3R77A

Crystal structure of the d38a mutant of isochorismatase phzd from pseudomonas fluorescens 2-79 in complex with 2-amino-2-desoxyisochorismate adic
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
205
structure length
205
Chain Sequence
TGIPSIVPYALPTSRDLPANLAQWHIDPERAVLLVHAMQRYFLRPLPDALRDQVVGNAARIRQWAADNGVPVAYTAQPGSMNEEQRGLLKDFWGPGMKASPTDREVVDALAPQPGDWLLTKWRYSAFFNSDLLQRLHASGRDQLILCGVYAHVGVLISSVDAYSNDIQPFLVADAIADFSKEHHWMAMEYAASRCAMVITTDEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Probable isochorismatase
publication title Ligand Binding Induces an Ammonia Channel in 2-Amino-2-desoxyisochorismate (ADIC) Synthase PhzE.
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 70
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 3.3.2.15: Trans-2,3-dihydro-3-hydroxyanthranilic acid synthase.
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3r77A00
2FQ1A 1YACA 2WT9A 1IM5A 1XN4A 3O92A 1X9GA 3OT4A 1NF8A 3V8EA 4WGFA 4L07A 1J2RA 3HU5A 1NF9A 3PL1A 4L08A 3O91A 3OQPA 3O94A 3O93A 4WH0A 3EEFA 3KL2A 3IRVA 3TXYA 1NBAA 1YZVA 3R77A 2A67A 1ILWA 3LQYA 3HB7A 2H0RA 3TB4A 2B34A 3O90A 3TG2A 3S2SA 3UAOA 4H17A 3MCWA 3R2JA 2WTAA
chains in the Genus database with same CATH superfamily
2D3WA 2FX5A 3FUXA 3K53A 4KXXA 4YY3B 3O38A 3CVUA 1IXKA 3B8EA 4D9NA 2QTLA 1F2DA 2JJMA 1D07A 1IJFA 3OEHA 1JFSA 1L6RA 5DLPA 2FSSA 4JP5A 4C3ZA 3IT0A 1HDZA 4AWXA 1E0JA 2FH5B 3EWIA 4B3HA 5AVQA 1WXHA 4K88A 5HM8A 4KREA 3CSSA 3PNLA 4ZCTA 4EFNA 2W0MA 3VOSA 1ODSA 2V7QD 4MINA 2AV6A 1A8IA 5DWVA 2WF5A 1M1UA 3QWFA 1S4MA 4GI1A 2VL7A 1GPDG 1V8PA 2XX3A 3OIFA 4BNFA 1OX5A 2P78A 5CP8A 2D2FA 1RHMA 1UQRA 1DWUA 1CQWA 3MT9A 4DA0A 4HXEB 4AURA 3VDRA 2E4WA 4C0BA 3VPAA 3ZGNA 1GGMA 1D4FA 3D7SA 3M89A 2C0QA 4CW7A 4D4LA 4E31A 3WWEA 1L0BA 2VRCD 1VMKA 1UL1X 1SOMA 2FPOA 1V71A 1YCFA 4KLNA 1T9BA 3HU3A 2XKAA 3PTZA 3R0IA 3HSSA 3W5JA 3OJCA 1LBEA 4CL8A 1ECCA 2GEBA 3ZJTA 2RHHA 2G76A 5F7ZA 3FOAA 4A7PA 2VNSA 3TINA 1VYTA 3QF4A 3CQ9A 4JJAA 3JR3A 4CJXA 1V96A 2W6JA 1KPGA 3C3WA 4MEJA 1CQZA 2X8JA 1RW4A 3EGXA 1U94A 2VP2A 1SKAA 3U5TA 4UVHA 2EBWA 4OI1A 2VSYA 4RDCA 3WLOA 3T3PB 4GDFA 1B0PA 2JRLA 3I1IA 5B1SA 3T7DA 4GR9A 3OEED 2AVNA 2QHXA 1TO6A 4ZA2A 1ZSVA 2VXYA 1KDTA 1T3LA 4MW1A 5DLDA 4KQWA 1XKLA 2QX6A 1NUHA 4KGVA 1RM0A 2P5UA 3FKJA 2NVOA 4C20A 3SWWA 1JXAA 3EIHA 3N7UA 4JJFA 3IDSA 1ZD8A 3ZGXA 5CDFA 4KPFC 3H8VA 4HQ6A 2EIXA 4L16A 5EUMA 2HRCA 4I46A 4G8CA 3C3EA 4DG5A 4H4DA 3QEBZ 1YMUA 1DKRA 2O5RA 5C8YA 5JZVA 1KXZA 3ZE9A 2V4UA 4XVHA 3O83A 1BOOA 4YR7A 5JSFA 1TAUA 3JD3A 1I01A 2TMDA 3QSYA 3DBHA 4PZPA 3A6ZA 4H1VA 4C88A 3EDYA 2FJPA 2B20A 4XFJA 1Y9EA 1GGJA 2PZJA 3U4DA 2JATA 3KYDA 4BFWA 2ZJOA 3R6TA 3EPJA 3KSMA 3NHKA 1ZITA 3T0FA 2I9PA 1VHWA 1CUBA 1VSBA 1MP0A 5F4BA 2HSDA 1X8KA 4TTPA 2R9VA 2FPMA 4IBOA 3GLIE 4RHTA 1RZRD 3OE7D 1Q0RA 3NETA 1SC3A 4NAHA 4D0LB 4QUJA 1IL0A 1WWKA 4L8GA 3ZU5A 1F60A 3T9AA 5FEUA 1MAVA 1OZ0A 4EAAA 2PSSA 1GSAA 4BMNA 3IP5A 2ZB2A 3SHTA 4F3KA 2VRNA 1PKXA 1JA0A 1Y8QB 3A3KA 3AUAA 3PHHA 2YQZA 3L7DA 4IMIB 4P5DA 1R9GA 2FPIB 4PS1A 1LV7A 2E5FA 2FNAA 4KEAA 2M6RA 5JSZA 1K0UA 1QOZA 4CKEA 1H93A 4C9BA 4URVR 1YUBA 3TQQA 9GPBA 4Q34A 1GWNA 2B3DA 1V6SA 2HQBA 4GYKA 2FRXA 3QQPA 4DJTA 2XCQA 3H2IA 1RWNA 1M2GA 4EA8A 4DQLA 3IP1A 4NU0A 1RJWA 2H2WA 1KI2A 1WCV1 2G80A 3ABOB 4CMKA 4FFDA 5HK9A 3QK7A 4I50F 1PTKA 4KO4S 1QGOA 4O2AB 2VTBA 4LXUA 4RNCA 1KPIA 1UZMA 2C4VA 3G7UA 1ZUIA 1H2HA 1JRLA 2YS6A 4JYMA 3GB9A 4IDOA 4MPTA 4QTXA 3HH8A 5DNEA 3OESA 4IZOA 5F1PA 3SKXA 3TZEA 1QVWA 3ACBA 1GSHA 3GLSA 5GZ6A 1E4VA 4D8WA 1ISFA 3PTLA 1SOVA 3HXPA 4Y6SA 3BFVA 1SCUB 1VGQA 1ZRHA 4YECA 1ZM9A 4QOJA 1NQAO 2ZTHA 5TV2A 2FEKA 3OURA 2B61A 3EPHA 1GFSA 1LY1A 1B76A 3HR8A 3I8SA 4LRTB 4WESB 3T7EA 1D4AA 2CSUA 1Z6ZA 3UMJA 3VU3A 4CIAA 2BVNA 2DKOA 4RZIA 4EG8A 4ALKA 3OX1A 4URZR 1KEEB 5AOAA 2LRHA 3OOWA 1J25A 2ZPAA 3UKJA 2QAGC 4CT0A 1VPWA 1EFRA 1NW6A 1Z22A 2VHTA 1ZAKA 5BNWA 5BY2A 1SIBE 2NUTA 2GQ0A 4CMHA 3SLGA 2AXNA 1ZJYA 3QVWA 3RYTC 3W3AA 5E6SA 4CG3A 1YOVB 1AQ6A 4ACBA 3E81A 2OKCA 4OQ4A 2BEWB 3B12A 1CFZA 5LC1A 1WXFA 2C7GA 4RC9A 2QV7A 3WB1A 1KJNA 3UENA 1PKEA 4F4IA 3FTEA 1UM9B 4IQGA 3A25A 3KQKA 2NXCA 1P9WA 4RZQA 1VKZA 2H57A 5AKKA 3RLFA 3TQOA 2DFVA 4O29A 2MCFA 3SYLA 3B1YA 5A5VA 1NPTO 1UEJA 2E4UA 3RVMA 1DIHA 1WZ2A 1GG5A 3AW8A 3JPWA 1YZHA 4MVJH 3MERA 1D2NA 4C4XA 3GBPA 5AW8A 3U4GA 4GLLA 4JENA 4P8RA 2G3YA 5C5IA 1DADA 3VPXA 1UEXC 2X7HA 3VISA 1Y3BE 3NKVA 1X3LA 2A9JA 3LCJA 4LIPD 1R0SA 2R7NA 3QHPA 5HF6A 2X0DA 3NATA 3DO5A 1RDFA 1N5OX 3JWHA 2WF9A 1UIRA 2DPXA 1REQB 2GCOB 4UC0A 4X1YA 1CEYA 3UKOA 1ZGCA 3O8BA 3W1WA 5ARBA 2ZQ5A 2G4VA 2J67A 2JCYA 2NTVA 2XQGA 5KVQA 3IRVA 4B76A 1GV0A 3E7DA 4UVIA 1CRLA 1V16A 3T95A 1F4VA 1DIOB 1X0XA 2HX1A 1LRLA 4N5NA 1EVLA 2QAIA 1Z6YA 1AV7A 4OUKX 2OFFA 2PLAA 4RSMA 3VPBA 4U7FA 1OC2A 1QP7A 1B8VA 2PD3A 2H2AA 4I1IA 2D1YA 4LC1A 3EUWA 4MZDA 3FCUB 1JJFA 3MIZA 4AO7A 1SGWA 4DV6B 1KA9H 1KO4A 2UDPA 4J29A 5EWLA 1PZNA 4HQFA 4FNGA 5LR6A 4RVUA 3FMFA 3GA7A 3WLKX 3ICVA 2ENWA 2CF6A 4G4SO 5FO1A 1I6MA 1F0YA 3TLGA 3U16A 4OP3A 2A3RA 2WTMA 1F8YA 4IIFA 3QKSB 3RFFA 1XVIA 3FMVA 1CUWA 4B3CA 1CW2B 2ZUFA 4JBIA 4JEMA 1JDPA 2J5XA 1N36B 1WO8A 4ZOAA 5FTJA 5EJ2A 3GQBA 3F8TA 4US0R 1J2TA 2R84A 2DB3A 1XJQA 4KI0A 3MWFA 4JMPA 4K6MA 2A6PA 2XUDA 4D02A 1A2KC 5C8VA 3KLBA 4YMHA 1A96A 1A4IA 1E94E 2XJ4A 5CMLA 3PE6A 4MP8A 1ETHA 2QZ4A 1BKDR 1S8NA 2RHDA 1MJ5A 3QKWA 2C83A 4K9DA 2RH8A 3CB4A 3HJHA 5ALKA 3U40A 1DNPA 1IFXA 1OBHA 4OSOA 3REGA 1K3FA 2BI8A 2TYSB 5D5QA 3WMXA 1W5EA 2W8BA 1ZZEA 3AIKA 3TI9A 1VYVA 3CEHA 3LLMA 4H7DA 4IHJA 3GPBA 1I1OA 4GZ3A 4AKHA 1AF7A 2VTKA 2QU7A 2OAGA 2AN9A 3GRAA 1GZDA 2GJ4A 3E8MA 4JR2A 4QTZA 1ZGJA 1N57A 2JIRA 1P9NA 4EM6A 1G21E 2VQFB 3AC0A 2JBAB 2L42A 3EXFB 1FU7A 3TKLA 2CJXA 2JBWA 4ER0A 4MP6A 3UJ6A 5GV7A 5G1NA 3ETGA 4BNNA 5TT1A 1V26A 4UAJA 4CCSA 1QE3A 2CVFA 1L7XA 3BCHA 3OT1B 1QAQA 4CNBA 2JD2A 3LX5A 2QX4A 1VKHA 1A95A 2ZSIA 3E0XA 3FSJX 3WZ2A 1QQ5A 1DBVO 1MRSA 2DH6A 4YJ3A 3OCCA 4HEA1 2IYWA 2XVXA 2XUKA 1SU6A 2DUJA 2FN9A 3LBYA 1QH0A 4OQFA 4RTKA 1B2RA 4ZHQF 1IY0A 3TZBA 1SM4A 1W0JD 3KVYA 1NQWA 3N2GB 4IXMA 5EVJA 3SQMA 2JEYA 2NV6A 4HLUC 2XMDA 5MFPA 5J2TA 2ZJ3A 4UBLA 2IP1A 2JFYA 2ZU6A 2POCA 5B37A 2CXQA 2D0PB 3R8FA 3A9WA 1NYTA 4A03A 2FK7A 4JSRA 1XHLA 4PSCA 5DB4A 1HY3A 2NAFA 5D7NA 4EIWA 1ZEJA 4EHIA 1LLCA 2Q29A 3SC4A 1L6IA 3M82A 1F3OA 3KOMA 1ACLA 5EP2A 4TTJA 4ZAGA 4LX0A 1LD3A 3B70A 1CNMA 3DE1X 3KVOA 4WLFA 1TEHA 2COKA 3JPYA 4DOMA 2IS1A 1M5TA 3BRWD 2X3FA 2CFCA 2VXCA 1CHDA 2JDID 4RPLA 1CUXA 2JVIA 2RKBA 3DHYA 5MN4A 4P4TA 3RSZA 2HY7A 3UMYA 4CR6A 3E0QA 2YCLA 3VTFA 1JIVA 1A5ZA 1LWNA 4GI3A 4BNKA 5K3FA 1QIHA 1I4EB 2M32A 1TTTA 3CLRC 2IOFA 3JQ9A 2V3WA 4Z51A 2ZJFA 3N0TA 5H80A 1TMKA 3K1AA 5AHKA 3FYCA 1KYVA 1RI1A 3I64A 3PS9A 2Q45A 3BFPA 1GCOA 4MB0A 2IW3A 2IYLD 4TTQA 1ZGAA 3PHBE 2BR4A 1QUFA 4UNQA 2PGDA 3VKUA 5AK3A 4QDTA 1RRKA 4RLFA 3QF4B 2MHCA 3ASYA 3HI4A 4JX8A 2HWWA 3F47A 4K6OA 1JFTA 3B1FA 5SV2A 4C29A 2JK0A 3JQQA 2XA2A 3MBKA 2X8JB 1JA9A 1UC9A 3EGXB 2DWPA 3LIIA 1DEKA 5CUQA 5EG5A 3GZ4A 1KRXA 4G1FA 4HBGA 4QYWA 4E2XA 3RS3A 4QVKA 1AKTA 3RC3A 4W5TA 3GJ4A 2FGJA 3HR4A 5KPDA 3TO5A 4YCCA 1UPTA 2ZRDA 3GA5A 4P58A 5LQNA 3JZIA 4B3JA 2CNLA 3E9RA 3H2ZA 5AQEA 1QUEA 1GPMA 1RYZA 2CL7X 4OMCA 4EHBA 2GBCA 4IXDA 5F51A 1RXYA 1JR4A 2JS7A 5EMJA 5IARA 3WC4A 4KMMA 1MJGM 3RF7A 5C8YB 3LPCA 4AMYA 3PF8A 2YQ4A 1YB4A 1AZSC 4PQRA 1JAZA 1MH1A 4R2XA 2MYTA 3U3KA 1ZJJA 1W5AA 1YZQA 3MJEA 4Q4LA 1SR8A 3HG7A 4ND4A 3KYDB 2A2ZA 2QVZX 3SLRA 1SQFA 1YE3A 1GYRA 1EVQA 1W0KA 2OVBA 3CT4A 4LY0A 5DT2A 5AVKA 5B53A 1BFDA 1LPPA 1L5FA 1P1FA 1HQKA 2I6FA 3CG0A 4KIFA 3FSGA 1MPTA 1VSVA 3JRXA 5KNCH 5HW0A 2GBFA 1Z6XA 1EB8A 4W1RA 4ZVNA 4ALNA 4DLXA 2PWBA 5KNBA 4CTJA 1L7EA 1ZMTA 2Y3IA 2ZBDA 3DL7A 4Y6LA 3WFIA 1CR1A 4BBAA 1P3Y1 1Q0ZA 2I65A 3KS9A 1VG1A 2RBKA 3DQZA 5AK0A 5BSTA 3JD0A 3W78A 1SHTX 4N41A 2XDAA 3PNYA 2SECE 3U9TA 3V5NA 3GF4A 5K3EA 4JDPA 4F5DA 1PV2A 4I4CA 5E2AA 1VIVA 2D1RA 1A2BA 2R6AA 2DT8A 4QPNA 5EMMA 3DV0B 4CL3A 2BGRA 1YRLA 1D0VA 5K7SA 2O0KA 4XD2A 5G0WA 2HR1A 4NZMA 1N3IA 4CKEB 4HYEA 4J7XA 1S8FA 4O4HA 3TEMA 1X19A 2V0CA 1NQ5A 5C32A 1AY0A 4Q0MA 3HYRA 1ZGGA 4BQQA 2BM0A 4X7MA 1R7RA 2NPIA 4WBNB 4U2BA 2GFHA 4Q3AA 4D9KA 3ILHA 1NBIA 2ZSBA 4CETA 2VTBB 1NVWQ 4G84A 2V7QA 3ONNA 3U13A 3WNQA 4CN9A 3W0LB 1G42A 4EZIA 4NKRA 2HC9A 4G25A 4MYUA 3L0PA 1QV7A 1ZDMA 3OWHA 1YZTA 8ATCA 5FXMA 3E5HA 3COJA 2OMKA 4P32A 2CLIB 1CKEA 1RYFA 3KPJA 1MA0A 1WPQA 3OIWA 3TGWA 4A8JB 4UNRA 3VSBA 1DRWA 3FFXA 1E6UA 3G8YA 1QYXA 4GM1A 2R8XA 3FCYA 2Y1FA 1WQ4A 3UTCA 4F7WA 3USES 2VRCA 3ML1A 2Y92A 4AY6A 1NPDA 3NTQA 3W2FA 1E79D 4RX1A 4LQLA 1UANA 2FFAA 2OLEA 2XMGA 4P53A 1LUAA 4QYMA 2C4KA 2NOAA 1Z36A 1PL6A 3FPKA 3ZE7A 3PFWO 3JS5A 2J3QA 4NCNA 1QX3A 2PVCA 1PLLA 4G89A 1GRVA 1IVYA 2B4QA 1LZKA 2NUTB 4ZRNA 2R4UA 5CD1A 3PTAA 3KEQA 3CLUC 2XA9A 5BR4A 5JI3E 3BCRA 1XHFA 5GM1A 1HYHA 3DMNA 2D2XA 2CHUA 5E6SB 3KKEA 1N7IA 2DY1A 3U9LA 3B36A 3OZAA 1GLVA 1JPVA 5D3MA 4IQ0A 5J5VA 3NX4A 2W2QA 1CUVA 1CDDA 4E33A 3OEEA 1QIIA 3BD8A 5DGDA 2XWJI 1T0HB 4D57A 3FTFA 4HRAA 5BQXA 4NH4A 3VAZA 3GH3A 1R4MA 1EDEA 2ALJA 2IPLA 2W2KA 3ESQA 1JDUA 5H9VA 2NO9A 3FVQA 4EJ2A 3ZVKA 2HJ9A 1HNZB 5LWHA 2PX4A 4PZZA 3C6BA 4RH1A 2Y1KA 3OZSA 5EXDA 3T54A 5KAPA 4AJKA 3WGMA 1LI4A 1Y7PA 3CZ4A 3EA5A 3VR4A 5A5GA 2OY0A 5JH7B 1K2WA 1VL2A 1OVMA 1JHOA 4WY2A 3VZBA 1LU9A 2E9SA 4JLUA 4JIGA 2GN4A 1M5RA 2MJLA 4HO1X 5A04A 2QPAA 4UVDA 3RC8A 1CEQA 2YCBA 1QTIA 2G0TA 2C20A 2Z56A 2XRYA 3I6QA 3QLTA 1T15A 4L75A 4MARA 4UARA 3RK4A 5K3OA 5K2OA 5FOXA 3K70B 3DYBA 1O1YA 3WYFA 4F38A 3TI7A 2IYNA 1IHXA 3LBHA 2CXPA 2J5QA 2P2GA 4X1YB 1KR5A 2I2WA 3ILXA 4C87A 4X8HA 5IK2D 1VQ1A 2XKBA 4IIUA 1BOFA 3ZVNA 1NYRA 3IQFA 1YVUA 2EP5A 1RZRA 1Z8HA 4KQXA 4BWVA 1V16B 1RRGA 2LIPA 2VCYA 4PAWA 1R0CA 2HCBA 3I2YX 3L01A 2IXBA 3B2QA 3O8LA 4RIFA 1JJAA 3SEFA 3DXXA 4N39A 2CFSA 1TGYA 4JVMA 4LHSA 1V3QE 4WA8A 4QA9A 4LXXA 1QFMA 2AX3A 4MYHA 2RBEA 4MIEA 3EPKA 3HJBA 3HXQA 3C5VA 1Z4IA 1OU4A 1MUUA 4G85A 4UKDA 2EEPA 3L79A 5EWLB 4XCQA 5EJIA 1TZCA 4NOLA 4YAFA 1S9HA 1MGOA 4ZU6X 2CJWA 1MTZA 2V7VA 3H42B 4X3CA 5ALLA 1UF9A 5BO5A 1HNWB 2ZTUA 3REOA 1ZNQO 3RRXA 3TLGB 1GPBA 2J9YB 4J07A 4CL2A 3HV0A 1RQRA 4GX0A 3UW3A 2PH3A 2D6FA 2A7XA 3PNBA 3QFFA 5D86A 3G68A 4YQZA 1OKKA 4N3CA 3FPHA 4QT4A 3ONEA 4JV5B 3H7AA 3GQBB 4HXGA 1QRSA 4OLHA 2VSNA 4R98A 2OO3A 2GZSA 1WXGA 4O8CA 4UDNA 4OHVA 2WIKA 3MMSA 5LYYA 3KL2A 5EC8A 3AO0B 4RL6A 3WWPA 3C8HA 3IP9A 2XRZA 3WGVA 3EY9A 3IV7A 3BTSA 2XCSB 5LNK1 3PFGA 4HTAA 4BO2A 4FHFA 2ZRQA 3H5WA 3R0JA 3O1IC 4KN9S 1Q1EA 1HMPA 3BFJA 2O07A 1BE1A 4M9ZA 4O4IF 4G4SP 1C50A 4HQKA 4A4DA 2W8BB 1NVVR 3EQ6A 3TIVA 1UP7A 1W75A 2R25B 4KP7A 1EVJA 1Z5OA 2HW8A 1ESNA 1MX9A 4OJKA 2P5YA 3WLLA 1R12A 4OO3A 5F1OA 4LV6A 3TKAA 4Q66C 4F2HA 4OHPA 5IJZA 3LTNC 1US8A 2FMHA 1D6MA 2DQSA 3CUEF 4HG2A 1SUPA 2CC2A 4NAUA 4YJKA 4BNJA 1IZ0A 3EGWA 2BM1A 3ZI7A 4EY8A 2YV3A 5AKJA 1LSJA 5JDIC 3MHPA 1KJJA 2YVLA 4F46A 1HA3A 4D9CA 3MYRA 3GUYA 3L0CA 1QIGA 4C2UA 4MP3A 1AKEA 4O4LF 1Z5NA 1MC1A 5E3JA 1ZIXA 4RPKA 4EQ6A 4DANA 1Q14A 4YJ3B 3B6EA 4UMDA 1POXA 3N6XA 3GVXA 3FYTA 1E4OA 4JY7A 4KDFA 2HJRA 4FYWA 2ZBVA 3SK0A 3LGXA 3UXEA 4RH0A 3ZJ4A 2CYBA 3O4VA 4CF7A 1N75A 2AC4A 4EHHA 1GTJ1 2PQMA 5B1IA 3UGKA 2NT4A 2XCOA 4U2FA 3JAKA 2BFEA 4KKVA 3ZX4A 1DLIA 1FW8A 1P2VA 2GAFA 3GJTA 4G36A 4BBJA 5KSOA 4RKYA 2HYIC 3FH0A 2Z3ZA 4KFCA 2TSYB 2P6MA 4KRGA 4KXUA 3CN7A 2AJ8A 4M88A 3UBMA 1ZH2A 4H3KB 3IPCA 2YYZA 3IHWA 3V3KA 1GO2A 2WUEA 2ZSHA 1KK3A 3TEJA 1Q17A 5IM4F 4QGBA 1DS6A 1RWXA 2QMHA 1RYBA 3RUFA 4L7VA 3ZDRA 5EPEA 3OLVA 4B6RA 4PPFA 2RG1A 3NOOA 3SMQA 4ENSA 3DEJA 3MWEB 4P4SA 5JJKA 3LTEA 4MRMA 4UBJA 4AMZA 1U3UA 2NO6A 4MH0R 4HDOB 1G8JA 2JD1A 3DV9A 4MRNA 4GP9A 3ROTA 1Y3CE 5K3FB 3RSQA 3QBJA 5B7NA 1HQCA 3ELYA 2QF7A 1K9SA 1WUYA 6REQA 2HQ1A 5C7LO 3HWRA 3L8CA 4ON9A 2O4CA 3PD0A 2JFPA 1VA4A 4FQ7A 3L0IB 5DNVA 2Q3JA 2Z5GA 1RPZA 1U28C 4RV4A 1VJRA 3L1VA 3D6UA 4RQTA 1OLSA 2YWEA 4OY3A 3CX6A 5EN4A 3W8FA 3JTEA 5KYWB 2QD2A 2X0KA 3CEMA 3WJ2A 5HPYB 2XXJA 3C24A 5IJWA 2Z5LA 3NONA 2KWIA 2WYOA 1Z4OA 5JADA 5DK6A 2C2BA 2GMWA 4KH1A 1OYVA 2IP4A 2VEOA 3O1LA 2H11A 1TE2A 1QPGA 1NN1A 2FUG1 2CLMB 4N0DA 4RADA 4K05A 3RSCA 5KX5A 3OJEA 3UK1A 2BR5A 2DAPA 1QZZA 3DDZX 1E1QD 1RYMA 2EF0A 4HDNA 3PLAE 1B6RA 1U5CA 1T1SA 4DADA 5A06A 2O8EA 2FRVA 2IS6A 5CFNA 2ZJ6A 3U1BA 4IPTA 4V39A 4TUYF 2EFEB 2CV1A 4Z4HA 4QQNA 4MS3A 2PFSA 2VOJA 1ZD4A 2QZPA 5JCOC 3MFQA 3MQ2A 2Q4OA 4R41A 1TMYA 1OFUX 1VKRA 1IRIA 4XIGS 4B6FA 2GEFA 2VPZA 3QUBA 4NAVA 3TMKA 4ACAA 3UT6A 5DN6D 1YDEA 3WJAA 1QJ4A 5JJ5A 3ORFA 2O8VA 3CTMA 3T1YB 4KX3A 1HQDA 3ONFA 4J1TC 5AOBA 5IC5A 3AR5A 1TT5A 1NF9A 1OFIA 1T13A 3CS3A 3QHAA 4HWOA 3FKQA 4MW0A 3S55A 5B7GA 1TW2A 2P3SA 3ZG6A 1B6TA 1KOFA 1RKBA 1QVRA 4D9JA 2DERA 5ES3A 1C30A 3SBXA 1G8SA 1QXSA 1NLZA 5A03A 3IELA 3O90A 4YYZA 1H0KA 1L4LA 3LUCA 3FLEA 4K9LA 4MDHA 1Y5IA 3T3IA 5I7FA 3WGKA 1N0HA 3NHAA 2Q27A 4FSHA 3MELA 4DMRA 4ENVA 3O0TA 4AW9A 4MVJI 4XDGA 5AKGA 4MO2A 1RLJA 4G65A 2K6GA 1H66A 3FOBA 2R8YA 3ELUA 5HZKA 1ZLXA 4QXQA 2W4QA 4Y98A 1NASA 3O8OA 1EVYA 2FX3A 1U98A 4MQMA 3ZE6A 2FQWA 3GJ6A 1LJLA 2WKRA 5CBKA 1W36D 3HP1A 1NV9A 4E07A 4EMTA 3SI7A 2FEMA 2J0EA 2NUBA 3PQ6A 1TM5E 2OCPA 1E1NA 2Q49A 2YV4A 3JX9A 3F71A 4MR7A 1QF7A 1PR5A 1VJDA 1M0TA 3G0OA 1GGHA 1S1MA 1OBVA 3N2ZB 2VCHA 4YT2A 3CIOA 3KE9A 3AF5A 2BFBA 2ODBA 2OO7A 4KWCA 3WHPA 3BRWA 3WTCA 4ENQA 1PR0A 5P21A 2QDKA 1FFYA 2XECA 2ICAA 1Z7BA 1E3LA 1CPYA 3A27A 3L92A 1XLUA 1BROA 1W85A 2JDIA 1V5GA 3EVBA 4TPKA 3PEUA 4WZ6A 4A5OA 5C1PA 3CF6R 1DP4A 3WY9A 4CQJA 3RC2A 2Z6VA 3ZOZA 1KYZA 2GUWA 3THSA 4EPYA 1SPXA 4EVRA 5ANRB 1OB5A 2ZSJA 4XE5A 2G82A 2EV9A 2XYQA 1S89A 2IYVA 3KX2A 3UNXA 4D43A 2MR5A 4XM1A 5KDOA 4S04A 1Q15A 1Q84A 3EWNA 3OFVA 4M76B 2QRVA 1AKVA 1ODJA 1II8A 3DEHA 3P9KA 3Q3EA 4MLZA 4EUNA 2FW1A 1D09A 2WHYA 3NDBB 3FWNA 3G17A 4S3MA 1QYIA 4MDFA 1V9LA 5TJHA 1M1NA 1YWGO 3FHJA 2QQFA 3D1JA 3O8NA 3D6FA 2GJSA 2IFTA 2E82A 4UCQA 4WCFC 1VI6A 3BOSA 2ZJ7A 4N8SA 4R3WA 1WB6A 1OWNA 3AL3A 5KC8A 6AT1A 1Z08A 5IFLA 5JALA 5D3MB 4OMDA 5LA6A 1O6FA 4UE2A 4UTPA 2AYZA 2XLCA 1PUIA 2JGRA 1GKLA 3SEZA 1TEVA 2GM9A 2YMLA 4FCWA 4BRWA 1T6BY 3M6LA 2VPWA 1GZHB 5IVHA 2C5SA 3D2BA 1T9GS 1R4MB 4WFKA 2J9GA 2W2KB 1PWXA 4MLDA 4MW9A 3L07A 1PVOA 1E9AA 1RYHA 3PZRA 2W2XA 1UWCA 3Q1KA 4QOSA 2RHTA 4MUFA 4UNSA 3T4EA 3TPZA 1EA7A 2QB5A 3AGQA 3SZLA 4B4KA 3L7BA 5KBYA 3Q0TA 4BGIA 4DR3B 1E3MA 1JEYB 1IXZA 1KBOA 2DR0A 1PFQA 3W5IA 2WSMA 2YZGA 2PG3A 3L40A 5CGQB 4LBVA 5CT9A 2GXSA 3I8OA 2VF8A 2FOIA 2OYRA 1I4DD 3C1OA 1I94B 3VOTA 2YJ3A 2DZDA 4UEQA 1CLEA 4KITB 4H3SA 2O7VA 3HFRA 1PQWA 3KBOA 4Q3LA 2O1SA 3H1AA 1YTLA 2E2WA 5FI3A 1WKVA 3ZNNA 1X92A 2R8PA 1A9YA 3V2HA 2Q5CA 1DQYA 2YFYA 4OFZA 4OXYA 1OV4A 1S01A 4FOTA 4OP1A 1HFWA 4PSVA 4V0LA 3W2GA 2XCRB 2RH4A 4B7UA 1KR2A 2HK6A 3K5IA 1ZK1A 2C42A 2NUPA 2BGMA 3ZJ5A 1BCRA 5HEKA 4GBJA 4ZMRA 2LCIA 3CFYA 4MPRA 4IM7A 4QUGA 4G8DA 1NULA 4UDYX 2Y66A 3S4YA 4U8HA 5EY5B 3IAHA 2RJNA 5D6NA 5EWMA 3RT7A 2ASVA 4D2IA 4CQNA 4KV7A 5ALFA 3VGPA 1DMSA 3IIKA 3QXSA 4LDZA 1OPXA 4WKOA 1IOLA 1LA2A 2YWGA 2DSNA 2ZCUA 1R0WA 3D8RA 3UCEA 4FYJA 1SHJA 1VB3A 2DC1A 1XYYA 4N03A 2Q5EA 2CJWB 2IOQA 4PGGA 3NIGB 3P94A 1JFLA 1O58A 2C7PA 2V3VA 3CG4A 2Q4EA 2ZUVA 3CUVA 1EKXA 3NIFB 3OZFA 1SAYA 1A9SA 1IN7A 2RJ3A 1PO7A 3MB8A 2NSLA 3NTRA 3Q9SA 4Q3KA 1TKRA 3SXPA 3V7FA 5D51S 1Z2OX 2WOOA 3H6GA 4PCVA 2Q50A 3A0UA 3QW4B 5CPBA 4F3CA 3AJ8A 3PSAA 3H11A 4FHDA 1YOBA 5AVXA 5I9LA 4E5UA 4OQLA 1B41A 4I7EA 2ETXA 1QQ7A 1UK6A 1QRAA 3PXDA 2ZE7A 3NHLA 4IIJF 5DP2A 5J40A 2QE6A 4E5PA 3CRNA 3QE2A 1YRHA 1VJ0A 4NZZA 4OX9Y 2WE8A 4L9RA 2R6JA 1WEKA 4IX1A 4E22A 3LPLA 3DFKA 3R0ZA 3GEBA 2NU6A 3KCQA 1ULAA 3D4LA 2I7XA 3ROPA 3HVRA 1G64A 2VAMA 3E1GA 2XB6A 5BP7A 2MDTA 4R69A 5FI0B 3BWCA 3ZGLA 5CDSA 2JJ8A 1DXYA 3OIDA 4MA0A 3ASUA 3RAPR 1TLLA 1UAGA 2OXCA 2PKQO 3OPMA 3TH5A 1E79A 1PWHA 3VZCA 2HNBA 4QDZA 3PX7A 4ZV9A 4ZZ3A 3QXXA 1KZ1A 3W7AA 1NLYA 4GYYA 3NTOA 2UUOA 5F21A 3N2YA 4W9MC 2XF8A 3FW1A 2DFPA 3LUKA 5G0SA 1ZD5A 3DEFA 3ZTWA 4DLLA 2EP8A 2IHTA 2WNSA 5JJBA 4KIUA 2V5AA 2CBXA 3BL8A 2YWJA 1VP3A 1FTWA 3PWSA 4GC5A 3T7CA 4B6JA 1YRQA 3DO8A 3ANXA 4JOQA 2P9FA 1OT5A 1JEOA 3TCKA 1NG1A 3O93A 1N9GA 2EFCB 4JT9A 5CBPA 4POAA 3V55A 4B6OA 4E03A 3L0BA 3DE2X 4RKFA 3M1YA 1ZMOA 2I5PO 3RHTA 2JI7A 1T6XA 4JBYA 3VNAA 1H4VB 3MA0A 1EUQA 2AOUA 2QVBA 1IY9A 5L3ZA 4CCAA 5EIXA 1QQAA 4YCMA 3ROKA 1NNUA 4UHKA 3JRNA 4KMRA 2D5AA 3B3GA 2MYNA 3RBXA 3JAKB 2BFEB 4CR8A 3TBHA 2XT6A 1VHTA 3CCFA 3LBIA 3OPYI 5EHIA 3NPMA 1K8ZB 2OD9A 3ZW8A 2VXOA 1KZ6A 1R0LA 3MXOA 2CT8A 3A06A 5AI4A 3TB6A 4YR9A 2BMJA 5ARDA 3GQVA 5IT4A 1J8MF 1IU9A 4FYIA 1GVHA 2WFZA 1KY3A 1C8VB 4XVRA 2PD4A 1HBJA 2Q5FA 4YHBA 1IN4A 1W94A 1CUIA 2VAVA 4P4SB 4MRMB 4TSKA 4MGKR 4DUGD 3DCYA 4Z3OA 3JD4A 2BFCB 4PZLA 3ZC3A 5KWVA 2AFRA 4GI5A 3BE6A 1L4UA 3NORA 3NKFA 1U80A 3KOYA 3R3VA 3RG8A 1S5PA 1Z4QA 3H1TA 4WUVA 1OTYA 2FWMX 5D2CA 3QUSA 1K66A 2BRUC 4CQLA 4RQAA 4ZYXA 6REQB 1O5TA 2H2HA 2NZVG 3OUUA 2DUMA 5JCPA 1OSNA 4LJ7A 4RGYA 1LTKA 3IDAA 1LPNA 4AAYA 4L4YA 3D02A 3FPEA 3GL9A 1OLSB 4HX5A 3KSBC 1AQJA 4AF8A 1VHJA 5AMXA 4CKZA 5HQ3A 3JTMA 2FV8A 3L0ZA 3EULA 3WP1B 1SBTA 3HL0A 3G6WA 5DI3A 2J3EA 3HKEB 4B32A 4ZKDA 2CLDX 1MO4A 2J46A 3DGEC 1H65A 1UMCA 1H8HD 3F7TA 4WY5A 1N5MA 1A5TA 1C7FA 3A26A 3CRW1 1AN9A 4KAJA 1KE2A 1HR0B 2ZQZA 3JY6A 3AWDA 4DCOA 2R00A 1CV2A 5KX5B 2IQIA 2NW6A 3DE5X 3KSUA 3OMLA 4KQ9A 1XTQA 2EF1A 3LVBA 4HDNB 2VIIA 2O8EB 4FW8A 1XDZA 4GX5A 4MEAA 1PFUA 3UGTA 3EPPA 1FFXA 1NI4A 3BCUA 3KZXA 3MJCA 3PNKA 1EFVA 2C97A 2Z5FA 4MS3B 4ESHA 3I2IA 3GCGA 2WU1A 3EG5A 3FBTA 4MVJG 1RM5A 4KQCA 2ZSAA 3GAAA 4OI2A 4AKGA 1YIAA 2ZBGA 5DDIP 5BSRA 2ZUEA 1U11A 3C8UA 2QTFA 3TW0A 4TRNA 1J56A 1DTWA 2VNHA 3FOEC 3I28A 1KVSA 2JFVA 3Q7EA 4BMOB 4C2BA 3AB7A 2B35A 4E1VA 3HVIA 2I9KA 1QIMA 3GUUA 2QVXX 2MSLA 1QGUA 3BB4A 2VHYA 2NXNA 1IEWA 1M1ZA 2CDCA 4GLOA 4IXTA 3LPMA 2BKEA 1GL6A 1TKBA 1MIHA 1C30B 3FCOA 2ZRCA 3HSKA 4H3VA 4OPMA 1TDJA 1LDMA 3SF8A 3UTDA 4AD8A 2OHVA 4RW0A 1AT1A 4MW5A 3RSOA 3M5DA 1ZLYA 3DFMA 5AJZA 5A5EA 4A82A 2FWJA 3DTYA 3AX6A 1UPCA 1CUYA 3D2AA 3JWJA 2ZUTA 1ESZA 2WSYB 3V4ZA 4I9UA 1O0SA 4Y2UA 3OQHA 2AD1A 4UBKA 4YI5A 5FEMA 1XROA 2V6IA 4R9RA 5TJ9A 2IRWA 1ADJA 1ZUD1 1XZ8A 1QCZA 3PXBA 2XGSA 3LY9A 3I9V1 3ZWXA 5JXWA 2HT1A 1KJYA 1T4DA 1L3IA 2PGOA 1VLVA 4KJXA 4L4SA 2XZDA 3EEIA 1UKZA 3NBZC 4RETA 2IHZA 2N46A 1BH6A 4J0JA 4DXAA 5JY6A 4K6FA 4KQFA 4LF5B 2LV8A 4WXRA 1L5SA 4WFIA 1WVIA 3N8NA 4EJ6A 1XZCA 2WJHA 4C3OB 2B4KA 3A70A 4A92A 1KMMA 4D0NA 1YVDA 4P54A 3J81k 2DCMA 2O2CA 3I34X 5JFOA 4MR7B 3K30A 1NWHA 1QGYA 2FETA 1SA0A 2D8MA 2VUTA 4LZNA 1Z7EA 4LUCA 4B44A 3K31A 3EXEA 3PC8A 2OHFA 4M7RA 2MTBA 1YS7A 2EOAA 3BMOA 2LNDA 4Q9DA 4KOAA 3C4JA 5HYVA 5F1KA 2O54A 1G291 2GBLA 1W85B 4LKOA 1N2SA 3MTIA 1GZUA 1QIKA 4LDNA 4XIIA 5E38A 3TJZA 5J4LA 1H2EA 1OI4A 5HMMA 5BMVB 1R0RE 2IGTA 5I7UA 3H13A 4WVFA 3T5DA 4TKZA 5JQWA 1M0WA 1I7NA 1TVCA 4WGFA 4YV2A 3CLVA 2ZW9A 1K92A 2J4DA 2ESRA 1XL1A 3AXSA 3PPXA 1C4KA 4UULA 3RKSA 1MJFA 1DLJA 3D6JA 1N7HA 5I9SA 2W70A 2QRVB 2G40A 3IV9A 1II8B 3EZYA 4H3HB 4Y2VA 2Q62A 4B3TB 2G9UA 4EJMA 3LDFA 1E9RA 2VXBA 1UC4B 1QFZA 1GZ3A 5EMLA 3WLPA 1M1NB 4OL9A 4ROSA 3LWZA 2XUFA 3VR1A 1Y42X 1G8KA 4R2JA 4D92A 4EY4A 2AJTA 4URUR 1VIYA 3FVVA 5KPJA 2MYPA 4UTOA 2Y05A 2Y0PA 1GTMA 1YZKA 3AVOA 4PHGA 1KTIA 1YR8A 5LA6B 5IUJC 3DMPA 1M74A 3K32A 1GNQA 1O9GA 1UBEA 3G1TA 4GPEA 3F5SA 3R3HA 3VPHA 4A6EA 1E1QA 2IYOA 1FS4A 4MXDA 1HE8B 5UKDA 2XDYA 4QULA 4OKNA 2WM3A 2X4IA 2VYFA 1XLTA 3MJ4A 4DIFA 3I6IA 3KIPA 2GYUA 3LW8A 3NM4A 1QF9A 4G5GA 4WD3A 1JEJA 2VAPA 4AXXA 2PMBA 4BGEA 2IBTA 1RAEA 2WVJA 2IUUA 5FWNA 4A3SA 4U7JA 3AM4A 2VWQA 5I7SA 4GD3Q 1N2CA 1Z0DA 3I5AA 5JS8A 5KVCA 1G66A 1UPFA 1DTSA 3F7MA 3BWVA 4FWIB 5DN6A 5I7OA 1L7NA 3T35A 3L8HA 4BY9E 4Y2JA 4Q00A 1KPHA 3PRHA 3QVSA 2APJA 1L5LA 1WSAA 4QYSA 1C8BA 3JQ6A 4A6PA 2C2XA 1IYZA 3PFKA 5GJVC 2YUTA 1HYQA 4KRXA 1Z2EA 1RJDA 4YRLA 1FJ2A 4S1OA 4YIKA 2A5FA 3DL0A 1YUMA 2HA3A 4JBLA 3BB3A 4FZJA 1S7CA 5JAQA 1CBUA 3AVQA 2X5OA 3EMKA 4LZOA 5CT5A 2NUPB 3A3NA 4YLYA 2XWPA 1BCRB 2FWAA 5PNTA 4XWKA 5TMDA 1OI2A 4GRDA 3JARA 4JUAA 2H00A 1JALA 4MUHA 2HPZA 5DX0A 1GTG1 2I6UA 2OUIA 1SXGA 5EWMB 4JWKA 2XE4A 2OD2A 3EDRA 2EFHB 1DKMA 5TGTA 5HVNA 1Z8DA 2O2SA 2WHXA 3N8HA 1MQ8B 4GVPA 4RM2A 5DCWA 3HCRA 1RC1A 4BB0A 1FSFA 4WUTA 4HNSA 1DVRA 4KH0A 4TS1A 2GX6A 4NQRA 5JQGF 5JJLA 1MJNA 4MI3A 3NHPA 2CXXA 3QBTA 4M46A 1XK6A 4DR1B 2H9AA 1A69A 3G5TA 1CY6A 5IC6A 1IG3A 3S3TA 4G26A 5BOSA 3W90A 3TTUA 3ILSA 4JUIA 1W88B 4X91A 1UZNA 1DHRA 4II7A 4NOMA 4PLPA 1J24A 1F38A 1MU0A 1R5JA 1XJCA 3LGAA 4HBZA 5CM8B 4ZT5A 3R9KA 2FW6A 3P45A 3H11B 3H2KA 3BG5A 3I0MA 4YDHB 5LZ7A 3X1JA 1ZSNA 3DOIA 3B20A 4PTLA 5DXJA 4FB5A 1LPBB 5A0VA 4LMRA 2DBRA 1IJEA 1GNPA 4R6XA 1RAFA 3WNVA 4O1IA 3B48A 2YY5A 4P38A 1KFKB 5ENDA 5GWXA 1NX9A 2OUKA 1TLFA 1QANA 4L6IA 1RKVA 4F3YA 4PQGA 1OF1A 1AQNA 1HC7A 3AJRA 2P35A 3DE0X 4IGFA 4DUPA 3EGOA 1KKLA 5EJ7A 3HXMA 1AHNA 3AQ4A 2OP0A 4MV9A 4Y2SA 2WTBA 4XGQA 2FU5C 4UXJA 2I2BA 3V2UA 3BTVA 4V2IA 3D7LA 3LFTA 3WL5A 4IIDA 1A7AA 4FQ5A 4TSRA 2HXSA 3H9GA 4B9EA 1Z4KA 2ZRJA 4F86A 3JQBA 4HAWA 3R3XA 2O06A 3NHJA 4WFJA 1YQ9A 2DGDA 3A7EA 5ERXA 4HAYA 5ER9A 1UXKA 3RIHA 3T7RA 4D0RA 1U31A 2P7IA 4F4JA 2A0FA 3QG1A 1H3EA 2Q9BA 1KI9A 1DRUA 3ICPA 2BTOA 1BX1A 2QRKA 3VNBA 5CBPB 1OQAA 4PAQA 4FYXA 2PX5A 3E7WA 3UK2A 2QYSA 3W2HA 2VCEA 4YV0A 1U6KA 4GF5A 4C6RA 1OBOA 2J31A 2BLNA 4URHA 4DSTA 1JQJC 3NTUA 1JKJA 4HNTA 3GAZA 4PWYA 3OX4A 2B9EA 4M4SA 4WK6A 1GG9A 5BRNA 3ZD8A 3ZQUA 2R8BA 1QU2A 1A71A 3LYHA 3M6MD 4D3ZA 4DSNA 1F2VA 5TMEA 4YJFB 3LZ6A 4OJTA 4J0IA 3CE9A 3SHVA 3N9IA 1A8UA 1V2HE 5BW6B 1U8XX 3S1LA 5JT1A 4EF4A 1U3VA 3B6ZA 1E8MA 4ZEOA 3BIXA 3GJ3A 3GPDG 1I0LA 3HVKA 1Q6ZA 4P86A 3ANSA 1XDWA 3QLEA 4FMPA 5FR1A 2ZWAA 5DBHX 1ACJA 2P1RA 2P2NA 1U8FO 1P2DA 1THGA 3D4NA 2BTQA 1YGPA 4I5GA 1FDVA 2NVBA 1CQJB 1SXHA 2XUQA 3QITA 4C78A 3LDHA 2F43A 3KJIA 3PQ2A 4C1NA 1FUEA 2Y71A 3A10A 4PHHA 2AE1A 2OGZA 5JANA 4OJQA 3LQ2A 1JV2B 2D5BA 4FP9A 1XZEA 1ZW6A 5K2MA 1XE3A 4FDVA 3U3JA 1Z5GA 4AUNA 1UPXA 4EABA 3ERCA 2J3HA 2JGKA 4C7VA 1OPRA 5SZJA 3S68A 4EJFA 3HR7A 1PFVA 4HJXA 4CQLB 4TMVA 5B1DA 1PR6A 1U3DA 2ROQA 3K6RA 1TO1E 1Y9JA 4OUDA 4DLAA 2LR0A 3ZQ4A 1WDTA 2ERYA 1J1ZA 1GVNB 4WFQA 5BQFA 4KRFA 2P0YA 2QD3A 4HDMB 1IM5A 2ZQYA 5IC4A 1M7GA 1YS6A 2J07A 3IGFA 4RSHA 4BGVA 3UGQA 1SC4A 4D79A 3BHNA 4BJ5A 3H9BA 2V1UA 3W5SA 1Z0KA 2X23A 1XAHA 2BSQA 4G0UA 2PKYX 3PG5A 4LJAA 1H1DA 3LX6A 5DI3B 1B8UA 4P3OA 1A1VA 1EG7A 3PXGA 4CV2A 3ZWMA 3K35A 4CMBA 3VOAA 4LF7B 2PEYA 4URFA 5JCZA 5L3QA 1YAHA 3P4YA 5ALXA 3CJQA 1PAUA 3A11A 3E27A 1FLVA 4BYGA 5H02A 3Q9LA 3RFXA 3G2QA 3HKDB 4YX9A 2H1OA 4PLTA 4V2UA 2BFWA 3ZH2A 2D1FA 1RXWA 3TUIC 4CT5A 1NI4B 5JDCA 4J4TA 1CNEA 1EFVB 2FP3A 3GVPA 3CWZA 3CC8A 2YRWA 1GU0A 1QCYA 3HZZA 1A9RA 1I9GA 1PEDA 3M8KA 4S2EA 3PD1A 1CJCA 1NVUQ 3O4GA 3FFBA 4RZHA 1XCJA 3JYHA 3FCSB 1NVDA 4YP6A 4ASUD 3ZOKA 1VJCA 2Y6VA 3DYVA 4LRQA 4RE5A 4BKPA 1JPJA 2FZEA 5E4YA 2UZ1A 3Q88A 4YMLA 1E92A 5EHQA 4H0NA 4C0AC 1SY7A 4INZA 2HYDA 4G0YA 1DTWB 5BQOA 4CR7A 4IW3B 1YIDA 1EYZA 2V0NA 2Y0CA 5AQ1A 2XZOA 1LLFA 3TYXA 1ONOA 2Q28A 2E55A 1QGUB 2ACKA 3L84A 2XBMA 5CH3A 1ISIA 3NVAA 1GQOA 1P7YA 3K5HA 4MKRA 4BQIA 1BE6A 2IY7A 3MW8A 4Q18A 2WKQA 1DAGA 4S24A 4U2KA 5LOVF 3SF8B 1OZAA 3WMWA 4MO9A 2FB9A 4BIMA 3LZDA 4EKDA 2HK7A 3AXTA 4NATA 5B55A 5FWYA 4AP9A 1WPGA 1R2QA 3AFNA 1KI8A 1HFEL 2GN2A 2QN9A 1DOAA 1RIFA 3EF1A 1CY8A 3F3KA 4XTCS 4Z7QB 4FOPA 1Y4SA 4L73A 1FFAA 4D56A 3LX4A 4X8MA 1JZTA 1JF8A 3W4JA 4N4AA 1BX0A 1LZLA 2J5BA 4RCYA 1RPNA 4YFYA 1LH0A 2G63A 3F6RA 2DU8A 3UMMA 2H4ZA 4ND1A 4RKWA 5KHAA 3OFND 4GGMX 2AC2A 3LA6A 3A4VA 4QXPA 1L5HA 2ZJ2A 3VTKA 4CTKA 1L5MA 3PEYA 2R86A 3UJ8A 1GD1O 1CWUA 1NSYA 1Y1LA 1UJ6A 4FDUA 4U1RA 5GJCA 4TT3D 3W6ZA 1WW2A 4EYGA 1Z16A 3KVRA 1QG2A 2O05A 3D9QX 4ZEXA 3N86A 1M2FA 3CZRA 1IIBA 1NXTA 1V95A 4H6WA 5K1ZA 3AVXA 4D26A 1G7TA 3O74A 1XCBA 2WKWA 1Q0SA 1Y89A 2Z1DA 3CGGA 3LMKA 4LVOA 2PWAA 4N9QA 4U2CA 5CVJA 3V42A 4NU8X 4EH1A 4FI3C 4MKFA 5H3LA 4G6ZA 1GAWA 4PO3X 3SE7A 2VHQA 2NUAA 5DMHA 2WWXA 1SA0B 3AINA 4LGMA 1N2ZA 1GOTA 4O02B 4UATA 3ZE1B 4ZFNA 3ADDA 1Y8ZA 1TJNA 2QENA 1BVRA 2BMEA 2PS1A 4QJIA 1K4YA 1YO6A 2Y76A 1ULHA 3BMOB 3L05A 2H5EA 2H1FA 4YRNA 5EHXA 2FQXA 3RVSA 1T8PA 4DUGA 1SPBS 2KQUA 2ZR0A 4Z86A 4CTNA 1Y63A 5E4JA 4AG6A 5HTOA 2QA5A 3ZNOA 4BDSA 4DLYA 4YUXA 3ZI0A 3HB4X 3AM1A 1OIWA 3F78A 1MQSA 3PUHA 5J63A 1SULA 3F3YA 4GZMA 4S1NA 3GNSA 3S27A 4W63A 4B46A 3PJDA 5KVVA 5EHGA 4RV5A 2XXAA 1YNSA 1QP0A 2ZRHA 1XNHA 3HHEA 4LEIA 1GKKA 4Y6PA 4UUBA 5IDXA 3A4NA 2Y93A 4UUAA 5KVSA 4K3UA 4WN9A 5EWJB 2UYGA 1KI1A 4K6GA 3PYMA 2B1GA 1ZHOA 3F46A 4HH3C 3VAYA 4X90A 2HBQA 3UUFA 1KEZA 2ATCA 4PYKA 1EFKA 4ZVVA 1OILA 1VKOA 5LKRA 2PH1A 5IWAB 2XQFA 1EZZA 1KYQA 4PCUA 3M9XA 2GPTA 4FXOA 1JLSA 2G1UA 2QTMA 3ND8A 2EQAA 5ALRA 3RVJA 3W4IA 4F1JA 3WRYC 3Q8KA 3NBAA 2P79A 5IANA 5IN4A 2YHAA 4DJJA 3GWGA 4HNQA 5EUBA 2GF0A 4QUBA 1Z6TA 1PNVA 1FPQA 2WOJA 4DJ5X 4R1MA 1K88A 2QUIA 2Y1WA 2VP4A 3B89A 3DS8A 3QPAA 4HQRA 4EHKA 1R3UA 4YRIA 4X65B 2DFLA 4KAAA 5JWRA 1ORIA 2P90A 2G88A 4MTLA 4P81A 1RHKA 1TL7C 2QGNA 3O84A 3NRJA 5B64A 2DULA 3LWDA 3QIVA 4ALLA 3NDRA 4F92B 1IVSA 1TM7E 1JIJA 3VBCA 1N2CB 3A9CA 3U26A 2Z57A 3NM5A 4RJKA 4R7GA 1Z28A 4GBED 3Q3JB 3P0JA 4Y2XA 1LFDB 3QUAA 4BTLA 3V1MA 2I1VB 4KXMA 4DTCA 4AVYA 3IB6A 1JTEA 1R66A 3HN2A 1BJKA 2R62A 1ZJ5A 3O3CA 1DDOA 1E3EA 2J6HA 2V1XA 3B78A 3FUWA 2DTDA 2RCNA 3D3KA 3KHSA 5DCLA 3UMCA 3WFJA 4YIHA 5M2QA 5K5EA 4DR7B 3PUKA 1II9A 1W76A 2GWRA 3L49A 4B6GA 3L7MA 4RDXA 3WBKA 1RRFA 2GPJA 4BWFB 4CF5A 1DBRA 1P29A 3CPSA 2X9NA 1ZUWA 3DBVO 2OA0A 2LDBA 4CLHA 2K2WA 1MG5A 3CN9A 1XRQA 2C3PA 2IUFA 4BX9A 3EMDA 3Q8WA 5C5EA 3GLHA 4NLLA 2XTNA 5ICEA 1W4BA 4PNEA 5C7OO 3JARB 3QLJA 4ITRC 3I05A 5TEVA 3L7OA 1XTSA 4GPTA 1MC8A 4RVHA 3ZNPA 5IYZF 2A0KA 5HX7A 2H5JA 3I01A 2VDMB 1TK3A 2WVHA 3ZV3A 4IWXA 5JWOA 4WV3A 4CV3A 3KKNA 5K8JB 1ILEA 1DG1G 1UBKS 1J4AA 3Q6IA 3H75A 3DE3X 3JQ9C 2VBIA 1AU9A 4KN8A 4H08A 4U2GA 2SICE 5AK6A 3RJTA 2YVKA 2WPNA 3QBDA 3UW1A 2NZYA 1I5EA 3GBVA 4K7JA 3RWBA 1A76A 1NVGA 2HHCA 4DDVA 1CEEA 1QIFA 1NBOA 1NSTA 3JQFA 4LZPA 2ZI7A 5JNRA 4FIDA 4Q6WA 4CEHA 5HSGA 1HZZA 4UCFA 3TZ6A 3E7PA 3TTTA 3K1JA 4JT2A 2F1IA 3GMDA 4Z7NB 4ZDWA 2QTCA 2V96A 3OIUA 3ES9A 4JQZA 1KP9A 2A57A 1DCFA 4TYMA 2QT0A 1XJ5A 2AVDA 2B30A 3GOQA 4J7AA 4P22A 1N2GA 4RORA 5DLQC 1VIMA 2AMFA 1F6DA 4MPDA 4UDXX 4XSVA 4I5DA 4IKOA 4RXMA 5DHUA 3WHKA 3X0DA 1EZ1A 2O7RA 2R7LA 1NPYA 1Z0IA 3I2FA 1EQ2A 1T1RA 3ABZA 4NBUA 5CX1A 2QM0A 4DMUB 1ZVMA 2FQ1A 2YY6A 3GEHA 1KYWA 2KX7A 4TKMA 3FYUA 4PBRA 1PEKE 3U7FB 4DS3A 1QRRA 3ZNQA 4DMMA 5LQJA 4URYR 3PGKA 4I36A 4XQ9A 2NO1A 2N1MA 1XMPA 4NJMA 5F7OA 5CNMA 2AEJA 2RSLA 3SQDA 4Z5XA 5CXQA 2P5SA 5DIZA 3U61B 2VDNB 1W25A 1G20B 4LGCA 4Q1VA 5DBGA 1NKSA 1PX2A 4Q9NA 3T94A 2BFMA 4DPKA 2V7WA 4MRPA 1NQTA 5JMPA 5AH0A 1N8SA 1G1AA 2HK8A 3LCVB 4NEGA 4F4FA 2XUHA 1AM4D 4DC1A 2J08A 1E8DA 1UFKA 2IT1A 3K8OE 1EJ2A 1ODIA 4OYRA 5IVDA 1P39A 1LRJA 4NE2A 2Q2QA 4KJZA 4YAUA 2IEYA 4K5QA 2UYYA 2Z2ZA 3S2FA 5JZMA 1CCWA 4J75A 4UNNA 2YDXA 4GKBA 1E5LA 1JKJB 4ISCA 3T0GA 3JQPA 1O7JA 1PE0A 1XZGA 2BFDA 3AR9A 3R9IA 4TZ0A 4TLCA 5ALWA 2ZCJA 5IHPA 1QHIA 1D1TA 3DHNA 4YWJA 3ISJA 2X4GA 2GEUA 4LK3A 4WH0A 3MUNA 3MAGA 4NL4H 1LW6E 3EC1A 3HCAA 3N6VA 4OP2A 4C01A 1DAEA 1GPLA 4RPHA 4YACA 4QBIA 4PZAA 2BTQB 3FROA 3RNLA 4EA9A 2QPOA 2QXYA 1IM2A 2GWHA 2M2IA 2WC1A 4R2LA 1EUDA 4TTAA 1TJ5A 3RU9A 3T15A 1KQOA 2VG8A 4A0SA 3E70C 4QGAA 1G16A 2ZIFA 2O57A 3HSYA 5DLYA 2F43B 1P1HA 1LJ8A 3GG9A 1V7CA 3PE3A 4GE0A 2KSQA 3W79A 4CKWA 2RD2A 5BOVA 1TO2E 1N34B 4MUIA 2R65A 1P4HA 3WAKA 2H07A 2GVZC 5JATA 3P5BA 2AL7A 2PPVA 2B8WA 1N9ZA 3PKZA 4H4EA 4H60A 1PS9A 1N0IA 1RLMA 3HN7A 1OYOA 1SBIA 5EEHA 4BP8A 1LNSA 1N3YA 2J3IA 2K2QB 4L4RA 2X2PA 2HXYA 3K1TA 1ZUNA 1JQ5A 1SHLA 1L7QA 2YTZA 4KYTA 4WOPA 5I3ZA 2BKAA 1W4CA 3AG5A 5K3BA 1EU1A 1VOTA 2AG6A 2J9ZB 2Q4RA 4O3FA 4JLWA 4JJ8A 1QO7A 4C1BA 1ZD9A 2JH8A 4CODB 1APBA 1QG0A 1LSSA 1NJGA 1ZJZA 4QOIA 1LDGA 4I4IA 2XUIA 1L9KA 4YS6A 2C03A 2WEKA 3UWDA 3MBIA 4N3GA 8MHTA 1JQKA 1JJVA 1LJUA 1SB8A 1EWYA 1NZDA 1XN4A 2NT3A 2GCPA 1AXRA 4HL6A 4N7JA 5HKLA 2IZOA 4H6XA 3SQNA 1Q1QA 4ZQCB 4FX2A 3ITDA 1E1LA 5E7JA 4JODA 1YVRA 1II0A 4L5YA 1W2WB 1KERA 2F8LA 3S40A 3OX2A 4DQDA 1H0RA 4H35A 3DOFA 2MU1A 1QG6A 4B40A 3FRJA 4CZ2A 2VT3A 3VZPA 5FOTA 2O2YA 4XWTA 5G4KA 3SYMA 4X3PA 4AM8A 4A16A 1TVKA 1P0CA 3R4VA 3DZFA 5DTQA 2EXXA 2OZVA 4CU5A 4DNFA 2XCUA 2F67A 2X5JO 1OXMA 1E0DA 1ZBDA 1HQYE 1K4MA 2BFOA 2ZYSA 3CUYA 2V45A 2QM8A 2QW0X 2QOEA 2QT9A 4BEWA 2G9RA 2XYGA 3K5WA 4G9BA 4MV7A 5J9FA 2CGEA 3HDGA 3KQPA 1GUBA 2BIFA 3C85A 4UPVA 2EBFX 2IL1A 2KHZA 2YJNA 2OV3A 3G5AA 2O8NA 1RWQA 3I76A 3NKLA 4QC2A 5C4IA 3E7FA 5I47A 1E66A 3MUOA 1Y3HA 3Q3VA 4GI7A 4BX0A 5M7EA 2B1RA 1FUKA 1T2AA 1NA5A 2J0UA 2ECPA 2V59A 4JXJA 5DW0A 2JCXA 2L19A 1DDIA 3PHIA 2Z3WA 4PIPA 5JD3A 3STXA 1H23A 1UIMA 2FK8A 1C29B 2YFQA 2NTEA 3B2NA 2VDWA 5T3YA 3JYLA 3D3WA 2R6R1 1YDMA 3U0BA 4WY8A 3LC2O 4EG6A 3OCUA 3PQFA 3CCCA 2HWKA 5FWYB 3BEOA 5JJCA 1NW5A 3ADCA 4PN7A 2X42A 5A3QA 1SZPA 1JW9B 4MWEA 2HA2A 1XELA 1M2WA 3FR8A 5JEEA 1NLUA 1RT9A 5BT8A 3CV3A 1NRJB 2GERA 3ZDDA 2EBHX 1ESMA 1P9OA 2ECOA 1THMA 3K2BA 5DV9A 3VJMA 4KO3S 2YZMA 1QH9A 4EITA 4OBEA 1E5TA 2B2XA 4UASA 3VBEA 5TF4A 5LQDA 1L5HB 1SIUA 3NYQA 3OPVA 2EATA 4E09A 3OLCX 2FE1A 3V7WA 4Y18A 2XCIA 1BXGA 3CISA 1RXIA 3FYDA 3K9WA 4OI0A 2NNLD 4PSUA 1ZI6A 4RHCA 3PSHA 4N3BA 1ZM2A 2LKCA 2P3OA 3A36A 3DAFA 5J47A 2I3DA 4BVFA 1EBUA 1H2AS 2R87A 1JDZA 4YT4A 1Z75A 4WBSA 1HYBA 3IURA 2I33A 3G0IA 3EGVA 3EXAA 4ENWA 5K20A 2XYVA 1T4BA 1GZ6A 1B3RA 1GIAA 4OM8A 3UUEA 2YWCA 4JLPA 4GPAA 1ABBA 3LYUA 4IJQA 2O4UX 3IAXA 5F1YA 2HAEA 1T5TA 4EB8A 5FAXA 1Z4JA 1OUMA 1E2MA 1VPDA 1XEAA 3QU7A 1NUTA 5BSKA 4UUOA 2UXBB 1A8SA 4EA7A 3L2OB 1U9YA 3ZGVA 2XXAB 4BMYA 2BFFB 2UVPA 2Z9BA 3U7QA 4BCDA 1QQ6A 5JEDA 2BHNA 3DC2A 1A9OA 1ZH4A 3BXOA 3LUGA 4OQXA 2GAAA 2CJFA 1E1KA 2PSJA 2XITA 1X7GA 2H4HA 4WN9B 5CVEA 3C97A 3SOPA 3SS7X 3C6XA 2BEVA 3WGHA 2UUBB 4YP0A 3C3BA 4K87A 3SD7A 1NYQA 2IYSA 1J09A 3M3PA 4ENUA 3CINA 3DJYA 1G7CA 1U3TA 1OV6A 2B25A 2F48A 4NCHA 3I2JA 5SZKB 4MMXB 4MKHA 1IN6A 2Q21A 2R4TA 2CNKA 3PWZA 4HNGA 4MLCA 4IUBS 1PQPA 4ETIA 1JB9A 4PFKA 5GV8A 1UT8A 4D96A 2W9XA 1EWRA 2X0NA 1RFLA 4DBZA 1Y8CA 3I2GA 4G0OA 3EEFA 4IO1A 1YRBA 4KSYA 4G5RA 1Z9BA 1OWPA 3RGWS 3WGNA 4HAIA 1HNNA 4JKOA 4G0WA 3VDMA 2VRBA 3WLEA 4GWKA 1V6AA 2QJFA 2FE4A 4P2BA 5DCYA 3N6RA 3WIEA 1U65A 3KQHA 2CEAA 3FOZA 1SO8A 2BBTA 3R7NA 2PV0A 4TLMB 1G20E 4F2GA 1FDIA 2ZXFA 5E4TA 3QBVA 2OGWA 2ZWMA 4FBLA 4IICA 4TLDA 1EINA 4JXZA 2ZIXB 1SXJD 5HJ7A 4N5IX 3U3RA 5K3CA 4DIEA 3E05A 4I1OA 4IVQA 3FXAA 5C4GB 4R71A 1I10A 1MDBA 5C18A 3K9QO 1OC4A 2J6BA 2QSJA 2HF7A 1QGED 1I3CA 4Q82A 4QM6A 2NO7A 4FKBA 2GCNA 4MR8B 2FG6C 1BNCA 1OOEA 4XFKA 3KWLA 3ROEA 5A6SA 3VZSA 3GEMA 2C7OA 1O9HA 3LP5A 4N40A 1IHOA 1T3TA 5SY9A 3R74A 3T5BA 3TLZA 1I6LA 3WZLA 3HWWA 4C4SA 2BTEA 3WVNA 4DF3A 2HIAA 2PYDA 3L4EA 4BVAA 5JAIA 3GLHB 3U7JA 4I3GA 4DWVA 3B3AA 5AUPB 3SMVA 1HMYA 1JQ3A 2F3TA 3M3HA 4DDWA 4A0GA 2NO0A 3TZLA 4JYZA 1BO6A 2JFGA 3OFNA 4NESA 1UBCA 2E37A 3UCFA 4DQXA 3UBTA 1FEZA 4CGZA 3SFZA 4AG5A 3NBXX 4FDAA 1QYDA 3FETA 1RJEA 1LXCA 3U4AA 3NC1C 4TT3A 4YMUA 2HTFA 3TM4A 1R27A 1FP2A 3LT2A 3QKRA 4MWCA 2X0FA 4RMNA 1Q6YA 3WYEA 1ADCA 3WWDA 4AZ3A 2FPLA 1PS8A 3GFGA 2IP2A 3B82A 2X76A 3ZWWA 4B6PA 4RF4A 5GMOA 1OI3A 4IF6A 4JFAA 3U3OA 3MT8A 5BSHA 1NW3A 1GUDA 5I9TA 1B8PA 3Q7SA 4NSNA 5I9NA 4CEHB 1U7DA 1FMFA 4HDQB 3GYGA 2AJCA 1TA4A 3LY5A 1OTHA 4C6TA 3LIPA 3HVHA 1CRPA 1DFIA 2JLCA 1F51E 2QTZA 1DIBA 2FSHA 4UQLA 4RTRA 5DASA 4UD2A 2C3YA 2P4QA 3QOWA 4UPDA 5CG2A 3ZEAA 3TZKA 4YRPA 4EPWA 5H4GA 1PD1A 2ENUA 4ZARA 3GT3A 5JW6A 2VF2A 1CUCA 3VV3A 4KGXA 3WYBA 2ZR9A 3PYXA 3TLAA 2O5EA 1X14A 5CX1B 1FVHA 5E6RA 3AHEA 2ZAOA 2QSUA 3HJGA 3WIDA 3E5NA 1T9CA 4XLZA 2P0AA 3FYUB 4O2AF 3GZNB 2WLTA 4L0QA 3SHOA 4LE2A 4C3VA 3CUWA 1G98A 1DO0A 2NSYA 1J99A 5EJ9A 4IYRA 121PA 4NJMB 4PINA 2QL5A 3UV3A 1QPZA 3H04A 1J8DA 1K6IA 1YACA 4PV7A 4Q7KA 1C1DA 3M6VA 3RIXA 5AWFC 2XWBF 3IB3A 4QUAA 1B0UA 2YMPA 1L7PA 1J2RA 3OF5A 4NYMQ 3UAGA 3R6LA 4E46A 2L17A 1XAGA 5GZ1A 4MA5A 1WXIA 1EQAA 1ZGZA 2AEFA 4CLEA 2WJPA 2RGUA 2E4VA 3ZIAD 2WV9A 3OZXA 4Q15A 4JKYA 2RGXA 1N6PA 1H6BA 1V7ZA 4XM2A 2FW9A 3SSOA 3H1PA 5B2EA 2CNDA 3C4QA 2HF9A 1E8NA 3UAWA 1RM4A 4RVGA 4U7DA 4NCBA 2BFDB 3C74A 4XLTA 3VJKA 3DBRA 3CVXA 2GHQA 4I4TF 4OIMA 4OM7A 2Z5VA 3G2HA 4J94A 4RSRA 4TMKA 5MGBA 3UC5A 2B1IA 1MHTA 4H15A 1A4RA 2EP7A 4MGYR 3SJ7A 4HNUA 1YJBA 4DB4A 3FPSA 3FNHA 3OA0A 2C84A 2Q7XA 4XJVA 5LJIA 1U99A 4YAEA 2ERXA 4WACA 1J8YF 3IV6A 5FP0A 1CVIA 1EUDB 4F9FA 2NTYC 2NVUA 2LD4A 4N49A 1K2VN 2PFGA 3CW9A 3JQGA 4OH1A 2WZBA 4Z9YA 2UZ3A 3OJFA 4RE6A 4PVDA 1N7JA 5IJ9B 2JFQA 3STTA 2GESA 4OK3A 2PN1A 4MVJP 5K8UA 4LW8A 5U4XA 4HWSA 2CN1A 1RI4A 4GX1A 1FX1A 1A0OA 4CEIA 5FX2A 1ZUNB 4DZRA 1FXSA 2QTVA 4QU9A 3T5TA 2FZWA 3PHGA 3EDOA 5JMWA 5MN6A 1E32A 5ADHA 2QRNA 2O0JA 4FEEA 3ZHBA 2GILA 4FHCA 4MB6A 1T5OA 3AOGA 4I1VA 2W6NA 2AOTA 2BP7A 1FTNA 1OA1A 2PRIA 3G5MA 4C05A 3F8SA 3H8SA 1DC4A 3MWYW 2VZEA 2PMFA 1N1GA 5A2GA 4ZTZB 1PJAA 2AZTA 2WUDA 1USUA 2QP9X 3EZXA 3EAGA 3OQIA 4EHJA 3GN1A 5JJIA 2PLWA 3SGLA 3LYLA 2B4RO 4OQDA 2FEXA 1Y4UA 4LSWA 4CE6A 3E3MA 3ETLA 4X1OA 5LL6P 4TV9F 3ZCVA 1WNFA 3F6YA 2FW8A 2VUUA 3PHJA 3SVLA 3HCCA 1BW9B 1HDIA 1RTKA 3O03A 1AGYA 3GRVA 5G4KB 3T7KA 3GPCA 2HMAA 1TVKB 1HPLA 2IYUA 3GH1A 4DLSA 1P5RA 1GPWB 5HGXA 3IILA 2ISSD 3D3EA 4I55A 4DRZA 1VJ1A 4EPTA 1AKMA 2IU6A 2FR8A 2ZAMA 3U4MA 3DPSA 3R7BA 3KR0A 1CDEA 5HDBB 3UK7A 2IYTA 2PMWB 5H1YA 4DG9A 3ONVA 2E85A 2JLQA 2VWHA 3E3AA 3LFUA 4PG8A 3L7LA 4Q7MB 1J6UA 4RU1A 3TL3A 1U2QA 3FKSD 1JXOA 1L7AA 1EM6A 3V34A 5AXDA 4CM3A 2XZPA 5D1HA 3G2NA 4NICA 3UYKA 5JU6A 5JXJA 1VLMA 1Q3KA 2FZ5A 5ED0A 2J0UB 4MV4A 4XFDA 2WYUA 3WICA 1DQRA 4BGUA 1NR7A 1OLUA 3O1JC 5IAKA 1M2EA 4AUMA 1I1NA 3EF0A 4MNTA 2VDWB 4ECAA 3D3WB 5FAKA 2NIPA 1HKUA 1CX9B 3NDJA 3E3LA 4OFWA 1FDOA 4MVXA 4X1KB 3V8MA 3CNNA 5K0LA 2PUAA 4LYEA 2WU0A 3CLTC 1YFZA 3V1UA 5FJJA 3F6SA 4UTVA 1E5XA 4U8GA 1VBFA 4LXIA 2WT4A 5C81A 1KJ9A 3NANA 2W90A 5JWHA 4KYVA 4QICA 4QU5A 1VZ3A 1Q92A 4B0OA 4ZDIA 3D7RA 1MVLA 1DIGA 3LOUA 2FPRA 1UP4A 3IAM6 4GMHA 4I5EA 4K6CA 4Y9RA 4BMVA 1L7BA 1DOZA 2XWQA 3JAWA 1U9IA 2OXTA 3TR5A 2HJWA 3ZDBA 2QMQA 3RJ5A 4ARBA 1BXGB 1IAVA 3W6OA 2ODWA 3VO1A 3THYB 5JS7A 2WNHA 3RNOA 4NQZA 2IYAA 1S96A 3J7TA 4L8VA 4M22A 3P5SA 1T2CA 4IIJA 2JLZA 1W7AA 4PICA 3VR6D 5JI2E 5HA5A 4NYJR 2ZSDA 2IHNA 4GGPA 2PJRA 3V8BA 2N3ZA 1X9IA 2HUNA 2WAYA 4WIAA 4CLRB 3NVDA 2HQRA 3B38A 3DZIA 4RANA 5FL3A 2I8CA 3DUFA 4ZZ0A 1JHPA 1IONA 4Y67A 4HDAA 2Q7DA 4A9AA 1L5QA 4AS3A 4CLOB 1GADO 1IMOA 3DKVA 2J85A 4FC6A 2W2VA 4EX7A 3A8TA 5FDFA 1YKGA 5I7RA 1F0PA 5TPZD 1KO7A 2EJTA 3U37A 4B43A 1BWSA 1HX7A 1Q21A 1I7LA 3ABRB 3K5PA 3L4BA 1GKYA 1I3OA 4INOA 2UVPB 3TOXA 3U7QB 1QPBA 3BKWA 2HDHA 3LLVA 5HUHA 1EX7A 4Y0AA 4B2YA 4QYTA 3IBGA 2WICA 5EP4A 3FLAA 2CLEB 3K4HA 1ZW1A 4NC9A 1J07A 3IOBA 4WNCA 1HH4A 2FTKE 3EZ9A 2H1IA 2VZ9A 4X3OA 2BEVB 3Q5GA 4A2QA 1ZVKA 4S1PA 4M9QA 4PZEA 1FUYB 4DV1B 2FJUA 5LCXA 3DMTA 1TLTA 1G2OA 2F17A 1X2BA 1CR0A 1KZYC 5T6MA 3D8TA 4LZWA 4QUEA 1DKLA 2MINA 1J33A 3OZBA 721PA 3PCXA 2WB2A 3GJ7A 4Q9HA 4FGUA 4JUFA 3KQVA 5ALUA 1G8GA 1PHPA 2OBYA 3PE4A 4KFSA 1KFCB 2QYHA 3ORYA 2I4TA 1CY7A 2V4ZA 1SXIA 1JLLA 3RC1A 4AJJA 1DV2A 2F1RA 2UU9B 2FYTA 2OV6A 5A5DA 1QH8A 1O96A 2GF2A 2IXAA 3KYJB 1V1JA 1GSIA 4WNAA 5ALMA 3CH4B 3SQOA 2DHQA 4RY2A 2P40A 1Y48E 3QM1A 3Q85A 5IAJA 4ZDKA 1YR3A 3SS9X 3FNFA 3WA6A 5DE3A 2Y1EA 2WAMA 1TC2A 2ZIZA 3UANA 1VI5A 2Q46A 5CFZA 2FZKA 4P33A 1X7XA 5I7VA 1O4VA 5CB4F 1WY5A 3AHFA 3K1YA 1QSGA 3DCNA 4AXBA 4ZJZA 1T4MA 4IIHA 3P9YA 5HBRA 3TCXB 1E96A 1X9GA 3M2TA 1YI1A 3EXIB 3BTOA 3IUBA 1POWA 2IU4A 3NIBA 1PJTA 2Z1NA 1HSZA 4L2IB 4G2TA 5EXPA 1BA3A 5A6SB 3E2PA 5ICSA 5L53A 2F3PA 3T1NA 3QPWA 1DO2A 1U7PA 4NJOA 1CVRA 4PPNA 2OXEA 4WRRA 2JK1A 2ORVA 3C3CA 5GZ3A 1YA6A 1UZLA 1DRKA 3FNEA 4MRVA 2WHRA 1TQ2A 2YJGA 1Z3CA 1SIOA 4INPA 3JV7A 1ZM4A 2JA2A 2WG1A 4RMJA 3BDVA 4LOKA 3I8XA 2XXBA 3U44B 2WIJA 1RD4A 3G88A 2NX2A 2WJVA 1XI2A 3L8MA 3NYRA 1AOXA 1JLRA 1Y1SA 3PCRB 2QTNA 1KAQA 3IA7A 4KXFB 5F78A 3GP8A 1MOQA 5JPCA 3NGXA 1I4LD 3DOEA 4GUDA 1K8XB 4W7SA 1NQOA 1P6UA 3OJXA 5B7QA 3IP6A 4M21A 1F20A 1N5RA 4ND8A 4RHXA 1BS1A 4RMIA 3EUFA 1WSDA 4XEHA 1TFRA 4ZOEA 4F5YA 1UMBA 2VSQA 1XTIA 4AZ3B 4B8ZA 2V7PA 3K2QA 3Q0IA 3JAMA 2JFWA 4EENA 2R60A 2O1WA 2JFBA 2Q4TA 1C3EA 5E1MA 3NHZA 1SCDA 2J87A 2JAUA 2CCGA 3OTHA 4OF4A 2CKMA 1PR1A 2WFLA 3JYOA 2EQBA 1G2QA 4YBRA 2KE5A 4IDFA 4V0OA 4C6TB 4RPGA 3AEYA 5LU8A 3OG9A 4OJMX 1ZXXA 1H5UA 1EXVA 2XNKA 3NEYA 1WKBA 3A9UA 4ZVOA 4DMGA 3FDFA 3NBFA 2R00C 3ITNA 4HEHA 4KLAA 3QYJA 3C7KA 2C7QA 4U5QA 3LQ1A 4URWR 2C2GA 4GBGA 2IPMA 2Y0DA 1FNSA 5A71A 4WBNF 1ELOA 4GIBA 5E6RB 3TQFA 1KAHA 1ULBA 4PIVA 4EYOA 1R9JA 1R8QA 1XU7A 2IZ7A 3EY4A 3GA0A 4H1HA 1QOPB 3WE7A 3A3PA 4CM7A 2C4HA 4HI0E 1Z4NA 4JUCA 3KQLA 1HV8A 3IIEA 4MRRA 4P3YA 4PG5A 4WDQA 4JI6B 1S2OA 1C1DB 2R48A 3MOIA 1DELA 3I04A 3AUUA 5CK4A 2GXQA 1G3QA 3AFOA 3BPSA 3AEUA 3QNMA 4H1WA 2KW5A 5FLXA 1QF6A 4GU5A 2VHJA 4O0LA 1C9JA 4FDLA 1L5ZA 5DGXA 5TY0A 2PS0A 1CLUA 4UDOA 4A0FA 3CR7A 3K20A 5F2KA 3N2IA 3R7FA 3OWOA 1LS6A 3PPVA 2I0FA 3OJLA 4C3UA 2FFJA 1D8AA 1P7CA 1TGVA 2B8NA 4MQBA 3RRNA 3GT7A 3S2UA 1XQ1A 4ZKEA 3WTBA 3RVBA 5LD2C 5A02A 1NDQA 4YMGA 2W6CX 6CHYA 3FRIA 3U1TA 1E6CA 3CRMA 1HDRA 1MO2A 1R8YA 3DBRB 4JJEA 5E95A 1XVVA 5FUVA 3CGWA 3PGXA 4E70A 1QHYA 1H6AA 1ZH0A 1U0LA 1QVZA 4PGHA 2I4LA 1KI3A 1Q0HA 1V41E 2B0CA 4YUVA 2F9FA 1SXJA 4RTLA 1FJXA 2HRQA 4MV8A 1M2NA 4AKIA 4E94A 3LQFA 1L4NA 3LOPA 1UZUA 2OCKA 2P9EA 3QFHA 2Q5OA 3TJMA 1RJ9A 3L6RA 3KOZA 2IUYA 1JL3A 1QZTA 3DLAA 4ZT6A 5ULLA 1JTFA 4OX9B 1X1BA 1EAYA 2FXVA 1QLJA 3MG9A 2FFRA 2H2GA 3PDHA 5LZ5A 1EDBA 1OGYA 3P0RA 2IVFA 3GLKA 3GLGA 4Z53A 3HO8A 2D00A 3OQVA 1U5AA 2PL3A 5TQ0B 2X1MA 1Y3DE 2YXPX 3UWKA 5JH7F 2EX4A 2ILTA 4CYMA 4W5NA 2QK4A 3WMRA 2WF7A 5CA0B 5DHPA 4FYYA 3IEMA 1ZRMA 4M0EA 4Z0TA 3W9BA 2V9PA 1FS5A 2QTVB 3BILA 4FYPA 4ZI2A 3PC8C 4LJSA 2VA9A 3ZUPA 4Q3EA 1QQBA 3VKHA 2FQQA 2X6RA 4ARAA 1X94A 3NO4A 2C00A 4KW7A 1R9MA 2GBLC 2I4OA 1PEYA 4JVLA 1HSOA 5ICCA 3S8YA 4UCWA 3W2EA 2AOTB 3BJEA 3R9WA 2BP7B 1OGIA 1PWYE 1OXSC 3HCFA 3LL7A 3LUBA 3OKFA 16PKA 2Y8EA 4C14A 3RPEA 2XE7A 4JLJA 3DOHA 4E6EA 4PLFA 3INYA 4HWTA 4N0EA 3OQIB 4U02A 4PF1A 3PFHA 1X1EA 3F1LA 4L4XA 3IVMA 3OE5A 2C94A 3BL5A 2Q41A 2XIQA 3L8ZA 3K9CA 5EIHA 2EGGA 1CUUA 1WQ1R 1RXSA 4H4CA 4NBVA 3H19A 3QVGA 1J1UA 4YALA 3OOYA 3UJNA 3IL2A 2XNDA 1NRWA 4HNVA 4G07A 5F3RA 3T0IA 3RTEA 3A0RB 3NAGA 5DYGA 4XJSA 1K6MA 1VLQA 3C3PA 2W2PA 2IEAA 1CVLA 2WU8A 3LL4A 3LC1O 3EIWA 4M1QA 4OOFA 4YRRA 4I55B 1YU9A 2Q7OE 2TS1A 1GRRA 1JX6A 5AJHA 1Z88A 3ENNA 4GKVA 1YR1A 3TMAA 1FY2A 1YH3A 3W9YA 1AQUA 4ILKA 1BD3A 4BE4A 4ZXFA 3E9DA 4RDIA 3VPGA 4B35A 5FV4A 2IH2A 2V0GA 2VDJA 3WLJA 1BXKA 1OFHA 5ERGB 2G04A 4M0MA 5IVIA 3WAJA 1XLTC 3IBTA 4AY3A 2EGHA 2H1LA 1Z38A 4JL8A 3NWEA 4W9NC 1ZQ1A 5ENZA 3F7NA 3LJKA 1T6ZA 1O6GA 2DQZA 5B30A 1OLUB 1PYGA 2H2FA 3HB1A 4NY1A 4XKJA 4RCVA 1VIDA 2R1ZA 3PQ4A 4GM4A 5C1DA 5B5SA 4RVCA 1DO8A 1Z2CA 2QD4A 4KR0A 3TE6A 4H2DA 3LUAA 5AKXA 2ZRFA 3IDOA 4CL0A 4R01A 1JSCA 2CL6X 3INGA 4WX2B 3EVCA 5EI5A 5AVTA 1JFFA 3WZMA 4UE6A 2H0QA 2IX9A 5JQGA 4MS1A 1SD1A 1AG9A 2FLKA 3C6MA 2FN8A 3N2NA 3MWGA 4NYIR 1CJSA 3ACCA 2O3SA 1L4HA 1YL7A 4HNHA 1WBDA 2VPYA 1Z82A 2Q3EA 3CJRA 2PZLA 2OR3A 4NMXB 3JAWB 4TS9A 3M6FA 3MF4A 1ID1A 1VBKA 4K8RB 5TQ2A 4WZZA 3AI7A 3KD3A 1SCJA 3FJ1A 3ENKA 1U5BA 5HIIA 1Z8NA 3CEAA 4R2WA 1NXWA 2QR3A 3ND7A 4QXMA 5HF5A 3WV4A 4EPVA 1G8FA 1JSXA 4I9HA 4JC4A 2VYND 4QFCA 4IIJB 4NECA 3AY0A 3KB1A 5EESA 4Q93A 2FHPA 3DHVA 5A4KA 3UH1A 3HCDA 2Y1DA 4ZQHA 3C87A 3WWYA 1VRCA 3ZWQA 4UEWA 2FSGA 5ECGC 1M72A 1U81A 1WU8A 2RGDA 4KFUA 5CXXA 3DUFB 2YKGA 2F8TA 4LDJA 4YUAA 1R50A 2A8YA 2QRMA 4MQFA 5BQPA 4PG4A 3SM3A 1T9DA 2R2AA 2HSZA 4KQ2A 3OLXA 1R6VA 2H9IA 5IAAA 2JIDA 3WIBA 5DHQA 1O97D 3X2EA 2E4YA 1CETA 3K16A 3DKKA 4N6GA 3TR6A 2J33A 2PRYA 4RY8A 3G8CA 4JI3B 1AUQA 4DV0B 3HP7A 3AY6A 4UHJA 3RLIA 2FRDA 3R5FA 1VM6A 5LQSA 1KMHA 4I8XA 1UXOA 1OYYA 4CF4A 4G8BA 4PAMA 2IU0A 3TTYA 2II6A 3OOSA 4GXTA 4DWWA 5FBHA 5LQAA 1YZ3A 1Z0AA 4C43A 1Z0UA 1ZO8A 1AUVA 1PDWA 1SUBA 3C3YA 3E6AA 4RHFA 2MINB 3QUTA 3R3SA 3BE5A 3RU3A 2CSXA 1KJQA 2ACEA 3F0TA 5G02A 1CERA 1VG0B 3NDPA 1AK9A 3JQBC 5DI9A 4Z2AA 3EZ2A 1UJCA 3DL2A 3NHMA 5FUYA 1LSOA 4YRMA 4ARVA 1XCGB 2GDJA 3DDCA 5KMGA 1QH8B 2ZDGA 1O96B 3HACA 4DRXA 2Z95A 3QKIA 4WNAB 3IKTA 2XVMA 3TNJA 1NJFA 4XR9A 1V47A 2AS0A 2O0MA 5CFRA 5KQPA 3E23A 1XT6A 3KZOA 1XRPA 2GM5A 3ZCTA 2I6SA 1V7PC 3FTPA 3E5MA 1X7XB 1OX6A 3FKSA 2Z4TA 4PGAA 1WDWB 3C8ZA 3GC6A 1CYDA 4RQBA 3U2QA 1NHGA 4OI4A 1TZ2A 3NHYA 3TSAA 3S2YA 1NQVA 3GEDA 4L5BA 3UJPA 1O94A 2QTAA 3AVTA 1FZTA 3TVYA 2NQ2C 1SD2A 4IDAA 4I1RA 4U7TB 1Y37A 5HOQA 5ILGA 3A6JA 2ZRBA 3R23A 4DIKA 1JKMA 1CY1A 1I2DA 4L27A 1NI3A 4L8WB 4GPIB 3R75A 2JEZA 3HRIA 1QR2A 1QWOA 1XUOA 2WQZA 3E58A 4Q1EA 3GGPA 4W1PA 1KRWA 2PUJA 4OJYA 2HMYB 2RC5A 4W5QA 3ZY2A 5EXEA 1ZG3A 2VEDA 1UJMA 3SICE 4E1AA 4ZZIA 1XIVA 4FOLA 4G9GA 5AVJA 1PGPA 4ZI5A 1KJZA 1EFLA 4DKXA 2C2ZA 5LNK6 3PGMA 4CKXA 2R6CA 5JVDA 2IOHA 4G4JA 4GOND 3C1TA 7YASA 1FUIA 1SWVA 1WRBA 1BDBA 2QX7A 3IEXA 1A4XA 2Q1SA 4QPPA 2V3CC 1EXDA 2IXDA 1JQBA 1P31A 2FFBA 2QBYA 3N2EA 2SNIE 5D84A 5AYVA 3C70A 3IR7A 5AKEA 2Z58A 2WV7A 1J5XA 2HDOA 2V54A 2HQSA 4NK5A 2QRQA 1FRNA 3F96A 3K3PA 4IAOA 3U7HB 3KKPA 1I2AA 3DFZA 4XCVA 1UMBB 1YFLA 4QUKA 4DR6B 4FVTA 3MGBA 4Q3NA 1T1IA 3ZWYA 5JXGA 1V3UA 2OT3B 3KXKA 2C4UA 2QWXA 3O2QB 3VR6A 4BLWA 1DL5A 1DT5A 2BM8A 2FHSA 3E61A 4MW7A 4P5PA 4LJYA 2AQKA 4UTZA 1EWQA