6YASA

Hydroxynitrile lyase from hevea brasiliensis, room temperature structure
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis.
pubmed rcsb
source organism Hevea brasiliensis
molecule tags Lyase
molecule keywords PROTEIN (HYDROXYNITRILE LYASE)
total genus 97
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 6yasA00
3IULA 1GKLA 4XX1A 1W4LA 2XMRA 4AO8A 5EHZA 3A2NA 3LS2A 3YASA 4FDMA 1XZKA 4YK7A 3JYHA 5AKEA 4YASA 1XZGA 1QIFA 3O4IA 5CXUA 4G4GA 3DS8A 4AQDA 5HF9A 1EH5A 2J3QA 4P92A 4MJ3A 1LZKA 3KDAA 5EHNA 4H18A 5LZ8A 2PUJA 1UK7A 2XUAA 3TEJA 4ZGBA 4K2AA 1K6EA 4G8BA 3FYUB 3ZLUA 4X97A 3AINA 5JYCA 1AURA 1BEEA 2V97A 3MUOA 3DD5A 4G1FA 1NX9A 3BF8A 1XZCA 2XUIA 4QLAA 3VVLA 1GQSA 3FSGD 3AZOA 4FBLA 3R3VA 1EXWA 4BE9A 1LPOA 3H17A 4UBNA 4E46A 2Q0XA 3VDXA 4EHBA 1YS2X 4CI9A 4ZV9A 4H7JA 1H23A 3VJLA 4BAGA 4N8DA 4BAUA 4CFSA 3A2LA 3AZQA 5JASA 1YCDA 3DEAA 3H1BA 1R88A 3DL7A 1TCBA 3H2HA 2QJWA 3LIIA 1WM1A 3I2HA 2OCLA 2Z5GA 3WZMA 4GEGA 2XUKA 3OPMA 3I6YA 1FFEA 5HF5A 3W06A 1SCQA 2D0DA 3EIOA 3VISA 5IVIA 1XRMA 2XMQA 3EQ7A 3H0CA 3B3QA 4QDXA 2HHAA 4B82A 2JGLA 3H04A 5JAUA 3KSRA 5BOVA 4W1PA 4MQMA 4PF1A 1E8NA 1GPNA 4OU5A 4GI1A 2BKLA 1VKHA 3I2IA 1MX1A 4D9JA 1L7RA 1VOTA 5DWDA 1G4HA 3WL8A 3WWEA 1W6RA 1BROA 1H2ZA 1H22A 1LPAB 4BC0A 2RONA 3VXKA 3QBJA 1SOMA 4I19A 4LHEA 3F96A 1O6GA 1QIKA 3PF9A 4Q05A 3HSSA 3BDVA 5T4EA 5JAHA 3BWXA 2BCEA 1QFMA 3C70A 5AHXA 1ISPA 1XQXA 1HPLA 5ALWA 1ZD4A 3QPDA 4EY7A 4PNZA 4C89A 3WJ2A 2CUTA 5DNWA 2X8BA 1YSCA 4PSUA 3QMWA 3FYUA 1JMYA 4DNOA 2XQKA 3DNMA 4F60A 1J2EA 5E2IA 1OILA 4CG1A 5HF8A 4XVCA 3WIBA 1JKMA 2XMZA 5H3HA 4WFKA 4AMZA 1DU4A 1WOMA 2HFKA 3Q0TA 3W05A 4K6GA 2VJBA 4G9EA 5FDFA 3IURA 5E4YA 2I3DA 4FOLA 2HDWA 4U2DA 3ESBA 4A5SA 1C7IA 2WFLA 1IZ8A 2C0PA 3PE6A 2HU5A 3D59A 3WKEA 4LKOA 4KE9A 3DQZA 1WHTA 5EIEA 2Z3ZA 2B61A 1K63A 2VT6A 1OCEA 3AJAA 4ARAA 5CXXA 1TAHA 1THTA 4C88A 4N5IX 1I6WA 5ALFA 4EA6A 3PFBA 3STVA 1ZICA 2JEZA 1N1MA 1TKRA 1QONA 1HL7A 1F8UA 3WWOA 4XJVA 2ZSIA 5IKXA 4J0KA 5K3AA 3HACA 4Y2TA 3SC2A 4BC1A 2OAEA 4GBGA 2XMGA 4HTAA 1IUPA 2QS9A 1MN6A 5D6OA 4BB0A 2AJLI 5DNUA 4UBMA 1HDEA 5CRIA 2C4HA 3ZLTA 4TPKA 2RGUA 2VTVA 1XZEA 5K3DA 4ZI5A 2AJBA 2XUOA 4L72A 1ORWA 2JF0A 3WWCA 1IUNA 1QIEA 5ALQA 2QR5A 1AX9A 4G5XA 2WJ4A 1H2XA 1JFRA 5K3FB 4AN1A 4K6KA 5CT5A 5LLSA 4NZZA 2O2IA 3QM1A 5CH3A 1E3QA 5LZ5A 3FVRA 4M0MA 2C58A 5AOCA 3G0DA 1MO2A 3DYVA 3W9BA 3EQ8A 4H7KA 1J07A 3O4GA 3C6YA 3K9BA 1CUAA 3WK9A 2QM0A 2QT9A 5K3EA 4BYMA 1LPBB 4RGYA 3D2AA 1XZAA 2CBGA 1N8SA 1CUSA 2OCIA 1E5TA 3STWA 3PF8A 2WHQA 2R8BA 3DCNA 2K2QB 1X2EA 4WJLA 2HU8A 5CT9A 5LP1A 3FYUC 4FTWA 4BDTA 1WB4A 2QUBA 4X92A 3C45A 2HU7A 3SX4A 1CUIA 1B41A 1ZJ5A 4Q82A 5ESRA 1XZDA 4UHEA 1CUWA 2CMFA 2WU3A 5ALUA 1A8SA 1EK1A 3G9TA 1XRPA 1EINA 1HQDA 1VE7A 2ZYSA 4EZIA 5KREA 4L9AA 3Q8WA 1J06A 2HL6A 4JYPA 3M83A 3DLTA 5AO9A 5T4BA 2PU5A 4LYEA 4RPCA 4FFWA 5K3BA 5AM3A 2XQFA 2WUGA 5FKJA 1R1DA 5FOQA 1ODSA 3C5VA 2DQYA 3CXUA 3H2GA 2GYVA 2E3JA 4E11A 4Y2UA 4I3FA 3U1TA 3VJKA 1FFCA 3EQ9A 2JEYA 2YH2A 4IHAA 2ACEA 4DGQA 1MTZA 5JAOA 1CUVA 4B83A 5AM2A 3O95A 3PFCA 1Q83A 3I2KA 2JGIA 4N5HX 1HLGA 3DOIA 3VJMA 2XUHA 1VJ5A 2Z8XA 3LP5A 4QA9A 2PBLA 2QXTA 3GZJA 3E3AA 1YAHA 5J3JA 5AOBA 4X7BA 3NUZA 4L0CA 1UK6A 4WFIA 1VZ2A 5DYTA 2BUBA 1CQZA 5KWIA 4BDSA 4IH9A 3WKCA 2WTNA 1TQHA 4B6GA 3ZI7A 3KOOA 4HZGA 5AKIA 2OPHA 1F6WA 5AKXA 2QUAA 5A7HA 2VT7A 2XT0A 2GBIA 5K3FA 3BF7A 2Y6VA 4K6HA 2JGFA 4DSAA 1L7AA 1XRQA 5AI5A 1UT6A 3FYTA 4CIAA 4EY5A 1FFAA 3WK4A 4WY8A 1MU0A 1W75A 2ZYRA 4GW3A 4DLNA 2G5PA 4BVLA 2QVBA 3FLEA 4JUIA 1U4NA 5AKZA 4OCZA 1JU3A 3GFFA 4KJXA 4QDUA 3VVMA 4UBKA 5HQ3A 5I8PA 1UOQA 5HK8A 1Y37A 3ICVA 4J0CA 4FLFA 5JALA 1MJ5A 2DHEA 2ECFA 1DWQA 1Z68A 4X91A 5AKKA 3WA7A 4GECA 4GXNA 5ISMA 3V1LA 2HIHA 2XQJA 3ED1A 3R3XA 2QMQA 4W1SA 1QJ4A 3I1IA 2VAXA 4UHDA 1IZ7A 4PV7A 2YASA 3H19A 2WHRA 2PSHA 3JWEA 2FJ0A 2WQZA 4RE5A 4U2EA 2Y2VA 5E4TA 5AP9A 5JD4A 1CIJA 4DSZA 3FVTA 3R3ZA 2VEOA 3KD2A 4AN0A 5ALTA 2XUJA 1R4ZA 1E8MA 4X85A 4OB7A 4UUQA 1DT5A 1N5MA 3WK5A 2Z8ZA 5ALGA 5DLPA 5ALZA 1CEXA 5BWCA 2Z3WA 1DX6A 1GT6A 5FRDA 2WFMA 1XRRA 2DHCA 3V1MA 2HRQA 4BVJA 3W2TA 3ZWQA 3DJYA 2G5TA 3TRDA 4MYDA 2C5GA 1ETHA 1UFOA 3WKBA 4KE7A 1LBTA 2J4FA 4FHZA 1CUGA 1P0QA 1QTIA 3WYDA 4EY6A 4MWTA 4JEIA 1UZAA 3STYA 2QRUA 5T4HA 2GZRA 3QYJA 1ODTC 1TCAA 4E15A 4I4CA 1QTRA 3STXA 5ALRA 4ETWA 4H77A 1K8QA 3BIXA 2WG1A 1VA4A 2I78A 4FMPA 1T2NA 2XMCA 1LPMA 4EUSA 4ZREA 3AZPA 5JADA 3G7NA 1CUFA 3FCYA 1XQWA 3IDAA 5C8ZA 1BN6A 2JGMA 4Q3OA 4GWLA 2CZQA 3ESDA 3JW8A 3PUIA 1QIGA 3HC7A 2H7YA 2WG0A 4TVKA 1ZIXA 3L1HA 4U2CA 1L7QA 3PICA 4J0IA 1B6GA 4DMFA 4X00A 2CJPA 4QDOA 2FJPA 4AXBA 1QO9A 1ZI8A 3ILSA 3O4HA 2OCGA 2OG1A 5LIPA 1CR6A 5EHQA 4KE6A 1UWCA 2WLSA 5D3KA 1ACLA 5A71A 3I2GA 2XUGA 5AKHA 3BXPA 3OC0A 2XUFA 2OGZA 1TCCA 4IO0A 3UUFA 1IUOA 1JU4A 3I2FA 4CIBA 1AQLA 4HRXA 4NMWA 4KRXA 1CRLA 1EB8A 4LYDA 4FFVA 4U2BA 4FLMA 1QGED 5C8VA 2H7CA 4GDMA 3ANTA 5T4FA 5ALVA 2Y1KA 1CUDA 2X76A 1EDDA 2VF2A 4XIIA 1UKAA 2G4LA 4DNFA 5CT8A 1HKHA 3FNBA 3D7RA 4ZV7A 2C5FA 5AK3A 3T52A 4H7FA 1XZLA 4QEKA 5CURA 2HA6A 5D7BA 4DM7A 1WB5A 5A7GA 2HA3A 4X6YA 3C6XA 2ZSHA 1JJIA 2O2GA 3IVMA 5CW2A 4J7AA 4X3CA 1YB6A 2XI4A 4BCCA 4W63A 5BV7A 5LZ2A 3IUJA 1FJ2A 5JAPA 4A23A 1X2BA 1KEZA 5FLKA 2ZJ6A 4EY8A 2QKYA 4KACA 4E14A 4WDQA 1JI3A 4Y2YA 1D07A 4X93A 4B80A 2G63A 2OGSA 2ZJFA 4MEAA 2IX9A 2O7VA 1LPSA 5AKYA 4KYVA 4EBBA 5CBKA 1ZJ4A 4BBZA 2WIJA 1UOPA 2WUDA 5JD6A 2JGJA 1DQZA 1UK9A 1R3DA 1G42A 5K3CA 1M33A 3P2MA 2X5XA 3MGAA 1U2EA 1QIMA 4NVRA 3I2JA 5AK6A 4ARBA 4OUKX 4FKBA 2VATA 2JBWA 4KE8A 4N8EA 4V2IA 3W04A 1E66A 4C4YA 3FLAA 4FWBA 1T4MA 2UZ0A 4J0JA 3QH4A 2B4KA 1CUZA 2OQIA 1EVQA 4X90A 4G9GA 3B12A 3QMMA 5ALOA 3L1IA 4UPDA 5EGNA 3IB3A 4YPVA 1LPNA 3IUMA 4X71A 3FWHA 3DL4A 1ZI9A 2HA4A 4Q3LA 5BWBA 5ALXA 5LZ4A 1OXMA 1JJFA 2XLBA 1DX4A 3KWFA 3IUQA 2BUAA 1S8OA 1W52X 1XKTA 4AX4A 1W76A 3H2IA 5K5EA 1K4YA 4QLOA 2WIGA 4QWWA 3G0GA 4LXGA 1GQRA 3RK4A 5CTAA 1GZ7A 2PX6A 3G0CA 2GBGA 1LGYA 3RLIA 3G9ZA 2W6CX 4AZ0A 4JH0A 1LNSA 4C87A 3FBWA 1ORVA 2HA0A 4Y9SA 3RM3A 1XZFA 1CUEA 1QIIA 2WIFA 3GELA 2PPLA 5C8XA 4QDTA 5AKJA 5SYMA 3STUA 3FSGA 4AMYA 1XZBA 3ZPXA 1AUOA 1QIHA 4UFPA 5AIBA 1CVLA 1SCKA 5LKAA 2CB9A 3FLBA 1QZ3A 5AM4A 1WPXA 4ROTA 2WKWA 2WFLB 3DDUA 4B85A 2WHPA 4IH1A 5HFNA 1MAHA 2RIPA 1XFDA 4QNNA 5HKAA 5A7FA 3WZLA 1VE6A 3GBSA 4C4XA 5I9IA 1ODCA 3ZV7A 4FBMA 2Y6UA 1ZOIA 2XLCA 2XMSA 4B0OA 1P0PA 1DWPA 1Y7IA 3LCRA 4JYMA 4X95A 1TRHA 1ZIYA 4Q3KA 1VLQA 2XUDA 4W1RA 4QE3A 5DYWA 3F98A 4DMHA 4O08A 3NWOA 5JZBA 4U2FA 5JATA 1AZWA 3V48A 3WKAA 2PKYX 3H2JA 3BJRA 2DR0A 3R0VA 2PU7A 1X70A 3WL7A 1XZJA 4Y2RA 3HYSA 2OAGA 4HRYA 5ALYA 2H1IA 3MUNA 4OYLA 2ZYIA 5AI4A 1KU0A 3KWJA 5AK5A 3ESCA 3AIMA 4KAAA 1GKKA 3B5EA 4G4IA 4UFOA 4DMKA 1BN7A 1JMKC 4LIPD 4X6XA 1CUXA 3CCBA 1IMJA 4Y2JA 4C6HA 4HVTA 2JGKA 2H9YA 3RARA 4BCDA 3C5WP 1BCRA 3G0BA 4Y7DA 4AO6A 2HA2A 1WCYA 3A70A 2WG2A 1R9MA 4RE6A 3LIPA 3R40A 5AI9A 2AJDA 3M82A 5FPPA 1YA4A 3CN7A 3QZUA 4BTVA 3S2ZA 5JARA 3G9UA 5AI0A 4Q1VA 5SYNA 2PSFA 4Z49A 3D4LA 2XMBA 1GGVA 1CUJA 3NGMA 3D2BA 4KRYA 1WB6A 2ZYHA 3UMJA 3HZOA 1MT3A 3M3DA 4BZZA 2WSLA 3NOXA 1ZD5A 5ALLA 1TIBA 4KAFA 4HXFB 4ZWNA 4RNCA 1XRLA 1VZ3A 1XZMA 3TJMA 1EX9A 2VJAA 4G4JA 3G9XA 2V96A 2RHTA 2PVSA 1N5RA 2RAUA 4H0CA 4MYSA 4UFNA 4DTCA 4W9RA 4BAZA 4UHBA 3WYNA 1XQVA 3WK6A 2DFPA 1XLWA 2VQ6A 2WJ3A 2PSEA 3D2CA 4PW0A 2B9VA 1QIDA 3K2IA 4J0DA 2BGRA 5CT4A 1THGA 1DQYA 2RI6A 2XMDA 3O9MA 4Y2VA 1UKBA 4J3JA 3D0KA 5CT6A 4G8DA 2W22A 5ALMA 2ROQA 3H18A 4DMCA 3A2MA 4QZVA 4GHWA 4BTLA 5ALJA 5E4JA 1K5PA 1CUCA 2V98A 2QXUA 3WA6A 1QE3A 3C6ZA 3STTA 5ALEA 3WL6A 4CCYB 1JT2A 5LYYA 1CUBA 5AJHA 4BZWA 4IH4A 5EIHA 3N2ZB 4B81A 2WTMA 4H7DA 3BDIA 2DHDA 2VJCA 3HXKA 1BS9A 1UK8A 5CH8A 1E89A 3W9UA 1QOZA 4ZXFA 4BRSA 4L3WA 5FV4A 4JNCA 3QPAA 2VAVA 1ZI6A 1YB7A 3ICWA 3QVMA 4P08A 4PSCA 5EI5A 1U8EA 5LKRA 2BJHA 3E1GA 5DTIA 3M81A 2C7BA 2IIVA 3WJ1A 5AM1A 1ZD3A 4Y2XA 1AKNA 1SFRA 5EHXA 5A2GA 2GBFA 2WJ6A 2D5LA 2EDAA 2DCMA 4OB8A 4CG3A 2YYSA 3WWPA 3U0VA 1KU6A 1LBSA 3AIOA 4LXIA 1CUUA 1LPPA 4MWSA 1DT3A 2FX5A 1MAAA 3I1YA 1MNAA 4CCWA 1A8QA 1VA5A 3AFIA 4UHHA 1H2YA 3OG9A 2H7XA 1WHSA 1BU8A 3RKSA 5AH0A 2PM8A 1UXOA 3VKFA 5HQ3B 1EI9A 4AZ3A 3WLAA 3WIOA 1FSSA 1ZD2P 2P8SA 2Y2UA 3N0TA 4BP8A 3E0XA 1IVYA 1R50A 1MX5A 3H1AA 4MXDA 2WUFA 2WU4A 1RWQA 3CN9A 3C6BA 3I28A 3IIIA 1BRTA 4X94A 1EA5A 4BP9A 1LLFA 3BJMA 4HXGA 1XQYA 4QDZA 3PUHA 1LZLA 4S0XA 2ACKA 5DYYA 1UOOA 5HZGA 4BCBA 6YASA 2HADA 4XWGA 4BATA 4OU4A 4OD0A 1PJAA 1Y7HA 1P0IA 3DOHA 3S8YA 2VA9A 4K5QA 3QPCA 1RP1A 1UKCA 4UBJA 5FUMA 1F0NA 5AKGA 4AO7A 4PO3X 2CEKA 2QTBA 1MNQA 4G8CA 3G0IA 3X3HA 5LZ7A 4HXEB 2ZVDA 3KXPA 4B0PA 5F4ZA 1YS1X 3AILA 1XLUA 5AIAA 1EB9A 3FAKA 1TK3A 3GROA 1U65A 5AKLA 4KEAA 4WY5A 2VSQA 2WIDA 4H35A 1NU6A 5A62A 4F21A 4J0HA 1GPLA 4J0GA 1CFJA 1W1IA 2HRRA 3OURA 2HA7A 4DNQA 3WK7A 1YA8A 3C43A 5JIBA 3H2KA 1DINA 4H7HA 5ALHA 4HS9A 4KAJA 2ONCA 2OLEA 1XZHA 1AGYA 3F9CA 2OQVA 3DKRA 3V1NA 4YX9A 3UUEA 1SC9A 4FLEA 3WKDA 3BE8A 4UBLA 3V9AA 3MVEA 4CCYA 3AIKA 1A88A 2PUHA 4QWMA 4J03A 4OSEA 2EEPA 1XRNA 2JGEA 1QO7A 4DNPA 5D3ZA 2NW6A 2PL5A 1Q0ZA 2VJDA 3R3YA 3TGLA 5FPQA 3F67A 3DKKA 3OOSA 1ACJA 2B20A 4WCVA 3ANSA 1CQWA 1XKLA 4B9AA 2V9ZA 1RYYA 1GXSA 1H2WA 5ALKA 7YASA 4H7IA 4WDRA 4CG2A 4UHFA 3IBTA 4DYHA 5HKBA 2XB6A 1EK2A 5AM0A 4INZA 1A7UA 2LIPA 3PI6A 2AJCA 2XUQA 5JZ9A 5FP0A 4LXHA 1AMNA 1EDEA 2GBCA 1G66A 2HA5A 4B7ZA 1XZIA 4BE4A 2WFZA 4X6UA 5DJ5A 3R41A 2IITA 3PDCA 1F0PA 3O9VA 2C0QA 4MQLA 1A8UA 1C4XA 3WI7A 3QITA 3BL8A 3T4UA 3F97A 5FXMA 5AOAA 2ORYA 4OB6A 2GYWA 3WQHA 5C7YA 4C01A 1VXOA 5JD5A 1XLVA 2DQZA 4TGLA 5CMLA 3WMRA 5I7UA 3R3WA 2BGNA 1CLEA 4Q34A 1CUHA 4AB1A 3EF3A 5AM5A 3LLCA 1MPXA 2PSJA 1J1IA 2O7RA 2WUEA 5ALSA 4WFJA 2GZSA 5JANA 2HM7A 2AJ8A 1EHYA 3BIWA 4MEBA 5LZ9A 1JJBA 2PSDA 2XQIA 1C7JA 2XE4A 4FNGA 1ZGBA 4ZRDA 5HCUA 2R11A 4PQEA 2DSNA 2CKMA 4OPMA 1FFBA 3G8YA 3FOBA 3HABA 1O6FA 1Q84A 4C4ZA 1DWOA 3OTQA 4N8SA 5ALIA 1CUYA 3HLKA 4F0JA 2GYUA 4EB0A 5IH7A 4EY4A 4M0FA 1CV2A 3ZLVA 5JZSA 1BEZA 3HEAA 1EDBA 3QMVA 1FFDA 5C81A 4A16A 2OXEA 1QLWA 5ALNA 3WK8A 1R9NA 3SWWA 1QIJA 2BUCA 2AXEA 3HRHA 5EFZA 3G02A 1G5FA 5KBYA 5IVDA 4Y2PA 1P0MA 5AK4A 1ZGCA 2J4CA 2YXPX 3R3UA 2BAGA 3OM8A 4W1QA 5KWJA 4NS4A 3O0DA 4U2GA 5HK9A 3I6ZA 2XQGA 4DIUA 3HI4A 4BRZA 4M0EA 3AUKA 2I3ZA 1NU8A 3E4DA 4PSDA 1BE0A 3L1JA 1YR2A 2I03A 2WHPB 4ITVA 2RHWA 1HBJA 3CCCA 5IVHA 3A6ZA 2EDCA 3O4JA 2HFJA 1PV1A 2JIDA 2OCKA 1XROA 2WIKA 1USWA 5AI8A 2BFNA 3C8DA 3HJUA 1SCIA 1PFQA 2QOEA 3ESAA 4Y2QA 3WWDA 5YASA 4F5ZA 1VXRA 3DYIA 2FUKA 4BVKA 3FCXA 4B84A 1DTEA 2WM2A 4UBIA 2QZPA 1YASA 5ALPA 5HF6A 4UBOA 2J3DA 5IVKA 1BCSA 4OYYA 3D5EA 5DNVA 5CH5A 1Q0RA 1AC5A 3V1KA 1QFSA 5A6VA 1CPYA 2ZJ7A 3EBLA 4GLBA 5DTJA 3I6MA 4HAIA 4Y2SA 3C87A 2O2HA 3F8SA 1EVEA 2OGTA 3WL5A 1GPKA 2WILA 2XDWA 3IA2A 4B9EA 5AICA 3IUNA 5EIAA 3K6KA 1E8DA 4P93A 4UHCA 2QJRA 4FNMA 2ES4A 4IQ4A 3SK0A 3GUUA 4P9NA 4H7EA 1MX9A 5HFAA 5AI6A 3C8HA 3GA7A 1WPRA 3D3NA 4KR0A 2XUPA 1YAJA 5ALDA
chains in the Genus database with same CATH superfamily
3IULA 4ND7A 3ROTA 3V3TA 4LVCA 4AX8A 2VRWA 1F7UA 2PQ0A 3D3WA 4XX1A 4A0QA 5H1YA 4R2XA 3QKTA 4QOFA 4E3ZA 4LEIA 3RADC 2UVPB 4MKFA 3OBIA 5I6DA 2B1IA 2PCLA 3GVIA 1N2HA 2GWHA 1RWVA 4R01A 2PT9A 4X7PA 4F56A 4J94A 4CKEA 2JJ2A 3TNYA 3A2NA 2VBFA 1GRNA 3YASA 1DJPA 3M2TA 3NHAA 4UE3S 4EGSA 4JB3A 2IYLD 1HYBA 5CLFA 4U00A 4MAAA 4MKRA 3AVQA 1C2YA 3LGXA 4ERXA 2EIHA 4J1TC 2DECA 3KSBC 3IUEA 5DE3A 2X2PA 4FGLA 2HXYA 4KO2S 1QIFA 2B69A 3N86A 4RQBA 4I5EA 2GHIA 4HY3A 1MOQA 5IXJA 1J5XA 3T4EA 2A14A 4KB5A 3ZXYA 4YUWA 2IBSA 3K1AA 3N87A 4F85A 2JAHA 3S2UA 5LZ8A 3W5HA 1J49A 2H00A 2JI4A 2CV0A 5HOQA 1UINA 3X2FA 1IK6A 4C76A 1IXSB 1UK7A 2FYTA 821PA 3SN6A 3TLMA 1MH9A 2V7BA 3MSCA 2IXDA 4AUKA 5SZJA 3FYDA 3M6VA 4FXOA 1WD7A 3EZ7A 4W5HA 4Y0AA 3ZWDA 1PQYA 3ZU3A 4LMRA 2IF0A 4X97A 1GQQA 4NCHA 3WGQA 2B25A 1HDOA 4G4SP 3WVNA 4XGRA 4MUIA 1NQTA 3VJRA 4L7QA 1T3SA 1WY5A 2QE6A 2XOKD 1DXYA 1U9CA 2YBDA 4HWSA 1OC2A 4OQEA 3T4XA 1IEVA 3CZMA 1HOTA 3AF4A 1ZMBA 2J87A 3MINB 4O4LF 1JHMA 2VPTA 4RHTA 4UTNA 2Q3JA 3PQ7A 1ABEA 4D02A 1ISGA 1PT9A 3ROPA 2OYCA 4ZGGA 2VPXA 5FFFA 2PXXA 4XSGA 1XXHB 2JFVA 2LTAA 2QI9F 1GQSA 2WOJA 3LUFA 1X80A 3LT4A 3FSGD 3R5TA 3RTDA 3DMTA 3DZKA 4FBLA 3I9LA 3RQSA 4E13A 2QAGA 2ILTA 4Y1RA 5C5IA 4M1SA 4G85A 2WAYA 1J9EA 2HTEA 4RA9A 2GJSA 1D2CA 2NU7B 3AJEA 3T15A 3VH3A 3WLKX 4BE9A 2JLYA 1EWYA 2BKAA 2QYTA 3HWWA 1LPOA 3H17A 3VV3A 3AVYA 2CNKA 2YWRA 3ZHCA 4FR5A 3VDXA 5THQA 2IOFA 1FDUA 1SUWA 1TQDA 3M5DA 3PITA 4KQWA 4O2AF 5EP1A 3TIIA 3DPIA 4CKWB 1NDHA 4MQUA 5KEIA 1H23A 4KQJA 1PJZA 2W6JA 3QWFA 1WNFA 4FEYA 5IASA 4N8DA 1I7SB 4CFSA 3UY4A 2YFYA 1VKZA 2GCEA 3HCFA 3WL3A 1FP6A 4G5GA 1YS6A 4DCGA 1QNLA 3AZQA 3O21A 4QYSA 1OAAA 2RHJA 1G2IA 1OTHA 2XNHA 2ZYTX 3G89A 1L0BA 1ODJA 2X58A 3QOWA 4FSHA 1TCBA 5LA6A 3OQNA 2QJWA 3I5YA 5AXCA 3UMVA 4OGLA 4ER6A 4I1VA 3NEYA 1T9CA 2QY6A 3ESQA 5C51B 3ZXXA 3I2HA 3Q2IA 4EI2A 3E5RA 5AVQA 4NYJR 1EDOA 1XCPA 2Z5GA 2JIRA 3EZFA 2HPAA 4HDQB 5GY7A 3HCPA 1FU4A 5I8WA 1H9BA 2A0WA 1NG1A 1FP7A 1W34A 4IIJA 5I5GA 3WZMA 1KQOA 4Q4JA 2Q07A 1QM5A 2YVKA 1KJ8A 3ASUA 1Z07A 5HM8A 1G18A 2ZB8A 5CX4A 2D0DA 3LBFA 4PO9A 1XLTA 2UYYA 1QTQA 2FDCA 4IHJF 3E9ZA 1XRMA 5DNDA 5FBRB 4GLLA 1QHYA 5FBZA 1V4VA 3U7EB 1DAIA 1T5LA 1Y1KE 4UVDA 1RYZA 1J23A 3C16C 4M49A 3E3NA 3EBPA 3FGNA 3D7NA 3LYLA 1EK6A 2FKNA 3L7CA 4L0MA 3L8ZA 5JAUA 1UXKA 3E9QA 3KSRA 3JATB 4HAYA 2QEQA 5FAXA 2W6ID 3DWEX 4LHXA 1GPNA 5B3LA 4QUBA 1E69A 1XR3A 1IPHA 2MMGA 4FNAA 1O6CA 4H1HA 4LXUA 1Q50A 3PNQA 3PX3A 4PX9A 4OGWA 4C7JA 2E4AA 1EWTA 2H4FA 2HEIA 4DRZA 3QG1A 4MVJH 3EXEA 2YJ3A 1K4KA 4J9VA 1P73A 1GGFA 2BBWA 3BTSA 4B73A 1L7RA 2VS1A 1B76A 4CMHA 1N9KA 3BXHA 3IKMB 5F3WB 1G4HA 4J7CA 1OZ0A 2X3UA 2IUTA 4M46A 3BC1A 3BGOS 3FPBA 3TXAA 3URMA 4FS3A 1JHVA 4I6GA 4RBNA 3ZXIA 4GBMA 4XJSA 1ZIOA 4FFNA 4CQJA 2BEVB 4RS3A 5KYNA 2RONA 5CYGA 4XYMA 3IR7A 2B34A 4TSKA 4LDNA 5ED0A 5GONB 1I0IA 3PF9A 4HAXA 1NXTA 3Q3GE 1U63A 1P6QA 4F5YA 4GYWA 4R1TA 3UICA 3WNBA 3BWXA 2BCEA 1QFMA 3EGOA 2WVHA 3LX6A 2ZETA 5KTTA 2C1EA 2VQDA 1DE0A 1FNCA 4DJDC 5BW8A 1NLUA 1YRYE 3GI1A 4TYMA 3GT4A 3P9SA 4MA4A 2WP8J 3I42A 3KEQA 4MNTA 4C89A 4DUYB 2V0CA 2X8BA 2I54A 5AXAA 3SZRA 4OJKA 2FPRA 4IGAA 5FUWA 4TUYB 5JNRA 2ATVA 1VLJA 2RJ3A 4PLGA 4YRCA 3HCRA 4PSUA 1BYUA 2XAAA 3ILHA 4RA6B 4BB9A 2PEYA 1JMYA 1LQTA 2B8NA 3BSWA 3GRKA 3I0NA 4GUAA 2M6KA 1CQIA 1JQLB 1X7YA 3W5IA 4D9NA 2NU8B 5LMNB 1G0OA 2ECKA 1E20A 1UBLS 4HH1A 2Q21A 3DWIA 1TQ8A 4CG1A 1RLMA 2WJZB 4BEVA 1UP6A 1JX6A 4LJ6A 4OKNA 3KV3O 1HQYE 2GN0A 3DR5A 4DR2B 2R1UA 1RQRA 4IDNA 3ICQB 2ANBA 4TROA 3AHJA 1M2KA 5BSTA 2R1TA 5DCUA 3N2YA 4XYGA 3K0CC 1FW6A 2FN7A 3DE5X 3Q0TA 4M1MA 1CVRA 2IZ7A 1NQ5A 3HYLA 2QPOA 3O8BA 1EWRA 3I9JA 3LWNA 1EJ2A 1VE5A 3GT0A 4ENVA 5K9ZA 4FOLA 3OT1B 1LK5A 2J09A 1EFHA 1WZNA 2CD7A 2HDWA 3ROEA 2PRJA 5DGCA 3FI9A 1WXEA 2AFHA 3OHMA 4AF7A 5I47A 4S1PA 3S2IA 4Y8VA 4RJIA 3BB1A 2WFLA 2X7HA 3BMOB 1OFUX 1JLKA 1H0KA 4GDFA 3ZS8A 2OBBA 3PA6A 1GYPA 5HTKA 4YJ2B 4MYUA 3ZXUB 3O2SB 4PBTA 3RVRA 1YQTA 2IEBA 4O5AA 1LU9A 3B1ZA 1KJ9A 3DQZA 4KE9A 3DCIA 2V6JA 1W88A 2PJDA 4HGZA 1KO4A 5EZ5A 5FL3A 4CLEA 2QN6A 3C8ZA 1RYFA 3GJ7A 2ZKLA 1XNRB 2AXPA 3U5ZB 1E1LA 2X2FA 1L4FA 3QWIA 4KBGA 3HP4A 3KJGA 1YQDA 5CXXA 2QSUA 4FE3A 4HTFA 4KGZA 3KHSA 2GESA 4MTCA 2UZ1A 4C88A 3U4DA 4EAQA 1I6WA 3GYBA 4OMCA 2VKTA 3UHPA 4JJ4A 3QKUA 3JYNA 4ISBA 1L5RA 4WK2B 1TA0A 4CNBA 5A5EA 2EATA 5JCXA 3PFBA 4OI0A 3B7WA 2XBLA 4NJMA 1KMQA 4YQEA 4YJ3F 3LKBA 4OFXA 1TKRA 3R0QA 1QONA 2AD5A 1RJDA 4N3GA 2W42A 4A4DA 3QSYA 5J59A 1WQ4A 2XKAA 3NEAA 3B1XA 2Z58A 3NOQA 2QE7D 3NT4A 5G02A 1XTKA 5EQJB 4C14A 4J0KA 5K3AA 4H1WA 5CFNA 3RQIA 2C0CA 1JAIA 4TSFD 3HA3A 3TXXA 2NXJA 3B1FA 2O50A 1NFRA 4IW3B 2ID4A 2XMGA 3PRKE 3ZBTA 3VMFA 3LOUA 3B2QA 2VQSA 4IHKA 5JAIA 1IZ0A 1BWSA 1PW5A 2QS9A 2HHLA 3NUQA 3O83A 1MN6A 2VHUA 3NWEA 1Z2PX 3HBLA 3PC4A 3R5JA 4W8HA 2PJUA 4JP2A 3WHKA 2X0DA 2AJLI 4F1KA 5DNUA 2VKQA 2I2XB 2ZRKA 1KSGA 1G20A 1KPGA 5MFPA 2NAFA 3WWZA 3BQ9A 4BPBA 4BGDA 3DWGA 4RY2A 5AW8A 1NPDA 3NATA 1M7BA 2CF6A 3KSZO 5GINE 1OH5A 1FDRA 1OXKB 2GAJA 2VVTA 1I4EB 2XYHA 3ZY5A 1CQXA 2MR6A 2G4VA 2AA3A 2B9EA 5KYYA 2OXCA 1MUUA 1TMKA 4GPD1 2JZNA 4RK1A 4N5MA 2IUSA 1XTSA 2VAPA 3UK7A 2XUOA 2XNSA 2V6GA 3BXFA 3QLTA 3RV4A 4QBTA 2H29A 3MIIA 1ORWA 1XCBA 2O8NA 4FM9A 1AMUA 1C1DA 1JT9A 1P17A 3IMGA 4PQEA 2HBQA 3H2ZA 3QXXA 3WWCA 4AROA 4O1MA 1EGVB 5A4KA 3I12A 2TMGA 3K8YA 1IUNA 1QIEA 3ND7A 4MW9A 5ALQA 4MIEA 3VHLB 1OYYA 3LBAA 3T7SA 2Q6LA 3X1ZA 1J0AA 3HU3A 3OKFA 2A3NA 2PX2A 1Z0AA 4ZT6A 2BGWA 4KCGA 1ZD8A 4MW4A 2J08A 2P4QA 4JD5A 3OQHA 4I3GA 4YH1A 2Q7DA 3WHPA 4XDYA 1JFRA 1JEAA 2ZRFA 5CCEA 2VG8A 3IMEA 4RVHA 3F6YA 5K3FB 3RFUA 4AN1A 1O94A 4UVEA 4K6KA 4PC6A 2IYVA 5FHRA 3LQYA 1AKTA 2O8CA 5EMNA 4A0SA 3A14A 2ERXA 3MCTA 3NHSA 4NZZA 1CTQA 2QNIA 3LT0A 4WXYB 2QRKA 1E3QA 2C5SA 2WMOB 2Z5VA 5CB0A 2RD2A 2WYWA 3CH6A 3DMNA 5DWVA 5LZ5A 4BZXA 1ZD1A 3NVKI 3M3PA 3PC8C 3FUVA 3W7AA 1H6DA 4NABA 4X6LA 1XA0A 3F78A 3MTBA 3JASA 3ZHOA 3EQ8A 1IZYA 2AG5A 4OHMA 4EENA 4KIGA 4TRJA 3B6IA 3MT9A 2GZDA 1OSNA 4L3VA 4Z8XA 1GOTA 3RIEA 3FBTA 4DCJA 4XGQA 5FOTA 5CDUA 3T1TA 3WK9A 3GEMA 2PAFA 1Y3FE 1ABBA 2TSYB 2QT9A 4IAOA 2D0OB 5KWEA 1TFUA 3IHTA 2YVLA 3JYPA 5JS2A 4A8PA 5C2JB 4RGYA 4LI3X 5IWAB 5TY0A 3T0IA 1TZKA 4N5LA 4V39A 3KHTA 2L17A 4PZYA 2F1RA 4REQA 5DM1A 4CM7A 3G0HA 2ECOA 2OCIA 3F3KA 1QFXA 5IKOA 3KYJB 4PXYA 3ADCA 3ON5A 3ZWNA 2R66A 4HPXB 1JA1A 1Q6ZA 4ZV4A 2B7LA 2JHPA 4PC2A 1GSIA 5IN5A 5A0VA 2F3TA 1KH2A 5CNIA 1MX3A 4TL7A 4PHTA 5CUQA 4RADA 4BDTA 3IAS1 2QUBA 5KYUA 2EZTA 4OHUA 3DH0A 1Z74A 4MW7A 4WPGA 4QGGA 2J0QA 2VZ8A 4BO5A 1CUIA 4OGKA 1NBHA 1JUDA 1W96A 2IC5A 1M66A 5J40A 1O94D 2VDKB 1OT5A 4JLVA 1IN6A 1KE1A 3WGTA 2OCAA 2G5CA 4Q82A 5ESRA 1ORIA 3DXXA 4ZQEA 1XXLA 2FFHA 1EFDN 4PWYA 5T3YA 3HUTA 3ESZA 2CT8A 4QL3A 3TTXA 1FNDA 4XTRA 1N2SA 3CXRA 3LQ2A 4HQNA 1VMIA 1VBMA 4IWNA 4R2KA 5I3ZA 3ETDA 3RABA 1QBGA 2ZP1A 2W6QA 1PJ4A 1E6CA 1IJKA 1R0BA 1X1CA 3MQ2A 2R1TB 4D92A 4TV9B 3TIGA 2Q5EA 2GZ2A 1UBJS 3U6BA 2CVPA 3UWSA 2HQBA 5F21A 4AJ4A 4FW9A 3UOAB 1Y4ZA 2Y0BA 4I46A 2JATA 4JYPA 3D6FA 3N58A 5DGHA 4CCSA 5C80A 1XKXA 2PQMA 4HUTA 3Q8LA 1JJ7A 2NVUB 4OJNA 5H5JA 1RWMA 5AO9A 2I7DA 2BM1A 5T4BA 4NCAA 2F1JA 4BMYA 2IXGA 2PU5A 4QD3A 1LDNA 2ZG6A 4TTVA 1NP3A 2UAGA 2ZR8A 2MTBA 4IIJF 3EEFA 4RZ3A 1LK7A 2Q28A 3VDQA 4Q9IA 2NP7A 1IH8A 3H1FA 2ASEA 1PJBA 1XD9A 1E4YA 4FFWA 4WNIA 1EQUA 5AM3A 1RHKA 3H9BA 5GWXA 4F12A 2OZEA 1J1ZA 3O8CA 3DR3A 5AXBA 4YR7A 4RTJA 3HY3A 3RRNA 2B3TA 2D5IA 1SVKA 2B30A 2ZYWX 3X1XA 2WUGA 2W0SA 3QBDA 2EEZA 4KXNA 4XQ0A 4B3TB 2D5AA 2X15A 4JMPA 3URKA 1H05A 1UEIA 1UDWA 4HTFB 1U81A 3SHFA 4I8DA 5T57A 2OHHA 5CITA 4E07A 1AD2A 1MOSA 4BV3A 4ZQIA 3H2GA 3C85A 3GPLA 4IOJA 1ES9A 5FLYA 5HIMA 1R8XA 3ZQ4A 4KQHA 1VIMA 3A04A 4MS1B 5L6LB 1DARA 4NBKA 3QV2A 3HJCA 1ZXLA 4EL0A 4US2R 5KX5A 5GADl 2FPXA 1CZLA 2Y71A 2VXCA 1CUVA 4P86A 1V16B 4D4GA 3OQIA 1RXEA 1Z5WA 5D5HA 2PUTA 2OLKA 2QLLA 5IARA 5DM4A 1IULA 4D4MA 3SMVA 5AXDA 4PZ0A 2J3JA 4EHNA 3AEKA 4EO9A 1XI2A 2R25B 1A2QA 4JLNA 4L73A 1HLGA 4BBJA 3DBRA 2J0UA 1NBIA 5EA2A 2F3UA 2XUHA 2GERA 2FCRA 2W00A 4ZCSA 3KQMA 4KPUB 3GEIA 5L40A 3AUUA 1JMVA 3R7DA 4OLFA 5M5BA 1OY1A 4Z54A 3JRWA 2OBXA 2ZVPX 4XVHA 1TM5E 1WULS 4LQDA 1LRLA 3NBYC 1PNVA 1S8AA 4KXVA 5J4VA 5LQRA 2WKQA 3V80A 1JI0A 3M4JA 2HT1A 4FYWA 3IPRA 4PQRA 4D8XA 1OHHA 1A2BA 1VZ2A 5T8KA 1GPBA 1L2TA 2M6RA 3TCKA 3RANA 1CQZA 3LW7A 1GQFA 3PHHA 4O59O 3P5SA 2YFHA 4RVGA 4XD2A 5JSKA 3SY8A 4PCLA 3OQVA 2I80A 4R1SA 3SSNA 1PZEA 2FGJA 5KWIA 2I9PA 3GJZA 4GUDA 4MIOA 1KS9A 3Q1KA 1G3IA 3NTVA 4TS9A 2NZWA 4KK4A 3TGWA 4YV2A 1MC4A 4COKA 1RIIA 4R5HA 2W2VA 4MHSA 3IPXA 3NH6A 4FGUA 2W8ZA 3KOOA 4TLMB 3RG2A 5AKIA 4BV9A 1F6WA 4FI3F 5AKXA 2DFDA 4NXNB 4R4JA 3K32A 3FKSA 5HYVA 1Q7BA 2VHWA 3WMXA 4PX5A 2LIVA 3EW9A 2RKBA 2VT7A 2C7OA 4K6OA 1NRWA 5K3FA 1SUCA 1XN1A 4P32A 4AULA 4NU5A 5KAMA 2Z9BA 4WCFC 1EX7A 2P5YA 2CXNA 4RVDA 4FEGA 4LE2A 2KW5A 1P7PA 3H9GA 1KK0A 3MM4A 2F62A 4RU1A 3R74A 6GPBA 4OXQA 3UH1A 2Q46A 3KSUA 4PIVA 1AK9A 4LPSA 4G81A 4DVJA 2O48X 5AI5A 3FCAA 1UT6A 1QSGA 2A5DA 2JAOA 2ZBEA 4CIAA 1SB9A 3HUEA 4EY5A 1FFAA 3WK4A 4EH1A 2NTVA 1QBKC 3QU9A 1H5QA 4JIGA 5ICEA 3L7YA 1XMOB 3FPAA 5HZHA 1MB2A 5SZHB 1W75A 1OIXA 3QTBA 5BVGB 3GCGA 1X15A 1JAHA 2PT6A 4MWZA 3H2BA 1SCNE 2QVBA 3A9SA 1DBSA 1QKJA 1WCV1 4PO1A 1JE1A 2XADA 3FLEA 3VC1A 4D79A 2C29D 5JZVA 5AKZA 2C3UA 5EESA 2I7TA 2FLKA 4GWGA 3WQSB 3ZX4A 3Q7EA 2WZCA 4TWJA 4F7DA 1S2LA 1SC6A 3ESRA 3W7BA 5KTYA 4QDUA 4ZKEA 3MFYA 2ZB3A 5ICSA 1V95A 3DMRA 5JLJA 3F8TA 5EPEA 2IKQA 4LC9A 3MMZA 1XP8A 4V1CA 1B6TA 2H4JA 2FSPA 4OFZA 4YTEA 3TR6A 3GLIB 1XVTA 5DGTA 2R1VA 1NY6A 2QL7A 4PZDA 5I9NA 1NG9A 5BMOA 4WLOA 4TTJA 3WOVA 5UKDA 4QTYA 5EIWA 3QYPA 4MV8A 5A4AA 1KI8A 5B4UA 2GNAA 1XHLA 2L69A 3RODA 5DGIA 4Z1MD 2X2OA 5TV2A 3PUXA 2HGZA 5ERGB 3M9XA 4D98A 5IBCA 2NZ2A 5L3SB 1PCXA 3P4XA 1E2KA 1I7QB 4GECA 4GXNA 2XCRB 1B43A 2DUMA 1JLHA 5EJEA 3MC1A 4NWIA 3BE6A 3E81A 3F4BA 3U7RA 4RSMA 1RWXA 1XMVA 2QMQA 1KQNA 3PCTA 4GLOA 4NAVA 3KB6A 4W1SA 3HB7A 1M8GA 4UHDA 1QVAA 2IVFA 4RORA 3SX0A 5BT8A 4PCVA 2X1VA 1JWBB 4IIYA 4A0GA 3I0MA 5EVCA 2RHMA 4CTJA 2ZYDA 5B4VA 2WK1A 5BYJA 4DRXA 1Y3CE 3GZNA 4KKVA 1V71A 2ZITA 1BOOA 2EBWA 2VDWB 1W5SA 5EJ4A 3SVTA 3WGUA 4LV5B 5CA1B 3AO0B 4BKOA 3QMPA 2I5PO 4JEHA 2K6GA 3CINA 4JUDX 2WQZA 2MSCB 1B26A 5BWMA 3OPYB 1WETA 1YRAA 3FTEA 2O2XA 4MGYR 3AVPA 3HUUA 2GHRA 1DKRA 4ML3A 3U62A 1DKPA 1FYWA 3SE0A 2KLBA 3V6LA 1N34B 2G28A 5AP9A 4LZZA 1FS5A 3KKKA 4DSZA 4GR9A 2P67A 3ZV3A 3TWOA 2HUPA 1NMQA 2VEOA 1BSVA 3FPSA 3LPLA 4S1NA 1E8MA 3BILA 3D5TA 1K5HA 4JGBA 1CY4A 4TLDA 4B79A 1YS7A 3CJQA 1QAMA 1N5MA 2QTMA 4EO7A 4ETNA 1PWXA 2Z8ZA 3WK5A 1PIWA 1R0KA 1YUMA 5GZ6A 2DC1A 1PEDA 2IKSA 5FNVF 4N9QA 1L5FA 3E7WA 4X5OA 3FWKA 4QPDA 4DLWA 1SUAA 2GK7A 3O93A 1DX6A 4Z1MA 4N3CA 2NO9A 1RWNA 3UM9A 3Q8XB 3N6VA 4TLCA 2DHCA 1E3WB 4BNHA 2XA9A 2Y8EA 4MGIR 3BZUA 5JRDS 2X77A 3OZSA 3ZWQA 3D6TB 1TZ2A 3TRDA 1Z3IX 2DFTA 3S28A 3TUJC 1ETHA 2IZ5A 5BNIA 1OFHA 2YV2A 3UC5A 3WKBA 1LBTA 4AJHA 1CSEE 1QB7A 2C2ZA 1G21A 2QTVB 5KX5B 4WNYA 4FHZA 1KAQA 1HDZA 4PX2A 4TUYF 3KQQA 1T8PA 3WYDA 4GX5A 4AJ9A 5A9SA 1TU3A 3NIFB 5D8DA 1KJZA 5KMGB 3CX3A 4B74A 1A82A 1J39A 1EP2B 1N5KA 4YI5A 4ER5A 4KJZA 4URHA 3HYCA 4BNXA 1E2HA 2XD9A 3JR3A 3QVGB 3KOYA 3EXFA 4LHWA 4UUBA 4YLGA 4E15A 3HBNA 4DKJA 2XECA 1R12A 4L4RA 2Q7OE 1P75A 5JCJD 3UGQA 3T1NA 1JIQA 4JQYA 2PL3A 1QDUA 5A5DA 4TLEA 2ZJ8A 3ZCPA 4J9UE 1SPBS 4BFWA 2C04A 1DQSA 3LDGA 4MP8A 1EQ2A 1VG1A 3GVPA 1YK1A 3ORHA 1U8XX 1E9RA 1Z37A 2B1GA 3DE3X 3MCUA 4JQSA 5AJXA 1Y4SA 1T2NA 1NUHA 4C7MA 1XWFA 1HFWA 1K7XB 1KL7A 4GAEA 1TO6A 3OETA 1KFEB 1KYXA 4N01A 3EX7C 4NESA 3UJ7A 4WACA 3TDKA 4TYNA 4X0EA 4HBZA 2WU1A 1A8PA 1MGPA 1DLIA 4TT3A 4ZREA 1N7HA 4XR9A 4TRNA 3TR5A 2PKCA 2VYQA 4MVJE 5JADA 2XRMA 2GYYA 5F2NA 2GQ0A 1WBDA 3H9EO 4NBNA 3A26A 1VGQA 3TE7A 3PL5A 3AEXA 5BNWA 4HVAA 1NIJA 2DH5A 2JGMA 4IDOA 3INYA 4WOPA 3RW9A 3GAFA 2AE1A 4B31A 2EP8A 3K6SA 3TI9A 2XXJA 5LQKA 1CR1A 3N8HA 2HCBA 1ZGJA 4O4LB 3L0IB 2W2MA 2JBAA 3DWFA 5AYVA 1L7QA 2ZU0C 3RC1A 3BEOA 2FUNB 4M88A 4J0IA 1KF0A 2PANA 4UTXA 1B6GA 1MQ8B 5C4MA 2ZI7A 2IPXA 3PXCX 4WV3A 3P9KA 3MERA 2D6FA 1M2WA 2FH5B 2WUWE 2R97A 3QLEA 3VGJA 1UMBA 3IV9A 1NKSA 4QDOA 3SFTA 2Q9UA 1BH2A 3KLMX 3LKDA 3NT5A 4H3KB 4XSVA 3PC8A 4DF3A 5KJFA 2DFKB 5A04A 1E5XA 2AUMA 3LSYA 2E5LB 3COYA 3V55A 3ROGA 2PLAA 5IC4A 3K72B 2OG1A 4FJ1A 5LIPA 1CR6A 1PYDA 1FTYA 1ZM7A 5EHQA 5KYWB 2P68A 1GFIA 2JDIA 3BVPA 1TKAA 3IR6A 3O8QB 2ZBFA 1VJTA 3G82C 1XAGA 5LDDC 2Z6QA 3RRZA 2R6ZA 5JQGF 2IXAA 2YXBA 2YHAA 3OC0A 1RRKA 3EXIB 5A71A 2C2HA 4KSYA 3MPUA 1ETUA 1O9GA 3NTQA 3V34A 2IXFA 3MELA 1X1EA 1FRNA 3F90A 3IPLA 4NFYA 2JBHA 1JU4A 1VFPA 1K9VF 4QU5A 4CIBA 5A6SA 5K0FA 1U3GA 3HKEB 4PAWA 5LOVA 4XQEA 3R76A 3NHZA 1GEEA 1PZFA 4UC0A 2K4MA 4IL5A 4U7PB 2VHQA 4MA5A 4DWOA 3AJ8A 1OV4A 1YDGA 2BFEB 2QUJA 4FHEA 5DK4A 4PN7A 4IRUB 1ZC3A 4QXOA 4XLTA 5FI0B 3ZW8A 1VRCA 2QP4A 1YRQA 4LHVA 4CKBA 5REQB 1ZK4A 2A9RA 3C4JA 1EB8A 3I6BA 4LYDA 4XM2A 1SVIA 3P96A 4MUKA 5TE9A 1ZLYA 2ODNA 2O3TA 4FFVA 2FOLA 2GB4A 3R5FA 1YVDA 3EBOA 3T7EA 3BWCA 3HXQA 2E5FA 3IJEB 1IXYA 5C8VA 1WZCA 3QUQA 3ZHBA 1J0XO 2FF5A 2E6KA 5L7WA 3F5MA 5T5QA 5TMEA 1QXSA 5LBUA 4NZPA 1KZHA 1F48A 4BFVA 6LDHA 1GPYA 3O4RA 1VYUA 4R8KA 4KYUA 5ALVA 1EDDA 1K4MA 1UZUA 1Y6GA 3LHFA 3V4FA 3LF1A 2Q0QA 2F1IA 3NM5A 4XZ3A 3AXTA 5CT8A 1HKHA 4DRXB 1WOYA 1Q0LA 3CIOA 1J42A 1VL2A 2VNJA 2WSBA 3L3BA 4ZV7A 5JPIA 2BP7B 3UF0A 4A26A 4BE7B 4DLTA 5EQDA 1WW3A 3BSFA 1XZLA 1EUZA 3LLMA 2N0SA 2OP1A 3HP7A 3RUDA 4W8GA 1QZTA 4QYMA 3EGXB 1NI3A 4TTAA 2GM4A 3NR2A 1IIRA 5I9MA 3C6XA 3JYOA 4WLVA 1VFNA 1L5QA 3WAGA 3VNBA 4P38A 5C1IA 3IE0A 2XE8A 1X14A 3KKZA 4D25A 3T94A 1YB6A 1PDWA 3LC1O 4QXPA 4ZRMA 5F3DA 2VCEA 3ZDXB 3ZU5A 4CM3A 2XWQA 3P9ZA 3AVTA 4EW1A 4KIJA 3CSUA 1F3OA 2XVZA 4O2RA 3TW8A 3BDAA 4Q1BA 5FLKA 5IC5A 1EFVB 3C3CA 4EY8A 3H5WA 4BNUA 3TUIC 4YUAA 3KE9A 4E14A 1LSSA 1NR1A 2XDYA 2NTNA 4IDCA 3DF7A 3SPXA 2JLVA 2BZSA 4HFMA 1U2QA 4OXRA 3B5IA 1TAUA 1RTKA 1D07A 1WPQA 1E3WA 2G76A 2RGYA 4NHOA 1RC1A 3DAYA 2YV3A 4X93A 3RVDA 1P5FA 4B80A 1EPUA 4YBRA 3QW2A 4YHHB 2C3PA 3FZYA 4FE7A 5FWDA 4PXSA 3JQ8B 1FNNA 1SXJE 1X9GA 3AL0C 3DF9A 2C2OA 2IX9A 3UFXB 3J7TA 2I22A 2X7XA 3FIJA 4FFRA 4O4IF 2QTHA 4W9NA 1P0CA 4LRTB 4CF7A 1NIPA 4IEFB 2WRZA 4EQZA 5LDHA 2EX0A 1GA6A 5SYAA 2VSFA 7MDHA 1UJ2A 5JNSA 3GUZA 3R9KA 2WUDA 2F9FA 4DS3A 2L42A 3MOGA 2PGAA 1JR3D 1JF8A 4RWZA 4LC0A 1TGVA 1KQPA 2JGJA 5FCDA 5LSAA 2C4TA 1O0SA 3IELA 2CY0A 5CYPA 4JXZA 1LA2A 1D6MA 1DQZA 2AYZA 1I9GA 2PD4A 4QUDA 4RFLA 3L4BC 5BUZA 5J58A 2WKSA 1NVBA 3BHMA 1G42A 4CKXA 3P2MA 1MO4A 4TM8A 3MGAA 1VJRA 1IN8A 1R0RE 3FRHA 3TLCA 3EG5A 4PBSA 2MJLA 1TVCA 1VGRA 4KXLA 4OUKX 3U17A 1XYYA 3LXUX 1E1QD 3UIEA 4E1BA 1U2GA 1M2GA 2H51A 2JBWA 2J48A 2QMEA 2VATA 3COVA 4MDYA 4CCAA 5JQGB 4N8EA 4R3UC 3QTTA 4K6MA 1UM9A 2PUGA 4V2IA 2QD5A 2GCGA 3PGA1 2X0NA 3E3MA 1L7MA 1JKJB 2RC5A 3QSGA 1E2JA 1M2VA 3SQLA 4EMTA 1UXGA 2XA1A 1O87A 2ZWAA 4C4YA 1V1RA 2QTNA 3H1PA 2A9KA 1WXGA 4LJLA 3V8MA 1UMKA 2BI4A 1IMOA 1YRWA 1VLLA 2ZSJA 4ZK6A 3H1EA 1IBKB 3RE1A 5ILQA 1Y81A 3WSWA 1K0FA 1JVSA 5CVJA 5CDFA 3AUSA 2EF1A 5HJ7A 3B6EA 2A9VA 2OQIA 1CUZA 4A6XA 3C3YA 5THXA 1JEOA 1YR1A 1I2DA 2IU6A 1PK9A 5BOSB 3CSSA 4PGAA 3ZLBA 4JL8A 5IBQA 3L1IA 3VAZA 1S89A 2GVNA 4L02A 4RGVA 1EG2A 5CHEA 2BMVA 4XEUA 1MQSA 4BNWA 1E92A 4UPDA 5DNCA 1X74A 3OZAA 5ADVA 4N0MA 2AG6A 4FFLA 1QQ6A 3IPAA 5GGXA 4DT1B 3E22A 3FWHA 2FETA 1HTBA 1WKCA 1SBTA 5CLGA 5KNDD 1Z63A 3KL2A 2HA4A 2Q62A 1KRWA 4N6OA 7GPBA 1U5BB 1I1OA 1JJFA 4E30A 1KIFA 3FSRA 3ZDFA 1R4MA 3H5TA 2JHAA 3WGVA 2EHDA 2ZXUA 3K1YA 3IUQA 3EXG1 1S8OA 2XVXA 3F8WA 2XMPA 5LP6C 3W1EA 3LE8A 3B60A 4AX4A 4GD3Q 4HMQA 2BH2A 2W98A 3Q7RA 3ICEA 4QLOA 3LW8A 2XTNA 3GGJA 4I1YA 1LB1B 4MPJA 3MA0A 1C4OA 1TTPB 4HWOA 3OKPA 1KJJA 3OOJA 4PRZA 3UATA 5CCXA 1PR3A 2XB8A 4OY3A 3GGPA 1L9XA 2CUNA 4LHSA 2HWWA 4XDHA 1EXMA 4NNPA 1ZAKA 2GBGA 1SA0A 4MV4A 5L3RA 2IIPA 3TAXA 2XOXA 4IX1A 4KWHA 3RLIA 2H11A 3DTVB 3OPNA 2OXTA 1TTQB 2XXBA 3JPYA 2J3LA 4JT9A 5G4LA 2NMVA 3O38A 4MQ5A 1LNSA 5A0FA 1AB5A 4EKIA 1CB0A 2DPYA 5BN4A 3KTAB 4IQFA 3Q12A 1AIPA 4PYJA 1CULC 1ORVA 4MLPA 4HDNB 5ICGA 4ID9A 4Q21A 1R0LA 3QWAA 1KSJA 3WMFA 1UKVY 1CX9B 2GM3A 5L3QA 1BXGB 1W4CA 2FRXA 3BQNB 3JARA 1DIAA 1Z2NX 2IW3A 2V1XA 1U0HC 1WRBA 2ZBDA 4MWBA 4WOJA 1GA4A 1QIIA 2QLMA 4I4NA 1Q17A 2HNAA 3HWRA 4KUEA 2PPLA 5FA6A 3OBBA 1DP4A 2Q9BA 2OHXA 4UOZA 1SK8A 2OT3B 1AGXA 2PEZA 4EVQA 2BI7A 5AUPB 1PP4A 2P62A 3CJTA 2NZYA 4M1WA 5TS3A 4Z5XA 3R4CA 3PR1A 2AX4A 5KQGA 1LDYA 3LBYA 2RGAA 2YIVX 4OK5A 4G0QA 3A6PC 3EAQA 4OHFA 2XZLA 1XZBA 1E6KA 2Q3CA 5AVKA 1A9XB 1P45A 2HCTA 4D9EA 1QIHA 3UHAA 1Q11A 1WLSA 2GASA 5AIBA 2OXRA 1LJUA 4NPCA 4OBEA 4YECA 5T3UA 4D97A 3LDUA 4MPTA 4MUXA 5G0UA 2WABA 4MUMA 1QG4A 3KALA 2ZJ5A 3WBKA 3WDKA 4LZPA 3ZNPA 4AYWA 1E2FA 3R1IA 4DJTA 4E2ZA 5CDHA 1VBFA 1HRDA 1FMJA 2QQGA 1NOIA 1V5EA 2XVMA 2AQ8A 2WHPA 3K9GA 4FX5A 1Y9DA 1KEWA 4RXUA 1M6VB 4GVPA 4QNRA 2QAJA 5BNFA 5F77A 5K8VA 3ZDAA 2HMYB 2NSJA 1PQPA 2D1QA 1XFDA 2XNCA 3BWBA 3DBLB 4DLLA 4HNVA 4FJ0A 3QKRB 3WO0A 5LD2C 4TMYA 2FRDA 1P1BA 2AC2A 1I6MA 3HGMA 3DZGA 5CFOA 2ZRGA 4BNTA 2NU6A 3I76A 3MWEA 1NQVA 1TCUA 2E6UX 2PKXA 5I9IA 2EZUA 2ZAIA 1ODCA 1AKVA 5EG5A 1GYRA 3UAVA 1CY8A 4I55F 1GFSA 1X3SA 5K0LA 2PS1A 1LQ2A 2BISA 2QZ4A 4CW7A 4JXXA 1XU9A 1TLFA 3DQQA 3I45A 4X95A 1GP2A 1RKBA 1RPAA 1WKVA 3LA8A 2R0QC 1O95C 1M34B 3FMIA 5C1BA 2XYVA 1JHZA 1QF9A 2JANA 4L6IA 3NXSA 3TTWA 3SR4A 2JFNA 1YI0A 2IEIA 5HKOA 1N2IA 3NWOA 3JVIA 5BN5A 4U2FA 5B12A 1KZ7B 2YDXA 3GLRA 3OIWA 5F5NA 2C5HA 3ICOA 3KS9A 2F8LA 4KLZA 2QQEA 5KKAA 3RVKA 1IBMB 3TG2A 3T0FA 1XB2A 2QD1A 2Z98A 4TS3A 1AZWA 4PYNA 3NVAA 3V48A 4FEAA 3H2JA 4YAUA 3DUFB 3BJRA 3JTEA 3R0VA 1X70A 2UU9B 4MVJF 4IQGA 4ZARA 4Y2RA 3W5SA 4ZZ3A 4O4IB 2OAGA 4LGVA 4PVCA 4HN2A 1PS0A 1WO8A 1HC7A 4B45A 3ZDRA 3PJGA 3UMRA 1XL1A 2ZYIA 3ZDYB 1TTHA 2JHFA 3A1CA 3H9QA 4TLAA 2EKLA 3QX8A 4LRXA 5AI4A 2FFBA 3KXLA 4KREA 3ESCA 5DI3B 2CVOA 2G8NA 3CLUD 5TC4A 3RKUA 4BZPA 4RULA 1DAGA 4J07A 3SKVA 3NBQA 4HQOA 1GKKA 1T4CB 4MO9A 1N25A 1ZZGA 3SC4A 1FDTA 3EEBA 3ZVLA 3UB3A 3ZZUA 2OCPA 3CRZA 1JZQA 3FDZA 3I8XA 4A1FA 1ML3A 1CUXA 1CS4C 2QNBA 3AXSA 1V5GA 3MGCA 4R9NA 4ATNA 3H5VA 2FMXA 5JJKA 1DUSA 5EMKA 4EECA 1YL5A 3LUGA 1QGZA 4FOTA 1K68A 3GP8A 1EIWA 1LLDA 1C9JA 2DWCA 4YCSA 5DMXA 1PL6A 3O3CA 3X1JA 1CDDA 4RHXA 1SVSA 3OOEA 1QLJA 3OTHA 4BFTA 1LSOA 2CWWA 3RARA 5IM4F 2W2KB 1E9FA 2C9MA 3DT9A 3THOA 4E4TA 3TMAA 4C3OB 4M3NA 5A3RA 3CU5A 1SKYE 2ZROA 3LCCA 5JUWA 3BCRA 3KZ1E 5A5VA 2W2LA 3CH4B 4XYEA 4C08A 1VGVA 4MITA 3FYSA 1Z7WA 3G0BA 4KUGA 4KMRA 1BX0A 3DMGA 1FPQA 5LVAA 1RIFA 3H4VA 4JR1A 1X38A 2LGJA 2HA2A 4NFLA 4ZO8A 3ZCTA 4DT1A 2UXCB 3EIXA 3SC3A 4DDTA 1WCYA 1K86A 3QJYA 3A70A 3UAXA 3WAJA 1WLYA 3S1LA 2YJNA 3B6MA 1Z38A 4D44A 3UKJA 4RE6A 4D2IA 3R40A 4HN4B 1GSOA 2B6NA 1CYEA 5KTSA 2YNMC 5IU6A 3M82A 3CN7A 2Y3IA 2J0VA 3OA2A 4D6PA 4Z4FA 4Q1VA 1V47A 4JITA 1O8BA 2QN7A 1C0EA 3A32A 5BORA 2BV3A 3D4LA 4L85A 4NOKA 4R98A 1NE2A 1WHSB 2XMBA 3KZKA 4RTSA 1WUIS 4BL5A 4PLWA 3NGMA 1X80B 3KV1A 3S1SA 1OE0A 1YR3A 5DTMA 5GVSA 3CVWA 4UE6A 1DIGA 1WXDA 4MRVA 3WLEA 1H6AA 2ZYHA 4JVMA 4KV9A 1WX1A 2WMDA 4HLUA 2WSLA 4EBFA 1U7OA 3E48A 4Z9AA 5KC8A 1TIBA 3JVUA 4CL2A 5BQFA 1MXHA 3VKWA 3OZVA 1M75A 2VP9A 1M6NA 1EZ4A 1LI7A 2VLIA 5EUQB 5HGJA 3SXJA 5FAKA 1XRLA 2GEDA 2ZBRA 3MRVA 1MKYA 2BCGY 2ZCVA 3I9V1 3IDQA 3TL6A 5EZ6B 4J6EA 4BLUA 4P4LA 2W6ZA 4DDHA 4TXLA 1RXWA 3IT1A 4ER3A 2PVSA 3OEHD 1ESDA 4G37A 3NOVA 2SICE 1OFGA 2RAUA 1ZSNA 4LXYA 4MYSA 4O8ZA 4ZC8A 1N78A 1RRGA 3U3ZA 5ICCA 4BAZA 2H9AA 2ZSFA 4IFTA 5E3IA 3JD3A 2XT6A 2DFPA 5TEWA 1F5NA 3Q0IA 1F9EA 4CV0A 4RL6A 5FUQA 2QX9A 1FTWA 3O84A 3QLVC 1PRYA 4QU9A 4G5QA 3B9BA 1Z7BA 1ESCA 1KMIY 3FJOA 1CS0B 2J3IA 4PW0A 2B9VA 4GX1A 3EEYA 4XI9A 4WRRA 5CXSA 4ZCQA 2ZI4A 2OC4A 4D8UA 4BVAA 4WECA 1IOZA 2CK3D 2IUFA 1V37A 5CT4A 2ATCA 5JHHB 4WBNA 5JQWA 3T8YA 1PLKA 2C96A 3W2HA 4I5GA 3TJZA 3TL3A 1XBTA 4CF6A 1KRHA 4CKEB 2P3LA 4RK5A 3O9MA 3WXBA 4BJ3A 3R9XA 1PG2A 5G0WA 1M2FA 2QA5A 4IBOA 2Q5QA 1T1GA 1XQ6A 3SSMA 3ZHUA 4QG7A 1QO0D 3GFTA 4FILA 3VO1A 4BVHA 3EF1A 5I8ZA 4WNAB 4Y67A 3SAJA 4X1IA 2E37A 3CNHA 4I55B 4YLYA 2DG2A 5IN4A 3EEOA 1RTTA 1MRSA 2X41A 3AIIA 4ZAFA 2CD9A 1FX0B 1XJQA 1KKMA 2ZFUA 4MB0A 1IIBA 4WZ6A 2OEPA 3G88A 1VIVA 4P80A 5CVCA 1NWCA 3PXUA 3I3SR 2FPIA 4WZZA 4Y6LA 5DASA 2PD6A 5G1NA 2ZS9A 4ANFA 5A4FS 3I9OA 4YDQA 1EVJA 2FZ5A 3DHWC 1VIAA 4W8OA 3ZX5A 1TRKA 2R6DA 4G0NA 4ZVLA 2O19A 4LV8B 2CHQA 3E05A 5E4JA 4B48A 4ZAWA 4BVFA 4E21A 1K5PA 2G3YA 3LHKA 4M1OA 2X42A 3LWDA 1Y7LA 1X8JA 3WA6A 1O6ZA 1QE3A 1G3RA 1TEXA 1ZJYA 4OM8A 1LRJA 4Y18A 2X22A 3GT7A 3EVFA 1JT2A 2CZCA 2QRQA 3FG9A 2PNJA 3I62A 2G07A 4G0YA 2C9CA 4H08A 1NATA 3NV9A 4CXMA 3P9QA 1GU7A 2F67A 2OM2A 2PGOA 3L0SA 3IODA 3OM0A 5AJHA 1Y5IA 2QJFA 3W0LB 4BZWA 4ZMBA 3PLAE 3TAHA 3RVOA 1G21E 1P80A 1LXCA 1N32B 2Z04A 4MEJA 1OHHD 2ZPTX 2PWYA 5B7QA 2VHEA 4YO8A 3N2ZB 5CBPB 3Q0EA 3WXMA 2BFFA 1LF0A 2WTMA 2XGOA 1NQUA 3PRYA 2W2TA 3BDIA 2IU0A 2M6LA 3U7JA 4N12A 4CHGA 3UQZA 3HXKA 2JLRA 1WF6A 3UH0A 3K16A 1OXTA 2O8DB 4PEVA 2QAGB 1LD3A 3A4VA 3AR6A 5CH8A 5IEBA 4QBKA 1RBZA 2J6CA 2WA2A 2XJ9A 1E89A 2WDZA 1QOZA 2WMYA 2AMJA 4BRSA 3PD1A 3U1VA 4NOMA 1B0ZA 3GLFA 3Q15C 1ADBA 1KI1A 2HXGA 3PFIA 3QPAA 5DF1A 1R8SA 3TSYA 3U2QA 5JXGA 1ZI6A 1WIWA 3B8HA 5FV7A 5JDCC 1CQIB 2VWPA 3CZPA 2O54A 1ECGA 1Y33E 4LXTA 2H2IA 4IG4A 4MUEA 1CERA 5B3JC 1BFDA 1RT9A 3ICWA 4OQ4A 2EX1A 3QVMA 4P08A 2Z1NA 3HSYA 4IUCS 4PSCA 4E31A 5ADWA 3NRBA 2C82A 2QM7A 1ZU5A 1XD2A 3BMCB 5LKRA 1W581 2H1LA 2Z3VA 2OYSA 3RRXA 1CRQA 4KXMA 1SQ6A 4MKZA 1UPAA 4ZVQA 4CHTA 2A33A 3H5IA 1QOPB 2C7BA 3L93A 2VZ9A 2IWHA 2BELA 3WJ1A 5JSZA 3A2KA 1JQDA 4FW8A 5ECYA 4WZBA 4Y2XA 4TTRA 5JJBA 3PQ6A 1TU4A 5C8YA 3H7IA 4N7JA 3HO6A 3ZQ6A 4N6GA 3RJMA 1QPGA 2G1PA 1XVAA 3M9LA 2EDAA 3BBPA 2AFHB 4MCAA 3EY9A 4MV1A 3UW3A 4CG3A 2XCQA 4BMZA 1L4KA 4LE0A 4HYQA 1JP7A 3H42B 3MRTA 3WLMA 1P9RA 2YWXA 4Y7CA 3UVEA 3PEVA 2HY7A 1LBSA 3NEJA 1EVIA 3LUHA 3SBDA 3KT0A 3VR2D 4OAOA 4QOJA 1KSFX 3W8DA 4C7XA 1JLLA 3DL0A 3SZMA 5HRAA 2CZGA 1A5ZA 5CA0F 1F20A 1MAAA 2Q2VA 5IUKC 1FXUA 2AEEA 3I1YA 2O8FA 1FMTA 1TEVA 1U7TA 3EG9A 2ZBGA 2APJA 4M98A 4XUEA 4J0QA 2FFQA 3FIUA 3FM9A 4UHHA 3TVDA 1Y6JA 4G25A 4JKOA 4S2EA 2YW9A 4RDXA 4MPRA 3WLLA 4QU0A 1Z5PA 3VDNB 4QYTA 3OG9A 2B2NA 1WHSA 2UZ1B 4O2BA 1BU8A 4OQPA 4CFZA 1N6PA 3NORA 2FNAA 1NM5A 3CPJB 4ND3A 1UXOA 3ZCXA 2Y1WA 2QMHA 3FCOA 4YNBA 3VHXA 3F3MA 1Z0KA 3M9WA 5KJ1A 1RAFA 1TO1E 1ZNXA 5HQ3B 3TECE 2Q9AA 2JAXA 3GD7A 3N75A 2QG4A 4FI3C 3MLEA 3JQBC 1OROA 1V8BA 4U9HS 4RGBA 1FSSA 4HDSA 2BHTA 2CW5A 3JRNA 3RSCA 4MJ7A 3OTOB 3E9MA 4RD2A 3SR3A 2YHIB 4DIMA 5CA0A 3CBQA 1R6BX 1IVYA 2G8LA 3GK3A 3PHIA 3MGGA 3V3KA 5E3JA 2P6OA 4YV1A 3U7GA 4CIYA 2H2FA 3VR6A 3H1AA 1YRBA 3OLVA 1OKKA 3JQFC 1VE3A 4NDZA 2BW0A 1ENYA 2REQA 2WU4A 1U6KA 1RWQA 2O06A 3L07A 3CN9A 5I4CA 1N0HA 3MJEA 3VH1A 4QNMA 2QG6A 5MN5A 4YJKA 1T5HX 3M5CA 1CIVA 4X94A 1K8ZB 2IYOA 2WNSA 2NQTA 4BP9A 4QIHA 1LLFA 1P18A 5B7PA 5KQPA 5LC1A 5JR3A 1E3TA 2V7XA 4NULA 1RI2A 4HNGA 4QDZA 4MUFA 3RFTA 1D2HA 3VZDA 2B1QA 3DZJA 3WHLA 5CXQA 2MYNA 2VDJA 2COUA 5FJIA 4ESVA 4S0XA 3HVHA 2CWDA 2WWHA 2OO7A 5DYYA 4KQ9A 5HZGA 3TH5A 1AK1A 4M9ZA 3AHFA 2NU8A 1PDOA 4LOAA 5EUMA 4EB6B 1GZ4A 4CODB 1C9DB 5TS2A 3HWSA 2LUOA 1Y7HA 1WZIA 3M6UA 3LPCA 1Z5UA 2CJFA 3PNSA 3WYCA 1EUYA 5TDHA 2VC2B 3PT9A 3L7LA 4K5QA 3KKNA 3KUKA 3OLQA 4R2MA 2NVOA 4UBJA 1A9RA 3SF0A 3H65A 1H6CA 1YU9A 1EKXA 2JRLA 2R6R1 2X0KA 4G5SA 4XFJA 3C3DA 5AKGA 1AF7A 3HVJA 3CUEF 1NV8A 1KA9H 3FOZA 1PFUA 1X19A 2V65A 1MMFB 4MJLA 5K01A 1I7DA 4GZ3A 3TSWA 1N0UA 1I14A 3QVWA 3RYFB 4UDYX 4U8GA 3X3HA 1ZP6A 2HMSA 3IDZA 3OUUA 4XD7A 4OHOA 1KI6B 2QGFA 4EHHA 1B4DA 3JASB 4KH0A 4QO7A 1L1RA 3BMOA 1K5DA 3O2QB 2MMCA 3NHMA 4WY2A 4KX3A 4EFNA 3BRQA 2CDBA 2YN0A 1E3MA 4HT3B 4YY3B 3T9FA 3KKPA 4CL8A 1XLUA 1YT5A 3OSZA 3UK2A 3HO8A 1K5GA 1HYHA 1XTZA 2M98A 2NYVA 4KR7A 2PKQO 3A9RA 5DVZA 2L2QA 2VF7A 4J2HA 4V02A 2YS6A 1UWLA 2J7PD 5EIXA 3R4VA 2O8EB 3W5BA 2HJSA 1CIPA 2F9MA 3A6DA 1UF9A 3B51X 1HFKA 2GCOA 4RFSA 5CBPA 4XWWA 1RHQA 1U65A 5AKLA 4KEAA 4IKEA 1P62B 1PFYA 1ULTA 2VSQA 1EXVA 1DAPA 1XZ8A 2Y4NA 1FTSA 3O91A 4R0VA 5CM2Z 2UZAA 1QE0A 1HSZA 3MTAA 1QZZA 1KYIA 1Z06A 2BEKA 4F11A 1ATZA 1GPLA 1TVEA 1V6CA 4YJHA 3FHTA 1P2GA 1XO1A 1WS6A 2IV3A 3M89A 4FXPA 1C1XB 4MUNA 4BMNA 1W6UA 3GLHA 4YP7A 2X9NA 1KJIA 4KOAA 3B53X 2HA7A 1T1SA 4F3KA 5FTJA 4B46A 2NV6A 2OAP1 2OV8A 5MHTA 3SJBA 1WSBA 5JIBA 1W35A 3B13B 5CCBA 3R8FA 1R27A 1IAVA 5ALHA 2HUNA 2PIDA 4M7WA 3IAM6 3N07A 2QTCA 4C0WA 1GTSA 3RRFA 4CQNA 3ZIDA 2BGLA 4ASUA 3P0RA 1GWNA 1LY1A 1GEGA 5L53A 1J2YA 1R37A 1G291 1D1QA 3DD1A 3UUEA 3MK31 1FA9A 1SC9A 2BDEA 3VAAA 2XTMA 2OBYA 4X61A 1MRNA 4IHQA 4AAYA 8GPBA 4ZHQB 1F2DA 3CY6A 2MSWA 3IQDB 4FJ2A 4JK3A 4CCYA 2I91A 1Z6ZA 3EVEA 1W59A 1ZQ9A 2I6QA 4FB4A 4OX9B 2VDOB 4MW6A 1WSAA 2AQHA 3D8HA 1WVGA 1SURA 1GRQA 2R6CA 3GH3A 2FWPA 1X7XB 2EEPA 2Q2WA 3FH0A 3L0CA 5E6RB 5I9BA 4D3DA 4DZTA 3GLVA 1E4EB 2AZTA 2FSFA 4DNPA 1DPGA 4F72A 2HX1A 1H8ED 2C61A 5IFLA 1N0IA 4QFDA 1EFAA 1I2MA 4LYGA 5AHWA 1E2IA 2VWHA 1C8VB 1I30A 3R3YA 3UKOA 1NW3A 1AQUA 1FLVA 4RV5A 2RJOA 3AP1A 3WJ7A 1YQGA 1JEQB 1HTWA 3HFSA 4GOOD 3UA4A 5C53B 1Z29A 3FNEA 1O57A 2X4DA 5AWFC 2XTJA 3ZE0B 1GKYA 1KQGA 1C9NA 3E8XA 2DT5A 5D00A 2UYCA 5TIIA 1K6JA 4F6RB 1F0KA 1T15A 1NVVR 3O1IC 5D5QA 3SYNA 1PQWA 5DNEA 3EMKA 2V9ZA 1RAEA 2VNAA 1RYYA 4IDGA 3JQAB 4JC0A 1AT1A 2JLZA 1GPWB 1RE0A 3E5HA 1GXSA 2JI7A 5DLDA 2K2WA 4C2UA 4CVNA 1H2WA 4X3PA 7YASA 4H7IA 4CG2A 2NO1A 1SHZA 3IBTA 1IEQA 4AY2A 3EARA 4HJRA 3HZRA 2NADA 4LBVA 3SFZA 4EPYA 3RTEA 3LP6A 3OFVA 3VU3A 2BYTA 5KVCA 1AKYA 5EOVA 2ZYVX 4CQLA 3UJ3X 1USKA 3A3NA 1Q21A 5JE8A 3N2KA 5KSWB 3QIVA 1A7UA 1EFKA 2PRSA 4ZCLA 2LIPA 5K2OA 2YYYA 2GZ3A 5CX1A 2AJCA 1AHHA 1EX1A 1TKCA 2GLXA 3S40A 4C5BA 3G2HA 3U6KA 2Q29A 2XUQA 5FP0A 2ZI3A 1UQRA 2GBCA 3R5HA 3H11A 4L5IA 1IATA 3GU3A 3MLBA 4WN3A 2CNNA 1G66A 3BFVA 5LFAA 1P60A 3OJOA 5FO0A 1VBNA 4B7ZA 2QGZA 3L0BA 4D81A 3ER9A 1DEXA 2WFZA 2FZLA 4JDUA 5CP8A 1W4ZA 1Z22A 3HDVA 4K40A 1I0ZA 1PU2A 3HY4A 1FRFS 2RC6A 4U5QA 2G0TA 3PDCA 1W36C 3SM3A 5EJMA 4TYWA 4N6NA 1EFLA 4LF5B 1N3YA 1JFLA 1V7CA 3NC1C 4MQBA 3EPHA 2ABWA 2G83A 4IM7A 2C0QA 3C39A 3PB3A 1X7DA 1I0LA 1TZMA 3B38A 3DTYA 3HU2A 2IXTA 3K15A 1BCSB 4INOA 1XU7A 1UZMA 3EXHC 3OCJA 5DLQC 3WI7A 3C15C 4H17A 1OLXB 4MR8A 1D4FA 4ZTBA 1NAIA 5F76A 1J6UA 1NMZA 2DRIA 3KFVA 5U4QA 3SS7X 2C2KA 1UZNA 4QGBA 2X0FA 4ITRC 3NYRA 3ZZNA 3CVVA 1PZHA 4K87A 3AHDA 4O1IA 1PTJA 1DRVA 2UUPA 1UFVA 1G41A 2XYRA 4HDMB 1KOJA 5AOAA 1N33B 4OB6A 4YQZA 3J81k 3GLFE 1LDMA 4I9UA 1NLMA 4LJKA 4URFA 4BKUA 4DUGD 2FX2A 3WQHA 3G2JA 5BN3A 1DMSA 1QZXA 4XJTA 5C7YA 2W7TA 3R0ZA 4WK4B 1U1CA 3LUBA 3SM9A 1XCJA 5LB2A 1OXVA 1HUQA 3Q87B 3J80A 1GTJ1 1JDBC 1GADO 1VMDA 2GDJA 2EBHX 3BH7A 1UPUA 2XCOA 4KO8A 4ISCA 4AP9A 3O94A 5AJUA 3DOOA 1JV2B 2CVHA 3KQLA 4GBED 4P6VF 1JHDA 4NDNE 1N3BA 5BUCA 4MDEA 4JCCA 4YAOA 3ANLA 3RRYA 2OHFA 1OFVA 2Z8YA 3ZK8A 4Q34A 1DBPA 1A2KC 4C07A 4Q7LA 3AKCA 2GPWA 3ECCA 4AB1A 2QQ0A 1Q57A 3L8EA 2JH9A 1I2CA 4G26A 4C4AA 3AEZA 4PTZA 1BE1A 1GNPA 2EZ4A 4U4AA 1RW4A 4GQAA 1LTHR 3PTAA 1ZJZA 1P4GA 2NU9A 5BYAA 4YAKA 3MBKA 4TZ6A 2LD4A 3UJNA 5B37A 3ZY6A 3BIWA 1Z7YA 5C31A 1Y3BE 4I50B 2O3UA 1Y6QA 2OHIA 2PSDA 4GGOA 4ARZA 3ZHTA 1WZ2A 1GTRA 4F3RA 4ENWA 5BSGA 4NH4A 1XEWY 2R7MA 2HBZA 4MYTA 4ZRDA 3UV6A 2XZTA 3RRBA 4BO3A 3C7AA 1FFBA 3R44A 2I1LA 5AMXA 1C9KA 5KYXB 3GJ6A 1O6FA 3HABA 3IA7A 2PBFA 2VK8A 2QN3A 1WY7A 2I8LA 4DHWA 5JNUA 1TUBB 1DWOA 1QE5A 1JSXA 3CZCA 9LDBA 3BFXA 1ZOSA 4J49A 4N8SA 2AEFA 2GRAA 3HLKA 4QJ4A 5B55A 4EB0A 3MGBA 3G2LA 1CV2A 1SUBA 2CYCA 3FZNA 5H16A 1SUSA 5GOTA 4G1CA 3CNLA 5GV8A 3U48A 2XDAA 1GL3A 3UBTA 1EDBA 2J9ZB 1FFHA 1N2GA 1N5LA 3IAXA 3VR4H 2IEGA 5JCOA 1KMHB 1ZVQA 3BZWA 3KAKA 1AN0A 1Q3HA 3IKLA 3IOBA 1CJMA 1QLWA 2HIMA 5EJIA 1NRXA 1GGJA 3WK8A 2VK1A 5EHIA 1T9DA 5DHQA 1XELA 3Q3EA 1PGNA 3K8OE 1H4TA 3W9SA 3KPWA 4MVYA 1CJSA 4DJ5X 1ZN8A 3IUYA 2JIPA 2LPMA 3SWWA 1FCJA 3KQYA 1QIJA 1YS4A 1DEKA 5EFZA 3QNUA 4L8FA 3IOCA 5EZSA 4CEJB 2QNRA 1T3TA 2Y05A 2QL5A 2I67A 5JXJA 1JN0A 1I1NA 2NZVG 3VUFA 4KO3S 3ZJYA 3OY2A 3QG5A 2J4CA 3QGMA 1OVGA 3DGFC 3EWSA 4K9DA 4MSUA 4K28A 4D45A 1G4UR 4FFPA 1E6UA 3OM8A 5F1PA 1K1EA 2X1LA 4EF4A 5KWJA 3REQB 3L01A 3PNOA 3K4QA 5F9MA 5LBIA 2E4UA 4B40A 3ZI0A 3O0DA 4D46A 2QPTA 2OQ2A 4RZUA 4U2GA 1M6WA 3DEIA 4D3YA 4L9WA 4G07A 2QLTA 3H8WA 3GGDA 1RJGA 2QZSA 3CO0S 5DW0A 4DQLA 1OKKD 4NR0A 3KVYA 5IM4A 3CPEA 1ESZA 4KIWA 1M9NA 1G5HA 3EXEB 3L8MA 3DLHA 4TMKA 1ZESA 2CSUA 3E4DA 1XCLA 4NK4A 1WAMA 3OU7A 1I10A 4G56A 5CPFA 2OCBA 4MYRA 2QTVA 2LKDA 2QVXX 3FTFA 4KIUA 2I03A 2QQ5A 3AR7A 1JG3A 1HBJA 2XB4A 3V2GA 1WUKS 1GKIA 3H5LA 3O4JA 1P7CA 2W2LD 3DFFA 3TQIA 3GLGB 3TF5A 2HFJA 1PV1A 1A9QA 1MO3A 1XROA 4ZVOA 3IV6A 3THYB 1USIA 1GLVA 2W6JD 5IYZA 2BFNA 2HGSA 5H0IA 3ZWPA 2UXDB 2R8ZA 1CZNA 3A11A 2Q3BA 2BF4A 1ECFA 4YS6A 4LDJA 1YRHA 5KS2A 5C18A 1KEEA 1U5CA 1PFQA 2V7WA 3FFTA 3CNBA 2QOEA 3JQ9A 3E70C 3FFWA 4Q01A 1XMIA 3LUCA 5DO9A 1FDIA 3VSDA 1W8DA 3DV2A 2R1VB 1P2VA 1NBMA 2Y77A 2WWIA 2Y0DA 3K20A 4UCXA 3ZWOA 2PL1A 3EIEA 3O03A 3FCXA 1Z6YA 4GFDA 1AM4D 1Y7TA 1X0VA 4P2GA 4OP2A 2FWMX 4BLWA 1TB4A 4K1LA 4F84A 5I4IA 1DV1A 1JR2A 1MABB 3Q85A 1M34E 5ALPA 3WB2A 3DZCA 1RZVA 3K2EA 2IYEA 5ER9A 1ZKDA 5IVKA 5FI1B 1BCSA 4JOBA 4WH0A 3OOYA 4K3UA 5FI5A 2G0NA 3ROXA 3HNRA 4A7PA 1O0CA 3B9RA 3V1KA 1QFSA 2A6PA 3V4LA 1YO6A 3UAOA 3CRNA 3X1DA 2AB0A 3REGA 4GR5A 1GGEA 3D4BA 4N3BA 1E7QA 4YRTA 4WESA 4YWHA 1FYDA 2JDID 3A4YA 1GG9A 2O2HA 3F8SA 2WTXA 4PC3A 4NC9A 2HCJB 2PYDA 1AKWA 4ZAXA 1EVEA 2OGTA 1E58A 3LUAA 4KQMA 4O4JF 3KQNA 2WILA 1CKEA 1JHUA 3KZMA 4XWYA 2D3TA 2GJ8A 3F5SA 4JGGA 2XDWA 4RJLA 5FTMA 3OPYA 1UZLA 1SXHA 1Z62A 2Q5OA 2Y9MB 4HB3A 5IW8A 4B9EA 2Z1DA 5C46F 5KU7A 5JJCA 1GDHA 1AGRA 1O8CA 1BMFD 3SZ3A 2VJNA 4P0PB 1Z5ZA 2D8AA 2PMBA 4TN1A 3EZLA 1DEOA 1P2BA 4P7JA 2ZAMA 3IP5A 4LOKA 1WA5A 4BX0A 1U02A 2D1YA 3DA8A 2JJ8A 3RVBA 3SS8A 2FSSA 1R5BA 5M3BA 4GE0A 5LU8A 2IYSA 3AHCA 3IP8A 4QC2A 2D00A 5EKXA 1K3FA 1W93A 3GUUA 3S4YA 1XTVA