6YASA

Hydroxynitrile lyase from hevea brasiliensis, room temperature structure
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis.
pubmed rcsb
source organism Hevea brasiliensis
molecule tags Lyase
molecule keywords PROTEIN (HYDROXYNITRILE LYASE)
total genus 97
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 6yasA00
5C8ZA 4OD0A 2CB9A 4E14A 4MJ3A 2JGIA 1DQYA 4Y2JA 2V98A 5CH8A 5ALHA 2AJBA 3IB3A 3I2FA 5AKZA 5DLPA 2YXPX 2JIDA 3W9UA 5E4TA 1Y7HA 4ARAA 1H2ZA 2PPLA 1QIIA 1XROA 3I6YA 1EK1A 2VA9A 3TJMA 2C7BA 3WKDA 1TKRA 2HFKA 2VSQA 3STUA 3STVA 3HACA 4W1SA 1MX1A 5ALIA 1H23A 4UHBA 3DOIA 4INZA 4UFNA 1AC5A 1X2EA 3DL7A 1P0IA 4QNNA 4RNCA 2OXEA 1W52X 1N8SA 1CUEA 2ZJFA 3X3HA 5AKLA 3KSRA 1BEEA 3R3UA 1DX4A 1PJAA 5AI0A 3SWWA 1UK9A 2QXUA 4Q05A 3V1LA 4BYMA 1ETHA 4Q3OA 3IURA 1CUUA 3K9BA 2RAUA 2WIFA 3O4JA 2WLSA 2QT9A 5EI5A 4PW0A 4DMFA 1CVLA 3F98A 1J1IA 1LPAB 1ZOIA 4UHFA 4BC1A 4BZWA 4X94A 1TCAA 4DYHA 4G4JA 2VQ6A 4KAJA 1YAHA 3E4DA 2HA5A 4ARBA 2WHPA 3CCBA 2QOEA 5FXMA 1CUSA 3PF8A 3O4IA 4FKBA 5LYYA 3H18A 1XQYA 3AZPA 2DHDA 2C5GA 1U2EA 5HF9A 2XUFA 2PL5A 2GBCA 3NGMA 3L1JA 5JAUA 1LBTA 3HLKA 1QIGA 3P2MA 3ED1A 4LXGA 5ALLA 3BXPA 3I6ZA 4B0PA 1CUVA 5LZ9A 1UKAA 3G7NA 3FSGA 5ALWA 2JGMA 2OAGA 1H2WA 2VJCA 4ZV7A 1AX9A 2XMDA 4AMYA 3ICWA 1CUYA 5HK9A 4K6GA 1IVYA 3QM1A 1R9MA 2Y2UA 1Q84A 1A8UA 4BAUA 1E8DA 2OCLA 2ZSIA 2QRUA 2PM8A 1XZAA 1H2XA 4BATA 4GI1A 3ZLUA 2RIPA 1XZFA 3E3AA 1ODTC 4DNOA 1XZIA 2XQIA 2H7CA 1Q0RA 5JAOA 4FLFA 1ODCA 1CUXA 1PFQA 2BUBA 2Z8ZA 1W75A 3FCYA 3H19A 4H35A 3CN7A 2D5LA 1XRQA 3D2BA 1ZGBA 4P92A 2R11A 1AZWA 4IH9A 3LP5A 5K3DA 2OCIA 1E8MA 1LNSA 2ZYIA 3QYJA 5A7FA 1THGA 1L7QA 3D3NA 3H2KA 4M0FA 5FRDA 4PNZA 1T4MA 3FCXA 3M81A 1H22A 4HZGA 4AQDA 5JALA 3W05A 3G02A 3ZI7A 2O7VA 4MEAA 4UHEA 6YASA 4B85A 2VF2A 1ZI9A 1J06A 4X3CA 3D4LA 4BCCA 2XMQA 2QUAA 4G8BA 4C4YA 3FLEA 3PFCA 3WZLA 2Z3ZA 4U2FA 5AM4A 5IVKA 2WSLA 5K3AA 4DNQA 1CUWA 3F97A 4Y2RA 1LPOA 2CMFA 1QIKA 2HIHA 4QDUA 5JYCA 5AOAA 2XMZA 4KEAA 4FNMA 4V2IA 4CFSA 4UBNA 5CT4A 2DCMA 4AZ3A 2CUTA 5AKKA 3AZOA 1UOPA 5AK4A 1EDEA 1UXOA 1SCQA 4EY6A 3GUUA 5D3ZA 4AO8A 5DYYA 5E4YA 2PSDA 4C4ZA 4AO7A 2G4LA 2GYWA 3DD5A 2QS9A 2E3JA 3TEJA 4LIPD 5ALRA 3G9UA 2HDWA 3QITA 3O95A 4MQLA 3OPMA 4DMHA 4DNPA 4X6XA 5HCUA 4DMKA 2XUKA 1YASA 4X97A 3G9TA 3EF3A 5CMLA 4TGLA 1HBJA 1YA4A 1VZ2A 1RYYA 1WCYA 1U65A 1WPXA 4BVLA 3GBSA 2XLBA 3ESAA 2X8BA 2WIKA 2BFNA 4BB0A 4EHBA 4QZVA 1W6RA 2C4HA 4Q34A 2HRQA 4G8DA 3OM8A 2OLEA 1MNAA 4XX1A 5AOBA 1SCKA 1AMNA 1FSSA 1ZJ4A 1Q0ZA 4W9RA 1G66A 4Q1VA 4S0XA 4X6UA 1VA4A 1MTZA 4TPKA 4FFWA 2ECFA 2WIJA 2JGFA 4FBLA 2RI6A 3SC2A 1KU6A 3C6BA 3RK4A 5FP0A 3O4HA 4B6GA 3IUMA 2CKMA 4L72A 4XIIA 3OC0A 2ROQA 5EIHA 4BAZA 5HFNA 1MAAA 1YCDA 4KE7A 4CCYB 2HA0A 4HXGA 1C7IA 1GXSA 2WTNA 1GT6A 4C6HA 5CT6A 2C58A 4W1QA 2D0DA 1UZAA 5ALMA 5BWBA 4LXHA 1C7JA 4FBMA 5JIBA 3PFBA 1QIFA 3FLBA 3I6MA 3H1BA 1R4ZA 5KWJA 1U8EA 2XLCA 5K3BA 4FLMA 1ISPA 1BN7A 5CURA 5BV7A 3WI7A 2QVBA 4BVKA 1MAHA 2H1IA 2XT0A 4RE6A 3FYUB 5AKHA 5LZ8A 1ORVA 1SC9A 4FTWA 3WL6A 4D9JA 5AH0A 1IUOA 1ORWA 3WA7A 1LPBB 3U0VA 4ZV9A 3UUFA 1A8SA 5C7YA 2B4KA 2Y6UA 4WFKA 5C8VA 1MJ5A 2HA6A 3F67A 3NOXA 3BF8A 3ANSA 3BE8A 5A71A 3QPAA 3FWHA 5CT9A 5E4JA 3QZUA 5AICA 4OB8A 3O9MA 3VJKA 4E15A 2PUHA 5AKEA 1E89A 1TK3A 3QH4A 1EK2A 1CUCA 1G5FA 4PO3X 4F60A 1H2YA 1XRRA 1YAJA 3O4GA 7YASA 1YB6A 1DX6A 3WZMA 3G0DA 2BUCA 3V1MA 3HEAA 1UK7A 4WFIA 4IH1A 2HRRA 4GEGA 1BU8A 2OPHA 5KREA 5HK8A 2WIDA 5EHXA 3UMJA 3VXKA 3EQ8A 1CFJA 2O2IA 3HABA 3WKCA 3DJYA 1BE0A 2DQYA 3V1KA 1EVQA 3HC7A 5LIPA 1UOOA 4JH0A 4CG2A 1QTRA 2CZQA 4J0HA 5YASA 1AKNA 1VA5A 5JD5A 4WY8A 2Z8XA 3IUNA 5LZ2A 3HSSA 5CW2A 5A7HA 4UBLA 1ZICA 3YASA 3W06A 3D2CA 5AIBA 4H7HA 3T4UA 1EXWA 2QJRA 3IVMA 1N1MA 1EH5A 4Y2XA 5BWCA 1CUBA 1K5PA 2FJPA 1UWCA 4LYDA 3DYIA 5JADA 2J3DA 3STYA 2WFLB 5SYNA 3BJMA 4PF1A 3R3VA 1VKHA 5H3HA 2IIVA 3STWA 2PUJA 5ALUA 3MGAA 3SX4A 5K3EA 2WFMA 4EBBA 3G8YA 1QTIA 2X76A 5ALEA 3WJ2A 1LPMA 4Y2UA 2BGNA 4EY5A 3FNBA 5AKXA 1F0NA 4ZXFA 3W9BA 1EDDA 2Z5GA 1XZGA 4QA9A 1W76A 2GZSA 2HA3A 4Y2YA 3WK5A 3BL8A 1R9NA 3VKFA 3C6YA 4FFVA 1CQWA 4UFOA 3I2IA 1XRPA 1AGYA 3O0DA 1TIBA 2XUPA 3AIMA 4J0DA 2JGEA 2XE4A 3VISA 4FOLA 5HF8A 5KBYA 4NS4A 2ZYSA 2FX5A 1QIJA 3C87A 3WWPA 4MYDA 4J03A 4U2CA 4UHCA 4F5ZA 4GW3A 1AQLA 5I8PA 4X71A 3IIIA 5ALQA 3FSGD 4LHEA 4WJLA 2B20A 5CXXA 4H7JA 1VJ5A 2G5TA 1E5TA 3CN9A 1F0PA 3FVRA 3HJUA 3LLCA 4EY8A 5F4ZA 5A2GA 4KE8A 1TCBA 1CIJA 1JFRA 3MVEA 1M33A 2JF0A 1GQSA 2CBGA 2PSEA 3C5VA 5AKIA 5AK5A 4CIBA 1E66A 3C6ZA 5LZ4A 2HA4A 3O9VA 4KR0A 1MNQA 3K6KA 4QEKA 4BAGA 3MUOA 4EY4A 3KWJA 4BC0A 1FFEA 4EY7A 2HFJA 3E1GA 4CG3A 3JWEA 1GPNA 5ESRA 3EIOA 3ILSA 3W04A 1IUNA 4N8SA 4EUSA 2WU4A 3IDAA 3FBWA 1LZKA 3FVTA 2HL6A 3AFIA 1JMYA 2DHEA 5JZSA 1CEXA 3PUHA 5DJ5A 5K3FB 5KWIA 4I4CA 5LZ7A 2AJ8A 4F21A 4JNCA 3DKKA 4QWWA 1AURA 2FUKA 5AM5A 1IZ7A 4Q3LA 1CQZA 3ICVA 1K6EA 1CUFA 2G63A 2JGJA 2QXTA 1Y37A 1GKLA 5AK6A 2PSHA 4M0EA 1ACJA 4G8CA 1CRLA 4O08A 2WFZA 3AINA 4FDMA 1EINA 1KEZA 1CLEA 2DHCA 2I78A 1CV2A 2RONA 4KE6A 3N2ZB 2WG2A 2OCGA 3G9ZA 2PSJA 4FMPA 5EHQA 4QDTA 1A88A 3M82A 4G1FA 3M3DA 5CT8A 1NX9A 2H7XA 4PQEA 1WB4A 3M83A 5AK3A 1DINA 5IVHA 1ZD2P 3RKSA 5C81A 4MQMA 2BAGA 5HF6A 1YA8A 3WKEA 4F0JA 4OUKX 1KU0A 4I3FA 2XDWA 1SOMA 4AZ0A 2B61A 1PV1A 2CJPA 4DM7A 5HKAA 3I28A 5ALFA 1LZLA 2GYVA 4HAIA 4Y2TA 3DL4A 1BN6A 2WILA 2X5XA 3WL5A 3H2IA 5ALZA 5DNUA 4FWBA 5AIAA 4RE5A 4C4XA 5HFAA 4CCWA 1OXMA 3A2NA 3S2ZA 2I3DA 1LPSA 4XVCA 1XLUA 3C5WP 3GA7A 4J7AA 1VXRA 3W2TA 5JATA 4L9AA 3QBJA 3WJ1A 3WLAA 2VT7A 3E0XA 1WHSA 5D6OA 3WK9A 2ZYHA 4J0IA 1ZIXA 3HRHA 1BS9A 1C4XA 5EHNA 3OURA 2XI4A 1A8QA 4Y7DA 3ESDA 4H7EA 3V9AA 1F6WA 3WYDA 3TGLA 3DOHA 1UFOA 4B7ZA 3C45A 1XLVA 3AILA 3WWEA 4KACA 4BP8A 5ALTA 5DNWA 1HL7A 1MX9A 1Q83A 2PVSA 2DSNA 5JASA 1UKBA 5J3JA 1LBSA 3C70A 4J0JA 5T4BA 4FLEA 2HA2A 2OGTA 5LKRA 4IQ4A 2WG1A 3IBTA 4BDTA 3QMWA 1CR6A 3GFFA 1N5MA 2VAVA 3F9CA 2BGRA 3CCCA 3WKBA 1A7UA 1WPRA 3MUNA 1CPYA 5DYTA 4OU4A 1XZHA 1ACLA 1USWA 4J0GA 3KOOA 4ZWNA 3R3ZA 2WHRA 4OB6A 1QONA 4P08A 5EIAA 5JD4A 3SK0A 5ALGA 5K3FA 5AI8A 4WDQA 4AO6A 5LZ5A 2W6CX 1WB5A 4A23A 3DS8A 4OSEA 4DTCA 3TRDA 4A5SA 4UUQA 3B3QA 4NMWA 2I3ZA 2ORYA 3AUKA 3ZV7A 2QMQA 5ALYA 3D5EA 5DTJA 2QJWA 2G5PA 2QZPA 1MN6A 1EVEA 4C89A 5FOQA 3HI4A 1TCCA 4MWTA 4K6KA 4B84A 2XUHA 3ANTA 3H2GA 4X95A 1NU8A 5DWDA 4HS9A 2J4CA 1F8UA 4DSZA 4E11A 2I03A 1XZJA 4AMZA 3ESBA 3PUIA 3F96A 2VEOA 3B5EA 5T4FA 3IA2A 3QMVA 3DQZA 4RGYA 2ZVDA 1VLQA 2WHQA 5FPQA 2ACKA 4UBIA 3LS2A 3V1NA 5ALNA 4K2AA 5AO9A 2WIGA 1E3QA 4Z49A 2XMBA 3QPDA 3DKRA 2OAEA 1FFBA 5AOCA 4G4IA 3WMRA 3I2GA 3FYUC 3I1IA 3NUZA 5JZBA 2XQJA 5FV4A 5AM2A 2XUQA 4MYSA 3EBLA 5I9IA 2XMSA 2QUBA 3WK6A 5AM0A 1ZD4A 1JMKC 2C0QA 4H77A 1Z68A 1BEZA 3U1TA 1RP1A 2VJDA 2BCEA 5HZGA 2V97A 3FYUA 4B80A 2QM0A 2ES4A 1P0MA 2XUAA 1IUPA 5AHXA 5A62A 3G0BA 4J3JA 4MWSA 1TRHA 1XLWA 2Q0XA 2AJLI 5CT5A 4UFPA 5ALXA 3LIPA 4UHHA 4HRYA 4H7DA 4P93A 5DTIA 3WKAA 2BKLA 4ZI5A 5JAHA 2WFLA 3A2LA 5BOVA 2ZJ7A 1UK8A 5JD6A 2OQIA 2VATA 4DIUA 5C8XA 4FHZA 4IHAA 5AM3A 1CUGA 4DSAA 3GROA 4U2GA 2DFPA 2XQKA 2HHAA 5FKJA 4BVJA 2IX9A 3AIOA 1GGVA 3QVMA 4QE3A 2YH2A 2VJBA 2WUFA 1OILA 4DGQA 5HF5A 5JANA 4OYYA 1YR2A 3HZOA 1MO2A 3PICA 3QMMA 4GWLA 2JGKA 1G4HA 1VOTA 5JAPA 4W1RA 1XRLA 3JW8A 4M0MA 4YPVA 2VJAA 3H0CA 3T52A 3G9XA 1ZD5A 5CBKA 4X92A 5CH3A 4KRYA 5IKXA 1QO9A 4LYEA 1VZ3A 3DCNA 1UK6A 3Q8WA 4DMCA 3A2MA 1EB9A 2RHWA 4NZZA 4Y2PA 3BF7A 3OTQA 2ONCA 3CXUA 2ZJ6A 5CH5A 4B82A 1L7RA 3FYTA 3I1YA 5AI9A 1VE6A 4N5HX 1LLFA 1QO7A 5EFZA 3N0TA 4ROTA 5SYMA 4TVKA 5AI5A 4BE4A 4QWMA 4YX9A 2RHTA 3WL7A 1XQXA 4HXFB 2HU8A 4GHWA 1FFCA 2WJ6A 1XQWA 4E46A 5LLSA 2WG0A 4BBZA 2W22A 2LIPA 4W63A 3FOBA 4LXIA 4X7BA 4QDZA 1U4NA 3BDVA 5FDFA 5FPPA 4KAFA 2R8BA 4G5XA 4L3WA 1DWOA 1QGED 5AKYA 2HU5A 4BRSA 1THTA 1HLGA 3IUJA 5ALJA 3ZLTA 4XWGA 4J0CA 2QTBA 4H0CA 2ZSHA 3B12A 2WJ3A 3AIKA 3H04A 4ZGBA 4BZZA 1QLWA 3WIOA 4GLBA 1DWPA 1EDBA 1ODSA 2WUDA 3DLTA 4BP9A 1L7AA 4YASA 4B9EA 1LPPA 1Y7IA 4OPMA 5ALVA 1SFRA 1UOQA 4CCYA 3G0IA 3BDIA 1ZJ5A 1DQZA 1XRNA 2BUAA 2WHPB 3R41A 4K6HA 3WK8A 2IITA 1GKKA 2FJ0A 3DNMA 5I7UA 1UKCA 2XMRA 1XZKA 1G42A 1I6WA 5LP1A 4Q3KA 2XMGA 4UBOA 4JYPA 4ZREA 5AM1A 2AJCA 3A6ZA 4CG1A 1QIHA 2O7RA 1QE3A 1XKTA 3D2AA 2Y1KA 3H2HA 1O6FA 4H18A 3ZLVA 1ZD3A 2XUIA 1WB6A 2RGUA 5JZ9A 3VVLA 4BTLA 2Y6VA 5FLKA 4HVTA 2C0PA 4HXEB 2JGLA 3EQ9A 4BDSA 4UBJA 4C87A 4X6YA 4CI9A 2OQVA 5AI4A 4X00A 3HXKA 2EDCA 1QIEA 4I19A 1JU3A 4PSCA 4LKOA 1ZI6A 4UHDA 3WWCA 1EX9A 3R0VA 5AJHA 4BRZA 1MPXA 1VE7A 5IVDA 3G0GA 1D07A 3RARA 4EZIA 2OCKA 1WHTA 4PSUA 1WM1A 1XZDA 1XKLA 1ZGCA 2PX6A 4HRXA 3ZWQA 3Q0TA 1DWQA 1DU4A 1HKHA 5DNVA 4DNFA 4NVRA 4RPCA 1TAHA 3DYVA 2HA7A 2GZRA 4JUIA 4GECA 3BJRA 1XFDA 2XUJA 5CXUA 2GBGA 3WWDA 1B6GA 3BIWA 5EIEA 1JI3A 2XQGA 4OU5A 1B41A 4OYLA 3L1IA 3V48A 4N8DA 1JJIA 1HDEA 1YS2X 2J4FA 1O6GA 2WQZA 5D7BA 1QIMA 5IVIA 1ZIYA 2VAXA 3ZPXA 3R3WA 5AP9A 1TQHA 2WKWA 4BCBA 3DDUA 4X85A 4U2BA 1EI9A 3G0CA 3K2IA 3RM3A 1XZMA 3R3YA 5A6VA 2DQZA 4OCZA 2H7YA 5JARA 5ALKA 3R40A 1LGYA 2VTVA 1K63A 2OGZA 2ZYRA 3H17A 1BROA 4AB1A 1GPKA 1CUJA 3VDXA 3L1HA 1X2BA 1T2NA 2VT6A 3F8SA 4KRXA 4X93A 4FNGA 1R50A 1XZLA 3WWOA 4Y2QA 3UUEA 5LKAA 2NW6A 2PU5A 3OOSA 2QKYA 3WQHA 4KYVA 1ZI8A 4BTVA 1JT2A 4OB7A 4PV7A 1IZ8A 1R1DA 4G9GA 4GBGA 2CEKA 5FUMA 3WK4A 1BCSA 4CIAA 5ALSA 1GQRA 4K5QA 1QZ3A 2WTMA 4UBKA 2OG1A 2HM7A 3HYSA 3I2KA 3OG9A 5K5EA 3WYNA 1AUOA 2QR5A 2WUEA 3VJLA 4BE9A 3LCRA 2V9ZA 2XUDA 3VVMA 2PKYX 3LIIA 3DEAA 3EQ7A 5EHZA 3A70A 4QDXA 2C5FA 3D59A 3BWXA 3I2JA 4WDRA 3C8DA 3IUQA 1J2EA 1YSCA 1P0QA 4C88A 2XUOA 1EA5A 4XJVA 3FAKA 3PI6A 1WOMA 4QLAA 1DT5A 5CTAA 4AXBA 5HQ3B 5K3CA 1IMJA 4B83A 1CUAA 1W1IA 1R88A 5AI6A 4EA6A 2XMCA 4G4GA 1GZ7A 1QOZA 1SCIA 3S8YA 2PU7A 2WM2A 3QPCA 4Y2VA 1MX5A 3KXPA 4WFJA 2XB6A 3PE6A 1CUIA 4N8EA 2WU3A 2GBIA 5AKGA 3AZQA 1XZCA 1HQDA 1N5RA 5A7GA 1NU6A 2AXEA 1CUHA 1E8NA 4J0KA 3WK7A 4PSDA 4ZRDA 1YB7A 3H1AA 3BIXA 4DLNA 1JKMA 2DR0A 1QFMA 1LPNA 1BRTA 1XZBA 4W1PA 4JEIA 3GZJA 2HU7A 2Y2VA 5ALDA 1DT3A 4QLOA 3C8HA 4Q82A 5IH7A 1JJBA 1MT3A 2B9VA 3D7RA 5ISMA 2EDAA 4A16A 2ACEA 1MU0A 1XRMA 2AJDA 4WY5A 1K8QA 3NWOA 1VXOA 2V96A 2K2QB 4KAAA 1W4LA 2BJHA 3IULA 1EHYA 4GDMA 2JEYA 4UBMA 4JYMA 3STTA 4MEBA 2JBWA 4IH4A 5T4EA 1OCEA 1JJFA 4L0CA 1K4YA 1UT6A 2P8SA 1XZEA 4WCVA 2HADA 2OGSA 2GYUA 5ALOA 4Y2SA 3ESCA 1S8OA 3C43A 1X70A 2J3QA 3FLAA 3PDCA 5CRIA 2O2GA 2H9YA 4C01A 3WL8A 4GXNA 1YS1X 3STXA 1RWQA 4QDOA 3PF9A 1BCRA 1EB8A 5HKBA 1CUDA 1R3DA 4BCDA 1DTEA 4B0OA 4G9EA 2YASA 1QFSA 1XQVA 1JU4A 4ITVA 3WA6A 5T4HA 3KWFA 1GPLA 1QIDA 1J07A 5E2IA 2O2HA 4X90A 4EB0A 2JEZA 4H7FA 2GBFA 4KJXA 4B81A 1P0PA 5HQ3A 4Y9SA 2XUGA 3JYHA 2Z3WA 4U2DA 4AN0A 4AX4A 3R3XA 4B9AA 3D0KA 5AKJA 3H2JA 4H7IA 4AN1A 3C6XA 2XQFA 2WUGA 1HPLA 4HTAA 5EGNA 4U2EA 3RLIA 1CUZA 3AJAA 2EEPA 4H7KA 4P9NA 3VJMA 4YK7A 5ALPA 2YYSA 3GELA 2PBLA 3KDAA 3I2HA 4ETWA 4X91A 4N5IX 4UPDA 4IO0A 5D3KA 1FFAA 4KE9A 2UZ0A 1FFDA 2WJ4A 1QJ4A 3KD2A 1FJ2A 3WIBA 4MXDA 2PSFA 5DYWA
chains in the Genus database with same CATH superfamily
1KOFA 2WTBA 1XZQA 4YXWD 1Z6AA 4RKWA 1TO6A 3KU4A 4RHYA 2PRIA 1I01A 4HWTA 3L7BA 1A69A 2F9FA 3PUWA 1AQUA 4JBXA 4K03A 5TB5A 3R7BA 1RW4A 2R66A 4ZQCB 3ZU5A 3HRIA 5FWDA 4Y2JA 1Q44A 5CH8A 5ALHA 3NS7A 3RC1A 5ADWA 4RMJA 1TYAE 5CEEA 3I2FA 2Z6AA 2Z3VA 3GFRA 2IIPA 1GCOA 3RFXA 3MJHA 3VZPA 2JIDA 2Z08A 3HUEA 3FTDA 3MS7A 2OVFA 2ZQ5A 4XYGA 4EEKA 4FC7A 4I1RA 1QIIA 2NO1A 1QH8B 3VR5A 1NMQA 5FL7D 5CA0A 3HV2A 1GGEA 1W34A 2YVKA 3WDSA 1LDMA 2MU1A 3Q3CA 4GZ6A 3TJMA 3W6ZA 4D8XA 3PJEA 1TKRA 5K05A 2HFKA 3OOHA 3ZIUA 3SQXA 3CZQA 1KI6B 1L4MA 3E3LA 4K46A 5DYGA 5LBTA 3JV7A 3ZWWA 1M2JA 3SSAA 2BMAA 1T4CA 1JQKA 1H2BA 1DC6A 3MINA 3L7IA 3ZU2A 3SSOA 3DM9B 3DT9A 1N4AA 4JLKA 5ALIA 1ORIA 4V0NA 3REQB 3LLSA 3TE7A 4DLYA 3HYNA 3PC6A 1J0DA 3P9YA 4B47A 4BNFA 4E2YA 1RCTE 1F14A 1T4CB 1YCGA 5FBQB 1DEXA 1MX3A 4UZEA 3N7UA 3DL7A 1JIIA 1UDCA 4IUCS 3RTBA 3W2FA 3WIUA 3I76A 3L8GA 3RKUA 1Y1PA 3VH1A 4R98A 2X4GA 4IHJB 2C7GA 1JXMA 4FIDA 1D6SA 1W52X 3O26A 4RIGA 2B69A 4XD2A 5MGNA 2G67A 2YRWA 3FOWA 1USVA 1CUEA 1DMRA 4C07A 4HAUA 3X3HA 3CLUC 3GDWA 4LQ4A 2GFIA 3RC8A 3Q5GA 2XDAA 5KNCD 1DX4A 3K4PA 1EVIA 1OPXA 4LE2A 1IPEA 4NBUA 2DPYA 1IH8A 2XCIA 4JBLA 2PS1A 3KQTA 4MUJA 2XXJA 2PR2A 1PG0A 5IM4F 3SWWA 2FMKA 3NV9A 3BGIA 4ONEA 1F4PA 1E0DA 2PWYA 1RJFA 3N1UA 4CEJA 3T1QA 1E9DA 4Q05A 3WGMA 1GG9A 3ZIDA 1NJ6A 2GX6A 1Z18A 3KR1A 5KX5A 1Q0HA 4DLUA 4MPRA 1CERA 1F5NA 3RSLA 1EFRA 4D4JA 1UH5A 2JFOA 4Q3OA 3UMCA 3IURA 4TX1A 1RM0A 2VG8A 1QRDA 4OXYA 4B3HA 4X24A 3PRKE 1NV9A 4NABA 3BREA 2PD3A 4XI9A 5TX7A 2RB5A 1QSGA 1J8QA 1VHLA 4MW2A 5ENDA 5EI5A 4C3ZA 3OIGA 3U61B 2ZUVA 1N2GA 1CZKA 1SQGA 2VNSA 1CHDA 4JXJA 3A3OA 2UZIR 4KKVA 4DMFA 2J3IA 2ARKA 2QYOA 3LU1A 1QS0A 2AEJA 1KO4A 3UYKA 1AKRA 1PK8A 1BHJA 1PT5A 4UU0A 4AJ1A 5K0JA 3ZNQA 4I1PA 5DIZA 5FI1B 3DHNA 5JFOA 4JLOA 3K5WA 4FFPA 1DUIA 3U17A 1PCXA 4BC1A 1CZHA 3CEPB 3FETA 4X94A 1SB9A 2Q7XA 3BS4A 3E9CA 3G8AA 2IDJA 1UPUA 3OQBA 3UO8B 2VQ6A 4DYHA 4E2XA 5AW2A 4BNLA 4JN6B 1E3JA 4RMHA 1Z4PX 2BBSA 3L4SO 1QOQB 1T25A 3G2IA 4ZOQI 1QGUB 5LQDA 2UZ4A 2MSLA 1U4SA 1JDBC 1KI7A 1XPRA 3CH5A 3O4IA 4WUVA 1ML4A 4FKBA 3V8VA 3KLNA 4B34A 1EUQA 1T9KA 1V26A 1XQYA 4OFXA 4EPRA 3WB9A 5KVCA 2VSYA 2HKIA 2F43B 3FNHA 3JQ9C 4CKWA 2C5GA 3IDFA 1XGKA 1RAEA 2I6UA 3RSOA 1ECBA 1CZRA 1UJMA 3PRHA 4YO7A 5I51A 5GV7A 1OLUB 3VZBA 4MUMA 3G1UA 1I4WA 3CRW1 2YVUA 1H0SA 4L73A 4MKZA 5K4AA 1C4WA 1KZ1A 1VI6A 3L7OA 1JQ5A 1U7DA 3VNQA 3DBRB 1ZHOA 5JAUA 4WLFA 4PXAA 1FNDA 5DYIA 1DPFA 3LRXA 1QIGA 1B26A 2JEOA 2WPNA 4N0PA 5GVSA 3USZA 5ALLA 3PTZA 2G8NA 1P61B 3QHAA 1NX6A 3U2QA 3EIUA 4KQ9A 4JLAA 1HL3A 2BP7B 4B0PA 1B76A 3EODA 1UKAA 4I50B 4XE5A 5LZ9A 1AQYA 4MV8A 1WSAA 1CVIA 2VP9A 4J8PA 1KPGA 1VMDA 1PJTA 3P2EA 3QIAA 4MVJM 2KI5A 1IMOA 5ALWA 1H66A 1W0JA 3FR7A 3PQ3A 2Q45A 4RCYA 4U6SA 2OAGA 2VJCA 4ZV7A 5IMSA 4NCAA 3ORSA 4HH4A 1VI5A 4GM0A 2ZUFA 4CDGA 1TA0A 1TGYA 5KYUB 5HMLA 1IVYA 1CQIA 1R2QA 5AFSA 3AIIA 1VRCA 2YS6A 1LDNA 1A8UA 1MB4A 1E8DA 2OCLA 4NPAA 4ZT3A 1GLNA 3NTVA 1T2CA 4F6RA 4TSKA 1VL6A 2PM8A 1G7SA 4X54A 2DFLA 2FN4A 2P8JA 3Q10A 1VKRA 1GV1A 1O58A 2TSYB 3H6KA 1SC3A 1H2XA 3IP7A 3UXEA 3ZTWA 4DA7A 2SKDA 3QVUA 1ZEMA 4PHCA 2FN3A 4PAWA 3TKAA 4C0AC 5JQWA 1RPNA 4F4DA 3RGGA 5CJ2A 3BG5A 1R4MB 4IDQA 5LA6A 1T2UA 4LJ4A 3ETLA 1E4EB 1RRCA 4M3NA 2X0IA 3OY2A 3F90A 5L3SA 4R8VA 1Y1RA 1EDZA 3EK2A 1U7OA 4I1UA 3WFIA 4C76A 4F96A 2RGYA 1ZNXA 2GK3A 3E03A 4WZAA 1SXJC 1WZUA 4UNQA 4ZANA 4P35A 4YUZA 1R0KA 2B34A 4AMUA 2Z8ZA 4X1YA 1W75A 2BM9A 1KJNA 3I62A 2J6CA 5IDXA 3CN7A 4RJIA 2OSVA 4DVJA 2D5LA 4QEDA 2OO5C 3C24A 1EYZA 1XRQA 1TK9A 4IH9A 4DSNA 3LP5A 2R87A 3GN2A 1ZISA 4ZK2A 1ZS9A 4PSVA 2NXCA 3AY6A 3GFTA 4BMNA 2G9RA 3NTRA 1LCIA 2XE6A 5KOHA 1SVKA 4K05A 1ZU4A 2C96A 2FSIA 3BZWA 2QBYA 4M0FA 5HRAA 4RMGA 4RC9A 4RJLA 1OXTA 4URWR 5FRDA 4DYDA 1B7GO 3KUCA 4PNZA 4NIMA 1SZCA 4F12A 4UTVA 5KJCA 4GO1A 3CF4G 4O5AA 5EP4A 2Z2JA 3BD6A 4D9EA 3K2EA 1J33A 3GIWA 2GZ2A 2QTWB 1JIVA 3DBHA 1ELOA 1H22A 4BWYA 1NW5A 5JALA 4YHHB 3G02A 1P45A 4EJ2A 5F9HA 1CS0B 2RH5A 2O8EA 4YMIA 1VLZA 6YASA 2CWDA 1DJQA 1GN9A 3L07A 3D3KA 2VP3A 3JARB 5H4GA 1EGVB 1ZI9A 3NDRA 2CY0A 1J06A 2CYAA 1X77A 2ZIAA 5CD9A 2GD2A 1I7SB 4R0NA 2RCNA 4X3CA 4RSGA 3E8XA 4S1VA 4RXMA 1W6UA 4BCCA 2XMQA 3KIPA 4C4YA 1UDAA 5FAXA 3TDKA 3HL0A 3K5HA 2UDPA 3FLEA 2FV8A 3PFCA 1H8HD 2YJTD 1QHYA 5AM4A 2FW0A 4E03A 3GYBA 4E3WA 1Z2CA 3MAAC 2Y0DA 4QQFA 4ACAA 4GC9A 1M2NA 4IEEA 4KYIB 5K3AA 4AMBA 3EXFA 1EFPA 4HB3A 2LCFA 4NF2A 1PZHA 1XAJA 2ZWMA 3UMMA 3J80A 2NUBA 1DBSA 1WCIA 1DRUA 3HBLA 3TNFA 4B31A 2CMFA 4MUNA 5HJ2A 1RAGA 5LJLA 4PFJA 2F55A 4HR7A 3PQEA 2WA1A 3NOQA 1E1LA 3PDWA 4QDUA 2OM6A 1GU7A 1Y3HA 3UV7A 3OTOB 3PLNA 2B0CA 5FPSA 4DDKA 2AWNA 1DRKA 1FTNA 3NO4A 2I2DA 5KNBA 2QZ9A 4CFSA 3ILYA 2XAAA 1T26A 1I5EA 1B6SA 3GNTA 2WJGA 5AKKA 2ECPA 4CW7A 1MW9X 1NXWA 4LC9A 1T8SA 1NOIA 2ZRAA 1UOPA 1VLMA 1RYNA 1EDEA 5CLIA 4N47A 2CXTA 5CCEA 2PXAA 1FDOA 3JASA 1PX0A 4JC8A 3VOTA 1T1EA 2C5EA 4Y2HA 4WX2B 2N3ZA 3CLRD 1VE5A 4RH0A 5D3ZA 1QYIA 3KJIA 1E5QA 3ROTA 1I80A 3G23A 4JOCA 4RH3A 4LJLA 1N2EA 3N2GB 5ECGC 4C4ZA 1ISGA 2QRQA 4Y30A 2GYWA 3FGPA 5GGXA 2R4TA 4QXRA 1XCPA 3PENA 5KYYB 2QS9A 2C88A 3HDGA 3JQ6A 4DBZA 1K0UA 3GAZA 4WT7A 2HDWA 1FW8A 3F4KA 4MO9A 4C0HA 5LVAA 2QM8A 3WGIA 3HU2A 3V46A 2Z5VA 1U94A 1GGHA 1U1GA 2RBKA 1UJ2A 2ATVA 2WV7A 3C48A 3HN7A 3OPMA 4FXOA 4P3XA 4X6XA 4DW8A 3T5AA 1YI8A 2ZS7A 2PA3A 2R65A 3FY4A 3FSEA 4OLJA 5JJKA 3EZGA 2GUGA 4L7QA 5EWMA 4ASUD 1SBTA 1FIUA 3BGVA 4QGSA 1YASA 3EOZA 4X97A 5ENVA 3BMXA 2NVBA 1G5IA 5BR4A 5IG2A 1ZW1A 1F0KA 2DEUA 1DG3A 1CWUA 2OO5A 1MC5A 4LN1A 1D4ZA 1RXWA 1RKQA 4ZYUA 2BZ1A 3KXIA 4EPYA 2PSSA 2ZT8A 4MV4A 4FFRA 5F5LA 5BUCA 2YKGA 3CTPA 3Q6MA 3I0MA 2V7XA 4Q4AA 5TQ0B 2D13A 3OEWA 1FYWA 1WPXA 5AW3A 2QSJA 3JPYA 1GQQA 4CM8B 1V8OA 5KNDH 2B7BA 1US8B 2YBDA 3AL2A 1P5FA 2OSBA 3KELA 3QX9A 4RM3A 3R7NA 2WKRA 3SLGA 1X8LA 3PFFA 2WIKA 4KQIA 2Q9AA 3UA4A 4AURA 5BSKA 2Z8YA 4EHBA 4B2YA 1W1UA 2QORA 3FHOA 1V8BA 2CXRA 4QC2A 4UKDA 1W6RA 2GZ3A 4DA8A 1L4HA 1YZ3A 2CF6A 3A37A 4XX1A 4QRDA 2EZUA 4QO7A 4YV2A 1YV9A 2AN4A 2X5NA 3NRJA 5LUBA 3IR6A 1AMNA 4JJ4A 1ZJ4A 5TF4A 3U4HA 4W9RA 1EFVB 4HLCA 4OKNA 3AESB 4LSMA 4J6FA 1VA4A 5TEVA 4ZV4A 4TPKA 5LLDA 3GLHA 3EE6A 3JATA 3LQFA 4FFWA 2VBGA 1X92A 3GLVA 3IQXA 2C31A 2EQAA 4UW9A 1SEVA 3R7DA 5ICMA 3CISA 1W96A 4FBLA 1RC0A 2AZTA 3E84A 2JAXA 1LDBA 1Z47A 3C6BA 1EVKA 1LRKA 3CH4B 1EG2A 4F3YA 2JK1A 2UYQA 5E7JA 1ZD9A 1I51A 4J0FA 4URVR 3U13A 1O57A 1WZIA 3A1CA 2Q62A 1HYBA 1IM2A 1BFDA 4R8SA 621PA 4CCYB 5KWVA 1GXSA 2JGRA 1HDOA 2GN8A 5KTKA 1DNPA 1S3GA 4MRRA 1U0HC 1GT6A 4DB2A 4C6HA 2E37A 3T4XA 5G40A 1UM8A 2BBWA 3CLSC 1KZ9A 1UZAA 3HDYA 1LTKA 4MUKA 4PYJA 5I5GA 4MCAA 5CM2Z 3B9PA 4FBMA 4I50F 2HHHB 2GRJA 1HK7A 1KARA 1RQLA 2ZJAA 1QIFA 1HV8A 3EEQA 1EX7A 1T3GA 1ESDA 1P1CA 3FLBA 3GMTA 3H1BA 3IGFA 2ZRPA 3T3HA 4FLMA 2O8CB 1ISPA 3BRQA 3OE7D 2QU7A 3DVAB 2QJFA 4DLSA 3TB6A 5DSTA 4CKEB 3PX2A 3L40A 2IU3A 2QVBA 4QTUB 2H1IA 2XT0A 1E6MA 1IPHA 1E0SA 3OUUA 4TWAA 3C3AA 5TC4A 5KI6A 3ZHQA 3ZW7A 5HM6A 3PNKA 1XF1A 4F4FA 3B1KA 1AA9A 5DCYA 2BGJA 1M6VB 5AKHA 2QYTA 3OQNA 2JS7A 5HCNA 2CV0A 3F6RA 2R84A 2BGKA 2X9GA 4UVGA 1XMJA 4NENB 3CZCA 1SC9A 4PGMA 3CJQA 3RHZA 4GGPA 3NUQA 4RV5A 1YJ5A 4CM3A 3DE1X 3R0IA 1Q91A 2PDAA 1EAMA 1Y89A 1IOVA 2KB0A 3GLQA 4GX1A 4KK4A 1M5TA 4L95C 3X2FA 1TD9A 2BEVA 3I6IA 4KMRA 3KQUA 1QDLB 3U0VA 1E62A 2A0YA 4EKGA 1GQOA 4NBKA 2O8VA 3NGLA 2YDYA 1Y4DE 3AI7A 1U9JA 4K9RA 3D02A 2CCJA 4CQMD 1SIUA 4EO9A 4LMRA 1K9SA 2I91A 4D4LA 2NXJA 1HYEA 1PR0A 4AD8A 2IOFK 2ZK7A 1FFYA 2GHTA 2VH2A 1XNRB 3BBLA 2P79A 2W6ID 3PC8A 2CHUA 4NLLA 5C31A 5LMZA 5LQKA 4TTRA 3BE8A 1B15A 2DSTA 3MBKA 5A71A 3OF2A 3E3MA 5FO0A 1IJFA 3LKVA 4A73A 5JS6A 2Q49A 3ORRA 2CYBA 3B5JA 5EESA 5ELLA 2XVYA 3EVCA 2Q9CA 1NGSA 1V8FA 2CLSA 4J16C 3Q40A 4NOJA 4C9BA 4BZXA 5CT9A 1C1HA 2B5OA 3OMWA 1GO2A 4P0TA 5HX7A 4D9NA 2VH1A 5CB4A 4P0QB 1S3IA 1IB0A 2GO7A 2ZSFA 3ELWA 5C7OO 4N49A 2F8SA 4PS1A 1G38A 2D1FA 4NNOA 2PUHA 2W7TA 3A9RA 3MBOA 2X14A 4Y6RA 5AKEA 4WXHA 3RBXA 3LHKA 3W9SA 4CQMB 2F90A 4MQ6A 1CUCA 3NHZA 1G5FA 2CNLA 4KAXA 4R1SA 5DLQC 1S1CA 1GEGA 1R5NA 1XRRA 1K4KA 4JP2A 1U2ZA 3JWJA 1JN0A 1RC1A 3KHUA 4V3CA 4WESB 1XKQA 1W36C 1BXKA 3NIBA 5JAZA 2AZ4A 3HCBA 5JSYA 3OEHD 4KGVA 3V1MA 3EEYA 1GSIA 1UK7A 2RC6A 2A86A 1LRLA 1KE1A 3UAXA 2BI4A 3L8EA 5BV2P 4KIWA 3OZSA 4G5SA 5F35A 2HRRA 4ECEA 3B82A 3HH8A 1QFJA 1L5OA 4N5LA 1G3RA 2EHJA 1BU8A 4FDVA 1JHYA 1E9CA 3ZGZA 1ST2A 3BTSA 5KREA 1SQ5A 3O3CA 1NW9B 2JW5A 2C7VA 1TLTA 2WIDA 3IAAA 3Q3GE 2VJMA 4G01B 2D6FA 1U2GC 4LWZA 2VHVA 5EE1A 3ZJTA 2AOWA 4IGEA 4O02B 4EL0A 5IWCA 1YRAA 3W5CA 4ER6A 1Y9JA 2ZT7A 4JCCA 1C3OB 3ORQA 4D3FA 4UNNA 4LNUA 2ZBEA 3WKCA 4KXFB 2DQYA 2GJ8A 2C83A 2I34A 3HC7A 5LIPA 1K7SN 1UOOA 1O5IA 1JXQA 2O06A 2FMHA 1MAWA 4JH0A 1ZVJA 2XKAA 3TLMA 2B2NA 5B55A 4CMEA 1RAHA 1HNNA 2CBZA 4WY8A 1P7YA 2WYOA 2Y68A 4AYXA 5LZ2A 2GXAA 4BO5A 3HSSA 5B2ZA 1B8UA 2B3DA 3L6BA 1V96A 3YASA 1MPTA 2NOAA 4QAJA 1XDBA 2IH4A 1V8DA 4WBNB 5AIBA 1ZM2A 1ORHA 2I2FA 1XYVA 3GRUA 4H7HA 1EXWA 4TLCA 4X45A 1KNQA 4JDUA 3D64A 4O1IA 3SHVA 2N46A 4AZ3B 3UENA 1R5BA 1G0OA 2A92A 2BH9A 5SZKB 1TT5A 2YOFA 1IL0A 2ZJBA 2G88A 4YP7A 1V7CA 3OM0A 4ZGWA 2ECKA 3SN6A 5MN6A 1E59A 3DYIA 1Y9DA 3E9DA 4LDPA 3T9DA 3VR1A 3O92A 1AKWA 3L6UA 4KXMA 4D82A 5JADA 1TI7A 2WSBA 1QKIA 1UIRA 3VQTA 1IXZA 4KN9S 1LUAA 3DBRA 5SYNA 1YZVA 5D8DA 1CKEA 1PQPA 2HBYA 1T43A 2JAWA 2Q3JA 1VKHA 1XXHE 3PNYA 4TSFD 1WW2A 3VU1A 3ADCA 3R44A 2BKVA 4KLAA 1DO2A 5ALUA 4MTLA 1XQ9A 3KKNA 4E70A 4M0LA 3SOPA 2WFMA 3EMKA 1Q7RA 4EBBA 3F2VA 2X7HA 3U3MA 3G8YA 1NXXA 4LF9B 3T34A 2XYHA 4IJUA 1QTIA 1QYXA 2B4TO 3L5KA 4NPHA 4KRFA 4EY5A 2JD0A 4HI0E 4L9WA 1ECPA 2DH6A 2HY7A 3K1ZA 3BE5A 4L07A 4KIUA 4BVAA 3TVTA 1W5AA 2ZCVA 1FNSA 2YYYA 3NP7A 1NRIA 1T91A 1ZCZA 3LP8A 1YHZA 4MVJH 3WGGA 2VSNA 3BCUA 2PMEA 2AOTB 2CFOA 2DBYA 1KMQA 1ODKA 2YZ2A 2G9UA 2GZSA 3P4UA 4MVJE 3TVDA 3QU5A 3DR3A 2IHZA 2H59A 4MVJF 3IMFA 4F1WA 1JB9A 3CNHA 4FP9A 3NT4A 3EXIB 4EPTA 5KU7A 3I2IA 4J9VA 2MIIA 5E6SB 3VZRA 2QG9A 4AKEA 1RRVA 3KOUA 3AIMA 1NUQA 3PA8A 4J0DA 4RZ3A 4YY3B 3IOMA 4CIWA 4JLJA 1YBHA 1RHRA 1YFZA 3BJZA 3KXLA 2VS1A 4J4TA 2F9LA 4KREA 1UKEA 1GARA 3T7KA 4ABYA 2D3WA 3EG9B 4CU2A 1C7FA 4DR5B 1H1DA 4B5KA 3S44A 4F4JA 2B1QA 3AXSA 1Y9AA 2EX0A 3ZY6A 1ZLYA 4PYMA 1SVMA 5BMVF 2QTGA 3I5MA 5DP2A 3NM5A 2JJ1A 1PWEA 4J03A 3LOPA 4U2CA 3HKEB 1Z5OA 2E6UX 2X0NA 1KHHA 3L1KA 1WV1A 3QX8A 1FP4B 4KGZA 1B42A 4G1CA 4AWAA 3RRXA 3O94A 4F5ZA 2ZUEA 1Z2AA 4B3RB 1UBMS 4UOQA 2XIJA 3ZR4B 3B6EA 3CF2A 3L7MA 3KQPA 2IWHA 4BLOA 4X71A 5L95A 2UXDB 4JB0A 5CDYA 1Q1NA 1QTNA 3U44A 1Y6GA 4EX7A 1M5RA 2Z58A 3OM1A 3UQYS 1FTWA 3JQ7A 4TKUA 3FOCA 3K72B 3K7EA 1Y4SA 3W5HA 3AVXA 1FYXA 4LHVA 3PFNA 3OMXA 3W1EA 4US2R 3C85A 2YFYA 3ITNA 3M6AA 4YLGA 3QOFA 3CN9A 2WZBA 4YDSA 3I04A 4L6CA 2ZRBA 1P8AA 1RI1A 4TL9A 3AC0A 1YQ9A 3BRWA 1HR0B 1Z2DA 4GNRA 3FVRA 4S12A 2E87A 3FOFC 4ALLA 4EY8A 2QVYX 3CEHA 5A2GA 4HEHA 3K8ZA 2VNJA 3FFXA 4H4DA 2NGRA 1E94E 7GPBA 2ZQYA 1CIJA 4GSLA 2W70A 3X1XA 4N12A 3RVMA 2QN7A 2VK4A 5DM4A 4YMUA 2H51A 3DKVA 1DKMA 1SKUA 3KG2A 1U3DA 4FEYA 4GPEA 4NYJR 1OZHA 4ZVNA 2CBGA 5H9VA 3RKRA 4KV9A 2EFEB 2YINC 3LVFO 3Q6NA 5DXAA 4BS9A 2CMGA 3ENNA 1XLTA 1HUQA 2WNHA 1RADA 4YXWA 2WT8A 4CIBA 4HQ6A 2ID9A 2MHCA 2PGIA 3FKSD 1XPJA 3DBHB 4LKRA 2DCUA 4LY3A 4PR0A 3E22A 3Q9NA 1VIMA 4R2IA 2A2ZA 5J2TF 3IP6A 1G4AE 3P0FA 3SG0A 1SBQA 2HDNB 2PV7A 1MIHA 2NU8A 1G8JA 4EJ0A 2BEWB 3NTXA 1PVDA 4NYIQ 4R54A 4AJNA 5LNK6 2Y1LA 4H3SA 3K70C 4AIRA 4U02A 3OEHA 5KOHB 2P6RA 3F6BX 2I6TA 4U7FA 3GOHA 3MA0A 2OFOA 4NZOA 1ECLA 3KR0A 3MC1A 3OIUA 1R0WA 1J42A 5TNXA 4B3GA 2JGNA 1NP3A 3KSDO 1T4DA 3QUQA 1O94A 3E1GA 1HE1C 3I42A 1KO7A 4MCJA 4D9BA 5HHTA 4CXMA 1I94B 1ESCA 1KYZA 4RZ2A 4RKFA 1YKFA 4FT2A 1IUNA 4ISBA 3GUHA 4N8SA 2WWGA 2P68A 5FFNA 4D4HA 2M6SA 4DCTA 4OQEA 3ESYA 3FBWA 1PEDA 4AJJA 5C51B 1T3TA 4M1SA 4WKBA 4Z1MA 5K20A 4JL8A 1HT1E 4M55A 5KCMA 1ZCJA 2ZQZA 2NUTB 1P1RA 3EPLA 5JZSA 3JR7A 2YQ4A 5L4LA 3ILHA 1U8AA 1DBRA 4IGIA 4FYKA 1TF5A 1XT6A 2ESRA 4FEAA 4PXYA 4X8LA 5K3FB 2BISA 4MLCA 1VDZA 4U0JA 2H1LA 3C2QA 3ITEA 2AJ8A 5IC5A 4G0QA 1UMDB 3DKKA 1WCIB 3HDJA 3UAZA 1I3MA 1AURA 1LI4A 3FCEA 4F86A 2AD1A 5AM5A 1EFPB 2J08A 4MUEA 2R8EA 2D8MA 3EZ7A 1HT0A 1K7EB 2TMKA 4PE5B 3WIDA 3C3WA 4ALMA 1BMFA 4FI3F 1K6EA 1NRWA 1XAIA 3DEFA 3NI2A 4RQUA 2G63A 5A5GA 1XNGA 3ZEIA 4DDVA 5MDHA 2P3OA 4AF7A 1SUSA 3KKQA 3RC9A 1EFKA 1P17A 4Y1EA 1ISSA 2QXTA 2IH5A 1IWOA 3TZQA 4H3HB 4XVHA 1SJ9A 5FWNA 3NALA 2JFVA 5L7WA 2J3HA 1KJJA 2QAGC 3GAMA 1N1GA 1RLTA 3SGLA 1W8DA 1GG5A 4WERA 3QWIA 4WASA 3UK7A 4DRZA 3BCRA 4CM6A 2DLDA 1R5OA 4DWJA 3CSSA 5EXXA 3QOWA 4KG7A 3ZDYB 3TCKA 1IPFA 3E22B 4GFDA 2Q0SA 1EWKA 3OU2A 3DTVA 1MO3A 5KZMB 1GVHA 1K9VF 1Y80A 2I78A 1RRPA 2FWAA 4U4AA 5JI2E 2RONA 1UJBA 4ENUA 4W8HA 2VRBA 1DAGA 2NZJA 4TYNA 1Y33E 3KL4A 4E5UA 2DAPA 4L50A 3LC2O 1ODFA 4C3OB 2JFWA 3G9ZA 4J43A 2OZLB 4CFYA 1PZFA 3HVIA 2JLXA 4QDTA 4W9NA 2M6LA 1BIFA 4M8KA 4Q7KA 1MJGA 1MQAA 3M82A 3M3DA 1PNVA 3IP1A 2O5EA 3N05A 2J5QA 2VCHA 5CFNA 2ZR8A 1S2MA 3LCJA 4P5DA 3WFJA 2YX1A 1TMOA 5GPBA 3A7DA 2R7AA 3OWOA 3I58A 4E31A 3FWPA 3HNOA 5BRJA 1GRQA 5CYFA 5AK3A 2YWFA 3QTTA 3VR3D 4CWAA 1OXKB 3ZIAA 4UTRA 1N5JA 3DFIA 4DCJA 2ISQA 5H1YA 1DINA 1HDYA 1QX4A 1JEAA 2ZDHA 2I76A 1S2DA 2B37A 2A9OA 4B87A 4TXLA 5HILA 4QL3A 5KTYA 3K6SB 2YJZA 3DWEX 4M1OA 4Z0TA 3NR2A 3UV6A 5AVQA 3CWQA 2NU7B 1E4EA 3CZAA 3OA0A 4HWSA 2MMGA 4MV9A 2FPKA 3Q7RA 1TVKA 1J24A 3WKEA 4ES6A 1NA5A 3ADOA 2NUTA 1U3VA 4G0ZA 4Q9NA 5BYKA 3RUHA 4AZ0A 2PUFA 4DVGA 3TG2A 3IB6A 3LFUA 1PV1A 2R25B 3INGA 4GKAA 4FOOA 4DJAA 4RJTA 1R10A 1H42A 1LKZA 4IX9A 4DM7A 5CD1A 4JY7A 3FPGA 1B8VA 4I1IA 4O1HA 5DOVA 1VGVA 4AC9A 3GFQA 1DO0A 4XWKA 1ZN9A 1AZSC 2F3SA 5GONA 2EGUA 2CK3A 3EBPA 4HVLA 5BYBA 2C5LA 2R6R1 1B3RA 3B1YA 2GYVA 1M1XB 4HAIA 2WYHA 3F5SA 1Y1LA 3AV0B 2C1EA 3OPYI 5C34B 5H8WA 2O8FB 3DB1A 1GHTA 1XUOA 4OL9A 4MKFA 1R8QA 1U9IC 4LBWA 1JQ3A 3H2IA 4L3VA 2GDZA 5IBRA 3ZU4A 5DGCA 4BVGA 5JXHA 4NE9A 4UQPA 3CIOA 1JEOA 4ZPXA 2E4VA 3DQPA 1UBKS 4R1UA 3UAVA 4PPQA 3UGJA 2BP7A 2FFJA 1N0WA 1SCUB 4JD5A 3UT6A 4MO2A 4C4XA 3UHPA 2XGJA 3LM8A 1ACMA 2H3HA 5JS7A 3D8HA 1BJTA 4GZ5A 4OQXA 1JIUA 4JI1B 3TD2A 2HCBA 2ZE5A 3S2IA 1E6CA 4QUKA 3WX0A 5B3LA 2EG9A 1ADFA 4FINA 5AXCA 1QVWA 3K71B 1ZGAA 4Z54A 3NVDA 5DMHA 3TOSA 3WRXC 2GN2A 3KRTA 3LQ4A 3QFHA 2CL0X 4LY9A 5FTLA 3C5WP 2Q6KA 1VXRA 1OBCA 2CXSA 4PYRA 1PU2A 2NQTA 4O4JF 3M4XA 1N2XA 4AS2A 4JJFA 2YIVX 4I46A 3Q8KA 1JMVA 4I2VA 1GNLA 4IOMA 3KR9A 1MIOB 2EXXA 2XEXA 3CKLA 3DT8A 4KIGA 4I81A 4DLVA 3WLAA 4M89A 2VT7A 3E0XA 3UHJA 1O95C 1GCIA 4ZCSA 1VL2A 3QQ5A 3MNFA 3ONVA 2CXPA 1O94C 5BO5A 2A35A 3N2NA 1UXHA 4J0IA 4EKEA 1ZIXA 2GM5A 2CCGA 4XPZA 1BS9A 1ZGJA 3N5KA 3RS8A 2OYCA 5CVEA 4G4SO 3MEQA 5EHNA 3RYFB 3TOCA 3IJ5A 1FDUA 2PBFA 4DIKA 5C2JB 2PUEA 2Q3EA 3DEYX 3OURA 3QE3A 1YD7A 2O20A 4N5NA 1OFTA 3ESDA 4HP8A 4H7EA 4Y7DA 4EP1A 4B6FA 3KV1A 4ZMRA 3TGLA 2HMTA 4KHPB 4AKTA 3E8SA 4IICA 4IOJA 4E88A 3DP7A 4LTDA 4ZYTA 2J3MA 2EF0A 5TT1A 2EBWA 2H4JA 1XZ8A 2EERA 3LXUX 1E9SA 3WWEA 3NIGB 1U8CB 1AKMA 4KACA 4BP8A 1K2WA 3H83A 2O07A 4LOAA 4WCFB 3MJEA 1DOZA 3TQCA 1U81A 3DHVA 3MELA 4N39A 5FQNA 2Z56A 2YMPA 3TIXB 1SOVA 3EGEA 2DFKB 2ATEA 1A9RA 2HTFA 4KXWA 1I7QB 4ESVA 4DREA 5JWOA 3SXJA 4CETA 2WC1A 2X0DA 1ZUNB 2GVDC 1EWYA 5ETJA 2CC2A 2ZUBA 4XQEA 2PXCA 5JASA 2IYXA 2W6ZA 1UKBA 5J3JA 4JYAB 5FFMA 2JIZD 2EBFX 5F73A 4UUNA 1GVNB 2Q46A 1M6WA 2YWEA 4GZMA 2RGDA 2WJZB 4ZODA 3UJ3X 1ZAKA 3BGSA 2JAHA 5FOVA 2FMUA 2OXRA 1QAQA 4GZ3A 1NN5A 2QV7A 2ZIXB 5T4BA 1YDMA 5CIWA 4OF4A 5NULA 2IPNA 4H15A 3WAGA 4YQFA 5FI3A 2OGTA 2VYVD 2QMHA 2V55B 1E3EA 1ODJA 3LPNA 4MLZA 4YRMA 1B8PA 4MYHA 5LYJB 4IHQA 2IOFA 2MSNA 2WG1A 3D7LA 3GEEA 1L5RA 4L2IB 1MEJA 3QMWA 4FUTA 5GZ1A 3RUDA 1V5FA 1WVMA 1N5MA 4OSOA 1JVBA 2ZSDA 4MVJI 2AKAB 1R6XA 2P91A 1LSJA 4TS3A 3CCCA 1IN1A 2IHTA 2D62A 4L57A 1D1SA 3SP1A 4I0WB 5EEHA 1PL6A 2GTPA 5AHWA 1R8XA 3UZUA 2DECA 1X80A 5DYTA 2EZ4A 4MR9B 2JFQA 2X1VA 3OECA 3IQFA 4ILEA 4LVUA 1XZHA 3R5JA 4JU8A 4J0GA 3UBTA 4YRDA 4NOLA 3GJQA 2CVHA 5HP4A 3KV3O 1RXCA 4I5GA 3CYFA 4ZWNA 3ZJ5A 3GPLA 3UM9A 2O3UA 5AJYA 1QONA 5JDCC 1GUDA 4P08A 1G59A 3HBAA 2O59A 1E9AA 4IDBA 4QGAA 1BD3A 1A98A 4RK5A 2ABWA 2VDJA 7AT1A 5ALGA 2GPYA 1I0LA 3ZKWA 1CR4A 3ENQA 4TL7A 2QIOA 3PUVA 4K6CA 5K1ZA 1JS1X 2ATXA 4L4XA 5KS2A 2NZ8A 4MCHA 1V95A 4MIYA 1A9SA 1G8SA 1M0TA 3EVEA 3NHMA 5EIBC 2W6CX 3GPIA 2O8BA 4HDAA 4HDRA 3FUVA 2WVAA 2KBEA 2GBPA 3DMDA 3HY6A 1J9GA 4K1XA 2QROA 4M49A 4NDNE 1UZMA 4G41A 1UXIA 1JEQA 3HWRA 3DS8A 3OOWA 4I08A 5ER9A 2C78A 4WJZA 3SLRA 2WJPA 2R85A 1J20A 1O9BA 3RVDA 1X13A 2W58A 4CG0A 2F3PA 4Q4LA 4Q4HB 3KSBC 2HJRA 5JH7B 4GLFA 3W5IA 4WXEA 5DW0A 3CO5A 4UUQA 2PQ0A 1VE3A 1XU7A 1SXJA 1T9BA 2ZRLA 3PD1A 2D7JA 1T34A 3MAGA 4RORA 5FA6A 4CDRA 3GH1A 1NQWA 3T5TA 4HQRA 5AD1A 3LQ1A 2O3QA 1EM8B 2DG2A 3VUEA 3RYIA 1X1QA 4M7OA 2JL1A 1YR1A 2VNIA 4BBPA 3ZV7A 1P77A 4X1IA 4JBNA 4GT1A 1W46A 4ARVA 3CLSD 5EINA 1GPMA 3HU5A 3KJHA 4XUEA 4QFCA 5ALYA 5KHAA 4BGEA 3D5EA 3A6HA 4FX2A 3U7FB 3DVQX 5A3RA 5C32A 5HW0A 2QJWA 4DCUA 2QZPA 1JSRA 1MN6A 5FOQA 4NENA 1SUEA 4MWTA 5SY4A 2GPSA 2NSDA 2Q5LA 3AHFA 3FG9A 1BOFA 3HCFA 3H2GA 1OR8A 1VG8A 1QHEA 1NU8A 2B4QA 2CMKA 4IWXA 5T6MA 3C1AA 4DV6B 2YMMA 5C7IO 4WN9B 2JLBA 1F8UA 1X6VA 4QVGA 2JH3A 4DSZA 3SXUB 3GLIA 3UJNA 2WDPA 3CZRA 4O0LA 1NVGA 4ENPA 5GOZA 3UT0A 1XZJA 3IAM1 1IXYA 2FZVA 4QYTA 4HAWA 4BLTA 1UC5B 3QXJA 3ESBA 5I9BA 1IRIA 3UOGA 4IQ0A 1WO8A 5E0OA 1NNUA 3B5EA 5A2QA 3UHFA 3F3YA 1XVVA 2UYOA 2Y1GA 2XNDD 3IERA 1N34B 3IAEA 3KPYA 2QTLA 4KVFA 3DWIA 4EMUA 2Q41A 5EP3A 3IA2A 1G17A 5BPHA 1HFWA 5DOZA 4DUPA 3S2FA 3UJ7A 2PJRA 3KT6A 2Q0HA 3LXMA 5FUXA 4MS4A 4CQLB 3PEUA 1GAQA 1OX4B 2WHQA 3D8NA 5FPQA 4LRSB 4UPEA 4UBIA 1NQOA 5EMNA 5F3RA 3GPCA 3VRHA 1TYZA 3DBLB 5CVUA 2Q9BA 4HO1X 2C2XA 4PY2A 1N7IA 3ETDA 1U0OC 2JLYA 1SHZA 1P1JA 5BVGB 5IM5A 3HRKA 3OP4A 3PT5A 4ZU6X 3V1NA 3VVCA 3EQ6A 2Q1YA 1I6MA 2Q27A 2JIZA 1WABA 1KO1A 4CDMA 4OQLA 1ZESA 2WIGA 3N59A 1QUFA 2C00A 2GCOA 2H4WA 3ND7A 5DWQA 1E3QA 2CW5A 3QPDA 5EC8A 3FPSA 4Z49A 3NC4A 1A95A 3DCJA 4RF3A 4KLCA 3IYLW 1HTWA 4G4IA 5DU2A 3WMRA 3L6OO 3I2GA 1UFVA 2H48A 2EATA 4UJ5A 4XCVA 3E6AA 5JZBA 1JECA 2H63A 2FLWA 4QJ3A 3LY5A 8LDHA 5KVSA 2XQJA 3SVLA 1X7HA 3SMQA 1GM5A 5AM2A 3NOVA 5HKLA 2J59A 1A2BA 1HURA 4FYHA 1M10A 2HHLA 4K9MA 4Y3UA 3DBVO 4W9NC 2XMSA 1VHTA 3LDGA 4XVQA 3V34A 1QJCA 3P2IA 3QNWA 3AHGA 4RYLA 1CQXA 5IAEA 4AF8A 4JBIA 3K2BA 1IFXA 1PQWA 1ZD4A 2I6SA 4KXYA 3CUYA 4E6PA 5BSHA 1V7QA 1XHLA 3HCAA 1NUHA 3I6BA 4KWTA 1A9OA 1J8FA 1GTG1 1WW8A 4H77A 3U1TA 3V6MA 4HZUB 4A9AA 3AG5A 3HB9A 4HB2A 3QGMA 2IUFA 3G5UA 5I9TA 3RSQA 2WTXA 1ZITA 3AKEA 3U7GA 1Y5LA 1VC2A 2UKDA 2GEKA 4B80A 1PO7A 3ZG6A 3E9YA 3GHHA 5JNUA 3S8EA 2P9HA 2W98A 1P0MA 4OHPA 1JSCA 4G97A 3WLJA 2XUAA 2O8DB 4LSWA 3D81A 4JX9A 3R6GA 3GQBA 4ZMSA 3M49A 4RK1A 3A1WA 3G0BA 3Q5DA 3AY0A 2SHKA 3FPEA 1VJDA 4UDNA 1L3IA 2ILVA 3MT0A 4G8JA 2Q0XA 4N3GA 4IXDA 1LJ8A 4NU6A 3JAMA 2AJLI 1EKXA 4Z53A 5J5VA 4EMSA 2WF7A 4JUDX 4NDZA 3UXMA 1P2TA 2AQHA 2PKQP 4JLMA 2AOUB 1JH8A 1X87A 3GD7A 1W0KA 3F5DA 1KDRA 1WQ1R 1Q57A 2C3PA 4MZDA 4Q37A 4R68A 4UHHA 2Z43A 5L4SA 3ASVA 1E2NA 1NR7A 3LGSA 2BKLA 3OQ1A 2PX2A 2WFLA 2P11A 3A2LA 3BA6A 3GX1A 4FE3A 3SYRA 1KY5A 3EFEA 3F2IA 4FW8A 2R96A 5DM1A 5BUZA 3IDQA 1M1YE 2RFLA 3QY0A 4JJ7A 1FYVA 1GNQA 2I54A 4H3VA 1C1DA 4GMKA 4EJSC 4EARA 1Z8NA 3N8KA 3NHUA 3FPHA 2VATA 2CDCA 4YAUA 3WYBA 1FFGA 1Q7TA 2GDJA 2NPIA 1N5LA 4G0XA 1CUGA 4DCPA 1J2RA 2JLVA 1XVAA 3HR8A 1TJ5A 1CJKC 1TZ2A 1VHJA 2VP2A 1LLDA 1PWHA 4GAEA 1NQVA 3IBFA 4OAOA 2RHOA 5FBRB 4B48A 2ZIFA 1HWYA 1EBUA 3GROA 3LUPA 3T35A 5L53A 1QQ7A 2XQKA 5BRNA 2C82A 5A03A 3RU7A 2WWFA 3Q9LA 2Z4SA 2FK8A 2EEZA 5FKJA 3U26A 4D1YA 1OFUA 2ON6A 1K3UB 4GI7A 2IHKA 4DUGD 3OQIB 4RLQA 3RTGA 2I3AA 1ECFA 3DLIA 1JHOA 1OILA 3QLEA 3WQBA 3HWWA 1P9NA 1VKJA 4DGQA 1Q3HA 5F7ZA 2L42A 2NO9A 2GZAA 3I0NA 4IIJA 5G4KB 2FE1A 5SZIA 4ZN6A 5FTNA 3CF4A 1PDOA 4C4TA 4P22A 2WHXA 2C2YA 2GB4A 2NQ2C 3S5JA 4QUEA 4AMVA 3AY7A 1GAWA 4B3IA 3T9BA 2Y93A 5CU7A 1N6LA 4MAAA 3JX9A 4UEWA 4BASA 4YAFA 1Q6ZA 2QX4A 3KFVA 3GV0A 3KHTA 1B74A 2GETA 1NTOA 3VU8A 2F1OA 3CB4A 3EWAA 1V16B 4M0MA 4Y9DA 4ZCIA 4O2BB 1I0IA 2VDKB 3EGIA 5DTRA 3TRHA 2PKEA 1ZD5A 5CBKA 2P4EA 3G6WA 1J6UA 3S29A 4BZPA 2NXWA 5COBA 3JRWA 4KRYA 4WK2B 3D6TB 1KJZA 1USKA 2XCLA 4N82A 1QO9A 1C3XA 1HEYA 2XZPA 4LYEA 4O4HB 2OHOA 4HNUA 4M9UA 3B2NA 4W5OA 2EW1A 2IOYA 2FSUA 2O3JA 3E53A 4DMCA 3V97A 5H9WA 1CS0A 3GPDG 4MTCA 5KNDA 3ASUA 3GN1A 3O83A 1UP6A 4P98A 3B8HA 3WYFA 5L45A 5D87A 3CZ5A 2FY8A 3L79A 1JHUA 2G3YA 4PYQA 4MPJA 1KP2A 3FCAA 4Y2PA 3WWZA 2IOQA 3OTQA 5E6SA 1J8VA 2Y0BA 3S7TA 4A8HA 1YL6A 3Q7SA 3IOBA 1N2BA 2ACWA 4J6EA 4ZVKA 4RVHA 4XWTA 2ZJ6A 3LC1O 4DDWA 3NT5A 2AI3A 1NF9A 3IHTA 3R75A 2X22A 1H69A 2NYRA 2J5KA 1VE6A 2CDNA 2BFEA 2XNHA 3QOXA 4KGXA 4AQ7A 3U48A 1Y3BE 4L28A 5I4IA 1QO7A 1II0A 2ZI3A 1UKYA 4N48A 3N0TA 2PS0A 4GKKB 2GSWA 2ZBUA 3EWIA 4BE4A 2IEGA 2OGUA 1A1SA 2UAGA 3E7PA 4YX9A 3PQ5A 1D9XA 2HU8A 3L04A 1YC5A 3P97A 2CMHA 2YJ6A 4HXFB 4JVOA 4KMOA 4RQTA 4L9RA 5DV9A 3VOSA 4LXQA 2PGOA 2H17A 4GLJA 3OTGA 1NYQA 4UXJA 1B2LA 4KH0A 5LLSA 4IKEA 3LI2A 1OV4A 4HRVA 4BBZA 2LIPA 1BMDA 4G5RA 4W63A 4B43A 1W93A 3PXBA 4FFNA 2V3CC 1HOTA 4XJXA 3GRZA 1SOAA 1BH2A 3WZ2A 3QWBA 4OLFA 1DO8A 3KQHA 2H9AA 1H5UA 1I2ZA 1UXKA 2GD0A 3BDVA 1OTXA 4G5XA 5J2UB 3QEKA 1E2KA 4WKPA 3O93A 1WXWA 7REQA 2EHDA 2EJWA 2BV3A 3M9WA 1DWOA 4S2UA 1L1FA 4C06A 1C9JA 5JZVA 1Z0KA 1DQNA 4BRSA 1A5BB 3NC1C 5IBCA 4ZD6A 1HGXA 1HLGA 3EXHC 3TXAA 3JQDA 3CVVA 2H00A 1AXGA 2G7MC 3C3DA 1KKUA 2J0EA 1NVBA 3HHEA 1JI0A 3V4VB 3GGGA 5CFMA 2HRCA 1VKOA 3DO8A 1OTYA 1CF4A 2VTDA 2ZULA 3SCZA 1IDOA 2Z2KA 3OIVA 1ZN2A 4UMFA 5U1PA 1LS1A 1M7HA 5DB4A 1TU0A 1XEWY 3D3EA 1FUIA 4DQDA 4PNEA 1L5QA 5J59A 1G3MA 2IYZA 4BQEA 2ZSHA 4H1VA 4IL5A 3RJ5A 1E2DA 1Z4QA 2RG1A 3W90A 4IFTA 4US0R 1ZK0A 3F8TA 3WY9A 5C1BA 3ENVA 1BA2A 4F5YA 3ZGXA 2HU2A 1L5GB 3AIKA 3ELBA 3OT1A 4MYUA 3H04A 4BWVA 1A72A 1A5SB 4OXNA 1PD0A 4BU1A 4BZZA 4FGSA 5IWAB 3GLFB 2V4UA 3DAYA 3OE5A 5EXEA 3DE6X 1FDTA 4GLBA 5FUWA 1M0WA 3CVXA 3BWDD 3S27A 1JAIA 1DWPA 2WU8A 2D7DA 1N4DA 4QUDA 1X74A 2NZWA 2DBVO 4BQPA 2C07A 3PJDA 4BFVA 4BP9A 3GLFA 1X1AA 2DWQA 5K6TA 1LPPA 2FSSA 4HKTA 1I13A 3RVLA 4MQFA 1Y7IA 2DT5A 2R2GA 4TROA 4B3JA 4M76B 1JKJA 2NV6A 4OPMA 1N2CB 2CNDA 1VL1A 3LYAA 4XUGB 5KC8A 2DR2A 1XA4A 3ZJUA 3TNDA 5LJIA 1SEPA 1O08A 3BHJA 2N47A 4TQGA 3R3SA 4MV0A 4A8TA 2ZDQA 1FA9A 2PNJA 4IBOA 4Q3EA 3TOZA 1I33A 2BUAA 2CVOA 5BQXA 1IYZA 1U0GA 3H3JA 3H2ZA 5I5EA 2WF9A 4BVHA 1PZEA 1T2EA 1I9GA 4PYNA 5C8DA 2R8XA 4FWTA 3GFOA 4QPDA 3CM0A 2OB2A 2YJ4A 1U6KA 2IITA 3K9LA 4JP8A 3QEJA 4TWJA 2DWPA 1P72A 5D85A 5AOVA 3DNMA 1TK2A 2I7XA 2A7XA 2TMYA 3QG1A 4FGLA 3CVOA 4FYJA 4PO8A 1Z4OA 3HWX1 4CMBA 1UKCA 3KUKA 4E5DA 5C80A 3K70B 1G42A 2CLOB 5EE3A 4G0PA 5TGDA 4JSRA 5JJ5A 1YQEA 3DXXA 5LOVF 3M5PA 3PQ4A 5LP1A 3IDZA 3SM3A 3MWEB 3SYLA 3MJFA 3UOWA 4AFNA 4BKRA 4DAOA 4D8VA 4G0WA 2QVXX 3UGKA 2F8TA 3GJ4A 1MF7A 3GT4A 2V6GA 3TLJA 3U80A 1E99A 5ARBA 4ND2A 5EQDA 3UJ6A 1KFKB 2YV4A 4MPTA 1GNVA 1QIHA 1UBNA 1T0UA 1CQIB 4HTFA 1LW6E 1WMSA 2GWHA 4BQFA 1SQ0A 3WADA 2Y1KA 2YR0A 2PRYA 3VJRA 1A5ZA 3NJRA 4H18A 3WGTA 1JHRA 1NY5A 3PDHA 1WB6A 1YR9A 2V8OA 3GZ4A 1PS0A 1EEXB 3F5QA 3FMOB 3H6HA 4MVJD 5JU6A 1PT6A 1FX0A 3H5RA 3HUFA 4KW7A 5CXSA 3ZD7A 2KSQA 4B3MB 1IY2A 3QU2A 1L1EA 1UJNA 2Q6OA 3VVLA 5I6DA 3HSYA 5K0TA 1P31A 1SVUA 3BH0A 3DFZA 3B3GA 2C0PA 1FSZA 1TCUA 2BKUA 1KAQA 2PRJA 2PMBA 3AF1A 3H9UA 4HVAA 4WSOA 4JZKA 1SBHA 4UBJA 1LBHA 3COJA 1FRQA 2IYWA 5ED0A 1AV7A 3UTDA 2VHJA 3EPKA 4C87A 1KOGA 2IYTA 2PVCA 4WJKB 4KN5A 1KMHB 2Q5JA 3L1UA 3N2LA 4DMUB 2IEAA 2O2SA 3G5LA 3D3WB 3RCBA 4G2NA 4R8LA 4W6ZA 1SHTX 2B8NA 4ZVRA 1ND6A 1OFIA 1VFPA 1XHFA 3IEKA 2H1WA 4X60A 4ZARA 3UANA 4I19A 1QIEA 4RADA 4GQAA 4XTCS 5DHPA 2C95A 4HNSA 1ONBA 3LNCA 2F43A 4LKOA 1ULTA 2F8MA 4UHDA 5HIMA 4G67A 4GYKA 5AJHA 4GUDA 5CK4A 4BRZA 1MPXA 3GK3A 4OXQA 4AY4A 3N8HA 3P9KA 2A14A 4HAOA 4HH0A 4XWAA 5DT9A 5IVDA 3SICE 5CXUA 5KTNA 3RYCA 2BY4A 2XYPA 2FPMA 4CKEA 4M9XA 2NUPA 1FYDA 3A06A 4R05A 1A04A 3TUJC 3ZD9A 4EZIA 1KAGA 3DOFA 1PD1A 1WHTA 3BPSA 3DVAA 3QV2A 3HTXA 1C7RA 4OIMA 3MLBA 5FOSA 1ZGZA 1FSGA 3P5BA 3M6WA 1GYPA 3BMOA 2WTEA 1ISFA 1N6OA 4HDKA 4RWEA 5K8TA 4ENRA 3PRJA 3JQAA 3OFKA 4N01A 2A1TR 3SDZA 4M1WA 1DU4A 2RH9B 3JR3A 4RGQA 1S2GA 5T67A 3QNUA 1OBFO 4MDHA 1ZMRA 3H8SA 4CGYA 4YRZA 1PZGA 1WDKA 2R5FA 1OWMA 3GGOA 4RPCA 5K0BA 1FFXA 1IB6A 3K4HA 3KB2A 2IWRA 1U1FA 4BBAA 4EYGA 4DARA 1JPVA 2JLZA 2BFCB 3T5DA 2A0WA 1G64A 2PQ6A 2FAXA 3LWNA 4KZKA 3SX2A 3I9V1 1NASA 1XXLA 2GBGA 4XOIA 3WWDA 5B37A 6AT1A 5K51A 3C7CB 1ZW6A 3SHQA 3TR0A 1AMOA 3T41A 3OWXA 2IP1A 4DCCA 1PLLA 3I0ZA 3MSCA 4BNMA 2ZVJA 1NBIA 1KJ8A 1GCUA 3MQ4A 1CULC 3TQFA 1E61A 2B25A 4UNRA 4O4LF 1MOSA 2WMYA 1J5XA 4HH3C 3ZD8A 3EQZA 4AF6A 3KZKA 3JVVA 1RM4A 3FRHA 5CK5A 4C5AA 2FETA 3BFKA 3TLAA 4KQXA 2QE7D 3K31A 2JI8A 1H94A 4OQPA 4WMLA 1W0JD 2H1RA 4DWVA 1HDEA 4FK8A 1T5HX 2V5VA 1NG9A 1XZPA 1R7RA 1YS2X 2Y1FA 4HWOA 2J4FA 1MOZA 2JLCA 1IZYA 4TMWA 1O97D 3MWGA 3VPSA 4OJQA 2A5JA 2JBAB 2OPBA 3E9ZA 1NVFA 1QGZA 3LLUA 4NU0A 4B40A 1TFUA 4D3SA 4M86A 3ZPXA 1P3DA 5IFKA 1PW7A 3CH6A 4M7PA 2AS0A 1WW3A 2FFAA 4BCBA 4XASA 3KD3A 4I9NA 3PNQA 4JU9A 4G07A 2B9EA 4JNKA 5LWHA 5L3RA 1CD5A 1MB9A 1PFKA 1SWWA 3G0CA 1LXCA 4GP9A 3RH0A 3NPMA 2W93A 1BGXT 3E9EA 2FOLA 1XZMA 2Q2NA 1J00A 5A6VA 1KNXA 3CC8A 4CM8A 1T9GR 3CG4A 1JBQA 5EZ5A 3SZLA 4ZK6A 3IT3A 1VPVA 3G1TA 1E63A 1UIMA 2ZYRA 4HG2A 1N6NA 1NR1A 2XZDA 2PMCA 3DM5A 4IOKA 2HW8A 2XGOA 3QLTA 4ZTBA 5LPNA 4C6TB 1BROA 1Z0FA 1JPJA 4G63A 4QYWA 2BVNA 2WP8J 3SQOA 1XE3A 3TVYA 1JEYB 1NG1A 1XL0A 2O0HA 2GASA 3IUSA 4P53A 1T8UA 5A6SB 4HVCA 5BVGA 3W5JA 3HUUA 2WT9A 3VDXA 3L1HA 2HLHA 1J2YA 1T2NA 1BMTA 1ULZA 2CXHA 1Q14A 3KYDA 1NM5C 4AJHA 4PZCA 4F97A 4X93A 4RTNA 2Z2YA 3U4QB 4HB0A 2QW0X 5GM1A 1R50A 3S55A 4ZJYA 1NUUA 2GN6A 1Q3KA 3LA6A 1L4FA 4IM7A 3UH0A 1G291 4WVLA 4AQYB 2X4LA 4J2OA 4QREA 1RQPA 3SR4A 2D8AA 4D9KA 3A4YA 3UUEA 2P7IA 4ZEVA 4W4TA 4EW3A 4Q3AA 1KPHA 4QO8A 4ZOCA 2LXNA 3BXOA 3TDMA 2QLFA 2HN9A 2NW6A 4E2FA 1EIWA 3QPWA 5JJIA 3OOSA 2QKYA 1WDMA 2IEZA 2YJ3A 2I4TA 3WC4A 1JT2A 4A15A 3X2EA 2QV0A 4MP8A 4OB7A 4C4SA 3AUTA 3RAJA 5C3UA 4ARIA 1R1DA 1Y8RA 4A7PA 1KVUA 3SS9X 4YAGA 4K6MA 1RKUA 4IHJF 2JFBA 2CNWA 2RGGA 4ZEOA 4CIAA 3PEVA 2V3WA 4K5QA 2J6BA 4RBNA 2GT1A 3TLYA 3P20A 1AS2A 2X42A 4DLBA 2PK3A 4HZUA 4FMDB 4Q7MB 3HYSA 3F9RA 5GIPE 4FGKA 3HMQA 3Q3IA 4CKYA 5K5EA 4KIJA 2G1PA 3WI7A 3X0DA 1YUNA 3FR8A 1M5UA 3UCFA 1D09A 1GRNA 5FUYA 3HUDA 1PQYA 1K08A 3FMFA 5FOWA 4Z51A 4MW6A 4RCVA 2E85A 2ZTUA 2QR5A 3JS5A 3NAMA 4IEFB 4JVMA 4L8WB 4EG8A 1O6BA 1YZUA 2ZB8A 3MRVA 4Q4HA 4EYSA 4DDTA 5ILOA 3NQ41 4KOAA 3DCIA 3A6LA 2H18A 1QMGA 3LIIA 2X8LA 4JJAA 1GG2A 1Q3TA 1VJ1A 3DVRX 5F51A 3R7WB 3RE1A 2F17A 4QBGB 3BWXA 1GZ4A 4WVFA 3KZCA 5B1YA 1ABBA 2AF3C 4KBGA 1SU6A 4OJKA 4URYR 1Q17A 1YSCA 1YIAA 5I7AA 1ILEA 1YZHA 1P0QA 4MDFA 3MTDA 2WZCA 3EIXA 3U9SA 2BSQA 1Q0UA 1U3GA 2Q3MA 4F85A 4CM4B 2MR6A 3WLKX 3LFTA 4A8PA 2GK7A 4FHGA 4LZWA 2GERA 1VHWA 1RABA 4G5HA 4QPZA 1DT5A 2EU8A 3M5DA 5CTAA 3RUPA 2BF4A 1CR2A 1E3WA 1U11A 3SVZA 2JCGA 5F7XA 4EMTA 2VKTA 3E2PA 4KQHA 2VPWA 3BX1A 4OHMA 3LC7O 2MCFA 4CUJA 5CB4F 3HN6A 1H8EA 3ZCXA 2IVZA 2X5OA 4BX0A 4LZJA 1W1IA 1R88A 3EOBI 5AI6A 4CM5A 2TMDA 2XMCA 4EA6A 4FQ8A 4A91A 1R6VA 5EZYF 1XCJA 4LISA 2DBRA 5AJVB 4JODA 3QU7A 4TUYA 4YUWA 5JDIC 4ON9A 1T4GA 4Y2VA 2ZOSA 2JASA 4RH1A 3WJ7A 1HTBA 3H84A 5JD3A 3WLTA 4L8FA 1QDUA 3AHIA 1I1OA 1IXKA 4MWCA 4X1YB 4RAQA 4WN9A 4N8EA 1O0SA 1JEEA 2X5KO 4E22A 1YJCA 3JZDA 1NOJA 3O8QA 2OV1A 4RS4A 1BS2A 2FZ5A 4RENA 1HQDA 2ZCJA 1NU6A 2G6TA 4K40A 2LR0A 2I6FA 5IAJA 3BQNB 4O8ZA 1E8NA 3GRPA 2DFVA 1M76A 2ZJOA 3AEQB 4P5EA 4D5GA 4DV5B 1T9CA 2BFMA 3U4MA 3ZK8A 1QHXA 2QRNA 5D3MB 3RSSA 1YB7A 1P4HA 4E2WA 2G4CA 1CNFA 4DLNA 1Z6PA 1HT3A 3VO2A 1ICEA 1H6DA 1DRVA 1ZUNA 2YHAA 3L6EA 2NT4A 3X1DA 4GOND 4EZEA 4D57A 2DP4E 1RPJA 2Y1WA 3VH3A 1ZJWA 4U5QA 1T5DX 2HF2A 1P2SA 1YDWA 2QN9A 4KUEA 4XDZA 4PAGA 4RPHA 3RYHB 1GAJA 3PB3A 3L92A 3TK1A 3PS9A 4EUKA 3J81k 2BGMA 5ALDA 4XUDA 2I2WA 2ZLBA 1KK3A 4FSXA 3C8HA 2Q1SA 1MT3A 3UK0A 2V9CA 1OWOA 3LKBA 3MS4A 4OHBA 5JYBA 1RHUA 3AVYA 6LDHA 3H9JA 3IUYA 3HE3A 1FQKA 1WLSA 2GVZC 3PUKA 4PRKA 5ICFA 1CJCA 4A16A 4Z4IA 1ISMA 2BHRA 3LPAA 3OA2A 3OCVA 3CS3A 2QD3A 2H1HA 4HHEA 2PL9A 3V80A 1XRMA 1SVSA 3GL9A 1K8QA 3NWOA 4J1SA 1KVTA 5IANA 2MSEB 3NLLA 4IDGA 4KAAA 3V33A 2VTBB 3JALA 5M5BA 1AD2A 2F1RA 4UTXA 2J30A 1K6JA 2NO0A 5EWLB 4ND5A 5DLDA 4QYXA 2FGKA 3ITDA 1ABEA 1XU4A 3VBEA 4OXRA 3G5AA 3HKBB 4AXXA 4IUBS 3STTA 3KJNA 2YVAA 1R9JA 3PC7A 1L5FA 2JI4A 1E2JA 3WGQA 4YJ3F 2IEYA 5E0KB 2IZ6A 2GEDA 2M9MA 3DO6A 4YRBA 3NM4A 3GY0A 5TQJA 3T9AA 5EKTA 1TM3E 5CA1B 3KOXA 3JWPA 2P8SA 4IF4A 1T2AA 4Q3BA 4W7IA 5E95A 3ZHOA 4CF3A 3B48A 1NT2A 3LTNC 3G68A 1FBTA 1LC3A 4YO8A 1YF3A 4L2IA 2RHJA 4Q18A 3LPCA 2OGSA 2ZRCA 3J7TA 1CP2A 1Z6TA 3W6NA 3FPCA 2OHVA 1ZRSA 3U9TA 4XGIA 2Q5OA 4WOPA 3W4JA 4JZYA 5HZHA 1SCJA 3ESCA 1S8OA 3IKMB 4G89A 2VDWB 3ZWOA 4DCMA 5A5DA 2ZM6B 2QPTA 1X70A 2EYUA 4O2RA 2QX9A 1DAMA 1NSTA 4IOLA 4OXXA 1H9CA 2H9YA 4Q48A 1REQB 1QH1A 3VHXA 3WL8A 1CXZA 2AK2A 2C0CA 3H6GA 1PNQA 1YS1X 3D5TA 3EWSA 3MT7A 4TN1A 4BNUA 1YVRA 2D1QA 3AEZA 3DTYA 2JA1A 1KY2A 1J2JA 4KN8A 5FBLB 4Z4FA 2JDID 2PZFA 4QDOA 1SIOA 1V1MA 1VPLA 4ZYLA 5HKBA 4DA6A 2XUZA 3L4BA 2ZDGA 3BEOA 1Q21A 1T3LA 3NTUA 1R3DA 4J3NA 3O8LA 1W4AA 1WHSB 3SAJA 1YB1A 3F6CA 3OZAA 3K1AA 4QHYA 3H5TA 2YWHA 2H0QA 1RIFA 2IL1A 3DQQA 3W2GA 4NOMA 3DC2A 2IUUA 1JU4A 3A6JA 4ITVA 4PLPA 4D9FA 1U7HA 1H0RA 2P1DA 5CNIA 3WA6A 2QNIA 4G1UC 4GMDA 1GPLA 1E32A 1H5QA 3VTAA 2O2HA 4X90A 1N2SA 1CQJB 3O31A 4OIFA 2DMRA 4H7FA 2LVBA 2QDXA 1JWAB 3NH9A 1JFVA 1PUXA 5ECWA 3B1ZA 4YP1A 5HZKA 5KQMA 4LDRA 3PX3A 3CNLA 1UXGA 4Y9SA 3UK1A 4NMLA 1V4VA 1PW5A 5BN4A 3P5SA 5AVOA 2CUZA 2XE8A 2VTBA 1QK5A 3L8ZA 2HQBA 3S0JA 2VJNA 3MK31 3R3XA 2PZLA 1JW9B 1T9HA 4H7IA 4TYPA 3ABSB 3SEZA 3LT2A 1HG1A 1PG5A 1S6YA 1UBEA 1WULS 2B7LA 2XQFA 2ZWPA 4MQEB 5DWVA 2QMOA 3W8DA 3IP3A 2L0XA 3QFSA 4EI9A 3ZXUB 1U7TA 4EMBA