6YASA

Hydroxynitrile lyase from hevea brasiliensis, room temperature structure
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HYDROXYNITRILE LYASE)
publication title Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis.
pubmed rcsb
source organism Hevea brasiliensis
molecule tags Lyase
total genus 97
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 6yasA00
1YB7A 5T4EA 4GWLA 3FOBA 3O4JA 1Q0ZA 4LYEA 4W1RA 1F6WA 5AM5A 2H1IA 2OPHA 5JARA 1G66A 1UFOA 3HYSA 4PSCA 4XIIA 5ALOA 4UHDA 2E3JA 3LP5A 4GI1A 1YS1X 3G0CA 1KU6A 2PL5A 4HXGA 3GELA 1J07A 1QLWA 2PSHA 2WUFA 1QTIA 1XRLA 5DNUA 1QJ4A 4KRYA 4C89A 3VKFA 1XQVA 2GBFA 3S2ZA 3RLIA 4AZ0A 5AM0A 1Y7IA 3OC0A 5LZ9A 4X00A 1RP1A 5DYWA 1HBJA 1QOZA 1LZKA 2AJ8A 5HFNA 3R40A 5JYCA 5F4ZA 3OPMA 4JYPA 4AMYA 3WKCA 1MX1A 4IQ4A 2ES4A 4GXNA 1CUXA 3E0XA 1H2YA 2WG0A 2XMQA 4WFKA 4L0CA 1P0IA 2QUAA 3O4IA 4B0PA 4C4XA 2PSJA 2JF0A 4P93A 2C4HA 2XLBA 5KBYA 1XRPA 4BAGA 2H7XA 3NGMA 2PSEA 3EF3A 3BF7A 3G0IA 5CT4A 2BAGA 1WB6A 2QXUA 2J4FA 1ZD4A 3CCCA 3ZV7A 2VJBA 4W63A 1THGA 2G5PA 1MPXA 1JJBA 2WIFA 4G5XA 1O6GA 2VA9A 2XI4A 4I4CA 2GBIA 2O2GA 1LBTA 4YX9A 1XZCA 4AO6A 3T52A 1SFRA 5FRDA 1HQDA 3AFIA 4KE6A 1XZAA 4B9AA 4KE7A 4MWTA 1A8UA 2XUPA 2CJPA 2IIVA 4Y2VA 1S8OA 3WA6A 3AIOA 4RGYA 2C5GA 1ZJ5A 2FX5A 2XE4A 4OB6A 4AO7A 4Y2UA 5E2IA 4BTVA 2PSDA 5AK4A 5LZ5A 3TRDA 4UUQA 2XUIA 2WJ3A 4N8SA 4OD0A 4A16A 1EA5A 2WUDA 2EDAA 2PU5A 3WJ2A 4BE9A 4X6UA 3QVMA 1P0QA 3FYUB 3M82A 4J0HA 5ALEA 1XZIA 4BVLA 4U2BA 2AJLI 1MAAA 3O0DA 3R3WA 4PV7A 3WK4A 1CUGA 3V9AA 2PX6A 2YASA 1DX4A 3OM8A 3B12A 3FAKA 4EHBA 5CMLA 3V1LA 4NMWA 3ILSA 4F0JA 5JAHA 1EDBA 1XRMA 1ZD2P 1ODTC 5AKEA 1QIIA 2B20A 1VE6A 3DDUA 4X94A 4MQLA 2QVBA 4B6GA 1ORWA 1XRQA 1ZJ4A 2IX9A 4U2CA 2WG2A 4W1SA 4X93A 1CRLA 3D3NA 5A6VA 5FV4A 5DLPA 3KDAA 5FPPA 1LPMA 4U2EA 3MVEA 3VVMA 1JFRA 2BGNA 4DMFA 4A23A 3G0GA 1HL7A 5BWCA 4OPMA 4UBJA 1CUIA 5CTAA 4M0MA 2DHDA 2XB6A 4UFOA 2ZJ7A 4UBOA 3BIWA 1CQWA 3IB3A 1VZ2A 3I2JA 2WIKA 1XLWA 3OG9A 2XQGA 4HRXA 1BU8A 4MEBA 2CKMA 2V97A 1EDDA 1GGVA 4Y2TA 4MJ3A 1USWA 2XMCA 5LZ8A 4ROTA 3W04A 1OCEA 3GA7A 5IVDA 3R3UA 4OYLA 3DL4A 3WK7A 1CR6A 3W06A 1M33A 2WHQA 2C58A 3N2ZB 5A2GA 1BRTA 4DYHA 1XZJA 1OXMA 2OCLA 2HM7A 1GXSA 4QDOA 5K3FA 3Q8WA 3WKEA 1ZI6A 3ZI7A 2HA0A 4H7KA 3C6BA 4BCDA 4X92A 1JKMA 5HF5A 5I8PA 4JYMA 4C88A 3H17A 5A7FA 1TCCA 4GBGA 1Q0RA 1UZAA 3S8YA 1LNSA 3QPCA 4MYDA 3PI6A 1F8UA 4LIPD 2JGEA 1YAJA 1TQHA 2I03A 1GZ7A 4G8CA 5JD4A 2HA2A 1LZLA 4AX4A 4CCWA 5JAOA 3BXPA 1J1IA 5J3JA 4KYVA 3BL8A 3C6YA 4BAUA 3STVA 1HLGA 2OGTA 1EK1A 1B6GA 3K6KA 4L3WA 1W6RA 4NVRA 1THTA 3I28A 3R0VA 1QTRA 1CUBA 3R3XA 4H7DA 4K5QA 2K2QB 2BKLA 3FNBA 5K3AA 5EFZA 5CT6A 2XUDA 4B9EA 1ACLA 4Y2YA 1L7QA 1W76A 3HZOA 3PICA 2QM0A 3VDXA 5AKXA 3WIBA 1D07A 2FJ0A 2X5XA 4HRYA 4QZVA 3C8DA 3H0CA 4KR0A 4Y2XA 1R3DA 1VOTA 2WU3A 1K8QA 1UKAA 3UMJA 2PSFA 3FVTA 4FFWA 3ED1A 1DX6A 3QH4A 2HFKA 5ESRA 1AX9A 1CUAA 2XUQA 3CCBA 4YASA 1ZOIA 3IVMA 1QE3A 1JT2A 3WYDA 1GKKA 3SC2A 1MX5A 2PKYX 3STWA 5KWIA 5DNWA 2GBCA 5JALA 1K6EA 1LPAB 4HTAA 4BRZA 1QO7A 2WHPB 3ZWQA 1E5TA 4EY8A 1NX9A 4J0GA 3I6MA 1BE0A 1SCQA 4KAAA 5T4HA 1EINA 1XZGA 2VT6A 5CURA 2GYUA 1ZICA 4OB7A 3GZJA 5BV7A 2GZRA 1G5FA 2DR0A 5ALDA 3IDAA 4XJVA 2WM2A 4K6KA 2Z3ZA 1DT3A 3WKBA 1QIMA 3K2IA 3FSGA 4TPKA 3WYNA 5AM4A 4BE4A 1W4LA 5AI8A 2WG1A 3FLAA 1R4ZA 4OU5A 4LYDA 1ZGBA 5LZ4A 5K5EA 4C87A 3VJLA 4AMZA 3AZQA 3HJUA 5FP0A 1CUZA 3WL5A 4N5HX 1C7JA 1BEEA 1LGYA 5I7UA 2WFMA 2P8SA 1GPKA 1BN6A 2QT9A 1WPXA 4GW3A 4H18A 4LHEA 5CXXA 4HXFB 5C81A 3LIPA 5K3BA 5AKLA 4QNNA 2WIGA 4F21A 2XUHA 3BJMA 2R8BA 2ZSIA 3A70A 3I1YA 1JI3A 1U4NA 3FYUA 2HFJA 1DQZA 2Z8ZA 1R1DA 5EGNA 4S0XA 1K5PA 1E8NA 4MYSA 2ZYHA 2QR5A 3F98A 4QEKA 4BC0A 3EBLA 2YXPX 3ESDA 5ALSA 3VJMA 2JEYA 5AHXA 4Y2PA 4G9EA 2PU7A 3G7NA 1ODCA 3IA2A 1WB4A 3I2IA 1UK9A 2DHEA 3FVRA 2V9ZA 3W9UA 4IH9A 2XUOA 4KAJA 1BS9A 1WPRA 3LIIA 4F5ZA 5CT8A 2RI6A 3I2FA 5CH3A 5HK8A 1SC9A 4MEAA 2ACKA 1XZHA 4RE5A 2H7YA 4M0EA 1ACJA 2XMGA 1R88A 3IURA 3EIOA 3SX4A 3DYIA 4QDZA 2OQVA 4X90A 4AN1A 1EH5A 1GPNA 1VKHA 1ZI8A 5AH0A 3ZLTA 1J06A 2HU5A 5DWDA 1MN6A 3SK0A 4FKBA 4OUKX 1RWQA 2B61A 4H7JA 3RKSA 1IUNA 4UHCA 1DWPA 5C7YA 5AKIA 4DTCA 2ROQA 3DD5A 2QXTA 1QIJA 5AM1A 2YH2A 1ZD3A 2Y6VA 1R9MA 2WHRA 3WQHA 1UXOA 1PJAA 2UZ0A 4ZI5A 5ALQA 4K2AA 5FKJA 1XKTA 1CUSA 2HRRA 2XT0A 5D6OA 1CVLA 4OCZA 3G0BA 1NU8A 1AURA 2JEZA 2VF2A 2DQYA 3PDCA 3AINA 5CH8A 5KWJA 4WJLA 1DT5A 4HZGA 3ICVA 4C01A 1FFBA 2J4CA 5IVKA 5AI4A 1F0NA 4Y2JA 1VJ5A 4BB0A 4L72A 4I19A 3FCYA 5FLKA 1Z68A 3V1KA 2WTMA 1QGED 4WFIA 1TK3A 2WU4A 1C7IA 3H18A 4ZXFA 1IVYA 3EQ7A 5CW2A 5HFAA 1ZIYA 5AKGA 5LP1A 4TVKA 4G8DA 1N5RA 3KD2A 2OGZA 3FYTA 4AO8A 5AI6A 3WWEA 4INZA 5AICA 4Y2SA 5EIHA 4FBMA 4GLBA 2HA3A 4MQMA 5DYTA 4B0OA 3G9UA 2JGMA 4RE6A 5AP9A 2WKWA 1E8DA 4G1FA 5LYYA 5LLSA 1AGYA 5EHNA 4IHAA 1HPLA 3FBWA 4BP8A 1IMJA 2W6CX 4Q05A 2XQFA 1WB5A 1I6WA 3F8SA 2I3ZA 4X97A 5EHXA 5AJHA 2QS9A 3QMWA 1GKLA 5HKAA 2WILA 2J3DA 5ALZA 2VQ6A 2CUTA 2GZSA 3D2CA 4UBIA 4CIBA 1CUVA 4HS9A 1ZGCA 3WZLA 4UBKA 5AIAA 1CUFA 4G4JA 3L1HA 4OB8A 5E4YA 3QMMA 4WFJA 3A2MA 4FLFA 2QJWA 2C0QA 4KE9A 2Q0XA 1CQZA 4D9JA 3WWDA 4DM7A 1BROA 3AZPA 1QZ3A 1CUEA 2YYSA 5HCUA 4U2FA 4BBZA 4ZWNA 4FNGA 2WFLB 4FHZA 5AM2A 4J0CA 2HA5A 2ONCA 3HI4A 1JJFA 4ZGBA 2WHPA 5FOQA 1LPOA 3M3DA 2HA6A 2HU7A 4M0FA 1MO2A 5SYNA 5I9IA 2BUBA 3OOSA 4CG3A 2DFPA 3WKAA 1SCKA 3KOOA 1Q84A 5EIEA 4XX1A 2G63A 1LPNA 4FNMA 4FTWA 1XZBA 3VXKA 2JGJA 1JU3A 1XLUA 4A5SA 2HA4A 1EVEA 4B85A 1LLFA 5HKBA 5LIPA 1E89A 5ALVA 4IO0A 2Z5GA 4K6HA 1BN7A 2DSNA 4MWSA 1XZKA 4E11A 3H1BA 1EB9A 4QDTA 3DQZA 3TGLA 2EDCA 1KEZA 3WZMA 1CUJA 4H77A 1TRHA 2RHTA 5T4FA 2ZVDA 3H2KA 1YCDA 1QONA 3W9BA 3BDVA 3D2AA 4J0DA 4C4ZA 1YAHA 3Q0TA 3T4UA 2Y2VA 2RONA 1IUPA 5AM3A 2CZQA 1AKNA 3A6ZA 4QLOA 2PUJA 5ALMA 4B84A 3W05A 1EDEA 1K4YA 3C6ZA 4BCBA 1U2EA 4GECA 3WMRA 5AOCA 1L7AA 2G4LA 2OCGA 3BIXA 6YASA 3R3YA 2PM8A 2ZSHA 4J0JA 1MJ5A 2WIDA 4PSUA 1QIKA 3FCXA 1EK2A 3GBSA 2JGLA 4BYMA 1ORVA 1N5MA 1LPPA 3IIIA 1H22A 1MNQA 4HAIA 3IULA 2AXEA 3WIOA 4EY4A 3QZUA 3A2LA 2C7BA 4X95A 1LBSA 3V1MA 5IKXA 5A7HA 4BAZA 3H2IA 2QTBA 4Q3LA 3QPAA 4X91A 4H7FA 2OQIA 3NUZA 4P9NA 1T2NA 4X85A 1VE7A 4E15A 5JANA 4L9AA 7YASA 3ICWA 4NZZA 2H9YA 2WSLA 1UT6A 4OU4A 5ALGA 4IH1A 5C8XA 1X2BA 4FOLA 4N5IX 4GEGA 1HDEA 1OILA 3GFFA 1U8EA 2D5LA 4CCYB 2PBLA 1CUDA 2HRQA 1UWCA 4N8EA 1QIEA 1QIGA 3VISA 4Q1VA 3VJKA 4J03A 3C45A 3R3ZA 4HXEB 2RGUA 5ALPA 1UOQA 2WLSA 2ORYA 5AKZA 5EHZA 1CLEA 1HKHA 3G0DA 1E66A 2HDWA 2OGSA 1FFDA 1P0MA 2ACEA 4KRXA 1XKLA 1XQWA 4DMHA 1R50A 4B80A 3AIKA 1AMNA 1CUWA 4QWWA 4X6XA 1YSCA 2WJ4A 1P0PA 1TCBA 1XZFA 4DGQA 2JIDA 2J3QA 4ITVA 2VATA 4EY5A 4ARBA 3QPDA 4H7HA 5AO9A 2C0PA 5EHQA 5AKKA 2WIJA 2OAEA 3GROA 3L1JA 4UHFA 3RM3A 3MUOA 1EHYA 3PUIA 3DS8A 1J2EA 4UFPA 3NOXA 4OSEA 3BF8A 4DSZA 4KEAA 4RNCA 2O2IA 1E8MA 4KAFA 1DINA 4X3CA 4Y7DA 5BOVA 2VEOA 3I6YA 2WQZA 1QFSA 2PUHA 2X76A 4EB0A 5AK3A 4HVTA 3WK5A 3G9ZA 1JMKC 5AKJA 1CPYA 1PFQA 3GUUA 1WM1A 2XMSA 1QIHA 3PFBA 3DYVA 1XQYA 4DMCA 1AQLA 4YK7A 1TIBA 3UUFA 4G4IA 3WLAA 2BGRA 1EXWA 2QMQA 1FSSA 1EI9A 2QJRA 1CUHA 2IITA 3G9TA 5HZGA 3WL6A 4XVCA 4KJXA 3F9CA 4BCCA 4BP9A 2PPLA 3PF9A 4UHBA 5HF8A 4DNQA 2W22A 1JJIA 2B9VA 3DJYA 3I1IA 4RPCA 1BCSA 5JADA 2WFLA 2HADA 2XUAA 3WJ1A 4LXIA 4FDMA 4JUIA 3AUKA 5ALHA 1X2EA 5JAPA 1G4HA 5LKAA 5AI5A 3B3QA 2V96A 3ZLVA 2XDWA 4JEIA 1UK7A 2Y1KA 2XUGA 1QO9A 3A2NA 1AUOA 2XQIA 3HXKA 3P2MA 4BDSA 3U1TA 1XROA 3QM1A 3H2JA 3RARA 3C43A 4W1PA 3E1GA 3D4LA 1VZ3A 3HLKA 1XZLA 5A71A 5K3FB 3N0TA 3U0VA 4LKOA 4UHEA 3W2TA 3WI7A 4Q3KA 5ALTA 5C8ZA 5ALKA 3H1AA 5JATA 5AI0A 4Q34A 4BATA 3EQ9A 3D2BA 1Q83A 4EA6A 5JZ9A 2GBGA 3VVLA 1FFAA 1WCYA 3HC7A 4J7AA 3R41A 4DNPA 1GQSA 3MGAA 4WDQA 1H23A 3HEAA 1Y7HA 4FLMA 4H0CA 4CFSA 1CEXA 1L7RA 3WL7A 1UK6A 4O08A 4MXDA 4CIAA 3BWXA 5ISMA 3K9BA 4FFVA 3JWEA 2AJBA 4Q82A 4AZ3A 3STXA 2JBWA 3BE8A 2DHCA 1UOOA 2JGIA 4Y2RA 4H7IA 5ALRA 2OAGA 4KE8A 1N8SA 2QRUA 5ALNA 4CG1A 5CBKA 1NU6A 2BUAA 5KREA 2CB9A 1VLQA 3G02A 3I6ZA 3X3HA 2FJPA 4GHWA 5E4JA 3H19A 2DCMA 2VJAA 1ODSA 3F97A 5FPQA 1EB8A 3M83A 4FWBA 3QBJA 4TGLA 4B83A 3F67A 5K3CA 3STUA 3MUNA 5HQ3B 3L1IA 5DTJA 5IVHA 4UPDA 4I3FA 1MAHA 3QITA 3DOIA 1T4MA 2HHAA 3D5EA 1GQRA 2LIPA 2WJ6A 4FLEA 3FWHA 5AK6A 3KXPA 2XUJA 5FXMA 4EUSA 5SYMA 4UBMA 2PVSA 1XFDA 3JW8A 3C70A 2ZYSA 5DNVA 1XRRA 4B82A 1W1IA 5IH7A 3E4DA 3EQ8A 1BEZA 1CUUA 2ZJ6A 4BVKA 3DCNA 2ZJFA 2NW6A 4CCYA 4E14A 5T4BA 3O9MA 1XLVA 1CV2A 3KSRA 4DMKA 1WHSA 4Z49A 4PW0A 5K3EA 1DWOA 1PV1A 2XMBA 3TJMA 2RIPA 2RAUA 5BWBA 5YASA 1SCIA 2VJDA 1MNAA 1DTEA 4P92A 2XQJA 3FLEA 3ANSA 3O4HA 4XWGA 3D7RA 1JMYA 1ZI9A 2BCEA 1YA8A 5AKHA 1FJ2A 2Y6UA 2XUFA 3AZOA 4NS4A 2XMZA 3OURA 2BFNA 3SWWA 3V48A 5HF9A 1LPBB 3KWJA 1TCAA 2AJCA 1BCRA 2WTNA 2D0DA 3DL7A 3D59A 2Z3WA 3FSGD 5JASA 3CN9A 2GYWA 3HRHA 5CH5A 2O2HA 3C5VA 3O95A 2R11A 5AOBA 4EZIA 4BDTA 3CXUA 1DQYA 4G9GA 4LXHA 3FLBA 1W75A 3V1NA 2Y2UA 1ETHA 5JZSA 3H2HA 4C6HA 3STTA 3FYUC 3IUNA 4ZV7A 3PF8A 2QZPA 4B7ZA 4DIUA 2BJHA 5JZBA 3WKDA 1YASA 4WCVA 3DLTA 5AK5A 1Y37A 5JAUA 2HU8A 3HSSA 3RK4A 4W1QA 3DKKA 3ESBA 4PO3X 1VA5A 2HL6A 4OYYA 1CUCA 1LPSA 3DOHA 1QIDA 1YR2A 3BDIA 5ALWA 2GYVA 2JGKA 3BJRA 5AOAA 2CMFA 4V2IA 1XZDA 4UHHA 4K6GA 3WK6A 2V98A 1EX9A 4J3JA 5HK9A 1YS2X 1IZ7A 3AIMA 4KACA 3ESCA 3R3VA 3IUQA 1XRNA 2OLEA 4PQEA 1VXOA 5ALFA 2VJCA 4LXGA 1IUOA 1XQXA 5EI5A 4DLNA 5E4TA 1FFCA 2X8BA 4X71A 2WFZA 2ZYIA 3LLCA 1A8SA 3HABA 1FFEA 2ZYRA 5LZ7A 4CG2A 4BZWA 2QOEA 2XMDA 3CN7A 4EBBA 3QYJA 5DJ5A 2C5FA 2JGFA 3F96A 1EVQA 3I2HA 4PNZA 4W9RA 3HACA 2EEPA 4BC1A 5ALLA 2XQKA 4X6YA 4QWMA 3AJAA 1X70A 3WWPA 2I78A 4C4YA 4AQDA 2BUCA 5ALXA 2WUGA 4BRSA 4GDMA 3C5WP 3JYHA 4PSDA 2XMRA 1G42A 1YA4A 5AKYA 3I2GA 2VAVA 3ESAA 4Y2QA 1WOMA 4CI9A 4J0IA 4F60A 4JH0A 3WA7A 2FUKA 3G9XA 3PUHA 4X7BA 4ZRDA 3TEJA 4BTLA 1XZEA 1ZIXA 2QKYA 1UKCA 2H7CA 4N8DA 3ZLUA 3IUJA 2O7VA 3QMVA 3IBTA 5D7BA 5LKRA 5H3HA 5IVIA 3WWCA 1K63A 1GPLA 1H2WA 4UBLA 4WY8A 2VAXA 5DYYA 1TKRA 3LCRA 1H2ZA 4QLAA 4ETWA 5AIBA 2G5TA 4H7EA 4Y9SA 3O4GA 4QDUA 5LZ2A 2VSQA 3STYA 1VA4A 4Q3OA 3DNMA 1AC5A 4FBLA 4BVJA 4H35A 3E3AA 5JD5A 4FMPA 3B5EA 1MTZA 1C4XA 4P08A 5HQ3A 3H04A 3WK8A 5CRIA 5JIBA 3I2KA 1JU4A 1QFMA 4G8BA 4DSAA 5EIAA 4AN0A 2OCIA 1W52X 3WK9A 1F0PA 3PE6A 2QUBA 4B81A 5CXUA 1R9NA 2B4KA 1SOMA 1A7UA 2CBGA 2VT7A 3G8YA 3WWOA 2RHWA 1CFJA 2ECFA 3C8HA 5ALJA 5DTIA 5ALIA 5CT9A 2XUKA 5HF6A 1A8QA 1DU4A 1YB6A 3D0KA 2O7RA 3WL8A 1E3QA 4DNFA 5A62A 5ALUA 1XZMA 1CIJA 5AI9A 1IZ8A 4AB1A 5D3ZA 1MX9A 1UK8A 4QA9A 4BZZA 1WHTA 3H2GA 4YPVA 4G4GA 5FUMA 5JD6A 2AJDA 1DWQA 2VTVA 2XLCA 1MU0A 4WDRA 4EY6A 3AILA 2HA7A 5CT5A 4UBNA 4E46A 4ZREA 1CUYA 3C6XA 1U65A 1A88A 1RYYA 1QIFA 1TAHA 2WUEA 3KWFA 3C87A 3UUEA 3LS2A 2OCKA 2DQZA 4JNCA 3YASA 3DEAA 4QDXA 2I3DA 4UFNA 4QE3A 1ISPA 1UOPA 2HIHA 4DNOA 5FDFA 3O9VA 3M81A 5ALYA 2OXEA 4PF1A 1MT3A 4AXBA 3DKRA 4U2GA 1B41A 4ZV9A 2OG1A 4IH4A 1VXRA 1N1MA 5K3DA 3NWOA 5D3KA 1ZD5A 5A7GA 2Z8XA 3OTQA 4U2DA 1GT6A 3PFCA 4EY7A 1O6FA 1AZWA 4ARAA 1KU0A 3IUMA 4J0KA 1UKBA 2CEKA 4WY5A 1H2XA 3ANTA 3ZPXA 5C8VA
chains in the Genus database with same CATH superfamily
1BEUB 4YAIA 2JI8A 5FA6A 3IRUA 3GUCA 4OJMX 5T4EA 4GWLA 4X66B 3FOBA 2MOKA 2O54A 2CLFB 2ZEJA 1Q0ZA 3MGCA 4LMPA 4NCBA 4LYEA 2AE1A 2PRYA 2RHLA 4XZ3A 4I9HA 4UU8A 1FVOA 1YS6A 2RGAA 3CMCO 2BP7B 2OM6A 4H17A 2Y67A 5AM5A 5AW3A 1X87A 4E32A 1FP1D 3BA1A 2GARA 2NVUB 4GMKA 1KA9H 3RBVA 2B3DA 2P9TA 3IELA 4PEVA 1LBEA 5AJUA 1WDLA 1SHJA 2YFKA 1U7TA 3MSCA 4KGXA 4LVUA 4ZRNA 3NHAA 2GO7A 1PCXA 3KWLA 1RYZA 3I5AA 3HYSA 4OUDA 2QVCA 5K0EA 3CC8A 3PX7A 1M2VA 4QKQA 3U7GA 4XB1A 3ADDA 4IUYA 4Q4DA 3ENZA 4NH4A 4Q15A 3OLCX 1WLYA 1N2CB 2ZSAA 1SM4A 1YS1X 4J90A 4M83A 4YVFA 5HIIA 4E22A 1BW9B 3G85A 1ZM9A 2YJTD 4HXGA 1LDEA 5TEVA 5IARA 4CTNA 3HKEB 1E32A 3GRVA 4Q4LA 3UMRA 4Z7NB 1FS6A 1UJNA 1G64A 3RB8A 2IUSA 4ZALA 4E1BA 4KRYA 2YJZA 2HH9A 3BRWD 2QN9A 1WKCA 3A28A 3ENWA 4WD3A 4G0PA 5F12A 1NI5A 3DG9A 1N78A 1GKIA 3VKFA 4GXTA 1TD9A 1Q3TA 2E18A 4NFHA 4FMCB 3AXSA 3RLIA 2EJWA 3OOHA 1G7SA 3OC0A 3PC4A 1I4WA 4ON9A 1RRPA 3RUFA 4DT1A 1XZQA 4OFBA 4L85A 1OY1A 5LZ9A 1LJ8A 3GPCA 4B32A 1KJJA 3BRQA 3ADCA 4LZAA 4HDSB 3OZCA 3MMXA 2GCOB 9GPBA 5D3QA 5I7RA 3DLIA 1Q3KA 3FJOA 1SBCA 4QFMA 1XO1A 2YY7A 2CXUA 4LBYA 2PJUA 1I3MA 2JI6A 2TMDA 4A8JB 1YUBA 4LJYA 4B3DA 3MJCA 5F4ZA 2I1VB 4FD3A 3WGGA 3GVIA 3WNCA 4IQ0A 4PCLA 1NNUA 3QF7A 3PJDA 2A1UB 3JZMA 4AMYA 3WKCA 2JLWA 4HDKA 1X6VA 4IQ4A 4B4UA 5E8RA 3CJRA 1KFEB 3E0XA 4LJ7A 3ZYCA 3E2MA 1DKRA 3JQ7A 3X1JA 2BMEA 1KWGA 4RCZA 4LHZA 3SSAA 1KZ9A 5ECWA 1DFIA 1PT7A 2XMQA 1ZESA 1N75A 2YY6A 3EAFA 3IV7A 5LBIA 1FF9A 2CNDA 3O3MB 2V0GA 1SNYA 3PNBA 4ARSA 1KK1A 3ROPA 1QQTA 2Y99A 5HOQA 3S81A 2VCEA 1CZUA 2GRAA 3THYA 1SXJA 3OZVA 3QV2A 2H1FA 2Q99A 3LZCA 5A5EA 3SC2B 3AF6A 5CDGA 2XLBA 2PZEA 3RVDA 3I73A 4EATA 2I22A 2MMCA 5BV8A 4YTEA 4IGFA 4TL9A 1KAGA 1OKKA 4QGGA 3CWQA 5TVGA 5C5CA 1JILA 2MDTA 1JLSA 2ZW9A 4Q6WA 4RIFA 4BAGA 4MW5A 2R7KA 5U9CA 5BYKA 4ARIA 3ED5A 2VQEB 1M1NB 3WZ2A 4EEKA 4YUAA 2EHDA 4CR8A 1U0BB 1C0KA 4WN9B 2OXCA 5EPOA 2EQAA 4P0PB 1J33A 4HFMA 2YINC 1PFWA 4H3SA 5CT4A 3EZ6A 1FK8A 4CLXA 1SVMA 3ZG6A 2OUIA 5HUHA 3L0IB 4MUNA 2DUNA 4ZZ3A 1EJ6A 1QAOA 3ZV7A 4P7KA 4W5JA 5IZCA 2B6NA 1GL7A 3NO4A 5EHIA 3HCDA 3IL2A 3HEMA 2VPIA 1E2FA 3E35A 3BFVA 5LBTA 3TRHA 2G5PA 4GZ6A 2QVYX 3O8OA 4JU9A 1MPXA 1D2RA 1NVWQ 2CNLA 4OQMA 3WJAA 5K03A 2M2IA 4G5XA 3T4XA 4FNOA 4UTPA 3KDPA 3PDHA 3PP8A 4QPCA 4RL6A 5TARA 3ZGZA 1EPUA 2BRUC 2X6RA 3BHNA 1ZWLA 4GQAA 2PX0A 5DX8A 1VE5A 2ATXA 4AMBA 6AT1A 2HMAA 1RFLA 4R9VA 1G20B 1XZCA 1IXRC 3RASA 3GFPA 4KAXA 4AO6A 5ICFA 1DCKA 1DARA 2RBKA 2GPTA 4ZOCA 1DWUA 1WRBA 1IQUA 3R5HA 1FTYA 2WJYA 3PXCX 1HQDA 4CMIA 2VH1A 4NFYA 3AETB 4KE6A 1XZAA 4GOOD 5T67A 4OATA 4IF4A 1XD2B 1KDPA 4ODIA 4E3ZA 1ZRNA 1BVYF 5DNYB 1A8HA 1UMDA 1CRZA 3QVTA 3ZZMA 3ZGLA 2P2YA 1AUQA 5EFZA 5JZOA 2PZKA 2SECE 4HEQA 1B0AA 1IRIA 1O1YA 1U9ZA 3ICCA 3TQOA 3P71T 3K2EA 1ZCJA 2DPHA 3K16A 4KUEA 3UAGA 2W98A 1GRQA 5HRUA 2QL6A 4M55A 2AL7A 3HYCA 1VGRA 3U4GA 2IHTA 2AIRA 4LJ5A 1ND6A 2FX5A 4L22A 1QU3A 3B1WA 3II6X 2WWWA 4KZKA 4QL3A 4FQ8A 3W1EA 2MSNA 3LUJA 5CG2A 1V35A 1AK9A 2WTAA 5AK4A 1T26A 3KOMA 3O83A 3PVZA 4YNBA 2ZSDA 4DR3B 4FCCA 1WF3A 3TRDA 2XNHA 1JR6A 1BHO1 1HY3A 4UUQA 3SN6A 4MW2A 2HO5A 1WW8A 2ZWVA 4RA6A 5J23A 2ZBGA 4N8SA 4AJHA 2RGDA 1D1TA 4A16A 1EA5A 2QNIA 1M34B 1LSSA 1KH2A 1JSZA 2EDAA 3PTLA 2PHZA 4F38A 4M9XA 4GFDA 1PT6A 2FUNB 1FXWF 1UODA 2R86A 3IKLA 4P7FA 4BE9A 1P5ZB 1Q7CA 1U04A 2JIBA 5H59A 1KEUA 3EK2A 5HGJA 1P0QA 2B4AA 1F8GA 1KI6A 1OF1A 1VYUA 3LGAA 5C3UA 3VNUA 3M82A 1GCAA 3MELA 4J0HA 4ZAWA 4U2BA 2C82A 3ZEIA 3B6JA 1K92A 2GEDA 5LYJA 4Z1MD 1BHQ1 5P8WA 3WK4A 4AF8A 3MWGA 4AJKA 2Y71A 2ZU0C 4YJKA 2WE8A 1EP1B 3IPLA 1KI4A 1ZPDA 5CA1B 3HB1A 3OM8A 3B12A 3FAKA 4ESVA 3V6MA 4EHBA 3W5CA 1GU1A 2CXHA 2QPLA 2AHOA 5BQPA 3RS4A 2OC9A 2H2AA 3P97A 3KHUA 1GVNB 4UU7A 4YFVA 4CL8A 1RRCA 3AUAA 1MFPA 3B38A 2G9UA 3F1LA 3KL2A 3PKJA 5JAHA 4Q9LA 4DBVO 2WFAA 2WVHA 2FFAA 4AP6A 1Y1TA 1U2GC 1TTHA 4RD2A 1FYDA 1JVBA 1IZ9A 2WNIA 3K72B 3Q3HA 3W2FA 2IY8A 3F73A 1IYZA 3CTMA 1EZ1A 1NTOA 1DG3A 1IBCA 1U8AA 3LYUA 3I5MA 1DRWA 4IYRA 3T5BA 5G4KA 4QICA 2PKEA 5AKEA 1P1JA 3B3GA 3BHIA 5B3JC 1KI2A 1QIIA 2AKEA 5LQKA 1L2TA 1PQ4A 1JEOA 2IE0A 2WVJA 4RPJA 3BK7A 4LGCA 4MQLA 4OA8A 4UPVA 4ARZA 4C0JA 5TRTA 2A94A 1SHUX 1XRQA 2X0DA 2IX9A 5B3LA 4FR5A 1W44A 1NBIA 1GQOA 1ZZEA 2AC2A 1GNPA 2FGKA 2QX7A 1B1CA 4CETA 5FV4A 4KMSA 4KKXB 3ZTYA 3W5AA 4RWZA 5FPPA 5L9AA 4U2EA 3BWVA 1B0ZA 3C7TA 1VQ1A 3FH0A 4RJ2A 3TPCA 3MVEA 5BURA 3GP5A 4JJ8A 1HT1E 4LJ9A 4D56A 2ZUDA 2OHIA 3G5LA 2NADA 4RA9B 3RHZA 4XH9B 1HL7A 1U9JA 3C2QA 1GPWB 2HV8A 1CJCA 4IKPA 5CTJA 1CUIA 3LQ4A 1YI1A 4JL8A 3Q8KA 1VMIA 5CD1A 2JGDB 4W4TA 4RVSA 2EJTA 2XB6A 4FT4A 1HYBA 1QDUA 2YUIA 4M49A 3VZDA 4ENUA 3FDFA 1KZ6A 4YYEA 1LW7A 2E87A 1CQWA 2Z2JA 1GU7A 2ATEA 3DEIA 1T8RA 1TECE 2NSJA 1VZ2A 3E8SA 3I2JA 5B1DA 3WIVA 2C2XA 2GK4A 3K15A 1LDYA 1OHHD 2YBDA 4PC3A 1NPDA 4HRXA 4U9IS 4AUEA 1WJGA 5CFMA 2GMWA 2XWSA 4E88A 3CYFA 1BU8A 4RTRA 4OXXA 3GG9A 2D06A 1Y98A 2X23A 1N2JA 1RLUA 2WSMA 1SRQA 1DBIA 3PJGA 3R9IA 1FYWA 3UENA 1YZKA 3DZ8A 1Z6AA 3JRWA 3UXMA 3WLEA 1Y6FA 5L4LA 4LK3A 1UBLS 3TLEA 4BMPB 5BPHA 2XV1A 3RT9A 1GTG1 3S44A 1P6UA 3AHJA 821PA 4G2NA 4PHCA 3PQ5A 2Y1XA 3CGWA 1MH1A 4PIVA 3QY0A 4ROTA 4EEZA 4M8LA 3W04A 1EWYA 4Q0MA 4BB6A 2GUWA 1HA3A 4TM7A 3SY8A 4FT2A 3VOAA 2WF5A 4X9XA 5LQDA 1C4OA 3HQ4O 5JJ5A 4J91A 2H08A 4LHXA 4Z3KA 3ZD8A 1SN7A 3W06A 2IP2A 1F2DA 1J0CA 2BMJA 4AYXA 2QG6A 3LRPA 1K97A 3IV9A 2K2WA 5AW6A 1ST3A 2C58A 3N2ZB 5A2GA 1CVIA 1F9EA 2DMRA 1NI4A 4Z9FA 4DYHA 2CFCA 1Y4UA 3QNUA 1KPGA 3R3JA 3IKMB 1NQ5A 4UKDA 4EIWA 1X7GA 1JDZA 1MIOB 1MVNA 1OXMA 1B73A 2OCLA 3AU8A 1JEJA 3LC1O 3MOSA 1P3DA 2WABA 5JC8A 1R4MB 4LUCA 3WE7A 3GCXA 3CUYA 3OUTA 1ZP6A 3REOA 3OZAA 4XVQA 4QOEA 5IAEA 4H4EA 2D1SA 1W5SA 5ERXA 2O8CB 3WKEA 1Z08A 4EKEA 4TLMB 2GAOA 2H1OA 1LQTA 2HA0A 3I9V6 3L4BA 3C6BA 5HILA 1D2AA 1YZQA 3LBHA 4HLNA 1QCZA 5EJ2A 1IN8A 4GBMA 3S2EA 5LA6F 5BUSA 2Z5FA 5I8PA 5HZKA 3T9AA 4NWIA 4EG0A 1JEQA 4IFBA 5C53B 3DE7X 3RVJA 2A8YA 2Z6AA 1QDLB 2SCUB 3W6ZA 4GBGA 2FFJA 1QP4A 4UU1A 1B74A 1XDZA 1LNSA 3G8AA 4MYDA 3E3OA 5BWLA 3HDVA 2V6BA 6ABPA 4HDNB 1UZNA 2VYNA 1F8UA 3BFKA 3SVZA 4AXXA 1ORTA 4ZVSA 2JD2A 4NFSA 5TS2A 1YAJA 5JHHB 3PJRA 1I7DA 2WJJA 2VFAA 1H9BA 4N0QA 1FUIA 1E0KA 1H3NA 1KK2A 1U1CA 3OO1A 3PGJA 4L7VA 4F5EA 5JD4A 1KIAA 2ZJ2A 4OL0A 4AX4A 1ONSA 4Z7OB 1J1IA 3LJKA 3VBEA 5B57C 2NP7A 2PQ6A 4I5FA 5IBQA 3WB9A 4PYIA 1H6DA 2QRGA 3H1FA 1WBDA 5JZMA 3C6YA 5GIPE 6NULA 2ZAMA 3LL7A 1OYWA 1NBWB 1Z2NX 2WF6A 1HLGA 2OGTA 2HDNB 4UXJA 1PU2A 4GI3A 4UOEA 5CDSA 5KTYA 3ELDA 2CV2A 4FGJA 2JCSA 4YJ3A 4O4JA 5H0IA 5FA8A 2Z6QA 3HKBA 1TA9A 3K6KA 4ZTZB 2DUJA 4HYQA 5E1DA 3OZ7A 4L3WA 1IY8A 2ZZKA 2FPGB 3IB6A 3MBKA 4BMZA 1KH1A 3SS8A 3I28A 1SBHA 3R0VA 2BFFB 4HNSA 2PVCA 1DRKA 2YNMA 3EEFA 1XTIA 2WB4A 2J30A 1U2QA 3RT1A 4AYWA 1OX4A 1T4GA 4B6JA 3FWPA 2GJAA 4D8TA 2R4UA 3QOYA 4FEEA 4C0KA 2YOFA 3OTHA 4R2KA 4S1NA 3D3WB 3IXLA 4Z8XA 5K3AA 1TUBA 3EASA 2ORVA 2J5QA 5CT6A 3TNDA 1PW7A 1NM5A 1VG0B 3GHYA 2XDQB 2B21A 3EXHC 2F8LA 4YRNA 2P2SA 2PX4A 4FFOA 3EGVA 1TJ4A 5BRNA 4P3YA 4BWGA 3PQ4A 3ESRA 4RY2A 1KARA 2YZ7A 1OH5A 3IH5A 4WXMA 4OXNA 1XN4A 3DD1A 4QEDA 1D3AA 3IAHA 3PV0A 4AKSA 2E48A 1FTQA 1XLTC 3OI7A 4KR0A 3U4HA 4JQSA 1M2EA 1EUDB 4Q7JB 2VS1A 4RHFA 4L07A 5JEDA 5EIXA 4WXPA 1X3SA 1R3DA 1VBMA 2C4TA 3K1ZA 2FX2A 1Z8DA 2WU3A 4NP6A 5FOWA 4EVRA 4D9FA 1K8QA 4EY6A 2ADMA 4LF7B 2I4IA 2IF2A 5ESWA 5FULA 3UMJA 4MKFA 3FVTA 1X7HA 5F1YA 1KYTA 1UJ4A 5G1PA 3M0EA 4P5DA 9ABPA 1L7NA 5IUNC 2Q0QA 2Z95A 3MFQA 4D46A 5JFOA 1I4EB 1EE1A 1XQ1A 3WIUA 4G0WA 2Z2XA 5B5SA 1AX9A 3PNQA 4OHOA 4YP5A 1CUAA 1TAQA 1YB4A 2XUQA 5GJVC 4YASA 4B6PA 5H8WA 3RDPA 2G28A 4IMRA 4CLRB 4EG3A 2W2LD 3RS8A 2NLOA 4RYDA 1MX5A 1UJCA 4WLUA 3RYHA 4FE3A 4E21A 1JIXA 8ADHA 1UEXC 1QGUA 1NBMD 2VNSA 4WCDA 5BPFA 4DAOA 5KWIA 1AUPA 1FMJA 4D0SA 4BBAA 4R6XA 4XWKA 1VSVA 3ZGYA 4I1RA 4ZVUA 3KSMA 1GVHA 1SHLA 3OT4A 2FUG6 4E5MA 4RMIA 4JJAA 3FNRA 1QO7A 4DRYA 3PRYA 2UYOA 3AY6A 5LP6B 2BDUA 2PR7A 3I72A 5EE9A 5SZJA 2PG3A 2QYTA 1I5RA 3UY4A 1LU9A 5KWVA 3K92A 5L6LB 2DLDA 2WM9B 4IOJA 4J0GA 4I99A 5CM2Z 3I6MA 4KXWA 1BYUA 2VRWA 1SCQA 4LYAA 4N0EA 1DLIA 5E7JA 1V3TA 2A9QA 4F2DA 5CURA 1TVKB 2C9OA 2QUJA 4MH0R 1GL3A 4Q4HB 5E9WA 5FNVA 5SY4A 2EIHA 2XSZD 2GYUA 5C2JB 4X62B 4XAQA 3LWDA 2CNBA 1FNCA 3JAKB 3RS7A 1PJBA 1TMYA 3KQOA 5ENVA 1E9SA 3RPEA 3AVXA 2EGGA 4DR6B 5GVSA 1FYXA 2Q9CA 1P7VA 3HZRA 4QUKA 3JR7A 4U6QA 3BK1A 4CT0A 3K20A 3TW4A 2Q3EA 4D9IA 2Z3ZA 4E2ZA 3CSSA 3WKBA 2XNDA 2QD4A 3ZGVA 5JBIA 3RREA 1HDZA 2AUMA 4LRWA 1ZJ6A 3K09A 5I01A 3K9GA 4D6PA 5JFGA 2VSXA 1DEOA 2H7VA 3ONWA 2W6IA 3KR2A 1W4LA 2VSYA 1Y7TA 1YC2A 2D0PB 5AI8A 1OGIA 4QO8A 3LT2A 2QBYA 2NN3C 3B78A 2OMEA 2CYAA 3DNPA 3FLAA 5C46F 5CCBA 1B8OA 2WF9A 3C4VA 4U39A 3WHLA 1XXHE 2GN6A 3OCUA 1KSJA 2JFVA 3OE7D 5CVCA 4BFWA 5LZ4A 5KNDD 2PWAA 1Z0UA 2XNCA 1YDFA 2VDMB 2ZIGA 3AUXA 3KV1A 5DSZA 3RAPR 3RTCA 4EARA 1XTSA 3FKSA 4Y0AA 1SJ9A 2C7VA 3DWEX 3M6MD 3PCXA 3PC8A 3ER6A 2V4ZA 3AFGA 4KPUA 5EKTA 1N2XA 5EUBA 1IHYA 1WMFA 5I7UA 1I7QB 2CLMB 1GPKA 1A69A 1N1DA 3WVNA 4I1PA 2G17A 1NNSA 2I2CA 4HUQB 4UVIA 3U5TA 3GYGA 5CXXA 5C1DA 4K3UA 1KOJA 1XU9A 1AM4D 3CLKA 1R74A 2CMDA 1PFGA 4I8DA 5E7IA 1JA1A 1QH8A 3O73A 5C81A 2AUNA 4DCNA 2XGGA 5FPTA 4NAVA 2JZNA 2R1TA 5CDTA 2WVAA 4RFSB 2H6EA 2B8WA 5L7WA 1NYLA 1LX7A 4O02B 1B2LA 3DE1X 1MRZA 2F1RA 5F7JA 4DMLA 2ZSEA 5CYGA 2NP6A 3BJMA 2R8BA 1Q1NA 4JAVC 2FZGA 2NPFA 1H1DA 1PEYA 1PJQA 4MGIR 3R7DA 1ATIA 3V42A 3FYUA 4L4RA 1GNRA 1PBNA 2WMNB 5C8YF 5EESA 3CZ5A 2PMBA 1R1DA 4LYYA 4HH0A 4JJFA 3I9LA 3AESA 1B8PA 1K5PA 1U3FA 4FDTA 3LQRA 1TO2E 1H6AA 1K5HA 1R27A 4MW7A 3GLIA 3SQDA 4MS4B 5FAXA 3ZWKA 4DDMA 2GUGA 2B4TO 1Q7EA 2NT4A 4OJQA 3KETA 1VPVA 3N2NA 3OOEA 4QO7A 3Q11A 1VI5A 1E4YA 3ESDA 3HY4A 4R8RA 1HK7A 2NPOA 4NHOA 2XRMA 1KY2A 4Y2PA 1B2RA 2PU7A 3KDSE 4GUAA 3G7NA 4QTXA 2VTBB 4X1YA 4AD8A 2CWWA 3QWBA 4EK9A 4BHTA 4HADA 1AGNA 1WB4A 2PTHA 3I2IA 2IUTA 2C1ZA 1UK9A 3K5HA 1NA5A 2GLTA 3BC1A 4DXAA 4WLOA 1OI3A 2H29A 4DUPA 1YMQA 4CV3A 3MT8A 1PRYA 3PL1A 5GM1A 1UBTS 4JJ4A 2M6KA 1WY7A 4W7SA 2ZR8A 2A9PA 3FPEA 4KAJA 1NNI1 3V2IA 4J3FA 3LIIA 1WPRA 1Z26A 2F64A 5F7ZA 2D1QA 3G17A 4MEAA 2BZGA 3W7BA 1M0SA 2B8TA 3CVVA 1ZIPA 1WDMA 4ZAGA 3QEKA 1KVSA 3UJDA 5LU9A 2CDRA 5JBQA 4G1CA 2NSDA 2O23A 3TB4A 2VPPA 3ZD6A 3DZFA 1C3VA 4PC7A 4BN0A 2YXEA 4CM1A 3LY7A 1FQJA 1PZHA 2A9VA 1R66A 4ONEA 4X3OA 4R1OA 4KIJA 1Y0BA 1R6XA 3BHMA 2QDXA 4AN1A 2PO7A 7AT1A 2ASEA 4PG7A 4R69A 2H11A 1RKXA 1YONA 4AKHA 1IBRA 4LE2A 4YAFA 3HCEA 2DC1A 2ZWOA 3EVCA 1EH5A 2I6GA 1G5IA 1GPNA 2IFTA 4IRMA 5AH0A 3RK0A 2VPYA 3P9YA 3UQYS 4RH1A 3UGTA 2WTEA 3Q5DA 5E3HA 2ATVA 4HGQA 4UDOA 2BWJA 1DCMA 1K6MA 3T3HA 3KSZO 3LHSA 3O82A 1KH3A 2JGNA 3HJFA 1LLUA 2NAPA 3AKZA 4GD3Q 3ZIAD 2PFGA 4RHEA 2PD3A 3HA5A 2DETA 1TGYA 1DWPA 2ONZA 3URKA 4ZGGA 3T61A 3BMNB 5KOHB 3LWBA 4G5HA 1THZA 5FLEX 2BGWA 4DTCA 2WVGA 1E96A 3D4OA 4F4CA 3U1BA 4BBPA 3P9IA 3PNSA 1JN0A 1E2DA 3ETCA 4RX1A 3U4QA 4LHYA 5GIOE 4B40A 4G0OA 2II6A 5ARCA 4FDUA 5AM1A 2Y1EA 1PQPA 4YT8A 3E9EA 2YH2A 2Z6UA 2RI0A 2RB4A 2I6XA 4Q3CA 2G8LA 2M6SA 4DANA 4ITRC 3ZDYB 1E9RA 1XCPA 3IP9A 1GP2A 1NURA 2Q28A 2WU0A 3HXLA 3IX7A 3LZDA 3TXYA 5HPYB 5FBHA 2BV3A 5IPFA 2WUWE 2PSSA 3IMFA 1UQUA 1L9XA 1RQ2A 2C2GA 3IQGX 1DAGA 5EP1A 1JVSA 2FEWB 3R75A 3RYFB 1RVDA 5AHOA 5DNDA 1FDOA 4JR1A 5IJ9A 4U7JA 2IZZA 5ICEA 2XEDA 2LV8A 4IJUA 3G0HA 1CUSA 4IXTA 1NYRA 3RSOA 5JAMA 2I62A 2AOUA 1CVLA 5LWHA 1AJEA 3MIIA 2R5WA 3EFOA 3G0BA 4F92B 5HGXA 1K8ZB 3SCZA 2AMLA 2L42A 1EGQA 5BWOA 1NU8A 3PK0A 3G8CA 3PDCA 2VF2A 2DQYA 4MLZA 1CJVC 2X9QA 2ZJOA 3GVXA 3Q7SA 5BXYA 1QVRA 1MG0A 5IM4A 5CH8A 4WJLA 3KKLA 1R6AA 1LX6A 3AWIA 2G9ZA 3AEUA 2D2EA 3EZFA 4G1EB 3NM4A 4JP8A 2XB2A 3L8FA 2QTVB 2H16A 3MCUA 3QE0A 4IDGA 4UEQA 1FFBA 4C01A 5HSGA 3ADBA 5JU6A 5DXFA 2PTGA 3FOZA 2FMKA 3MWEA 4REQA 1I3NA 2Q0HA 3ACCA 4PPYA 2QYSA 3WMFA 1E9FA 2GZ2A 4F5WA 2G40A 2VZLA 4Y2JA 1VJ5A 4BB0A 4O63O 4CFYA 3WLRA 3U81A 1QXSA 2Q27A 3FMFA 3F7OA 1XN1A 2GN9A 3E82A 1QUFA 2GX6A 3LKDA 2V7PA 5BN4B 2R8OA 3E4CA 1PL7A 5EINA 3TOSA 5ANRB 2ZRGA 1L7BA 2PS1A 2AKYA 3GPIA 4ZEMA 5IS2A 1JDTA 2H1RA 1OR8A 1TK9A 4H1VA 1THMA 3QE9Y 5FHRA 1JAHA 2OBNA 5J4VA 1YCGA 2XB8A 3I9MA 4RZQA 3DBRA 4BL5A 5BV0A 2P9ZA 1E6KA 1NVTA 1QPBA 1IJEA 4KBYA 4G8DA 1N5RA 3P9SA 2OGZA 3KOXA 4O4JF 4YJ3F 1UDWA 1TM1E 4M0KA 4FFBB 721PA 2W2KA 2ZWAA 2J46A 1T0UA 1QBGA 4PZ0A 1Q74A 2ZB4A 4TMXA 4AO8A 2ZWMA 3NHRA 4INZA 2RCNA 1D2CA 3CJTA 3IJPA 1E4EA 1IN4A 4H1UA 2PUFA 1A9XB 2VHUA 4WHMA 4TYNA 2GASA 1KRWA 2JD0A 4RD3A 4GLBA 5D6NA 3LP8A 5JNTA 1MOZA 1KJIA 4TTSA 3IVCA 3VR4A 5DYTA 3W5DA 2AXNA 4E31A 1K6XA 4B0OA 2BMVA 2JJQA 3RIHA 1WIWA 2Q3FA 3KFXA 4JB3A 5J63A 3ORSA 2UZIR 4BCDA 1RI5A 4OI0A 1XTZA 1NONA 4P34A 5D1HA 2PK3A 3LY5A 3W3AD 1EVZA 1U8YA 1E8DA 1ESZA 3EZGA 4G1FA 5LYYA 5JZBA 2VI5A 2JDID 2QSUA 3GJ8A 4W9NC 2JFOA 4OXQA 5KNCD 2L0XA 1OJLA 4JLMA 4OHWA 3LF2A 3FN4A 4XUCA 3RSLA 4BP8A 1P3Y1 1IMJA 2W6CX 3H9UA 3ME5A 3MW8A 4Q05A 4R8SA 3VV2A 4QGBA 3KOWA 4DDHA 3SKYA 5CX4A 2C1EA 2DOKA 1FLNA 4GR5A 5EHXA 5AJHA 1P44A 2QS9A 2DERA 2PYDA 3MTGA 3UUWA 4JBIA 3OD1A 1GKLA 1QRUA 1EFTA 2CWDA 3X1XA 1AV7A 1J2RA 2IEYA 1DIHA 2AK2A 1MJHA 5EKUA 1DBPA 3HFSA 1AQNA 2R8PA 1VJTA 3EXG1 1ZK1A 3W0LB 4YRAA 1AO0A 1IWPB 1FXSA 1VMDA 2DFLA 4HQ6A 3MINA 2P4QA 4CIBA 4QUBA 1C7RA 2JIRA 2VQ3A 1ULBA 4JGBA 4OO3A 3GX1A 5F76A 1HOTA 4ZT4A 4YUVA 1G7RA 2X3UA 1BTOA 3AJ9A 2DFTA 3T0FA 3ER8A 1V16A 3WYFA 4NE7A 3NRJA 3UOGA 1TEXA 5LMUB 1JIUA 5DK4A 5H3CA 3PHHA 2ZSFA 1YR1A 4ZI7B 1CUFA 1NJ5A 2W2NA 2F8TA 2WZQA 3KLPX 3B6IA 3HP7A 2IHNA 3GLHE 1RWNA 3WAGA 4OB8A 5IT4A 4LISA 2XKKA 2JH8A 2E5LB 1KZ4A 3PENA 2I8AA 4XVRA 4N18A 4IRUB 4ZZ2A 3HU5A 3SE0A 4A9AA 4BO6A 5JNWA 4UTZA 3AL0C 4FLFA 4UNPA 2OBFA 3IBYA 2O2XA 3O90A 2FNAA 1PR4A 2QJWA 4XYEA 2C0QA 3A9CA 4OSPA 3LGSA 1KMCA 4KE9A 4URZR 5ULLA 1S0UA 1R8XA 2HTFA 1P0FA 5FHQA 4DW8A 2WTBA 3GIDA 2Q1UA 5CLLA 5DEOA 1DG1G 1BCSB 1UBGA 2P5YA 4YPFA 3HV0A 3WNZA 1X8JA 4FHZA 3NBYC 1L7OA 5AM2A 3PL5A 2YS6A 4Z0PA 5T6MA 2P27A 4YP7A 3CLTC 3K8ZA 1MOQA 1OI4A 5BSTA 3HI4A 5CA0B 3F3YA 4ZOLB 5HRCA 5FNVF 4HWTA 2I34A 5GWXA 3I5YA 3WLMA 3M3DA 3LA8A 4KLRA 1KEEA 2BH9A 5TF0A 4YR9A 3UJ9A 3VPXA 1YULA 3TLKA 1YZ3A 5SYNA 3O1IC 3BJEA 1PGOA 3PKZA 1T2UA 3T4EA 4BS9A 1NKTA 1YQEA 1V8OA 5TNXA 3T1VA 1P45A 4CKYA 1HDGO 1XAGA 3VC7A 4Z51A 4PRKA 4CEJB 5GM2A 3IHWA 3OOSA 1QVAA 4CG3A 4EMUA 5ECGC 4JUFA 3WKAA 4LHVA 5G4LA 2GCNA 5JVDA 3ST7A 4TRNA 1KS2A 3KTAB 4BLRA 1O54A 1Q84A 4LOIA 4OYRA 5CITA 5EIEA 3SEAA 4S04A 3RUDA 5SZHB 1ZK0A 3BSSA 3RSGA 4FNMA 1HYHA 5EWMB 2R4TA 4KQ9A 3JAWB 1UWKA 4Z4FA 2X2EA 3HZZA 3GD5A 1XLUA 2ZIFA 2OEPA 4M7OA 4X61A 5EP4A 3W8DA 3RRXA 1DC7A 5EIBD 2NU6A 3RTGA 1NUUA 2O8DB 3LXRA 4CDRA 1LLFA 2YJNA 3ZE0B 4J1NA 4UM8B 2ILVA 3PHGA 3I9NA 3N2GB 3PNLA 2OCDA 1GIAA 2HSEA 1J8QA 3ZWBA 3OMLA 1JHRA 1FUYB 3JTEA 5IDVA 1LKZA 4MMZB 4E30A 1WQ3A 4ER7A 4QLBA 1DC4A 1T0JB 2CK3D 3KZOA 1LQ2A 1IQRA 3N2KA 1YFKA 5KOIA 1QKJA 4JXZA 1I0LA 5FOUA 2QN1A 1EB9A 3H1BA 1QP0A 2XT9A 4EPTA 3R7NA 1Z13A 2R1VB 3O91A 1OAAA 1RAEA 2EDCA 3I92A 1CB0A 5DIZA 1OVMA 3ILYA 2RK6A 1LI4A 3CBQA 4G86A 5KTTA 6ADHA 3CF4A 2O0HA 4TT8A 3SS7X 4BMDA 4LBWA 5LA6B 1BX0A 1V2HE 5TS3A 3SI7A 3TX2A 1IXZA 4B33A 3RKRA 3S5UA 1XJCA 1JU9A 3U5ZB 2TMYA 1TC1A 1G4UR 1CDZA 2ACVA 1MA0A 4LMRA 2FB9A 4C22A 1YCDA 2XBUA 4URXR 3LC0A 1UEJA 2QXYA 2ZJ3A 3W9BA 2GXUA 3IXMA 4J0DA 1D6SA 3JZFA 5C7OO 3EGDB 1XVAA 3EZ9A 1JG6A 3DZCA 2MCFA 1GGFA 4ZDKA 3JYQA 5FLYA 4C4ZA 1RR6A 2WPNA 1PEDA 3Q0TA 1YQQA 2H4YA 3G13A 3P9PA 4DCVA 1Z6TA 1ABFA 2RONA 5AM3A 2HPAA 3E3MA 2NUBA 1SUIA 1PV2A 4B84A 5LWQA 1NBME 4OXYA 1EDEA 1YT5A 2FPIB 3D7NA 3NOQA 2C4KA 2R6HA 4TN1A 4H0FA 4XM1A 3I5XA 1GG8A 2HQOA 3C6ZA 3WLLA 3PQEA 4IL5A 4TRJA 1Y3BE 3I8OA 5K8VA 4GECA 3OKFA 4LJKA 5I9NA 1NN1A 2J6BA 1KY5A 1ZNZA 3L0PA 1C3LA 1L8QA 2G4LA 3BIXA 3EWSA 5AOCA 1SKUA 4B79A 3NOOA 3FWZA 1QLJA 3N2YA 3R3YA 2CXPA 2FRDA 2O4UX 2QSJA 1MJ5A 1UBNA 2WIDA 4PSUA 1ZD8A 4M46A 5EMKA 4BPRA 5FUWA 5L53A 3FM9A 1JUDA 4L6IA 3NTLA 1XVUA 2OOKA 1N3YA 1EK2A 4KQHA 4S35A 4WKCA 1JQAA 2HNKA 3A10A 2JGLA 3NKVA 5ESXA 5FUVA 3T12A 2SBTA 4BYMA 2M9MA 1GCIA 5AYVA 2F90A 3OZXA 3NWPA 5TPWB 2AE2A 1CTQA 3WRYC 2X86A 5IP5A 5KTSA 4H6PA 5JXHA 2A9RA 4RVNA 3WMGA 1OXKB 3ZWWA 4ND3A 3WIOA 1SK8A 5FV7A 3WWZA 5MN5A 5BN5B 4NX2A 4MB0A 5KEIA 2PGJA 3L82B 1GNTA 3MLAA 4FDLA 4HMQA 2JAXA 3TINA 2XECA 4I50B 4YJHB 2C96A 3JQ7B 7REQB 4QXAA 4BAZA 4PRLA 4EFLA 2C7RA 5IN4A 3IR6A 2ZATA 4DPLA 3MAAC 3BHJA 4GNKA 1IATA 4BJ1A 4GX0A 2OZVA 3FPAA 2YXBA 4WOKA 1EHCA 4F97A 1LK0A 1PDOA 1WXGA 4P9NA 1ILEA 1EEHA 1KIMA 1J0XO 1I6KA 1WW2A 3IT1A 2DBZA 2JIMA 3EQZA 4KCGA 1VE7A 3MWFA 1NW3A 1SQ0A 3L3BA 3I1FA 1Q19A 4N3BA 1QYIA 4E15A 5JANA 4L9AA 7YASA 5KYXA 5LQJA 1JPNA 4GO1A 1POXA 2CT8A 2NOAA 2WF8A 2ASVA 4RV4A 2XVMA 4D4JA 2SHKA 3GEDA 1KMHA 1UT6A 1EE9A 1FSGA 1BAPA 1JG2A 1V26A 4OU4A 3UMSA 4IGAA 1L5ZA 5EPEA 1EFVA 4IH1A 4D80A 4F3YA 1D4ZA 1HF3A 4RO0A 3L8DA 3NFRA 2RHBA 4XSHA 3MJVA 2EFCB 1GCGA 1NP3A 3FI0A 2D7DA 2QSYA 2NU7A 2YJ5A 3VNSA 1G5HA 2VHYA 3GFFA 5CYOA 3TFOA 1U8EA 2D5LA 3EDRA 3F2VA 3U3XA 3W1VA 2QD2A 5HTOA 1M1YA 4WBNA 3RU9A 1Q5PA 1CP2A 3L05A 3VZCA 3F6EX 4FVTA 4FGKA 3T06B 2EJCA 4QUHA 4DBZA 1LBIA 1FVXA 4QSMA 3VDRA 3LUGA 1QIEA 3OIVA 4CQNA 4GBED 5IM4F 1CXZA 1FX0B 3O8OB 3ZX4A 3QVKA 3TTYA 3WLPA 1P2FA 1U9IC 4DG9A 2VEDA 3GGPA 1TUIA 4IVPA 3OX3A 2JC3A 1JLLB 3BZWA 1W0CA 4ZIRA 1I6MA 3LQYA 2WLSA 2YWHA 2ORYA 1U0RA 5CX1B 1T5LA 4RHCA 1OJ7A 1H0KA 4U5XA 2FW1A 4U7WA 1XAIA 5HIAA 2IW1A 1E1QA 2DHQA 3WFJA 1GQQA 3DMHA 1WULS 1V6CA 3G0DA 1T6XA 4H1HA 4I08A 1Z0SA 4ZOBA 5CDFE 1F12A 5CLJA 4ZYXA 2HR1A 1I51A 1W94A 3R20A 5HBRA 5CW1A 4XJTA 4L74A 4B3RB 1NYTA 3OA2A 1JHVA 1Y4SA 3UMVA 4BX2A 2J0QA 1O94C 2C42A 2O2EA 3QA3E 5E6RA 221PA 4MUBA 1QHHB 2X9LA 1M5UA 1Z4NA 2YV3A 4B80A 2EBWA 3I05A 4K8RB 1BQEA 4U4AA 1ISJA 2R66A 2W48A 4R2MA 1R6TA 3KPUA 4QWWA 3DB1A 4FINA 4URFA 3ULKA 4DUGA 4RNDB 4OEHA 1TCBA 1MC4A 3CUWA 3RVLA 5FQOA 2Y1DA 2VKTA 2CY0A 1KJ9A 3L01A 2CKDA 5TVKA 1E2GA 5IEBA 2CV0A 2YFHA 4RUKA 3SBEA 5AO9A 4TYMA 4IVRA 3H4VA 3A36A 2C0PA 1WMDA 2ENUA 2ZE6A 1MR3F 2W6MA 2IBSA 2IYUA 2HLHA 5EAIA 1R37A 3QELB 3NHLA 1V4NA 4PG5A 4LF6B 4KPFC 4TLEA 5EQJB 3LQKA 4CQLB 3L1JA 1HWYA 4UHFA 1MLDA 2IPOA 3RM3A 4IG4A 4UW9A 2BRUA 2ZBEA 4YLYA 3DS8A 1BDMA 1J2EA 3I32A 3UANA 2JAUA 5HXAA 5CUQA 4UFPA 1U8TA 3AV0B 3QTLA 3HJAA 1LLCA 1E59A 1W93A 1BNCA 2XKBA 3EIFA 4KEAA 2DYKA 2XIQA 4GC5A 2BFPA 1XU4A 2O2IA 3TB6A 5K6AC 4EFNA 2NQ8A 1ZN2A 4JVMA 3NFYA 4KAFA 1NXOA 1CZKA 5I5EA 4TV9A 3EDCA 4BGIA 5C8YB 1H2HA 1GZ3A 1P6QA 3L7JA 3R2JA 1IHOA 5BOVA 1CS0B 1NVXQ 2WQZA 1CY1A 1LDGA 2I6SA 2X76A 1BXRB 1NQWA 3ZK9A 4D1YA 3GJQA 3L8YA 4E4RA 2A78A 2FZKA 3CLUC 4HPWA 5TMDA 2PT5A 3GRUA 4MZDA 2OKGA 4FYJA 3VU9B 1JMKC 5SICE 4CQMD 5AKJA 3TDNA 4NZPA 1A97A 2WZCA 1CPYA 1E77A 1U02A 2AJTA 1PFQA 2IHVA 3JD0A 3CEMA 4K3VA 4N3AA 1Y5MA 2SKDA 2W6NA 3ZNQA 2XMSA 1XDDA 4D79A 4D4LA 1TIPA 1A0OA 1XQYA 3BH6A 3PC2A 3VNQA 1AQLA 1CZNA 3KPVA 3W2GA 4EA9A 2XWJI 1O0SA 1XMSA 3ROZA 2P2ZA 5JLAA 3VV3A 3MS7A 2BPOA 4J6FA 1BDHA 4G4IA 1DKPA 5DK6A 5H9VA 3TM4A 2BGRA 1WU7A 1EXWA 2QMQA 2OXTA 2FWPA 2QYOA 1Y8QA 4YMGA 3AUSA 2PV7A 1DIAA 2CLHB 3PPIA 3JD3A 5DM0A 1S8NA 1VPEA 2QTZA 2QQ0A 2CXQA 1UKZA 2JFQA 4U8HA 4EHFA 1B0UA 1RZUA 1PF7E 2ZITA 3K94A 5BNFA 1JDBC 2DY1A 2R8ZA 3OZGA 3Q6IA 1TYCA 4HGZA 2XITA 5L95A 1GFIA 1P29A 3ABOB 2BEUA 4OXRA 4PSVA 1NMXA 2V74B 4UNSA 2Y05A 3QXXA 2ZPAA 1YGPA 5BSRA 1E6LA 4PGGA 4R2IA 3TRIA 3HDQA 4D4HA 4DCCA 4XWAA 1T6NA 3PF9A 4QU5A 3IXQA 2W22A 4LRXA 1Q6ZA 3WXBA 3WQSB 2GEJA 4DIOA 5I3ZA 1QB7A 2I2WA 1APBA 4FFPA 1E9BA 1K98A 2XVZA 3OZUA 3MQ4A 1G7CA 2J67A 3DJYA 2AF4C 2XX3A 3OOJA 4JSYA 1ZCZA 4KQMA 1EX6A 1Y1RA 2HJHA 4QG7A 5EMHA 1U2GA 3QJGA 1ESMA 3JARB 1V6AA 5EWLA 2WFLA 3GP3A 2OBYA 3B8EA 4Z3OA 1GTSA 5CB8A 2E6UX 1REQB 4JUIA 3OP4A 2PVPA 4URUR 3W5UA 2GYYA 1ZK4A 2CXSA 2PH1A 1M8JA 4MRRA 1H0RA 4HB2A 1E58A 3FWYA 5GGYA 3JQEA 3D5TA 5HQJA 4YALA 2ZUBA 5B3JA 3I0MA 3OCYA 5JVDF 5LKAA 3LLMA 4JLAA 3GUYA 2VZEA 3ZLVA 2XDWA 1EEXB 5G2OA 4CKWA 2XY4A 3KQHA 2VDJA 2I67A 1YDWA 3PNMA 4OMDA 1TZCA 2C29D 3LRTA 1RWKA 5K4AA 5GOZA 2V9PA 3Q3IA 1ISFA 2QVZX 4P31A 1QO9A 4ZCRA 4ZYUA 2XQIA 5EMLA 3ZZ1A 2G88A 4Z2AA 1G8HA 4JLVA 2RBGA 3H2JA 4EJSB 2R6FA 5G1OA 4RDHA 4B6FA 4CTKA 3TLMA 4C20A 4L02A 3EX7C 4S2UA 2UKDA 2XHEA 4UREA 4YRTA 3LBNA 4XDYA 4H1WA 5CDUA 1V4VA 3NHYA 4F11A 4YV0A 3HL0A 3PE4A 4ND4A 2O5CA 1SXGA 4BNHA 4KV7A 2W42A 2BFEA 5K0GA 3U44A 1LNQA 3FVWA 4A7PA 5K8TA 2Q8PA 4D9HA 3Q85A 3NBMA 4LVOA 3N59A 1WZEA 1OBVA 5FOTA 1RJGA 3AF3A 1EUQA 3HMQA 2J9GA 2MSWA 4AY3A 3MGBA 1KPHA 1PR5A 4FU0A 3QOWA 5FJJA 1UPTA 1ZN9A 3DOJA 3SHFA 2DTXA 4Z7JA 4W5OA 2ZE5A 5ALTA 5KJCA 4LOHA 2B36A 2FFQA 2V59A 1MABA 1IOVA 1WKVA 2AFHE 4NYIQ 2Q3BA 4QXRA 5ALKA 1JEQB 1LVGA 5FTWA 4P4LA 3ZJ5A 5B6IA 3O8CA 1ID8A 1YK0A 1JBEA 2GPSA 2FR8A 5JATA 2SICE 3IODA 1Q1EA 4KFTA 3THWA 4Q34A 1XXHB 4FSHA 5LM3A 4M2LA 2Q4BA 4Z9XA 1FFHA 3BD8A 4V0ME 2IEZA 4ZARA 4TT3A 1O77A 3R8FA 4Z4CA 1V96A 2P67A 1N7HA 2ZWPA 3R41A 1GQSA 1T5BA 2D1RA 1HE4A 2D5AA 1ORDA 2G76A 5JFTA 2AQHA 3GRAA 1INLA 4OFXA 4XLZA 5E2BA 1YJ8A 3TGWA 2B94A 1SHKA 3PXXA 4CFSA 4D8VA 3C14C 1Z15A 2YZNA 2CHEA 4DSNA 10MHA 3WL7A 3PHJA 4FHGA 4M1QA 5COBA 1AQJA 1M2OB 5KO2A 1ZM3A 1Z7WA 5KYYA 4MXDA 1F17A 1C29B 2J7KA 3FPKA 5DBHX 1T4CA 3MWJA 3NDJA 3Q41A 4LDQA 4MWDA 2PNJA 2VO1A 5TQ2B 1K7EB 5JTTA 5IKPA 1FDSA 2DPXA 2VRBA 4ZYZA 2PBFA 4EG7A 2OFPA 1KRXA 1QH9A 1SWWA 1T0IA 2D5BA 2P1ZA 3STXA 2XYPA 4BLPA 2YHIA 1W1UA 1UOOA 1O96B 1GZ4A 2QM3A 3Q98A 1SC4A 4HX9A 4K9KA 2JI9A 5F5XA 3BMXA 3DLHA 2AR7A 4Y6RA 1ZBDA 4KE8A 1N8SA 2CMKA 1IRXA 2Z4SA 3ZJUA 3BS4A 3EVDA 1XL0A 1WZ2A 1V8FA 3LU1A 4KBGA 4UUPA 3C4QA 5HS4A 5A0TA 3O2SB 1HR0B 3PHCA 3K70D 1YQDA 5KREA 3F4BA 2NZYA 4RSRA 3OHMA 4X0EA 2DWCA 4Q1BA 1VL2A 3E5MA 4LC1A 3UJBA 1GU0A 4WMLA 4N3GA 1AQIA 1JB1A 1Z45A 3CRZA 1K7XB 5KNDH 3H19A 3EDMA 4O0LA 2I2XB 4KI0A 2WAMA 5J58A 3UKDA 2DCMA 4Z4HA 3FYSA 3M3HA 3FMVA 1LI5A 3Q9UA 4HFJA 3PDWA 1FIUA 4ADSG 2B9EA 1EGHA 1BFDA 3PPVA 1R00A 5H5JA 4BQQA 3STHA 1E0AA 4MSUA 1MZVA 3OFVA 2BE7A 3F67A 3N0VA 5K3CA 2IU3A 3JPWA 4TKVB 3SFZA 5U1PA 4FNAA 3L46A 4CPDA 1JG3A 3F3SA 4FEGA 2AXQA 3DLCA 1ZVKA 4QTTB 1A95A 3T7SA 9LDBA 1NXTA 5HQ3B 4QVKA 1WD5A 4B7CA 3DVQX 1MAHA 2WLTA 1CEQA 1ELOA 1RI1A 3LY8A 3ORYA 3O84A 4QGHA 4DWVA 1LDNA 1O87A 3L84A 3IMKA 3N3BC 3N76A 4HT3B 1T4MA 1PS9A 3DT9A 3D5EA 2V0CA 4FMBB 4A2QA 1QVWA 4BOYA 1NOKA 4CKEB 3TXXA 3E5HA 4P54A 2E85A 2XUJA 4EHAA 1Y6GA 4YONB 4A8JC 4UBMA 2X7JA 2G67A 4ALIA 1FB5A 3KUDA 1PZEA 3NAGA 4PR0A 4WFQA 4XWOA 1Y8ZA 5D5HA 3GR6A 1WA5A 3LSYA 3M6AA 5IXYA 4MCHA 3E22A 3MG9A 3K05A 2XE7A 4QOFA 3W2HA 5IDWA 3ELWA 3T1OA 4YR7A 1F06A 2AW3A 1IC6A 3C70A 3DXXA 4FYIA 5KPJA 2HREA 3OKAA 2X1HA 1CVRA 3AM4A 3GZNB 4KPGA 3HI6A 2IOFA 4WBNF 1XJWA 4AKGA 2FPSA 4NBKA 4JA0A 1TE2A 5BSWA 3Q6MA 3EXHA 4V3CA 5K4HA 2G0AA 1MP0A 1NZJA 3A1WA 1MDFA 3GCWA 2V5VA 1BXKA 1F20A 2X5KO 4IDCA 4OJYA 3SOZA 5L3QB 4NCIA 1KZHA 3T1HB 3M4JA 2JVIA 1SA0A 4NRDA 4RDXA 2XTJA 3SHOA 4H4CA 5HMMA 1EYZA 4AZSA 2EATA 4E14A 1RPZA 1N1EA 3CS3A 2HK7A 1XLTA 1CV2A 2PT9A 3BFXA 2HWYA 2X5NA 3KSRA 3CZ9A 3AKYA 4DCPA 1WHSA 5CEEA 2QNRA 5PNTA 1L4LA 4RD1A 4URHA 5TMPA 2GNAA 3D0OA 3FDXA 3HCBA 2D4HA 1O9GA 3I3SR 5EZSA 4EGCB 4Z49A 1Q0QA 1SOAA 4FDAA 3B1YA 4PHFA 1P91A 4I5GA 2XMBA 2ZYTX 3TJMA 3I4FA 1VSQA 1F14A 5CLIA 4DIMA 4RTOA 1RSZA 2H0AA 4M87A 5EMJA 1JP7A 1DJLA 2QAIA 4MV8A 1W6UA 2VJDA 1MNAA 1DTEA 3CZMA 4J29A 4P92A 4HZUB 5CNJA 3VHLB 4AJEA 5A3QA 4PM4A 2ZBDA 3T1QA 2XQJA 4ZZ1A 1W1WA 5EGSA 5DGCA 2QRZA 4NU8X 4MAAA 2ZOSA 2I2FA 5CGQB 2ZREA 1QYWA 3AEZA 4F3RA 1OZAA 2MTBA 3HUDA 4YRSA 2F43A 5KTNA 2GAIA 1UBKS 3O7WA 5CLGA 3L7BA 4DDKA 1IMOA 2PIDA 3DLAA 3HP1A 3P9KA 3AZOA 5HKOA 2R0QC 4NS4A 4BNGA 2O0KA 4JA2A 4YFYA 3DULA 4YI5A 3B8HA 1QFZA 1NP6A 2NPIA 2J8ZA 1FP2A 3OEYA 3GU3A 3BTVA 5JCJD 1E2QA 2YWRA 4HH4A 2ZQZA 3V48A 3D3EA 5HF9A 4O25A 5TJ9A 4D3ZA 4RVCA 3B36A 3D4BA 2BE9A 1TCAA 2IEDA 1BCRA 3S28A 1RBZA 1MVOA 3VSCA 1SVSA 3CT4A 2CUZA 3GJ5A 2NAFA 1YBFA 4HWOA 1JFSA 2G07A 4TVOA 4KO3S 2ZUEA 3X1YA 4NS1A 1V6SA 1KDTA 1MA3A 1RW4A 1W4BA 2XNDD 3U7RA 3CB2A 5C52B 4IKEA 3FNEA 2FR0A 1KHHA 1TLTA 3ZWYA 2Z6VA 2BR3A 4HEJA 3ISJA 3MB5A 4MPRA 3CN9A 3MERA 1P19A 2CN1A 1V2GA 1EZ4A 2J48A 3TLZA 4K0RA 4KXUA 3HRHA 5CH5A 1ZHHA 1ZH0A 3C5VA 3JQAD 4KXQA 4AQYB 1BH2A 4NIMA 2ON6A 4BDTA 2R8RA 2P9CA 4IDBA 3S27A 1SD2A 2JFXA 4H3KB 1SUWA 5CAEA 4TV9F 1ZUNB 1FTNA 5EJFA 4MLCA 1WLSA 1QCDA 1CHDA 4U7TB 2LRHA 4K8OA 2BEVA 3DMDA 2CCJA 2YJ3A 3FDZB 3FKSD 3O8NA 2GCIA 3H83A 1I6LA 1E18A 1I10A 1AKYA 2ZFUA 1ZOOA 1KEWA 2N1BA 3FNHA 3GFVA 3OZWA 3PDUA 4FC6A 4H31A 4KV9A 4M6WA 2AG0A 4PZCA 5BN1A 1GL9B 3VZSA 5IG2A 1YQXA 3SYTA 3R7WA 3ENNA 4MHOA 2IEGA 1ZN7A 1GUZA 2BCGY 3DMTC 2VNJA 1B1AA 5JZSA 3GLFA 2HJSA 3H2HA 3L0OA 3WGZA 4A3SA 3TMKA 1Z6PA 4MJXA 3STTA 5LLDA 5LQCA 1E4VA 2PJDA 2ZJ1A 4X1YB 3RJTA 4MKGA 3WIEA 2I9PA 2ALJA 4R84A 4CM9D 2BJHA 1CY6A 1Y89A 1I4OA 3KOZA 4N5MA 1ZKMA 4D4MA 4Q1AA 5CJPA 5T3YA 1GDTA 4UVDA 5AK5A 3E0QA 1UOEA 4H6VA 1OV6A 1QG6A 4XGQA 4LXUA 3WTBA 1AT1A 2Q4RA 4IV5A 4N7RA 5A4AA 3RK4A 3DKKA 1ZRHA 2C5LA 1CS4C 2X8JB 1IN1A 1VA5A 1QRSA 3E2IA 4IVNA 1A9YA 5HJ7A 4GOJA 3S2IA 3GNSA 3N70A 4KO2S 1TVCA 3ZEAA 4QM7A 1QIDA 2BMWA 5TXGA 1W34A 1Z5PA 2ICAA 1YR2A 3NAZA 4WADA 3HCAA 3WLJA 4FB4A 1IJKA 2GYVA 3X44A 3CM0A 3N86A 2IXAA 1FDWA 3MMSA 1HH4A 3TCNA 2DFVA 1DAKA 3GLTA 3G1WA 4FFRA 3NIDB 2O50A 3MOIA 4K6GA 1E61A 3VPSA 3WK6A 2V98A 4C6TA 4DCUA 2E1PA 1L7EA 4MO2A 1DVRA 2G4CA 4EX6A 2HGSA 2A5JA 4J3JA 5CIWA 3GLHB 3X1DA 2YWXA 3D64A 5HK9A 1XXLA 1YS2X 2FPPB 1IZ7A 4KACA 1GCUA 5BV1A 1KAMA 4YMVA 3D6JA 4D57A 1J1UA 5AVSA 4FZ5A 1XRNA 5KYKA 2WWIA 1VXOA 2D7JA 2I4NA 4IJMA 2V3CC 2R6JA 4UOZA 1OA1A 5ALFA 5L51A 1JF8A 1PUXA 3W3AH 1OXSC 2QN6A 3VJRA 4RMNA 4RF3A 1XQXA 4RZHA 4RV5A 3M6UA 2CHVA 4MYCA 4DCOA 1BO6A 1IPEA 3VOTA 4YO7A 5HW0A 4KX3A 4QATA 3QVVA 1N2GA 3LLCA 4FW8A 3RTEA 1Y9JA 3EARA 3ZZTA 2XGMA 2YMQA 3LCMA 4ZAVA 4MKXA 3MJHA 1QR2A 1TNDA 2QLBA 2QTHA 3N8NA 4MV4A 1NF2A 2X3YA 4PC6A 2HRCA 5HUQA 2GVDC 2AX3A 5REQA 5KTMA 4DA4A 1FFEA 4XYBA 2CUNA 2VP4A 3S4YA 3EXFA 1RE1A 2ONYA 2ZYRA 3RGWS 2H1WA 3HBJA 1OLXA 5KYUA 1ZR4A 4QREA 1CP3A 3V1TC 4A82A 4BZWA 4FK8A 1XBTA 3OQBA 4HEA1 3NTOA 1B6SA 5C7LO 1Q0PA 1WG8A 2QYHA 3G7UA 3GXOA 1ZXXA 4X8LA 1E0DA 2JGFA 3F96A 3HBFA 2WAOA 1J8VA 4IS2A 2WZDA 4OHPA 4W9RA 2FJUA 1II8A 1YDMA 3GJZA 3HACA 4R2HA 2JBAA 2FRVA 4JLNA 4RJIA 1HC7A 1PJ3A 4WNAB 4HQ0A 2O2YA 4X6YA 2XT6A 4OHXA 3RE1A 3HYRA 1MJFA 3FFWA 3KXKA 4QYTA 3SAJA 1SUCA 1GN8A 4RENA 4FOOA 1YNOA 3IPXA 3L7KA 4NKRA 4Y18A 2B2XA 1T3ZA 3AJAA 2YX1A 4ZCPA 3U60B 1X70A 2XZTA 4I1YA 1E9CA 3KT6A 4AQDA 3MTIA 3NYRA 3QXCA 5EA2A 2NUTB 3RRJA 4EKNB 3KLBA 2GAFA 4F5YA 3JYHA 3C3BA 5GPBA 1VPDA 4M21A 1JFFA 3FRIA 3H8WA 1W96A 3MT0A 4MICA 5F77A 1GPH1 2OILA 3JALB 5BUZA 2K7FA 1GPAA 3B3AA 4UTOA 1XMQB 5K8UA 5AKYA 4X1IA 1XTTA 3SF8B 1CY7A 2FZ4A 3DNFA 3I2GA 1QANA 3ESAA 3ES9A 2HWKA 4CI9A 3BN3A 3JQ9C 4F4HA 3QUCA 3LV8A 4RTNA 3ZE1B 1RJEA 3KB1A 4ER6A 4TXLA 2W4QA 3M5PA 1XDSA 6REQA 4ZRDA 3TEJA 2PWPA 3A4TA 2NYAA 5JS1A 2D00A 2OHFA 3HDGA 4UE2A 4F4FA 1YA6A 4TL6A 3V8RA 1BX3A 2XCUA 3LX6A 3TOVA 1UKCA 1KMMA 2H7CA 3K8QA 2JNWA 4N8DA 4O1IA 1RXSA 2IYEA 3RT7A 3VHXB 3ZI0A 4EYEA 1EBBA 3N6XA 4AN4A 4MVJG 2B82A 2YOHA 1Z3CA 3IUJA 1PJ8A 3TSYA 1TCVA 2P78A 4GYJA 4IKOA 3CVXA 1P1KA 3JVIA 5IVIA 3ZU3A 3O1JC 4CM4B 1WDTA 4MR9A 2PMKA 5F1PA 3S6JA 2XAUA 3CNNA 5HEKA 2ZTMA 1NKSA 4AZWA 4DMMA 2ZKLA 4RVDA 5DYYA 4YJDA 1ZH4A 1XYVA 2GILA 2P4HX 5FBLB 3RRBA 1TQ2A 4WECA 3EVZA 4PZUA 3UWOA 2W2PA 1FZQA 4D8XA 4Q3NA 3M4NA 3T5TA 3U09A 4GSKA 5JI2E 4OH7A 4TYPA 5F51A 1ADGA 2JZCA 2QTGA 3V5NA 2CV1A 2HSJA 5F7OA 3EMDA 4OJNA 2VK4A 5K0SA 3FNQA 4TS1A 1ZG3A 1P39A 3Q1LA 3UUGA 4EUKA 2J87A 1I1OA 4C07A 2IYZA 3LPCA 2BGGA 5J4LA 1QH1A 4IW3B 1L9KA 4Q47A 3PUZA 1DJQA 2ZG6A 2HT6A 4FBLA 1RABA 4RCVA 4RDCA 3AEKA 4LZWA 4ROSA 4TTPA 4O4IA 3E3AA 3G2NA 1MENA 5JD5A 4UVEA 3VR4D 2FPOA 1KOFA 4JX8A 4QVGA 2JJ1A 2YUTA 3RRZA 2XZLA 3R24A 1K5GA 1UM9B 5DTEA 3UM9A 2CHGA 3B5EA 1J5PA 1MTZA 1OFTA 4AMUA 1C4XA 3I42A 1Y4ZA 2VOEA 1E3WB 4PG4A 3SZUA 3TTWA 2F8SA 1SD1A 4DIEA 1NT2A 4ZA2A 1GUAA 4R40A 1L5WA 1G2PA 3M5DA 3PPWA 3U9TA 3O9ZA 3E9RA 1KXJA 3OSUA 1RVV1 5DBOA 4OGKA 5C1IA 4QNMA 5CRIA 4BNJA 4DSAA 5CFPA 5EXSA 4DQ0A 5TE9A 4IPTA 5CB4A 5J43A 3G9QA 4E70A 2B78A 2JLYA 4PGAA 1TEHA 2LWIA 2WAYA 4FHDA 2OCIA 3ROTA 1NP7A 4W5RA 2C3MA 2QZZA 2WHXA 3OH8A 2E37A 2XJ9A 1WEHA 1KJ8A 4GRDA 2IIBA 2GESA 4W9NA 1ZMOA 4FHCA 1PDVA 4WLEA 1SOMA 1TA0A 3T7IA 4HGPA 3G8YA 5EXXA 4B87A 2FMUA 3GAZA 3LY9A 2RHWA 4MIYA 1YB2A 1G59A 1H85A 3TI9A 1JKIA 1PWEA 4DDVA 2UUOA 4LVNA 4TLDA 1T9HA 1CFJA 2VDVE 4GVXA 1VMKA 2ECFA 1MKYA 1QK4A 3HG7A 3KKQA 3MWYW 3QK7A 3DDNA 4Z7QB 4QX6A 2HSZA 2N3ZA 2G9QA 2ZRDA 1Z12A 1CHNA 4KWTA 3SFVA 4CU5A 5CT9A 2Q5HA 4CWAA 4MVJI 2XUKA 2IHBA 5F9MA 2Z2ZA 1O6BA 1S02A 2Y4OA 1SUDA 5G53C 2OHHA 3HNPA 1A8QA 1YB6A 2EP7A 2Z57A 3A9VA 3D0KA 4ID3A 4R6WA 3AUFA 4XQEA 5CVVA 2YWDA 4WNIA 3WL8A 4JMLA 1QF6A 5K01A 5A62A 4IX1A 3UT0A 1XZMA 4NJMB 1CIJA 3EPRA 3COVA 4BXOA 3S2SA 2NU9A 3AL2A 4W99A 4WINA 3UK6A 2Q0SA 5IDXA 3MJFA 4CV1A 4MRSA 2FFBA 5D3ZA 2QHXA 2UUBB 1PIWA 1U7UA 3BZBA 3ILHA 5LP6C 1EG7A 2HDOA 3ZY4A 2GNPA 2ODWA 1NXSA 3QLJA 4XE5A 4JMPA 1JDUA 1XTPA 2WY2D 1UK8A 2Q3LA 1T2FA 1RKBA 2HRBA 3EH2A 3QLUC 1RRVA 1RQPA 1WHTA 1Y3FE 2P6PA 2Y1WA 3IEKA 1A96A 2RJOA 3KLNA 4G4GA 4QXQA 4YPVA 3FFBA 1TM7E 5CU7A 4BLTA 4B43A 5JYBA 1QPGA 2AJDA 4C7KA 5A4MS 3NJ8A 1SRRA 3IEUA 3FMPB 4XGNA 2VUHB 4RU1A 5I8ZA 1KKLA 5FD8A 3AILA 1LD3A 2MYPA 3QIAA 2VRNA 3NNNA 1VGQA 4J4HA 3KE9A 1NDQA 3BB1A 3RAGA 5KC8A 3DL0A 4NYMQ 3ZHOA 1P74A 5CT5A 1Z2CA 4ALKA 4UBNA 4EG6A 5KSYA 1VJRA 1N8NA 1V7CA 3VPFA 2HF9A 4B5KA 5HJEA 1RZ3A 3N2LA 3PVCA 1L8AA 1WUIS 3H5VA 3QKRA 3NTXA 4TVSA 5K0FA 1U65A 1U28C 2R7NA 1A88A 1DBSA 3R5KA 4FOPA 5DKFA 5C4GB 4ECEA 4D02A 1PGNA 4MV6A 3HADA 1KE2A 3RAFC 4NY1A 3L6RA 4M1MA 4NC9A 4F8EA 3QU9A 1L5HB 3TRFA 2FW0A 2VH5R 4BV2A 3KWFA 1HLPA 4LDPA 5LUBA 3OAAD 3PBKA 3G82C 4U3JA 1IK6A 4Y0VA 1DQPA 3B52X 1OT5A 3E9QA 1XPUA 4LY3A 2ZJAA 4S1WA 1P5FA 1Z5ZA 3KG2A 5FBWB 3K1TA 4A0QA 4HMPA 4IEFB 3R7LA 2R25B 3I01A 4YAJA 3I9OA 5K8JB