3R77A

Crystal structure of the d38a mutant of isochorismatase phzd from pseudomonas fluorescens 2-79 in complex with 2-amino-2-desoxyisochorismate adic
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
205
structure length
205
Chain Sequence
TGIPSIVPYALPTSRDLPANLAQWHIDPERAVLLVHAMQRYFLRPLPDALRDQVVGNAARIRQWAADNGVPVAYTAQPGSMNEEQRGLLKDFWGPGMKASPTDREVVDALAPQPGDWLLTKWRYSAFFNSDLLQRLHASGRDQLILCGVYAHVGVLISSVDAYSNDIQPFLVADAIADFSKEHHWMAMEYAASRCAMVITTDEVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable isochorismatase
publication title Ligand Binding Induces an Ammonia Channel in 2-Amino-2-desoxyisochorismate (ADIC) Synthase PhzE.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 70
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 3.3.2.15: Trans-2,3-dihydro-3-hydroxyanthranilic acid synthase.
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3r77A00
3HU5A 3O92A 3MCWA 4WH0A 3S2SA 1X9GA 4L07A 3R2JA 1XN4A 2A67A 3TG2A 3PL1A 1NBAA 2WTAA 4WGFA 3HB7A 3UAOA 3O91A 1IM5A 3LQYA 3O94A 3OT4A 1J2RA 3O90A 2FQ1A 3TB4A 3EEFA 3O93A 1ILWA 2WT9A 3R77A 4L08A 4H17A 3IRVA 3V8EA 3TXYA 2B34A 1NF9A 3KL2A 3OQPA 1YZVA 1NF8A 2H0RA 1YACA
chains in the Genus database with same CATH superfamily
3OQJA 1U9CA 4NICA 5JCJA 4AJJA 3N28A 1HE4A 4GMFA 1E2UA 3NRJA 3RYHA 3IMFA 4K2HA 4NTZA 2ZXFA 4CQMB 2VT3A 4MQFA 1EDEA 1RBQA 3T7AA 1J1UA 7REQB 1I0LA 2PANA 1P9NA 3QVGA 1DO0A 2O2SA 3KBBA 2E2WA 1WMDA 5AYVA 2HUPA 3GV0A 3R40A 4M7RA 1MBZA 3CW9A 3IV7A 4OHVA 4HN9A 1Z6AA 3F4BA 2BGLA 2RDMA 3CRQA 4TX1A 3AP1A 4ZCQA 5F78A 2OQIA 2Q1TA 4LJRA 3WBKA 4P7FA 2ZDQA 3LCJA 1EQAA 2CZCA 3FE2A 3KQVA 4WOPA 4LWZA 4WJKB 3RFTA 1W44A 3RSFA 1V45E 3TLGA 2OBFA 2HK9A 4MLDA 1QQ5A 2W2VA 1TYDE 3MLAA 4BVBA 4FP9A 1JUDA 4Q9LA 2YWFA 4YALA 2XHEA 2POCA 3CUUA 3OP1A 4O1IA 4TS4A 5AH0A 3AM1A 4CCSA 1ZMOA 1Z7EA 2QEQA 1YO6A 2Q4RA 3LDAA 5CP8A 4D9MA 4QG3A 4I66A 3TIXB 2X4DA 2GAFA 2GDZA 3MWGA 1TM7E 1GSOA 1O1YA 4NE9A 2B98A 1AKWA 4HDRB 3ZE7A 3EG5A 2H16A 4X1YA 3WKAA 4B4OA 3LUBA 4G36A 4W9NA 1Y6RA 4AQYB 5ES4B 2QM0A 1HF3A 2PUBA 4EJ6A 3T1OA 4DILA 1L7BA 3LBHA 1G18A 1XF1A 4S1VA 4A26A 4BZZA 1V11B 4N6GA 2Q5QA 2XCRB 4AQ7A 2C7QA 4CEIA 3NM4A 3FCUB 1RTTA 4E2ZA 4RLHA 1DWQA 3DO8A 2FMHA 3G1TA 2FN3A 2NV6A 4MDHA 3BJIC 4QEDA 4TWAA 5B3JC 3CX7A 1TCAA 3QVWA 1RCFA 2JLWA 3E9ZA 3QWHA 3HXOA 4CDMA 10MHA 1ESNA 4YRCA 4GP9A 4GKVA 1KDYA 1XO1A 2O8EB 2ZXUA 1P8JA 1NLYA 1ZIOA 1SPBS 4IO1A 4EG3A 2CXRA 1CULC 1MQAA 3IURA 3LTEA 3PC8C 1X7GA 5EZ5A 3OJOA 1RQRA 2CDNA 3ADKA 2CWWA 4TV9B 2X2OA 4J4HA 1R74A 3ZDRA 4V0SA 1K6JA 1GPDG 2OCPA 3AUUA 3DBHA 3L8EA 4ZJZA 5A4JA 3I9V6 2JEOA 1OYWA 1CRPA 2XWSA 4OJTA 3WB2A 1PEAA 3MN1A 4LZPA 2FSFA 2Y9MB 2VF2A 3MK31 3T9EA 3QLTA 1FF9A 3IDSA 2FW1A 4IFBA 1XMVA 5DYGA 1FL9A 4LQDA 1WS6A 3A1VA 2V6GA 1ARZA 2GPBA 4W5HA 1YKSA 2CV0A 1QG0A 2E5WA 2N1BA 2X4LA 4CI0B 3DHVA 5EIFA 1ONBA 3S2FA 4FMCF 2G9ZA 2SCUA 1FQOA 3BIOA 4TOIA 2VTDA 2F4VB 1YJ8A 4Y9SA 4M46A 3WMXA 1NNSA 5BNFA 4OL9A 3R0JA 4DEXA 4F45A 5TIIA 421PA 2XGGA 4HCJA 3VR4A 3F9RA 1IN5A 1E9AA 2GF0A 3NYWA 1CUSA 1OC2A 5CJJA 4D0GA 2PX8A 1T36A 3LC2O 4UBMA 1IPFA 4UMFA 4CRWB 1N0HA 3JU3A 1QX4A 2HGSA 2VKTA 3OPMA 2Z9DA 4KLCA 4EEXA 1NYLA 2YY5A 4Q39A 1KQ3A 3L6EA 2YJ6A 3LG2A 2C2GA 3TECE 2OCDA 1N2EA 3P45A 1M67A 4Z4FA 1CC1S 4NS4A 5LYJA 1AHPA 4ILEA 5KTRA 2FPPA 4YUAA 3QEMB 1HR0B 2D1RA 3KOUA 4FOSA 1EKXA 1MTZA 4HAOA 1DAFA 2CV2A 4YRSA 3F6SA 3LOUA 4MRVA 1G7TA 1PRYA 1CBUA 2QM7A 1GA4A 4YN3A 4Z8YA 1Y7IA 4EY8A 3TTWA 1FFCA 2AJDA 4BX2A 1VTKA 2WHQA 2HA5A 1B93A 2Q7DA 5BWBA 1PNVA 4MQ5A 2VDJA 1F0PA 4IEEA 5L51A 4HZGA 2OZVA 2WABA 3C1TA 2R85A 4AJHA 1OFTA 1A2OA 3IVRA 4Q12A 1Y6FA 1R4NB 3Q6MA 4Z86A 3WRXA 2J3DA 1AE1A 2BFDA 2CNDA 3IJRA 4OJYA 1XZFA 4TTRA 3SFTA 3V1LA 4EG6A 3TLAA 1HTBA 1NRJB 2D2IA 2YYSA 4R2LA 4R3NA 4UFNA 5IWAB 3HGTA 3FWYA 4GMKA 1X39A 1Q3HA 1JWBB 3CWQA 1ZN7A 1CQIA 2G1JA 3EJWA 3HV0A 3PFGA 5AVOA 2R8BA 1HQYE 3C6MA 3OLVA 3QXHA 1GKYA 4ADSG 1BXRB 1VIMA 3R77A 4LF8B 3EPHA 4QNRA 1ZH6A 2D4HA 2WFZA 2XLBA 2HTEA 2JHPA 1E7MA 3DC2A 4FFVA 1P4SA 4REOA 2F64A 2O2HA 3UBMA 4AWAA 3WBJA 2XGSA 3NHUA 3FOCA 2WVGA 4LJLA 2GCGA 4YRPA 2H3HA 1K7XB 3N75A 3OLWA 3WKDA 4QTZA 2PGJA 2C59A 4W9NC 3R5XA 1NW5A 4QGHA 3H04A 3OIGA 1D07A 3P9XA 3OZXA 4MUYA 4WOCA 5JSUA 4BZWA 3NGXA 4B6EA 2ODAA 3U3XA 5T5QA 3TTTA 4DC9A 3CEJA 4JOCA 4PXSA 1DV2A 1INLA 5CLFA 3DL7A 3I1IA 4JL8A 4RENA 4ZAGA 3RLFA 2ZYRA 2DERA 3RK0A 4O2BA 2ZI3A 5IAEA 1OI7A 4OQFA 3GLFA 2DVMA 2I3GA 1D9XA 1XQ1A 3G7UA 2ZSBA 3LX5A 3LRXA 5IHPA 2QYTA 2XRFA 4OHCA 4TXHA 2H18A 2OO7A 5BSVA 2X76A 2P6OA 5HM8A 4YAFA 2O20A 3KQYA 5I9LA 2WZDA 2XB6A 3M1LA 2AYYA 1YR6A 4I5EA 3RJTA 3BK7A 4TUYF 5TGDA 2GUGA 3N8IA 4FONA 2H1SA 3I2GA 4F6LA 3QI7A 2OSBA 3CVJA 2EJCA 3O2NA 1JEOA 1Y4AE 3ROEA 1NOIA 2VHUA 1E79A 1XRLA 1YOVA 2Y3IA 5KAMA 5JMPA 2XCSB 2FPXA 1P33A 3IR5A 1Q0TA 1CKEA 1SXHA 2Y1EA 1VGQA 2A94A 4DLSA 1SXQA 3WGTA 1PCXA 2HK8A 4G84A 2HK6A 4OLBA 1M72A 2VJCA 1T29A 4RL4A 3ZEIA 3DLPX 3NORA 4IDDA 3AB3A 1E6KA 4PX5A 3Q7IA 4LMBA 1YUBA 2HKIA 1XC7A 2RG7A 3BMXA 2J4CA 3NOVA 5AKKA 5B55A 2XWQA 1O6BA 1PZNA 2FSSA 1IMJA 2DFVA 3IIMA 3KB2A 3D02A 4L50A 4FWTA 1JWLA 3UMBA 1L8LA 3GARA 4RQUA 2VRWA 1MD9A 3HMKA 4Q00A 1L4YA 3KR0A 5IK2D 1WW2A 3ASYA 3HACA 4D81A 3HO1A 1NBWB 4EG5A 4UAUA 2PNJA 1QGZA 2GCOA 4U0KA 3B5EA 4J0JA 2WSBA 3TZBA 3VR5H 1VKNA 1IBSA 2IXAA 2QHXA 2QE7D 2ZIEA 4Y2TA 1U7XA 2G5CA 4HB3A 1MO4A 1IEXA 3HCFA 3GA0A 1SVOA 1N2ZA 2AOTB 3MYYA 8ADHA 5IABA 2W8BA 4UEWA 1OCEA 2OP0A 3BZWA 4JROA 2VH2A 3SR3A 4EVIA 5HJ5A 1Z5PA 3RUPA 1RWVA 2VXCA 4XI9A 1CQWA 4F2DA 5CD9A 5HJ7A 5ADWA 2XCUA 3K0FA 1GNRA 1SCJA 2F1IA 4AXBA 4CLHA 3CJQA 3NB0A 4K87A 2BGMA 1SR8A 2BY4A 3NH9A 4HBZA 4ZOLA 2ZCJA 2WU0A 3CZ5A 4Y1FA 3DB2A 4YUXA 2W58A 3GLKA 1Z0JA 5JUWA 4K9DA 5EJ9A 1U0JA 3WRXC 4EJ0A 1EX9A 3TXYA 1PFQA 4EUKA 5GPBA 1G6Q1 1TU4A 2XMRA 2BDEA 4N0DA 4P4SB 3KJNA 1Z8DA 1GQYA 5D51S 4PYKA 1LK7A 1VPTA 1ZI8A 3E5NA 3GGJA 4OM8A 2DP4E 2PIAA 3HG7A 2Y1OA 3KZ1E 1Y9JA 4CUKA 3T41A 1CV2A 1GAXA 1QE0A 1Q6ZA 4FS3A 4U9UA 2GK6A 2WTNA 3I9NA 4JDPA 4WZAB 2XEXA 1S3IA 2ICAA 4YAKA 4WESB 3VSCA 5DLDA 1KY4A 5EHIA 4F4UA 3BEDA 1JT2A 1IUPA 1ZGBA 2X0FA 1DX9A 3RG8A 1J0DA 4K0RA 3WP1B 2XQJA 1LFDB 3IVGA 4PTLA 2D6FA 5DKFA 2JGEA 3O0TA 4QO7A 4F84A 1A9RA 4HVCA 3UMRA 1BHO1 2JIQA 3X1ZA 3W5UA 5G1PA 4Q0MA 4Y30A 2XOXA 3H4IA 5IAAA 3KOZA 4P92A 5F5LA 1YF3A 1KJQA 4KMRA 3LPDA 1BW9A 3ESYA 1GUFA 5IF3A 1CU1A 2R5WA 2X7XA 3T7SA 4HDQB 1IEQA 3L1UA 1HFJA 1CVIA 5EIBD 5EJAA 2JJ2A 3UJAA 3GBSA 4MUHA 3BSYA 3ROMA 3NHWA 1GRQA 1ESMA 1UBFA 4TMYA 4D44A 4Z3DA 5F3WB 4K6FA 3F8TA 4EKDA 1YE8A 2J6CA 4GLLA 2DBRA 4Q66C 4AL4A 4EFKA 4QOGA 4TV9F 4YMIA 3V1UA 1BOFA 3CZRA 4I08A 1N5JA 4Q3KA 4FW8A 1R6XA 3ESQA 2FQWA 1YT5A 3KVVA 4UUPA 3TSWA 3FD8A 3AUTA 2A2ZA 4CKWB 4KR7A 4QARA 2ZTMA 3D4BA 1DBQA 3DC7A 1ODLA 3SX4A 3MQFA 2GKSA 1J23A 2XSZD 2X41A 4E3ZA 4ECEA 4FOLA 1IK4A 2HRBA 4Y2HA 1J49A 3FSGD 3GFSA 3MGGA 3GROA 4A5SA 2BW0A 1NNEA 1DSSG 2J9GA 2JIPA 3B3GA 1U5AA 2XE7A 4DDHA 2C9DA 2R751 5CPBA 3VZBA 3OPVA 4E5MA 3HCWA 1P2FA 4KQ6A 1E6EA 3K6JA 1ZS9A 3UUEA 3WJ1A 1FP6A 3ZCPA 3H5IA 4X1IB 2H7VA 4LHYA 4G1MB 4AB1A 4ETMA 3EOBI 5M5BA 1Z2EA 2X5XA 4FHEA 1F7UA 4Y0VA 1U4OA 3D4PA 2IIBA 4IH9A 1QZUA 3OZVA 1H8ED 4EA7A 1FFYA 5FOTA 2JLVA 2ZSKA 4DJJA 5AVQA 1MO3A 2XVZA 4NP6A 4B6QA 4V1CB 2WMNB 1JJBA 3FGNA 1QG2A 2O8VA 4NPHA 3SBDA 2ZITA 5AW4A 1PE0A 2J9YB 5HG0A 4BGEA 3OM1A 5BORA 3IH5A 3DNFA 2O4UX 3DLIA 3LUHA 1F8UA 2JBAB 1R3UA 3UOWA 3GOHA 1EP3B 3LD9A 3EWIA 4HNQA 1G98A 4ZHQB 2UZ1A 4S12A 4BVHA 1OZ0A 3FN4A 2N9UA 4EF5A 1KR5A 3N6RA 2WNIA 3NBAA 4IIEA 1ISJA 3OE1A 4RTOA 1I0IA 1QIEA 2BM8A 3P2EA 3PXXA 4Q3BA 3OY7A 2WZCA 5C7LO 4M0FA 4ER5A 1P74A 3U13A 2J3IA 4WGGA 1UKCA 4HO1X 3RUIA 4M0UA 4B4KA 3LY8A 4DY6A 1UXJA 4ND3A 3ESZA 4TS1A 4DLZA 4JP5A 3WV5A 1SCDA 2IEZA 2JLQA 3GT7A 4AS3A 4N5HX 4RKWA 2FJ0A 4WLVA 3DBIA 3AETB 1LS6A 4QOIA 2F43A 5A5EA 5ALQA 3HLKA 5B2EA 9ABPA 2F3TA 3LW7A 2BFWA 4EPYA 4DDKA 1ONNA 1NQXA 4I6JA 1E2NA 4MW7A 2FVYA 4B17A 1T8WA 1NXWA 2ZSDA 1YQEA 2DPLA 1R5BA 1PV1A 4PGHA 4GOKA 4HAWA 4WCFB 2PBRA 3N7TA 4MMYB 1S2LA 2EFGA 4QATA 3S8MA 2QBYA 3UV7A 4CQMD 3BL8A 2IXDA 3JQCA 3TAUA 1SPXA 3BQNB 3PB3A 5HDBB 1PNTA 4HNHA 2HY7A 4BUJA 3R9XA 1G5RA 3EGCA 1B0UA 1PGOA 4XWOA 3ZBTA 4MJXA 3FDZB 2WC1A 3C4JA 3HXLA 3CPEA 3L43A 5I47A 1NDQA 2OHOA 2L19A 4E32A 1GITA 4R1MA 1DO2A 4ZVQA 4EY7A 4EW1A 2Z1DA 4MUMA 3FLBA 2BR5A 1S2MA 4JKOA 1N5IA 3F96A 3GEDA 3DXFA 2NPFA 2F8MA 5KU7A 4FNOA 3PJEA 2OUIA 2FZVA 2XUFA 2O7SA 2LV8A 3DM9B 1W35A 1X0XA 2V6JA 3WLSA 5F7JA 4ZI2A 5HQTA 1DTWB 3P71T 4LBZA 3UHAA 1QIIA 4DANA 3PDUA 5JD5A 2BJWA 2J33A 4EA8A 3N7UA 2DBYA 3D4LA 5FI0B 4CMIB 1L7RA 1SVNA 4QE3A 2XIJA 3PTLA 4HMOA 5JSZB 1XD2B 4AX8A 1VJRA 1Z5OA 4QGAA 1JS1X 3CLSC 1E2EA 4RA6B 2J0QA 2CLDX 2PWPA 1ZY2A 3K4QA 1L5NA 4BVEA 3X1DA 1XB2A 2GPWA 5SZHB 1VJGA 2OYRA 1CNEA 3DWGA 4PQYA 3R4VA 3I01A 3QGMA 5A6VA 1I7DA 4NY1A 5DMXA 4MVJM 2IELA 4JC8A 2AUNA 4G6ZA 3DQQA 1W1WA 3O4GA 5IAOA 1PUIA 3L1KA 2XCTB 4HLQB 2VDUE 2XT6A 3MT7A 4JSTA 4P4GA 4UUNA 3SD7A 4E12A 5IWCA 3J81k 4MPJA 3N39C 4AVYA 3I2JA 3MUOA 4BATA 1U0HC 4MKRA 2DR2A 2PKXA 1Z4PX 1I1OA 1D09A 3K1TA 3WAKA 1OIVA 4MP8A 4H1HA 2XB2A 1W2GA 3IQDB 2I0FA 2O1WA 3NTUA 3F6YA 1EGHA 3PP8A 4QUBA 4GVPA 1F2DA 2O7QA 3BD8A 2GKOA 2E1RA 2QV7A 1OF1A 1OU4A 4GICA 5L7TA 2HLNA 5DIZA 2OENG 4NCBA 5I7FA 2NQTA 1EINA 5JBIA 3HEMA 2DTDA 4G0NA 3PRHA 2BH9A 2C5AA 3K4PA 1DIOB 1T2AA 1QLJA 1X19A 4UHFA 1M6WA 2MINA 2PEZA 3HJRA 5LB4A 2NP6A 1TTHA 3L8CA 2PGDA 4LK3A 1KPHA 2WWRA 4N6OA 5TQ2B 3OQMA 4OOFA 1EUCB 2P5TB 3P2MA 5KTOA 4KE7A 1U8UA 5HRUA 5HUQA 1CUFA 2FGJA 1QV6A 2EL9A 3KL4A 4LWOA 2H4XA 4DPMA 1EK5A 2DRIA 2EKQA 2ADMA 3LDFA 1SC9A 1AHHA 1OAKA 4CHGA 1VIDA 3AEKA 4EQ6B 3QUTA 4KOEC 2FPSA 2JJ1D 1R27A 1X80B 1V8OA 3N2LA 3VAZA 3B36A 5JJLA 4LXHA 5FO0A 3LQ2A 2C7OA 2QRJA 5AJTA 2I8CA 4QA9A 4NV1A 5HP4A 5IT4A 2AG1A 4YXWD 3MERA 4YQYA 4E14A 1AGNA 2Z2YA 1YULA 3WGNA 2CL0X 2LVBA 2RBEA 4PYQA 1U6JA 5CAEB 4II2A 3BIFA 1BGXT 2PZJA 3NUZA 3PICA 3VHQA 1JDTA 1Y0BA 4Q1DA 1SQGA 3HDGA 5JNTA 4JVSB 1F1BA 5YASA 2CLSA 1FUKA 2EP5A 3U26A 2P75A 2ZANA 1WKVA 3E9NA 4K40A 4XR4A 4BLSA 2DHQA 2QLTA 1OU0A 1GL3A 1XCLA 1X0VA 4BDSA 5K2OA 621PA 3HN2A 5CCDA 4TZKA 1R5OA 2RGUA 2R1ZA 1JLRA 1XQYA 4GLJA 4K6OA 4TMFA 1NI4A 3KOWA 1RQ7A 4F5ZA 1SA0B 1KY5A 1CUUA 2BFAA 1C7QA 1RZRD 4LRTB 5IASA 4M36A 2ZS8A 3CR8A 2RONA 5ED4A 1QK4A 4GUAA 4OPMA 4RHEA 2D7CA 2DFDA 2QPOA 1P0MA 4CI9A 3L7IA 1BA3A 2VAPA 4IQ4A 2TMYA 3LLSA 2FOLA 1TFRA 1C3XA 1ZMBA 2VAMA 5KOIA 1GFZA 5K6AA 3OIVA 4JX8A 2ST1A 2XOKD 4TKZA 2XXAB 3FPCA 2Q45A 2RGGA 2VDKB 2XWJI 3OM0A 2I3AA 1DQNA 2FNAA 2WSYB 2CF6A 4MUJA 1Q7EA 1XEXA 4JBIA 3HB9A 3JALA 4RNCA 4WACA 5FOQA 3AI1A 3NWBA 3H9JA 5FWYB 1VL6A 1H2EA 3I64A 2IHKA 4MRSA 1MQ9A 1YQXA 3MWLA 1X38A 4OMCA 5FXMA 1P0PA 3VPHA 4C7JA 1Q1GA 3PHGA 3O4RA 5DIFA 5KI6A 2AVNA 4UULA 4DKJA 1OXBB 5JCZA 4OUKX 1TD1A 4TMZA 2DWQA 4KDEA 2VBGA 3WFZA 3ZI0A 5B4TA 3BFJA 3IELA 2QTFA 4LC1A 4XJVA 1NVDA 2R68A 1KWKA 2PV0A 3FNFA 2Q7XA 1X7XA 2B7CA 4G1FA 3D3NA 3M70A 1J33A 1G8FA 1VPEA 3TOZA 6AT1A 3ACDA 5CVJA 2YV4A 5GV7A 3JQGB 3G0OA 2C2KA 1MN6A 1WB6A 2X6QA 3KQNA 5KO2A 2V7UA 1ESEA 1JQLB 2CNBA 1LLQA 4OHZA 3IFSA 3DPUA 3ONWA 2VBCA 5HRCA 4KI7A 3UATA 4PICA 1L4NA 2GLTA 3O5AA 4QU0A 5TXGA 1AOXA 3UB3A 5KQPA 1G3RA 4KXLA 4QQKA 2BP7A 1B0AA 2ATEA 3SC4A 5TDHA 4L6IA 3T1NA 2VBIA 3VJLA 1H6CA 5IH7A 1ZMTA 1EDBA 1TQ8A 2EKLA 4HB2A 4L8YA 3TX6A 1V5EA 3NH6A 2XKBA 2PUFA 1TLLA 4WKNA 2WIDA 1TYCA 3OTHA 3GZ4A 1VJTA 5FKJA 3IP7A 2PX6A 1CB7A 5I4KA 3BM5A 2ILTA 4ZHQF 1ORTA 4BO8A 2ZBQA 3MNFA 3MSXA 3WISA 1CFJA 1PQUA 2ZAOA 2DKNA 4P34A 2HO4A 4XA8A 4LVNA 2V4UA 3MMPA 4LRQA 5B7QA 2JAQA 4ZC8A 3WK7A 5TS3A 3GQBA 2A9RA 4IG4A 4DV1B 1A7KA 2X23A 4FNAA 2RHLA 2I6QA 3WLLA 4D9FA 2OM2A 3K05A 4FMPA 1YOBA 5B7GA 2XH8A 4COOA 1UBUS 1P29A 2IUYA 2Z2ZA 4OTZA 1M66A 3GFOA 3RVJA 1VZ2A 4PAMA 4ILKA 3VVBA 3LF1A 3OUZA 3V8BA 3V33A 3RAPR 2VHTA 4I99A 1LF5A 3VPCA 1A9QA 1Y8RB 3ZCSA 2H0RA 4JEIA 3CEPB 4IWYA 3O2JA 5E38A 5IJAA 4CKCB 3FMVA 4GQAA 1V16A 1PGJA 2CL5A 2MDTA 2PRJA 3CG0A 3PTAA 1IJKA 3GP8A 1E5DA 3H2KA 3RTGA 5BT8A 4R1NA 3KOXA 1V8BA 1ZUNB 2YWGA 2Z3VA 3TG2A 1U3DA 4UDYX 4HDKB 5ALMA 3CY6A 1EQ2A 3SJUA 4PRYA 1LPOA 4L5CA 4MWZA 3J80A 2HCRA 4WKBA 1RYNA 3U2QA 1UDWA 3EARA 2Z3ZA 4QXRA 1FU8A 2X6TA 3SDSA 3DE2X 4I9HA 1W29A 4E5NA 3RC2A 3TMKA 1Z63A 4DG9A 4ENPA 2AA3A 4JIMA 4EDHA 4B7ZA 4MPDA 4JBWA 5CG1A 2JFYA 3L7YA 3B2QA 4P31A 4GMHA 4EGCB 4QTUB 1WCIB 1YBMA 2FSHA 1Z6TA 3QEJA 4KGXA 3DA8A 3FW1A 4MWBA 4P36A 1R0YA 5FNVB 1KK2A 3UWKA 1DAMA 2G07A 2X5JO 3H2YA 1WMAA 2Y0DA 4FI3C 2H48A 4BFWA 5K6AC 3W7BA 5KKCA 1IM2A 4HPJB 4U2BA 1OSNA 3OKFA 1EFTA 1I24A 2OO5A 3CLRD 2WYHA 3IKVA 4QG7A 3WNDA 1LSUA 2VT7A 1XVLA 5D1HA 3WQRA 4DIMA 4DJFC 4CZ2A 4C2BA 4MW9A 2RGNA 3Q87B 5D87A 3FGPA 1IJFA 5KJ1A 5EJMA 5A9SA 2Q6VA 3MWEB 4XYEA 3RYFA 1V2HE 2EZ9A 1SBYA 3KL2A 2I3ZA 2YHUA 1VOTA 3CWCA 5L6LB 1MX5A 4BVAA 3GLGA 3I73A 5D3KA 2PJUA 4HOYA 2XQKA 4B4DA 3FLMA 3CF2A 4FD3A 3VR5A 4XVUA 5EKUA 4P0QB 3OE5A 3L0IB 3GNSA 2ZCVA 2R44A 3ZEAA 2XJ4A 3EGXB 4YQFA 2P2SA 2D7JA 1IBRA 4TPKA 5DNUA 1LI4A 4RPKA 1MA0A 1NR1A 3ZTWA 3N6XA 1KHTA 4K9RA 1CF4A 3QWFA 1MC1A 2PEYA 1M1ZA 3WVNA 1H3NA 3QG1A 2J5QA 2NU8A 3ORSA 2AF4C 1USUA 3BREA 3D7NA 1SIOA 1G8GA 1O9GA 1SBTA 2A9VA 1JEQA 2MR5A 2QVBA 3GJXC 3DNMA 4J0KA 3O31A 3IOCA 4TL8A 5J4LA 1TC2A 1EFUA 4YMWA 3S5UA 4M38A 4RD3A 1I2BA 1Y89A 3VPBA 5FNZA 3TH5A 5DX1A 3T3OA 4ZYXA 2I4RA 3E23A 2XZTA 1XFAA 3C6XA 1P91A 3JVEA 3JTEA 5JY1A 2UYQA 2VTEA 3Q4GA 2QR5A 3C5WP 1GA6A 5T57A 4BNDB 5L7WA 2R6DA 1TEHA 3WYAA 1GYRA 3IUMA 5T6MA 2BGWA 2ERXA 1Q0LA 3TE6A 2ZU0C 3DEYX 5IKEA 1L1RA 4Q3AA 3IBSA 2WHPB 4H7EA 4A6PA 3MEQA 4L76A 2BBTA 1J1ZA 5KPJA 1FXWF 1VSVA 3IDQA 1SQSA 2ISCA 3NIWA 4TTTS 1X9IA 1I5OA 1J56A 3B6MA 1US8B 4LY6A 4RXMA 4G1VA 3CYFA 4IHAA 4OXIA 2NXNA 4B5KA 4C7KA 4LKRA 5C51B 1JVSA 3VO2A 5L53A 4ED9A 2D0IA 3RSLA 1KKLA 3B9BA 3QVXA 5IVIA 3PUYA 4OYHA 1Y1SA 3VR0A 2OM6A 1OLSB 3QOXA 2E5LB 4FSXA 3KV1A 2ZRLA 4N01A 5JSKA 4DGSA 1A7UA 2ECQA 4NABA 4RXTA 2AUTA 1U7HA 2HF7A 4UM5A 3K2EA 1QOQB 3AO0B 2VJKA 2W98A 2Z3WA 3QKRA 3SG0A 2B37A 2K2WA 4N65A 3IESA 1K63A 3SXUB 2VATA 2W2LD 3FFAA 4GPAA 1AQ6A 1YKGA 1BX1A 1S8OA 3HBFA 4HWOA 2BSAA 5AVZA 4FCVA 3U1VA 2X0RA 4U7PB 1A95A 1SY7A 4RSGA 3ZOZA 4D9JA 2X8WA 3DAGA 2P9GA 3Q7QA 2Y1WA 1CY6A 3JWEA 5HE9A 4LF9B 1D8TA 3R75A 1NPTO 1RRFA 2VDLB 3N6VA 2YWJA 3T12A 4MIOA 1CLEA 1RFLA 5LP6C 3A04A 4E0BA 1RM0A 1URPA 3SICE 4J76A 3ZCUA 2GPAA 1G8PA 3V48A 2PLWA 1SBIA 2CLHB 2HJVA 2YYAA 3Q40A 4LMPA 4QDXA 2O5CA 1SU7A 5SY4A 1QU3A 2CNLA 1U9IA 1A9ZA 2VYND 2QIPA 4QDZA 3DFFA 2DR3A 5B64A 1H2YA 1BYIA 2PD4A 3BFVA 3F1KA 4JI3B 1CUZA 1JU3A 3SHFA 3KSDO 3PR3A 3ZNNA 1D03A 2IP2A 3EVAA 3NNSA 3PPXA 4JC0A 3A05A 3KWLA 4GGOA 2WWIA 2XE6A 3QBJA 4OMDA 3Q9UA 1P7PA 2OO5C 1CUGA 2JCXA 1IN6A 1O97C 2Y0PA 3IUYA 4JFAA 4PAOA 2PMFA 4D6XA 4FQ5A 1SHKA 2RGNC 1ZGHA 3ZHBA 2WVAA 1EA7A 4HDNB 2OAP1 1YRBA 4HY3A 3SS8A 3UMFA 2QLBA 4L78A 1TVMA 2PIDA 4KQEA 2IEYA 5LQDA 1O0CA 3ORYA 3AILA 3T6KA 4BV9A 5FQOA 2ZJ7A 1DKPA 2HWUA 2MU1A 4ND6A 2G6TA 1LFAA 2EG5A 3BWCA 3V46A 1U31A 4PZPA 5DYYA 3D2AA 4K6KA 1NC1A 1E60A 1ZX1A 3UJHA 3EAFA 3TUJC 5IJ9B 1O95D 2H11A 2XXJA 1MG5A 4XD7D 3FMIA 3NAMA 2VK2A 4DLTA 3IMGA 3LCMA 5D5HA 2GBGA 3TNJA 3QFRA 3ZHCA 3IJEB 3VYUB 3DZGA 1WY5A 4LTDA 2AI3A 5CFQA 1IONA 4TTJA 3RSHA 5JS6A 2ZQ5A 3QOWA 5FV7A 3HXQA 3DE1X 4G24A 5HUJA 4DVGA 1R5JA 5CDUA 4CM9D 1NU6A 3B1KA 1W94A 2PH5A 3LKZA 4I3FA 5FO1A 2IYLD 3C97A 5KINB 3O21A 3NKFA 1POWA 3W2IA 1OUMA 2J0SA 1XU9A 2OMKA 2OYSA 1D7AA 1EFHA 1DKRA 2EW8A 3IIJA 3KT0A 5JD3A 2B61A 2QRMA 1MR3F 1EBFA 1RU3A 3EVFA 2IPOA 3EGEA 2G0NA 5CLGA 5BSTA 2ERYA 1UBMS 1X1DA 4CV1A 1Q1BA 4UVDA 5DM70 1MKYA 1KKMA 1TIKA 4FCCA 3OMLA 2QXYA 1JEAA 3HA3A 4FJ0A 3IQEA 1T1SA 4H4CA 3GLIA 2XKJE 3LDUA 2H3EA 3D3JA 3OT5A 3UV3A 2YDXA 2R25B 4S35A 3KAKA 4E30A 1G8KA 1EXMA 2HI0A 3DCYA 4E5YA 1GUAA 1MW9X 1ST2A 1FJGB 3GN1A 1REQA 2XCLA 4WT7A 2Q46A 4G0PA 5IUNC 2G82A 4ZAXA 1VSUA 1K6MA 3QEOA 3MSCA 1CQXA 4WN3A 1THGA 4OGWA 3LHKA 3QELB 1BVHA 2OCIA 1ND6A 4Z4HA 2QLLA 1RJGA 3O4VA 5KOJA 1NN0A 3WJ7A 1VP9A 2C4HA 3CIOA 1GZ5A 3GRPA 2PMEA 1N32B 2ZUTA 1P4RA 1CQJB 1T4BA 3ZYZA 3S29A 1G4AE 2JLBA 4XX0A 5AUPB 5LYJF 3THWA 1D2GA 1HNNA 1UJBA 3E22B 2I65A 3OZRA 5FBHA 1XN4A 3QUAA 1NFQA 3FPGA 2DX7A 1RHKA 4N5DA 3MHPA 1QWSA 3D6NB 4X93A 5JVDB 3R7WB 2JS7A 3QVVA 2IXGA 4R1UA 1IG3A 3UHJA 4CR7A 4NZPA 3UFXB 1XZNA 1ZEMA 5CM9C 4NNOA 5CDFA 2DBQA 3WTBA 1UKVY 4TQAA 4YRLA 2RH5A 4JU8A 4L4ZA 2ZYIA 1PFKA 1DLJA 5GJWC 4W6QA 1VL8A 3M9LA 1F12A 2VFAA 3P9QA 4V24A 2YBDA 2YJNA 3E3OA 3QKSB 4YRQA 4X85A 1KJ9A 3Q3VA 1T9AA 5FEMA 2OC4A 4AZ0B 5FNVF 1E6LA 1U9IC 4JT4A 2RB4A 2E89A 3REOA 4BDTA 2H2DA 3PFBA 2P40A 1Q15A 3IEIA 1ZQ9A 1XCOA 2X9VA 2YNMA 4QUGA 3OPXA 5AM2A 3C8HA 1JIVA 1I8TA 2ZWVA 1SU8A 2BRUA 1OBOA 2PZ8A 3R44A 3VOAA 1EFRA 4QUDA 2FPUA 1IHDA 3EIUA 1T34A 3HKCA 3P9PA 3QLJA 4HXFB 3SK0A 1KRHA 1V8FA 4C0SA 3RADC 1DX4A 2ILVA 3Q7EA 2C2BA 2ATCA 3L06A 2GBPA 3GW8A 4OXXA 3CKMA 2A88A 2OBYA 1DG9A 1OTHA 3AK4A 2VWHA 4QO8A 1WPXA 1RRPA 4WIAA 1E94E 1MH1A 1RJWA 3Q3EA 2HHJA 4GBGA 4DSTA 3HK2A 1MENA 1RS0A 3MJVA 4YGXB 5EAIA 4W5RA 1BO6A 4LMRA 3BDVA 2JI4A 4CKBB 2C9OA 1QH1B 5JO0A 1UZLA 3MMNA 5SV2A 4DUZB 2BGGA 4WVLA 3KJGA 4RELA 1EFVB 2HBRA 2OL4A 3CLKA 1B16A 3IP1A 4MIKA 4PPYA 4DDVA 2BFNA 1Z2OX 2I80A 3JAKB 1CJBA 3UGKA 2YQ4A 2QE6A 2O1SA 4Z9AA 5EEHA 3OEYA 3UWMA 3OSUA 3NAQA 3VZCA 1V3VA 2LWIA 2NVBA 2Z30A 5AI5A 1AO0A 4DLPA 4R2MA 4BGVA 2XUJA 1G8AA 5FWXA 2JIOA 5H4GA 2WD7B 3NRCA 4F1KA 2CUKA 3TR0A 2PS0A 4Q18A 4WFQA 2LR0A 1WQ1R 5E4YA 1LV8A 1E4OA 1VB3A 3MD9A 1LK0A 2GMWA 4B7AA 2H06A 2OBNA 1JL3A 2J6HA 1V3UA 2NT4A 4N5NA 2J4FA 4GOLD 1U04A 2CLKB 4GVXA 2FETA 1N2BA 1A8SA 2H57A 3LLCA 4GXNA 4KCGA 1M2HA 4X8HA 5SYNA 3IQWA 4GKJB 2QMUA 1E3WB 5D01A 2EGUA 4BLWA 4PHHA 3N70A 4OHPA 3W5HA 3EZNA 5BWCA 3EGOA 1F5NA 2BCEA 2A9QA 2X7JA 1JFTA 1WDLA 4F3TA 4ODIA 2COUA 5H0IA 1R6VA 5I7WA 1T0PA 1XNJA 3D2CA 3W1VA 4FHCA 2J4DA 4MV7A 2HF8A 4B82A 4CVNA 1KEKA 5KUTA 3R5JA 4PYRA 1KC3A 2FEPA 4H4EA 1OXMA 5G1OA 4AZ3A 4ZVVA 2CJWA 1VPWA 5E9WA 3TFOA 2F3RA 3R09A 2IXTA 1ECJA 1U2TA 2H2AA 4J0CA 5HK9A 1NZFA 1ULZA 4QIHA 2GFHA 2L18A 2NT3A 4AFNA 1XDDA 4M1KA 4DDUA 1WP4A 3AJ9A 2WT8A 4JEHA 1I33A 3VYSB 2PGAA 2OE2A 4OHUA 1ABBA 4URUR 4HR7A 4URWR 5DLEA 4RS3A 1IHOA 2IHNA 3BWEA 1DCMA 4KPGA 4LXIA 3FTPA 4TQ9A 5GVSA 1T4DA 3WLQA 1TPYA 4C5BA 4C14A 2IYPA 3MCVA 2RC5A 3SEQA 2DB3A 3BMCB 3OU2A 2OWDA 3PVSA 4TVBA 4OIFA 1CY4A 2NSDA 4D41A 2YS6A 3IR7A 4OJNA 3QMVA 3QBEA 4ALJA 4D0NA 3NTLA 1KAOA 3VA7A 1CUBA 1QGYA 3RHZA 3WB1A 4JXXA 3LFUA 1J00A 1K9SA 2CK3A 2DCMA 1Y5NA 1CUHA 2CZQA 2FU5C 1U02A 2ZETA 1IHPA 1PAUA 2P35A 3DR3A 4DWWA 4QYIA 3HEAA 2OVBA 1X1AA 3H17A 3TUZC 5G40A 1GZHB 1C7IA 2G1KA 3KWFA 3C3DA 3ETGA 3QF4A 2IU0A 5IG2A 2XRMA 4UEKA 2CDCA 1KMHB 1TMYA 5DK4A 4JLSA 5AQEA 1PS0A 4P81A 4JJKA 4Q9JA 1WPRA 4JXKA 4BFTA 3PNLA 2YJ4A 2ODPA 4N4AA 3HE3A 1QS0A 2Z08A 3FX2A 2YNMC 2A1IA 1T10A 2AFHA 1GR1A 5L8VA 4F91B 3A37A 1Y3HA 2BRUC 3IL2A 2XRYA 5BWOA 1G21A 1NW7A 3TLCA 4TSFD 2LKCA 1MCZA 2NUPA 4HF7A 5HKAA 2IS1A 5EWLA 6ADHA 1FUEA 1KJIA 4QBGB 3AF2A 1USIA 4LF5B 1NONA 1CR1A 2R7KA 3AIKA 4FYHA 2JGFA 2P2CA 4MWOA 5EEGA 3ZK8A 3PYXA 3THYA 3ED5A 4YCAA 1RJDA 1L5QA 3I30X 1M2VB 1ZSNA 2XNHA 2XECA 4I3GA 5ETJA 3P5BA 1J07A 2BE7A 1O6ZA 1NV8A 2E87A 4IGIA 4V2UA 4CMBA 4DREA 2X8BA 2XTMA 1ZW6A 1HZZC 2FZ5A 2Q4DA 3H19A 3OSZA 1W6RA 2Z8ZA 5AOAA 4OI1A 1U7WA 4MUAA 3DAHA 1QORA 4X94A 3VC1A 1CRQA 2C3UA 3HL4A 3SEFA 3OZEA 1TQ6A 1L7MA 1CE8B 2FGKA 4C0WA 3SSMA 5AICA 2AB0A 1ZIYA 1SB8A 2V7QD 1FJHA 2Y71A 5CDFE 4QOFA 3ONFA 3R7NA 5JZSA 2DQ4A 1HOXA 5EP4A 4XWWA 3ZWNA 5ANRB 3QE3A 1J0AA 1Z82A 2AK3A 2W6ID 1U7ZA 2YWXA 1CDDA 3ANXA 4JU9A 4XIJA 1DIBA 2GA9A 3MS2A 5BYJA 2VPZA 1UPFA 4FFWA 1GTRA 2JAOA 1LNSA 1X1BA 3IP9A 1SVLA 4GOND 3TQIA 4V0RA 3EFOB 1IULA 1K7YA 3LT1A 1Q3TA 3VV2A 3R5TA 4PIVA 2WYOA 1ISIA 1EB9A 2NU7B 4DRZA 3L7BA 1J2RA 1VMKA 3SY8A 1WOYA 1KDVA 3ZHUA 3I32A 3TZKA 1PDOA 2HIAA 5IBRA 3UM9A 3V7FA 4G9EA 3RRMA 2ZJ4A 2QUAA 2IE8A 4JEUA 3ZJYA 5KPDA 4FIZA 3PHJA 5F7OA 2Q5FA 4JR0A 2BWJA 4ASUD 1IXSB 4YO7A 3KWJA 2Q8PA 4XYGA 1S96A 1JBQA 3PBKA 3BD9A 3DDHA 4RACA 4JQSA 3TK1A 2UV8A 1UF9A 3GR6A 1HY3A 3DDZX 3JYLA 2BGJA 3K0AB 2K2QB 4K1LA 5DO9A 4EGQA 4GKKB 3K5WA 4GO1A 1MNQA 3MM4A 3ILYA 2D0OB 5ELXA 2DETA 1NMXA 3HR7A 1TW3A 3OEED 2ONYA 3AJEA 5LXTA 1DJQA 3EXHA 1RI3A 1LDNA 2VWQA 2QP3A 3OAAA 2GSDA 4UCFA 4EY3A 3TE7A 4BU0A 1YZHA 4MEBA 2WWFA 1HLDA 3OECA 3E9YA 2VTKA 4REMA 2EKPA 2VOEA 3C3JA 2X3YA 1AHNA 2XNCA 3DD5A 1L2TA 2W6JA 2JB9A 4TMXA 4ESOA 3OC0A 4IGFA 1T8TA 3TNFA 3PGVA 4KIUA 3CZ9A 4DM3A 2DSTA 1BEZA 1WDWB 1E9FA 1WQ3A 4LYHA 4N6NA 3WWZA 2OHFA 2YIJA 3TYXA 2AEFA 4YT8A 1PT5A 1SUBA 1WTAA 2IIPA 2B5OA 3E15A 1IZZA 1DJOA 4H7IA 5AJZA 3ZQJA 3K20A 1GJRA 4MMXB 4YP7A 5JVDF 4J1TA 4B4WA 1NIJA 3GVPA 4S1NA 3ROQA 4UTPA 4X54A 3Q3HA 3T3MB 1C7RA 1P72A 3LI2A 2HTFA 1F8YA 2A1TR 1A7AA 4JYPA 1MGOA 5DPMA 3ZDBA 4QFCA 4LGMA 4WFKA 1YJXA 2NZVG 3SSNA 3C7DB 3VKVA 1TAHA 3WLPA 2YKGA 1DAIA 3LQYA 4YJFA 1COZA 3AEQB 5IM4A 1S6YA 3EPLA 1OXTA 1H94A 2W42A 3JSXA 1S2OA 4OP2A 2ZB8A 3CTMA 4EB6B 2AI1A 5JNVA 3VPGA 3IQFA 4WOKA 5HX7A 1DMRA 2P2LA 3PNBA 1GPNA 3GLUA 1JALA 4RPLA 1XZIA 3DEFA 4NDZA 1E0KA 3R8XA 1AZTA 1SVIA 2DJIA 4TLCA 3V4PB 1Z16A 1QIMA 2PVPA 3R24A 5C7IO 1MA3A 1JI3A 4NJMA 1IHUA 3GGGA 4M9QA 3MLBA 1SN7A 2VNIA 2NUTB 1M0TA 4MTCA 1WSBA 4X0EA 2C0PA 2Y0CA 2ZYSA 3EA5A 3L8HA 4JV5B 1W5SA 3H42B 4DLUA 2W6ZA 4RQAA 1NFFA 5K3FB 1JILA 1JKJA 2PXCA 5C8XA 2R8YA 1V9CA 1I4LD 1Q0PA 1RM4A 2I1LA 1NF2A 2Z4SA 3B52X 3BWVA 5EKSA 5BOSB 5T41A 1GDDA 5CHEA 3K9QO 4MP3A 4YRIA 2Z5FA 2XODA 1T3HA 2CKDA 3BAFA 3PFIA 5ECDA 1UINA 1HURA 4KIJA 4I5FA 1LH0A 5EZYB 4LF4B 1M2FA 1RKQA 1Z2CA 5AI8A 2IEDA 5HKKA 2NADA 2EJVA 1ZDMA 4L74A 3U39A 4DXAA 3FUTA 4Q9NA 2P11A 5A1JA 2I6TA 1V47A 3CN7A 1O7JA 2Y05A 5FJIA 4DPLA 1G9TA 1JP7A 4ZOQI 2A33A 1YZGA 4QOEA 4E09A 3I5MA 2WHRA 2CHGA 1IHYA 2IP4A 2P9YA 2V6FA 2WT4A 2PX5A 5FCDA 3TCKA 1HM5A 3TFQA 3ZK7A 2P6RA 1NVEA 1QFJA 1LJLA 2BHTA 4IFEA 5DN9A 5C4IA 3R5SA 2RKWA 2A0UA 1Z18A 1IN4A 1LTKA 1VDMA 2HSDA 1I6KA 4GGPA 4URYR 3RSGA 4WTOA 2XBLA 3BMOB 5E1MA 4WEQA 1VI2A 1WMBA 3OPNA 3C4QA 1CFZA 2Q3FA 1OFHA 2GNPA 5TJHA 2OFFA 3EXFA 1MC4A 1ZH2A 2JCSA 3CEMA 4PG6A 4WNCA 3ZBPA 4YFVA 3X1KA 1RHMA 1T2VA 3D5QA 1RYMA 1RRGA 3MC1A 5AK3A 2FWNA 5CR9A 1U63A 4IZOA 4KLNA 2H5EA 1Z0FA 1NW8A 1E4YA 1KI8A 5HIMA 1R8YA 3DEKA 3HB0A 2EBFX 2X14A 1CP2A 3A6GA 3GJRA 1TK9A 2XDWA 4U9IS 3TOSA 3T1TA 4P3XA 1Y34E 3IVAA 4UPVA 5DWQA 3HY4A 2V97A 1ZFNA 1FNMA 3DZBA 3LKVA 1RQXA 1P39A 1T1RA 4ZRDA 2DBZA 3K8YA 3N5CA 3V80A 4BPRA 2DECA 1TT5A 4TYMA 5K0BA 3EXHC 4M54A 2IZ0A 1DKOA 1GNVA 4ZPJA 1HTTA 1HYBA 2VJOA 4G1BA 4JUIA 3SI7A 1QG6A 2Z57A 4C4RA 1GPKA 1L8AA 3E5MA 1R12A 2JPDA 4QU9A 3TTYA 4NZOA 4E4YA 1CHNA 2I9PA 2VAXA 1W4BA 2PYDA 4B6GA 1RZ3A 1LBHA 2QX7A 3IAFA 3U60B 4MO9A 3DLHA 1QCDA 4GNRA 4M8IA 4K46A 4NFHA 4GW3A 3HXMA 3OOSA 3UG7A 3IHTA 1S2GA 1QLHA 4FC7A 3ZQ4A 2AE1A 3W8RA 1BD4A 4ZVTA 4FEGA 4AG6A 1KFBB 4CKYA 1PR1A 4J1TC 4WXRA 5A62A 2QIOA 5K4AA 3INRA 4NRDA 3M5CA 2JD1A 1WQ4A 4P9NA 1E9VA 2I6SA 1EWRA 2REOA 1BVYF 4XJXA 5LBUA 3IXQA 4M7PA 7MDHA 2D06A 1KOJA 2V7VA 5HILA 1V5GA 2WYUA 3WRYA 4WZBA 3V3TA 2O1EA 3ZH2A 5J2TA 4Z4GA 5H70A 1FNDA 4QTTB 4BTVA 1E1NA 4LJAA 1W25A 1VYHA 1GFIA 1UPCA 1HT3A 2JEYA 2QLMA 4N5IX 5A05A 3JQAA 5A5DA 4DR7B 3MUNA 5B3AA 4EVSA 2CVZA 1BX3A 4FGWA 4EYOA 2C5HA 2ZJOA 4OJKA 1S0UA 2PBFA 3H6HA 4LRUA 3UJ9A 3TGLA 3DO5A 4R8LA 4D96A 5DRTA 3HYNA 4BFXA 2W9XA 3HCBA 4AIRA 4Q7LA 5ADHA 4R2XA 2C7PA 4G4IA 2M2IA 2R8ZA 3K1JA 1ADCA 3IEUA 1O54A 3UCXA 1YU9A 4A6EA 4V3CA 4FVTA 4LF6B 3I6YA 4U4AA 4CNBA 3IPRA 2R1TA 4HWKA 4BMYA 4NONA 3SSOA 1QX3A 1T9DA 1ZI6A 4MLZA 2GEDA 4QHTA 1HDZA 1FDTA 1XYGA 3PXAA 4RSHA 3MOSA 4M4SA 3JWIA 1FVXA 3ZE0B 5LQKA 1Y6QA 3RS8A 1NKSA 1SVMA 1TF7A 2WJJA 3BFKA 1Z8NA 4YLYA 3W5JA 3KUXA 2MIIA 4GPEA 5K6RA 1QO0A 4FGLA 4G0OA 2C1ZA 4K6CA 3I0NA 4B3SB 1FMCA 5KSWB 1GDHA 4FDMA 2YWRA 4HSEA 3OJWA 3R4CA 4MUIA 3OCUA 4BQIA 1JE0A 2V96A 3SCZA 2RH8A 4P1ZA 5DGIA 1P45A 1Q21A 4J0EA 4WV3A 1M3SA 2HCJB 3QE4A 3EF1A 4N18A 4RMNA 5CFMA 4GSKA 4MB2A 4JELA 1KFJB 5JWOA 4HRYA 3GWGA 3IULA 2Z4RA 3OOWA 4YCNA 4HH4A 1YAHA 3T3GA 4KO1S 1OVGA 2GHIA 3O1HB 4ITVA 2GQ0A 4DCSA 2R4TA 4A8TA 1ZK0A 4CDRA 3GRVA 4EMSA 1K2WA 3BDAA 2JLAA 2UUPA 3HJUA 3NOQA 4FMDB 2DSNA 5GM2A 3U7IA 5IT9A 1RC8A 3R0QA 1B26A 3U6BA 4JLNA 4D02A 3GB9A 2ZPUA 4NYJQ 4OV6B 3ZY4A 3VVMA 3C74A 1GTVA 4IX9A 2BMWA 1T5SA 1P77A 1JYSA 3AVOA 3EQ9A 2ZIZA 3PNSA 3QFCA 4PQEA 4C4PA 5K8LA 5CB4A 5K3EA 5ECYA 4DYVA 2QZZA 5AK4A 3WMFA 5JANA 1P0QA 1O08A 2YN4A 1TUEA 3MUEA 4G63A 1XN1A 1X8JA 2PL9A 1FNBA 3W8EA 3I72A 4I4CA 4KVAA 1WVIA 1T0BA 3UIEA 4YDQA 1RI2A 2H08A 4GLFA 5IJXA 3W90A 1KMCA 1ECCA 1JTFA 1A4XA 2G25A 3SIPA 3DPIA 3D8NA 3BAZA 5BN5B 5A4AA 2ZR9A 3CXUA 1HKHA 1MB3A 5IYZB 1TTTA 2WE8A 4KGZA 3NM6B 3QH4A 4KI0A 3A6KA 4XW2A 4YRJA 4KQCA 2BMJA 4UREA 4RAOA 1V96A 4NK5A 4IXNA 4PSVA 4CM5A 2DHEA 3QJGA 3EEOA 2NP7A 1MB4A 3ESBA 3STHA 2XMQA 1CIPA 4LDJA 2P4UA 1AB5A 3K16A 1NAIA 1YU6A 4BKPA 2QUBA 2XNKA 1M7HA 3CZCA 3M5WA 3AI7A 3LXUX 4MLPA 4D8UA 2KHZA 1RABA 2QTNA 3GUVA 2O3JA 3LYAA 2C94A 2VPIA 1PTJA 4K8OA 4PGAA 2X0EA 4D5EA 1ZHOA 1X7WB 4JR1A 2CYBA 2GPYA 2W71A 4C0HA 1GRRA 3B6KA 4GOXA 4KR9A 4M7OA 1A97A 1GNPA 4HQ6A 4NCKA 1XAHA 3TPZA 1FVOA 2N0SA 2Y1FA 1NUPA 2ZSHA 1TIPA 4ZT2A 3ZKWB 4KRYA 1SZPA 4MS4A 1G8HA 2FFRA 2HLHA 3KKOA 4RORA 2CMGA 4LZAA 1SCIA 2FI1A 4EEZA 4YJ3A 3M4JA 5J40A 5CT8A 1Y8QB 5E1BA 4PV7A 3A3OA 5KU1A 3ESCA 3JTMA 3RYCB 2ORVA 1GL6A 1E9CA 1NJ6A 3DNPA 5J4KA 4B3GA 1JGTA 1G19A 3GJ6A 3EC2A 3ACBA 3HCEA 3WRYC 1DP4A 1NNLA 4MYRA 3F7TA 2RCYA 4DJ5X 1WV0A 2XQFA 4M9RA 1OGJA 1L5HB 1F2UB 4G5HA 4G89A 4ZQFA 2W8ZA 4MULA 3M33A 3INGA 4EATA 5KVCA 1Z17A 4RMHA 3OLZA 1JN0A 3ZHQA 1RYDA 1LTHR 1CJVC 2W6NA 2MSEB 5IAJA 1NPYA 3RVKA 4DNFA 1SUWA 1OX4B 4HUTA 4TMTA 2HUNA 4D8TA 1LLCA 2AG6A 2UVQA 3OVMA 3LLMA 1YB5A 2PLFA 3CE9A 4MW5A 5GVRA 3REQA 4BAUA 4IGEA 1AA9A 5J58A 2ZJ1A 5KNCA 4C7MA 2FEXA 2B92A 1TUBA 1W4ZA 2GETA 2XZPA 1VE3A 4DCMA 5EJ8A 1A1SA 2IS6A 4PLGA 4XB1A 5TNXA 4NBTA 1N0VC 3R20A 4HNAA 1HFWA 5CVTA 3B2EA 1NJGA 3OZTA 3K30A 1FTYA 2IUSA 2VUTA 3BBPA 3D6FA 2GEKA 4LSGA 4R31A 4ZQCB 5EZYF 3UW1A 4G5XA 2B4TO 4YH1A 4B7XA 4BLQA 4CMHA 4C3OB 4WK0B 5F73A 5DGHA 3WGGA 2E55A 2OZKA 1LWNA 6Q21A 4GBED 3P4UA 3VKHA 3G6WA 2F90A 2W2PA 2ZP1A 3ZHYA 4G5YA 2LUOA 1MIHA 1GQFA 2RI0A 5LDHA 5F2EA 3W5SA 2E0IA 3U4QB 3Q98A 1YH3A 2JZCA 2ZUDA 3I0ZA 4U5XA 4J0FA 4YUZA 3ABOB 3L4BA 2E4VA 1XLWA 1UFOA 2F1RA 2CMKA 3R6WA 2EQAA 3MYRA 1XZMA 2PU7A 1S2DA 2X2EA 3GEMA 3IAAA 4XIFA 3LT0A 5LZ7A 1O96B 2VP4A 2WUDA 3N2KB 3N3BC 1N92A 3GVXA 3IEMA 3EZXA 3OE7D 2YWBA 2QUZA 2KYRA 2PM8A 3ISVA 3LGXA 1KOGA 1HT0A 1NN3A 3P5SA 5KYTA 1XNRB 4M37A 3L0DA 3FNHA 2G5PA 4JBXA 2P6UA 1EHIA 4TZTA 3I01M 3A1NA 3CU5A 1TF5A 3DMPA 4YJGB 2PS3A 1HDEA 1XGKA 2NZJA 4DF3A 1YZKA 1UBNA 3CNQS 3BF7A 1N2GA 4F9TA 1EG2A 3DPSA 2V6MA 5LLTA 2CXPA 3QUCA 2JZNA 2J3MA 3GDOA 3H2ZA 1QHSA 1EM8A 2GAAA 1KO4A 4N8SA 5G53C 1E1CA 3EGIA 4AICA 4URVR 2AW5A 4QDUA 5IKPA 4CIWA 4FYPA 3I9OA 3PIIA 3JZIA 2OEPA 4LW8A 2JAPA 4ZT7A 1B8NA 4WKCA 5AJWA 1JLLB 2Q1XA 3AP3A 4GI5A 1YE5A 4D74A 3V5NA 2XWBF 4ZQGA 1TZJA 1NVVQ 4DRXA 3L6CA 5DBOA 3IIEA 1XTTA 3O84A 3GRAA 2BPOA 3G85A 4PIMA 2E21A 3WK5A 2W2KB 3ZLJA 1JQJC 4FILA 3LFTA 3GNQA 5DI9A 1JG3A 3SBEA 2C9ZA 3QXJA 3WL7A 5AW5A 5K8JB 1UOEA 2VLIA 3KD3A 4E1BA 4Y1GA 3ZK9A 2AFIA 1R66A 3JZAA 3LX4A 5GGXA 1TMOA 4UNNA 2A5YB 2MYPA 1SOUA 2JLRA 4QGGA 4F5WA 3X2SA 1TL7C 2H07A 5IXYA 5IMBA 3UWSA 3ASVA 5E8JA 2FPGB 2YIDA 3O8NA 5CLIA 3SBXA 2OT3B 3KJQA 5E3HA 4FT2A 4QECA 3TDMA 1EQUA 4IHQA 2XA1A 2XF2A 1ZWKA 3BL6A 3UXMA 3DFMA 4OXNA 4P8RA 2A5DA 4DM7A 3JQQA 4Z4CA 5DHSA 4UUBA 3AH8A 5EJ5A 2VCEA 1P60A 3BMNB 4CW7A 4P2BA 2UVPA 4ZA2A 2FPWA 3GFPA 5JQWA 3S40A 2WWYA 3RWBA 3F5DA 3JARB 4FFPA 1G1AA 2NSJA 3O8OA 1TAGA 1VGRA 3SNHA 1TVKB 2OTCA 1BC5A 2B2CA 2H2GA 2FY8A 3EBLA 1IJEA 4TSRA 4BQPA 3OJLA 2OZPA 3RANA 4D9CA 2OSVA 3EPPA 1UDRA 1L3IA 4YCSA 2ZJBA 3C7KA 2HADA 3JATB 4RF3A 2D62A 4ZC1A 1VLJA 2QN7A 4BJHB 1D6MA 4MAFA 1E2LA 1P73A 3D7SA 3DTVA 3HDYA 4MP6A 1MRNA 3DE7X 4Z99A 5CU7A 2HW8A 3CS3A 1Z2DA 3SSAA 2NUAB 5BV1A 3OU6A 5CXSA 3NVDA 2A6PA 4C4SA 1QIGA 4B46A 3HBMA 1E32A 4DIUA 4DHWA 1O03A 5FHRA 3TTVA 1I1HA 3WDKA 3C6ZA 3I8XA 2GZ1A 3DP7A 3RRXA 1R0BA 5K6TA 1GCUA 1V41E 3N74A 2Z2XA 4IDFA 1YR3A 1BCRA 4TGLA 2FWJA 2V3CC 4S1PA 3ZY3A 1KZ9A 3IOYA 3ZTYA 2Q28A 3HCAA 3GWZA 1JG2A 2PD3A 1U1DA 1IUNA 3AM5A 3MTJA 3NOOA 1DHTA 3K8QA 4NPCA 3OZDA 4OK6A 5H80A 4ZEWA 1AKMA 4FHGA 1TA9A 2NO7A 2LP4Y 1H0SA 3DGFC 4LGVA 4Q15A 3L4BC 4WRRA 4DBLE 5IZCA 1DU4A 1KORA 1NBMA 4FMDF 1JDNA 5F2KA 3WZ2A 5KNDD 3ZGZA 1EVKA 3WS7A 3RIGA 2VA8A 3JCZA 3OM8A 4FEAA 1L7VC 4UHHA 3LVQE 4Q4JB 3N59A 4JK3A 3ZCTA 4F8EA 2ZRQA 3NYRA 1A72A 1G55A 4Q3CA 3RABA 4LBVA 2VF5X 3B89A 3S2SA 4X5OA 1ZXBA 1Q0SA 2FP4A 2QD3A 1GTZA 4TTSA 5AI4A 5AKJA 1CIVA 1ZJWA 3SHTA 3BOSA 2YHIA 2FG5A 1PVVA 1FPMA 2HM7A 5DP1A 2XTNA 5G1NA 4C4ZA 3E35A 3EFEA 5ALYA 3G6KA 5DWVA 1Q17A 3HUEA 1Z38A 1RFGE 2QJFA 1YMUA 4XDYA 5HJEA 4D3XA 1KZYC 3DE0X 4WNAB 5H59A 5IYZF 4R83A 1TZCA 5A71A 3ROFA 1W36B 3VU9A 3DT6A 3SJBA 1JFVA 2YXPX 4HB4A 3HDJA 3P0JA 1LDEA 3OIUA 2PUAA 2ECFA 1QSGA 2QT1A 1C50A 3PX2A 1N9GB 3GMIA 3TRHA 2D5LA 1W19A 1F2VA 2G0AA 4AUKA 4RFSA 4C6TB 1ZM9A 4K28A 2D5BA 1E7QA 4YYEA 4ZDIA 5A6SA 4S1TA 4IFTA 4P3NA 2PMBA 2ZE8A 4KUHA 4DR1B 3BILA 1JA1A 3PX3A 3QU2A 1A27A 1K7FB 1W4RA 1HDOA 1K27A 3D6VA 5FQNA 3RARA 2Q8QA 1XTUA 4DZTA 2XQVA 1QB8A 4AO8A 1TZKA 2X1VA 2WLTA 3FHCB 4IEFB 2RGEA 1PD1A 3KR9A 1NWCA 4O1HA 2AD5A 4L5BA 5JNSA 3BSSA 1XCBA 3WGZA 1XMIA 3A70A 5B37A 4XH9B 3PFKA 2QAIA 3MJ4A 2EV9A 4YMHA 1AJEA 1AK2A 3MJEA 3OHMA 4GFDA 1QK5A 3U4DA 3UWPA 4XPIB 1CUVA 3H4MA 1N9KA 2CB0A 1F38A 4O0MA 5IPFA 3W9YA 3COPA 3BQ9A 2F48A 3PA8A 3D43A 2AC7A 2OZEA 3O83A 5F33A 2WMDA 5AMXA 3RTBA 1G5FA 1IRIA 3QEBZ 4UD2A 1LJ8A 3B1FA 1XWIA 5FTMA 4MX8A 2EATA 1I4TD 5BVHB 3C3KA 2IVZA 4AW9A 2RHDA 4HQOA 2J9ZB 2VDMB 2QTBA 2HH9A 3FGOA 4C5CA 1ENOA 4KSCA 3MG9A 4UU1A 3KZOA 3LK7A 4D6YA 2A1UA 2HFJA 5E6UB 2XRZA 3GGOA 2AJBA 4YBRA 1N9ZA 1OPXA 4KR0A 2A5GA 3W2TA 3PHCA 1E99A 3OPYA 1YTUA 2UKDA 5FUMA 3ROKA 3G9UA 3RC7A 3ZXXA 3DL0A 3QMMA 3O92A 3WY9A 3RB8A 4R2JA 4PPFA 4ZQBA 4DIBA 4MW0A 1V1MA 3PPVA 3T94A 1SKAA 2FEWB 4TYWA 6REQA 2PX2A 3C14C 4H3VA 5JYEA 1JG6A 3N2ZB 3N87A 5FL7D 5JPCA 4C78A 2YVQA 2D7DA 1VJ1A 3BCSA 5DOZA 1QWOA 1YVRA 1P0FA 3C1OA 3EXIA 4L0CA 3UCEA 1FTWA 3LVBA 5THQA 4F2GA 2BD0A 2BIFA 1H4SA 4KQFA 1CK4A 3KALA 5AHOA 3TN7A 4B85A 1AU9A 3ZKAA 3SE7A 4DV3B 4IXDA 4KHZA 4E7OA 1ENYA 1A4IA 1G0NA 4EIWA 3DUFA 4DR5B 4Q82A 5JSQA 1QIFA 1RZUA 3MJRA 3KQLA 1PD0A 3NVAA 4UHDA 2NM0A 2B0JA 3G2OA 4L3OA 1KU6A 1RYYA 4HT3B 4OBEA 4WBXC 3ENVA 3NHZA 4KXQA 5BO5A 3T4EA 5B6IA 4ENTA 5IZCC 1RLMA 1NG1A 3I9JA 1CUJA 2CJPA 3BVPA 3TI7A 3O1JC 1SD2A 1EJ2A 3WWYA 4KAAA 1MIOB 1JG1A 3EW9A 4B31A 2FW6A 2FF7A 4Y2GA 2PMWB 2NTEA 4Y9UA 1B8VA 5K03A 4QGFA 1Z0DA 1JQBA 2FP3A 5K0JA 1JLMA 3U16A 4NQRA 3NG1A 4FKBA 2QORA 5AFSA 4X8LA 1M34B 1NLMA 4ZV7A 3TW4A 4CIVA 3SYTA 4C43A 1A9XA 4DXHA 4G9GA 5LMZA 1WU8A 2AYZA 1T8YA 4L5YA 2YOGA 3TAHA 4NAVA 2WJ4A 1GTJ1 1T2EA 3CX6A 2O8BB 3VH3A 4NENA 3CUVA 3KAJA 5GMOA 1P81A 1H4VB 2J09A 1EUDB 2QN3A 3KYJB 3LYLA 4MVJF 5E6SB 3OPYI 5LOVB 3DE3X 3OF5A 1P31A 2ATVA 2RHTA 3L9XA 2BM1A 1N6PA 2J0VA 1SGWA 3CM0A 2CBXA 3JQ8A 4XIGS 3U80A 3HM9A 1T35A 4S24A 4D0LB 1JFFA 2JARA 1M6NA 4ZCIA 1XTZA 2O7VA 1VJDA 3MILA 1JJFA 1ODKA 2FWRA 2ZRNA 3E7PA 2C99A 3G0GA 3PGXA 4Z8XA 5G0UA 2WWHA 5AVSA 2AUMA 1OE0A 1F4LA 2VI5A 4MJ7A 5CK5A 1XMJA 3KKQA 2B20A 2DPXA 2FZKA 3QWIA 3HS3A 4I4NA 5BY2A 4D3YA 4GXQA 4RIHA 4MB0A 1M6VA 2HAEA 3IE2A 2NSHA 2I2CA 2G06A 5KOHB 1X9HA 3QXCA 4Q3DA 1ZK3A 5LDGA 4KXUA 1IH8A 3ZV7A 4RZ3A 3SC2A 3T5CA 1ZJJA 2HBYA 3KTFA 3RHTA 4EM6A 5KTYA 5FPYA 5CXQA 3GFBA 3G0DA 3UICA 1JKFA 4PNHA 2XAUA 2XQIA 4D0SA 1GCGA 1J4AA 2H51A 2I99A 4TTAA 2ACKA 1S02A 4R6WA 2B4KA 4OXQA 4PYJA 2OY0A 1DEOA 4YQEA 3BXEA 4RCVA 4L8FA 3NEJA 1EIZA 5L4SA 4X71A 1ZOIA 3ZGOA 1J22A 3E5HA 3D3QA 1YUMA 1QMGA 3DL4A 3DF9A 3AP2A 3GCGA 4PCLA 3Q1KA 2FE1A 2ORIA 4YEDA 4R9VA 4MWDA 2H1LA 3UC9A 4MGHA 1TRHA 4BLTA 1DCFA 1GNQA 1J5XA 2FDXA 2J45A 5BMVB 1XZBA 1N2OA 3KXKA 3PNPA 4BX3A 4LDPA 3RIMA 3FPEA 2IOHA 2J30A 2OAQ1 2R3SA 3F8WA 4NC9A 4CTJA 4Y0NA 4X44A 4UTZA 4E03A 2C03A 2C0QA 3BWDD 1BS9A 2ZYHA 2DT5A 4MI3A 5ADUS 1B7GO 1MT0A 3AI3A 3R7AA 4ESVA 4AMYA 2YV3A 3WIUA 3KU4A 4Q7EA 2FQ1A 3FVQA 4V02A 4XIYA 3W6OA 5JAHA 1C9EA 1OVMA 2XT0A 3ESAA 3AOEA 2W22A 2XUQA 2QB5A 3KPWA 1VHJA 3I04M 4LE2A 1YZVA 2APJA 1T2CA 4MGYR 1U0NA 2G77B 4DJAA 1ECPA 1XTIA 4YAOA 4H0FA 3JSAA 3KEOA 5KDOA 1NN5A 5HJ2A 4BX0A 4PYNA 2BFCA 3LUCA 3L0ZA 3P0EA 3PE3A 3T7DA 1T4CB 5HCIA 2J32A 1HEUA 1VPVA 4IS3A 3M0EA 1XZPA 3OETA 4R84A 1IY1A 3TBFA 1EJ0A 5JH7B 1QAQA 1JSRA 3EVNA 1WHSA 1CZKA 1HDXA 4EF4A 1BWPA 1V6SA 2IKQA 2XADA 1J9ZA 2C5SA 3ILHA 3TFWA 2CXXA 2F8SA 1K89A 4BNNA 2H54A 2BMFA 3LUKA 4CJXA 5IVKA 4BY9E 4I4TA 1NMQA 3P0FA 3PE6A 3NHRA 4CN8A 4RC9A 3MTDA 4AY2A 4RZQA 4R2WA 1XNHA 3EG9B 1NHWA 1C8BA 1XVTA 1EVZA 3L0SA 1B14A 1KYIA 3OIFA 3W4KA 1YB6A 3FKQA 4X84A 3KQWA 5KIAA 1NQVA 1F7VA 1JLHA 1CHDA 2CVHA 4PFJA 4ZDWA 4NKRA 3IEXA 4N40A 4GT1A 1DJPA 3WGHA 1Z08A 2GD1O 4TL7A 5I51A 4JT2A 2W4QA 2O4CA 4N5MA 1OYVA 2IODA 3OQBA 1VBKA 1ZXXA 4EA9A 5KWVA 3W5AA 2ZT5A 3E3NA 4E6PA 1SXIA 1N57A 4PF1A 4QYSA 4D9BA 2HNAA 5LP1A 5A7FA 1C9MA 5JCXA 1BJKA 3FTDA 4O3FA 1PT8A 2CHVA 2XCOA 1NP3A 1PFGA 3CSDA 1U8EA 4ZODA 3BMQB 3G2KA 1MU0A 1KK1A 2XD9A 3HFGA 2CCJA 4MR7B 2YUIA 5BMOA 1HORA 3PWSA 5HF6A 2BBSA 5IFLA 1KK0A 1M6EX 1YB2A 3BK1A 3FB1A 3ZW7A 3V2HA 2UXCB 1IIRA 2IC5A 1N7JA 5EE5B 3V42A 3RU7A 3ZZNA 2IITA 4KQIA 4YRZA 1BH6A 4B3MB 3A9WA 3ICOA 1ZWLA 3C3WA 4IZHA 4KXFB 1LQ2A 2IU6A 1RM3A 4P3OA 1IBKB 5K20A 2JASA 3ZWQA 3AFIA 1ISRA 2RGBA 1C0IA 2AEEA 2FEAA 3GUCA 4ZDKA 2C2WA 1VIVA 1ZUIA 3P8ZA 1Z0AA 4CTMA 5GZ1A 2ZBGA 3AZQA 1D04A 3E5RA 2HDHA 2VF7A 1CJSA 2WW8A 1Y9EA 3IP5A 1T6YA 4LJ6A 3AC0A 1V0JA 3BRQA 4DSUA 3ZDDA 2X0NA 3VX3A 1IVNA 4YJ2B 5AR1A 4RE6A 2BM0A 3W04A 4MVJD 2Z6VA 1NBHA 4FK8A 1Y1KE 1ZD2P 4H0CA 3ZGVA 3IO3A 3LDHA 3KQUA 1RYHA 5LQJA 3V7YA 4NBSA 4MINA 2D0PB 3K5PA 2FQXA 3E9DA 4A8JA 4RF5A 1K88A 2WJZB 1S3GA 3SGLA 2PZAA 4Y1RB 2I1QA 4G23A 3IVXA 2AXNA 4RJKA 1NMZA 2GS9A 4CR8A 3N8GA 4YJHA 2WFMA 5CT9A 4ZTUB 3EJ6A 3WK9A 4WN9B 1BJRE 3CLHA 4C03A 4Q1VA 2V7GA 1H42A 1W88B 1DQPA 3KKLA 5ALUA 3R3ZA 4X60A 1NKVA 3ZIDA 1D4AA 1RIFA 1KSJA 2PVCA 3DXXA 3GGDA 2WMOB 3I76A 4YP1A 3RT1A 3T34A 3TTXA 3WDSA 2H8GA 1OROA 2NYRA 4NHEA 5CB6A 5EJ4A 4C30A 5DEIA 3O82A 1N2CE 3FF1A 5IK2A 2PRZA 3LUPA 2M6LA 1SIBE 5LU9A 2AKEA 1VCOA 5D3QA 2NIPA 2FKAA 3H0EA 1PQ4A 4FOOA 3TR5A 4H7PA 2CHEA 2QE7A 2W5UA 3NTXA 3ZHTA 4FZ3A 5COQA 2V7EA 1Z47A 3CPJB 4XDGA 3ZY2A 1NVUQ 4D4HA 5AKGA 1O5OA 1HH4A 1VJ5A 3G5UA 1KZ7B 4O4HB 3NS7A 1I1QB 1II8A 4KJZA 3G49A 3PTZA 5JJ5A 1H93A 4EJSC 2XUKA 1EDDA 3K5IA 2WKWA 1YACA 5AUQA 1NE2A 4HC4A 4K3UA 2X1HA 3SKXA 3WK6A 4EY5A 3COJA 1Z22A 2C4TA 3VPXA 1C4WA 1QO9A 2KLHA 1KI6B 1R8SA 1P1KA 4DARA 2H0QA 1JFSA 2L2QA 1RI1A 2D3WA 1XP8A 3FOAA 5NLLA 4B6OA 4YV1A 3ZDEA 3IKJA 2XNSA 1EVQA 2VLBA 1SUDA 4FFBA 4B3HA 3H1TA 3QKWA 3H87A 5E8RA 2YY7A 3G1UA 2DT8A 5B6PA 3WYEA 1GO2A 4CKEB 1PLKA 4KIFA 1IOWA 2LNDA 3JVIA 3PZBA 1L5KA 2NNLD 2FHSA 3DVRX 3NHFA 2V7TA 3BXGA 3ZTTA 4QVIA 2WIKA 2AVDA 1L5WA 1RP1A 2XNDD 3ON5A 4FC6A 4LRWA 4I2NA 3ERCA 1YBFA 4BWFB 4F5DA 3ASZA 5AM5A 4Q34A 1JH8A 3A1DA 4ZDJA 1XHFA 2QDXA 5LOVF 1IZ7A 1FDOA 3LIPA 1UADA 2OV3A 4RK0A 2D1FA 2ID9A 2RBGA 3BGOS 3UK0A 4JODA 4PXAA 4LRSB 1PWEA 4EW3A 3WX0A 3GXBA 1KJNA 1ZMXA 2CCGA 2RJNA 3BULA 3P2OA 4LYEA 1RWBA 2P5YA 3G5LA 4CCAA 2I6GA 5JJCA 1L4KA 3WLFA 4RETA 1LVGA 3L1VA 3Q12A 4ZT4A 1IATA 5JD4A 1WZUA 2DULA 3KAPA 1VRVA 3KRTA 4FSDA 1CP3A 3V6MA 3L7KA 3F3SA 3GLVA 4TTVA 1XI2A 2OHJA 1ISMA 4KWCA 1E8DA 4U0JA 3A6DA 3GRUA 4UD6A 1XVAA 3JQ9A 3ONDA 4BRZA 4KNYA 3C1AA 1L8QA 1XVIA 3IBTA 1NJ2A 3SZUA 4E94A 1W47A 2P1ZA 5TGZA 4XQCA 5C1BA 4HZUA 5I7UA 3EUFA 4TZ0A 1ZSYA 1KTVA 4XPZA 4CTOA 2FK8A 3A1SA 3AR2A 3CTPA 5DSXA 1W36D 4H15A 2XNJA 3WYCA 5L3QA 2XSZA 2Q2WA 4AKEA 5LA6B 1O6FA 1WTCA 4Q37A 4YJKA 2VHVA 4JXZA 2BFEB 2OZLB 2PKWA 2H1RA 3FSGA 1CZOA 3TCNA 1ZA2A 4DUGD 5F23A 1VM6A 3I8OA 4F71A 4DV5B 1X1CA 2CZGA 2KBEA 1EP1B 1M1YE 3FZQA 2AOUA 4YHBA 4X7MA 1UKEA 3LBAA 3LCUA 3P9ZA 3ADOA 2PAAA 3T38A 4A8JC 5BMVF 4BLPA 3HPQA 1GUYA 1FMFA 5H9WA 3HSYA 4IJUA 4CIAA 3KB6A 1PGPA 4H6WA 2CCKA 3OZWA 4E13A 5ALSA 3DBLB 3E4CA 1PWZA 2RGAA 2VZ8A 1H8EA 1Z5WA 3JD0A 4FFMA 1EHYA 5EKXA 3EAGA 3QJYA 2B9VA 1E7RA 2HB6A 3PCXA 1S01A 5CEFA 2OV4A 1GTSA 4QXMA 5K0NA 5DHUA 3HP7A 2J3QA 4GVLA 2HQRA 2I78A 4KO4S 4NCNA 4TUYA 1BDIA 4D92A 2BH2A 2H9AA 2WUGA 2XE8A 4AS2A 1U9YA 4KQ2A 1KP2A 4B6SA 3LT2A 1ZBDA 4U02A 2Q3EA 3A31A 3NBYC 4KN8A 1WXQA 1UFKA 4JLUA 4TKVB 5BWMA 4OQLA 3TL2A 1NBOA 4AP6A 3IQXA 3AHEA 2PWBA 3GJ5A 2QTZA 4UM7A 2NO9A 5CXUA 3K31A 4E2YA 1QV7A 1Z6QA 2J0UA 1E3EA 3RREA 1P5JA 2F67A 3DV0A 3WDMA 5JH7F 2ZZMA 4US1R 2F59A 3MUFA 3QVGB 1N7IA 3T7JA 4BTLA 5DW3A 2EJTA 4IUYA 1FQKA 4LOLA 3SYRA 1WMSA 4R40A 3ZZMA 1MHTA 1XEAA 1YR8A 3FNIA 1E2DA 2R97A 1JAYA 4CFYA 3UAZA 4YC7A 3TGPA 2H2HA 3WGIA 1W5BA 4C2UA 2HPZA 4F6CA 5LDDC 4XAQA 4BNUA 1GGMA 5FLEX 5KOYA 4JGGA 2HLPA 4AKTA 5FUXA 1TM1E 2WUWE 1UAGA 1A8PA 3L8DA 4UEOA 4XWKA 3N07A 1XVVA 2IYWA 3GDHA 2GD0A 4FXPA 4YA6A 1LPMA 4YRTA 5DGTA 5EYPB 3TLGB 5LMUB 5BW8A 3ZDCA 1YBVA 3NP9A 3PYLA 3EB9A 4I1VA 1GPWB 2ZQYA 4C7OA 4ROTA 2FPIB 3WC4A 1UFVA 2GVDC 4D3ZA 2GM3A 2AX3A 2HNBA 2GZDA 1G38A 4H31A 4CQMA 2A58A 5AW7A 4F93B 4ZVUA 3HBJA 4TL9A 7REQA 1P80A 2X5NA 3FNRA 3KTAB 5IBPA 1HLFA 1UOOA 3K9CA 1JECA 3AUSA 5IUJC 5LQUA 4YLEA 3A9RA 1DUVG 2VNAA 1K4YA 3BXHA 4MWSA 2WE7A 3R8FA 1CEYA 2BFFB 4ECAA 2P5UA 3AFOA 1T3SA 5TPZD 3RVQA 3PC6A 3PITA 2H9YA 5I9IA 2Q2OA 3MJCA 3HWX1 4G5FA 1Q1NA 1XWWA 5CLHA 1RKUA 4DTCA 2HQ1A 4Z53A 4H1WA 4NQZA 3GI1A 3HVJA 2R47A 2CKMA 4RY0A 5EIBC 4M8NE 3B9QA 4GWLA 1C2TA 2PGLA 3INNA 5DHFA 1EI9A 3B5IA 3JQ9C 3QVJA 4JITA 5HIJA 4C4OA 1QVVA 3MBIA 2FYTA 2J07A 1AZLA 4OL0A 3PEEA 4GXRA 1ZC3A 3RNLA 3WGLA 3NHBA 4HDRA 5KWIA 2FEMA 1V37A 2RGXA 4D9HA 3RVRA 2N75A 4PZYA 1PSWA 4YQZA 2C0CA 3DBHB 4QWWA 4YJ2F 3W8FA 4ZEVA 5KC8A 2QAGB 1VRWA 3AR4A 1Y4DE 3O7WA 4KQ9A 3JZDA 4K6HA 1ZCJA 2XY4A 3M6LA 4NCHA 4INAA 4M6WB 5FTJA 1V11A 2NSYA 4KBYA 1QZZA 1TQ4A 4HGRA 3STXA 2OFWA 4AG5A 2LIPA 2FW7A 3KHUA 3OM9A 4ZI7B 2JLCA 3TLEA 1UM8A 1GT91 3CWZA 3SJ7A 1P2SA 2Q0HA 3CUKA 4PLTA 3U48A 3ITEA 3W6PA 3R5KA 3L93A 1ULSA 1GSIA 1MJFA 3IO5A 2ZJFA 3KB1A 5LR6A 3B6JA 2IBSA 3QWBA 2BOVA 3FOBA 3CVWA 1HRKA 2VNSA 3DZ8A 3P32A 3MRSA 4IRXA 2O8EA 2NXJA 1PNQA 4Q24A 5JC8A 3SEZA 4BE9A 3NONA 4OHKA 1CDZA 2CDBA 2IW1A 3OTOB 3K9FC 1KYTA 3RPEA 1H2FA 3Q8XB 1W4LA 4G0YA 4TV9A 1UMKA 4WUVA 2JGMA 1GPAA 3PNQA 4P5DA 2CDAA 4EB0A 1OZAA 1WF3A 4PRLA 1Q0HA 3C85A 3QITA 3CRVA 1GYQA 2VYVD 5AW8A 3NIBA 3VDXA 2UAGA 2GN1A 1UPUA 2B1RA 4O4HF 3X2EA 3QNUA 1H1LB 3RD5A 1I3KA 2BZ0A 5A4KA 4FNGA 3FZNA 3O9MA 4NYIQ 1QJ4A 1FE8A 2BE9A 2Q5IA 2V6IA 2JFVA 3BTUA 3NNDA 4JENA 1E0DA 4S0ZA 4AF8A 1T15A 2C83A 3HC7A 3CF4G 1W0JD 3DOOA 1PKEA 2XZDA 4NK4A 4J7AA 2YINC 1YS2X 3C2QA 3DAFA 4LV6A 4QXPA 4X41A 4Z9XA 4JP8A 4V3BA 1K3FA 1E58A 2ZCUA 4KFSA 3T5DA 4PHGA 4BQSA 1EFKA 1JJAA 1P1JA 5I7HA 3Q85A 3V55A 5AKXA 3FPLA 5DM4A 2XT9A 1BXZA 3V7NA 4YXWA 4A0RA 1VSQA 2DM6A 3FKSD 1MJGM 2V7XA 4UNQA 4UBLA 1UBOS 3REGA 1OB2A 2DKOA 4QTXA 2GNAA 4DZZA 3AEYA 4X20B 4G09A 4ZYUA 7ABPA 3QOYA 2YUTA 4D9KA 1YZ3A 4BCBA 5ICMA 3K2QA 4BO2A 4HNTA 3JAMA 3LC1O 3D8TA 4LHVA 3A0RB 1QDLB 5HCNA 2ONZA 4BVLA 3QXXA 1J8VA 1TEXA 1HDIA 3GGSA 3QEMA 5EE0A 1SC4A 1LLDA 1RKBA 2W2TA 2PS9A 4EO7A 3JWHA 2YJ3A 1YL6A 1FYXA 1WUJS 2UXDB 4JA2A 4V03A 2FWAA 1V71A 2O2CA 4ZGBA 4ARVA 1DL5A 2IBMA 3IHWA 3KKZA 5ERXA 3KFLA 3KVNA 4OFBA 3LDGA 2D2XA 3ZWDA 5JJBA 4IIFA 3LQFA 2ISQA 5EUQB 3V8RA 1ZNZA 4ND1A 2ZGVA 2X86A 4V0MA 3TCXB 3TVDA 4O2LA 4AURA 4A36A 4DB2A 3VU1A 1OLXA 4HKTA 4G1UC 1NXPA 2R8XA 3K96A 1NJ1A 2ID8A 4DQLA 1R4NA 2G6BA 4RABA 2VP0A 3LT5A 4AO7A 2CVOA 1PQYA 2XOKA 2RAPA 5HQJA 3C8MA 1KXZA 3N2EA 3N0TA 1UT8A 5MF6A 2RI1A 4Y6SA 3ODPA 3WK4A 2HHLA 2RD2A 2V74B 5T4EA 5AK6A 4GI2A 3TSAA 5BV2P 4ZYVA 2EFEB 2O8NA 1BXRA 4U8HA 2P9CA 1AZWA 2PMDA 3DEJA 4LTMA 1IZ9A 4U3JB 4WKPA 5EIOA 1YQGA 4TTIA 1N1MA 2C5FA 3VR2D 2CLLB 2DH6A 1CSEE 3JR7A 1ESDA 3K2IA 5BPHA 3QUQA 1T9HA 4B48A 1WHTB 2TYSB 5LA6F 4KFCA 2B35A 3K5HA 5C34B 4D46A 3MMZA 3EEIA 1TGYA 3ZGNA 2JFNA 2YICA 2WU4A 2I8LA 4L0QA 3WHIA 4ZWNA 4WI1A 2QXUA 2E49A 4PNEA 2BSXA 1U1FA 2HWKA 3BE4A 2FQQA 2A7XA 1V3TA 1ZD4A 4LDAA 2NZWA 1L5LA 4IW3B 3MS7A 1JQEA 3EDCA 3RS9A 1WETA 3RHFA 5C1OA 1BN7A 2IGTA 4RK1A 4OU4A 5K3AA 1EFLA 2IX3A 1L5SA 2K5UA 4Y2SA 4XUEA 4KX5A 5TJ9A 2YVLA 2KX7A 2ZI5A 3SC6A 3TW0A 3C5VA 2I66A 3VOTA 3U6KA 1YWGO 5KKAA 2IBTA 4PG8A 4E5KA 4WOJA 1FK8A 1DQZA 2JGLA 3K6KA 3CEHA 1K7SN 3H3FA 3N7AA 3NCTA 2B1GA 4J91A 3NDPA 2I34A 2QTVB 2D1TA 1W49A 3GBVA 4WPGA 1R16A 2FUG1 4X8MA 4YCBA 3RIEA 5K09A 4KITB 3O38A 3JPWA 2P9BA 4JYBA 2C2HA 1J99A 1YDWA 1ZKDA 4YCJA 3QF7A 2WDPA 3FPSA 3U0BA 3DQZA 1ZPDA 1AT1A 2XR1A 1P2VA 4J6FA 4XZ3A 5B3KA 3GY0A 4LHEA 2DFTA 3ZDAA 2PY6A 2WAOA 3KO8A 1NLUA 4ZRNA 5H7XA 3TLMA 5CVDA 3MW8A 3EIHA 4DMCA 3ELBA 4G81A 4IIHA 2EJWA 2QYSA 1XOIA 1GOTA 1FMTA 2I4LA 2O0HA 2DWCA 5AW2A 1Q83A 2AZ4A 3H5WA 4DLBA 4X7BA 1EMDA 1XMQB 3NBMA 3H11B 5JXGA 3P27A 2PNFA 4XRRA 5CNMA 5FX2A 3H18A 3DMNA 2BMEA 4LCJA 2R4UA 2OCAA 4TL6A 1L7AA 2ZS7A 3OFND 5ICEA 3KUUA 1QRDA 1Z4NA 4O1MA 2DJ5A 3KR1A 1AQIA 3ZXIA 2VRCD 4HWTA 1X7ZB 4IVNA 2NLOA 4E5SA 3RRBA 2GASA 1QRRA 4JC4A 4YPOA 4B1FA 3QX7A 3ZWBA 1EEXB 2WM9B 5EWMB 3KSRA 3TSYA 2OBXA 2JVJA 3GD5A 3UAYA 2C42A 1H9AA 4LZNA 2VHJA 4PZDA 4XEHA 1UIMA 5HF8A 3OHPA 1YQ9A 4XWTA 1A77A 1HE8B 2FEKA 1NTRA 2P30A 3BGDA 1AO3A 3ANSA 2L17A 2LIVA 1X7YB 3JAWB 5AESA 3OOEA