2H1VA

Crystal structure of the lys87ala mutant variant of bacillus subtilis ferrochelatase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
309
structure length
309
Chain Sequence
SRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLAHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ferrochelatase
publication title Amino Acid Residues His183 and Glu264 in Bacillus subtilis Ferrochelatase Direct and Facilitate the Insertion of Metal Ion into Protoporphyrin IX
pubmed doi rcsb
source organism Bacillus subtilis
total genus 120
structure length 309
sequence length 309
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2006-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h1vA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h1vA02
2H1VA 2HK6A 4KLCA 1HRKA 2HREA 1C9EA 2PO5A 3HCNA 1QGOA 2JH3A 1AK1A 2Q2NA 3HCPA 2QD2A 3AQIA 4KMMA 2Q3JA 4KLAA 3HCOA 2DJ5A 2Q2OA 4KLRA 2H1WA 2XWQA 2AC2A 2HRCA 2XVZA 1N0IA 2XWSA 3HCRA 1L8XA 3M4ZA 4CCSA 3GOQA 2XWPA 1C1HA 2QD4A 4MK4A 4F4DA 1DOZA 2PO7A 1LBQA 2QD5A 1LD3A 2XVXA 2QD3A 2C8JA 3W1WA 2XVYA 1TJNA 3LYHA 2AC4A 2PNJA 2QD1A
chains in the Genus database with same CATH superfamily
3BTOA 4EJSB 3LK7A 3W8FA 2GPJA 4BVLA 3EVEA 3ECCA 7MHTA 3HNOA 3QE2A 1GAWA 1JLSA 1F2VA 1F4LA 1Q74A 1V6AA 1ZSVA 2YN4A 3O91A 4JB8A 4OSEA 2IYTA 5DBIA 2ZIUB 5BO5A 5BWOA 1RXSA 4AJLA 1U7WA 1IONA 4FFRA 1DJPA 1EQ2A 3AVVA 4KAFA 1L5YA 2ZP1A 2BH9A 3EULA 1DJNA 3ZDDA 2GNAA 2D8AA 1QG0A 5KWEA 4I1YA 4IDOA 2KW5A 3L46A 4ZYZA 1K27A 1WCYA 4K1XA 4ZJYA 3AB8A 2XIQA 3LXUX 3IUYA 2BGRA 3HJNA 4PC1A 2PUFA 1BH6A 4BNNA 2WMNB 3M3DA 1FQOA 3IP9A 5TEWA 1G4UR 4HUJA 1KU0A 1THMA 1ZCZA 2XUGA 3ELWA 4RZ3A 1TQHA 3R7SA 4XD7D 4QJBA 1KU6A 1MU0A 1AQ6A 1PJAA 4IYRA 4X3CA 4ZWNA 4CV3A 3KYDB 5CBPB 3B1FA 3GLHE 4KPEC 2REQB 5K3FB 3OOHA 4RH0A 4XTRA 2NNLD 4A2PA 1WNFA 3HXQA 3RVLA 5I8WA 2OD9A 2W90A 1B8OA 4HXFB 4YGXB 1GV0A 2Q28A 4GMHA 4ZAFA 5FV7A 5C5EA 5JZBA 1B76A 2FGKA 4Q7KA 3HDGA 3TAXA 4CF6A 3F5FA 1PK7A 1TA9A 2I34A 2XYGA 4G65A 3V00A 5KQPA 2O8DA 2AI1A 4Z4IA 4A26A 1MLDA 3UN1A 3T5AA 1DARA 3I05A 2B37A 2BKUA 1Z73A 3C8UA 1O96B 1IPEA 2ERCA 4U0JA 3WG9A 1L5GB 4D26A 4F5YA 1YNSA 3FMIA 1MGOA 1RKXA 4Y2HA 4L5CA 4OK6A 3VZQA 4KFUA 3R77A 2HIMA 3ZHXA 4HPXB 3H2SA 2P6NA 3MAGA 4RD2A 2R8BA 2Q2NA 4NS4A 3ASVA 3FY4A 4M9UA 2OCDA 3LT2A 1QQBA 1ZIXA 4YMIA 4OI0A 5IC4A 3INGA 2CWDA 1BOOA 4ANFA 3U1BA 2HBZA 4TYNA 4JGIA 2ZR8A 2FW1A 1JLRA 4TMKA 3G2LA 4IOMA 4I0WB 2C4UA 1C9NA 4GWGA 4CEIB 3GJYA 2VHZA 1Q1GA 2VOEA 3ZWNA 2CNWA 1IZ0A 3DD1A 2NPOA 1DEKA 2X8JA 3MILA 4GBJA 4YAFA 1PU2A 2W22A 1ZRSA 4AIIA 2Y1WA 1P1CA 3KWFA 3MN1A 5IT4A 5KBYA 4ZTBA 3DA8A 4ERNA 2HA0A 2WQZA 3EIEA 1YRBA 4X90A 3OC6A 1H2XA 4ZP1A 5EWLA 4PZAA 5G53C 3DP9A 4EFLA 3FPBA 3IE0A 4R1QA 1BW9B 2VYND 3FJ1A 4N7JA 5TMPA 2FSFA 2SHKA 5EAIA 3QVVA 4OK3A 1XLUA 3KQTA 1QRTA 1L5RA 2FSVA 1U8ZA 1TECE 1NFFA 2FFQA 3EW9A 3LG2A 1I5RA 1VQ1A 1W85A 3NOQA 5BWNA 4WLVA 3IYLW 1X3LA 1C3EA 1OWNA 3IAM6 4UTNA 2CNOA 3DV0A 1MFPA 3PFBA 1GQOA 2A0WA 4B7ZA 1XRPA 1SHUX 3PVSA 4HXGA 2NXCA 2I9PA 1V3QE 3HKBA 1LC0A 1ENYA 2VDJA 2YXEA 4CL2A 1G21E 2YW2A 3VNVA 2OGTA 1ZI6A 3IALA 3Q9LA 5AOBA 3ESXA 4FZVA 2V0CA 4TKUB 4LWOA 1VJ5A 2QVZX 3WL3A 4ZIRB 4OCZA 1O4WA 1N7JA 3KEGA 2G1UA 1TUBB 5AH0A 2HCTA 1R7RA 2AK3A 1JRLA 3DQPA 2PT5A 1YIAA 4X20B 1QHIA 3CY6A 2X5OA 4P4TA 3ASZA 1VG0B 2FEMA 3FVQA 4DR7B 4HQ6A 1JDJA 3ENWA 4OLBA 1TAQA 5CTAA 4KDFA 5M34A 1YE8A 1XG5A 3E9RA 5L7WA 1WPRA 1MAWA 3IJEB 4YQYA 3TIXB 1T1EA 5ALRA 2B4KA 1C8VB 1JDBB 4H16A 4Q21A 4BQIA 1L7XA 1X1CA 2ABWA 4RABA 1Y1TA 1ZQ1A 1BWSA 3E0QA 3PYXA 3ZGXA 4A6XA 2UVDA 4MV7A 1ZAYA 4E1VA 5EEGA 2BI8A 2HA5A 1U8XX 4Y6QA 3DL2A 5PGMA 2HWUA 4OBBA 3D6AA 3RU3A 3J80A 4A36A 1G59A 4EO9A 2C4MA 1GR0A 1IEXA 2JLYA 1T25A 1D2MA 2GK6A 3HUEA 3UV7A 2J9GA 5H8WA 1C3XA 2O57A 3IP8A 4PRKA 3WRWA 4TRNA 1OFVA 2ZTHA 2ETXA 3P5BA 2BHSA 3RLFA 1TYBE 5FOXA 3CTPA 3ONEA 5KKAA 3WK6A 1AQIA 1KEVA 1ZM7A 3NPMA 4XX0A 3CO0S 3WMFA 2A94A 1C9MA 2UZAA 3DMRA 4ZU1X 1I9CA 1ML3A 1Z2DA 5AQ1A 3KJQA 4M53A 3QUCA 4P54A 4QUKA 2Q3CA 3R7WA 4RTPA 4LF7B 2GVNA 4ZV9A 4I6JA 3RYIA 2ZIEA 5KWJA 1VE3A 1Y8RA 4PSUA 1O2DA 1UUFA 3H1EA 4Q1BA 4YNBA 4EX7A 3ONNA 2NPIA 4WDRA 1PWZA 3AFGA 3EGXA 2DFKB 2NN3C 5CD1A 1DXHA 1Z34A 2NZWA 3G23A 2AF3C 2PN1A 2D0OB 1ENOA 4M37A 4QWWA 3RJ5A 4AD8A 6CHYA 1CZHA 2AKAB 1UK6A 3VPFA 3OM1A 1KGSA 4MW1A 4D98A 4JASB 4YDSA 2HIAA 2DHRA 4A6EA 1LPBB 1E1YA 1OMOA 2D7JA 1A88A 2DMRA 3KHKA 5LMNB 3QVXA 3MB8A 2ZJ4A 1UDWA 3E9EA 1QB8A 2QY6A 5JEEA 1BWPA 1I3KA 5I4CA 3HZZA 5JH7A 3I53A 3ORSA 4MR8A 4UXIA 5CVDA 4CTKA 3EQ2A 1Q7EA 2PKXA 5D87A 3KZCA 4R8VA 3TUIC 1QQ5A 1V1RB 3WRXA 1GAXA 1GLVA 2YINC 3OPXA 1FMTA 1UKVY 3DLPX 5JDCA 2XA1A 1T36B 1JXAA 3JQBC 2YJTD 1YQEA 2FX3A 4B2YA 1MORA 4WNYA 1J39A 5DRTA 1BJKA 1HXHA 3R7BA 2WJAA 5KQSA 1UBLS 4IAOA 1NMEA 4F3NA 2VRCD 3ORFA 2XV1A 2OGZA 4C0XA 3CJQA 2G9UA 3T9DA 1ZGJA 3M2PA 1ANKA 1T5SA 2BDEA 4AROA 2YOHA 4IIUA 1M5TA 1JIKA 3B3FA 1IQPA 1L5OA 3L05A 1DJMA 2AFHB 4QOHA 4MI6A 2XB9A 1Z5VA 1ORHA 3ICWA 2OUIA 5B3JA 2IZOA 5L3VA 2QR2A 5IHXA 2C5LA 5CYPA 4DSTA 3T0GA 2QX8A 2QNIA 2HLDA 1E5XA 3SC6A 2VXCA 2P1RA 2WA1A 3TSZA 4LGCA 4IDNA 3ZEIA 3TOZA 3RB8A 5JH7F 2ZM5A 4RA6B 1OXBB 1G5HA 2PAFA 1HH4A 2HCRA 4YRSA 5FLXA 2DPLA 3LW8A 3W06A 2F8TA 3PNSA 3E7XA 4TYQA 2ONZA 1QQTA 3E5MA 4ZCLA 5ISMA 2G9RA 4A0SA 3R44A 3PSAA 1JWBB 4LI0A 1CJCA 2WP0A 3HHEA 3IEIA 3FCEA 1M7GA 4CV0A 3TN7A 4B83A 1BXZA 4I4NA 1W94A 1RLJA 4MEAA 5DYWA 1TPZA 2B92A 4G97A 2GBGA 3M89A 4C0LA 4E2ZA 3B6JA 3GFPA 4IX9A 4Q1DA 3UK0A 3UZUA 3FHJA 3TSCA 4BVGA 5ITZB 1KJWA 1H5UA 4M9QA 3PKIA 5FO1A 4TQ9A 3U6KA 3SBDA 4K2HA 4BBJA 1VIDA 1NOKA 1ADFA 3ORYA 5SV2A 2QLMA 3GDOA 1F5SA 4RL6A 3UF0A 2EWVA 1MQAA 3CV3A 4ZOCA 1P19A 3NGXA 5JHGB 3O47A 1DGQA 3D8RA 1R6UA 4CM4B 1OF1A 1E6MA 3RAGA 5BV1A 1A2OA 1GSAA 1FTGA 4UU7A 1YO6A 1ZI9A 2EF1A 2PLFA 3F2VA 4S1TA 3WOHA 1XMIA 2QTAA 3JVIA 3PC2A 4MRVA 5C81A 2C7PA 5KYUA 4DA9A 4IH9A 1DIOB 4DVJA 1FEZA 2XRMA 5B1SA 3VKVA 3IUBA 2X6TA 4Q7LA 3BK1A 3GGCA 4ZU6X 3GGGA 5IFLA 5JBQA 2AD5A 1QIDA 4RGBA 1QNLA 2DT5A 3MT0A 1B3RA 4J16C 3E7DA 2WD9A 3U7HB 3G2HA 1ZGZA 1N0HA 3RSCA 1SCQA 2ZBVA 1GPMA 2XXBA 4LZAA 4MA4A 4MUHA 4XYLA 4CE6A 1MNAA 3RJ9A 1FBNA 5TR9A 1AXGA 1Z0KA 5EE1A 5DCWA 4C20A 3I6BA 4PNZA 1A9PA 2E7ZA 3WLTA 1ZVKA 3F1LA 3ZDXB 3ZDFA 3AY3A 4RTJA 2YWXA 3HRKA 1UJ2A 5IXYA 1F14A 1M0SA 2DUWA 1RAGA 4AZWA 1UQTA 4CIDA 1KI6B 1VPDA 2HQRA 1K2WA 1KIFA 1UWVA 4IJWA 4D46A 2PUEA 3FNQA 5KJCA 4V0KA 2BGTA 2XSZA 3IB6A 4QO7A 4AC9A 1KSFX 5LB4A 4CV1A 3LE8A 2MR6A 5ALDA 2YV4A 1P0CA 2NU6A 3EVBA 3GN2A 3PJEA 3DE0X 4I5FA 4PLWA 4TQGA 1WF3A 2O3JA 5ALXA 5I7UA 1KYYA 3OY7A 3FWYA 1KE1A 2Y77A 1M2VB 1NV8A 4FGUA 2O7NA 1WPXA 2IWHA 3G5MA 2WA2A 3HC7A 3B2QA 4BNJA 3R7NA 1SNYA 3RVBA 1B8NA 4QASA 3TRIA 3ED5A 2FLWA 2PUGA 1VLZA 1YDEA 2YMPA 3GDGA 5DHSA 5LP6A 3O2JA 1VSQA 1U1GA 3TEMA 2Q1WA 1PQ4A 4MR7B 1YHNA 1Z4QA 1K6JA 4QQ8A 1SD1A 3STWA 2VHYA 4DCSA 3O0DA 4DV3B 5KZMB 2XA9A 2ZREA 3HDYA 3TEJA 2AUNA 2JCGA 2PANA 3C15C 4L76A 3SEAA 3NBAA 3QVTA 4NK4A 5K8VA 4ZA2A 5D3QA 1PNOA 4JU8A 2EYUA 2WWIA 3P2KA 3BL5A 5BNIA 4J0IA 2WHPA 4P35A 3QX3A 3MQ2A 2BGGA 4E30A 2OCPA 3V8RA 1N2ZA 3PFGA 3FPKA 2GGSA 3RFTA 4M1SA 4I7EA 5KKCA 1LDNA 3LP6A 2XZPA 1Y42X 3LW7A 4I2NA 1JMYA 3FBTA 3EGOA 3HJGA 2BEWB 4B47A 1IEQA 3ASUA 1YL6A 5F9MA 2VSXA 4Q0MA 5A0FA 1WVGA 2D2IA 2JBAA 4QNRA 4C0QC 1YBHA 4K6MA 2YFKA 2OQVA 3LC1O 1M2FA 3O93A 4PVCA 3TB6A 3H04A 5CPBA 3D0RA 2YWEA 4F71A 2WEKA 4K9SA 4CJXA 1AC5A 1D4AA 1DAPA 3F8SA 4RY2A 5FNVA 4ZVUA 1EFRA 2FVXA 2IYLD 3JYPA 1OASA 2CNKA 2YMLA 3TTXA 5TF4A 2OZVA 3W9UA 4FHDA 3LUKA 1A50B 3GJXC 2WUEA 3NAMA 2Q5OA 3Q3JB 4DLLA 4Z9YA 2D1QA 5DLEA 1OA0A 2ZCVA 2D2FA 5REQB 5BRJA 5JS8A 4Y2QA 3PWKA 4J75A 3H13A 4TPKA 3WDMA 5KOJA 1OTYA 3PYMA 5BWLA 3THSA 3D8NA 5DPMA 4ND7A 1RWMA 3UMYA 1F0YA 2WSMA 2J07A 1BDHA 1EX6A 1VSBA 1SIBE 2B78A 2P75A 3VR3D 4ESHA 2C0QA 3NKLA 1NZJA 4FCTA 1T2FA 2YQZA 5EZYA 4Q9HA 2JCVA 3QU2A 1KAEA 3LQQA 1Z6ZA 4PZLA 4PYMA 2IYPA 3EARA 5JPCA 4IQ4A 2W6IA 3V5NA 4OJKA 1YC2A 1IZZA 1SULA 5HOQA 5BN5B 5HMLA 3CVVA 2VWPA 1A8QA 2VHQA 2IYZA 2F1KA 3A9VA 2BFWA 3IOYA 4KAAA 4A0GA 1TM5E 3FPHA 4MP3A 4QREA 3T3IA 4CNBA 4F6LA 4WV3A 3V80A 5GQSA 1HT1E 1KTVA 1SU6A 1UT5A 3M6XA 5L8VA 3G0HA 1ISRA 4FKZA 1KOLA 5CD9A 3F8WA 1SWWA 2GLTA 4P0PB 5HBRA 2WVJA 1DE0A 4A5SA 2FPOA 1WBDA 4GKJB 2EWMA 1SXQA 3DVAA 1V8DA 3U39A 3ZWAA 2FCRA 4AMVA 1ZMBA 1SM4A 4EYEA 1JJFA 2VSNA 4YV0A 2OC4A 4MKZA 1TO6A 3HYCA 3Q8WA 4KYIB 4F3RA 5I7OA 2ZROA 5TPZD 2WW8A 1UAGA 4IKPA 1TLLA 1P6QA 2F3UA 2OK8A 1AQJA 5KX5B 1M6YA 4BLVA 1H1TA 3I2HA 4NQZA 2F90A 4X84A 4B79A 5CG2A 4KNWA 2PMEA 1RQXA 2JIQA 3WQRA 3RNOA 1VYUA 2HMYB 2ZYGA 4UQLA 1LUAA 1C2TA 2Z98A 5HNKA 1R3UA 3JTMA 5IHPA 1XAIA 3E1SA 4HDAA 2NO4A 4TOIA 5LA6A 1PCXA 2VPZA 1S01A 2P0YA 4M1QA 1U7ZA 5EZYF 3KUUA 4TN5A 1AVTA 1W88A 3QBJA 4B4UA 1XTSA 4LYYA 2QMHA 2P90A 5AVQA 2WD8A 2VF4X 3NC0C 4D0GA 2Q50A 5JY6A 1YFLA 3TE6A 5DTEA 1JG6A 1ZR4A 4EB6B 4OGFA 3W77A 3OQJA 2TMKA 1O8BA 3X0DA 3RIYA 2CXQA 2JGMA 2BR3A 2ZB8A 2ZSUA 3HGMA 4GPTA 3PE4A 2O8FB 1E4YA 3NBXX 4CQNA 1OC2A 3M6MD 1SCIA 1RWQA 1DAKA 2GBFA 2OV8A 4M21A 3VYTB 4NCNA 1XRSB 2A9OA 3QX7A 3F3KA 3D4OA 5CFRA 1NXXA 3KPYA 3P0IA 1Z2OX 1O9HA 2B1IA 3JAKB 1W1IA 5LD2B 1B00A 4BFCA 4HOYA 3K3PA 2PY6A 5F64A 3C3WA 2Q62A 3EVAA 1UJ4A 1R6VA 1XMVA 4J3FA 2C82A 1DTWA 3DONA 1F8FA 2V7UA 3QP9A 4ZAWA 4IH1A 4NJMB 4TKLA 4DMMA 1QOZA 2VXYA 3KUXA 3V2GA 1C9KA 2ZRKA 2W0MA 1SB9A 1VSUA 3NIGB 5EESA 1AK2A 3LQKA 3DQQA 3ZGYA 2ANBA 3LBNA 4YQFA 2D1RA 5JS2A 4IS3A 3WHIA 2O6HA 4OBXA 3GPIA 3B12A 3D8SA 2TMYA 4U9HS 3SNHA 1QIFA 4D9HA 1FFYA 2O8BA 1LV7A 3HKDB 2AUMA 4MS4B 3SGLA 4FDLA 5IK2A 1UK7A 3JVVA 3S2IA 2ODPA 4Z53A 3OOSA 4A0HA 1AZSC 3V3TA 4CN8A 2WJ6A 1P3DA 1SUIA 1E99A 3BK7A 2GYUA 3ZU5A 5HMMA 4DGSA 2EZ8A 4LHWA 3REOA 5JTTA 4GI1A 1N2CA 4DIEA 4DBLC 3GLFB 1FSFA 1VCHA 3NC1C 1FY2A 4YYEA 4EFMA 4ZGGA 5K01A 2DGDA 2OORC 3WLFA 4JUCA 2BMVA 3DOUA 3A04A 4R98A 1XELA 3LUGA 4L7QA 3EAFA 2Q5LA 5DASA 1B0PA 3PHCA 1Y4ZA 4QEZA 2R4QA 3HJCA 1Y6FA 4EY5A 2GAOA 4BDSA 1A98A 5KOHA 2PS0A 1G5PA 4KWEA 4OX9B 1XMXA 3G9XA 2PZFA 1ZEMA 4AN4A 5IZCA 1KZ1A 4DDVA 4CKEA 2AHOA 2BBWA 1JB1A 3PV0A 4L4XA 5FTNA 1I7DA 5TY0A 4D41A 6PFKA 3ZE0B 4PTYA 1C50A 1GUBA 2CN1A 2R5WA 4GMFA 4XVRA 3TLGA 5LVAA 2YIVX 1YFJA 2H5LA 1JEAA 4BAGA 2GILA 1QHHA 4DVGA 4LZZA 1M7BA 1B73A 1X1BA 5DNAA 1MC4A 1MRSA 3C5WP 3IVAA 3QITA 4G2NA 1E0JA 6AT1A 3OCZA 5KNDD 3EEQA 4HQFA 1V9CA 4F6RA 4WFIA 2ZBUA 2D7DA 1ZP6A 2A7QA 1CQXA 5IM4A 2PXCA 5T4EA 4Q3BA 3ZHCA 1MXHA 1SOAA 5M7EA 3KJZA 4Y30A 1RM0A 5BV0A 2JLUA 2OCYC 2VJAA 4LYEA 2NSLA 3GF4A 4OHXA 5C8ZA 1W36D 1Q12A 1XU4A 3T6KA 4BYGA 2GUGA 4UBJA 2GPTA 1W75A 2HDHA 1D2RA 3TPCA 4ARVA 4LE2A 3GVPA 1T3TA 2V1XA 5AKEA 1QS0A 1L9XA 1IHDA 1NC3A 1UDBA 2JIPA 3CX3A 1OFUX 3GBSA 4G25A 4I3FA 4WRRA 4N9QA 3A6LA 1F3LA 2BFMA 3F6RA 3HWX1 3I6QA 4G0QA 1A4XA 5FJIA 1NL3A 3AR8A 4F11A 2I4IA 3LPLA 1R64A 4JLDA 3S1SA 4O4LA 1U2RA 2O8DB 2P1ZA 3L7AA 1ESMA 5CM2Z 2AE1A 3M0EA 2OUKA 5H02A 4CMHA 5CFLA 2GRJA 2ZWIA 4I3GA 5AW9A 3H8VA 2VH5R 4NJOA 5C35A 1I36A 5ES3A 1FNMA 3BFVA 3LRXA 5BR8B 4PLZA 3KCQA 2RBEA 4FGSA 4J0QA 5L7YA 5TS3A 2HHAA 2PZGA 4NBSA 4RVSA 4YXFA 4U7DA 1KHHA 3FYCA 4NCXA 2QW0X 4FEGA 1FXUA 1LLDA 1M73E 2CGEA 1ZNYA 4W1SA 3MLBA 3KXPA 5JAOA 5IM4F 2F55A 1L4GA 2A14A 1XVLA 2NAPA 5JMPA 4CKZA 2QHXA 3B60A 4EDHA 4HWPA 3IDSA 3Q98A 1PFUA 2WYWA 4G1FA 3L6RA 4LYGA 3DZFA 2VP2A 4HZGA 5IWCA 2RHMA 3FOCA 5BQFA 4O3FA 3UATA 5JJKA 1R9JA 3EFBA 3QE0A 4OIFA 2XD9A 4RESA 2XGSA 2R8RA 2W2LD 4DCGA 3HBNA 3JQDA 3RCBA 4CMCA 3MWYW 2PS9A 2G5CA 1EZ1A 3T54A 1QP8A 4IIBA 4OQFA 1T5HX 2UAGA 4LF8B 1BWRA 4IDBA 3NH9A 3PGJA 5EWLB 1BRMA 2UYQA 3C43A 3E0XA 4WLOA 1RPAA 3S55A 2WVAA 4O4LF 3U4HA 4D6YA 3SZ3A 3OKAA 4E5NA 4O0LA 2OO3A 1IK6A 3H5VA 4NABA 4QX6A 3UAVA 5K03A 3UMMA 1ZEJA 4AF6A 2FR1A 2CNNA 3AHCA 4RVCA 2M32A 1GUFA 1W85B 3W8NA 5LDHA 1AJEA 1VHTA 3DMHA 2E2WA 3DV0B 3DAOA 1P72A 3O4FA 4N0PA 2XYPA 1OZHA 2ZSDA 5A3VA 2ZJ0A 1E58A 3EPKA 1VKJA 2HIHA 3H3JA 2HQSA 1LEHA 1NR7A 1R6AA 2J6IA 2QUHA 3CT6A 3IOBA 3HKBB 3VZSA 1JKJA 4R5MA 2X2OA 2R66A 1RI2A 2QLNA 3Q7IA 1P1HA 3OZXA 1FZTA 2HJGA 3V32A 3USCS 2B35A 3NWBA 2PRYA 2ZB3A 5LB2A 2GK3A 3ZK9A 3OPNA 4LF5B 1FMFA 2I22A 2V03A 1Z3CA 3NUZA 2GAFA 4JQSA 2FPKA 2WKRA 2GH1A 4R05A 3IC5A 4HYTA 4LK3A 1V11A 2V7XA 2ZEJA 1XTTA 3BIJA 4EI2A 3GVXA 3M6AA 3PCXA 2M6LA 2CMFA 4MVWA 3GLFE 2AG5A 2GN4A 4C4OA 3PVZA 4UJ5A 6YASA 1D6MA 4UMFA 2HBQA 1MA3A 1TUGA 1UDCA 4ARUA 1LLFA 1P2VA 5H59A 3BZBA 3QFSA 3C5VA 2BTOA 4FFLA 4CKWA 2PXXA 3ER6A 4ZVMA 4R1TA 3SYTA 1ZO8A 4DCUA 4E5PA 1DFIA 4B3MB 4FI3C 4JBWA 1LFDB 4MB2A 2NO6A 1Z18A 4ZCTA 4UM9D 4X64B 2FKAA 1VDZA 3HR4A 2O1XA 4FW8A 3MSXA 4P3OA 5D00A 3BL6A 4Z0PA 2DKFA 2EW2A 1PJCA 5C7YA 3BCUA 2F3SA 3ACCA 3WADA 3O0TA 2INGX 1EUDB 3O3CA 1CZLA 1QHYA 5GZ6A 3U48A 4RU1A 3C87A 1CDEA 4XYGA 4RV4A 1KFKB 2BEKA 1E0DA 5B3LA 4XX0B 2POQX 4ZAYA 3IP3A 3H8JA 4KPUB 3EEFA 3OESA 4TLCA 1K2VN 1SVOA 3I0NA 3ADOA 3R7WB 4YCLA 2JEZA 2WMDA 4HEA1 3RYIB 2WY2D 4P9NA 3DFKA 3HP4A 1Y8RB 3P8ZA 4M76B 2HMVA 2DFPA 4IVQA 4INJA 2QQ0A 2A0YA 3EGXB 3BEOA 1CUZA 4B6FA 4BRSA 5DCUA 1C0KA 1XWIA 2I8AA 3TIGA 3X1MA 2P5SA 4YRTA 1Z2PX 5BMOA 7ABPA 4YASA 1SBNE 1SBZA 2C2XA 2VJLA 4M83A 4YP1A 4YTEA 5T57A 1T6ZA 1PFQA 4FFPA 5TQ2A 3VOAA 3N8KA 2J5QA 4OHRA 1FYWA 2VJBA 1XALA 4LV6A 3RTDA 3TPZA 3KV1A 1GM5A 5B12A 1E9CA 1SWVA 5JH7B 3GCWA 4DG9A 1OYOA 2QN6A 4HN2A 3SIWA 2J0VA 1CUAA 3H18A 2YCLA 1FB5A 1Z8HA 4LN1A 1UZNA 1GDTA 1RWBA 2HL6A 3IODA 4RCYA 1G9TA 1CSEE 4ZK2A 2X0DA 2E4WA 3KR2A 9ABPA 3AI1A 5LQDA 1G291 1T9GS 3B8EA 4RKEA 1UAYA 2PD6A 4ACAA 3AFNA 2Q0HA 4Y2XA 1SZPA 1I32A 2VAWA 1T2AA 3WLHA 4DLWA 4GZ5A 2WZBA 1QE0A 3OOEA 4P6VF 3WLJA 4HDCA 1MV5A 5HZMA 1TVEA 3QWFA 5JDIC 1PJRA 4Y67A 1VMAA 1WCV1 4RFSA 1KKUA 1HZZC 5F7OA 1OV6A 1QF6A 3M6IA 4OATA 1AB5A 1P45A 3GAAA 4D4LA 2WKSA 2NSDA 5BMVA 3FCYA 3R0IA 1F8YA 1U0LA 1YZUA 4OD0A 5JY1A 2UZ3A 2EHJA 3PHIA 3VYSB 5IARA 5C8XA 3FB4A 2PUHA 4XDZA 1NTOA 1XPRA 4OHVA 4M54A 4ALJA 4G0ZA 2IIVA 3VQTA 2YZKA 1K68A 1NDHA 1VHWA 2Y0PA 1RWVA 3FSJX 4E7OA 2ZRMA 1SKBA 4V3BA 4CQMB 5JADA 1KPIA 3DOOA 3KT8A 4KIJA 821PA 8ATCA 1RZRD 2WUWE 4R8MA 4DQVA 1N92A 3H1GA 5B4UA 2OHFA 5U1PA 3HA3A 1D7OA 3KIPA 3JATA 3MWKA 3B6ZA 1JT2A 2JFHA 2HJHA 2A6PA 3WSWA 4C6TA 3E53A 5DOZA 3TSWA 5JW6A 3NAQA 1F8XA 1WPQA 4ONEA 1YI1A 4DUGA 2FXVA 4EH1A 1M0EA 5BW8A 1ISJA 4WNCA 1YA6A 5JJIA 3U7QB 2SBTA 2X8BA 3LUBA 4KO3S 7ADHA 1OFUA 1K7CA 1RXUA 3IJPA 2CE7A 2FSHA 4EUEA 2PRIA 4LSWA 3WISA 4C4PA 1MD9A 2MYNA 1PJ4A 4KQCA 4ER0A 1C9YA 1R27A 2Q4DA 3K5WA 2WM3A 3PEVA 1II9A 1P5HA 3KE9A 4QOGA 4BVEA 5HXAA 2JLQA 5LQMA 1RIFA 1P4RA 2YZ2A 3E18A 5BMVF 4LXUA 5SZJA 3NXSA 1LI5A 2BN4A 1W5EA 2ARKA 2YH2A 1G5QA 3CKKA 4KGVA 3DFIA 3CFYA 2PH1A 3LA8A 3P9SA 1ULZA 4FCCA 1LSOA 1KKLA 2JDID 2CBGA 1H0RA 3LVRE 5D6OA 4GYWA 1A8SA 5EMKA 1CPYA 5ADVA 2WDZA 5KYUB 1YT5A 7REQA 1GIAA 1XJWA 3LD9A 4Z2YA 4WCFA 1K88A 2C58A 5CXSA 2NW6A 2C20A 4CR8A 3SVTA 3R0XA 2V5VA 4K6OA 4Q4AA 3DNMA 4J94A 5CG1A 5INTA 1N7GA 2JD1A 4OGWA 3TMKA 4MVJF 3TGWA 3HDQA 3PEWA 1RBMA 1LX6A 1P9LA 1OB2A 4O4HA 4OKSA 3H1BA 1PX0A 2IYYA 5KEIA 2H2GA 1KSJA 3ZS9A 4N0QA 5A2QA 2J9ZB 1NC1A 1U11A 2C0CA 4FD3A 4BFZA 4L7VA 4BE9A 2BE7A 4JA0A 1DZ3A 2VYQA 1K7SN 4UBOA 5CB4A 2JD0A 3RVKA 1QZZA 3UFBA 1KY2A 1U2ZA 3FRIA 4H7DA 2E4VA 4OHPA 4WKNA 4YRPA 1OH8A 3NWPA 3HMKA 3ORRA 2FMHA 3RUFA 2Q1YA 4IL5A 4YC7A 5J5VA 4IJVA 3TIIA 1VMIA 2DJIA 4BUJA 3N8HA 3RUEA 3T5MA 3W6UA 4NYJQ 2VJYA 2QNBA 5JI2E 2EFJA 5TT1A 2R85A 3NHAA 4O1IA 4ZOAA 4XOUA 4AUMA 1Y1PA 1Z06A 2ZJ1A 4L1KA 3ZDQA 1UM8A 4AL4A 2G5TA 1KHTA 1MKYA 2BRUA 2RHGB 4EG1A 2CC2A 2Z6QA 2Y92A 2P2LA 2NU6B 4Y9UA 5SYNA 4Q1VA 3SX0A 1CJUC 1JG7A 4O2AA 5DBGA 4BQOA 4UEKA 3SJCA 3HB5X 4KQ1A 4D3SA 4E3WA 1KBQA 3MUNA 2B83A 3DBLA 1GRVA 3QKRA 4L4UA 3R7AA 3CCBA 1YCFA 1W8DA 3NJ4A 3OJWA 3UENA 3WNDA 5DGHA 5LP6B 4V1CA 1ZVVA 1ZN2A 4ZO7A 2GBIA 2OZEA 4QTUB 1ULUA 1KI7A 4O4HF 5E7MA 5JC8A 3MJEA 1G18A 1CY6A 4OV6B 1KI1A 3PUHA 4QU8A 2UYYA 1WXWA 1SUPA 4UARA 4CMKA 1JG2A 3BJRA 1YB1A 3IUEA 3GWGA 1RLTA 4TS1A 2JFYA 5CB4F 1PDVA 2XE8A 4XKJA 2R86A 1QDLB 4KGDA 2NYRA 2WHPB 3CX4A 4XWWA 3P1JA 3NDBB 2AH5A 2JGEA 2YDXA 3PX2A 3O3MB 1WLYA 3Q2IA 5DNWA 4A91A 2C7OA 2JCBA 2EP7A 1DJLA 3OZAA 4AQ7A 3AIKA 1QYWA 3BHJA 4BV2A 1MJHA 4FYJA 4DNOA 5IXJA 3QE3A 2EX1A 3G9UA 2PL9A 2BHRA 4UM8B 1W29A 4CU5A 1HFWA 3OA0A 1UFRA 1O3YA 1GG5A 1Z16A 1MH9A 2X0JA 1JEEA 3K9NA 4O2AF 1U65A 4IXNA 3GP8A 3B89A 2F1HA 2F43A 2QJWA 2JBAB 2WOOA 4X0EA 1EA5A 2NT3A 2LNDA 3FPJA 1U8CB 2WF6A 3OJFA 5LMZA 2I54A 3KKNA 3NXKA 5SY6A 1PTJA 4N0EA 4O4JF 2PBRA 1JDZA 4DLAA 5FNVB 1QG6A 4OI1A 1YQTA 4YJGA 3ZVNA 1ZOLA 2V3WA 2V8BA 4GGOA 4MWZA 1BDJA 2YX1A 3JQRA 3ZWCA 3PUZA 5JFTA 4L74A 1H3NA 1SIUA 3KFLA 1EI9A 3KLNA 1RJWA 4KUHA 5FL3A 2JHAA 3MB5A 2YW9A 1FOEB 1Z13A 3U4DA 5BURA 5KOJB 1ESNA 2CBXA 2YV1A 3NO4A 5EPEA 4DJDC 5I9SA 5AVTA 2H9AA 4NCBA 4EJMA 3PNKA 3WGOA 2A0KA 5BN1A 3IEVA 4C4AA 4Y2PA 1P9NA 3JRWA 4BY9E 4J0KA 3AVOA 2FN4A 3JD4A 2QD2A 4GOOD 3UJBA 1G3MA 5EZYB 3IHTA 1T8SA 1JHQA 5JT1A 5TSDA 3GRUA 5K3SA 2PCJA 1Y4AE 3M5DA 1NBMA 2ZCJA 3OICA 4IW3B 4ME6A 2C2BA 4JQYA 4GKVA 4MUNA 1K5PA 3EIUA 1Y63A 3L8EA 1CX9B 1RABA 2X5XA 1ZESA 3SF0A 5JCZA 1DQRA 2ZWMA 1IDN1 3GJRA 4FKBA 1TB4A 3OIWA 4OI4A 1FDWA 2Y1GA 3B5JA 2VWQA 1CIVA 3A2LA 4I50B 1FXSA 1FW6A 1SXPA 2H1FA 1Q19A 2NSHA 3IHKA 4MPDA 3R6WA 3DVAB 3UXYA 4C7VA 2OK7A 5G0WA 3OETA 1R0RE 4KQ9A 5FRDA 4OHYA 1JDBC 3ESQA 3T7RA 2PSFA 4HAOA 2WPDD 4UZEA 3TBFA 1FDRA 4DHWA 1Y3HA 5L7TA 1TAUA 1WDLA 1ZS9A 3W90A 2ZIAA 2Z5FA 4JUAA 3ZLVA 4BP9A 2FPIA 4Q9JA 2IYSA 2X2EA 1II8A 4OSPA 3W4KA 4FQ7A 3ZVKA 2IVZA 4UDXX 3ZX4A 3ZJUA 1FRQA 1O6CA 1YVDA 1SCUA 2G1PA 2VQSA 2H59A 2ADOA 3G49A 4H31A 4N7RA 3A1FA 3AL0C 1D4OA 2NVOA 5DNEA 3WAJA 4NFLA 1GO2A 2XT6A 2MOKA 3D64A 1P2UA 5LA6B 3H8SA 2AEFA 3LHKA 2IIPA 5IMSA 2C7GA 2WTUA 1CVLA 2AXPA 1W88B 1V9SA 4YP9A 2IV2X 2CXRA 2C2WA 2PKCA 3N2NA 4GPAA 3GGOA 3W0LB 5F33A 2ZIXA 2X86A 3G2IA 2XMBA 4FUTA 2REXB 1EGMB 1KAQA 1NW5A 2NO7A 2QI9F 2XOKA 3DB2A 1AMUA 2ZE5A 4BN0A 5DHAA 4RQUA 1OQAA 2QL5A 2UZIR 5CFMA 2R2GA 1O6ZA 3A3NA 4EZBA 3FGPA 2H85A 2CCKA 4QYIB 3ZU4A 1JL3A 1QH1A 1OFGA 2IITA 2OSVA 4AKSA 2JLRA 2W11A 1Q1EA 2XTAA 1OTXA 4FFWA 1EIWA 1VA5A 1HYBA 2A5LA 2JS7A 4FYWA 4M99A 2Q1SA 1UPCA 4OH7A 3CLKA 4NBLA 3P9IA 1GTVA 2QD3A 2W6PA 4GI7A 4AUNA 3GOHA 4J1TA 4KXFB 4OEHA 4W8GA 4AO6A 2IZ7A 3FZYA 1KL7A 3C3MA 2YJZA 1FYXA 2J3DA 3WB9A 2JLCA 1PNVA 1DTWB 3FUWA 2J0UA 4XWAA 5FFMA 1T9BA 1SQ6A 1P9RA 1FTQA 5AW6A 1TYEB 1FRZA 4FCVA 5DXFA 4D9EA 3PB3A 3RBAA 4JOBA 3ZIDA 3F0TA 4S1NA 1X74A 2X8WA 3PZRA 2JFXA 4IH4A 3A05A 2WILA 3PNPA 4C7JA 4OQXA 9GPBA 4J2OA 1PL0A 2HDWA 5JNUA 1ZKMA 5A7HA 4I1SA 3W2FA 2CUNA 2DUMA 4E14A 4HSEA 3KCNA 2VDKB 2HCBA 1PN3A 4D4JA 3IBFA 4LX0A 4CF7A 2GZRA 3TNYA 3RC3A 3FUCA 4WJLA 2ZE8A 2IX9A 4U63A 4DLVA 1M5UA 4BZZA 1G0OA 2D5LA 3HP1A 1DBWA 1N2CB 1F9AA 2C7RA 2ZBDA 1G2QA 4JDUA 4Q00A 3AU9A 4HB3A 3AP2A 2Q4TA 4BX2A 5LUAA 2O5RA 5H9VA 5CFPA 3RGWS 2VO1A 1Q17A 3MOSA 3NHMA 3LRPA 3DL0A 1GNTA 3HH8A 4JI7B 2Z2KA 5KOHB 1XYYA 3KOUA 1YDFA 2EBHX 2GI4A 1EDBA 4AS2A 1DPGA 5ILGA 3G5TA 4U02A 3WRVA 4CKEB 1AF4A 3AHHA 4Z9BA 3D8UA 5KAPA 1A9XA 2OXCA 1NMSA 1V2GA 1NVMB 3BULA 4FGKA 5EIEA 3WL4A 4LBYA 5FT9A 3TLGB 3BS4A 3W5CA 3IULA 3B3GA 3IT0A 5FLEX 2ZUDA 5A0TA 1QHHB 2FQ1A 2H48A 1YR2A 3OM8A 3ZWMA 1XMPA 5HF5A 1MOQA 2C42A 3SHQA 2A58A 3GRPA 1PJ3A 1RRKA 5T3YA 4F6RB 3G0IA 1PT9A 2WU4A 5KVCA 5JNRA 3KUDA 3UHPA 5ABPA 4CL8A 1XHLA 2GEJA 4JU9A 3CE6A 3RVOA 1O0BA 5LZ5A 5CJPA 2OQ2A 4IMRA 2ZDGA 2RGDA 3DUFA 2PSSA 2G63A 1PJTA 2YFHA 2PJDA 3DVRX 2VNJA 3EWIA 3KNZA 5AIAA 1E20A 2PT7A 2W37A 1LC3A 4HRYA 2RGAA 4LA4A 4OAOA 4Y1FA 5C2JB 2NAFA 1XCBA 3O95A 5ARDA 5H1YA 4DQLA 3AJDA 1KK2A 2IA5A 4DRXA 5BORA 4ZQBA 2W6CX 2ZJ5A 4F3TA 1BQ4A 1QS0B 1WDWB 2EX4A 4UM5A 5JV5A 3IKTA 4MDEA 4QVKA 1BGXT 2Z04A 3H7AA 5H82A 4H3HB 3O4VA 5E3IA 2I7XA 2OV4A 3IAEA 3N2KA 1TK2A 3L04A 3PKZA 4HDKA 4W5NA 3VMMA 1RACA 2B82A 3F5DA 5JQWA 2KBEA 3RF7A 4F86A 1YDWA 4M38A 4ZT6A 1DIHA 1K3UB 1RYBA 2XMZA 5LQRA 2G9QA 1RP7A 4R8RA 2PT6A 2WYHA 2OC9A 4HWRA 5IAJA 4DTCA 4WY8A 4B3SB 2D00A 3BGOS 3HYLA 2Z2IA 1VPVA 1YMQA 5E4YA 3S28A 2RD2A 1XQ6A 2XUPA 3QM1A 2AMJA 2A59A 2V8OA 5MN6A 2W6OA 1NI3A 1XAJA 1X38A 3F98A 1PZXA 4TS3A 4BO9A 4BO1A 1G2PA 1ZHFA 1SPBS 5KIAA 4GL2A 2M6KA 3JZMA 2RGNC 4EGSA 4MZDA 2QAGB 3GFRA 2BFNA 3A4VA 1XWWA 2Y0BA 5AXAA 1QTQA 1Z2NX 3NBUA 3UKOA 4IV5A 3OY2A 3BCRA 4G4SP 2I78A 2H7CA 3HWRA 3I92A 2W00A 3OKPA 3FRJA 5E6RA 5FBRB 2J6BA 5BSFA 2BJWA 5CEEA 2Q3FA 2D1SA 3OUZA 1P31A 4OUDA 4NPHA 1R0BA 4KJZA 4D9JA 3VR5H 1DQYA 1U0NA 2JHFA 2G40A 3PYLA 4FZRA 4RZSA 4Y0NA 9LDTA 1N78A 4OO3A 1P2TA 4A8HA 2BM1A 5E9AA 1Z29A 3UXEA 1YI8A 1QK5A 2X6RA 5FD8A 2ZKLA 5IT5A 1XUOA 1MQ9A 5AHWA 1D03A 3B8HA 3KZNA 1U81A 1H6CA 2PSJA 4BPRA 2W6NA 4KDEA 1QHGA 1YKFA 3PXGA 2XH8A 2K5UA 2EL9A 1V7CA 4FYPA 3LCMA 1BTOA 4TRJA 4MRPA 3IDZA 4WMLA 4F56A 1S5PA 4FC7A 4TT3D 5CNJA 1LCIA 4QAJA 2Y1CA 3FPFA 2R8OA 2AJCA 3OF3A 1FRNA 1JKJB 2PH7A 3P9YA 4WK4B 5IEBA 5IJXA 2X7XA 2YNMA 2QGNA 2H7XA 2QTMA 3U9TA 3DDUA 1UJ6A 1G42A 1RYHA 3QEKA 4QATA 5LBUA 3FOWA 1S2GA 4YDRA 1DBRA 5ALFA 3ZCUA 1EM8A 1N6HA 3SQOA 3CNOA 1HDEA 1AKUA 1DBQA 1TFRA 3F47A 3S44A 4PQYA 1BOFA 2VKQA 3TM4A 1J5PA 4F3KA 5LJLA 1V11B 1YSCA 4A0QA 4DFDA 1V35A 2PJUA 2DETA 1AM4D 2OV2A 3HXTA 1Z68A 5DXAA 1N2CE 5IT9A 4XZ3A 4Z54A 4RJTA 2YWCA 3TRFA 1HK7A 5TVGA 1ONOA 1X7YA 2XRYA 3L49A 3PF9A 4PU0A 4Q9NA 3V8EA 4YRAA 1YCDA 2WHRA 2Q0XA 2PFSA 3HSYA 4M98A 1X2EA 1JQ5A 3MG9A 4QPCA 4PC7A 1U7HA 3DG9A 1ESCA 4MV0A 1PYGA 2B1QA 1U0RA 1EGAA 2RH9B 2B99A 3OLCX 3SX2A 4CKWB 3W5DA 2P2ZA 1NFRA 2XB4A 2VS1A 2PKQP 2WUGA 1KTIA 4XSVA 1R1DA 3WICA 2BGLA 4M46A 1VBFA 3VVBA 4HR7A 1V39A 4CTMA 5DP1A 3KLBA 1MVNA 3T9EA 4D6XA 2R47A 1XTJA 2GD6A 1K8YB 2GMWA 4ZZIA 5I7SA 3V9AA 2DBRA 4MPPA 5DE3A 1KEWA 4KQEA 2CFSA 2VXOA 4FT2A 3ANTA 4R8KA 2FDRA 1G60A 1R8XA 3BDAA 3RYFA 1O03A 3TQSA 2RGCA 3HJFA 3CA8A 2CXTA 3WMGA 5JIBA 1TU0A 4PLVA 2F17A 1C2YA 3H16A 1IY2A 2C8LA 3HXLA 2GLXA 2ZI5A 3L06A 3P52A 3RTGA 3ZJYA 2GPWA 4Q9KA 4HFMA 4DIBA 4YVFA 5KINB 1E2GA 5HA5A 3B1WA 1VJ1A 2WHXA 3H1FA 2VLBA 3TL3A 2XXJA 3FIJA 5BYBA 3U5TA 1H4QA 4N3CA 4BMYA 5JJCA 1ECLA 2IC5A 3DM5A 5FWDA 3WYNA 2JF0A 3GIDA 4B7XA 3UYLA 3HI6A 4NYMR 1RJFA 3LUAA 4UBMA 1JLMA 1Z83A 3KYIB 2Z8YM 3QUBA 5AJVB 4B45A 3GVHA 3SC2A 3WHLA 1HE2A 1XGKA 1W87A 2HHLA 2Q5QA 2Z8XA 5TQ2B 4UCFA 3WGYA 3VKHA 3L7NA 3PFNA 3H2HA 2V7PA 4MYRA 4R2KA 2OCBA 1V1JA 5DM1A 2FR8C 4YFYA 1UJBA 2FF7A 2QXUA 3F5QA 1I01A 2NU7A 3BBLA 1PUJA 1IXRC 1WB6A 3DZHA 3NRCA 4NDAA 4Z7OB 2C77A 2PX0A 2QRGA 3DZJA 5J43A 1U5AA 4US2R 2BKVA 1YS4A 4BMZA 2Y0CA 3GBVA 4QULA 3OZDA 3O90A 3CG0A 4MHTA 5GADl 3FVRA 4NDNE 5C8YA 1DINA 4YRIA 5BV8A 1L5SA 2BZGA 3PE3A 4LJ6A 4B81A 4ENUA 5F3WB 5BOVA 3GFQA 4ZVQA 3U1VA 4HSGA 2Q45A 2P2GA 3RS2A 2JCXA 2UUPA 2ZBEA 4XRRA 3IUSA 4RYLA 4X71A 3T1VA 4MRRA 3M2TA 1TU3A 4Y6SA 3BSFA 3I0MA 4EA7A 4RFSB 3A25A 4PYJA 1DO2A 4DZZA 1F4VA 4OFXA 4ZCPA 3D7RA 1QFZA 3L8HA 1WKVA 3OWXA 5IP5A 1COWA 5BMVB 5JAMA 4F60A 1LS1A 3CKMA 4TZKA 1J21A 2XF8A 5LD2C 1DWPA 1JAXA 3F49S 1ZH8A 4H3VA 1I3LA 2B5VA 3DT8A 3EGDA 4D79A 5COBA 3BEDA 3DEHA 5JS6A 2Z09A 4WA8A 4R1OA 1N1DA 2EV9A 3M4JA 2YVAA 1ODSA 2KMLA 4BMNA 4Q05A 2XHZA 1NI5A 3PVCA 2X1VA 5SY4A 2JEOA 5GV8A 2IPLA 2ST1A 2OYCA 1BZYA 4NZPA 2ZRQA 3RASA 2IE8A 3N6RA 1MW8X 1BHSA 3LOQA 2D5BA 4IEEA 4BVKA 3D02A 2PKEA 3A11A 3JATB 3MRXA 3OZIA 2JFVA 4N5IX 4UHBA 1RBZA 4RFVA 1NSFA 2JEYA 4P2BA 4C6TB 3WGIA 4LJKA 4CNQA 3IQHX 1S1CA 1K7YA 2M2IA 4BQSA 3ERCA 3QRWA 5FTWA 3NATA 3P97A 3I6MA 1RZRA 3PKJA 7MDHA 3B7PA 4FVTA 3WWYA 1ZQ9A 2PZBA 4HQKA 3DPIA 4X1OA 5J40A 2QU8A 3WNZA 5B64A 3VO2A 3ZD7A 1XA3A 1N5LA 1V3TA 1A71A 1HC7A 1IBCA 4ZT4A 1RC8A 3DW1X 3MTDA 1XCJA 4JUBA 1KPHA 1FA9A 5U4XA 3HJTA 4OLJA 1VI5A 1Y5LA 1CKEA 4E51A 1IUNA 5JAUA 3LHFA 4AG6A 3HUDA 1OWPA 3CF4A 4BIMA 1U6IA 1SXHA 1AURA 1ESEA 1YQDA 4LYAA 3BMOA 3JQ8A 4B3FX 1VL0A 3UV3A 4YP7A 1HORA 3HU3A 1N25A 1OLUA 4UFOA 2VAMA 4U0KA 1CR1A 3FLMA 5JAHA 3NGMA 2C8KA 4GZ3A 4LYHA 5IUJC 3A9CA 2QRQA 2QDXA 4KQIA 3AW8A 5CYOA 1ZJ4A 4Q4AB 4WACA 1Q84A 4QUEA 2P3OA 1YRAA 1SC3A 4BO5A 5CEJA 3RAFC 3WS7A 4O4HB 1FLAA 3A3PA 4UM7A 4CLOA 3VSEA 1AS2A 3E3OA 1AE1A 4GQAA 3DGEC 4BJ3A 1SC9A 2ERYA 4RD3A 3VR6H 4EMSA 4ZEMA 4MDFA 1NW4A 2H2FA 5CB4B 2HM7A 1RPZA 2A8YA 2VK8A 2VDMB 1RADA 1X8KA 2GN6A 3IQZA 1CRWG 2GZ2A 2GZSA 4II2A 2GZMA 4DL9A 2PJRA 2OT3B 3WYFA 2O2EA 1Y5IA 3OMLA 4HWKA 4LXGA 4Z0TA 2I66A 2VOJA 2CXHA 4UAUA 2J67A 4DQ0A 5H80A 3ZHQA 4BASA 2BR4A 2DUNA 1RQLA 1E9VA 4ID3A 4MW2A 3RFFA 4FOSA 2ZRIA 2XUDA 1M2HA 4Z3DA 3S27A 3TLXA 2BGJA 1A27A 2JLWA 3V1TC 4G26A 4E7PA 2G07A 4I9FA 4TWZA 3JVUA 4XJTA 4IGKA 4PZCA 3R09A 4IIXA 3FF4A 4O2AB 3FSGA 4GLOA 4U2EA 4DWJA 1MO2A 2SKCA 4MCJA 5IG2A 1LFAA 3DCIA 5K5EA 4DCMA 5LBTA 1TYDE 1OZFA 1C3LA 1DC3A 2FPWA 4JJIA 4JD5A 3F6EX 4KDRA 2PQ2A 2QYHA 4R31A 3DBLB 3QKRB 1C30A 1P2FA 5EOVA 4G24A 3E22A 4LI3X 4RQTA 3RDPA 4H1TA 1RWKA 2Q3MA 5BNFA 4V1CB 3C4JA 4IY1A 1VL8A 1CLEA 4UD6A 5E7IA 4COOA 4D4KA 2IDJA 3KT0A 3HCDA 2OBNA 4UHKA 7YASA 1OUMA 3T61A 5A4IS 1XJ5A 3HY3A 5AJXA 3H1AA 4GEKA 1KRHA 3DDNA 4DWVA 2GF9A 1QG4A 1N6PA 1WZNA 3FTNA 3H17A 3VDXA 4A82A 5AESA 4LZJA 2QUZA 1KRXA 1X7WA 2I3DA 1NVWQ 1ZVQA 1Y4SA 5CGQB 3PC6A 2ORIA 1IATA 3CINA 4KIGA 1CIPA 2P2DA 5F7JA 1Z0ZA 3I4LA 3WO0A 3EDRA 1MT0A 2X9GA 3OZ7A 5BN4A 1P0FA 2H0QA 1FFEA 2ZJ7A 3CNNA 2QPAA 4S3MA 1IMJA 2JAXA 1JHAA 3MOGA 2JLAA 4NU6A 2P9EA 3N2GA 4OHBA 3UWSA 2VUTA 1Z4IA 1H0SA 3CRMA 3SU8A 2Q9BA 2HC9A 1E2UA 4BKPA 1PFKA 5CA1A 2Z5GA 2Q9CA 2F43B 4RPCA 5CURA 4HNTA 1UQRA 2GNOA 3T4UA 2P69A 3A6HA 2IYVA 4ID9A 4JUFA 4W5WA 2BTQA 2WNIA 4MGKR 3OEWA 1C7IA 3TTSA 3L7BA 3CJTA 2OBLA 4F91B 1IXKA 4M0PA 4NBRA 4O2LA 1UBTS 3ZXXA 4WZ6A 3LP8A 4UFNA 5GVRA 2RGRA 4YJGB 3P9ZA 4YI5A 2QF7A 1YZTA 2CDBA 2NSYA 2FSVC 3D9QX 3FYHA 4KR7A 4ISCA 1UK9A 1EDDA 4HG2A 5FUQA 3CB4A 1LLUA 1YB4A 3OCWA 4FSHA 5HF6A 1J5XA 5K51A 4COKA 1L5QA 1B8VA 4ZQFA 4AMYA 5LQUA 1IBKB 1U0HC 4I19A 4M7PA 1RRGA 3AOGA 4EFDA 2O1WA 5GMOA 1RDFA 4BNFA 1W52X 3PUJA 5HX7A 1LH0A 1KAGA 4NCJA 2QJRA 4H2DA 3KSBC 4AP6A 2K7FA 1UPTA 1AA9A 3FTDA 3AUSA 4J9VA 5BSRA 3OQBA 4RK6A 1YRYE 2FWNA 2IPNA 4KBFA 3O84A 2EFGA 4INOA 2AOVA 3VHRA 2DKNA 1KETA 1WW8A 2JGKA 4KI0A 1MTOA 4YT2A 3CR7A 1HBJA 2LGJA 3IMEA 4ZCSA 3OT4A 4CLRA 5JZSA 4WEQA 4YUWA 1BDIA 3H75A 4TZTA 2O3UA 2JW5A 3VZDA 1G20A 2DPXA 2R2AA 4FLMA 2X2FA 3NNSA 2B4TO 4RVFA 1TDJA 2WTMA 4UDYX 2WUVA 2J09A 3A6EA 4S2EA 3DWIA 4ALIA 2Q5HA 4YMWA 5BW4A 3HDTA 1Y3FE 4ZZ3A 1NW9B 1Y8CA 5JWHA 3WBJA 2R8XA 1H93A 1Y1LA 1TYCA 1Y1SA 3O2NA 4OYHA 4RJLA 3V1MA 3QVKA 3V4VB 4WXEA 3BOSA 2FPIB 1TMGE 2YFQA 1II8B 3NGLA 1NVXQ 4JEHA 1SAYA 1TZJA 5CUQA 3LQYA 4HNVA 5LIPA 4JC8A 2ACVA 1KQFA 1WSBA 4GF5A 4CZ2A 5I8PA 5AICA 1II0A 1AHHA 2JGFA 1OBHA 1ZIDA 2RHTA 2OAEA 1BS9A 2WG0A 3AF0A 3EMKA 1E63A 3GRZA 2CMGA 4R16A 4JLOA 1IXZA 1VRVA 1YV9A 3ROTA 3WNVA 2ZIXB 4J07A 4H1WA 3K71B 4DMLA 2XAUA 4LE0A 2ADFA 1RC1A 1FUKA 2F64A 3DZCA 3C97A 5ECGC 4F2PA 1OYWA 3RUIA 3ME5A 4ND4A 3ET4A 4W7SA 3L4JA 4C2UA 1P2DA 3W9BA 1Q0PA 2QUKA 1QH1B 1Z8FA 4ZDKA 1K0FA 3OIUA 3NASA 1Y7IA 1HQKA 3Q41A 1T0PA 4PLFA 1CS0B 3ID6C 3EW7A 4C0WA 2XMDA 3L4BC 4J0GA 2A5FA 3AY0A 5ALVA 1NN1A 1XLTA 2HLPA 2OAP1 1EQUA 2GPSA 1K98A 1R50A 3M3HA 4WL0A 3QMMA 1JFFA 1OLOA 1CHNA 2R1TA 4GFDA 3EZ6A 3OIDA 2Z4SA 4GNRA 5KPDA 1GL9B 1NBOA 3COPA 2CMKA 4MROA 5C51B 3VU3A 3AWDA 2J0UB 1RJ9B 5DYTA 1QKKA 5LLSA 2O7RA 2JI4A 1GRCA 1RRPA 2AFVA 2HXSA 2ZVDA 5KYYA 1JQ3A 2O0HA 2X5NA 1I6WA 3K9QO 4HI0E 2GAJA 4B2IA 2BEVB 5BSVA 1XRLA 5H16A 5JDCC 1E89A 3KU4A 1XFAA 1HE3A 4PSVA 3UJ9A 1P4HA 2APJA 3V6LA 3HK2A 4KEAA 4U6NA 1PWYE 4H3KB 3RT7A 3EVDA 4GH5A 2C1ZA 4JLAA 1EM6A 4NBTA 4CN9A 5ITSA 1VYVA 4D4HA 1Q16A 1E0SA 2H7YA 3D5QA 3K1TA 4WESA 4C6HA 5LQAA 1LTKA 3G0BA 1N7HA 1VMKA 2ZR7A 3PK0A 1RI5A 3QVUA 5NULA 1I3NA 3IB3A 4C7OA 1O94A 1LSJA 1N3LA 2FI1A 4UUOA 2W2TA 1T0BA 4HDNB 1E3QA 3OPYA 4RPIA 5CYFA 4DIMA 3RWOA 1SQGA 4IWXA 2BONA 1VGRA 1JBKA 4JSTA 1VCNA 1EFKA 2QM0A 2XECA 4A2QA 3S8YA 5DW3A 3PWTA 2Q46A 4PZEA 1P60A 2REBA 3KV3O 5LBIA 3SEQA 2VZ9A 2QLLA 1GOTA 1EK0A 3I9KA 4JJAA 1NBHA 1L7NA 4ZICA 1E3TA 1RZVA 3TI9A 3MWFA 5E3JA 4MLDA 1I94B 1A9XB 2AOTA 5DNYB 2C96A 1KC3A 4BZQA 4HL6A 4LNUA 2NU9A 5HS6A 1P44A 4MB0A 1FFCA 5EE9A 5DW0A 5LQSA 4WOKA 2XTNA 5K0ZA 4J2TA 3AM1A 3FHTA 4K1LA 1IHUA 4JGGA 4U7FA 1GAQA 1R6XA 2WYOA 1DU4A 2C97A 1SXGA 2MU1A 1U2TA 2CEAA 2RAUA 4OL9A 4JR1A 2CHQA 4J1SA 4M7RA 3AEZA 3N7AA 1KS2A 1GG8A 4RMHA 4G3XA 1N7IA 3IBTA 3Q9SA 4LY3A 2KPOA 1XRRA 1GJRA 2CVFA 3DUFB 1YA8A 2I7CA 3QKTA 1NBME 4L27A 3NS7A 4KXXA 3S3TA 4BQRA 3CRNA 1UFOA 4F92B 3OJ0A 4I08A 4EKNB 1LSSA 3TCXB 2PL5A 1WVIA 3FAKA 4PGAA 1F2TB 4INAA 4K6GA 3CUTA 1L2TA 2XNSA 3N53A 3WLAA 4AX8A 4DRXB 4YACA 4CT4B 5JYDA 2JLZA 4TMTA 3IT1A 2G72A 5ULLA 2FJPA 2VP0A 5IDXA 5KU7A 1D7AA 1WXFA 4B71A 1VLVA 1X7XB 2EKPA 2P9YA 3JQ6A 3N2KB 4BQEA 5LLTA 4HDKB 2X9QA 3W34A 3D2LA 3I01M 3RV4A 1TD1A 3WKEA 4PBRA 1NF3A 3PQ3A 4H1HA 2VXBA 3IH5A 4TRRA 1EZ4A 2CFTA 3G1TA 2ROQA 2HMTA 3HZRA 5FPYA 4A92A 4EELA 4QT4A 4KR2A 3KOZA 3Q6MA 4FFDA 4LYDA 4M0CA 4XEHA 3T7EA 3ZCXA 4HVLA 3F46A 3GRCA 2D1FA 3EQ6A 3SR0A 3OUTA 2XUOA 1XAGA 3GWZA 3UT6A 3DBVO 5C52B 1NE7A 1QK4A 2D0PB 2R751 5CIQA 3EVTA 3OLYA 4E70A 4ESEA 1M1XB 5CVUA 2GUWA 3S68A 4B4VA 2FWRA 1F0NA 1FX0A 4HGPA 1T0JB 3UHFA 1VIVA 1D4ZA 1XRNA 2JJMA 3HCPA 4HJRA 5TQVA 3STVA 4BFVA 1F8GA 4I14A 4BGVA 3MT7A 3VKGA 2FUNB 2F3TA 1YCGA 1VJTA 2WV9A 3H6KA 3AERA 1GFSA 2PWZA 1U1EA 4G89A 4B0PA 1M0TA 3N28A 3P9QA 5EHGA 2OPHA 4B84A 2WB4A 3PNYA 4LW8A 2QA5A 1UCFA 3K92A 4JJ4A 4JP3A 4M2LA 4ZQIA 2FK8A 1NNSA 2A9VA 5IS2A 3IEXA 4CM1A 2Y3IA 1W0CA 1WTAA 4MW5A 4Y2VA 1OSNA 2H06A 5E6RB 4URVR 4EUSA 3D5EA 5C1IA 2BFEA 2RGUA 2VUSA 3A26A 3MRSA 3V3KA 4OUDB 3DZGA 2IBMA 4DSOA 2W7TA 1W19A 4NVRA 1SOWA 2YXLA 3U4IA 4HNQA 1Y3DE 3LFTA 4KLNA 2HPHA 4IDGA 4N82A 2PL3A 5LP6C 1OXTA 2AJTA 1OROA 3RANA 1XK6A 1C0PA 1OX6A 1SC4A 1Z5OA 2Z58A 3A37A 5AJTA 2BCGY 2LW7A 3ZZMA 4KVAA 1PLJA 1ZM4A 1I1HA 3DZ8A 3ESZA 4JCOA 1FSPA 2OYRA 5FHQA 1MHPA 4CDRA 5HTOA 4NEGA 3JU3A 2DWQA 1U2SA 4U7PB 3TBKA 3R2JA 3KKEA 2C3OA 5THKA 1DAOA 2I4MA 4UEJA 5G4KA 4HZIA 5CLJA 2PUAA 3ZNOA 3WYGA 5B7PA 4QO8A 5LM3A 5ADWA 1H8EA 5KOYA 4DR6B 3FXAA 4L0MA 3FHOA 1EXMA 2JI6A 2W2NA 3G9TA 4M1EA 5LP1A 4BB5A 1PHRA 2R6DA 4IF6A 2Q29A 1H94A 4M86A 4QGHA 3ZW7A 2AEEA 4B74A 4MYTA 1EM8B 1HLPA 4L02A 4O2BA 1BVYF 1Q44A 3DAPA 3HNPA 4LZOA 4WX2B 1WXXA 2GD1O 5EKUA 2C03A 3FYSA 2ZUCA 3U9SA 2XYVA 4HDSA 2JAQA 4C22A 4B4DA 2A1IA 1GEGA 3OMWA 4L6CA 1BXRA 4LRXA 1KK0A 4M1WA 1C14A 4LRUA 3I3SR 5A05A 4OB6A 1JR3D 5CM8B 1GZDA 4H18A 3VC2A 3EASA 4OJQA 1DBIA 2AMVA 2GPBA 5DLQC 1KERA 2UYGA 3L0DA 3M8KA 4RQBA 2ZYWX 3ZHSA 1BVUA 1TIPA 4XPIA 2BPOA 2J45A 2VDNB 4XLZA 3VO8A 1E60A 1A97A 5JANA 2EFDB 3I04A 4M9RA 1CZNA 1Q95A 3DHNA 3LPCA 4DLYA 2P40A 4KXQA 2JGLA 1B1AA 3OJEA 4JOSA 4GLBA 3ZVRA 5A3JA 3WIDA 1D0VA 3K31A 3G79A 1NXOA 4G8DA 4IOLA 3WVNA 3WB2A 2V7BA 1CR2A 3DXZA 3C39A 3ONDA 3G5AA 1EP9A 2CDRA 2H1WA 5PNTA 1OH5A 3X3HA 3ZH9B 4CG1A 3IA7A 3OSUA 3RYFB 4MICA 2Y1LA 4KTVE 5LIRA 1ADJA 1RHKA 4N9WA 3ADPA 4FXPA 4L8WB 4NI5A 2HEIA 3FLBA 4O2BF 2GETA 3U4CA 4E2WA 4W5QA 1HL3A 3HPRA 1FE8A 2I6FA 2R7KA 2X9VA 3BA1A 4IEIA 5G3ZA 3SS7X 1PQUA 3N5KA 2DX7A 1TJPB 3BRQA 3LY7A 3Q9UA 5J5CA 4D9KA 4JAVC 1GLGA 3HM9A 4KKXB 2DWPA 4AN0A 4IILA 1KQ3A 2X3UA 4R2LA 1C7FA 4Q5IA 2J85A 2WIKA 3V1YA 3JR7A 4P86A 1GPWB 4NU5A 3TE7A 3SC2B 1WUJS 2V65A 3Q15C 1I1OA 2VCYA 4NBKA 5EMNA 2JB9A 5IDQA 2W42A 1IC6A 3G0GA 2OD2A 1AKRA 3GB9A 3VYVA 3OE7D 4TLDA 1VB5A 4F7DA 2HMWA 3FZNA 3OFND 4B5LA 3HV2A 2PAAA 3CZQA 1M10A 1RXYA 3PD7A 4QTYA 3OTIA 4I9HA 3KR9A 2PFGA 2NU7B 1BROA 1E96A 2XQVA 1O6FA 3P2OA 4L57A 5CX4A 2G67A 2XQIA 2O5CA 4EAAA 4K6KA 2PNJA 5CAEB 4KWIA 3ZIAD 1QU2A 2JAWA 3SPXA 5C8YB 1RXVA 1K75A 4RYDA 3HJRA 1YMUA 3ETNA 1IVSA 1NVFA 1FYEA 4D3YA 3KPJA 1GR1A 2DFTA 4D9CA 4UVDA 2YVUA 2BDUA 2ZRNA 2ZS9A 3AJEA 4LSZA 2GEFA 4MHOA 5BQPA 4BGUA 1W4ZA 3PJRA 3IQXA 1Z5WA 3HM2A 3GPBA 1BE0A 2WT9A 3LGXA 5CJJA 1H1LA 1TMOA 5FOTA 5EJ9A 4YCJA 3X1JA 3AEQA 4DPLA 2QRUA 2AVDA 2AXNA 4Q24A 1QOQB 3ZW9A 5I9LA 5LPNA 3MRTA 1NLZA 3T8YA 3MAJA 1WDMA 2TSYB 3SXUA 1SH7A 3MA0A 4RGVA 3HJAA 3RRFA 1C3JA 1UXGA 3O3OB 2QXTA 1P2GA 2BWJA 3MTJA 3WK9A 3EQ9A 3WWEA 1GN9A 3EGDB 4YGYA 1CE8A 2RGXA 3RI3A 5HQTA 3BE6A 1AQNA 1LRLA 1TM3E 3CSUA 2V6FA 5DGXA 5F1OA 5CCXA 3H5RA 3UKDA 2NZJA 1MDBA 2TS1A 2Q3JA 4ZZ2A 3TR0A 4GR4A 2VP6A 5A4KA 3N87A 5CDTA 3Q5GA 5J2TA 1PEYA 4WDQA 1RNLA 3I9MA 4IS2A 5G1OA 2DR0A 3R41A 2C4HA 4P4NA 3TMAA 4L0DA 2FEAA 2OILA 4XB6B 1EBFA 4WLUA 1E2IA 2RGWA 2YL2A 2ZWPA 3HKEA 1DBSA 2N1BA 3CCFA 3ZJ5A 2IHZA 4FDVA 1JKIA 2VJPA 3C0KA 1TUEA 3PWSA 2H63A 2RJNA 5JISA 2ODBA 4JC4A 4DV7B 3AH8A 4E15A 2A5YB 1U9YA 1C1YA 4Z1MD 3KWJA 4WLEA 5E0OA 3VU8A 4BL5A 1W1WA 4O8ZA 4V1CI 4Z9FA 2FOIA 5D1HA 1V8FA 5ALOA 1HOXA 1IM5A 4TV8F 4ZXFA 5DWDA 3EZYA 2C5BA 4W5JA 3HWWA 1GZSA 4LRQA 2AG8A 3DHWC 2NTVA 4K2AA 5ED4A 5DYYA 1IUKA 1JP7A 4RPKA 3GU3A 4P33A 3BMOB 3JQ8B 1ABEA 5DBHX 4HEJA 5ERXA 4QXPA 4H4DA 1OI4A 1OLUB 2G5GX 1YB2A 2I4NA 4QUDA 1O1YA 1DS6A 1P29A 3IDFA 4HB2A 1MC1A 2WT4A 4C6SA 3NKFA 3R3HA 5HCUA 1KZ6A 1LU9A 4FINA 3UCEA 3ZXUB 2W0SA 3IA2A 3ISTA 3RKUA 3GJ8A 1ETUA 1WABA 4BU1A 4P53A 4ZU3A 2EATA 5EPUA 4FMDB 2JFPA 5K3AA 3BJIC 4UPEA 2QMZA 1SMKA 1BNCA 3OO0A 1K89A 1V71A 2C92A 1KDOA 3NHRA 5D5PA 1TU4A 3EODA 4LGMA 3L0SA 1KVRA 1SK9A 1YBAA 4AXXA 3NDPA 3W2GA 2ZYAA 1AKMA 2WU3A 4RJKA 3VGPA 2YJGA 2ZWVA 3VXKA 2NGRA 3A58B 5BSUA 4E5UA 3MMZA 4G37A 1VTKA 1GPJA 1NVGA 3O8OA 4XUCA 3THRA 5IX8A 3KSDO 1TKAA 1VCOA 2V6GA 4RMGA 1ZWLA 2HWWA 3DFUA 1AZWA 3KSZO 1E2MA 1MZVA 2WUDA 3PP8A 4MUGA 2ZZKA 5EHNA 4NAHA 2VK2A 2H54A 2WSIA 3DPUA 2Y67A 2CE2X 3NIFB 3R3VA 4JEUA 3W5UA 3W9YA 1I5OA 2PPVA 1E9DA 3M4XA 5BQ3A 1UODA 2HU7A 4KWCA 1TQ4A 1A2KC 1G63A 1NPDA 1U9IC 2C4WA 2NZ8A 1J25A 1ARZA 2NUTA 4EMBA 3IQWA 4NG5A 4MA0A 3KQVA 4TZ6A 3STYA 2RHWA 1C30B 3UMRA 3WHPA 1GPAA 2I2WA 3E22B 2WWGA 1LVHA 5BNWA 1HT2E 4L07A 5J23A 3RVMA 1S0UA 3MTEA 1CUHA 4JI8B 2G28A 5EUBA 1GU7A 1C8BA 2DBQA 2E4UA 1K8RA 4GUDA 1UPBA 1A9ZA 4MUAA 3UPUA 4R9UC 1TQ8A 4DR4B 4UE2A 3UJDA 2XRZA 2WAAA 3E4CA 4C7KA 3PQ8A 4MWOA 3DJFA 1OOEA 1ZSNA 4KVFA 5DO9A 5IMBA 1F0KA 2ESRA 1X7WB 4I1PA 3UW1A 1QJ4A 3RF6A 1ZUNA 2AOUA 3H5IA 1U3TA 3ONFA 2EWWA 3K4PA 5H4GA 1NN5A 2QRNA 3HY6A 3SZRA 1QTIA 4K87A 2H4JA 3IRVA 5J9FA 1DX9A 1MB9A 3U60B 5CDYA 2QAGC 3N2GB 4K81B 1M8FA 3OTQA 4IZIA 1WMDA 3I4FA 5H70A 4QXAA 4KNYA 4B3HA 1NY5A 1J90A 2X4GA 2VYVD 3JYHA 3CF4G 3KZKA 3T9FA 1M2JA 4PIPA 4YXWD 5LQCA 1J8MF 1MB0A 1ZYUA 4UAVA 4GOLD 2BTQB 3MYRA 2QR5A 1QWSA 3BIOA 4KFRA 5KDOA 4W5OA 1MAUA 5CNMA 4KYTA 3LCCA 1KDVA 4BMCA 2Q4OA 3H99A 2ZR9A 3E3NA 4X44A 3T4EA 3PXUA 4LHEA 4CM9A 4TVSA 3LWDA 2NO0A 2R25B 4G1BA 4AZSA 1TC1A 1RMTA 1X7DA 2XB6A 3FSEA 3MQ4A 4C04A 2HGSA 3P4YA 7REQB 2AJBA 4P8RA 4PLPA 4Z4FA 3OFSA 4QU5A 2Q8PA 3M1AA 1IUPA 1ZR2A 3RG2A 1JGTA 1GT6A 3TD9A 4AICA 1BH2A 1Q0RA 1SHTX 2CHGA 2R8PA 3MEQA 5AUPB 1CUXA 4EMTA 5E95A 4JEIA 2CLCX 5JZ9A 2AI3A 3QEOA 4YP6A 3W1WA 3NU1A 1GGHA 5IN5A 2VBCA 2DB3A 1L9KA 3GVIA 4TKMA 1GZ5A 4NSNA 4GM0A 4JEMA 4D6PA 2RC5A 4QRDA 4B82A 4K0KB 5GPBA 3RTBA 4B5KA 4BLWA 5T7BA 1NV9A 2OKGA 2XNKA 3IOCA 1P5JA 2NYVA 3EXEA 4XVCA 1FL9A 2WJWA 4X1YA 1AMOA 2BM8A 1E62A 4CLRB 1UC9A 2L0XA 3VR5A 5BSHA 2VTBA 4H0NA 2R44A 1KKMA 3VR4D 1G20B 5CMLA 3E84A 5AVXA 4FW9A 5C7LO 5FTKA 3HN6A 2VQ3A 3CN9A 3I5AA 1RT9A 1XB2A 1ODJA 3N8GA 3M6FA 2QMQA 5AI8A 4WBNA 3K70B 5FA6A 1QM5A 2V7GA 3LCUA 4YJ2A 5AVRA 4A15A 3L4EA 2RK6A 2FUCA 4J7CA 4P4GA 2IHKA 2PYZA 2ZRPA 4OG2A 2AR0A 3N7TA 4GXQA 1XVUA 1XYGA 4FNMA 5JI3E 3LBHA 4OXKA 1PQWA 4NFSA 1K4MA 3GAMA 1Z6QA 4G0XA 2J46A 2D0DA 4OGLA 2ZLBA 5EE3A 4C4RA 3FAZA 1PP4A 2ATXA 1E3EA 2EXXA 1XJCA 1Q5PA 2F1JA 3GP3A 4Q7QA 1MB3A 1RYDA 4D57A 1EDZA 3T9BA 3BD8A 1D0IA 3B6MA 4DYDA 2C88A 1FDUA 1CUSA 4KO8A 4RTRA 5JE8A 1EYZA 1DOZA 2AR7A 3X2SA 2IGBA 3MOIA 4OREX 2CZCA 4URWR 3W5BA 4ZALA 4LDAA 3ZN2A 3AI7A 4PSCA 3FMOB 3G8BA 1T24A 3GPCA 3H4MA 4BTEA 4K3UA 2GPNA 2HK8A 4PGFA 3L1KA 4PY2A 1S2IA 1JPNA 4IGEA 4WGGA 3SQNA 4BCBA 4OQEA 1R6DA 2JVKA 2B1RA 1OV4A 1Z6YA 3IDQA 3STTA 4WBNF 1BWQA 3E82A 4FK8A 1JFFB 4OHOA 4P7KA 3F7NA 3VA7A 2R1TB 2Z2ZA 4HFRA 621PA 3L1UA 1EFDN 1TM2A 2C5AA 2E18A 4I4TF 4XIGS 1IXSB 4E4TA 3GUHA 1B4DA 4GKKB 1NQ5A 1PV2A 1Y89A 2GWHA 3AMVA 5HZGA 3R9WA 3CF2A 1JU3A 3T12A 1U2PA 2X22A 4P0TA 1EPUA 4PPYA 3N9IA 3EEIA 1C4WA 1J9ZA 1RW4A 2DOKA 3OF5A 2X19A 4UNIA 3S2EA 1CW2B 3T41A 4AJ9A 5BSWA 3GPLA 3NDJA 3HCBA 1ODIA 1GKKA 3IT3A 3N2EA 1K8ZB 1KP9A 4UVGA 4XTCS 2VF5X 3UK1A 1QGOA 2AT1A 1WW3A 4FHFA 4NOKA 3TZHA 1CP3A 2VJOA 3E48A 1J07A 3RREA 4INZA 1XF1A 1QFYA 4WESB 5AM0A 1E4OA 2BZ1A 3OWHA 1S2LA 1OHHA 3R3WA 1P2SA 4BGIA 4C7OB 1VJCA 1DNPA 3URKA 4CIAA 1CQPA 2WIGA 3OPYB 1R6TA 1IRXA 4JP1A 2R48A 4DMHA 3I2YX 1MOPA 4F5WA 2I1LA 2X1LA 3MTAA 4R69A 1X1SA 1C4KA 5HFAA 1NVUQ 1NULA 3LL7A 1KA9H 2X2PA 3JRXA 1PR6A 1XNQB 3EZFA 2GCGA 3TNLA 2J9FA 3PFWO 1GCUA 4MKGA 2WOJA 1DVRA 1EVQA 4MWTA 4Y6GB 4BV9A 1UBNA 4RHCA 5TMEA 2OB2A 1Q1NA 4BO0A 1VBNA 1X8LA 3O92A 4RZHA 1IYZA 1Z0UA 1OLXA 3CNEA 3EMDA 3NOVA 4LNUB 1SA0A 4FQ8A 2NU9B 4QE3A 3SICE 1GZVA 2Q27A 3VO9A 1JSRA 1NBIA 3C1UA 2TYSB 2J3EA 3DE6X 3K0FA 4ZI3A 3D3NA 4MKHA 2L42A 3WK4A 1IZYA 3ANMA 3W78A 1QCDA 4OHKA 5C34B 1S7GA 3ZBTA 1E18A 1JJ7A 3AUAA 5AVJA 3VH2A 1HSOA 2YRFA 3DF9A 3HY4A 1B42A 1T4CA 3RODA 1U4OA 2EF0A 3CKYA 3W7VA 4E5VA 5F7XA 5CB6A 2D13A 3WWDA 3WKBA 3DMNA 3OQMA 1ZD9A 2VJDA 3U40A 4JNKA 2E87A 4GOKA 3I72A 4WOCA 1OJLA 4HMOA 1JR4A 5EE0A 4LX8A 1DWQA 3RUHA 3U0BA 3AIIA 2ZTSA 4X1IA 3NHFA 1DTEA 3OEHD 3I9JA 1WQ1R 1H9AA 3K4HA 1ZJWA 1COWD 1G20E 1HFJA 1JFTA 4QARA 2WPNA 2ID9A 2IYEA 3RSLA 1M6HA 3GLRA 3LZ6A 2JIRA 3JW8A 4LZNA 1Y3AA 4A0FA 2OQIA 2WFLA 2WTEA 4C87A 5TMBA 1W0JA 4LYFA 1VBMA 3H3XA 5JQGF 3JWEA 2IS4A 2CWWA 4W9RA 1JE1A 3CMCO 4DBVO 1KI9A 1P0QA 5T64A 3R7FA 2O0LA 5K0EA 3AXSA 4RZ2A 3GMSA 1HE4A 1VJ0A 1CBUA 2ZIGA 4KIFA 5ENZA 5KREA 3PR3A 3B7GA 5K8IA 5KVVA 3ESCA 4UHJA 4MPTA 4ZCIA 1G2IA 1WZEA 4LSMA 4RLSA 3GA5A 2GD0A 4ILEA 5HJEA 1GSOA 3A3OA 1M2OA 1MJGM 4RKYA 1KMMA 2GZ3A 1FFXA 4K8OA 4HDQB 1Z5ZA 2AWNA 3AJAA 4C0JA 2G7MC 1PUXA 3MTBA 4RHFA 4XYBA 4AQYB 1UMCA 5FEMA 3FHLA 3AERB 3B38A 4XB1A 5EUCA 4ZMSA 4PTLA 2B69A 4DEXA 3NP9A 4M0MA 1DKPA 4RS4A 4WTOA 5CEFA 2BRUC 2I7TA 5D5HA 4F45A 5KTKA 1IBRA 2JBHA 2VDWB 1T5OA 2VWHA 4RMIA 3UG6A 3IPAA 1MB4A 3S5JA 2BFEB 3QOXA 1I3MA 2I62A 3N8IA 1SHLA 3PDCA 3O9VA 5BYAA 4KN9S 1BN7A 4H7JA 2HY7A 2P77A 2XKKA 1NSTA 2WFZA 1ZXLA 1XEAA 2X0IA 4GOXA 2BL4A 3GFFA 3IVGA 4MV3A 4PANA 4PZPA 2A5DA 5BV2P 3VR6A 1SZDA 2DERA 4QYWA 5KS2A 5LYJA 5A4FS 3WA7A 1LVGA 4D0NA 5BP7A 2Z6UA 4ER7A 4G81A 2D4HA 3OLQA 4GYKA 4WXPA 1HDCA 3LLSA 4US0R 1KEPA 1HDYA 2D2EA 2G0AA 3AR7A 3IKMB 4O8CA 2ONKA 4K05A 3JSXA 2WYUA 3I5MA 3KX2A 3UHOA 5G4KB 4B3JA 2V54A 4U39A 3V2HA 1KK3A 2A86A 2NZYA 2DFDA 2VP5A 3LM8A 4I6EA 4J4TA 2Q41A 4CQMD 4C4YA 1KJZA 1USUA 2PZKA 3QLJA 4RF3A 4UVHA 1CUEA 2YYYA 1ND5A 2O3QA 1P6UA 3A4YA 4IXWA 4QFMA 4YAGA 3FDFA 2P9HA 3D3WB 2BW0A 5BVHB 1Z07A 4D74A 1KK1A 1MEJA 1SELA 4PLYA 4RKWA 1QHFA 4MKIA 4ZYVA 5AKLA 2XBLA 4QDTA 2HRCA 1G9XA 3ZR4B 4BNKA 2IEZA 4HDSB 5DTJA 5EMJA 4C0SA 3P2JA 1FS4A 1E7WA 2RGEA 1BXRB 3OVMA 3UMSA 4E12A 1FVHA 1TM4E 2D1TA 4V3CA 2IWRA 1V4NA 5F78A 3DH0A 1OBOA 1WY5A 5K4GA 1NVAA 2BHLA 4MAAA 3UAXA 5LQKA 4QBFA 5SYMA 3UTCA 5K3BA 3V33A 5JS1A 3AF1A 4YJDA 2HHCA 4GGPA 4UNQA 4OI2A 3VC1A 1AS3A 1S8OA 2TECE 2WU1A 3C3CA 3JZAA 4XPIB 4AKEA 3QV1A 4XD7A 5DMXA 5FLYA 1N36B 3HL4A 3EZGA 1GUYA 4Q34A 1Z5GA 1ZISA 3O31A 5LYJF 5IVHA 5BRAA 1VL2A 2GPAA 1WUYA 4JLSA 3DBHA 3BDIA 4JUDX 3RRZA 3HL0A 5AW3A 1P0MA 1L8XA 3CLSD 4D9IA 5CA1B 2FOXA 1QFSA 1V7PC 2IOHA 2OFXA 3QYFA 4JXZA 2VZ0A 3P9CA 2FMKA 3KB2A 1Z63A 1C81A 2O7VA 3EUWA 4B48A 4EFNA 2OCXA 1XN1A 3EHDA 3VNAA 3RVNA 3BF8A 1GGMA 2B1GA 1LI4A 1YFZA 1A82A 2HKIA 3DL4A 3KXLA 1V48A 1S02A 5BOSA 1A1VA 4AKHA 2NUAB 3OQOA 3RVSA 1L7BA 3FTPA 2K7ZA 3LKBA 4BO2A 4I6GA 3ZTWA 5H7XA 3B1VA 5GZ3A 3RRBA 3EZ9A 3JPWA 1R0ZA 4IEFB 3PDUA 3OCXA 1CY4A 4NEHB 3SS8A 4RAOA 1Q50A 3NHLA 4U7WA 2H00A 1HTWA 2JIZD 4HK4A 4PZZA 2LIVA 3GCZA 3E2IA 4ICIA 4K40A 4RKFA 5EMMA 3BH6A 1ZLXA 2PQ6A 2FK7A 3OUUA 2FETA 3OWOA 3SMQA 3DXYA 4AM8A 2YHUA 4GMKA 1QHEA 1Y98A 2C8JA 5F23A 4E5KA 1ISMA 2LCQA 2PKYX 3PJDA 2KLHA 3RVRA 4B8YA 5TGDA 5A7FA 2PPLA 3NBFA 5CH5A 2J7KA 4MWCA 2QYOA 2IHJA 4DV6B 1KYWA 3FNBA 4QBGB 3DDWA 4WK2B 3P96A 2ZJ2A 4Q3NA 3ZK7A 5A4AA 2O7QA 4NZ9A 4YP0A 4PICA 1QGUA 1ZJ6A 3DFMA 2VYNA 2JFGA 3ZCRA 1SIWA 1J1ZA 1Z4PX 1IAQA 4MJ7A 2GHTA 1GTL1 2Q9AA 4RH1A 1ESZA 4RHUA 4WKPA 1QP7A 3CZAA 5B7GA 4AZ3A 4KXWA 1R0WA 3QBEA 4Q4JA 2YRXA 2BBSA 2BMWA 2CHEA 3FKJA 1RI4A 3PL5A 1H05A 1H1LB 2A3NA 3I5UA 3KOMA 2OHOA 1TT7A 3AEQB 3DL7A 3QEMB 4MS1A 1W2WB 1YZVA 4Y0VA 3T3HA 1NM5A 2XVAA 1ZOIA 4F2WA 2FR0A 4DY4A 3SXUB 4XM2A 2LUOA 4ZN6A 3DYIA 3HBFA 3IX7A 3ORHA 3OURA 4G9GA 5H5JA 2EW1A 3EEYA 3VU9A 1TF7A 3FTCA 4KQGA 1S8FA 1TEXA 3PXAA 1J2TA 2PIAA 5KYKA 3ZBPA 1CE8B 2QTRA 1ML4A 4J1TC 3K9BA 4ZVNA 2G06A 4PX2A 2FQWA 1V9LA 1S3FA 4JENA 4L73A 4ZDJA 1G3RA 1P17A 2JVIA 4QAQA 4IIVA 5ALMA 1WETA 3QFHA 1N5JA 3IBGA 1CRPA 1T5IA 3MBKA 4F4JA 5J2TB 2FN9A 3H2JA 4QEKA 2Z2JA 3U17A 5TMDA 1U02A 3KQKA 1W35A 4TXNA 3LUFA 4UUMA 5ARBA 1TLFA 3R5XA 1QFMA 4OQDA 3UM9A 5CDFE 4XX1A 4G1UC 2MWMA 2BP7A 1QQAA 4ZI7A 3ZGVA 2I7DA 4FPXA 4PHTA 1UBSB 4D3ZA 5AW4A 3EMBA 1JEOA 1TX4B 3NV9A 4FR0A 4FWBA 4QUAA 1IWOA 3QKUA 2PRSA 4NONA 4D2IA 4F84A 1JHMA 4ZYXA 3C2QA 1PD0A 2QVYX 2IH4A 8MHTA 1IQUA 3JTEA 4KU4A 4DADA 1ABFA 4GX0A 2UVQA 3WTBA 2G36A 2G77B 1Z17A 1K3TA 5SY9A 4E2FA 4EYOA 1EE1A 3ZG6A 4XVUA 5JCOC 4G09A 1QRUA 1CERA 4EZEA 2O8CA 1UP6A 1A4IA 1O08A 3B52X 1EWKA 2EQAA 4LXYA 4WKGA 2Q5JA 1RAFA 2C98A 3A28A 3IE2A 4U1RA 5FUVA 2Q2QA </