3R77A

Crystal structure of the d38a mutant of isochorismatase phzd from pseudomonas fluorescens 2-79 in complex with 2-amino-2-desoxyisochorismate adic
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
205
structure length
205
Chain Sequence
TGIPSIVPYALPTSRDLPANLAQWHIDPERAVLLVHAMQRYFLRPLPDALRDQVVGNAARIRQWAADNGVPVAYTAQPGSMNEEQRGLLKDFWGPGMKASPTDREVVDALAPQPGDWLLTKWRYSAFFNSDLLQRLHASGRDQLILCGVYAHVGVLISSVDAYSNDIQPFLVADAIADFSKEHHWMAMEYAASRCAMVITTDEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable isochorismatase
publication title Ligand Binding Induces an Ammonia Channel in 2-Amino-2-desoxyisochorismate (ADIC) Synthase PhzE.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 70
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 3.3.2.15: Trans-2,3-dihydro-3-hydroxyanthranilic acid synthase.
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3r77A00
2H0RA 3MCWA 3HU5A 3TB4A 4L07A 4L08A 1X9GA 3O94A 3HB7A 3O90A 1NF8A 1J2RA 3O92A 3S2SA 3TXYA 3UAOA 2FQ1A 1ILWA 2B34A 3O93A 2A67A 1YZVA 3KL2A 2WT9A 4H17A 3R77A 3EEFA 1XN4A 1IM5A 3R2JA 3O91A 3TG2A 1NBAA 2WTAA 3IRVA 3LQYA 1YACA 3PL1A 4WH0A 4WGFA 3OT4A 3V8EA 3OQPA 1NF9A
chains in the Genus database with same CATH superfamily
3MUFA 4B3XA 4D9NA 4RELA 4J6FA 1HE2A 1EK6A 1O4VA 1R4MB 2F00A 3LU1A 3PNMA 1W9MA 4FZJA 4GW3A 4LCBA 3S55A 3U3XA 1K66A 3ZE0B 3F6EX 3W1WA 1E3TA 2EX0A 1EXMA 2YS7A 4LNUB 2G9VA 1ISIA 3A1DA 4MUBA 2FSIA 3FTCA 2VATA 4HQRA 4MVJF 3D4LA 3GROA 1O95D 2JH9A 3QFSA 4NU8X 5LIRA 4S0XA 2HT1A 3CX4A 3M5PA 4R2MA 4ZGWA 3PI6A 3W4JA 2VBIA 4YCNA 2X9NA 4WCDA 1J0EA 2CK3D 2P67A 5KWVA 1Z16A 1US8B 4PG8A 3CZMA 1FRNA 2BAGA 1X1AA 2ZJ4A 2ZTMA 2HSWA 2Q9CA 1WZ2A 1IM8A 4Q3NA 1SC3A 4IP0A 4MS4A 4DA8A 3WO0A 2HK9A 4IKPA 1II9A 2W9XA 4KEAA 5DM4A 4QYWA 5BW6B 4MEJA 1A7JA 2RK3A 3KVVA 4HGYA 4REQB 1M0SA 1UDAA 1WU7A 2G6TA 2ZYIA 3BC1A 3L7BA 4DXAA 4EABA 4IXWA 2A6PA 1CJSA 2PSFA 2PKQO 1IAVA 1PAUA 3HVHA 4YQYA 3T3PB 2YMMA 4LJ8A 4W6QA 2NO6A 4FX5A 2ZJ8A 1IN6A 2FMIA 2PS9A 2LZ0A 4LK3A 3HA7A 5KWJA 3AF3A 2V7QD 3CUYA 5CM2Z 5FNVB 3N2IA 5EKXA 4O3FA 3PICA 4Q7EA 4BNZA 5F52A 3KL2A 5M7EA 5HTKA 4RK7A 2O2EA 1GKUB 2O1WA 4I5FA 5BV2P 1FMTA 1D6JA 2H4JA 4HZGA 4KQGA 3T35A 1OWNA 5BSFA 3FF4A 3SP1A 3K2IA 1F7UA 3AL2A 3MB8A 3AY6A 4ZVNA 1T2FA 2PL9A 2D62A 1MABB 4M55A 5UKDA 1QZXA 1H69A 1V1RA 3AFNA 1HEIA 1LLCA 3NVAA 1I5OA 4WNCA 3H1EA 4G3XA 2DSTA 4PQRA 1QIFA 4RL6A 4IDOA 5C31A 5ITZB 2NTVA 1WR8A 2VRBA 4MRSA 4YV7A 1I7LA 2FZWA 1SEVA 3BMCA 3VR1A 1H0SA 1QAQA 1R3UA 2BR4A 2CLMB 1PWHA 5EJ4A 1XFAA 5DYNA 1KRXA 1CQXA 1YMUA 3GV0A 2BEUB 3OUUA 1Q21A 1LVUA 4PU0A 4QXQA 3MCVA 3M1YA 3M6AA 2WJPA 3WDSA 1UADA 3MLBA 4Y9SA 1TTQB 2II6A 3ETNA 1YL7A 3UJBA 3PC4A 1PT6A 2I4LA 3HADA 1HYBA 1NMYA 3SIXA 4IMIB 5A62A 5H9WA 5JECA 4BJ3A 4FFBB 4MUJA 1XVTA 2ZW9A 1IJFA 1V45E 2E4XA 2P9EA 2XCIA 4GBJA 4DMCA 4CMIB 4KLNA 1W85A 4OXIA 2GEVA 6YASA 1JBKA 5CJPA 2Z6AA 2CNWA 4O2BF 1KVRA 4MV7A 3KKEA 3V9AA 5CH8A 2F6RA 3VOTA 3LC2O 1V3VA 1XDSA 2AR9A 2YZNA 3UJNA 3BWXA 3L8EA 2DY1A 3B6JA 1CY2A 4D7AA 1WZNA 3H84A 4PRLA 3FSGA 4HEJA 3EGIA 4B81A 2XGSA 4AW9A 3PR2B 4FWIB 2BEVA 1T8TA 1HDRA 3D54D 1AG9A 1KOJA 1QS0A 3NIDB 4YRAA 5BWCA 3DEYX 3C6ZA 3DVRX 1C0KA 3IPYA 5CM9C 3EZNA 3TTTA 4G0VA 5H9VA 3U09A 1K86A 3O82A 5D3ZA 3W6UA 5C53B 6LDHA 1WAMA 3F8TA 3UM9A 1QP7A 5AH0A 4IIJB 4RM2A 4WBSA 3WHPA 4EI9A 4EH1A 5C5CA 3F6RA 2CV2A 5KJ1A 2JIMA 2OHIA 4C3UA 4PZAA 5P21A 3NHFA 4XWGA 1MX1A 1KK1A 3HCAA 1JA0A 2XBLA 3NEYA 3VQTA 6REQB 3RSSA 3SHFA 1AURA 2O3RA 4L6AA 4PZPA 4ZCIA 4D4KA 4G4IA 2W83A 1DG1G 4H4EA 4NBUA 4JC8A 4B44A 1T6ZA 2QTAA 1B6GA 3MT0A 1EK5A 5JYDA 1QG6A 4JIGA 3IA7A 4PSUA 1L7QA 3O4GA 1TW3A 4ECAA 3RRJA 1C8VB 5C1OA 2OCXA 4PQFA 4UHKA 2HADA 1GRNA 4FP9A 2JGNA 4WZBB 2H5IA 2JARA 4HBZA 4Q4AA 4E3WA 1ECCA 2L2QA 3H9UA 4LY9A 5EE5B 1I01A 1RRVA 1E5DA 3N7TA 2OCGA 1KSHA 5M29A 1X8LA 2WM2A 4AY4A 2WIAA 1P5ZB 3CNOA 1O8BA 1QIHA 1X3SA 3DFFA 2O8CB 4GNRA 4XYGA 2JLBA 2JFQA 3CINA 1U80A 1JR3D 3CZRA 4WV3A 5TRTA 2IWRA 2XGGA 3R7AA 5JWOA 1JH8A 1Q0TA 1RI2A 3HJAA 5ALRA 1C3XA 2C1EA 2IW3A 5JZVA 2JBAA 4YI3A 2B4QA 1AOXA 4CZ2A 2XWPA 3NOQA 2GM5A 2ECKA 2ZR9A 3DW3X 3F9RA 3GJTA 1QO0D 4JWTA 4QDTA 4D96A 1XXHE 1QRSA 5ITWA 1T1EA 2C5EA 2ACWA 4L0DA 3RUDA 4KRFA 1CW2B 1F3LA 1W5TA 2I29A 2NYAA 3N8DA 4HAZA 2WD8A 5GZ1A 1F4VA 5L3VA 4A8JB 1IAQA 1U5BB 4CEJA 3QHPA 4NEQA 2O2ZA 3D7SA 4GP7A 1UMDB 1ZVMA 2QAIA 5G2OA 3RI3A 4PN7A 5I8PA 1M7GA 4I36A 5BMVA 4YY3B 4GO1A 3EDMA 3U5ZB 1S2GA 3QENA 2H2FA 1WP9A 1M2WA 1OXTA 2O2YA 3RFVA 1P61B 3IT1A 5F2KA 2D74A 2CFCA 1FU8A 3HCNA 3FPAA 1OLSB 1PX0A 1H4TA 2OG2A 4YPVA 2PRYA 3TAUA 3DB1A 4UDNA 4CEIA 1A5BB 1K8YB 1KI7A 1NG1A 2C2YA 2O7SA 3CEJA 3PEFA 2XAAA 3BGWA 1TUEA 3NVDA 4WNAB 3PXUA 2E82A 3L7OA 3I0MA 1KWKA 3J80A 3I9MA 2WWIA 2XUOA 3GJ3A 4KQXA 3TVTA 1UK9A 1E4YA 4L0CA 4NNOA 4NMHA 4ZO9A 1RYNA 2ZS7A 5ERXA 5C1DA 1GZ7A 3DV9A 1K92A 1P4HA 5AVRA 2IU3A 1OZGA 2VTBA 3PQEA 3Q7IA 2CHGA 5HDBB 2UUPA 1TLLA 3BSWA 4ML3A 1UBKS 4E70A 2FUNB 2H2HA 1XJCA 2AD1A 3VISA 4HYEA 3H05A 3HBJA 4HSEA 3GHHA 4J43A 4DNPA 4CIAA 2CLOB 4WK4B 1GFIA 1H85A 1A8UA 2P9ZA 4HMQA 1G5TA 4HS4A 1C7JA 1E3IA 1WLYA 4E5YA 5JJKA 3IVCA 1D2RA 4MW6A 1SHUX 2Y4OA 6ADHA 1Q3HA 3RUHA 3JQ9A 4B6FA 3V1MA 3OEHD 1W52X 5JPCA 2XKKA 3CW2A 2K6GA 3L4SO 3LPCA 5ER6A 1K5DA 3M1LA 3QHQA 1AX9A 3DQPA 3P8ZA 1EK1A 2QPTA 2OFOA 3GFVA 2ODTX 1SU6A 5F2OA 3ILHA 4FYXA 2W93A 2FZGA 4QBGB 1H2RS 2HUNA 4WKCA 2IQIA 2AFHE 5ALGA 4H16A 1O6FA 1RXSA 2IU4A 1KO4A 3AFHA 3E03A 5AJUA 1JJBA 1SM4A 2GLUA 3LHIA 2VT6A 4KW7A 1G8HA 1JRLA 2WJ6A 1WBBA 4FFMA 4AWAA 4I81A 1TVMA 4DBZA 3I6MA 1EA5A 3K4PA 3VH2A 4TV9F 3HCCA 3DF9A 4CUKA 1YFZA 5C9ZA 1VMAA 2J41A 3EWSA 1GSIA 2WF7A 4ZVRA 2J0EA 4EMTA 2H8KA 1QM5A 2P9QA 4L9RA 4E88A 3EIXA 1EDZA 1SRRA 5TC4A 4DHEA 3IB6A 2FWRA 4JBHA 4OU4A 2ZRGA 4IOKA 3HMQA 4DLTA 5G1NA 4BZZA 2CHVA 3CB4A 5DLQC 2B78A 3RT9A 2CMKA 4HWTA 6Q21A 5JCZA 2ERXA 3TSCA 3RSFA 3UN1A 4CMCA 1E7WA 4O2AB 1WMAA 1N9GB 1PIWA 1W4RA 2DLDA 1ZN2A 2GD6A 2QSYA 2REBA 3EMDA 4HYYA 3ZE6A 3ZCSA 5EHZA 2X76A 3K7EA 3IB3A 2EBWA 1JB9A 1FDWA 3AC0A 3BMNA 3O1JC 4O4LF 1V5FA 3BWCA 1YUBA 1V9LA 3JQ7B 1NI3A 2E55A 2B8NA 1GZ3A 1ECJA 5ALKA 5EJ8A 1E32A 3F97A 4F86A 3GX1A 4HCJA 4DV5B 1ZGZA 3OCJA 1NI4A 1G60A 4UEKA 4C3ZA 4F06A 4JFRA 4GI7A 2I66A 4FC6A 1PFVA 4PANA 3H1PA 2I65A 2JIDA 3RRBA 5B7GA 4YONB 3DAGA 4YJHA 3ACBA 3HP1A 5FV7A 4ZVPA 2JKVA 3D0KA 4ZAFA 3NS7A 1T0JB 1X7ZB 3M8KA 3EWAA 3EN0A 3SE0A 3O8CA 3AVTA 5TGDA 4B3CA 2RJ3A 3WYGA 2IP4A 2CC2A 1NAHA 2A58A 2YXEA 3HPRA 2Q7XA 5JU6A 1CV2A 3L7CA 1QYWA 3JYNA 2NSHA 1STOA 1UP6A 3BULA 3O4JA 2UZ1B 3LE8A 2HJWA 3OJLA 3R76A 1LV8A 3GXBA 3L49A 4TV8A 2XZTA 3DTYA 1BOFA 4OLBA 3WGLA 2W0SA 3I37X 4DY4A 2YZMA 3AVVA 1KMHB 3FNBA 3GLIE 1BX0A 1VGVA 1JW9B 2EYUA 1WXWA 3CF2A 3L7AA 3OPQA 4YCCA 3VMMA 5IMBA 2VK4A 3FSEA 2Q2QA 3QA9A 3UKDA 3V4FA 2A35A 3RVDA 3MHTA 4NFLA 1TZJA 4RH0A 2EF0A 1DVRA 1DKNA 2YASA 1J1IA 1Z17A 1MCZA 1R6XA 2ZDHA 1YZYA 3ABOB 3DKRA 4KGZA 1F2TA 1OKKD 1B43A 5AKJA 1G21B 2B7CA 3PHLA 3GRUA 4GGPA 1LJ8A 3EGXA 4DDUA 3PX3A 4M8LA 5DSZA 3T1HB 4F38A 5TQ2B 3WWPA 4OB7A 1S3IA 2Y66A 3AETB 5JWRA 2YWXA 2JJ8A 4FCWA 1BU5A 2F3SA 2GGSA 4AJ9A 2XUPA 4P2BA 4C06A 3JAKA 4I0WB 1E62A 4K9QA 3UMFA 2RHCA 4OP2A 1KERA 4C78A 1XZKA 2M2IA 1NMEA 1TT5B 2PZBA 3LUKA 5ALWA 2D3TA 5LC1A 2EP8A 2P9GA 5KYVA 2IUTA 3GI1A 4XYMA 1XVAA 3L7DA 1OB2A 2PQ6A 3N2EA 1RWWA 3OESA 1GPNA 2P75A 5B3AA 4BRZA 2R97A 5HJ7A 1M0TA 2YW2A 4NMWA 4PGFA 4HTAA 1Z9BA 5BUQA 3A27A 3I9OA 3TEJA 2O8FB 4NV3A 4QHTA 3DCYA 2R0QC 4RVFA 3IUJA 3V7UA 2GVDC 4YJFB 1F0KA 2RH5A 3VV3A 4N40A 4Z53A 1RLUA 1LLUA 1PGPA 2FETA 4NK4A 5JY1A 3WRWA 5I7AA 3K1TA 4AS2A 1E1MA 5A0FA 3GFTA 5EJFA 2G6BA 1JEDA 3EXEA 4N0PA 3UBMA 2WMDA 2JL1A 4ZOEA 1CRPA 1TMOA 3CF4A 2H2GA 2FAXA 3H9BA 1LD3A 1TK3A 3PDIA 1QGUA 3WE7A 4XFJA 4ZCTA 3A1SA 1UF9A 1PYDA 4IHQA 2BGKA 1M2OB 1G5FA 4HYQA 1H1TA 2PGIA 2AVDA 1GUZA 1IHYA 1WNTA 1W6RA 4N3AA 2DUWA 2JEZA 4RF5A 2GZRA 1VG0B 4HS9A 3GY0A 4BVLA 5FB3A 2ZROA 4EMUA 3HXKA 4BWGA 4ALKA 2Q5IA 3IC5A 1RZ3A 4RLSA 1YRHA 3BGSA 1D03A 1ES9A 3RHTA 3QMWA 4E1AA 1SCKA 1T1SA 2OFXA 4C5BA 3V8RA 4HNQA 3ZXXA 2J85A 4GOOD 1E98A 2B35A 4JI0B 2AYYA 3HQ4O 4ZAYA 4MZDA 5L3RA 3ROTA 1LWOA 5FI3A 5TARA 3FYUA 1ZZEA 2Q21A 1CBUA 2HCFA 5LQUA 2OBMA 2ZJBA 3A0UA 3OEEA 4B4KA 2O8DB 3SM9A 1QGZA 4B4OA 3A4NA 2OVBA 3H8WA 3ON5A 4MVCA 4X24A 5EVJA 2OILA 3KLPX 5EMKA 1KI8A 2C57A 2Q5HA 3T7CA 3A4MA 2OK8A 3IEKA 4F4JA 4G5QA 3WNQA 1Z35A 3V2UA 3FLMA 4PBSA 4HDNB 4Y9TA 2HJ9A 2FVYA 1JA9A 3D81A 5K0NA 3S44A 4JDUA 4FWTA 4Y3UA 3G5LA 2MCFA 3DUFA 1DKUA 1JPUA 2ZU0C 3H0KA 4H6XA 1TPZA 4BQEA 3UCEA 4DQVA 2R1TB 4BKOA 3DLTA 1S6YA 1W2GA 1ZK0A 1FUIA 3MJHA 1YRQA 2WHXA 1WMBA 3U3MA 2C5LA 1Q44A 5KVSA 1XLTC 4NZMA 2DFLA 3TW8B 3WYFA 2XUDA 2YWBA 3Q5EA 3COJA 4JXZA 2X2EA 3D8UA 1P5FA 4W8GA 4X45A 4LCEA 3VPHA 1I6MA 2QTZA 2PT7A 2QSUA 4MRPA 3EVTA 4WN9B 4UJ5A 1F1JA 4I55B 1SD2A 4EGSA 1H94A 2WUWE 5AVYA 3UH1A 4A6XA 1IWOA 2FPOA 2IPNA 3Q2OA 1XF1A 4N0DA 1XLTA 3ZBUA 1E94E 1EQAA 3VPSA 1SZCA 4UTOA 5BWNA 2I7TA 2BFBB 2FFHA 1IN8A 2Q5CA 2QLBA 4J07A 3UQZA 3ZGLA 2VDUE 5CDSA 4MVJE 1TUIA 2I9PA 2CFOA 5BRNA 5IASA 4BVJA 3RGGA 3T3HA 2ZRJA 3QEAZ 4TYNA 5FRDA 3IJEB 3H97A 2IDKA 2VTVA 4M1SA 2JLSA 5BSWA 3G0CA 2POCA 2VP2A 1SCBA 1TA9A 1WXQA 4F3NA 3CA8A 1GPKA 1VJ1A 2COUA 3QKRA 1U11A 3WWDA 2BRUA 1S2OA 1M2NA 2H4XA 4DNQA 3I58A 1Y6FA 3I32A 3QWAA 1RSZA 4DYHA 4OHYA 3PIRA 3GDOA 2OY0A 4RH3A 3BIFA 1UR5A 1YC5A 2QGZA 1EQ2A 2WUGA 2JD1A 4HWOA 2WM9B 1Z4OA 3I73A 3ZBQA 2ARKA 1ZESA 3QVGA 1R6BX 3PFWO 1H6BA 1QMPA 4GMKA 3EGOA 2ZEJA 5EIFA 2X19A 2HF7A 5BW8A 2A5DA 4AO8A 2FSSA 1CY0A 2OV4A 3JVVA 4B4VA 1A98A 3PNQA 3MFYA 5F2EA 3LM8A 1QF6A 1JSXA 2QWXA 1CB0A 1MAUA 2QD1A 3CURA 4UD6A 4ND2A 3U16A 3E9DA 3LX5A 5THQA 2CYAA 4BFVA 2IELA 5JO9A 2HUPA 2OGZA 4IICA 4LWZA 5KNDA 1PK9A 1UEXC 4PY2A 3IKLA 4WXPA 4XA8A 4UAVA 2XF8A 3DSRA 2CF6A 2RHLA 3K72B 3QITA 4H4CA 4YAOA 1YVPA 4K7JA 4QOGA 4DQDA 3RIGA 5G40A 1F6BA 4IILA 1O54A 1CQPA 2GEUA 3AOGA 1E9FA 1PL8A 2Q2OA 3AUSA 4GD3Q 4NH4A 5GQSA 4Z7OB 2BZ0A 3NP9A 3RHZA 5TPWA 2TS1A 1U8EA 4KLAA 4D3SA 2WWGA 4YPOA 3OMLA 4MCAA 1D2MA 3F49S 3NTRA 1X7YA 1XJ0A 4I19A 1FS6A 4JB8A 4LRTB 4WLUA 4WJKB 5GVSA 4MS1A 2IYUA 2EG5A 4DVJA 1V9CA 3LLMA 2QPOA 3MFQA 2WFLA 3X43A 1NJFA 4ZCQA 4BY9E 5H0IA 4TZKA 4IVNA 1M10A 2QYSA 1PSZA 4MLZA 1O57A 2XMQA 5AICA 1P2BA 5D7BA 2WSBA 1D8TA 2L17A 4NPCA 2VXCA 2PVPA 4ZODA 1Q57A 1A1SA 2FP4A 2W6JD 5LP6B 1QHHB 1S2DA 4RDIA 4Y6OA 5IXSA 3MT8A 1D04A 1LQTA 3ETLA 3ODPA 4DSNA 5CA0B 4QNRA 3R40A 3STXA 5BVGB 1ZITA 5CB4F 1ZNQO 3M6FA 4WFQA 4YAEA 5K2OA 3FN4A 4IJMA 2VJBA 3S2UA 4B7XA 4TSKA 4A0RA 5I9IA 4JBGA 1OYWA 1VFPA 2ZRPA 4HRAA 2VPQA 3L5KA 1U0FA 1RXYA 3NI2A 1U1CA 3P71T 3R7WB 2SKEA 4A2PA 4DAOA 4US2R 4XLZA 4Y1EA 5TF0A 4XCXA 1JDNA 3RO7A 5GP1A 1A2BA 2PMBA 4X41A 4K6FA 3K5HA 4EY6A 1BCRA 2QZSA 3VC3A 4GMXA 5A4MS 1Z2NX 4QTYA 3ZGZA 2AMYA 3Q8LA 2NQTA 5E1OA 3VVCA 5IXYA 3C5VA 1WKBA 3ENQA 4LG1A 4ZHSA 1VKZA 3DO8A 1DARA 3BMOA 3R3SA 4X1YA 1RRPA 4V38A 2OXIA 4EY4A 2FN3A 3TZQA 3FTDA 4KUGA 4L16A 1L4KA 2FW7A 1CVIA 2QTMA 3H2JA 3HYNA 4ND4A 1N5JA 4RD1A 5TV2A 1LF5A 3WLSA 3CKMA 3JYPA 3RYCB 621PA 3TG8A 2OM6A 3PC3A 3RKUA 1T0IA 4G5RA 3GIDA 3SC6A 1W5SA 5E7IA 4A26A 3OOWA 5FBWB 3LQ2A 3ZYZA 2Q4DA 3T7SA 3TGLA 2PUTA 3CMCO 3PGMA 5FLEX 5J2TF 1M8JA 2OECA 3HJBA 3UMCA 4ZFNA 5THKA 2DCUA 1Z0AA 2GBGA 3EZYA 4PLGA 5JXHA 3AFGA 1FFAA 3L0YA 4F04A 2JIZA 4ESEA 3ESXA 4NZPA 3W7AA 1NBME 1V3TA 2XUIA 1JQ3A 4ER5A 1RLOA 4A5OA 3ZGXA 4MQ4A 4BO0A 2V3CC 2OCYC 1WW2A 1ZH4A 3ZOKA 2PSSA 5HZKA 5U4QA 4UTXA 3E9QA 3RVSA 3B8HA 2AUMA 3O93A 2NSDA 2CJYA 1JG2A 4X3PA 1W96A 5HIAA 2XXAB 4B1FA 1A5TA 1O5TA 4JV5B 4NARA 1UQRA 2GJ8A 1VHJA 2P2NA 2ZUEA 2F1JA 4J0IA 4XYLA 4XVCA 1PJCA 2JA1A 5DYGA 5HXAA 4A73A 5K8JB 3F96A 4EO7A 5JH7B 4LY6A 4CFYA 2M1XA 4DBLC 5DTMA 1M7BA 5MN6A 4R0NA 1SQ0A 1H5QA 3K32A 4HR7A 3HFRA 1JHYA 1LNZA 5JFTA 4IM7A 3UK2A 5CEJA 2CGEA 2OBNA 1D6SA 4GWGA 3WAKA 2QE7A 5IUKC 3FGZA 5FUWA 1ZH8A 4P3YA 3VV2A 3OQVA 5ER9A 5TX7A 4DABA 3ZWNA 3R3UA 4R5HA 3DYIA 5ESWA 5EEGA 5CA1B 3DA8A 5TR9A 3ZWVA 3TLGB 4AG3A 4AXBA 1AHPA 1XZHA 4HAOA 1PJZA 1FOEB 2IF0A 2PVCA 1C4OA 3UGQA 3X44A 2AN4A 1SIUA 2DUMA 2WWTA 4X8HA 3ODGA 2Q8PA 4ZOBA 4NG4A 4ZYZA 3UUEA 3MD9A 4CMGA 4K40A 3BL8A 4LDRA 1PV2A 3SS9X 2VDWA 3J7TA 2I4IA 3KYDB 4DS3A 1D2GA 4IIBA 5JATA 2O8FA 3WY9A 4ITVA 1W36D 1YSCA 3GLGE 4X1KB 1XZNA 1QB7A 3G2MA 3T54A 4KV7A 1JILA 3DHYA 4A1OA 1JH9A 1RQPA 2ZYSA 4B71A 2XA1A 1MX3A 3A32A 3OZCA 1GAXA 1ECPA 3E3MA 3DLPX 4OJYA 3NPMA 1QF9A 4YXWD 3FFWA 5E6RB 1AQJA 2NUPA 5KVCA 2OD2A 3DOHA 4MS3A 3T5DA 3R3XA 2IEAA 4JUIA 2OV3A 3IE1A 2H92A 3M2PA 5FUVA 4MW1A 4KPYA 4XE5A 4EI2A 1OH5A 3IR6A 2XQFA 1Q11A 3ZJUA 1QGDA 2I4NA 2V4UA 5CU7A 3WLHA 5J43A 2R1VA 3VYUB 1BHJA 1WMEA 5DM1A 1PJAA 1NHGA 1Z6TA 1BXGB 1N2HA 3TIFA 1ABBA 2YHIB 5I7OA 4MQEA 4OI2A 4B9AA 2I8AA 3AK4A 3CRW1 3CX3A 4P4GA 4Q00A 3EOBI 1L4NA 1RWMA 1XXHB 2ZJ1A 4Z9XA 1W36B 2E89A 2OV8A 3IQGX 4BNYA 1XV5A 2C5FA 2HSDA 2OMKA 2XNSA 1G8GA 3FPEA 1OHHD 2F64A 2N9UA 4HDQB 4MA4A 4OKIA 4F2WA 1BS1A 1T6XA 1UKAA 3A4TA 3AILA 1ICEA 4NMMA 1XMXA 3VI3B 5HPYB 1H0RA 4QGAA 2CFTA 3OPYA 3I64A 5JNVA 6ABPA 4M3NA 3E7FA 4A6PA 4BNUA 3U6BA 1U9ZA 3G0HA 1UKCA 3T1QA 3VKFA 1ETHA 3NR2A 2W70A 3IEVA 2R3SA 5AJZA 4DLNA 1L1QA 3C5WP 4TLMB 5I5GA 3IP7A 3B7WA 1QORA 2DH5A 3LZCA 4NBNA 5KJFA 5I9LA 5H4HA 2PR2A 3ROQA 3U37A 3ADOA 3ZS9A 2WF8A 4ZYUA 1QBKC 3DBLA 2FPPA 2Z56A 1YCHA 3KTAA 4TTQA 5FORA 1XOIA 1NI5A 5EUBA 5F33A 3M6VA 3G02A 1M33A 1YJ8A 1XP5A 2ZS8A 4GR4A 1C7EA 1UBJS 3CKLA 5SV2A 1W1IA 5JDCC 1O94D 2QXUA 1PLKA 1BCSB 2QRGA 4WOPA 2G9RA 1YR1A 3R9KA 1JHUA 1U2RA 1I3KA 4JGIA 4YLYA 1RYDA 2JFPA 2X2FA 3ZU3A 1YBAA 1T0HB 5DLPA 4XWOA 3NC4A 3MCZA 4NQZA 2B82A 3TI9A 2AKEA 5GPBA 1V1MB 1JSRA 4QFDA 3SR0A 2GI4A 4W8OA 2O8BB 4IWNA 1GDDA 2HHLA 2PA0A 4OFWA 1VB3A 4MI3A 4LUCA 4YV0A 3PFIA 2G17A 2JNWA 4NPAA 3PZRA 4S1TA 5D5PA 1LGYA 2XW6A 3KRTA 1KZ7B 3PUWA 2CNBA 1BGXT 3KQVA 4HNTA 4QOIA 1AZTA 3N2NA 4Y9DA 3ZDBA 3DMHA 5DCLA 5C1BA 2NPOA 3O5AA 1NSYA 4G65A 2WMOB 1Z34A 4GFDA 4BFUA 2IUSA 4D0NA 4CEHA 1F17A 2WJZB 4FQ5A 1QV9A 2F17A 3HUUA 3HY3A 3KZMA 4MRRA 3SS7X 1U63A 3C8UA 4RV9A 2BMDA 1OYVA 2BUBA 2VPYA 2DHDA 2C4NA 2ZBEA 3DCNA 1NYLA 3NIWA 1FY2A 2AF3C 2AFHB 4UNSA 5EE3A 4IR7A 3KHUA 1XHFA 1JTVA 2EBHX 2G1UA 5HEKA 4MPRA 4Q9HA 1MDFA 5L40A 4M0UA 4WVLA 3FZYA 1XAIA 4ZIRB 2KW5A 2BZSA 3I34X 1P3DA 4AMBA 2AWOA 3WIDA 3JASA 3FOBA 2IYAA 4AN0A 1C3EA 1NVTA 4QVIA 1YNSA 2BTQB 3VTAA 1XTJA 4YBZA 1PR9A 1X9HA 4BIMA 5CLJA 1JAHA 1I4EB 2EZ4A 2XI4A 4GPEA 4YJ2B 2X2OA 1CVLA 2RGBA 3TI7A 4LFAB 2XMZA 1QYDA 1OILA 2A5FA 3DZGA 2CL7X 3F5DA 2ZJ7A 1OYYA 4G1BA 4IHKA 3TX2A 4CF7A 1XMJA 5HA5A 1DPFA 3OTIA 4XOIA 1Y6RA 4YP7A 1M72A 1MFPA 2H48A 4EG6A 1BKDR 4XFDA 1Y4UA 1TYAE 1SHZA 4LOHA 4TYWA 2ZTVA 4JLAA 4P98A 1GKIA 2AUNA 3H4TA 3LBFA 2QENA 3QJGA 3T4EA 2AQKA 2H1HA 4BVFA 2O19A 2XPCA 3C14C 3MS7A 4FJ1A 5BSRA 2I2CA 2W2LD 1JX6A 4V24A 5BN4B 5KYUB 4GICA 3V32A 3W3ZB 4O4JB 5DGHA 5DHSA 5L6MB 3V4RA 3F71A 4N7BA 3UTCA 4HMOA 1THGA 3QPAA 4EPWA 2PLFA 5B2EA 3GLHB 4I4TA 1W7AA 4KYTA 1AXEA 1BXKA 2OKGA 4B5LA 1RCUA 2H1WA 3MIIA 3HO6A 1N5MA 3AF6A 2BGGA 1VE3A 4TMXA 3GGPA 2CW5A 2W58A 5LP6C 3LC1O 2NNWB 3IAXA 1XDWA 4MUYA 1MH9A 1ANKA 1NVGA 2P79A 1UWKA 3HP4A 1YB5A 1K2VN 5AW9A 3V3TA 4B17A 5IUJC 4XX0A 4BFYA 3DZFA 2PUCA 4PV7A 3VXKA 3ZXYA 2ZYGA 4WJLA 2HIMA 2AG0A 4IH9A 1UT5A 1DI0A 1IWPB 1TGYA 2NAFA 4C4YA 4EY7A 1IZ0A 4IFIA 4ZEXA 4XDZA 1Q91A 3ZU4A 5BY2A 1ZSNA 5FT9A 4H7PA 5M5BA 2EARA 1AXRA 5B1DA 1RJDA 1Z2EA 1JWAB 1LTHR 3X0DA 1SB9A 2O0KA 3BRWD 3CLKA 4BVAA 2XHZA 3BX1A 2NU7B 2HLDD 4F60A 2WKPA 1ZCJA 5KOHB 1OXUA 1QG0A 1X6VA 3CHYA 1U3CA 1WBJB 2P11A 4NU6A 3SSNA 2CVHA 1ZH6A 3SNHA 3TLEA 2V7EA 3UV3A 5CGZA 3W9BA 3CUUA 2P3LA 3TF5A 5K3DA 2V6JA 4IQ8A 4MV0A 3GARA 1JHMA 3N74A 3GLIB 3G2OA 2ZG6A 1TO6A 1PW5A 2RMKA 3MOIA 3QMVA 3QPWA 3R2JA 1QCZA 4NYIQ 3SHVA 4O63O 2IOHA 5BW5A 2HLHA 3E53A 4KSCA 4YEDA 3GU3A 3PENA 4V39A 5JD5A 2D59A 5KNCA 3GBSA 4XM2A 1DUSA 1P7YA 2PMDA 2P6OA 4C0JA 3P1JA 2ZK7A 2DULA 5DWVA 4E15A 4A6EA 2EJCA 2ZCJA 1VIVA 1UDXA 1YAJA 2P1RA 3Q7QA 2XDQB 2XB2A 1MX9A 3JALB 4U02A 2DQKA 2PGAA 2QM3A 2YX1A 3AESB 5AHKA 2FVXA 2PYIA 4LVNA 3H2KA 4ZO4A 1I6WA 1T5BA 3ANMA 3MD0A 3R3YA 4G2NA 1OTHA 1T1GA 1Z0UA 2EOAA 1EWKA 1G55A 2G4CA 3AX6A 3WQBA 4KFUA 1MAVA 1U9CA 2D2XA 2VJMB 3ZHVA 4PWYA 3K71B 1G63A 1Z7GA 4XLLA 1JKJA 1NZJA 4ZK6A 4K9LA 3K70D 1N2GA 1MU0A 3DMDA 3QX3A 4MGHA 2IDMA 5L3SB 3BE5A 1MGPA 4JR1A 5F78A 4DCMA 1JDVA 5HCIA 4Z2YA 4BKPA 4YFYA 2DHCA 3DBRA 3EXG2 4MKIA 5EP2A 2UYCA 2Q9UA 5T4HA 2GILA 5IAGA 3ML1A 2DP4E 5DISB 4LZZA 1PDWA 1R5BA 4PPGA 4QPCA 2Q6TA 3RU3A 5JBNA 3U17A 1W4AA 2C92A 2BFCA 4EYSA 1A50B 1MXFA 3AY3A 4ARZA 3T38A 1VDMA 5B30A 1GNLA 1ACMA 1JLKA 2DQYA 1XRRA 4HQ6A 5E4JA 4EMBA 1XFDA 2D4AA 2UYQA 4BO7A 4N7RA 3SYKA 4HAVA 4MVWA 1DO0A 3D2BA 5EZYF 4HDSB 1ZJ5A 3NDIA 4BCDA 3DOCA 5K3BA 3C16C 3ENNA 3UZUA 5JJIA 4MKFA 1A96A 5KOHA 1K68A 5D1NA 3E58A 5I3ZA 3BHNA 3LRTA 3BZUA 1NMZA 4LGCA 2QHXA 4JOCA 3SN6A 4F3RA 3K70B 3HGQA 4MUNA 4J0JA 1FVOA 3HI4A 5DW3A 3GDGA 4AZWA 1HDIA 1OX4B 1RTTA 1ZL2A 3PFFA 3BS4A 3SXUA 1UPXA 2FFJA 1W2HA 3TZBA 1P0PA 4QODA 2FW0A 1N2EA 1ZD3A 4UULA 1QCDA 1KYTA 1TU4A 2F9FA 2JIQA 3U4AA 4JU8A 4C7OB 3I92A 3NRBA 3SYLA 4EW6A 2XDAA 1W59A 3QKUA 5C0OE 2EKZA 3TPZA 1EP2B 4JZYA 4LMAA 2NPIA 5H16A 4DQUA 4BDSA 2Z30A 3QNUA 5FWDA 2JKZA 2Q8QA 1MVNA 1ZR2A 1EUQA 1NXSA 4UVIA 1JEYB 3DP7A 3I4CA 4ITRC 2RIPA 2Z6QA 3VZQA 1BMQA 2QQGA 1HNZB 3WGMA 4EHDA 3ZWBA 2VBFA 1RYMA 4NLLA 4F8EA 2F9MA 2HMWA 1W36C 4BGIA 1XNGA 2JAHA 4LVOA 3P94A 4RTJA 2WHEA 3R20A 4KR6A 1Q16A 3W5AA 4MVJD 5IK2D 5T4FA 4JB0A 3H1AA 4OG2A 1U1DA 3RS4A 2R1UA 3UMVA 4E1BA 4M0CA 1MC1A 2HAEA 4ZU3A 2OZEA 4CKBB 5DX1A 2IV3A 2C78A 2H6EA 4TVBA 2D5AA 4PXAA 5H81A 1B8PA 5AFSA 1NP3A 3IDZA 3BHJA 3L8GA 3NM5A 3RV4A 1Q0QA 4R9UC 5CT8A 2PJZA 5DM60 2WJ4A 3K0HA 3F7TA 2A7QA 4Q82A 1MDBA 3F9CA 5F4ZA 1TF2A 1UOOA 4PO3X 1NQTA 2BMJA 2C9ZA 1BJKA 4OYLA 4BVBA 5AW6A 1ZA1A 1BRTA 2VAWA 4WXYB 1NW3A 3MIZA 4WKOA 2VOJA 4M6WB 3O4FA 4BQPA 3TQSA 9GPBA 1QPZA 2BW0A 4W9NA 5TVGA 3PNOA 4JUFA 1ZKMA 4KX5A 4WZAE 2XADA 1E3LA 4D9FA 5KZMB 2DF8A 4ZJPA 2WM8A 1WXIA 3TQCA 1GNRA 2QTBA 3JQRA 3QVSA 5REQB 4BWVA 5K6AC 3T0IA 2QYHA 1C8KA 4BNFA 4BE9A 1WM1A 3C41J 3A1VA 4O8CA 3GZTB 2NO9A 1E5XA 1Y8RB 2I2BA 1Q1EA 2H3HA 3W2EA 5T3UA 2PRIA 3E70C 1D2NA 2XY4A 1FYVA 2O9JA 2IUEA 4TLDA 3ESDA 3VNRA 4DIDA 5CVCA 1BE8A 3TB4A 4FYIA 5K6AA 1HDCA 4CCYB 2Q1YA 4DUYB 4U0JA 3CNNA 2B1RA 4OF4A 1GUFA 2GCEA 2QROA 3DONA 4WNYA 5BNFA 2NUTA 5B1YA 4UEJA 1RACA 2B34A 1EXNA 2QYTA 1X7XA 1RJ9A 2C8LA 3CLUD 2DT8A 1I9GA 1L4BA 4JU9A 4ON9A 1C9NA 1XKLA 3W06A 1TM5E 4IDQA 2HU7A 2HA0A 3KBOA 4ND8A 3U9LA 4N4AA 3QHAA 2GN9A 3DNMA 2YN2A 5FO1A 5EINA 3VR6D 3L8FA 4QQNA 3DEKA 2YN4A 4C07A 3P5SA 5JAMA 2CYBA 1ECGA 3OPYI 3FPJA 3AB7A 3C7TA 3GJ5A 1ZGHA 3V55A 3BREA 4BMYA 5MFZA 4X97A 1PTJA 2IXTA 1X8XA 3H2HA 3BZWA 2P2LA 4FYVA 4HWSA 4GHWA 5AK6A 4DDVA 5IKXA 4DIMA 2ISSD 3THOA 4Y0AA 2IYQA 3C45A 3ZWXA 1RXUA 5TEVA 1P2SA 3OU6A 2B1QA 2CLHB 1K9SA 3GCZA 4F85A 1ENZA 4BP9A 4W9MC 2A3NA 3BGDA 5KTPA 4HTFA 2MYNA 4XB2A 1VIDA 4RPHA 3WL6A 1T3HA 1ZM2A 3KEMA 1SQFA 3DKKA 5CM8B 3U0BA 5JUWA 3BAZA 5KU7A 5FBRB 1H9AA 1AUOA 1R4NA 2R48A 3QZUA 3D8BA 4OY3A 2ZVJA 5DB4A 2YINC 3R0ZA 3UMSA 1UZMA 5AJTA 4YUVA 3S29A 1WEKA 3FMPB 4NSNA 3OP1A 4UTVA 4HH4A 3N0WA 3RHFA 4U8HA 2DLNA 2H0AA 2D2EA 4DGQA 5JEEA 3EQ2A 2QNIA 3CJQA 2H5LA 4OJKA 2WUFA 4QYXA 3L6UA 4DR6B 1AHIA 1BXRA 2Y1OA 2YNMA 2Q07A 2RBEA 3ZCXA 1B42A 1KO1A 3GRFA 2AFIA 2ZIZA 4O2BB 1PHRA 2J3EA 5KMGA 3ZJTA 821PA 2XB8A 1CUZA 3EDYA 1U2EA 1R00A 3S7TA 1JKXA 4AF6A 3E1SA 3S3TA 5T67A 2RARA 3TNYA 2RGNA 4LGVA 5DXAA 4BIIA 1J22A 3GLFB 5GIOE 1WSBA 1MNQA 3GGDA 4U2DA 3ZXUB 1V8OA 1C3OB 5D1HA 4YRZA 3I8SA 2G5TA 1DFHA 1RLJA 2ZTLA 3COWA 3I4FA 5MFPA 3H4MA 1QE0A 4IH1A 4YROA 4IIDA 5HW0A 5JAIA 2VT2A 2OZKA 5CYOA 2VS1A 3L43A 1G41A 2FHPA 5FOQA 2GYUA 1D1SA 4PBTA 3T4UA 2VJNA 1N1MA 5H80A 4NU5A 3A6EA 3BFVA 4LJLA 3KCNA 4RY8A 2Q9AA 3GPIA 3ELDA 3FHLA 4UVGA 5JDIA 1ZOSA 4TQGA 4EVSA 1Z4LA 1QRUA 5BORA 1TQ6A 1A27A 4I6GA 2PXHA 3K6SB 3BJZA 3I5MA 4JLPA 1KPHA 1H05A 1JDBB 1NE2A 5IZCC 5F9HA 3FHTA 3NDBB 1VGRA 1U1IA 2WF5A 3LJKA 2X8JB 1H4VB 3FWYA 3M0EA 3SQNA 2X5JO 4N3CA 2FX5A 1AO3A 1RM3A 1ZWLA 2KLBA 3N2YA 4KRXA 1NUPA 2AG8A 4MKHA 1E9CA 4RZIA 5CJJA 3SOZA 3WLNA 4EJSC 2Q5LA 1GM5A 3LAWA 3LOUA 5JLAA 2QT9A 4FZ3A 4EGCB 4IIYA 1BC5A 2CFSA 3T7KA 2XUGA 4FHFA 2FH5B 3KU4A 2H07A 3CTMA 5CG2A 3LVRE 3PFCA 2XB6A 3E2IA 3KQOA 2W4QA 5DTEA 1PZGA 8ATCA 1F38A 2J07A 1DCMA 3CR3C 2Z1NA 1AKYA 1RRFA 1SA0A 3A6JA 1RQ2A 4EJSA 2V7BA 2MDTA 2D2IA 4BLUA 3HB5X 5CG1A 4S1NA 4O3MA 4KAAA 2VJKA 2R8EA 3A2MA 3D6UA 4B8WA 3PYLA 5E2IA 1X2EA 4OXKA 1Y7HA 2MWMA 4ZVUA 3IQHX 1YRYE 4MWZA 1EFVA 3GUYA 1KBQA 1B15A 3H2BA 4BMCA 4DPMA 1BD3A 1HQYE 3RYFA 3AERA 1ST3A 3EQZA 3AB3A 2V45A 1RYBA 4IGEA 1AKVA 3QMMA 5KYTA 4NQRA 3IAM6 3DO6A 5CVUA 3F5FA 4L4ZA 5I4IA 2FEXA 2ZB4A 1WXEA 3P32A 4DLVA 3VH1A 4DRZA 2ZE6A 2IYOA 2PZ8A 4Q3OA 5CT6A 1M83A 3LNTA 5A6SB 1IXRC 3T5TA 2CMFA 1QLJA 1YBMA 5JD6A 2GPNA 3O3CA 4GMGA 1LDNA 1P8AA 4Z1OA 2D2FA 3B48A 4U39A 4NV1A 2ZJ0A 3JZDA 5FPHA 4RPGA 3GLGB 1AKRA 3H5WA 3EARA 4R0VA 4Z4CA 3PLAE 1R50A 1CE8B 1U3WA 4UVHA 3EVEA 1E3WB 1IBCA 1X0XA 1WPQA 1IOZA 3SF8A 3PNLA 5FFFA 5A2QA 3X2SA 4X8MA 2DKNA 4GH5A 4NRDA 3ETEA 5TIIA 3V3KA 2GPJA 1I2MA 3ICCA 4PLCA 3CEAA 2FG6C 2FR1A 2V7PA 4RTKA 3LCJA 5EIBD 2B4YA 3CH6A 3Q3GE 2NXEA 1OQAA 2XQIA 3G13A 2BM8A 4KRGA 4LYFA 4ASUA 4ZGBA 4KR7A 2BJHA 4H6WA 3G17A 2ZSIA 1VL8A 4QEDA 5TQ0A 2DAPA 4INJA 3T61A 1OZFA 1U6IA 1C7IA 2GT1A 3NUZA 3QW2A 4F6CA 4WESA 1PVOA 2VSOA 1LKZA 1WABA 2FJPA 5DM0A 2ZUUA 4OMFG 4R9SA 4KE7A 2WB4A 1W581 2BN4A 4P33A 3AR4A 2XYPA 4U7PB 3RS8A 4IFEA 4IDHA 3U62A 2GM4A 5IJXA 2JFZA 3FVVA 5TPZA 5I4KA 1CFZA 2I6TA 1QTQA 4Y2GA 3N7UA 4UNIA 2KWIA 1YGPA 3G9UA 4ZV4A 4KR2A 2DB3A 2QJWA 2C29D 2NV0A 4UEOA 2O07A 4AMZA 2C8JA 1T8SA 1KY5A 4OREX 1EIZA 3S2ZA 1G4AE 3Q9SA 1E1YA 4GX1A 1JHXA 1Z2OX 1L5YA 4YHBA 3C6YA 4IW3B 4IKEA 3TWOA 1VXOA 3EXFB 2GK3A 3PEEA 4WY2A 2I2XB 2NQ8A 3EWIA 2VKQA 4JCOA 5ALTA 3P0HA 3LCCA 4BNMA 2VVTA 4TRJA 5GJCA 1M6EX 3OCXA 2WBLC 4D3FA 5G0VA 1VSQA 3HRHA 3EIFA 3FIUA 1IXZA 2VAMA 2R6HA 4DMUB 5B3KA 4JB2A 1GNVA 3KK0A 2YJ3A 3KO8A 1DC6A 2PZJA 3NHRA 4TV9B 1V8DA 1D7AA 4DA6A 1U2PA 5HOEA 4Z4EA 3R44A 4FFVA 3RT1A 3OZAA 3EA5A 4HQ0A 3NTUA 2GXUA 3MILA 4HX9A 4TVSA 1NDQA 1HO3A 4ACAA 5I45A 3LQ4A 2WP8J 4D9EA 4E4YA 5ESXA 5BQXA 5BWBA 3N87A 1UC5B 4Q9KA 2J5KA 1PUIA 3HJRA 3BTSA 2JF0A 4YA6A 2A9VA 4HDMB 1U0HC 5J2UF 4DJ5X 2WZDA 1QFSA 1SHLA 1J5PA 3MJ4A 1KBOA 1LW7A 1SVWA 2BJVA 2QTCA 2LVBA 2K2QB 2QZ4A 3BGVA 3Q5DA 1JI3A 3M33A 4PG6A 4RDCA 4A4DA 3MTIA 2VCEA 3GH1A 3U44A 4QPZA 3HB0A 5JNWA 1TMKA 1N7IA 2WF9A 4BLRA 3A1TA 5KX5F 5T7BA 4JUAA 1CXZA 1FJXA 1IH8A 3HKBA 5A7HA 3KB8A 4AZ3B 4JXKA 3GEEA 4ZDWA 3UB3A 4JVOA 4X5OA 1FFSA 4CQLA 1WHSA 1HOXA 1KYQA 4CL3A 2FPMA 3CUWA 3LUCA 4BATA 2GZHA 1DAPA 2W48A 1EHCA 3KJGA 3OFNA 3PPIA 3K15A 4MPJA 3EXIA 3E6AA 1KOFA 4KQ2A 3PA6A 4MB2A 3DL2A 4WLOA 4OAOA 3VHRA 3ERCA 4R9VA 1SG0A 3IPLA 2XGMA 5K8IA 1MJ5A 4UBIA 2AOVA 4EIWA 4FS8A 4D0GA 5ARDA 3EZXA 5ICEA 3FNHA 2D7DA 4ER0A 1KMIY 3V1LA 1HTTA 3U9TA 4YRIA 1P77A 3H9JA 1FW8A 1M6NA 3N6VA 4LKOA 2NVBA 4FOSA 4OIMA 4Q9AA 2H2DA 3IV6A 4TLBA 4Z6KA 3FWPA 1ZOPA 4GRAA 5JSZA 1XQ9A 1RLIA 4DM4A 1PBTA 3JTEA 1LPBB 4LF6B 3VGJA 1M1XB 4GSKA 3RGWS 5BSKA 2APJA 2WZQA 3B1ZA 3TCXB 5IBRA 1ZS9A 4E46A 5DGCA 3K4HA 4P81A 1O08A 2W71A 1Q19A 1OI3A 1RHMA 4AJIA 5D3MA 1QC5A 2MSDB 3LSYA 3SZMA 4KO1S 3S5UA 5F1YA 4W5NA 1SZPA 2ZUDA 4U6NA 4BGVA 3OP4A 4KLZA 2BEKA 3BTOA 2R8YA 3EA0A 3LKBA 1F3OA 2O3TA 4GOLD 4K9KA 4N0MA 1Q1BA 2E2WA 3N5CA 3CSDA 1NOJA 1PR5A 5FI0B 1EWVA 3V42A 2AOTA 4QOEA 3ZWDA 4UQLA 2ADMA 3QLEA 4UCXA 3FOEC 1S9DA 1N3YA 1X8KA 2VJDA 3IT0A 4JXXA 3KKNA 4PX5A 2R2GA 3QSGA 2NVUB 1U4SA 1VOTA 4GMHA 2V0CA 3FVQA 3QKWA 3I9FA 3AUUA 4MA0A 4R6WA 2WNIA 1QOZA 5CW2A 4BE4A 3F6SA 2CE7A 5A04A 4OAQA 3D4NA 4RD4A 3T3EA 1S7CA 4EG4A 2AYZA 4DEYA 3LRXA 2ZT6A 3HKEA 3C3KA 3MJTA 4HGPA 3TW4A 4RK1A 1XNHA 5GM1A 3OF3A 4ZOLF 3Q1KA 4S12A 4CM1A 3WGYA 2CYCA 2YVQA 1CIJA 1IPEA 5FTMA 3RHSA 1BWQA 3MAJA 4E08A 2H4HA 2H1RA 1CNMA 2P4UA 3GCDA 3X1YA 1UMBA 4AKHA 1WD5A 3DZDA 2GRJA 1NNSA 1VG8A 2M98A 3KQYA 4QAQA 3ZE9A 3QUAA 5D7NA 2VXBA 4UHCA 5ALNA 3H5RA 3R8CA 1VCIA 1K89A 4DG8A 5ALPA 3P27A 3MRXA 3QXSA 1YDEA 1I1OA 3V8VA 1W1UA 3OQ6A 5EHNA 3SU8A 1JT2A 1KJJA 4WD3A 5J40A 3N2KB 1E9DA 1HNNA 1JDBC 1ENOA 2X7JA 3DOEA 1QU2A 2QL7A 2Q3MA 2YV5A 1PJ4A 4KKXB 1S5PA 1T2UA 1X1CA 3GAFA 1L8AA 3KYCA 2FZKA 2ADFA 1Y37A 2NO4A 1CQIA 1MP0A 1I5EA 3JWHA 4WK2B 4ZT4A 3UT6A 4DMGA 4BLTA 3HDQA 2Q41A 5KVVA 4YQEA 1AC5A 2OA0A 3UUGA 4RA6A 4B6SA 1JB1A 4DNOA 1U0BB 2VRCD 3BMQA 3EJ6A 2VHZA 1QDLB 1OLXB 4MHSA 5DJ5A 4KIUA 3W1EA 1W25A 1RAHA 3PQ5A 3LXRA 3PPWA 1IXYA 3B13B 4GBED 2VDPB 3V7YA 1FFXB 1M2VB 4M0KA 1VJDA 1FLAA 3OFJA 3DLBA 3NKLA 3HUEA 1C7ZA 2DWPA 2CXHA 4FHDA 2XBUA 3PRHA 2O20A 1GQFA 1NBMA 1L5SA 2O2CA 3LBYA 1ZY2A 4CQMD 4CW7A 1TJ4A 1GG8A 2WPDD 3GCWA 3H9GA 4HEQA 4L8WB 4QJ3A 3L6DA 1A0OA 3AW8A 3GCGA 1DV1A 2VHTA 2BFDA 3F90A 1FE8A 2W6IA 2X0JA 1LPSA 3BK1A 2FQXA 4UUOA 5EKDA 2GPBA 4J0QA 1CDOA 3WYDA 2Y6VA 3G2NA 1NW5A 2ECQA 2Y0PA 2UZ4A 3L7NA 2IZ1A 4BEBA 5HZHA 1FTGA 3NJ8A 3VU3A 3C1AA 1NT2A 1Q0RA 4H7HA 4LK2A 4K3UA 3ADCA 4AX4A 4KHZA 5LYJB 1WW3A 2UV8A 1DQYA 2CMGA 4P8RA 4QXAA 5BN5B 1DX4A 3H4IA 4RK6A 5EXEA 3WLMA 3FUUA 1O3YA 3IJ5A 4C6RA 1PGJA 2G77B 2H4YA 2FGJA 3JD2A 4GOKA 2CJWA 2B2CA 4I9FA 4J0GA 4OKNA 1NY6A 4ARSA 4QM6A 5T64A 4QATA 2EATA 2QSJA 3UUFA 1USVA 3RB8A 1N34B 2ONKA 4UQOA 1ORHA 4CQMB 1E6CA 1AKUA 1OPRA 2JCVA 4WAUA 3Q0TA 4NU0A 1QHFA 3DKPA 1QLWA 3JQAA 2AEEA 1PWYE 1VPDA 1QIDA 1Y9DA 2FSUA 1Q17A 2Z2XA 3OD5A 2O52A 4OQDA 4OA5A 3CS3A 4R6XA 3LRPA 1T8RA 3INGA 4B3BA 4CTJA 4E03A 1E5TA 3KOWA 1HYGA 4C2AA 1PF7E 3LDHA 2C7VA 4V0RA 4QVKA 1UIRA 4WOBA 5CK4A 1QVRA 5H3LA 3P5BA 1UBNA 2DE0X 3FOCA 4RTMA 2JI7A 1PLLA 4CF4A 5LZ2A 1Z8HA 2EJVA 2F1HA 4CKCA 1E59A 2GAJA 2WZCA 4YC7A 3T7AA 2JGKA 1MBZA 5K4AA 3FOZA 1H9BA 1UOPA 4A03A 1N4DA 3QEMA 3EG9B 1I2DA 1Q7BA 2NT3A 2VH5R 2WE8A 4C3VA 2XCRB 1SKQA 3D6JA 2NXWA 5FD8A 2NU8B 1U9JA 1GARA 4U3JB 3M83A 2AOWA 3JV7A 2IU0A 5E8JA 4AKTA 2NO5A 1Z6GA 1G66A 1WDMA 4DHWA 3DMFA 1TADA 2AS0A 1GZSA 3NBKA 3O6VA 5DPMA 5AUNB 2XVMA 1JIKA 5LZ5A 3HXQA 1HGXA 3RTCA 1REQB 3ZWQA 5TS3A 1XDUA 4K05A 4BX2A 3VR5H 1NONA 1UCFA 3AF1A 4Q4HA 2Q50A 2VQ6A 2VSFA 3ZVMA 3DUWA 1T9BA 2V8BA 4C0KA 1KXZA 1I3LA 1VMEA 2QE6A 3H0CA 3RIXA 2XXJA 1ZHFA 2G76A 2I7DA 2DM6A 2FUKA 1Z4KA 1L7BA 4QRDA 1Z2AA 3ONNA 2ZI4A 1U2SA 1IB6A 1T9KA 4KR0A 3OZGA 4RZ2A 1L5HA 2PMWB 4FR0A 2PNJA 3VJKA 3VVMA 1XTVA 3TOCA 2AUTA 5HK8A 4IXTA 5U1PA 3H3XA 2C31A 2CCKA 2RAFA 2JIZD 3JZIA 2FEOA 4UFPA 3TTWA 2XRFA 5B7QA 3QWFA 2Q6IA 5CTJA 4EI7A 1QVWA 5FNZA 2DC1A 4BBJA 2GKSA 2OD9A 2J6IA 1PD1A 1U31A 2C8KA 4NKRA 3HPQA 1N8TA 4PHTA 3L82B 1MB0A 5CUQA 1ZI6A 1EIWA 3BAFA 5AHXA 3HKCA 1U7TA 5IF9A 1QNLA 4YMWA 4R3UC 5DSXA 4B3HA 3BL5A 2R1ZA 2ZIXB 4Z0TA 1RKXA 1VSBA 1PG0A 2C3MA 1C1HA 1SKYB 3D4IA 3M4XA 5AD1A 5CD9A 1M2HA 3FTQA 1U3VA 2QY6A 3GGJA 4PFSA 9MHTA 5BNZA 2VT7A 1H2WA 2HF9A 3NNNA 2P2YA 2WAAA 4RULA 4Q39A 2AIRA 3L1JA 3SBEA 2QE7D 3AEQB 2AJLI 4JUBA 4WOKA 3ETCA 5CP8A 4G4JA 1ULZA 1V43A 1V48A 1XVIA 3AHJA 3DV0B 3FUVA 1ZMTA 3KR2A 4PSDA 4K6GA 1W35A 2Y8EA 4IIGA 3EZFA 4FK8A 5CB4B 2AKAB 3RJTA 1IIBA 2ST1A 5COBA 4LAFA 3BL6A 1YU6A 2G63A 2ZSFA 1FZTA 1O5IA 4NYIR 2XCLA 3VVLA 1EINA 3U7QA 3GLSA 3EE6A 3HJNA 3HYCA 4RJIA 5K0BA 2VDKB 3FHJA 1KOGA 1EFHA 1Z0SA 2XD9A 1EVLA 3AVWA 4O4LA 2YFQA 2A9OA 4E14A 4RADA 1B41A 5L4SA 3NH9A 3T06B 4TL8A 3TKYA 2GD1O 1LVGA 4IDEA 2BFFA 2HTEA 2PV0A 1SBTA 3G5AA 5HCNA 4WUTA 5EMNA 5BT9A 1MC8A 2EWMA 4ARUA 2O4CA 5DNVA 1GNTA 2OR3A 1FRFS 1ULHA 2XQGA 3N0XA 3FKSD 4KOEC 5SZJA 1OBHA 3TJZA 2JD0A 3W90A 4PZUA 4REMA 5E1MA 4UPVA 3DKIA 5ICFA 2X4IA 1NR1A 3NAZA 2LDBA 1GPMA 3DE5X 4N8DA 3RSLA 2A4KA 4F72A 3SC3A 2AF4C 3WLOA 5IRCD 1Z6QA 1M5TA 4TGLA 3TNJA 5JCPA 1XEWX 3IT2A 5KB3A 1QFJA 2AN5A 4NATA 3OE5A 3WRYA 2ERYA 3RVPA 4HNUA 4HI0E 4HUJA 1CLUA 1K9VF 1PR0A 4X20A 4C5AA 3OE1A 1NQVA 4TMTA 3U0VA 1XZBA 1TRHA 1OLUA 1U65A 3LO5A 4MV5A 5J2TB 2PUBA 1B8OA 1QHGA 2QN6A 2XEDA 2CLKB 2EKPA 2VSQA 3RQIA 2V5AA 1ZCBA 2R66A 2TMDA 1MMFB 2IE0A 2P1ZA 2O6HA 1V7ZA 3HO8A 2QW8A 3PGLA 1WVIA 1K75A 4F2GA 3W4KA 4IJVA 1O4WA 3VR2A 1XUOA 1PEKE 1QQ5A 2BWJA 2AI1A 2J59A 3P9PA 2LIPA 3HDGA 2XV1A 3BPSA 2E48A 1GQRA 1YZNA 4ES6A 3NUGA 3WRXA 1GNQA 4RQAA 3CONA 4AROA 2WZBA 5K09A 4ME6A 2C2WA 4Z4FA 3PE3A 4JLWA 2IZZA 4QBIA 1NL3A 3UXMA 5AI8A 3WBFA 3WSTA 3T5CA 4P32A 4V1CA 1RP7A 3G2IA 1YHZA 5AM2A 5KOJB 4L5CA 2JW5A 1U2ZA 2IEBA 3TTVA 3MINA 4Z9FA 5AW2A 1PJ2A 2G71A 3PPYA 5A03A 1KQOA 1ZN7A 3V4LA 1MC4A 4DDTA 2QXTA 3G5TA 2YUTA 5ALSA 2MOKA 1JS1X 1P19A 4HG2A 4RPCA 1UJ5A 4LOLA 4DIUA 2W42A 3H99A 4FT2A 3IMKA 2G8NA 4Y1RA 3I72A 4EFMA 2IPOA 3WGTA 4BJ6A 3UFXA 1JDPA 3TRDA 3EBOA 4Q3KA 3ZWWA 1J90A 3A6LA 3IEUA 2GBPA 1YGYA 3CVJA 3DBHB 3DOIA 3L02A 4GZ6A 3UJHA 3UT5B 3AOEA 1QQTA 3LLCA 2VDQB 5K01A 3B36A 4U7FA 4DMFA 2XCTB 2IH5A 1RVV1 2ID8A 1NLMA 1KJQA 4LY3A 4AL4A 3Q7PA 4XDYA 2PWYA 3QEBZ 4TSFA 1AGYA 2GEKA 1N2CE 3PE6A 5FR2A 4RF4A 4FFSA 3HH8A 3FFAA 1EFTA 2ZPTX 1YQTA 2OCPA 2R8RA 3M9XA 3C6MA 4ZKDA 5IKPA 4LE1A 3WB1A 1GPLA 4U00A 3BHIA 2FDRA 5WRFA 2FUEA 1JU3A 4PCAA 5C2JB 3PTZA 4F12A 3ZDCA 3OA0A 3LO8A 4EG8A 1NJ2A 4F45A 1P1KA 4OMCA 3C5CA 3WL7A 3LGXA 1NV9A 4QJBA 4FONA 4R2IA 4DCGA 2X6QA 3OSZA 4D9MA 3E2MA 1CKEA 1KAEA 4MRNA 1PKXA 4FMPA 4FLFA 4EUKA 2ID9A 1KFEB 2ZWMA 2R11A 2XCOA 2YYSA 1D6NA 3ET4A 3FJ1A 4G8BA 1MB9A 4L57A 4M83A 1Q7EA 3UMYA 4CR6A 3E4CA 4DCUA 3BE8A 3GJ4A 2QLNA 5IAEA 4ZEVA 1JV2B 5DYWA 3NCTA 3WMWA 2J4FA 4BFXA 3PNYA 1RQ7A 2JJYA 2XUHA 4URXR 4Z99A 2AB0A 4K1LA 3AMVA 3C1UA 5E6UB 5A05A 5KQMA 3B1KA 2DHEA 4IHAA 3CRVA 1OE0A 3MWDB 3CPEA 2YWDA 4TLCA 3FI0A 4M88A 3DAFA 1BAPA 1T1JA 2AQHA 1GU1A 2XE8A 2ZE5A 2BCGY 5LBIA 1MR3F 2QAJA 3NASA 3K0CC 4QUEA 3KOZA 4JKIA 3WNCA 3C3JA 1XALA 3AGPA 3KEQA 5DW0A 4KJZA 3D0RA 3L3BA 4BXOB 4PTYA 4FGLA 1UKBA 3B2EA 1RJGA 3GNQA 5JCOA 1P62B 2EVWX 5JD4A 2AMJA 3KUXA 1UOEA 1C50A 3HUTA 3SG0A 4F9EA 1DWUA 2CLDX 1CY4A 1X77A 1XO1A 1KDPA 4MTLA 1P7PA 1GCUA 1JVSA 1KEWA 1Q3KA 3H11B 1G8PA 3B7GA 1ZWKA 3KV3O 3L4EA 4L2IB 4ZAZA 2OQRA 3TSAA 2KQUA 3QBJA 1Z6AA 2I6SA 1GT6A 2JAWA 3CNHA 5DHFA 3WX0A 4B6GA 2HHHB 3AF4A 1Y7PA 1K1EA 4QUDA 3K53A 2ZJ3A 5DCUA 4PO1A 3Q11A 3VPGA 5TEWA 3GRRA 2V96A 2VHUA 2XTZA 3HC7A 5G1PA 3NAQA 3UJ8A 2GVZC 1ZUD1 4E6PA 1RBQA 4WPGA 2IYEA 3M9LA 4PVDA 1J8DA 4NF2A 2A3RA 1K6JA 2I33A 3HACA 4N03A 1USWA 1J2TA 1MXHA 1NF9A 4FFRA 4FGWA 4LZJA 3EPLA 2ZQYA 1JEJA 1BRMA 3QQ5A 2H2AA 2VI5A 1L5KA 2ET6A 1S9HA 3LCUA 2GB4A 5DCWA 4JP3A 1ZOIA 4ZEOA 4I6EA 1U4NA 3UA4A 1H8ED 4QGSA 2GPSA 1C9MA 3N8HA 3FX2A 1Z5UA 3N2GB 3IXQA 1X1EA 1XVVA 4GLLA 3REOA 3UCFA 10MHA 1P2DA 1Z25A 1SXIA 1G6OA 2GXQA 4LZAA 2V7GA 3W3AH 3HKDA 5K0SA 1XCGB 3HEAA 1G7TA 5CCBA 4XPIB 4C05A 1PEAA 4WSOA 1EUYA 4C2UA 4ABYA 1KYXA 3D1LA 1FS5A 1H2FA 2QR3A 1AQIA 2VDMB 2ZTUA 4PQGA 2BH2A 1E9BA 4BKMA 2IY8A 4O2LA 1YQDA 3DWEX 1XCJA 1JI0A 4G85A 2HRQA 4LI0A 4KBGA 4GC9A 4URHA 4ZT7A 1PG5A 2J7KA 1PJTA 5KNCD 3F4LA 3PSHA 1FC0A 4HH0A 1E0SA 1O0CA 1YKGA 3ND8A 3PUVA 2VBCA 3D5TA 3DEAA 3HNRA 3QFHA 4KHPB 4EZBA 1K4YA 4LYYA 4YYZA 1FNSA 2HK6A 4PHGA 5EXXA 4NP6A 2O5VA 1N3LA 3DOOA 2JZNA 1YRLA 3KKKA 1E66A 2R5WA 5IC6A 1M6VB 3DEIA 1K88A 4WCFC 1WHTA 3UJAA 3VYWA 1UJ2A 2XE7A 3PTAA 3D3JA 1Z47A 2DUNA 1FP7A 2ZJZA 3GWGA 3QLVC 3O8LA 4X00A 5HDQA 2PX6A 3O95A 3X1MA 1PZEA 3ECCA 2AQIA 3ISTA 4WZAA 1QDEA 2ZB7A 1W1WA 3BF7A 1T9HA 3JARA 4RE6A 2OFFA 1N25A 2OQ2A 3WGUA 2XMBA 1OC4A 3BE4A 4WCFA 1EDOA 1G9TA 2HCBA 3DM5A 4LF5B 3PQ2A 3MXOA 3F78A 2HJSA 4Q4JB 1WXGA 3CUSA 3E22A 5DLEA 2I78A 5HX7A 3LPDA 3I6QA 1DBQA 1DIOB 4LJSA 4OCZA 2XUZA 2KPOA 2GTIA 4KO8A 7MDHA 1XRPA 1EVJA 5AIAA 3CGGA 1CJKC 3G2QA 4DV1B 1FMCA 3I12A 4KVGA 4LZOA 4RC9A 4TTSA 2REOA 3IDQA 3QY0A 4DR7B 3RSOA 5IWCA 3MLAA 3SQOA 4TXJA 3HXMA 1H1LA 2FMFA 3AY0A 1AHHA 2ILTA 4R8RA 5BV8A 4TXNA 5CFOA 4DV4B 2MYPA 1EX9A 1FL9A 2I3ZA 4IQGA 5AWFC 4B87A 1VMIA 2PCLA 2QLFA 3QYAA 4RD0A 5F5LA 1Y9JA 1RYZA 5FAKA 1G5QA 2X1HA 3DPUA 4ED9A 2CZGA 1ZGBA 1TQ2A 2R86A 4HLUA 5CAEA 2CLEB 1HR0B 3PUXA 2C7GA 4TRNA 5BXQC 3GJ8A 4KFTA 1OIWA 2J5BA 3KVRA 1FF9A 3QVMA 3UIEA 1R8JA 3ZU5A 1DZIA 2BDUA 4G5XA 3UGJA 5JAZA 1OXMA 5H1YA 3IXMA 1QPBA 3KT6A 3JYLA 1AKQA 4TYPA 3ZUPA 2WNSA 4BMSA 5BNIA 1YFKA 2VP6A 3G8DA 3DLIA 1LLFA 4MUMA 4Z7QB 1N2JA 3CZAA 4PCUA 2BFEA 4FOOA 3AT1A 3IAEA 3OT4A 1DQZA 3KJIA 1PQ4A 1KI4A 1DAIA 4GUAA 4K8RB 3S99A 3RTAA 4D6YA 1SH7A 3CNQS 1TM2A 1HZZA 1CR2A 3OTWA 3PL5A 1QFMA 1XB2A 2ZRQA 2R8XA 3IR7A 3OCUA 3I4LA 3KD3A 4DMMA 4YRQA 1GR0A 2RJNA 3DYVA 1ZUWA 4WKNA 1P3JA 2J09A 1WDLA 1Z88A 2WIGA 3JXEA 4WLVA 5AJVB 1DUVG 1ILEA 1C5KA 2BFNA 2IDZA 2X0EA 4E21A 1LPPA 4TMYA 4ENWA 3A1WA 3L6CA 3C3XA 3ZK9A 3OCYA 4OGGA 2XBMA 3T7TA 2NSYA 2WW8A 3QXCA 1IWBB 2ECFA 3R5SA 3PHJA 1OI4A 4LWPA 3KM0A 4BAZA 2W2XA 4D3YA 4Q9LA 3CGWA 3PNBA 4ALIA 2J32A 1R5JA 3OWHA 2KHZA 2OSVA 3L1VA 5T4EA 3WMXA 4W5JA 2C2XA 1DIGA 4MEBA 3FF1A 5K2MA 3OHSX 4A0GA 4BQOA 2C83A 2CFRA 1RYFA 3IMGA 3LA6A 4M1MA 4US0R 2FEAA 2VJOA 3WHIA 3QSYA 3O03A 3CVOA 5K8VA 3JYOA 4NR0A 3L6OO 4XR4A 1E5VA 3UJDA 3D6TB 2B7BA 4NYMR 5DHRA 2EYQA 1ZD5A 1P2FA 1T4DA 1V8FA 3E9NA 4RWEA 1JA1A 3WLPA 2Q3JA 2NM0A 4OJTA 5ALDA 5IT5A 1QO7A 1TGVA 3X2FA 4UREA 2PGOA 5A1JA 5HZGA 2RI1A 1CF9A 4O2RA 3E2PA 2C2KA 1QHEA 2XECA 3PWTA 2JCYA 5E1DA 2Q6VA 3A1NA 3THYA 1ZGGA 4CUJA 3KFXA 5CXQA 2GS9A 4PYMA 2W6CX 4TS3A 4W6ZA 2XQVA 4ZI7A 2QG9A 3OAAD 4FOLA 3CX6A 4AO7A 3PITA 3GR6A 3PXEA 5T3YA 4JJEA 1O87A 5K0FA 4Z4QA 1DU4A 1PZNA 1UBUS 1WWKA 4OI1A 2GJ4A 3VUFA 4IDFA 1T8PA 3OT1B 4G23A 1KY3A 1XTSA 1GV0A 5DP2A 3CO5A 3MG9A 4F4HA 2NP7A 3K4QA 5DT9A 3W6NA 2GASA 3ZIDA 3ZU6A 3VSCA 1XU9A 4N12A 1XMPA 3ZKWB 2IYFA 2Y9PB 2YV4A 3OEYA 4IDBA 4G5GA 1LEHA 3O7MA 4JBIA 4MXDA 4PG5A 5EKSA 3LUFA 3DDCA 1B6RA 2L69A 4WI1A 1CJUC 2IOQA 3FGNA 5CB8A 2HFKA 2PMFA 4F2PA 4P9NA 2CXOA 3ZHXA 1C1XA 2DWQA 1XEXB 2C77A 2PR7A 4X7MA 3CH4B 1HNWB 4MYSA 2V0GA 3NWJA 1NKTA 1P1HA 4URYR 4JOBA 5CIQA 4RZHA 4MUIA 1QG2A 4CQNA 2UZ0A 5GJWC 1CS0B 3NHYA 4IZ6A 1AKWA 2JGEA 3O3NB 2XITA 4B73A 4CHGA 5IULC 1NJ6A 2XT6A 2IKQA 2VQDA 1E1CA 2VNKA 4CDMA 3R5KA 1EP1B 4IEIA 2FOLA 3CPJB 4Z3OA 3GQBB 2IS1A 3A70A 1KI1A 3C2QA 3RUFA 4V1CI 4O0MA 1T26A 2FMUA 3B52X 1M66A 2G5GX 2FRDA 3FKQA 4LVUA 1GZ4A 4A82A 3ETGA 5EHIA 1XK7A 3R0JA 2C5HA 1YJ5A 2ZBRA 4Y2JA 3ZEIA 2ATEA 3KXDA 1TFUA 5BR8B 3ELWA 1ISGA 2R7MA 3ENVA 2ZZKA 3MN1A 4D99A 1U2GA 3G6KA 1E2BA 3UANA 3BMXA 3WGVA 4ENSA 1GLNA 4C4OA 4R68A 1JMVA 2EJUA 3SJ7A 3PKIA 1SOAA 2CUZA 3T94A 3C8MA 4P4NA 4A8TA 2IXBA 2H1IA 4C7BA 2MSWA 2AXPA 5EIAA 3D4OA 4RL4A 5BXYA 1Z4JA 3KU1A 3VA7A 3OWXA 4FBGA 3MWJA 1TCBA 3H2GA 4Q18A 1BMFA 1RIIA 1SMKA 4U4AA 5J59A 4QDZA 3S4YA 3DT6A 2XTJA 1G3MA 5LU8A 2RIRA 1NLYA 4ABTA 1BX3A 4ZXPA 4BX8A 1DC4A 3U4QA 1LUAA 4FDVA 2FNAA 1VL5A 2DX7A 4UQPA 4B40A 4D80A 5CDTA 1IBMB 2EP5A 3C3CA 4KMMA 1OAKA 3QFCA 3KT8A 4QLBA 4KO4S 1EZZA 4EHIA 1NRXA 5ADVA 5ULLA 4F3YA 5L7TA 3GUHA 3STTA 1Y89A 5IVIA 3RT7A 3FM9A 4JXJA 1YT5A 1UM8A 3TM4A 3USCS 3V80A 4ZGGA 3N2LA 1MIHA 1DC8A 3ZQ4A 2DBYA 1CQZA 1Z0ZA 4LYJA 3BTVA 3VJRA 2W6MA 4D8YA 1SBQA 4WBNF 1XEWY 1FYWA 4N5DA 4XH9B 1L5QA 2PBLA 2VBGA 3AKEA 1IZZA 1JG3A 2QRVA 3JYQA 4RHTA 3LW7A 2XUJA 1QHSA 4RY9A 3S2FA 3MB5A 4UATA 1VTKA 4WW0A 5B58T 3SZUA 4EFNA 5JY6A 3IAS1 4YRTA 2EAUA 4RX1A 5DV9A 4A23A 4K87A 4PNZA 2QRPA 4CM3A 4EFKA 1OY1A 3KVNA 2VNJA 3KYIB 4XASA 1A4RA 4G1VA 3TLKA 4CKEB 1HX7A 3FBWA 3KOYA 3GBPA 4TWJA 4YAGA 3L0IB 2YMPA 1SR8A 2E1PA 4TROA 3T1TA 3GJYA 2D1FA 3QG1A 4OHOA 3B5EA 3FUTA 1MG0A 3Q6NA 4QAJA 2B25A 3KAPA 2NQ2C 5JXJA 3HXPA 4MJXA 3GLTA 5JAQA 4ENPA 3UPUA 1P5HA 4UXHA 4D92A 3Q40A 3K0AA 1ZL0A 4HXYA 1PFKA 1DJMA 4R1UA 2DTXA 4MDEA 1M1YE 2VF5X 3QF7A 4H7KA 2NZVG 1PNVA 2LPMA 2W2KA 2GBFA 4LYEA 4E5KA 5JI3E 2BUAA 5AI9A 1V96A 1SCNE 3UBTA 1HDXA 3GO4A 1CNEA 2OP1A 1OSNA 3F6BX 3KZ1E 4I9UA 5TJHA 4G1EB 4FXPA 3WIUA 1W88A 1C30B 4F91B 3JQBA 2O3JA 2I80A 3NJRA 3WGQA 3LY9A 2P6UA 4R2JA 1R0YA 2HT6A 3TOXA 4ALNA 1OXBB 3MJVA 4NZZA 5ED4A 2R6GA 3QIVA 2O59A 2I62A 3TIXB 1V2HE 4G67A 2R00C 4TTAA 4FKBA 3MRSA 5B3LA 5KNBD 2C7QA 1F60A 4YPFA 3SF0A 4C22A 1UK8A 5IHXA 2GLTA 3LUGA 1RLMA 2HMTA 2O0LA 3R1IA 4NI5A 5C46F 1AT1A 4MEAA 5D85A 3BD9A 5CPBA 4M98A 1SUCA 2BM9A 4CLEA 1NHWA 4S0ZA 2OLJA 3FH0A 1T1IA 2ZUWA 3FW1A 1V0JA 3GJ6A 3QWHA 3ZOZA 5HKKA 3TG2A 4G0OA 3RSCA 3OY2A 1E9AA 3OLZA 2Q3EA 4PZ0A 2B98A 4LDNA 1WQ1R 3UMGA 3ZJYA 4DA7A 1R10A 5F3RA 2A9PA 3MQ2A 1NUHA 4A7PA 2H9AA 4RO0A 3TAHA 1IHXA 3PWKA 1HG1A 1JTEA 4ZVOA 3OQJA 2SICE 4XGNA 1TIKA 2TYSB 1SRQA 2QTRA 2HIAA 4UMVA 3B5JA 4KYIB 3PXGA 2LGJA 1JIVA 2G7MC 2OD7A 4U6QA 5DULA 3UWDA 5AVJA 3GZ4A 3ZI0A 2ZYRA 2J7PA 2OYSA 3IBGA 2IS4A 4I1UA 4ESOA 1VBKA 3CJTA 4ASUD 1AB6A 1YBHA 2IHTA 3DAYA 2IW1A 4RGVA 3TAXA 4BYMA 2AE2A 4U2KA 4EPRA 2VZ8A 4I5DA 2R5NA 1YB1A 4F8JA 1HDGO 1TZCA 3CXRA 3NYIA 3GVPA 1EUDA 4B6EA 3U7GA 1E1NA 2DG2A 2PTGA 1UMCA 3I6YA 3M4ZA 2IYNA 3MWEA 4GBGA 5EJIA 1DUIA 3LHSA 2WY2D 2ZUSA 2MSNA 1Y1SA 3LT5A 3PUKA 5IMSA 4AIIA 3WGHA 1SQSA 4MA5A 2JZCA 3B1YA 1HFWA 1LNQA 2DFPA 3MTJA 2IF2A 1IN4A 2OG1A 3AHHA 1EP9A 1GPWB 1NLZA 3CNEA 2GCOA 3GRPA 3HHEA 4JOSA 4HP8A 3UKOA 1LSUA 3ZQUA 4B35A 4F8YA 9ATCA 4W99A 1MJGA 1CJBA 2WU4A 2EWWA 3ASVA 3U40A 4ZHQA 1MO2A 3AFOA 1NW4A 4XIYA 5DTRA 3SQXA 4D3XA 3OM1A 4RAOA 1ZCAA 1FU4A 5CXSA 1EGAA 2YY6A 3KLBA 1KY2A 4HDKA 4HWKA 5FNVF 3RH0A 5CFMA 3RREA 2R4QA 2EFCB 3CO0S 4IIVA 1ZD8A 4OM7A 2OL4A 5AKXA 2P4SA 1BFDA 3JQGA 1I10A 4NEGA 1U8ZA 1FRZA 4BJHB 1W19A 3L06A 4XJXA 5EA2A 2EXXA 4B45A 5BOSB 3RU7A 3AR6A 3E5HA 5FFNA 2JG3A 4KFSA 5I8ZA 1OH8A 1A76A 3I0ZA 4UOEA 3RFTA 1DC5A 3NEPX 4OATA 5B36A 3CEHA 1PUXA 2FPUA 4DT1A 2OBFA 2I8LA 3FWHA 3W8DA 1G5RA 1EBBA 3RM3A 3P26A 3FJYA 5KWEA 2PUVA 3D9QX 2GM9A 1NFRA 1TM7E 2OAEA 4Q24A 4R1LA 1Y8CA 2DVMA 4IIXA 2PX3A 1YE5A 3I9JA 2I7CA 2G4VA 5IARA 4A8PA 4ERNA 5IKMA 3JVIA 4IOJA 1Y3IA 1N2CB 4MYRA 4EKNB 1R74A 1GAJA 5EZYA 4CDNA 1L0BA 1PYOA 2ZSHA 2DWUA 3WYBA 1T0BA 1YZKA 2DOKA 4PLYA 1YV9A 2Z9DA 4UZEA 5SY4A 4BAUA 4EJMA 3R41A 3FTFA 4JH0A 5CDHA 1OXKB 1A5ZA 1DBIA 1OX5A 4MK4A 3ZWYA 1OFVA 1IEVA 1W0KD 2B20A 3GGCA 4I1OA 3OFND 4JDPA 4QQ8A 4BZXA 1A8SA 2WUVA 2V9PA 1FJGB 2XODA 1P8JA 3BGOS 3NG1A 1ZUHA 3OJEA 3VX4A 2O7VA 4RNCA 4P54A 2J5RA 3WHLA 1TCUA 2IIPA 2FOIA 1RBYA 2Y1XA 2SCUA 3KKQA 5JG7A 3N07A 2NVOA 3GJQA 1SC4A 3PS9A 2GKGA 4AQYB 3TL3A 2YXNA 5F23A 3GNSA 3RIMA 5LN1A 5DGXA 3ZDRA 3VNBA 1JN0A 2JRCA 5ISMA 1KY4A 2EZ8A 1V4BA 3ITEA 3PPXA 4FMDF 1J2UA 2X40A 4PFJA 1P5RA 4RA9B 3Q5GA 1P9WA 1SD5A 2C9OA 2EIXA 4JASB 4Y1FA 3U7HB 1FXUA 1U8XX 2ZAIA 1HI9A 3CG0A 4JFAA 2WV9A 4YASA 1FU7A 4RCVA 4BC0A 3KYJB 1TVKA 2AN1A 2NN3C 2Q8NA 3DXYA 4OHVA 4PHFA 5G4KA 4CTKA 3NORA 3GGSA 4RCZA 1U3FA 1YQUA 3KZNA 3QJYA 1RWXA 4FN4A 4AMYA 2Q5EA 2WT8A 4Z1MD 4YTEA 4LPKA 3EZLA 1RC0A 1FBTA 1UQTA 1XTPA 4MUXA 1HE8B 1VA4A 4LHXA 4LMPA 1USGA 4RJKA 2PRZA 2OBXA 1XMSA 3WBBA 3TLAA 1OGIA 3VPFA 1M34A 1IEQA 1M5UA 3WLFA 1EVQA 5AKLA 1QIEA 2Y6UA 3O83A 3ZDDA 5FKJA 1Q84A 4POAA 2WYUA 1KMNA 2Z1MA 4L5BA 4LOKA 3ST7A 3RRYA 2ZM6B 4KGXA 3INYA 1XJ5A 3K2EA 2W2NA 3L8YA 2LCFA 1U98A 2J3KA 5AT1A 2PYZA 3LVFO 4RKWA 1NP6A 3KEGA 3I6ZA 4NNPA 3DE0X 5AK4A 1HQCA 4POOA 2BFMA 2VAVA 2J87A 3I2HA 1DKRA 5KX5B 1YXMA 3GFBA 1EG7A 4QYTA 4GWLA 4CU2A 5K0TA 4DV6B 4D8VA 2FMTA 1H23A 1N0UA 1ZVQA 2V9CA 3ELYA 3H19A 5I5EA 1IHUA 2ZGVA 1RWPA 3VU8A 1HOTA 1NVBA 4OK6A 3R77A 1ICIA 3AI2A 4BWYA 4ZC8A 4FFPA 3VPDA 3VTFA 5KCZA 4NYJQ 4E07A 5KJ6A 3LDUA 3O1HB 4OXQA 4FFWA 2G70A 3EVFA 1EG2A 4N5IX 2E4AA 3RRFA 3QVXA 4FUTA 2NZUG 3DMPA 4QU0A 4CT0A 4BLWA 3HWX1 4HNAB 4XQ9A 5K0JA 1LDYA 4KE6A 5KQLA 3SSOA 4EQ6A 1J2RA 2ZBVA 1OBCA 3P7MA 5JOQA 4HQFA 2QMHA 3Q88A 2QVYX 4YX9A 5FL7A 3R0XA 3VSAA 4L9SA 2GPWA 2DZDA 3KV1A 7AT1A 4NZNA 1M6HA 2Z6UA 4EHLA 4F3TA 5JROA 1N1EA 4GGMX 7REQB 4DUZB 3OLWA 1NJSA 5LXTF 2FV8A 2NZYA 3PVCA 5AI4A 5ICGA 5C18A 4D25A 1ZM7A 4E2ZA 1ORDA 3REFA 3S8EA 4CGZA 3CCFA 3SHQA 1VLVA 5ES4B 1ZVVA 5DRTA 3RC7A 1VE6A 2P4HX 4LJYA 1OWLA 1XL1A 5BOVA 4MAAA 1E2NA 3NWPA 1BWRA 1Z6YA 2ZI3A 3IP1A 3NHBA 4G1MB 4QOFA 1ZHOA 3NTOA 4MR9A 5A5DA 2VYVD 1AV7A 2M9MA 1M2JA 2ZIGA 3HB7A 1SXQA 1T8WA 5D8DA 2UVQA 1W4ZA 1N0IA 3R3WA 5AUQA 2W6ID 2BEJA 4P5PA 3WMGA 1C2TA 3OQIB 2OBYA 1KOLA 5ADUS 4D8UA 3FPGA 1QQ6A 5KHLB 1CUJA 3U3DA 1TQ4A 2X6RA 4DRXB 4KFCA 5LQKA 2HEIA 2PTHA 3M6MD 3NM6B 1U0TA 1GQOA 2PKXA 1AQLA 1BEZA 1EX6A 3LCRA 3PUHA 4JBWA 5EJ5A 1DEOA 2IPMA 3NGLA 4R1OA 3R7SA 4UU0A 3SBXA 1IY2A 2VQEB 5H8WA 2C96A 1L4YA 1O9HA 3IAHA 4QEKA 3MPOA 1JBQA 5E38A 2FE4A 2QI9F 3V97A 4EECA 3ER6A 1CQWA 3HU2A 3PQ4A 4ZOLB 2GJKA 4IOLA 5FPQA 3W9UA 2UYHA 3ICQB 3B6KA 1UPTA 1N33B 2JI4A 4B82A 2QT1A 3TO5A 4N6GA 3LVQE 1SY7A 4Q1EA 5KWIA 1JJFA 2QLJA 3CKKA 1ONSA 2GJAA 3T6KA 5CFQA 2IXAA 1MUUA 2FPIB 3IP6A 2JFUA 3QYFA 5FDFA 1KH2A 3D3WB 2QL9A 3JQAD 3ITNA 1TJ3A 1X13A 3LUAA 3SOPA 4F4IA 5JS7A 4J76A 2ZZMA 5IVDA 2YOHA 1KKLA 3QKSB 2HRCA 4NCKA 3UHPA 1X7HA 5K4GA 3DS8A 4P4TA 1MVLA 2B61A 3AVQA 4O1HA 2H4WA 3KTOA 1CUVA 2DPLA 2R47A 4L3VA 1G9XA 1M1NB 4K9MA 1BW9B 1PT7A 1AZLA 3U31A 4JT8A 4MRMB 5I7SA 2P30A 3IHLA 1JAYA 1OV4A 2DR0A 3FOAA 4YIKA 4OV6B 3IBTA 3JRWA 5CFNA 4D8XA 4HX5A 4URZR 3P97A 2XA9A 1VC2A 2C4HA 5KYWB 2B1IA 2JCXA 2V4MA 5CNIA 3IQWA 3A1EA 2PKYX 3RQSA 3Q2IA 4I8XA 1E8NA 3I2JA 3Q10A 4B6PA 2Q1SA 3P4XA 1VB5A 3BCUA 1Z63A 2X0KA 4K2AA 3SEFA 2OHVA 2FDCA 4NWIA 3WKBA 1B00A 5EWMB 1L7XA 1YQGA 2D1RA 4C03A 1ZO8A 3E3AA 4YJGA 2UDPA 3KXKA 3ZY3A 2HA6A 2D5BA 4GEKA 3D3QA 3VOAA 1ONPA 1XWFA 2XOXA 4DJEC 4P58A 4EVIA 2G08A 2P65A 2WYIA 1KE1A 1TC2A 2JVIA 4YO8A 5JYBA 2DR2A 3DFMA 3F7OA 5JJCA 1VHLA 1DRWA 4CI9A 4HADA 1KBZA 3CLHA 5IT4A 2F3TA 4HB3A 3JQCA 3PFKA 4HXEB 5JVDA 3GEDA 1MPXA 4HATA 5K0ZA 1DGQA 4ZTUB 2DT5A 1DV2A 4TMVA 2NYRA 4EJ2A 1YZQA