZJ2A 1G5RA 3R3WA 3VM6A 2VNKA 1MJHA 4GPTA 4A6PA 4IUBS 4LXTA 2EGHA 3BRSA 3L07A 2AT1A 3SI7A 2PUCA 1YJ8A 2FEAA 4K6OA 3WHPA 2YXNA 2W2KA 1NQ5A 1RPNA 5CBKA 4JLUA 1N77A 4ZRDA 4I9NA 3P0HA 4X62B 1VPLA 3CTMA 3LDHA 4DNFA 1UIRA 1KWKA 3VNQA 2MYUA 3TZHA 4IIDA 2WEKA 2IV2X 3TOCA 1QDEA 3WV5A 5A6VA 3U4MA 5JJLA 3PD7A 1W9MA 3FI9A 3TI7A 3UH0A 3ZQ6A 3ABSB 4UTRA 2WWRA 3FSGD 5LZ8A 4J9UE 2OILA 1QZZA 2GZMA 3E3MA 1BCSB 2IEIA 2WJ6A 3NC1C 4NP6A 3HFRA 5LQKA 3OPMA 3GU3A 4ENQA 3I76A 2I6SA 4R2JA 3A2NA 1JE1A 4D44A 5HUJA 3IQHX 3E9MA 1W1UA 2GM9A 2O2CA 2AXNA 3JALB 1DUVG 3EZXA 3I12A 1U81A 3M6UA 4QFMA 3VYUB 4DDHA 3I34X 4EO7A 5TF4A 1WKCA 3MXOA 5FUXA 4FM9A 2QTVA 3QTTA 4JB3A 2QDXA 2ZDHA 4L3VA 1UXJA 1S2MA 3ZXXA 3ESBA 4RVCA 4FWBA 1CQWA 4Y30A 3WNZA 3WRXC 1N9ZA 3LUFA 1GGKA 3PKJA 4E5DA 3MWYW 1GDTA 1MO5A 1SURA 2Q0SA 2EEPA 4LVUA 1YAHA 1GDHA 1Q3HA 3PHBE 4ITUA 3WO0A 4DPKA 2R8RA 2WY2D 4DYVA 3I9NA 4AKHA 1MB3A 2OYCA 2VHCA 1RLUA 1XXHE 2VSNA 5D86A 5EWMB 4QDOA 4X90A 1PL8A 4L07A 5JWOA 5KQRA 3VDQA 1GVHA 5BR8B 2C9ZA 3IIKA 2EGUA 3F49S 4EUHA 2QLJA 4FZVA 5DBGA 1RCTE 1COWD 5KJCA 1R74A 3ECAA 3R3UA 3RYFB 3AUTA 1G41A 1QU3A 1G4AE 1EKXA 1QIMA 4UCQA 4I1IA 4KGXA 1NAHA 5ALFA 4AYTA 2QN1A 3HKDA 4ZVOA 3E18A 4P35A 3Q1KA 4L4SA 1GEGA 2P2NA 1IHUA 2IW1A 3LQYA 3P9SA 2W2KB 1SXJC 4KIUA 1JVBA 1G9TA 1NPDA 3AX6A 3OWXA 4CMCA 4HH1A 3OX3A 5BSHA 3Q9NA 3U4DA 1ZCZA 3EXIB 2QPOA 2E87A 3UFXA 4ZYYA 5KJ1A 1W0JA 3AJAA 4YRBA 5C8XA 3PUXA 4ZGWA 4H3HB 1LK0A 3EG9A 5ULLA 4BCCA 1QLJA 2CW5A 2WWGA 2V6JA 4HZIA 1AU9A 4DA6A 2AD1A 3KEMA 4XCQA 3G0HA 1VL5A 5BVGA 2OGTA 2V03A 1J24A 1IL0A 1JMKC 2BLNA 2YHBA 3GY0A 4Q4JB 4AZ3B 3TTTA 1B6RA 3LK6A 4US2R 2PZEA 3UNXA 1S89A 4PZCA 2FKNA 4LSWA 3ND5A 2YIVX 1R6TA 3ABQB 3MYYA 3DKVA 3JPWA 1QYRA 2J6HA 1WCIB 2RGCA 2Q3JA 4M8KA 1JSCA 5L53A 5EZ6B 4PTLA 3JD3A 3KXLA 3T9EA 4CTMA 3L02A 5E4TA 2QAGB 1QX3A 1XHLA 1GKLA 1DKLA 2QP3A 5I3CA 4BLPA 4UDXX 3MLBA 1CU1A 1QVVA 3R7WA 1RLMA 1BXRB 3IMCA 5C80A 2XTZA 4B4VA 1NL3A 4IWYA 3K70B 2ZIXA 4BB9A 4YJFB 2PO5A 2WTMA 3QY9A 1NHWA 4F4DA 1VBKA 5IPFA 2FXIA 4CJXA 1UBJS 1U90A 3RU2A 2JAHA 3FMVA 1ZRHA 3UK7A 3AV0B 1ZOSA 3UMBA 2HT1A 1BE8A 4M0KA 4FEEA 4YA6A 1RS0A 4JR0A 3SM3A 4P0QB 3SSMA 1IXSB 1GGVA 1PG2A 2QXTA 1Z6PA 4ZEWA 3RS8A 5JBQA 4PWZA 1BW9A 1HYBA 4PYMA 1D6SA 2PX2A 4G2TA 3V6MA 4CFYA 2I67A 2QOEA 4YWHA 4ANFA 1YZFA 1FTYA 3MELA 1NN3A 3U9SA 3GYBA 2GKGA 3TINA 3N7UA 4QFCA 3I52A 4WDQA 5U4XA 1O8CA 2W98A 3BWEA 5CJJA 4YAFA 1Q7RA 4BZWA 1LDNA 4MVCA 4U6SA 2VKQA 3UHAA 2OXTA 5IH7A 3I61A 5EEHA 4OP3A 1E60A 1RDFA 2Q5QA 3MXTA 3PC3A 4P86A 3S68A 3UAOA 1DFIA 1D0IA 4BGVA 3ORRA 1I13A 1ZHFA 3D4IA 4X24A 3VA7A 2A5JA 1YJQA 3PPVA 3BHJA 2O52A 4EDFA 3KX2A 5IUNC 1GPMA 4B3GA 1IZZA 1U5AA 1VJ0A 1G20E 2H5EA 5KNBA 1GQQA 1NVAA 3SYKA 1UXGA 1OGJA 4B3JA 1Q7BA 2QVLA 2ZTSA 3KEGA 4C4ZA 1CUHA 3A0RB 5FBKA 3D64A 3QXJA 5EYPA 3ZKAA 4HP8A 4DJDC 2O3TA 4F7DA 5CM8B 2J0UB 3ESDA 4XVCA 3PEYA 3VTKA 4GZLA 5EI5A 2D7DA 4IRMA 1XVIA 4DLZA 2AG5A 5HIIA 3ZCXA 3U60B 2IELA 4X94A 1UKEA 5TF0A 2QVBA 3FWNA 1S3FA 3B3QA 4I1UA 1JA0A 1MG0A 2O8VA 1W4ZA 3I5UA 1EB8A 1XMPA 3VR6D 5ISMA 5HJ5A 1GZ7A 1X8JA 2JAPA 5T57A 2WSIA 5FEUA 4UCWA 1CF2O 1D2NA 2HXSA 3AYZB 4PLWA 3CWQA 3SHWA 1X9HA 3PVZA 1SUIA 2RHWA 3EJWA 3CIOA 3H0CA 2PKRA 4IX1A 1W5FA 2LUOA 3D0RA 5H0IA 1ZL0A 3RSLA 2E82A 3QPCA 5EMJA 4BUZA 4X3CA 1L7PA 1TJPB 3ZWKA 2XMBA 4L0CA 1G3MA 1QB7A 3QENA 1QFYA 1DQNA 2XOEA 4D9MA 1C7RA 5JJCA 4LI3X 1JRLA 4DV3B 3EXFA 1F2UA 3GFBA 1RP7A 1L7XA 3OJFA 3ZXYA 5JC1A 3IX7A 4NONA 2OVBA 1N5DA 2B1RA 4KHZA 2B6NA 3IP7A 3IBTA 2BGUA 1F9EA 5F35A 3DCYA 4Z8XA 2X0EA 1DUIA 4XIFA 2V1XA 2ODTX 4C2TA 1JVSA 4KWIA 2CCGA 4TMZA 3HV0A 3K9LA 2HSWA 3I0MA 1RC8A 4MIYA 1A9RA 3E9ZA 4QBGB 1W36B 1A27A 2A7XA 2P9EA 4IZIA 1PJ3A 3F47A 4HWRA 4MNTA 5EJAA 2B1JA 4L73A 5BWLA 5HF5A 4KXLA 3EPHA 2H1FA 1V5WA 3CRVA 2DR2A 1NP6A 5B7QA 1DEXA 1LU9A 2PT9A 4UTXA 3OAAA 1CR0A 3LP6A 5FTWA 5K05A 1T8PA 4E13A 4DT1B 1UBTS 1EVLA 1RQRA 3JWEA 3OJWA 4N5LA 3RIYA 1NW5A 2H2FA 3D8HA 1Q14A 4UKDA 3TS1A 3MWEA 5HCIA 1P1JA 4ZHQA 3TQTA 4A3SA 4CL8A 3DCJA 4DM3A 2EG9A 2Z9BA 1US8B 4LTDA 4KIJA 3QJ5A 4XGKA 2B7LA 1LQTA 4E2WA 1A7AA 2QP4A 3GGGA 4OAOA 3LO8A 5SV2A 4E07A 4OH1A 2VJDA 5DNEA 3CINA 4TT8A 1EZ4A 3Q7SA 3DLTA 1SK9A 1VL1A 2P79A 2YUTA 2FCRA 3GJZA 3U3ZA 4B71A 1EK1A 2R1VB 2ZG6A 2HF7A 2RGBA 3Q9SA 4JXKA 5IT9A 3W9UA 3KD3A 3ECCA 1WZNA 2ID7A 4MVJM 1OYYA 2A1IA 2PPLA 3FJYA 2VTEA 3G5AA 3BEDA 4KQXA 3EZFA 4EFKA 1NLMA 2PA3A 3IAEA 5FULA 3I3SR 3FETA 2P90A 3KOXA 1T9GR 4RIIA 1P81A 1YRWA 4EZEA 4JX9A 1XQYA 3RYHB 3LYLA 4QFBA 3LW7A 1BCRB 4TRRA 4RKWA 4OB6A 4P36A 3QTLA 3EBLA 3C8MA 4JLSA 4HWGA 5TS2A 1IY0A 2G5TA 3DWEX 4RHTA 3TRHA 2WNHA 3RKRA 3VPSA 2W6OA 3A58B 4BFWA 1TO1E 4OFXA 5E9QA 3HKDB 1P1CA 4IDFA 4LJ4A 3V42A 4JBHA 1J0EA 2Q29A 4R5HA 4DCGA 4Q3BA 3CWZA 2D7JA 4LFCB 1KZ4A 1XEWY 3DQPA 1TYEB 3KAKA 3GLKA 1FXWA 5DWDA 3BCHA 4ZO8A 1R6DA 2XAAA 2XNKA 3H2IA 3DEAA 4N40A 1QS0A 1D2HA 1JVNA 1WABA 4FDAA 3GN2A 2AD5A 4NNOA 1KK1A 2YQZA 4O5OA 3ZDYB 1KNQA 1LC3A 1VTKA 3ENQA 3T4XA 3DLHA 3T9CA 2EHDA 1DKPA 2GYYA 5I5GA 1P91A 3Q7EA 2GEJA 3EH2A 3FOAA 3GL9A 3PGVA 1LUAA 4E5MA 3ABRB 3EZLA 2W2LD 3GJ0A 4PC6A 2R66A 4BOYA 3ST7A 1OREA 2V6IA 3C7TA 3UT6A 2W0MA 1R3UA 4QNRA 3Q7TA 4CKEB 4EMBA 4JV5B 5E6UB 1E1RD 2CD7A 1KK0A 1WB5A 2BFOA 4NYIQ 3C3WA 5D3QA 8OHMA 4B6SA 3NRCA 4MINA 2OCXA 4DXHA 2C4UA 4LE2A 3QMMA 1H94A 1OWMA 3R7WB 1JEQB 1EDBA 5M2QA 1FC0A 1NVWQ 1JHYA 3O8LA 1MO3A 4Z2YA 3PGLA 4F9EA 4KV7A 1WHTB 1NMYA 2CUNA 3TIVA 1KMCA 3INNA 1IRXA 3JSAA 2MSNA 4REOA 4YCNA 2A59A 2AFRA 1Q2UA 3HS3A 3ZD9A 3QXGA 3AUFA 4R2IA 3CKLA 4CG1A 1YB5A 2DH5A 3FNRA 4LYDA 4ZQIA 2ZCJA 4CL2A 1I5EA 2QMUA 3LS2A 2HMTA 3C1UA 4PG5A 4WL0A 5DBFA 3SJAA 3VSDA 1JFRA 1W0JD 5KTOA 2OR3A 4MYCA 2C61A 1QPGA 4TSFD 3ZK9A 5BQXA 4R2XA 1CSEE 3GUVA 4M7WA 4NYMQ 3FRHA 4RADA 3WB0A 5J23A 1X86B 4ZAWA 2Y0BA 3ICWA 4TKMA 2Y1DA 1VDMA 5AVOA 2RI6A 1PFVA 2GOYA 3DLIA 3R5SA 3RC2A 4ZEVA 1SC9A 5A3RA 1M73E 4R83A 4G81A 2RGAA 3DH0A 4ILEA 4FFBA 4U9UA 1WPXA 3DD5A 4GH5A 1E6MA 1XTKA 4F2PA 4NV0A 4WZBB 2A57A 4R9RA 5TMBA 4B80A 2Z56A 3ASUA 1UM8A 2IDJA 3M4NA 2Y0PA 3ROEA 2PQ0A 3A2KA 3NHKA 2BJVA 4KLRA 5BN3A 1UAAA 3THWB 1A7UA 1L5MA 2P2SA 1MJGA 2H31A 1IN4A 3CBGA 4JZKA 4ZCPA 5HEKA 4CM8A 3SBOA 4MQBA 5C1OA 1WSBA 1NV8A 1CUZA 2PAFA 4I1VA 1X7ZA 3MVEA 3WLNA 1OU0A 2R87A 3MRSA 4HYTA 2JI9A 5CFZA 5KX5F 1M2WA 5J3JA 5DB4A 1HA3A 2BGTA 2HJSA 1S3IA 3GAAA 4BKMA 4MA5A 3MJDA 2JLQA 4I8IA 5AI5A 2X2EA 3EGEA 5JHGB 1Z62A 1Z0FA 2BI7A 3L0CA 4TVSA 1YZQA 4NAVA 3P2MA 4A91A 5CDHA 2Q5OA 3EDOA 2C2MA 2DBYA 1H69A 4YMSA 4OM8A 2VTBB 1MF7A 2YWJA 2GVNA 3R0VA 4KXFB 4RNCA 5H70A 1TM3E 3K2BA 4RMHA 1ZH6A 2BMFA 2XQVA 4JL8A 5THKA 3K6SB 2JRLA 1USGA 3AIMA 3MINB 4MH0R 5FUMA 4PLZA 3SX4A 4TYPA 1N6OA 3PL1A 2MR6A 3WTCA 3QVOA 3D6NB 4YRPA 1Q12A 3ZX4A 5EZQA 3JQCA 4JUDX 5B53A 4DLTA 3DVAA 1OYOA 3RVBA 1YRAA 3WGGA 2PKCA 1XDGA 5J2TA 5H8WA 1TQHA 3KP1A 2RK6A 2RE8A 1CX9B 2OEPA 3I5MA 4GOXA 1P1RA 2GBLC 3KHTA 4L85A 5D8DA 3FKSA 1L4HA 1IE3A 1RFLA 4CF3A 3K1YA 3OETA 4XB2A 4XWOA 4NU5A 5TQ0B 2AOUA 1DAEA 1YCDA 4JJIA 1F6DA 5CT4A 3ZUGA 4HF7A 3EHEA 5HUHA