2H1VA

Crystal structure of the lys87ala mutant variant of bacillus subtilis ferrochelatase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
309
structure length
309
Chain Sequence
SRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLAHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Amino Acid Residues His183 and Glu264 in Bacillus subtilis Ferrochelatase Direct and Facilitate the Insertion of Metal Ion into Protoporphyrin IX
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
molecule keywords Ferrochelatase
total genus 120
structure length 309
sequence length 309
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2006-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h1vA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h1vA02
4KLCA 2DJ5A 4KMMA 4F4DA 2XVZA 1C1HA 2HRCA 1HRKA 2PO5A 3W1WA 2HREA 1LBQA 1TJNA 2XWPA 1L8XA 3GOQA 2HK6A 2JH3A 2QD3A 2QD1A 2AC4A 4KLAA 4MK4A 2C8JA 3M4ZA 3HCPA 2XVYA 2Q2OA 2H1WA 2QD4A 3LYHA 2Q2NA 2PO7A 2XWSA 3AQIA 3HCNA 2XVXA 2PNJA 2AC2A 1N0IA 2Q3JA 3HCRA 1DOZA 1LD3A 2QD5A 2QD2A 4CCSA 2H1VA 4KLRA 3HCOA 1AK1A 2XWQA 1QGOA 1C9EA
chains in the Genus database with same CATH superfamily
1BJRE 3S44A 3PKIA 2NYRA 1Z33A 1R4NB 3USCS 3PQ8A 2ZKLA 4KNWA 3UZUA 2HRCA 2BM9A 5FBLB 2VOEA 1UDAA 3OQJA 3E3MA 4NATA 4BN4A 4NS1A 1RLMA 1D1TA 1X19A 2R8PA 4K6KA 5CG2A 1GRRA 4TQAA 1S2OA 3DNMA 4OVKA 5D84A 3WVNA 3GL9A 3HGQA 4IUDS 1V45E 4DLPA 3KZKA 5EMMA 1DS6A 2VHXA 1OWPA 1NOJA 3VGJA 2JI9A 5CGQB 3F6BX 5EWLB 2GEJA 4M49A 3OZSA 3T7DA 3MNFA 1XQ6A 4CW7A 4BMVA 3T1HB 2HGZA 1Z0FA 4GZ5A 1G0NA 1TM2A 1XJ5A 3I09A 2ES4A 4MJ3A 5B58C 1EJ6A 5FHQA 2CD9A 3K9FC 2WQZA 4W5NA 3ITKA 2WU8A 4A03A 5JWOA 2CUZA 1KVSA 4LOAA 1V5EA 2A1IA 3B51X 4B48A 2YBDA 3JYLA 3LJKA 4G0YA 4N6NA 5KCZA 4RK6A 3UB2A 2VSFA 4ZIRA 1T2EA 3GK3A 2OL4A 3JQBC 4MR9B 4E11A 3N28A 5T41A 4EHNA 4O4JA 1OH8A 4RDIA 1YJAA 1TFRA 2RB4A 2RGYA 1BGXT 3BMNA 3IAAA 3L93A 4U7GA 3ESXA 4YO8A 3VYSB 4EG4A 2PZLA 4JLJA 5K0FA 4B2YA 4YQEA 4XVQA 3EISA 1IWOA 4M8LA 2YJ3A 5F98A 2GN0A 4DF3A 5AK3A 5TQ2A 1FMJA 1KK3A 2LNDA 3CNHA 1YIDA 1ZR4A 1UBCA 2EWWA 4GO1A 2XYGA 4NMMA 3C3PA 4D0RA 2AW3A 1DBPA 1NFRA 3M49A 1MIOA 4F92B 4ZCIA 4AKHA 4WCDA 2VCHA 4DSNA 2XOEA 1QKIA 1NJ2A 2I6GA 1QMGA 3NWPA 2XDYA 3HDGA 1G8AA 1Z0DA 2J08A 3CIFA 3DWFA 1CDDA 1LDNA 2VP3A 3H1GA 3ML1A 3TDMA 3B2EA 1JH8A 1U8UA 3E9YA 4Y6LA 1M2OA 1KZ7B 3IPYA 4PG8A 4ID3A 4PNHA 2EZTA 1ATIA 2JEOA 1ONOA 3QRWA 2MTBA 4OFWA 5DE3A 1I33A 2HQ1A 1L7PA 3C15C 5CVCA 2AG5A 1HGXA 2NUPA 4MWBA 5K3SA 4CMCA 3B9RA 1ZC3A 4FQ7A 1HI9A 3SFZA 1YF3A 1KMCA 2KJQA 2GJAA 4HAXA 3K70C 4DLBA 2QVYX 1HRDA 1K5HA 3VISA 5J4VA 5E3JA 3KKMA 5DCUA 2KLBA 4UAJA 4C0QC 3R7WB 5FBWB 1H6CA 4KO3S 1KE1A 1GNQA 1E63A 1AN9A 1OC2A 2ZT8A 3KRTA 5EOVA 2WG2A 4XUEA 1HQDA 3GCZA 2IP4A 3N2LA 2OPHA 5CDUA 3MSXA 2BGWA 3SAJA 4AFNA 5EJ5A 3EDOA 1K98A 3VDRA 1G3IA 4B7ZA 1PTJC 3DZFA 4QUJA 1E99A 2XE8A 1F60A 2GZDA 3PICA 3EDRA 4ZAYA 1VQ1A 5IK2A 1JLLA 5JD5A 3TUZC 4A82A 5CK5A 3B20A 1PVVA 2P4QA 2PKXA 4ZOBA 4JLBA 4URWR 1NATA 2B34A 3TKYA 5ECDA 2GEVA 3O31A 3U49A 4F84A 4EZBA 5C5EA 1CX9B 2FN7A 4L28A 2BHTA 4OIMA 3LCMA 4WK0B 2FKAA 4WNIA 3VPBA 1R4NA 1X1RA 2XCUA 4WK2B 4ZP1A 2Q1UA 4CF5A 4Z4HA 4XFKA 1Y34E 5B3LA 3RHTA 3OLYA 4N5IX 2H85A 2ZSBA 1I7NA 2CVQA 3BSSA 5LZ7A 1U1FA 2QQEA 2Q9UA 4NE9A 2G88A 2CZQA 1E6WA 3QVKA 3CLUC 1SG9A 1U0LA 1XTTA 4B6EA 1GG2A 3HDYA 1MVNA 4EITA 2HIHA 1LV8A 3VDNB 2FUEA 2F3QA 1YJCA 4FYHA 2QD2A 1RM0A 4AX8A 1J1IA 3KBBA 3ZHQA 5JSKA 2SCUB 4CL2A 2YJTD 1CLUA 2X0RA 1JT9A 3V7FA 3IBCA 1EE9A 3QF4A 3SR3A 4NBLA 1SD5A 1ZFNA 4R9VA 4C6RA 1WVGA 2R9VA 3L6CA 4LF6B 5JAIA 1DC5A 2JFQA 1DJLA 3JWHA 3T3HA 4EG0A 4TKMA 2JHGA 2GMWA 3DGEC 4I8XA 2ZSAA 5KVAA 2AC4A 3L4KA 2DPMA 1TA4A 3GDHA 1BHSA 3PQ7A 4JJGA 3RS4A 1QHSA 1VJGA 3ADOA 5BNFA 1LLUA 1ZBDA 1VRCA 3ANMA 3BERA 3ETDA 4KN5A 4B79A 2WINI 2H5LA 2ORWA 3BFKA 3O74A 3SJCA 4RJJA 1JH9A 5BVGA 1NR1A 1UANA 1NPDA 4OMCA 1YZQA 4L9RA 4DQXA 1QB7A 4QUHA 5LKRA 1OLUB 4IZOA 4RD1A 1LI4A 2CL0X 3D2BA 3K0EA 2B6HA 2Q4TA 3QF7A 1BCSA 2OXFA 4J16A 3ZE2B 4DHEA 5A5DA 1HG1A 2JPDA 1C1HA 3IAM1 3RIGA 1LGYA 5SICE 4TZ6A 4HNTA 2J3MA 1IG0A 4QGGA 2C2BA 3NHWA 5C32A 1PJAA 2OR3A 1KA9H 4F6RB 3IVCA 1GN8A 3H2GA 4PTYA 5CA0B 4Y6QA 4F3TA 1PWHA 4RIEA 1CS0B 3Q9LA 4KIFA 5DW0A 3V80A 1RRCA 1QU2A 2OV1A 4J9UE 2HBYA 3K53A 2ZSDA 5BSFA 2WMOB 1YI0A 3FY4A 3FOBA 3VVMA 2XUHA 2CJXA 3QU4A 1JHQA 2QV7A 4WX2B 2XRMA 2VDVE 1S8OA 1B8PA 3CWQA 1DRUA 5FOSA 3GPLA 3EIUA 4CM4A 4CTOA 2WTXA 3BSFA 1R6DA 2FMFA 4AY6A 2VBFA 3AOEC 4DDTA 2HUPA 1KP9A 3S8MA 4JUAA 4N3AA 3K5HA 3M5WA 4S0XA 1E79D 4FBLA 4A6EA 3FNHA 4B85A 3DAPA 3V4RA 1BMTA 5F12A 3FOFC 4RMHA 2RHDA 2WSBA 1E2FA 2CLMB 3UPTA 1PWZA 2VLIA 5GOTA 4M37A 4TLAA 4QO7A 1SK8A 1WP9A 3L8CA 3ZVRA 1E2JA 3CQ9A 4JQSA 5T4HA 4RQUA 4EQ6B 2YZ7A 2Y6UA 1FX0A 2BJWA 2G72A 3HUTA 4XEHA 3LWDA 2VLBA 2FDCA 4CDRA 3JWEA 3I3SR 4I1PA 5KVSA 4KEAA 4QQ8A 3OMWA 1BMFD 5CK4A 3ZXYA 4X61A 2O4CA 5K05A 1ADFA 1J5XA 3OJFA 5ALFA 2GCIA 1Q84A 1EBFA 3BFVA 4UUPA 1N5IA 4GC5A 5EGNA 2WFAA 3HFGA 5IW8A 3RBAA 3ZW9A 4H3KB 1N1GA 4C4XA 3W4KA 1A8SA 2XWPA 3HL4A 4HBZA 4DNOA 1RC1A 1GFSA 2VP4A 4RXTA 1Q5PA 4RADA 1IJKA 2C5SA 3WSVA 1GA4A 2VYND 4FNMA 4MINA 4MI9A 3O03A 5H7XA 1N5RA 2VK1A 3PEFA 4IQ4A 1JZTA 2RGUA 4G36A 6REQB 4NQRA 3HBLA 1C3EA 2I9PA 3AFOA 4ZQGA 3DOJA 5ES3A 2XX3A 5EIWA 5FL7D 3ZY2A 3W9BA 4DJJA 1OZFA 3IAHA 3S7TA 3C8MA 1OD6A 2JLSA 1Y5NA 1XGKA 3WI7A 2KE5A 4IQ0A 3GLHA 3PPYA 1UBSB 2PSFA 4DUGD 3DZ8A 1UIRA 4TWJA 4BCDA 1F0KA 1QE5A 3L06A 4IHJA 1WSDA 3A8TA 5EUCA 1GY8A 2R6HA 4BBZA 3LGSA 1CK4A 4HPXB 3THWB 2B25A 1U3VA 1XVLA 5KOJA 1XCPA 3GLIB 4BRUA 3QVGA 1K7CA 3E03A 3OLVA 2WLSA 3CS3A 4ALJA 1M74A 3UC5A 4D79A 1ZMRA 4DTIA 2HSZA 4M7RA 3EX7C 1AZLA 3NC1C 3EW9A 1LDBA 1R5BA 3G0BA 2Y05A 4WLEA 4QSMA 1CEYA 3CVUA 4U5XA 1ORHA 4FFBB 3U81A 4NZMA 1ZOIA 1UBUS 3D0OA 4D45A 3T0GA 4ARVA 5EKTA 1W52X 3VZBA 3MHPA 1YVPA 3W7VA 5IS2A 1C7QA 2OAQ1 3LPNA 4FSDA 1FRVA 6GPBA 3QFFA 5INTA 1U2GC 2I4NA 3A6LA 4XSHA 4C03A 5T8KC 3WR5A 2G5PA 3DW1X 3QBDA 2H54A 2EFJA 5EZQA 4WOBA 1IEQA 4DEXA 4XAQA 1J8MF 5EIXA 3VR2D 4ND4A 1SY7A 1GNTA 1K3UB 4JR1A 2ZRKA 4BJ3A 2W6OA 1GPDG 2XY4A 2PWPA 1G8GA 2QROA 3QWFA 1T35A 4D6YA 2GCOB 4IZIA 3RRMA 2H1IA 3IP6A 3LH5A 4CKBB 1HT2E 3X1DA 2OSVA 3GLFE 4FYPA 2GAFA 4E14A 4XUDA 2W0SA 1SURA 3D8SA 1URPA 4B8WA 1P4AA 1IFXA 3FCSB 3I12A 1N77A 1KOGA 2FN3A 4I50A 2NUAB 1A27A 1CE8A 5EHNA 4HH4A 1DKRA 3JASB 3HB4X 2EXXA 4ZO6A 1BGVA 4CCWA 3MWLA 5EMKA 2HQBA 2HZBA 1N78A 2D4HA 3EZ6A 3H0KA 2GD2A 5K7SA 2DBQA 1U3CA 2G83A 4G09A 3IAXA 2JLZA 3TQRA 4DR4B 1IULA 4HDNA 3ZKWB 2VATA 4Q7KA 3M6MD 5BSTA 3JRXA 3AKZA 2GF2A 4WBSA 3DM5A 2ZRNA 4WACA 3OPXA 2JFWA 4EB6B 4JVNA 2C00A 4DWWA 1H9BA 3FGNA 1LPSA 4W5JA 1JWBB 4GPBA 4QREA 4OH1A 4QZVA 5LQMA 3URMA 2CBZA 1PZMA 3HJAA 2WIKA 1GL7A 1AUPA 1AKUA 2QJRA 1DO8A 2P75A 4MJLA 1IBKB 3FSRA 1XHLA 1M34A 4URUR 1AZSC 3VNRA 1EFUA 4JS0A 4RJIA 3IT0A 4B4WA 3HUDA 4D80A 2FKNA 3ICPA 1RXIA 4GOJA 3VR2A 4PLFA 1EUCB 4U2FA 5AXCA 4UEOA 2ZBGA 1R8SA 2O1SA 3ZE1B 3A6DA 4BP1A 3VYRB 1BXGB 1I94B 1KTVA 5AKYA 4HXEB 1Z5PA 3AF1A 2OLEA 1C9JA 1FYWA 2NO4A 1XMPA 2O6HA 2P62A 3LT5A 4XB2A 5T4BA 4DAOA 2H9IA 2DBZA 4WNYA 4II2A 2ZDHA 1OT5A 3MCWA 3HSYA 4NHEA 2PZEA 4MVJG 1D3AA 1HTBA 4Q16A 4Q1DA 2HJ9A 4OMUA 2VBCA 5GM1A 1ZN7A 1JR3E 1RXEA 3CURA 3KLBA 5FQNA 2FEXA 3ZWWA 2VC2B 4CMBA 1ZIDA 2AUMA 4MVJD 2NTEA 5HUHA 1WZIA 2P5SA 5TT0A 2P0AA 5JSQA 4LZLA 3G5UA 3RTAA 1A82A 1IXKA 2XQGA 4PZPA 3U44B 4LWOA 3U9LA 3ZE6A 4Q5IA 1P5JA 1XRMA 4IL5A 3K6RA 3QEAZ 1N8TA 3FTPA 2BOVA 4HQKA 4MA0A 4O63O 3Q9SA 1RJ9A 4Y2UA 5KCMA 2V7PA 2DUWA 3R24A 4M2LA 5E4TA 4G0PA 1J8FA 3UCFA 4WCFC 1TA9A 4ITUA 3OKFA 3NALA 4CEJB 3UK2A 4HDRB 4P5DA 1WW2A 1MX3A 3PEYA 3RANA 1FW6A 2FQXA 4MYDA 2A0UA 3N39C 1H69A 4DJTA 3UY4A 4HXGA 3PB3A 4A73A 4RYDA 4YXFA 2R7MA 3GLFB 2RI0A 1CYDA 1WX1A 3THOA 5DTRA 1WXXA 3FDJA 1FLNA 3LTEA 3PDIA 2WMYA 1C3XA 4C5CA 4EEKA 3EIXA 4FFDA 3AHEA 3NEJA 2CJFA 1FP4B 3CV3A 4UMDA 4OM7A 1T29A 1ULHA 3CLHA 3X1WA 1A88A 1TVKA 1A4UA 2ZWAA 4D9BA 1EK5A 4B4VA 3S81A 3JATA 4FINA 1HOXA 1UXKA 4EY8A 1W0KD 4OL0A 4M1WA 1FTSA 3GN2A 1GAJA 3VZCA 3F4KA 1B3BA 3SDBA 4BPBA 1S96A 4AUMA 3K92A 3SQOA 2AEJA 3O2JA 3UAGA 1OB5A 3ENKA 1OU0A 2XBUA 4RMNA 3TIFA 4UM5A 3VTAA 3W3AD 1Z56C 1NX6A 1D6NA 1P60A 2O3RA 1U2ZA 3OI7A 2ENUA 2X1LA 3HP4A 4WK6A 1VMEA 3K4HA 3PNOA 5M2QA 1QZTA 4G26A 4JYPA 1RM3A 3ZWYA 2WJPA 1H4SA 4TX1A 1T6YA 1GNLA 3BGOS 3HJUA 2GSDA 3FA2A 4P34A 4ZQCB 4C04A 1A8IA 1PQPA 3OM0A 3N8NA 5F9HA 3D7SA 1BRMA 5CTAA 4GX2A 1EEHA 2JGDA 1ZGGA 2WE8A 2XVXA 3R40A 2A9FA 4C21A 3UCXA 4KH0A 1I1QB 1FSSA 4EY3A 5I7EA 3SKYA 2QZ9A 3ABIA 3NP7A 2OGUA 4IMJB 3PZRA 5AR1A 1N9GB 1FFCA 1CG6A 1WAMA 3AXTA 1SBNE 3PXDA 2NSDA 3RR2A 2G1UA 1D07A 2Q3FA 7REQA 5IC5A 3P97A 1C7FA 1Y8ZA 1JSZA 2XE4A 4NJMA 4EEXA 4F06A 1FPQA 1M2VB 4DBLE 3KDSE 4BP3A 3ESYA 3CX7A 4LSWA 4KV7A 4R8KA 1Q7CA 1TYZA 3OF3A 4A5OA 3EUEA 4UU7A 2IL1A 3ADKA 3W79A 4XD7D 4B6RA 3F6SA 1AKEA 1O54A 5CM2Z 5SY9A 3WWEA 4IKOA 4ZVMA 4UBMA 3A9RA 2P2GA 3AR6A 4MZXA 1NBEA 2V7EA 5J40A 3TRDA 1D0IA 1IG3A 2XCTB 1Y9AA 5CVUA 4FGLA 2H2IA 2P30A 3IOYA 2OVBA 4EG8A 2X0JA 3KR1A 1E2PA 3KQKA 2XB2A 1ENYA 2FPLA 2RI6A 2ZP1A 3VTZA 4BB9A 3A9UA 1HV8A 4DV4B 3PFIA 2Q0XA 3LUJA 1OLXA 4L1KA 3USZA 3SSAA 1NNLA 3DTVA 3A6PC 3OY7A 1BQEA 3LS2A 4Q9IA 1HX7A 3ZNPA 1CQJB 1UDBA 4L8GA 3R7NA 4F97A 1MX1A 2ZJ5A 3IE2A 2D2EA 4DC9A 4KR2A 5F1OA 1Y9ZA 3ZK9A 2LGJA 1GAEO 2H11A 1MABB 3BE4A 3NBUA 1V8BA 2O20A 1U0GA 2G36A 3GGPA 5BRAA 1EXVA 4JUDX 4ALIA 3M83A 1KZ6A 1SVSA 2ZJ8A 3GGOA 3G2KA 4KGVA 5ICEA 3OC6A 4MRVA 1FRFS 2O05A 5HEKA 4BJ6A 1U4SA 1E1MA 1Z6AA 2EQAA 4QYIA 5G02A 3EUFA 1QYWA 3KJQA 4BXOA 4BWFB 4OP2A 2PAFA 3WMRA 2OZPA 4C2AA 1OV4A 1E3LA 3ANNA 4PZEA 5E1OA 3NIFB 1Y8RA 4LWPA 3EVBA 2C57A 1YI8A 5JRDS 2I6SA 3RYFB 2NU6A 1QV6A 2GCOA 4FFLA 2JA2A 3KT8A 1CJSA 5J4YA 4E94A 3LA6A 4Q7MB 4JSYA 3DKKA 2WUEA 3DCYA 4Q37A 3JQ8A 2V4ZA 1VE3A 3KYDB 2ODWA 5IJWA 5JJIA 1Y3FE 1JFTA 1WPQA 5D5PA 3ZY4A 2V5AA 3COZA 4HOYA 4JASB 4YCJA 3E2PA 5B4TA 1EPUA 2AH5A 4D8VA 5KYGA 3ZNQA 1U5CA 3I23A 4BFZA 4XVUA 3MS7A 1USKA 4FSXA 2AMVA 1H0KA 4QPJC 5CHYA 1AKMA 3ZE0B 1DFIA 3QOFA 4MV1A 3T34A 3VR4H 5HOEA 5CCXA 1NR5A 1WMBA 2D5AA 2WBLC 2XT6A 3NDPA 1VG0B 4HDMB 3HNPA 1R37A 4ZALA 2DECA 2VP6A 3FPCA 3GP5A 4WKOA 2QYOA 5GQSA 4XYLA 2ATXA 2H06A 3RJ5A 2ZS9A 2WR8A 2CCJA 4HMQA 1O94D 3QEJA 3FNGA 4AUKA 4KUGA 4DS3A 2VK4A 1S3GA 4FZVA 3DBLA 4MS3B 1E1KA 1LQ2A 1SOMA 2NO1A 3GGCA 4R83A 5JXHA 1OFIA 1WXFA 2NSLA 4B3HA 1B23P 4P4GA 4RY9A 2G5GX 3CYFA 4EY5A 1NP7A 1TZMA 2WFMA 3E2MA 2ZIVB 2WIBA 3TLXA 2QX7A 2YC2C 5C7LO 2G08A 1N2BA 1DLIA 4QXPA 2YWRA 3I2HA 1A4XA 2WC1A 3N1UA 4NJMB 4H6XA 2NQ2C 4K8RB 2J3DA 4NMHA 3TEJA 4M7WA 1ADJA 1J6UA 1L4EA 3D1VA 4IGEA 4LBWA 3LYUA 1I10A 2GCGA 3DXZA 3R0XA 4DR5B 1IUNA 3FSJX 5IKOA 1RMTA 2PSDA 5TJ9A 3RLFA 5ITZA 2MSKA 2Y99A 1O6FA 2E85A 3F74A 4GLJA 4YGXB 4ZGWA 3QA9A 4YV2A 2OLKA 2G63A 4CMIA 1K6JA 1MB0A 2VCYA 3EUAA 1BXRA 4B33A 4RNCA 1KFCB 4DPMA 5BNIA 5E0KB 2ANBA 1NN3A 4Z3DA 2K87A 3TOSA 1QUEA 2JJQA 2OWDA 3DL4A 4FDLA 3X1JA 1G1AA 5C1DA 5CDFE 2QQ5A 2VAMA 4ZVPA 2ZSFA 4HEQA 2UKDA 3WNQA 1R0LA 3IEPA 2ECQA 5ALOA 1SKQA 5CCBA 3EDYA 3L0YA 5GIPE 3CW2A 5AK0A 2XYQA 5EG5A 3HWWA 1BX0A 1ZZGA 4D6XA 3I45A 4IVNA 2CSUA 3FG9A 2JFXA 3KPUA 4WGGA 5T8KA 4KR9A 4MVJP 3VPAA 4GX0A 3KV1A 3EDMA 4BYMA 4EJSC 3NHMA 4TLMB 3STWA 4PLVA 2UVPA 4BLQA 4NU5A 4AP9A 1XE3A 2G5CA 5ALUA 1KY4A 2A5GA 3EZLA 5JFGA 1QS0B 3EWIA 4TV8F 4UHCA 2WB2A 2POQX 1ESCA 2PLWA 3H83A 1MT0A 1BXKA 4ZEVA 4MP3A 3DZHA 4U6SA 1N8NA 4D57A 1AMNA 3N5KA 4OQEA 4F5EA 3GJRA 3V7WA 3HYLA 2B20A 4NOLA 3EA4A 2XOKA 3JARA 1E8NA 2IXEA 4ZGBA 1E3TA 2JARA 5ITVA 1QO0D 2P65A 3WADA 3PXXA 5A1TA 1FQJA 3SCZA 1DWPA 3ZTWA 4ND3A 4ZCTA 4MPRA 2G1JA 3AR7A 3W2EA 4XWKA 1XZFA 3I5XA 1QJ4A 2QYSA 4EQZA 1K2VN 3D8BA 5B4UA 5JMTA 1UKEA 1XN4A 1M6VB 1DAGA 2WPNA 4II7A 4R3WA 5DFAA 4EFDA 3CF0A 2E89A 5MFZA 4MQBA 1KAEA 1IY2A 1RHRA 3A4NA 3WWPA 4M22A 1R64A 4UJ5A 4DQ0A 1Z62A 4S1WA 5JFTA 5K09A 1J33A 1G41A 2AN1A 2GDJA 5B1YA 1G4UR 4EKGA 2AOTA 1ETUA 1XRJA 4XGNA 3AL2A 1W5EA 4WCFA 1HE3A 4ZARA 4TSFA 3R3VA 1TO6A 5COAA 1KXZA 1VYTA 1DQSA 1ZCJA 1PHPA 1PR0A 1GADO 3BH7A 1DDOA 2JATA 4TMZA 5LP6A 3R9KA 1L8XA 4CM8B 4RACA 3ITEA 1RI3A 3SHQA 1GPKA 2AR7A 2V5VA 4AN4A 3GBPA 4A10A 3IAM6 1S7CA 1IK6A 1PFGA 1IIRA 4FCTA 2G9UA 4KODA 3REGA 3ZNOA 3I8SA 2GASA 4MQ4A 1ECLA 1WOMA 3R6GA 2PCLA 1WHTB 2X9QA 2UYCA 4C30A 2RGDA 2WM9B 4PU0A 2C5AA 5E7QA 5C7YA 2DPXA 2R751 4KPFC 4UNRA 1I3LA 3HYRA 5D7BA 1KSGA 4HNUA 2ECOA 5KJCA 3Q5GA 1XXLA 5FUBA 4DNFA 1NI4B 1M8FA 4F4JA 4Y9RA 1U9IA 1A97A 2Y1CA 3L4EA 2ZIXA 2FUNB 2XWBF 4MLZA 1SCKA 3EFBA 2EF0A 3BDAA 5LQDA 3DBVO 3UW3A 3NT4A 3U4CA 3TLZA 4MRSA 3ZLTA 4LOLA 3V1TC 4H0FA 5LMZA 4M0UA 1UXIA 4EHIA 2CWWA 4HEA1 4DA7A 2NO6A 2NVBA 3G7NA 4LVUA 1Z83A 4QA9A 5HE9A 3M6IA 4C1BA 2JIBA 3DB1A 3AT1A 4UNSA 4YREA 5C31A 2XF2A 5ALMA 4EB3A 4PRLA 5ED4A 1OAKA 1JFFB 3EG9A 3OPYB 2YV5A 1MABA 1P74A 2VYFA 1KP2A 3T9FA 3DV9A 3VUFA 4AG3A 2H65A 5KYUB 2NP6A 1B2RA 5GY7A 4B09A 4BWGA 3CMMA 1A9SA 1OHHD 1XMVA 3ZU2A 2BE7A 2V7QA 1KU0A 3RABA 4G4SO 2VAPA 3T7RA 2ONZA 3U9TA 1CUZA 5MF6A 3W05A 4WUTA 1E1QD 2WM8A 3T06B 1Q57A 2TMKA 2O8EA 4I4LA 2HXSA 3NT2A 3EGWA 4FOLA 2VDUE 5CIWA 3QYFA 1HE2A 3CFYA 4X93A 1AMUA 5CCDA 1PD0A 1DQPA 1DDIA 3B2NA 4H4DA 3ZGNA 5KMGB 1P19A 4Z9FA 2O0HA 2B3TA 3LDGA 5C1PA 4CYMA 1ZI6A 5FV4A 3AIOA 3QVUA 1NF9A 4PSDA 3U9SA 3ORHA 4KK4A 2P1RA 5JW6A 4OY3A 1FA9A 1DBRA 2HBQA 1M75A 3GGJA 3KQMA 1YB7A 2OECA 2V8OA 3GZNB 3ZLVA 4ACAA 3VU9B 1NX9A 3EA5A 1RHJA 5A2GA 1F48A 5D3ZA 3BXHA 2GZSA 3GD5A 5EHQA 2VJLA 5A0TA 5A0FA 3AHDA 5CM9C 4ZAVA 2IELA 3BMCB 1XU4A 3UC9A 1ZSYA 4RCYA 5A04A 2BGJA 3LWZA 4RF4A 5FOXA 821PA 4EHBA 1VE7A 5FR1A 1XZKA 1A50B 1C1DA 3VZDA 1Y7IA 1SD2A 3AXSA 3IQDB 5I7OA 1JEJA 3WDSA 1ABFA 1E32A 4GP7A 4G4SP 1ZUD1 2HC9A 2OV2A 1UM9B 1Y37A 3LXXA 4DM4A 1F2UB 2N1MA 3HCEA 3H9GA 3PDIB 4KC0A 3B3GA 4I4TB 1CRWG 3WSTA 2D2FA 5HFJA 5CYFA 1R12A 1MZPA 1KC1A 3S2ZA 1OGIA 2PUAA 5CNJA 4D9KA 5C35A 4IJQA 3K4QA 2ADFA 4P3PA 3QW4B 4ERXA 3ZQ4A 1RBQA 1K9SA 1W4ZA 4FNGA 3DLPX 3OSUA 4OK5A 3FXAA 2ZUSA 4O2AB 1NUAA 4N8SA 2VQFB 2ETXA 2C3PA 2VNJA 1J21A 2W0MA 3CZRA 4QOEA 4RE5A 4I5IA 1PGQA 1Z8NA 2JJ1A 4BDSA 4ED9A 4IAOA 3I83A 3S1AB 1UP7A 2BTEA 1GQ2A 4EYOA 2WSMA 1IAVA 1Q1GA 4Q47A 2OYSA 1TK3A 3U3MA 3UANA 1AGNA 2AE2A 5KYVA 4PPYA 2HAEA 1A5AB 2AE1A 2WZBA 1WKCA 2JBAB 1KSHA 4LDZA 4GKJB 3KALA 1WULS 2FV8A 1LJLA 5KYXA 4LBVA 4P36A 3WYFA 4UAVA 5K8CA 2PL3A 4BLVA 2OZVA 1SUEA 4N9QA 1H3FA 1KY2A 2WU0A 3NMUF 1MEJA 1WD7A 1QP4A 3DEKA 3VHLB 3WQQA 4CMIB 2ZI4A 3KSAC 3KOMA 2QJOA 1ZGJA 2MSNA 1U2DA 2W11A 4F72A 3MWFA 3CVXA 5AUNB 3OM8A 5FBQB 1L5ZA 2ZI6A 2K7FA 2IS6A 4ZDKA 3LCUA 4L57A 2FPOA 2XBMA 3UUGA 3KJNA 4XGQA 1OZAA 1JDPA 4KDCA 4RH3A 2O8NA 5CA1B 4RTSA 1I01A 1DQYA 1K4KA 1OAOA 2CFTA 3FNIA 2H7CA 3R3ZA 1N2XA 4RX1A 4RESA 1LC3A 2BBSA 3RVKA 2Q3EA 2R5NA 2VF4X 2ZQ5A 2ODQA 3MAGA 4ND5A 4J0QA 4WMLA 1K2WA 3RYIA 5BW5A 1MAVA 1DV2A 1OX5A 3OTIA 4B40A 1ZCFA 1LDYA 4CKEA 1ESNA 1I4TD 1M6NA 5L7YA 3IQWA 4KPUA 1EMDA 5HKKA 1U4NA 2UYOA 4IDPA 1X6VA 1KO8A 3OQIA 1JX6A 5DSTA 1HOTA 3R6WA 1HDCA 1XNJA 1NUPA 1ZD3A 2ZK7A 3K6KA 1XKLA 4NICA 5ICFA 3TM4A 4ARZB 3A0UA 4LVNA 3T4PA 1FOEB 1XWWA 3IEIA 3PDJA 2SECE 3H2KA 1VGQA 3KU1A 3IB3A 4NS4A 3G9TA 1WNFA 5K99A 4EJMA 2JASA 1P3DA 2FA9A 4KWHA 4IQGA 3U17A 2ZXFA 1RWBA 3UFXB 1CQJA 1VCIA 1TKCA 3ACBA 1SKYE 4P7GA 2QLNA 1NBOA 3PD1A 4LZOA 4UEQA 1K75A 5BSHA 1FP2A 2QSZA 4DUPA 2A14A 4GZLA 1TD1A 1O5IA 2D5IA 4G56A 4Z54A 1RXVA 5FTWA 1QZXA 3R5TA 4V2IA 4X95A 3VOSA 3P7MA 4Y6OA 2JIMA 5KC9A 4A8TA 3THSA 5FNVB 3M6FA 4L95C 1VYHA 1ULTA 4FDTA 3C85A 4TXNA 2FLWA 3CBQA 4IR7A 4JZYA 5B5SA 5AVVA 4NBVA 4U0KA 1EWKA 4J8PA 3TX6A 2BYTA 3GJ5A 4U8HA 3QFCA 5KQRA 3UG7A 1WL8A 1ECFA 3M2PA 4JODA 4MW0A 1CERA 2Q1WA 1EK0A 2NGRA 3GT7A 1QVZA 3WC4A 5C1IA 1VIAA 1VPEA 3NHBA 1JKIA 3G0GA 4GNKA 3OU2A 4QRDA 2ERYA 1UBHS 1Z4MA 2EW2A 2QPOA 1DCMA 1M10A 2J4FA 2OGSA 1VCHA 3AKYA 3JPYA 3OZVA 1RWVA 3QIVA 4LRSB 4MH0R 4Q0MA 1NE2A 5JD3A 1UJ5A 4A2PA 3SS8A 5I9IA 3L84A 3U19A 4C7KA 2O2SA 2E4ZA 2XWJI 3ECAA 2PYIA 2IDKA 3KDAA 1IMJA 2IXDA 2HWYA 4K6FA 4D4KA 2ZIUB 2W2KB 3N86A 4YAJA 3I5YA 3N58A 2EF1A 4LS3A 3P2OA 5JWHA 3V97A 5KPDA 1G2OA 3CG0A 3FRJA 1D09A 2BFCB 3G1TA 4IVRA 1Z22A 5K3AA 4EKYA 3AU8A 1HEIA 3DEJA 4L02A 1X42A 4Z4GA 2JIZD 7MHTA 1T2UA 1C2TA 4J0CA 1ISGA 3B13B 4J7XA 3FYTA 4ALMA 1GNVA 1G8KA 2GPJA 3RTGA 4HB2A 1UWVA 4FHCA 1FFYA 1GUZA 3I3OA 1VTKA 2J0UB 4Z6KA 3ZGYA 1BD4A 1PJ4A 3DQPA 3ZV6A 3ILVA 3WIVA 4BUZA 2IUEA 4HSEA 3RG2A 1Y7LA 2PX2A 4MWGA 3V1YA 3R8XA 3SEFA 1E2DA 3R23A 4OMFG 3DDZX 4A0SA 1DC3A 2QP4A 3X2SA 3T7CA 1KYXA 5F7JA 2KI5A 2I54A 3JQFA 4D8UA 1NV8A 1PW5A 5KU1A 2C83A 2B94A 5L3SB 5KQSA 3NBAA 3P5BA 3NC0C 3I0MA 1UOOA 3ED5A 1SBHA 3NEPX 5D00A 5DZSA 2QXYA 3UQYS 1KQPA 2OM6A 5A03A 2RKOA 3A58B 1LX7A 4G4GA 3K1AA 2F3TA 4DLUA 4X64B 1B4DA 5HJ2A 1GNPA 5CDFA 1DZ3A 3IKVA 1JG4A 3MM4A 3AVUA 1GR0A 2R7NA 2WA2A 4HWOA 3VR3A 5LXTB 5I7WA 3KKLA 3QHPA 5BN4B 3HB5X 3L04A 5KSPA 2ZYRA 4DWJA 4BQSA 2WT4A 3TI9A 1ACJA 3IUYA 4IMPA 4BZPA 5K5EA 1GGMA 4PYKA 4GX1A 4KPUB 2DM6A 3KT0A 1Z6TA 2OD7A 1V3VA 1I1OA 4IDBA 3KT6A 4ZDIA 2WSSA 1Y48E 3ZCUA 4ETWA 4Y2HA 2AC2A 3OCYA 4M1YA 4RK0A 3KPJA 4CI0B 5AVQA 2BKEA 2XQVA 3PJGA 2RGGA 3F2VA 1C14A 3IPAA 2CFSA 2PH1A 1SPBS 2Y76A 3B6JA 3ETLA 4RJTA 2KWIA 4DR7B 4B3RB 2X1VA 1ZJ5A 4LHZA 5JCPA 2Q0HA 4U63A 4K9RA 2HHJA 1XMQB 1HE8B 1YULA 5M34A 5KTYA 4MKFA 3A6KA 3KS9A 2BP7A 2RGRA 2XZLA 1KOLA 3W1EA 221PA 3M6VA 1E5TA 5J5AA 3WBJA 5JJLA 1ZW6A 4WZAB 3UJ9A 3W9UA 1T9AA 1P1CA 3GBSA 5ALRA 4YJ2B 1PJZA 1P2BA 1WQ3A 4Y0AA 4CWAA 2PBRA 2C3YA 2I9KA 3KKEA 4MP6A 1N6KA 2VUUA 4F9FA 3S2FA 3F5SA 3ILXA 3PNYA 1HNXB 1DPGA 1F0NA 1JKJB 1M2HA 2JH9A 4GLOA 4LTDA 4MWSA 2ZUEA 3MOSA 3PQFA 2FOLA 4RO0A 1P2SA 1G2QA 1MAHA 1PWEA 3MN1A 4OMDA 5F64A 3ZQKA 5SZJA 3ZX5A 2QN1A 1YWGO 3LSTA 1RW4A 4PRZA 3A25A 2D3WA 3QPDA 3C3KA 3ZEIA 4DXAA 4AI6A 5C51B 4O2AA 4KYTA 3DULA 3MRXA 4HZIA 3GFPA 3TLGA 1E0SA 4R2KA 3IKLA 3ZEAA 3GQBB 4C20A 1D7OA 1KF0A 3CGWA 4MWEA 4B43A 1BVYF 3TXAA 3I2KA 4B3SB 5GWXA 3VVBA 3E5MA 4M9UA 1VI6A 1UPFA 1F9AA 3I9MA 5CT9A 4GL4A 1MC8A 1U2RA 1BXZA 1XYYA 3C74A 1R00A 3FUUA 2GJ4A 3FUTA 2R8RA 4GPEA 5K8LA 4NU8X 4XWWA 5KHOC 4C0BA 1JEYB 1XLTA 5LYYA 2P9EA 4I8DA 1WRBA 5FOVA 3ZHUA 3JASA 3RVSA 4YP6A 3W8RA 2XTZA 1B3RA 3VYWA 1DI0A 3G79A 3KG2A 3T61A 1XD8A 1YBHA 4O1HA 4OG2A 3MT7A 2ZYAA 4E5KA 2G1AA 1GG8A 3L0DA 3RSCA 4RKQA 2EEPA 3FKQA 3GEEA 5DBEX 3OETA 1CW2B 1GAQA 1T5HX 1Z74A 3QSGA 4JXXA 1U99A 3QLJA 4K9DA 2R4UA 4PG4A 1MO4A 4OLBA 2O3UA 4A0FA 2BZSA 2CMFA 3L1HA 3HQ4O 3TW8A 1O0SA 2QN8A 2YQZA 4IJ5A 4UDOA 2ZRFA 4IRUB 1AKWA 2VXOA 1YZNA 2RHLA 1DARA 3PA8A 1ZJWA 2E6KA 2YHBA 3IX7A 4PZDA 3R74A 1QKJA 2GPSA 3UJ3X 1DX9A 4AB1A 4ZEXA 4MR7B 1ZHFA 1DRKA 4Z4EA 4A4DA 4V02A 2WWRA 1L5HA 4L7QA 4NAUA 5LBIA 4FYXA 3UMBA 4YUZA 2LD4A 4IG9A 1Z47A 2A3RA 5BT9A 1I1NA 1QE3A 5G53C 3BK1A 1F3LA 4OQDA 1I0IA 3K35A 4W8OA 2VP9A 1W59A 2RHRA 3KU4A 5CNMA 2NUTA 1HWYA 3N8HA 1BU8A 2X9VA 2GK3A 3K0FB 4RV9A 1O87A 4BNHA 1TCAA 4H18A 4KBYA 1K66A 2I3GA 1ODJA 3EGXA 4XIJA 4F5ZA 1UKVY 1PE0A 5LUBA 1MAWA 3AESB 4LBZA 2V6BA 3CPSA 4POAA 1XZJA 5DK6A 5JJCA 2QVGA 4XQEA 4L8LA 5KKAA 1X13A 2ZOSA 1OXBB 2C7QA 1ZM4A 4ZRNA 5H70A 5J1TB 4Z7JA 3DB2A 3H1EA 1RVV1 3Q5DA 4GI2A 4W1SA 4B3TB 4NQZA 1QHIA 3OZ7A 4R2HA 1OZHA 2IA5A 3BKXA 2BEVB 4FHGA 2H4ZA 3PGJA 4JHXA 5ESRA 4UUMA 2QZSA 1SBIA 1EBBA 3OC0A 4X41A 4UUQA 5DF1A 4DLKA 1OTYA 3Q7SA 3QPWA 5DSXA 4LY3A 2QUHA 4N6OA 4BKMA 4Q3KA 1YDGA 2FJ0A 2V6JA 3BAZA 4TM8A 3HJRA 1N57A 3KD3A 1QDLB 4FR5A 3ICOA 1Y5RA 4WZAE 2EWMA 3LFUA 1GRQA 3IDOA 5AOAA 4DZTA 5HP4A 5JPCA 1Z7BA 4OUDB 1P0MA 2CYCA 5FXMA 3IT3A 2JAQA 4U2CA 1SO8A 4MW5A 1D0SA 5JCOA 4DA8A 4Y1GA 4K0KB 2JEZA 4W9MC 1SIBE 4ARUA 1UK7A 3M6XA 4V0QA 8GPBA 3OF2A 4TTTS 4Y2QA 1H0HA 2XB8A 4ZOLB 1LDEA 2FG5A 1EX7A 1QH1B 1L7EA 2GJKA 2YS6A 1OBHA 4ICIA 4ZYXA 2EKLA 2QG4A 1W5TA 3ZPXA 1NNUA 5ALDA 1I80A 1PGOA 3U3RA 3EXFA 1AKRA 2VPZA 4Q7QA 4Z49A 4K2AA 1JVBA 1UUFA 2WKWA 2FQQA 1L5OA 4NCJA 2F3SA 1OJ7A 1P8JA 5ETJA 3PEVA 2PEZA 2OMKA 5KTOA 3GJ6A 4D4GA 1KZ1A 4HG2A 1RQXA 2WTBA 1L2TA 1X0VA 2PD4A 2TECE 3OQBA 4OI4A 4EG5A 3EG9B 3U44A 1ZNXA 3C4JA 1T6BY 3PVZA 2H07A 2QS9A 2PRIA 3O4JA 3DE5X 1ONPA 4N76A 4CEIB 5IZCA 1HFKA 3SHFA 1E9CA 4X1YA 5I4IA 4UNQA 3TUJC 2NNWB 3NW9A 2R87A 5LFAA 3LUFA 1OIWA 4BQRA 1HDEA 1LS1A 1M9NA 2ODTX 3WMGA 4XJXA 3G0CA 1A5SB 3UMMA 5KOHB 1KI1A 2PGAA 2Q0SA 3I73A 4NARA 5GM2A 3UJHA 3QU5A 3VSEA 2G0TA 1SC9A 2FPUA 4YRQA 4K26A 3I6QA 3AB7A 5H02A 3VPHA 4PEVA 4AXBA 5DM4A 4D8TA 2CF5A 5JS2A 4KOAA 4I5EA 2TS1A 1R8QA 1EVKA 4FQ8A 3LZDA 4EUHA 1N2SA 2CB0A 2DH5A 3V2GA 2VF5X 3UJNA 4WK4B 2CVOA 5G1PA 4B44A 5EUQB 4EPWA 3T12A 1RCUA 1EVJA 1DXHA 4B2PA 5MN5A 3J7TA 2Z8ZA 3MGBA 3QNWA 4CLEA 3KYIB 2P11A 3WQBA 4DR2B 4ENPA 1V8PA 3L7NA 1DIHA 3RC8A 1UT5A 2A9QA 3EHDA 1BCSB 2QUBA 3AMVA 1CF2O 1PIWA 1V4NA 4NWIA 4UBKA 2YWHA 1RWNA 2WB4A 3DEAA 3AEUB 3AUFA 4MAAA 1S3SA 1HNZB 2GBLC 2GCEA 1JB1A 3LGXA 3JQAA 3RSFA 3SQDA 1A1SA 2C20A 2O5RA 4RELA 4EK9A 2BFDA 2LP4Y 1U3DA 4E2YA 1R6TA 3H7IA 1YR8A 3TSYA 2W2LA 4I5GA 1RFLA 3DV2A 4DSZA 4CHTA 1CBUA 1F1BA 1SKUA 4YAKA 4HDAA 4GZ3A 4PCLA 1XJWA 5IANA 4P4LA 2QD5A 1QF7A 1Z2PX 1CY6A 1SCIA 4H6WA 1NLFA 1JIQA 4QSHA 4E09A 3R7AA 3LQ2A 1QHYA 3DR3A 1RACA 1RYEA 2K2WA 3WHKA 1PR3A 2OCKA 3QX9A 5TE9A 1O08A 4RD3A 2BMAA 2C4VA 1TNDA 4FW8A 1SEVA 2G25A 4R8SA 5DI3A 3VR6A 1FFBA 2QPLA 5C52B 2QD1A 3O8OB 3PR3A 2JJ2A 3KR0A 4PICA 1W8DA 4OJYA 5G40A 4AJHA 2OGWA 6CHYA 2BZ1A 1KIFA 2OHGA 1TIBA 5LXTF 4X7PA 4UM9D 5D3KA 3WK8A 2YHIA 3UTCA 3V8VA 4YAFA 3C39A 5J58A 1OASA 3EPJA 1SC3A 1HFWA 2CXXA 2PX4A 3C8UA 3K8OE 3TW4A 2J4CA 1WKVA 1Y8RB 3AHIA 3EUWA 2XNDA 3G2LA 4M8KA 3KJGA 3TZ6A 5C3MA 3U4HA 1GGHA 5JNSA 1WV1A 1U7DA 2B4TO 2NUTB 4TYMA 1SOVA 3AF0A 5H3HA 2D62A 4FXPA 1JQEA 3OBIA 1U0TA 2FFJA 3WYBA 4L74A 3RADC 1JA9A 1OREA 5K0GA 3UMRA 1NN1A 4MUEA 2G7ZA 3QPUA 4O4HF 4RFSA 2X3FA 3RUAA 1Z3IX 2EKZA 1W73A 5AM1A 4YTEA 1O58A 2AZXA 5LYJB 1T1IA 2GILA 2NXNA 4O5OA 6LDHA 4N3BA 3ORYA 4IFTA 1P61B 1KOFA 2CFOA 1PF7E 2PLAA 3IQGX 4GM4A 4M0KA 3TG8A 4P3XA 2X4DA 1XQWA 3R77A 4LKOA 1ZW1A 1BEUB 4V03A 4XWGA 5EKDA 3D6JA 1AK2A 5JECA 1B8VA 2ZATA 3E5RA 1FSZA 2X4IA 3KAKA 4HTAA 4HWRA 4Q3EA 3IB6A 4ZO8A 1EDEA 2X0IA 3P20A 4ND1A 4EF6A 3L07A 5HHTA 3KQUA 4R98A 2HHLA 2ZG6A 1HK7A 3HP7A 3NRBA 5ALPA 4P35A 1WMEA 2VZ0A 2VO1A 4WEQA 3W5UA 3WGOA 2HA7A 2CVFA 2I7DA 2Q9BA 3BGDA 3IR7A 3X1ZA 10MHA 1ZGBA 4HDSA 2XODA 2H7VA 3NNSA 3FBTA 4Y67A 3RF6A 2XDAA 3I4CA 4OKNA 3QWBA 4OUDA 3TTXA 1L5RA 1ZCZA 2J09A 1MO2A 2JI4A 3DNPA 4NCAA 4P7FA 3BN3A 3L7MA 4TLBA 2Q2NA 2CLSA 5E8RA 3RIHA 1RABA 2V6MA 5HK9A 4LNUB 3JQPA 2V55B 4GUAA 4ND8A 4P84A 5IU6A 1H6BA 2O1XA 5F9FA 1Z7WA 4I6GA 3RREA 2PR2A 1RI2A 1TT7A 2BGIA 4KQIA 1ZITA 3EVNA 4RY8A 4NESA 1YHYA 4AWXA 3AEZA 2EQ5A 4YXWA 2DHQA 4TMFA 1BOOA 1C30B 1JV2B 1ZUNA 5I7HA 3L7KA 1W96A 1PR5A 1CNFA 1IBCA 4P32A 1KWGA 1JJBA 1MQ8B 4ON9A 5F5LA 1UKAA 4BVLA 4MW4A 3AM5A 5JI3E 1I32A 4JY7A 1I51A 2Z5FA 3SZOA 4IHAA 4MUNA 3AEUA 1DT5A 4CIWA 1KEUA 4KO4S 3WLOA 3HU2A 3FWNA 4GP9A 1XB2A 2J1LA 4XIIA 3WZ2A 1JLMA 2KLHA 4QDXA 3DLHA 3PRJA 2NW6A 4RHFA 4Y2VA 2Q7DA 4BFUA 4CQNA 2R6GA 3E81A 5A3SA 4RVGA 4PAOA 2G0NA 2FPMA 1MX9A 3DLBA 2JGNA 3G0IA 3CF4G 1E2LA 2FNAA 5H68A 2HDNB 4ZMRA 3TH5A 5FKJA 2ZRDA 1KDPA 5JCZA 4C01A 1DAEA 4IWXA 3WWZA 3BSWA 5D6OA 1M1XB 1AKNA 2BGLA 4PQRA 3GJSA 5SYNA 1J2YA 2AW5A 3LUAA 4E1AA 1NF3A 2GT1A 3O93A 4MDHA 1OFTA 3MTGA 2XRZA 1WLYA 2YHIB 3LF1A 1PI3A 3H42B 5AESA 3HCFA 5KX5B 2E48A 2OZLA 2W6JD 3R9IA 1E4VA 3IALA 3OFKA 3GIWA 4DMLA 9GPBA 3WLTA 1G42A 2GJSA 4HSGA 2PKYX 4EHJA 4MLDA 2B7BA 4X97A 4AS2A 3HXPA 3K73O 5JQGA 3PUWA 2MDTA 2KYRA 1G5FA 1LI7A 1B0AA 2PEYA 1H5NA 4M9QA 2TRSB 9LDTA 4MEBA 4DWOA 4ESVA 1TLFA 2LKDA 1VIMA 1HQCA 4CNBA 4M54A 1BFUA 1SUFA 2HQOA 5FBKA 3IPLA 2EFDB 4UAUA 3T5DA 2HR1A 1XLWA 1ZVMA 3CBGA 3GVIA 3ZCQA 4PX5A 1L3CA 1A76A 2PL9A 2ILTA 5C53B 4HNGA 2YHUA 1LI5A 3UHAA 1U2GA 1OI7A 3SIXA 4ETIA 2O48X 3TB4A 2QGNA 3H7AA 1FSPA 3ZCSA 3QZUA 2FP4A 2OMEA 2VTEA 1F8XA 1UFOA 4M1OA 4TTRA 1SM4A 3AR3A 4ND6A 2L82A 4GI1A 5K2OA 1RTKA 2HGSA 3SKXA 2A3NA 1R0WA 2WJ6A 3K9LA 4TSKA 4CV0A 3GLSA 4KBGA 3WK9A 5AHRA 1B8OA 1JGTA 4FXOA 5PNTA 2ZW9A 4B46A 2Q4RA 3U31A 5JRZA 2W4IA 2RIRA 3DZJA 3ONVA 4KSCA 3D2CA 1CLEA 2H0QA 2VIIA 1M0WA 4DGQA 1YIAA 1CR1A 5AKGA 5L53A 3N3AC 4Z51A 3RS3A 1WM1A 3ZZTA 4PANA 3KL2A 1DMRA 4QNNA 1Z7GA 1WA5A 2P6MA 2P41A 4EL0A 3F4LA 3HG7A 3ZC3A 1USWA 4DSOA 2HRQA 2QMYA 2R00A 3HEBA 2YMMA 2BP7B 3OLZA 5TV2A 3HWRA 3IA7A 3D7MA 4CEJA 3R0QA 1RP7A 5ULLA 1LVGA 1Z34A 2WWWA 2Q21A 3WLSA 4Q3LA 4B82A 2DFLA 4NY1A 5CU7A 4JVLA 5CG1A 1AD2A 5JCJD 4TS9A 2YDYA 4TSFD 2QLFA 1HFEL 4I9HA 4M55A 1WEHA 1OBFO 3W78A 2R6AA 4RHYA 4CKCA 4MEJA 2WHXA 4WA7A 1TW2A 2NPFA 2FB9A 3LQYA 5AW9A 3DVAA 1BA2A 2PUHA 1M8PA 4LJ6A 3QTLA 3FWZA 2IYOA 1RYFA 2Q29A 2WP0A 3DLTA 1VDZA 1DIGA 3LC2O 4WOPA 4OXXA 1T8WA 4RENA 4ATNA 2PPVA 3ID6C 4DYVA 3EH1A 3FUCA 5JJBA 1Z2OX 1EFRA 1ZEJA 4F6LA 3R0JA 4HYEA 1NVFA 3I9LA 4W5HA 5KYYB 3K8YA 4WQMA 2VTBA 1DP4A 1NDUA 5BMOA 3N2YA 1Z2AA 2NADA 4JITA 2VHCA 2VHTA 3DEZA 3BRSA 5EP2A 3WOHA 1KQ3A 4H3VA 3NIBA 4BVJA 5I8WA 3OZAA 2NTVA 1UKYA 4LZZA 5EIBC 1WO8A 4OU5A 3BVPA 3RV3A 4ZZ3A 2JGKA 2X23A 2FOIA 3IVGA 3E70C 2BFFB 2V4UA 3VVLA 3TBFA 3LKDA 1K88A 5JSYA 3L7IA 3LBYA 2F64A 1CS4C 1P0IA 3UMJA 3VSAA 3CW9A 3EJWA 3GFBA 4CR6A 1Y4UA 3R75A 3TRKA 2ZB3A 3O2SB 1N4AA 1QV7A 3EYAA 2HF2A 4I55F 4HMOA 4NBTA 2Q6LA 4OBBA 1D2NA 3L7LA 2CXUA 4XKJA 4I6EA 1O57A 4IHKA 1XRPA 3TSCA 2PMFA 2ZTLA 4Q3BA 3VPFA 2F55A 2Q6TA 1TUBA 3OT1B 4TRJA 5JS8A 2EARA 3HRKA 1T2VA 1N32B 4PC7A 3ETEA 3VHXA 2QJWA 4C5AA 1MQSA 2J9YB 3Q7QA 4JL6A 2EJCA 3MMZA 1E5XA 1X39A 2VSOA 3K05A 2W2QA 2DVMA 4ZAGA 1L5HB 3Q15C 2C7PA 5GZ6A 4IW3B 4IIYA 6ADHA 1OF1A 1YRBA 3RC2A 4OGKA 4G1MB 1AKVA 4JUBA 4EVQA 4IINA 3RC1A 1W29A 1JXAA 1DBSA 3SVTA 2Q1SA 1MP0A 3VNUA 3DDSA 4NCHA 3QE0A 3WP1B 2A9KA 1EJ2A 2DWQA 2VRBA 3ZY5A 2FFRA 1E7QA 4G1BA 6REQA 3TECE 3SQLA 4RZIA 3NQ41 4OXQA 2Q7XA 3IUQA 4KLZA 4GPAA 4N54A 2AOUA 4N41A 4NNOA 3Q9NA 1X1EA 1KZ4A 2BMVA 2OXEA 2PZFA 1P1HA 4TL7A 4YBZA 1P33A 3KXIA 3K5IA 3KELA 3CLSD 4P4UA 4LC9A 3GNQA 3V8QA 1QM5A 2ZYDA 3OX2A 1ZH2A 1GPH1 5IC6A 3WLJA 4A8HA 3TNLA 1LK5A 4YCSA 3LLUA 3Q3IA 3OECA 1ITZA 1I5RA 4L7VA 3AY7A 3WZLA 5A4MS 3L4BA 3RYTC 3CNQS 3IJPA 2L18A 4PHCA 3TN7A 1VGRA 4CMJA 3HYNA 4GI7A 4MWZA 1F1JA 5BSMA 2J41A 2Z30A 3DFMA 2E4YA 1WABA 4BMZA 4AECA 3V9PA 2OK8A 3T1OA 1X3SA 3I6YA 5LQAA 2VKTA 5E7IA 4RD2A 1X1CA 5I9LA 1T2NA 2H1CA 3OU6A 3T7AA 3D7NA 3UT5B 5AICA 4F4DA 1GDDA 2Y1FA 1KQFA 4JYAB 1JVNA 3BCRA 1XV5A 1VL2A 4I1IA 1GQOA 1H5QA 2Q3MA 2DG2A 4E2ZA 2IU6A 2X2PA 2C3OA 5H8WA 2D0IA 3IERA 5E2AA 4AMVA 4JX9A 4ZVTA 3OIGA 2B37A 2IYZA 4OHZA 4A26A 2Q8QA 1KAMA 3DWIA 1YRWA 1J2TA 2GR9A 3QHAA 4EZIA 1BC5A 5E9AA 1ARZA 3DZIA 4EARA 5BPFA 1RZ3A 1V9CA 4QWMA 5LA6A 4DBVO 4RMIA 1LBSA 1RYBA 3AYZB 4EA8A 5C7IO 1BOFA 3SM3A 1TW3A 2W8ZA 5SZKB 5IKMA 1V7QA 3SEQA 1H42A 3WOVA 1GTRA 4E33A 3D43A 3K1TA 2IXBA 1DBVO 2OQIA 4JJ6A 5LWHA 2ACWA 4ZTBA 2H4FA 3OQMA 5KUTA 3PTAA 5IUJC 1C8BA 3H6KA 4X6XA 1NNEA 1N7JA 4DV1B 4R81A 1LBQA 2YV1A 2E4VA 2QM3A 1Z4QA 1RQ2A 3NATA 4G0MA 4G8JA 1E9FA 1FRZA 3V8RA 2P9ZA 2DHRA 3TQOA 3L77A 1YBVA 4QLBA 4FS8A 4CBVA 4F5YA 3U6KA 3VNVA 4EUNA 1YONA 1EQ2A 2IYQA 3OOHA 2GKSA 4HGOA 4J1NA 3TAXA 2PV0A 1LY1A 3LYHA 4EI2A 2BCGY 2WV9A 3NT5A 2B0CA 2C54A 1PQWA 1P2UA 1CQZA 2EX0A 5D5HA 3GBVA 4JB2A 1ODTC 3EQ6A 2HBRA 4YHBA 3LQRA 4N5HX 3ZN2A 3KQNA 1TUGA 1TGYA 1ONNA 1Q19A 1SC6A 5DXAA 1H6AA 4MKRA 4DV6B 3P0EA 1RRMA 1NXQA 4YV0A 3IEMA 2NYAA 4L8YA 3H0EA 2ZE7A 1QH9A 1ZVVA 2FLKA 3ZS8A 2HWXA 2BISA 3P0IA 1VB3A 5HK8A 4HF7A 1Z29A 3RVNA 4AZ3A 1YL6A 5A7FA 1KEKA 2OV4A 2P35A 1YSCA 3QXSA 1Z4NA 5IK2D 1XU7A 2XDWA 3GZJA 3HKDA 4FJ0A 4LPKA 1QGYA 2D4AA 4DM3A 4EGSA 4NE7A 1ZQ9A 4DQLA 1QO7A 5A4FS 1RPZA 3MGKA 1NUSA 2O50A 3VZRA 4EGQA 2J9RA 1VHLA 4HHEA 1C0IA 3RUIA 3UAZA 4TYQA 1SUIA 4U02A 1E9RA 1VL5A 2FEPA 4LSGA 4RGVA 1LRJA 4X1OA 4I36A 1ECGA 4LF9B 3ZD7A 3F47A 1TEZA 1L4GA 4JQZA 4AF7A 4DQKA 2M6SA 5GV8A 3AW8A 3SYKA 1R66A 2Z0MA 4F12A 1LB1B 4PW0A 3L6BA 1LBHA 2G04A 1A4RA 1JHOA 4GQBA 1A9QA 2C96A 3DT9A 2X8LA 3KVOA 3TIVA 3PYLA 4D0SA 1V1JA 1CEQA 5CYPA 5H3CA 4WJZA 2YC4C 4V0ME 2PK3A 2O0LA 3E6AA 4OHVA 5AKKA 4B6PA 2Q2WA 2CLCX 4LXGA 2QRUA 2P5UA 4ZJZA 2AXPA 1AXRA 2LDBA 2C2ZA 1BN7A 3ESQA 3L0SA 1NC3A 2MSCB 4Q12A 2HA5A 3ZW7A 3ZJVA 4X24A 4X1IA 5A71A 3SXUB 4EPYA 4B3MB 4N0QA 1SMKA 4C7OB 3HCDA 4PWYA 1IOVA 1FTNA 2J0UA 4P9NA 3C5EA 2VDLB 3DLAA 3X1YA 4FB4A 4CQLB 5A7HA 4K7JA 5I4KA 4NECA 5HS6A 3EVZA 3SD7A 4BRZA 3M1AA 4UTRA 2JLXA 5JOQA 5AVKA 5HMMA 4RGBA 3NTQA 1ZIPA 4AYTA 2WP8J 3TMAA 1L4BA 2ZI3A 2VTBB 2V3VA 1VA5A 3JTEA 5DBHX 1FIUA 4PE5B 5ENVA 1EJBA 1VSVA 3WNCA 3GEHA 3NTUA 5EUBA 3TNFA 5AXDA 3LA8A 1KEZA 1EUZA 2Q49A 3K16A 4KFRA 4DLLA 1P72A 5AFSA 5CB4F 2HNBA 4LUCA 2CWDA 3QU9A 4Q9NA 3MJVA 3GARA 1RHQA 1U9JA 3RYHB 4QVKA 3AKEA 1GU7A 2GPWA 2QPAA 2QA5A 1Y4SA 1YVDA 3G9XA 3OAAA 3PEUA 4D8XA 1A2QA 2X40A 2ODBA 3TJRA 1ANKA 2C2GA 2TMDA 4EDHA 4MI3A 3HSKA 3JZIA 4IJWA 3KNZA 3STXA 2N1BA 3DMRA 3R2JA 3T7TA 3ZI7A 1XHFA 2GNAA 1FS6A 2UVQA 4BNIA 3KLMX 3UIEA 3UEOA 3EZXA 1RNLA 3EPRA 5TXGA 1KFEB 2HL6A 3M4JA 2IYWA 2C77A 3G49A 4AMBA 4JR0A 1E9AA 5JZSA 5FPHA 5JZ9A 1G7RA 2FR8A 1NSTA 1ZVKA 2WE7A 1Z4LA 2XAUA 3VJMA 1HSZA 3H5LA 1A7AA 1VE6A 3CE6A 3B5JA 3H18A 3CUTA 4DCCA 1Z5UA 5CDSA 2O8EB 3BX1A 4CM3A 1RXWA 1T9HA 3O4GA 3G88A 4KZPA 4DEVA 5EIEA 2W2NA 1Y33E 2Q5EA 3COPA 4H31A 2NSJA 3NTLA 2PG3A 2YN0A 5FOUA 1B00A 1O95D 2VR1A 4IZ6A 5DHFA 3I53A 1AZTA 2Q8PA 1BDBA 3D6FA 4DGSA 3CZAA 2YVLA 1QTNA 3GRRA 5KNLA 3FJOA 4A1OA 3NKVA 5A4AA 5CFNA 1P4JA 4YP0A 3AKCA 1MORA 2VK2A 1ZOSA 2O2CA 4IDGA 1QG4A 4X5OA 3UENA 4RK4A 1B43A 3A06A 4WLFA 3EIHA 2OXCA 1YUMA 3OF5A 1U90A 3A27A 3VSBA 2DTEA 1IWBB 1E66A 1TKBA 3IUJA 3FETA 3MBKA 3EF1A 4ENWA 4ARBA 1JR4A 3NASA 2PZAA 4QFBA 4DIDA 4RV4A 2X8BA 3EEBA 1Y8QB 4TYPA 1ZWLA 3PHGA 1J4AA 2YVKA 4MB0A 3WS7A 1EM8B 4FFNA 4J49A 3UYLA 1YZTA 3IQHX 4PXAA 4ENSA 1RQLA 4FR0A 1OAAA 1Z4JA 3H1BA 4ZT3A 4CQMB 2CCKA 1ZR2A 1FFEA 1PUIA 3QBTA 4JXKA 1LPOA 1BHQ1 4AMUA 4EG7A 1CXZA 4AZ0A 2E87A 4Q4JA 3NDRA 4DA9A 3JCZA 4XGRA 4FWBA 2H9AA 2QX8A 2R48A 3W6ZA 1T3ZA 2CXOA 3GJ3A 3FAZA 3ET5A 1R0RE 5IKXA 1YCFA 3BD8A 4YQFA 1Z06A 3N3BC 4XIYA 1RS0A 1QVAA 1XEXB 2YW2A 3AJ9A 4DT1A 4DDKA 3GFOA 1LPBB 4CTJA 4OUKX 3INTA 1QH0A 3AG6A 3AK4A 3EPHA 1PDVA 4OOFA 5AW6A 2HEGA 3H86A 2X7HA 1IOLA 3FNBA 1GNRA 1L8OA 2COKA 3MJFA 4GBMA 4LAFA 4ZZ2A 1FBNA 2A9OA 5DLEA 4JBIA 4C2TA 3GRUA 1GZ3A 5KTRA 1W6RA 1QYVA 2XYVA 3BL6A 1V8OA 2WK1A 1OBVA 5JSZB 1GPLA 3IH5A 3EFHA 5E1BA 2A9PA 1NG1A 2ERXA 2WKPA 4HVCA 3T5PA 1SUBA 3COJA 3TSWA 3K09A 2CVPA 5LIPA 3VU8A 3ZDYB 1NL3A 4I66A 4KPYA 2FG7C 3P45A 4FD3A 4FFBA 3ZUPA 2O0KA 4F1WA 4J0KA 1SHTX 4BRSA 2BDEA 1M6YA 4H3HB 1T9CA 4YRDA 4BX9A 5G4LA 2F4VB 3DZCA 1XTIA 2GKOA 4DJ5X 5DLPA 1UQRA 1L1RA 3FYHA 1PL0A 4C6SA 4HP8A 3I4LA 1VBMA 2C8VA 2R8YA 3BEDA 5A3JA 4HB4A 4H4CA 3DOIA 4HLUC 5A4KA 3I92A 2M6KA 2XMQA 2H59A 3BWYA 3CSDA 1AS0A 2VNSA 4BWYA 3TD9A 2EAUA 1GGFA 1E98A 3JAKB 1R88A 4ZV4A 2AKAB 3KYJB 4GOMD 4UZSA 2YV2A 2OENG 3O73A 2IZ6A 1GZSA 1K5PA 4OHCA 3H97A 3RVJA 5IJAA 4P6VF 4IG4A 3Q8KA 4E5YA 5DOVA 4EHLA 1NSFA 1VSBA 2ZR7A 4G8DA 5K20A 1KJ9A 1E3QA 2IWHA 2ECKA 1GUDA 2GN6A 1H2FA 1E6LA 4B3DA 1JEOA 1ZUIA 2AFVA 4P82A 2ARKA 2VBGA 3Q4GA 5BXYA 1UZMA 4CIDA 1BE1A 6YASA 1XQ1A 4US0R 2YOFA 3CPHA 3I9FA 3DBOB 2Q4OA 3BILA 4Y3UA 4LHYA 3LC0A 3CZ5A 3Q7IA 5CH5A 1PVOA 4PG6A 4YAIA 3FM9A 1WIWA 5KYNA 3R3XA 2QVCA 1UXOA 2PKQP 4R0NA 5MHTA 2W4QA 3QE3A 1RJDA 2X5NA 4P81A 1P9LA 4RPKA 4ND7A 5AJTA 3VOBA 2PNJA 4WAUA 2CNWD 4J7CA 4F7DA 5IDQA 4EHHA 2G9ZA 3JYQA 5F52A 5M04A 1PBNA 3VUEA 2Y9PB 1NR7A 1U1DA 4MHOA 1BAPA 4CMGA 1YR7A 1AK1A 4YDSA 4JB3A 5JAZA 4QPNA 2ZWPA 4DV5B 4LWZA 1V5FA 1IM2A 2WFZA 3NYIA 4O4IB 2V7VA 4WFQA 1LZKA 3GNSA 1SBYA 2HIAA 4BE9A 1C3OA 1TTHA 1PJLA 2H4XA 5BN5B 1O94C 4KQ9A 1AQYA 2E4XA 3HADA 5HF5A 5F21A 1KJIA 2BUCA 3GVHA 3WBFA 3NKFA 4HRXA 4L9WA 4MVJH 5TEVA 4Z4QA 2NV0A 3AW9A 3K8QA 3DHEA 3PFCA 4KG7A 4O02B 4FOOA 3CWCA 3O4RA 3U7RA 3MXOA 2BW0A 5JYDA 4I5FA 2QRGA 1R9MA 3TE7A 5ALIA 3Q8WA 4CV1A 3PL1A 3DUFA 5JD6A 4QNRA 5AXAA 2GM4A 4JI4B 4UPEA 1WUIS 2VZ9A 1CUSA 1RAFA 4FFPA 4GR9A 4LJYA 3RHFA 5J4LA 1EXWA 1TO1E 4KKVA 1PV2A 5EA2A 2XSZA 5AW8A 1V41E 1KMMA 4UU1A 1JLRA 1T1SA 5I9TA 4GPD1 4J1SA 4MGKR 4BB5A 4R40A 5B1HA 1U80A 3K8ZA 3LM8A 4QULA 4ZOEA 3EPKA 2C4NA 1DDGA 2FAXA 3M3PA 5LOVB 2AEMA 3MAJA 2VHYA 3BMOA 2Z95A 3GLGB 2IOHA 3NUZA 4ER7A 2QY6A 4HGYA 3KSBC 3LNCA 3NBYC 3D4NA 1ZN9A 2AB0A 1FMFA 4QXQA 1D9ZA 4KE9A 1PN3A 1SU7A 4H1UA 1IHUA 3F90A 5TJHA 5TMPA 2UV8A 1EB8A 2IPNA 1T9ZA 3EQ8A 2JCYA 4J3NA 4FEAA 3UATA 1H85A 1AHNA 5DHUA 1CDZA 2HB6A 1NKVA 3PKZA 1A69A 1C3LA 1OJLA 3GPCA 4M1KA 4RA6A 3O2NA 1J9EA 1DTWA 3LIPA 1VPTA 3B1KA 2CMKA 2PGOA 4G89A 4IDEA 4QDOA 3BD6A 4ZVNA 2B4AA 1M76A 1DKPA 4BV3A 4BC0A 4DLNA 4YT8A 3ER8A 3ZIDA 4DV7B 1MB4A 5LP6B 2BAGA 4UU0A 2ZIFA 1E6CA 4TV8A 2NMVA 2KB0A 2NO7A 4HFRA 1M2KA 2OOKA 2Y6VA 4X7MA 3MYYA 4E3ZA 2R11A 4U7WA 3FMPB 2HPZA 2AWOA 5KAMA 3I6IA 5DNDA 4E6PA 5BR8B 1T1EA 4IEEA 4M53A 2IJGX 3A1TA 1RBYA 1LWNA 3BMNB 4JSTA 2ATCA 2P3LA 4BEVA 4P0PB 3AHJA 1OFGA 3HLYA 2XMZA 2GEFA 3EZYA 4NENA 4ILEA 4CMEC 2E7ZA 1YUNA 1RI4A 4JT8A 1S2MA 2YDXA 2FOXA 3BFPA 3JQ6A 3AQ4A 3C24A 4UKDA 3IP9A 2P5YA 4KLNA 3T41A 5GVRA 4PSAA 2M9MA 3A6ZA 4WY8A 2D59A 3EYWA 5GGYA 5GPBA 5THQA 4PWZA 1N2OA 4TKUA 4Q21A 1RYZA 1A9XB 1N2ZA 4JLNA 1T3SA 2G9NA 721PA 4DCSA 1R0SA 3MVEA 3OPQA 3STVA 4KHZA 1HSOA 5KC8A 4MXDA 2CNKA 4XA8A 5KJ1A 5CM8B 5LOVF 5ISMA 1KMHB 1NHGA 1Y3DE 2J6IA 4FC6A 2BV3A 1T1JA 1IJFA 2ST1A 5AO9A 5GMOA 1QX4A 3PGMA 1KPIA 4BB0A 5LQRA 3GAAA 2PT9A 4MPPA 2NU8A 3AUSA 1ZU4A 4DPLA 1ZXXA 4XB1A 1GZ6A 1SPXA 1MU0A 2VJMA 4NMLA 2JLAA 5DVZA 2AA3A 2FSHA 1DC6A 4FMBB 5F7XA 5MFPA 4HQLA 1TVMA 3HVIA 1XYVA 4CF6A 5HYVA 4FDUA 1RWPA 1OPRA 3VZSA 4IIJF 4AZ3B 4C3ZA 5K3OA 3GFSA 2CXTA 2B8WA 3HZRA 3GJTA 1YDEA 2C5BA 3ASVA 3IOEA 3KUXA 1JWAB 4KQHA 1F8YA 1H23A 4HRYA 3FHLA 3NHFA 3UMFA 3EZ7A 1KVTA 2BZ0A 3DMTA 4AN0A 3P5SA 4FE7A 3ORQA 3OZFA 4F1KA 1Q11A 3FHJA 1DQRA 1BWQA 4ZRDA 4CEHB 2JFYA 4RKFA 2ZLBA 2RB5A 1Q1QA 2YNMA 5HILA 1RWWA 3KO8A 3LL7A 1HG0A 4KXYA 4RLFA 4XQCA 2VKQA 1GKYA 1NXXA 1U3TA 2I67A 3UGQA 5IPFA 2COEA 1LQTA 5AM5A 3WK6A 3CG4A 2W58A 4QPDA 4U3JA 2RGNC 3IAS1 5DLQC 2IOFK 1XZLA 3EGOA 1B0UA 3RS9A 1J70A 5D3QA 1O6BA 3CRW1 5E6UA 2BFOA 2JIPA 3SJBA 3C48A 3KB2A 4KE7A 3NVDA 3PF9A 4FBMA 3T5CA 4AW9A 4EY7A 5A4IS 5KEIA 2QVLA 1WBBA 4EKIA 4WN9A 1Z12A 4ZKEA 2FZ4A 4UHHA 5JV5A 3FNEA 3LP5A 1I3MA 5EJ6A 4Y98A 1FDVA 1MJ5A 2QL7A 1C8VB 5AW7A 3T52A 5IYZB 1FNMA 1RRKA 2QAGA 2WOOA 4QHTA 2JHAA 4RGQA 5JHGB 2QY9A 2YWEA 4XX0A 1Q16A 3K9CA 4JI8B 1U28A 2WPDA 3QX7A 4TKVA 4LSZA 3L6RA 2JZNA 2O7NA 2DF8A 3NDJA 3U80A 5K8UA 5EP1A 1FFWA 4OTZA 3D54D 2YMLA 3O2QB 4V38A 1YZUA 3WHLA 1ZCBA 3A32A 1FMTA 2QTGA 4HVLA 1Q3TA 4OLHA 4W7IA 5BR1A 3B78A 3KZOA 4UEWA 1KE2A 3U37A 3H9JA 1E1NA 4AJKA 1NPYA 1GGKA 4G85A 3P96A 4M0DA 3J81A 1WWKA 3P8ZA 4KWIA 4MTCA 3PQ5A 2PS3A 2Z1MA 4LJLA 2EKDA 2DHCA 1U65A 1DAIA 4UC0A 1EWTA 2QZJA 1RQ7A 2NQ8A 4OFBA 4X9XA 1GD1O 1NYTA 4K9QA 1VMDA 5KNCA 2XYPA 4A8JC 2GHTA 2OCGA 3L1IA 2OUIA 2X3UA 2PMEA 3WL4A 2IITA 3REFA 3P1JA 3GRYA 1KVQA 3DZGA 4GRDA 2CLIB 2Y2VA 4UQLA 4ZO7A 3DE7X 1V39A 2FUCA 3QLVA 1DAOA 1R0KA 4PC3A 1Y8AA 1QQ7A 3IIKA 1V5WA 3QH4A 1ZYUA 2B1RA 5TF4A 3UMCA 3LBNA 4LISA 3DO5A 3E1GA 4ZAZA 3VV2A 3L7DA 4REQA 1ABBA 3IV6A 1G9XA 3NPMA 4JELA 1SUAA 3WWOA 5ER9A 3ZY3A 2CZGA 3GYBA 5K0NA 3E9MA 4X8HA 3WKBA 1II0A 1R6VA 4CLRA 4FT2A 8LDHA 1NWHA 3HH8A 4R68A 3DHVA 1CFZA 1N92A 4LYDA 2I8AA 4AQYB 2C97A 2FN8A 2WPDD 1V47A 4JROA 5K1ZA 3LPCA 4PXSA 3R1IA 3AL0C 4ZOLA 2GM9A 1JU4A 2OO5A 3UJCA 4QBTA 1W5BA 2C8JA 3TX2A 3HI4A 1OY1A 2HA6A 3RVRA 3M5PA 3HI6A 4ZYZA 4GWLA 4IP0A 1ODIA 5TMBA 1IHOA 4GMXA 1YOBA 5TVGA 2WDPA 4QYWA 1GTVA 5BMVA 3A1EA 1YH3A 3RVOA 3I2JA 2QSUA 2P9JA 3Q98A 4F96A 1K1EA 1P0CA 1PJRA 1L9KA 4NZOA 2YHSA 4IIHA 4BNXA 2QLMA 3BTOA 1U7XA 2O3TA 3HVKA 4CLOB 1K7FB 5KNBH 4P2GA 4BKQA 4CEIA 1G8HA 4I3GA 4W9NC 5JBIA 1MJFA 3NBQA 4DCUA 4H9GA 2HO5A 2JGFA 1U8ZA 3GFQA 4GMFA 4TV9A 2B5VA 1FYFA 4MAFA 1PQ4A 5KHAA 3REOA 5EHZA 2UU9B 3BC1A 4TKZA 1L3IA 1WHSA 2AOVA 3EVGA 1KVUA 3NCHA 3UHJA 4MKXA 1X80B 2WM3A 1YXMA 4HGQA 2YNMC 4C89A 4EUKA 3DTNA 2FMIA 3DWGA 3JAMA 3KVNA 4O4IF 3NM4A 1AC5A 4L85A 1IZZA 2FSSA 3PNMA 1CY4A 5C8YA 1J5EB 1E3WA 1O9HA 2RH8A 1TRHA 1L5WA 2ZWIA 5EMHA 4B47A 5J4HA 3ICVA 2V3CC 2B0JA 2EKPA 4BNWA 1J00A 3ZLBA 3RIEA 1E3EA 3KR2A 5CYGA 4K3UA 4Y9UA 2A9RA 2OYRA 2VRCD 4TQ9A 1JG7A 4DBZA 4LV5B 4ZODA 3GAFA 1R0CA 3RHZA 2ISCA 1D8TA 4JNCA 4AZTA 2BFPA 5CEEA 2HSGA 1NA5A 1SXJA 2DFTA 2JFFA 2X2OA 2Z58A 2AN5A 4AMYA 2R7LA 2EKBA 5CRIA 1CJCA 2I1WA 1ZC4A 4NCXA 2HX1A 4IIUA 4GI5A 4ZQFA 5EY5B 3ZV7A 1B7GO 2B7LA 2C98A 3KIPA 4IXNA 3JD2A 5BQ5A 4AWAA 4M99A 2RKBA 4QICA 5JVDF 2R3SA 2EP7A 3HBMA 1NVAA 2NO5A 2AKYA 3JWJA 3P9KA 5T6MA 4AS3A 3GLKA 2BRUA 3I37X 5DMHA 4XDGA 5AVSA 3LD9A 4UULA 1ZRNA 3FTFA 2JLWA 1JILA 2C84A 2XYRA 4G6ZA 3S1LA 2VPPA 1D03A 1N5LA 1O9GA 2VL7A 3C97A 2BL4A 1T9GS 4QT0A 3ZIUA 1BEEA 4RETA 3W6UA 4NV3A 3UWMA 5HGXA 1FXSA 2HJHA 4GWGA 2WJHA 1BW9A 2BLLA 3RARA 4E1VA 1UOEA 3UHFA 1PG0A 3HABA 4M0LA 5ALYA 2Q41A 3G2HA 3U7EB 5HJ7A 4JIGA 2VDOB 2YZKA 3KKPA 8ATCA 3L02A 3DOOA 4HN2A 1YL7A 1D6SA 4P3NA 4Z5XA 2XXAB 4F04A 2R25B 2GZ1A 3V7UA 5FTJA 2ZUFA 1KFBB 4EI9A 2ZYVX 4CKEB 5HS4A 1RXYA 3IXLA 4H1VA 2GDZA 4Q4DA 1TAGA 4GU5A 4CLRB 5JLAA 4WFJA 4H15A 2PNFA 2CUNA 4BAZA 2ZI5A 3WLQA 5LC1A 4RAQA 1SRQA 3L6EA 4K3VA 4KV9A 4PPGA 4XLZA 4A92A 1ISIA 1H1DA 1SBQA 4FZRA 4B5LA 1DL5A 4C0LA 1YQUA 4GR5A 7ADHA 5EHXA 4KIJA 3KJIA 3HY6A 3DE6X 4HQFA 4ZREA 4AY4A 2Z6QA 1VIDA 1V16A 3NTVA 4QXAA 3CX4A 1PJTA 3M9WA 3PFBA 5AVJA 2VP2A 4Z1OA 1S01A 2UUCB 4WERA 3Q1LA 1O8BA 1RYHA 2V7UA 2VNHA 1L3BA 7YASA 3UFXA 3VO9A 5IEJA 3QVJA 5H1YA 3B7WA 3CCCA 4NBUA 2X8JA 2PKWA 4F4FA 4C4RA 3PENA 2X9NA 2Q0QA 1MVLA 2ZE8A 1F14A 4BVKA 4BL5A 3S27A 1G6KA 1Z25A 4TGLA 4KVFA 5L40A 1TF2A 3T1NA 1SNYA 1TJ3A 1ZK2A 1MC1A 2GETA 4B2IA 1XEFA 1GKKA 4WESA 2YOHA 1DE0A 4WD3A 3B9QA 3K1ZA 1WDTA 1TX4B 2AS0A 1NFQA 2FZWA 3GDFA 5IN5A 2K5UA 1CUVA 4HLCA 4ZT2A 1M34B 3T3EA 3PEWA 3SM9A 3C3YA 4XM2A 3IUSA 3I28A 2NVUA 1IRIA 3T5GA 1Q1AA 4DXDA 3SG0A 1MHTA 4MQMA 1NYLA 2B8EA 3WWCA 1ILEA 4S12A 2IV7A 3QXHA 4BQEA 3VKWA 1X9GA 2P2NA 1NVVQ 4G0UA 1Z4IA 2F1RA 3LW7A 3PJRA 3G5LA 4GX5A 1KZ9A 1NJ8A 1RPTA 4RPGA 3W1WA 3ZZ0A 4TLEA 4NXMB 2UXBB 1JQKA 5P21A 2QUIA 5EPOA 2GUWA 2O2YA 2ZBQA 3PP8A 4RHXA 3AB3A 2CEKA 1Z8FA 3PWTA 4MGHA 3B36A 3S1SA 1ZD9A 2E2WA 1FC0A 2C07A 2DOKA 5IM4A 4LZWA 4XXHA 4D9IA 3I62A 3DDCA 2Z83A 1KJJA 5DM70 1U8YA 3AP3A 2ZZNA 1ZJ4A 5LJIA 1U8CB 1I3OA 2NNLD 1FU4A 3S8YA 3PPXA 2LW7A 2CD7A 2QTVB 3DPUA 3OCVA 4G2TA 5FOQA 2WI8A 4TTVA 2R60A 4FE3A 2BH9A 4XE5A 5LZ8A 3DS8A 2HO4A 4CM8A 4Z4FA 1RZUA 1SJ9A 3HNOA 4G5GA 5FA8A 1NP6A 1O9BA 5IAOA 2G77B 1POXA 1PUJA 3ZHSA 3ZDRA 2QRMA 1KJ8A 1SQ0A 3KWFA 5LZ9A 1W8IA 4BX2A 2Q1TA 2FPIA 3AFNA 1DO2A 1SUCA 5EL0A 4F86A 2AXNA 2I29A 5B4VA 2NT4A 3AERB 1NXVA 5F2OA 3CLTD 4WXEA 5TT1A 2JLUA 3KKZA 3QA3E 4C08A 1GPAA 5CDGA 3U1VA 3AJRA 4GOND 2PLRA 1VLHA 5L3QB 2JJ1D 2NOAA 2JAXA 5JVDA 3BXXA 1ZXBA 3FWPA 1WB5A 3IO3A 2GD1O 3KOXA 5EEHA 3UW1A 5A5FA 1CQIA 4QOJA 3S40A 1VBKA 1WP4A 5B2EA 2O3QA 4QGHA 1ORIA 3V55A 2G4CA 4Q4LA 4FJ1A 2QP9X 2ZXUA 1FMLA 2PRSA 1TF7A 1JJAA 1MUUA 4WT7A 3DL0A 4E5VA 4EKDA 2O8CA 5J63A 1RIIA 1W85A 3RKSA 3V2IA 2I78A 5DYNA 5ALWA 1UWLA 2PT6A 3KWJA 4AU1A 2ZBDA 4NBNA 3HO1A 4FMPA 3EA0A 3ZVNA 3OCCA 1MA3A 3BBLA 1J97A 4R7GA 3Q0TA 3QX8A 5AT1A 2O54A 3VPCA 5CJ2A 3FIUA 1O89A 5KO2A 5FX2A 4LXUA 4ACBA 3QUQA 1V6AA 4RTMA 3D64A 3EVEA 1A04A 2JFZA 4KZKA 1PK9A 4OA8A 2EJVA 2AFHA 3A4VA 2WF8A 3HLTA 3LUDA 1AIPA 3N0WA 3RHSA 1O6ZA 4F4IA 3A3KA 3MLEA 2QKYA 1T34A 3PNSA 3ET4A 3GG9A 2Q9AA 5C0OE 4CF4A 2HF8A 5MN6A 1S5PA 4YPOA 5H3LA 1XD9A 2M6RA 4HAOA 2P7HA 5LNK1 4F21A 3JAWB 1GWNA 1KDRA 1YNSA 2X7XA 3LX8A 5NLLA 1OMOA 2I1QA 2KPOA 1DSSG 3E4DA 4IUYA 1HLFA 5AKJA 5ILGA 1FJGB 1E3MA 1YDWA 1BW9B 1N6PA 4E2WA 1I7QB 1R18A 4D3FA 1KDYA 3GI1A 1NM5C 2C5EA 3FDZB 1R4AA 4UZEA 1DAPA 5BSKA 1IY8A 1CU1A 3DKIA 2Q99A 3ORSA 5FYQA 1RC0A 4F85A 621PA 3A1VA 4Y18A 5GV7A 2HMAA 5J23A 4E51A 1EM6A 4DDMA 1LUAA 2A78A 1QRTA 3LDAA 4O4HA 5KX5A 1IUPA 4TWIA 4TXMA 4JLKA 4LZJA 4C7JA 2OKGA 2B99A 2PHZA 5CT8A 3WGVA 3O1JC 2YN2A 3ETGA 2WFLA 1E5QA 4Z2YA 1LNQA 4V1CA 1I2MA 4DNXA 2JLBA 4MYUA 4RE6A 1RLJA 3EEQA 1VP9A 2G17A 3FDIA 2ZJAA 3TAHA 2ABWA 3Q11A 1G20E 1Q74A 3AUUA 4NMXB 2ZGVA 1TM4E 1FFXA 4ZT7A 5JMPA 2GHIA 2R5FA 1NAHA 1IAQA 3PQ2A 5CA1A 1XTBA 2FPRA 2HJSA 3KOUA 1VMKA 4J2TA 4KFCA 2VHEA 3BE6A 4L5AA 1UXJA 3AUJB 4NEQA 3DC2A 3DOCA 2R4QA 3K3PA 3ND5A 1Z2DA 4E5DA 3UPUA 3H2ZA 3SC4A 3FBGA 1I1HA 3BH6A 3PTLA 4DA4A 2FZKA 4GFDA 4B3XA 3QVMA 1UZUA 4U0JA 1KYTA 1B8UA 2ZAIA 4F45A 2B1GA 3DFFA 3GDOA 1Z6QA 1ZNYA 2PGJA 1DIBA 1TB4A 1U7OA 4RIIA 3W2GA 5J2TA 1VCNA 2OO5C 3LNTA 1N75A 4UOQA 2F8TA 1X14A 1U7WA 3KOOA 4JK3A 1D4AA 4OK6A 3NIDB 3WFZA 3EXG1 4I9UA 4RNDB 5FLEX 1UJ2A 1BMDA 2O1EA 1LJUA 1XCMA 3L7YA 5EC8A 4N9WA 1RHMA 4YT2A 3U1BA 1CE8B 3TYXA 3F96A 2EFGA 2XXBA 4RLQA 3HPQA 2AFIB 2ZRCA 5KYXB 3CKKA 2HU5A 1MB3A 4KDEA 2X5XA 3CF4A 3JSXA 5D7NA 1QANA 3HXQA 2DMRA 1SG6A 1MBZA 3HYTA 4R51A 5DB4A 5DYGA 1Z26A 3U26A 421PA 5BO5A 3P4YA 2AN9A 2BWJA 2ECPA 2ZWOA 4JBYA 4J3JA 4V0SA 5C5CA 2O7RA 5BQOA 2G06A 3LT2A 4P53A 4R71A 1W49A 3SIRA 1TZBA 4R31A 3RYHA 3WSWA 1UDRA 1T2FA 1T1RA 1XMXA 1IPEA 1MFPA 3VC3A 1W34A 3OT1A 3D3EA 4MIYA 4PO3X 3SSNA 4P3YA 3W7AA 3HCAA 4TMYA 1JHDA 1X7XB 1I13A 1V4BA 3AGPA 4KX3A 3FGZA 1TT5B 4U6NA 5HRCA 3KL4A 4W9NA 3P9IA 4RVSA 2CV0A 2QE6A 1CETA 2Z6AA 3F7OA 1JR2A 2OM2A