6YASA

Hydroxynitrile lyase from hevea brasiliensis, room temperature structure
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords PROTEIN (HYDROXYNITRILE LYASE)
publication title Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis.
pubmed rcsb
source organism Hevea brasiliensis
total genus 97
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 6yasA00
4Q82A 2QJRA 2WG0A 1N8SA 2O7VA 5D7BA 1HDEA 1SFRA 3GUUA 3ANTA 3BWXA 3STXA 4CCYA 3D4LA 1GPKA 4W9RA 1I6WA 1DWOA 1UOPA 2CBGA 4U2DA 2H7XA 4ARAA 2OGSA 3I1YA 4PNZA 5AK4A 2YASA 1LBSA 1CUJA 2HA3A 5DNUA 5AI0A 5CT5A 4ZWNA 2XMQA 4OUKX 4UBKA 1EK2A 3BIWA 3ED1A 2Z3ZA 2PUHA 4BYMA 1W6RA 4FKBA 1LPSA 3STUA 4B84A 5ALSA 2VT6A 3EIOA 3I2KA 1AMNA 2XUIA 1G66A 1BN7A 1CUIA 4EY7A 3WMRA 4UHDA 2V96A 4E14A 2RGUA 3T4UA 2AJLI 5ALXA 4Q3KA 1A7UA 5IH7A 1UZAA 2I3ZA 4IHAA 5AKEA 5FKJA 1PJAA 2VT7A 1XRQA 2XUPA 4G4IA 5A7GA 3LIPA 1LPAB 1WHTA 1GPLA 3AZQA 4L3WA 1MX9A 5EHZA 3FLEA 1YS2X 1UKBA 4ZRDA 1B41A 3HC7A 3GZJA 3WWDA 5HZGA 4G8DA 5KBYA 5EI5A 4Y2SA 2GBGA 4H7IA 5LP1A 1DU4A 1CVLA 1F0NA 1THTA 3IURA 5AI9A 4J0KA 4ZV9A 1G4HA 4Y2PA 2DQZA 4N8EA 2XQJA 4BZZA 3FSGD 2GYWA 4BZWA 5LZ5A 1UK8A 4UHHA 4DMKA 4LHEA 4WFKA 2WHRA 2GBIA 2WIKA 1U4NA 2ZJ6A 1EDEA 3QZUA 1LPNA 2CZQA 3DCNA 3JYHA 1BE0A 3H0CA 4FLEA 3ZV7A 2OCGA 5J3JA 5DYYA 1XFDA 1USWA 1TRHA 4J0HA 2DHDA 1O6FA 1QTRA 4GW3A 3N0TA 3KSRA 2CKMA 3SX4A 3WIBA 2RONA 4N8SA 5AKXA 1JKMA 5AOBA 2IITA 4KJXA 2PX6A 2PKYX 3WK4A 4H7EA 2Y2UA 3TRDA 4UBOA 4KRYA 4HRXA 1BS9A 1EDBA 2XUQA 4A23A 4Q1VA 3TEJA 2OQIA 1CUFA 3R40A 4J7AA 3LIIA 5FPPA 2C5GA 1W52X 5AM5A 3QPDA 5BWCA 1BRTA 3W06A 5CMLA 1E89A 5LZ8A 2VSQA 3F67A 3S2ZA 3DNMA 3PFCA 1LZLA 1T4MA 4KAJA 4W63A 4B81A 3WK7A 1DWQA 5SYNA 2XI4A 3ESDA 1SC9A 5H3HA 4BATA 2X8BA 3U1TA 4RPCA 4DMCA 3D59A 4OD0A 1CUZA 3RKSA 4X92A 4AN0A 4PW0A 2PSFA 4TVKA 2OPHA 4H7DA 1W76A 2WQZA 2XMRA 4DMFA 3H2HA 4X3CA 1ZGCA 2YH2A 2JIDA 4Y7DA 5ALTA 4UHEA 5DYWA 1N5MA 1XQVA 4F0JA 5HKAA 3AIOA 4X6YA 5LYYA 2ZYIA 4QZVA 3A70A 3R3ZA 5JARA 4CCWA 2BFNA 3BF8A 2WFLA 4N5IX 1LNSA 2C4HA 2FJ0A 1W4LA 5AKJA 4EA6A 3OC0A 1EHYA 4H7HA 4DSAA 1X2EA 2JBWA 4WY5A 5CBKA 2J4CA 3B12A 5E2IA 3Q8WA 1LPMA 4UPDA 1CIJA 4H35A 4EB0A 2J3DA 3G7NA 4H77A 1WM1A 5DJ5A 3MVEA 1GKKA 3I2FA 4WFJA 3MUOA 3HSSA 4UBJA 4X95A 3V1KA 4CFSA 5D6OA 1XKLA 4BE4A 2XQFA 3O9MA 3WKBA 4B83A 5ALDA 4FHZA 2PU7A 2WHPB 5ALIA 1QONA 3A2LA 3I1IA 1DX6A 3C70A 5KWIA 2XLBA 5CH3A 5AI5A 1ZICA 4X00A 1QTIA 2EDCA 5SYMA 1TKRA 1SCQA 1WOMA 1ORVA 3JWEA 4W1PA 1G42A 1OXMA 1ZOIA 2VJBA 4RGYA 3ZLTA 3IUNA 4HXGA 1NU8A 4Q3OA 4AZ0A 3G9TA 5K5EA 1MPXA 2HL6A 4OB8A 2DCMA 4UBNA 5AOCA 3AUKA 4MQLA 4OU4A 3FVTA 2QXTA 2WIJA 4GHWA 2AJ8A 4KRXA 1GXSA 3KWJA 5DNVA 7YASA 5YASA 3WZLA 4AO6A 4NVRA 3K9BA 1XRRA 5K3FB 3C45A 4W1SA 1EB8A 1TIBA 2XMCA 3IBTA 3IUQA 1ETHA 4OB7A 5IKXA 1E8MA 1AGYA 4MYDA 5EHNA 1P0MA 3VVLA 2JGMA 2QMQA 4Y2XA 3G02A 4P9NA 5C81A 3FYUB 2HRRA 4C6HA 3HEAA 1XQYA 1K6EA 1MNAA 2I78A 3C6XA 2JGEA 2V9ZA 3HLKA 3WZMA 4EHBA 3H2JA 3WA6A 5A7FA 4B0PA 4KACA 1R50A 4ZV7A 5JAHA 1E3QA 5CT6A 2Y6UA 3AIKA 4JUIA 3DS8A 2XLCA 1ZGBA 4ITVA 2ECFA 2JGKA 1IMJA 1QOZA 3N2ZB 2AJCA 3EBLA 4LXHA 2C58A 4FWBA 4N8DA 3H1BA 4P93A 1MAHA 1VLQA 3IUMA 4Y2VA 1BROA 2WJ6A 2WILA 1CUWA 4CIAA 1QIDA 1E8DA 1N5RA 1R1DA 3BXPA 3QITA 3HABA 1HBJA 2WFMA 3G9XA 4AB1A 4DSZA 4CI9A 4OB6A 4GWLA 2QVBA 2DSNA 4JEIA 3C87A 3ESBA 3ICWA 2WUDA 1OCEA 2PM8A 1QFSA 3M81A 3IULA 1OILA 4ZGBA 3PICA 2G5TA 4Q3LA 4AMZA 3ICVA 4PQEA 5EGNA 5JZ9A 1UOOA 4ZXFA 2D0DA 4M0EA 1UKAA 1CUGA 3FAKA 5ALNA 5AHXA 4EY5A 2QJWA 2XQKA 2WHQA 2CMFA 5T4EA 2CEKA 1ACJA 2OGTA 5CT8A 3I2GA 3RK4A 1QGED 4IH4A 3QMMA 3D7RA 1JJIA 5LKRA 1DTEA 3G0GA 4AO7A 5ALYA 1O6GA 3WL7A 5ALHA 2HDWA 4I3FA 5EIEA 1QIGA 1MJ5A 1A8UA 2XMZA 3SWWA 2FUKA 1Z68A 3QM1A 3O0DA 2HA4A 5ALMA 1ZI8A 2HIHA 3H2IA 3EQ9A 2P8SA 4W1RA 4AX4A 1VA5A 4Y9SA 3I6MA 4XX1A 3PE6A 3ESCA 4KE6A 3WQHA 4GEGA 1R3DA 1YA8A 4F60A 3WWEA 5FOQA 1L7RA 1CPYA 1ZD5A 4UHBA 4BAZA 4DLNA 1K63A 1A88A 4J0CA 1K4YA 4XWGA 2HU5A 3UUFA 2C5FA 3R3XA 1MO2A 4MQMA 4NS4A 1NU6A 5JIBA 1SCIA 4QNNA 5CH8A 3WWPA 1QE3A 2OCLA 2Y1KA 3NUZA 3NWOA 4S0XA 3NOXA 4CG3A 1YAJA 3P2MA 3F96A 3WWOA 5E4JA 2ACEA 4AMYA 5JD4A 2EEPA 3DYVA 2D5LA 4C88A 1DT5A 1H2YA 3H1AA 3LS2A 3C8DA 2FX5A 3PFBA 3CCBA 5AIBA 4HVTA 5HQ3B 3VVMA 2ZSHA 3QMVA 2R8BA 5AI8A 1ZD2P 4LYDA 2QOEA 1CUUA 4B9AA 1QIKA 4B82A 3MGAA 5AKHA 1CUDA 3R3VA 1FJ2A 1Q0ZA 4UBLA 1PV1A 1CEXA 2QUBA 4ETWA 4OU5A 3D0KA 1J1IA 1YA4A 1U2EA 1ISPA 2H7CA 2HA0A 3V48A 1MU0A 4Z49A 1ODCA 1ACLA 2WJ4A 1XZJA 2O2HA 3PF9A 2HHAA 1VKHA 4OYLA 5JADA 4BC0A 1CV2A 4PSDA 5AP9A 4OPMA 2DFPA 1EX9A 4A16A 4K5QA 4J0DA 4QWMA 2ONCA 2VATA 1X2BA 5JANA 2LIPA 1E8NA 4HXEB 3OG9A 1H23A 1Y37A 1CLEA 2WHPA 3ZLUA 4XJVA 4J0GA 2XUKA 2CUTA 3WKDA 1WHSA 3VJKA 3CCCA 1CUCA 5HK9A 2JGJA 4C4YA 2IIVA 1SCKA 2PSJA 4LYEA 1CUHA 1FFEA 3HYSA 4MEBA 5HF9A 2ACKA 4QA9A 4UBMA 2O2IA 4EUSA 1YB6A 3WWCA 4AXBA 5CH5A 2WIFA 3PDCA 4BBZA 3OM8A 2H9YA 2UZ0A 2O2GA 3HXKA 1KU0A 3WKAA 1Q0RA 4C89A 2G4LA 2OCIA 3A2MA 3I2JA 4H7KA 3K6KA 1FFAA 3DEAA 3BJMA 5A62A 1GQRA 4IH1A 1MAAA 5D3ZA 5AI6A 3QMWA 5KREA 2WUGA 2AJDA 3B3QA 2HFJA 5K3FA 3K2IA 5KWJA 5AK5A 3GELA 1QO7A 3WIOA 2GYUA 2O7RA 4K6GA 3EQ8A 3ZPXA 4A5SA 4BAGA 3V1MA 4BDSA 1GT6A 2WG2A 4G5XA 2BGNA 3ILSA 5CT9A 3R3WA 3HZOA 4W1QA 5AKZA 2B20A 1YASA 5CURA 3FYUA 5LZ9A 2ES4A 2DQYA 2GYVA 5A7HA 1FFBA 1K8QA 2VJCA 3C6YA 1P0QA 1GKLA 4HTAA 3I6YA 1CQZA 5LZ4A 3ZI7A 2X5XA 4DNQA 4EY4A 1X70A 1CUYA 1QIFA 1AC5A 4Y2TA 1BEEA 4C4ZA 4O08A 1UK9A 2XDWA 2XB6A 5A6VA 1J2EA 1HL7A 5DTIA 2WU4A 1VOTA 3QPCA 2R11A 4U2BA 3WJ1A 1AZWA 3WK6A 1CUAA 1EA5A 4Y2UA 2C7BA 3FSGA 5FPQA 1XZCA 4QDZA 4IQ4A 4X71A 3TGLA 3PUIA 3CXUA 3DYIA 4KR0A 1QIHA 1XRPA 2DHEA 3BJRA 4EBBA 1R4ZA 4GDMA 2ZYHA 1XQXA 4PF1A 1THGA 4LXIA 4BB0A 1UWCA 5C8ZA 3G0CA 4KEAA 4GXNA 3DJYA 2QTBA 3IUJA 4X90A 2XUFA 3JW8A 2JGLA 1TCCA 2OLEA 2QS9A 3OURA 1TCBA 2B61A 2K2QB 5CXXA 1UKCA 4KE7A 2WLSA 3W05A 3AZOA 4INZA 3IVMA 3WK9A 4UBIA 5HKBA 3GFFA 3ANSA 3F98A 3H19A 5FV4A 2YYSA 1LPPA 4Y2QA 1DQYA 4UUQA 5EHQA 3BE8A 4Q34A 4B85A 5IVHA 3F8SA 5AKKA 4GBGA 3HJUA 5LZ7A 1G5FA 5K3AA 1ZIXA 2PL5A 5LLSA 4CG1A 5HF8A 3M82A 4BP8A 4FLFA 2FJPA 3G8YA 3H2GA 1W75A 5DNWA 2WSLA 2HA2A 1XRMA 5CTAA 5FDFA 1IVYA 5ALZA 4BCDA 2ZYRA 5AK3A 4BAUA 1JJFA 1Y7HA 5E4TA 1N1MA 3PF8A 5JAOA 2QR5A 1XZIA 1XRLA 5K3BA 2WUEA 5T4FA 4MEAA 4EY6A 5AK6A 3WYNA 3IA2A 2XUJA 3W04A 5DYTA 2WIGA 3STVA 1ZD3A 3WJ2A 4G4GA 2QRUA 3F9CA 4DIUA 2GZRA 5AKGA 1CUXA 1BCSA 1RP1A 4U2CA 3FVRA 4G8CA 4MYSA 5C7YA 2ROQA 5HQ3A 5AH0A 3WK8A 3WL8A 2Z5GA 4DNOA 4K6KA 4H0CA 5AI4A 3DKKA 1QLWA 3AIMA 2XUHA 2BUCA 2XMBA 3RLIA 2ZJ7A 1GQSA 4J3JA 2XUOA 2PSEA 3O4GA 4YPVA 3G0BA 3AINA 5C8VA 2V98A 4BRZA 2X76A 2Y6VA 4TPKA 2HM7A 2J4FA 3DKRA 3G9UA 3YASA 1WPRA 5FUMA 3I2IA 1QIJA 5AM1A 4FOLA 4IO0A 5DWDA 1XROA 2WFLB 5T4BA 2GBFA 2RHWA 2BAGA 2QXUA 4GECA 3KD2A 4X7BA 5LKAA 5AM3A 4KE8A 4DNPA 2QM0A 3STWA 2Z3WA 4CIBA 1WB4A 4QE3A 2E3JA 2OQVA 3L1JA 3WLAA 5DLPA 4KAFA 2XMGA 5ALGA 4L9AA 1JMYA 3VJLA 3DLTA 1C7JA 3D2CA 4M0FA 3RARA 2WJ3A 4U2GA 3E4DA 3ZWQA 2ZSIA 2OAGA 1MN6A 3QYJA 3BL8A 3L1HA 5AKLA 1JU3A 2HA7A 5IVKA 1SOMA 3FBWA 3VDXA 1IZ7A 2NW6A 1C4XA 1EDDA 4BRSA 5EFZA 2BUBA 5DTJA 4UFPA 2OXEA 4BVJA 2HA6A 4CG2A 1CUSA 1ODTC 1KU6A 2H7YA 4BVLA 3D3NA 4NZZA 4QDUA 2OAEA 3DL7A 4FNGA 1T2NA 4B6GA 3VXKA 5K3CA 1XZLA 3TJMA 3O4IA 3DL4A 1MX5A 4MWTA 1VA4A 3WKEA 1QZ3A 3FNBA 4K2AA 5ALWA 1XZMA 4OSEA 4E46A 1EVEA 2EDAA 4LKOA 1XZDA 1YB7A 1XZHA 1Y7IA 5AKYA 4G9EA 3OPMA 2W6CX 1J06A 5ALUA 5ALVA 3L1IA 1S8OA 4X94A 3VISA 1WPXA 2PSDA 3STTA 1IUNA 1GGVA 5AOAA 3X3HA 2DHCA 2ZJFA 2JGIA 5JD5A 4P92A 4WJLA 4FBLA 3EF3A 3DQZA 1WB5A 1FSSA 1LGYA 4B80A 4X6XA 2WUFA 3F97A 5IVIA 2VQ6A 4N5HX 1JU4A 1F0PA 2VA9A 5HF6A 4XVCA 4FTWA 1UT6A 1ZI6A 2RI6A 1XZFA 3GROA 2B4KA 2WM2A 4E15A 5FLKA 1E5TA 5JATA 3KDAA 2WTNA 4FDMA 3WI7A 5CRIA 4MXDA 4FMPA 2HRQA 1IUPA 4FFWA 1AQLA 5LIPA 1EXWA 1U8EA 2VEOA 3IIIA 4RE6A 1HLGA 4H18A 4JYPA 2RHTA 5I7UA 2I03A 3C5WP 4UFNA 1MX1A 1C7IA 4DYHA 2Y2VA 1P0IA 2H1IA 3KWFA 1H2XA 3NGMA 1LPOA 1KEZA 2IX9A 1NX9A 4QEKA 4Y2RA 1FFCA 1W1IA 1VE7A 3EQ7A 1E66A 1UFOA 3DOHA 1BN6A 4FFVA 2VAVA 1H2ZA 4QDOA 1AUOA 4YK7A 5FP0A 4Q05A 4F21A 1TCAA 3HACA 3I2HA 1IUOA 2PPLA 1F6WA 2GZSA 2AJBA 4BTVA 5AM2A 2CB9A 1EI9A 3O95A 2BUAA 5K3DA 1HPLA 2XQGA 4DNFA 1TK3A 3LLCA 4NMWA 2HU8A 1P0PA 2OGZA 1DQZA 2GBCA 2JEYA 1VXRA 1QO9A 4RE5A 3I6ZA 4BVKA 1CUEA 5ALQA 3WA7A 3R41A 1Q84A 4V2IA 1XZKA 5ALKA 3LCRA 2QZPA 2BJHA 3MUNA 2PUJA 3IDAA 3E1GA 1UXOA 3V1NA 1ZJ4A 5FRDA 3D2AA 3SK0A 5JD6A 3FOBA 1XQWA 1QFMA 5JYCA 3H17A 5EIHA 2RIPA 4X91A 3BDVA 4BE9A 4P08A 1JI3A 4KE9A 3ZLVA 5I9IA 4L72A 3H2KA 1XZGA 5ALEA 1JMKC 1HKHA 3V9AA 3GA7A 3C6BA 3STYA 3BIXA 4B7ZA 2WG1A 2RAUA 4I19A 4YX9A 4CCYB 1UOQA 2VAXA 1CR6A 5ALFA 4U2EA 1XZAA 3A2NA 2WFZA 3LP5A 3UUEA 1YAHA 5AM0A 5AKIA 3FCXA 5IVDA 4X85A 4WFIA 4EZIA 5F4ZA 4X6UA 4QLAA 1MTZA 4G4JA 1R9MA 4E11A 4LXGA 1WCYA 3W2TA 1JFRA 3H04A 1DWPA 1K5PA 5AO9A 3M83A 2G5PA 2OCKA 4BP9A 4BCBA 4D9JA 2XE4A 4WDQA 4C87A 3E0XA 5AM4A 4PO3X 3R0VA 3A6ZA 1ODSA 1UK7A 3WL6A 1AURA 5JAPA 5HCUA 1DINA 3IB3A 5D3KA 1EK1A 5K3EA 2C0PA 5HF5A 3AFIA 1BU8A 1AX9A 3FCYA 4QWWA 1DX4A 3C6ZA 2WIDA 4HS9A 1YCDA 1VZ2A 1JT2A 2YXPX 4FLMA 3FWHA 2QKYA 2Q0XA 1A8QA 5ALLA 4G1FA 3G9ZA 1XLWA 2Z8XA 1D07A 5JASA 3E3AA 4EY8A 3R3YA 5I8PA 2ORYA 1VXOA 1LPBB 5AIAA 5CXUA 1JJBA 1B6GA 3DDUA 4ZI5A 4HAIA 4F5ZA 3VJMA 2XQIA 3WL5A 5ESRA 1TAHA 1YS1X 3UMJA 1L7QA 2XT0A 4X97A 3V1LA 1ORWA 3QH4A 4L0CA 1EH5A 1ZIYA 2HA5A 3AJAA 3QPAA 5AICA 1MNQA 3SC2A 1ZJ5A 2PSHA 2QUAA 2C0QA 4KYVA 2W22A 4I4CA 2PVSA 3R3UA 4G8BA 1YR2A 4DMHA 3GBSA 1XLUA 1YSCA 2WU3A 4ZREA 5A71A 3PI6A 1L7AA 3FLAA 4YASA 4WDRA 3S8YA 1BEZA 4B0OA 1PFQA 1VJ5A 5JAUA 1EINA 1VE6A 3DOIA 5JZSA 5LZ2A 2BCEA 4LIPD 4PSUA 4AQDA 5AJHA 4QLOA 1ZD4A 4JNCA 4ROTA 3AZPA 2PU5A 5E4YA 2XUAA 4GI1A 4DGQA 1BCRA 4U2FA 4BCCA 4J0JA 4PV7A 4C01A 3CN9A 3HI4A 1F8UA 4PSCA 1CQWA 4BC1A 1DT3A 2HU7A 5BWBA 2ZVDA 2AXEA 1IZ8A 4X93A 3FLBA 3I28A 2BGRA 1QIMA 5ALRA 5A2GA 3C5VA 3G0IA 2QT9A 3D5EA 3FYTA 2I3DA 5JALA 2BKLA 1LZKA 3CN7A 4KAAA 1A8SA 2PBLA 4H7JA 4JYMA 2HFKA 1VZ3A 1LBTA 3KOOA 4QDTA 5C8XA 4UHCA 2B9VA 2HADA 1EVQA 4HRYA 1MT3A 3W9UA 1TQHA 5JZBA 1R9NA 2JGFA 2VF2A 3WK5A 5CW2A 1XZBA 3H18A 4AN1A 4UHFA 4AZ3A 5ALJA 5CT4A 5EIAA 6YASA 1FFDA 3HRHA 4AO8A 4XIIA 5HFNA 5FXMA 1XLVA 2VTVA 1Q83A 4C4XA 2XMDA 1XKTA 4Y2YA 1H2WA 2OG1A 1R88A 2VJAA 3O4HA 5HFAA 1ZI9A 1RYYA 1QJ4A 1CRLA 4FNMA 5ALPA 4TGLA 4GLBA 1EB9A 1LLFA 3OOSA 4JH0A 3G0DA 5ISMA 3B5EA 2XMSA 4HZGA 4UFOA 3FYUC 4OYYA 4DTCA 4IH9A 3Q0TA 5BV7A 1XRNA 3OTQA 4DM7A 1M33A 2JF0A 4HXFB 3PUHA 3O4JA 4M0MA 1J07A 3W9BA 3AILA 2J3QA 1CFJA 3BDIA 1GZ7A 2XUDA 5ALOA 4ARBA 3BF7A 4J0IA 1H22A 2Z8ZA 2VJDA 2XUGA 5T4HA 1UK6A 3RM3A 1QIEA 1GPNA 3O9VA 3WYDA 1AKNA 3C43A 3D2BA 1CUBA 4B9EA 1HQDA 3QVMA 2WTMA 3DD5A 4WCVA 2DR0A 3KXPA 5BOVA 4FBMA 3WKCA 3C8HA 3ESAA 4K6HA 4OCZA 2WKWA 4G9GA 2JEZA 3VKFA 1XZEA 1U65A 1QIIA 1CUVA 4BTLA 4WY8A 3M3DA 3QBJA 4Y2JA 1WB6A 5EHXA 1RWQA 4QDXA 4H7FA 4MJ3A 2CJPA 4BDTA 3U0VA 4RNCA 4MWSA 2ZYSA 2V97A 2G63A 5HK8A 3T52A 4J03A
chains in the Genus database with same CATH superfamily
3DXFA 3NJ4A 3ZIUA 1U4OA 2ADMA 5TQ2B 3GNSA 4QXRA 5KPJA 4GE3A 2R8RA 2P6PA 5D7BA 5EZYA 2WICA 3BWVA 3CLVA 1SFRA 3CRQA 3ANTA 3SSNA 4O4IA 5A5DA 2OAQ1 2Q8QA 4FGKA 1W9HA 4DV2B 4GWKA 2CBGA 3BRSA 4BN4A 4DE5A 2H7XA 5JLJA 2OGSA 1PNTA 2OZLA 4O2BF 1ODJA 3LM8A 3R8CA 2ZWVA 2ZI6A 3P45A 4YGYA 4PNZA 1ZHOA 2QG6A 2QZ9A 3KV1A 4Q5IA 2V58A 2CFRA 3K1YA 3TLEA 4CM6A 4CNQA 1O95A 4KQWA 3DV0A 3LK6A 4UAGA 4RPGA 4B6RA 1K7XB 1QRUA 2POCA 3RABA 1J20A 3MCUA 3X2SA 2UXDB 2H54A 1PG0A 3EFOA 4UBKA 4YUAA 3ED1A 3VSEA 1QYIA 4V1CI 3WIVA 2Q1YA 4YALA 5ED4A 1W6RA 2G1AA 4JB3A 4ZYVA 1RXVA 1KQPA 1JVBA 3HR8A 2R5NA 3QVLA 4OQ4A 5ALSA 1XR3A 2DOKA 1QHXA 2VBCA 1TZMA 4Q3EA 2HX1A 5TT1A 3G8CA 3RHFA 4ZARA 5JO9A 2Q2WA 1AMNA 5GPBA 5FTKA 2VQFB 1WR8A 1XO1A 1CUIA 2G40A 3DWFA 3K9HA 4TV8A 5I45A 2W4IA 1BXZA 3GLQA 3HNRA 1BA3A 3FNHA 4L4SA 1D6JA 3EIQA 3PL1A 2RGUA 3T4UA 4FU0A 3UFXA 1Q2XA 1XN1A 2AJLI 3A3NA 5ALXA 1V8ZA 2GFIA 2D0OB 3E23A 1NG9A 1TUIA 1BEUB 1M2OA 1B3BA 3GLSA 3JWIA 3LP6A 5AKEA 5DMXA 5IH7A 4QSMA 2FP4A 1SJ9A 5CFLA 2VXOA 3M6LA 2BHNA 2QZZA 3UATA 3ZW9A 3P9PA 2H92A 3UMSA 1YB2A 3ZI0A 3O8DA 3GO4A 4JFAA 5HJ2A 2B30A 3G49A 4JSYA 1SURA 4WJZA 2DE0X 4G4IA 3L8FA 1TKBA 1RJFA 3H65A 1DC6A 4DS3A 3LIPA 3S55A 1AU9A 2ZPTX 3FMIA 2Y68A 3FOAA 4RKFA 1ZHFA 1LKZA 2YWHA 5MGBA 1NASA 2AI3A 4L3WA 5EMHA 2FLWA 5EHZA 2MDTA 1DEXA 3TMYA 5HW0A 2HMWA 1MTOA 3TUIC 1G3RA 5JV5A 3HO6A 4LJRA 2Z9BA 4RZHA 4AM8A 3M70A 1BZYA 1WZUA 3WWDA 2A9JA 4K3VA 5T6MA 5KBYA 4IF4A 1JAYA 3DEIA 1SBCA 3BWEA 3BXZA 3FTNA 1G0OA 4H7IA 5FYQA 4LNHA 5C4MA 1H9CA 1E9RA 1WMFA 5L3RA 2NTEA 2VHXA 5BVHB 1C9NA 3V7FA 1UBSB 3AVUA 3RROA 1H3FA 1DU4A 2W42A 4V03A 2FPLA 3FOWA 5LBUA 1UXKA 4E32A 3IURA 3T5DA 4RZIA 1LLCA 3CRMA 4QQNA 4ZV9A 3UGKA 4JI6B 3A0RB 2K6GA 1MOQA 3EGWA 2AW5A 1U5CA 4QDKA 4BZXA 3BMQB 1C0EA 5CVCA 4W4TA 5ELMA 3FSGD 3QGMA 1NOIA 1FVFA 2C7GA 3LYHA 3PR3A 2BGLA 5THQA 4EAQA 3V4OA 1Z0FA 1JN0A 2HYDA 3NORA 3R7AA 4E2WA 4IDFA 4MPPA 3OHSX 4UNQA 1Z6YA 5PNTA 3RGWS 4C29A 4Z99A 4D0LB 3G88A 3T7SA 3TZKA 4NK4A 5FF9A 5FNVA 4A8JA 1K6JA 2JFNA 4DMKA 5BY2A 2VP6A 4F9FA 2Z8YM 3SU8A 2C82A 4F4JA 1PK7A 2IYVA 3K0FB 3SYTA 1G18A 2P75A 2ZJ6A 1RRPA 4URWR 2ZYTX 1NAHA 1VIYA 5D86A 5I7HA 3PXGA 4BYGA 4KVZA 4P7FA 4N3GA 2YIMA 3BSSA 2R7LA 1OYVA 3SNHA 2VHEA 2ZBGA 1Y6ZA 1YZGA 3PUVA 4HYTA 2CZQA 2EJTA 2QAGC 2XY4A 2EZUA 3BMNB 1X92A 2E4YA 2P65A 4FLEA 3N2EA 3U3JA 2O7SA 2GPSA 5FBKA 3K9WA 3MJDA 3FWPA 4WN3A 3TLGA 5GM1A 2Q1XA 4YP0A 4L4UA 2HNAA 1G5PA 1KBOA 1PJ3A 1ZNZA 2SKEA 4A2PA 5KIAA 4U7JA 1D6SA 1O6FA 1QTRA 4TLMB 1MO3A 3L0ZA 4QXPA 4RDXA 2P7IA 1M2JA 4DR5B 2YHIB 5ADVA 1T4GA 2G9VA 1YULA 3TD9A 3SX4A 5TGZA 2D00A 4BMCA 1D7AA 1JYEA 1EFKA 2RONA 3L2OB 4NEQA 4RVCA 2POQX 2CFSA 2IITA 3E35A 3R9KA 1L4UA 1CDOA 3C24A 4KJXA 1NFFA 2NSDA 2E4XA 1IIRA 4ZT4A 2YBEA 4AKHA 4QNMA 2PKYX 4TTVA 4H7EA 2EG5A 3WLIA 1BKDR 1PO7A 1S2DA 1NKTA 1XDZA 3CT4A 4Y8VA 3DO8A 1NVBA 4UBOA 4KRYA 2WD9A 4YAWA 4CR7A 4KUEA 1PEDA 3MFQA 4FN4A 5JXJA 3V55A 2IH5A 1VMDA 4G2TA 4CKEB 4A23A 1M0TA 3TEJA 2OQIA 1SUEA 2PR2A 3NBXX 3K2BA 1VIAA 1ZEJA 3R40A 2F9LA 2ORED 3BIJA 1OBCA 3RRZA 3T3HA 2UUAB 2RI1A 3EGXA 1QYDA 4E07A 1H3EA 3EXHC 1K68A 1DXHA 1M2HA 4RQAA 5AW1A 2CXHA 2O5RA 4F5EA 2FLKA 1NI4A 2XTAA 3UBTA 4B1FA 1F12A 3CX6A 5AHOA 2F9FA 3EMKA 4V39A 1FXWA 3TTTA 2W4QA 5CMLA 4MZXA 2NU7B 4LWQA 2PZJA 1K1EA 3I3OA 4BN0A 4HEJA 4EYQA 2HMVA 4IKOA 2EQBA 2VSQA 3P9QA 3S2ZA 5JCZA 2IP4A 4URHA 4ER7A 2IY8A 3TFQA 1LZLA 1GLVA 1HDCA 2FZ4A 3R20A 2HSGA 4D8TA 1A98A 2X2PA 4Y6QA 1C1DA 5JXHA 4LZAA 1CYEA 4N18A 3ESDA 2GO7A 5K8LA 1KIFA 3E0QA 1QPBA 5H3HA 3WLRA 3RQIA 3U1TA 1QH1A 1O96B 3GEPA 3GFRA 1I80A 4OD0A 2I6QA 4F86A 2B69A 4C1NA 1FW8A 4DPKA 5IZCC 2RHJA 4NYMR 4N5NA 5LPNA 2PSFA 3PUJA 4EW6A 4PFQA 4WZBB 3IVXA 2VA8A 2OPHA 3WDSA 5LUAA 4GGOA 4MDHA 1RLJA 4Y6RA 2DB3A 4FB4A 5I7RA 2MHCA 3GPBA 4OGWA 4M1QA 5GMOA 2J45A 2JKVA 3MN1A 2XMRA 4PONA 3ZQ4A 2ZIGA 5KNBH 2VTBA 3NETA 4ZPXA 3B5JA 3U4HA 4D9CA 5L7TA 1QQAA 3DDZX 4PRYA 3A2KA 2VT2A 4G0QA 2AR7A 3R7BA 1SCNE 1ZGCA 3OQIA 4MQ5A 1GL3A 2AKYA 2FFJA 1B00A 1SKAA 5KI6A 3WRVA 4ARCA 1PV4A 4LYYA 4Y7DA 3HBMA 1Q0SA 3HHPA 2FWBA 1KEPA 4K1XA 1TU4A 3KPUA 3Q8MA 4QBKA 4BNIA 5DYWA 3UW1A 3O1LA 4F0JA 1T26A 2VTKA 3RTBA 3NI2A 4S05A 3CH4B 3OZIA 3UXHA 3AIOA 1L4FA 3QY0A 3FBTA 4NV0A 1SBTA 1IOLA 3V8RA 1SBIA 3EZFA 4NXNB 2CLLB 2I4IA 4QZVA 2PUEA 4MP3A 5JW6A 4B3TB 4DT1B 3E9MA 1FP1D 2SCUA 3QEMA 2BFNA 2EAUA 3BF8A 3L05A 4CCWA 4U5XA 3IR6A 4OQNA 4N5IX 3G8AA 1ODIA 3T1NA 3JTEA 4B3FX 4C0KA 2FJ0A 1M1YA 3JASB 3TX6A 4YY3B 1PWZA 2BE7A 2RG1A 3A3OA 4IQGA 4TMTA 1WX1A 4M8KA 1FTNA 5G02A 1E64A 2WSSA 1YQEA 2QMZA 3DC2A 4GBJA 4N5DA 1VPTA 1A8IA 2BKAA 5K8CA 4YT5A 3AEQA 2J6HA 2ZSAA 1JQBA 3E22B 5TGTA 2A7QA 3LGXA 3GYBA 3JRWA 4ZP1A 5DM1A 1INLA 1KSJA 2RG7A 1C50A 1T3LA 3F74A 2BEUA 4LX8A 4U9IS 4ARSA 2O8DB 2HYIC 2W7TA 4ZYXA 1YR1A 2BTOA 2EL7A 2VJMB 1I1OA 2Z2XA 3HNPA 1MQAA 4H35A 5TXGA 2J3DA 2GM5A 3G7NA 3ID6C 2X41A 1KI6B 3CW9A 1USUA 2GHQA 5HR5A 4FYXA 1IJEA 2D2XA 4G1EB 5JSYA 3HA3A 1WRBA 4NCIA 3UCEA 4A26A 2BFBA 4DDUA 1XYYA 4WFJA 4ZU6X 3THSA 5JJ5A 4U00A 1U7ZA 2DHRA 5LYJB 4X95A 4US1R 1N2CA 4RQBA 2WAXA 3VVCA 1T91A 1FEZA 2GN4A 2P78A 1VSVA 1B26A 1XZQA 4OLJA 1GGNA 3FR7A 3Q8LA 2HNBA 3NRJA 3GEDA 3W5SA 3U1BA 1U9CA 4LZJA 4AKTA 4Z7OB 1U7XA 1ZM7A 2BTQA 3EQ2A 1EX6A 4H27A 4LTDA 3ZE0B 5CVJA 2GN8A 2VKQA 5CVUA 5LLDA 2PLRA 2GZ1A 3AUAA 5M04A 4UMVA 4PPGA 1GDDA 1KMIY 5JS8A 2Q62A 1KY4A 1WY7A 1JDBB 3ETLA 2P9FA 2PU7A 2IUYA 2EBFX 4LJKA 2ADFA 2WHPB 4MKIA 1ZLXA 4PLFA 4DDKA 4ZKDA 3AESA 3P2OA 2N42A 5ALIA 3QKRB 3VA7A 4QPCA 3DZDA 5CUQA 1B2LA 3AKCA 1GPBA 3TNDA 5MGNA 3GYGA 2J9FB 1NBMA 4L2IA 2BEVB 3ZCQA 2QRHA 3I1IA 2IYAA 4JXZA 3CC8A 1C7EA 1DXQA 3ZK8A 3E2IA 3NEAA 4LGCA 4XGIA 2ZSKA 3C70A 3L9WA 3R5JA 5K51A 4EVRA 3ZJVA 2AYXA 4IXWA 3EA5A 1NUTA 4JBNA 1A0OA 3UCFA 2CBXA 1RQGA 1LRJA 4F56A 1JWLA 1T4CB 2G1PA 4MQEB 5F76A 3UJ9A 4XLTA 3NHWA 1SD2A 4A2QA 4YJ2B 2ANCA 3HDQA 2RJ3A 1PK9A 4JGIA 1VTKA 4NONA 1NVWQ 3GFOA 3UAYA 4UQLA 4X00A 1N2HA 4BFUA 4MWEA 4Z4IA 5CDUA 1RC1A 2AQHA 3FNQA 4OBBA 1YZVA 1V8OA 1ISRA 1WOMA 3CUEF 3DDOA 4HN4B 2RK6A 2OKCA 3SZGA 4B33A 3A26A 3KJGA 3G13A 4KFRA 1T0HB 2MSCB 2X1LA 2A9VA 1L0BA 1V7ZA 2QRGA 4PX9A 3O8RA 5CEFA 4ETMA 3OIDA 1OXMA 1YJQA 3LKVA 1TMGE 4GP9A 1YO6A 1NVTA 3L6RA 5BN4B 4YJKA 1BHJA 3UV7A 1AHIA 3WGNA 1G291 3TINA 1GR0A 1X42A 2DT8A 3Q41A 4Q7KA 3V4PB 1P4GA 1GNQA 2GK4A 4M38A 5SY9A 4CBVA 1TZBA 2I91A 3F6PA 1BDMA 1U11A 2HL6A 2LV8A 4Y1FA 3ZZUA 2AMJA 4W8OA 5B3JC 1ZFNA 1EVYA 5AOCA 4EHFA 5E3HA 3CX4A 3OD5A 1WTAA 5EWLA 1QYCA 3WOHA 8LDHA 3FVTA 1K97A 3PDUA 2ZCJA 1HLDA 2GWRA 3G1WA 2AJ8A 4KRXA 2XXAA 4RHCA 5F5XA 4BJHB 4YDHB 1P91A 2FQYA 3FMOB 1DMRA 3OCUA 1PJZA 5B1IA 3D8RA 2PKQO 4LQLA 3WGKA 3EA0A 1L4MA 4LPSA 1T9AA 1H42A 1DBIA 3BXFA 3L04A 3H1PA 2DKFA 4KFTA 3SZMA 3GIDA 4NVRA 5K3FB 3C45A 4W1SA 1VFNA 3TOSA 2NVOA 4Y30A 4W82A 2XMCA 3B1WA 4LYAA 3SEZA 2XIQA 3IBTA 1ETHA 3PP8A 4OGKA 1J0XO 5BVGA 2QGFA 2XCIA 5H83A 1Y7PA 3RVJA 3LF1A 1NW3A 3FOFC 1T3ZA 4G5YA 5IKXA 4GUDA 4NQRA 1WP9A 1ZJYA 5F77A 1RJ9B 1TA0A 1MW9X 3FW1A 3FTPA 4QEZA 5BWOA 3C16C 2BSXA 3AR8A 4BJ5A 4YT8A 1CULC 2ZTUA 2OYRA 3U7RA 4O29A 1G60A 4YA6A 3T12A 4N0EA 1H0RA 3URMA 3SJCA 4HQLA 3W3AA 4PZLA 3V2GA 4HDMB 2QV0A 2IQ5A 2WM3A 4HK4A 3H97A 1Q50A 4QAQA 1N6LA 3WWYA 2QMYA 4TKUA 5JSHA 3DBRB 4RSHA 5LQMA 1OFTA 4JOSA 4PYRA 1CRWG 2HRRA 2PSSA 1RC8A 1EFLA 3D31A 3MCTA 4M0DA 2Q07A 1S9DA 3OE7D 4KLAA 2CFIA 3UGQA 4CF6A 1EZ1A 3C6XA 4Y1RB 3TAHA 3A32A 1AS3A 1RDFA 4J1TC 4NDAA 1YJCA 2I6FA 3WZMA 3K6SB 2NTYC 2XEXA 3MF4A 1FQWA 3EDOA 1KYTA 3M5WA 3NGLA 4KACA 3TBHA 3F47A 1OH5A 1R50A 1R7RA 1X1TA 3NC0C 4N0MA 3VZPA 4BX0A 3PK0A 4DCTA 1AQIA 1PS0A 2IK8A 3R4CA 1OYWA 1XIVA 4FBGA 2G5CA 2ZAYA 3UN1A 4TMZA 2IE8A 1KFKB 4DOMA 4ENVA 1DBWA 2CLHB 1SG6A 2D13A 3E8XA 2J5XA 3ZZ0A 4Z4QA 3PIIA 1ZL2A 3N5CA 4BQFA 3C85A 1Z13A 2AFIE 2QE7A 1M10A 2XZPA 3QVUA 4FHCA 4TRRA 5DNYB 4N8DA 3L06A 4QYXA 4U9HS 4AMBA 3D4NA 2IOYA 5K0SA 3PNMA 3IUMA 1DUSA 4UATA 1N6IA 4Y2VA 5FR2A 4F38A 3MHPA 2JL1A 3CMMA 2W2KB 5IMBA 1GSHA 1V9CA 221PA 5BNTA 2XJ9A 3VC7A 2IDMA 2FSHA 4IOMA 1QIDA 3CBGA 1E8DA 2Q3CA 4OLHA 3W7AA 3VVBA 2RCNA 1P1JA 2BMFA 3FZGA 1A9XA 1FFWA 5TEWA 2PZ8A 2WFMA 1JLKA 4D4IA 3G9XA 5KU1A 2AEJA 1M2VA 4O8ZA 4II2A 4I66A 4IS2A 4AB1A 4POOA 2VDKB 4JUAA 3NG1A 3IP9A 4JP2A 3LCVB 2NO4A 4H6PA 4JI3B 3V3TA 2WQ7A 3GZNA 3N3BC 1UBEA 1YI8A 2ZUBA 3RG2A 1U9IC 5AR1A 4EO9A 5LD2B 8OHMA 1DG1G 3ESBA 5K0LA 3ABZA 3OPYI 4NMMA 1MT0A 4ZDKA 5EJ5A 1OCEA 4GPAA 2YJGA 4KXNA 1NN1A 1QFSA 3DLIA 2A59A 5ESWA 3PEEA 7ABPA 1DIBA 4TLCA 4ZGBA 2G5TA 1JWAB 4HQFA 4JBYA 3SMQA 2QYTA 3WS7A 1A9RA 4PQEA 5EGNA 1IB0A 2EGHA 3ZHSA 5JZ9A 1I3OA 4GLOA 1UOOA 2YKGA 3ZDAA 2D0DA 3TAUA 1FTYA 2OVBA 1CUGA 2X6TA 3TB4A 1ST3A 5EEGA 5GIPE 3MYRA 5GONF 3KEQA 3EVFA 4L07A 5EYPA 3PQ8A 1LLUA 5DYNA 5T4EA 1TO6A 2Y0BA 3EDRA 2OGTA 5CT8A 9GPBA 3PVSA 4YACA 3AR5A 1UAYA 3CRRA 2QENA 4AF6A 3G0HA 3ZWWA 3L4JA 3MCZA 4L74A 3T54A 4F4UA 2QMEA 2PBRA 3A14A 4GX2A 2ETVA 4MUGA 3S0JA 4QXMA 1JJIA 5LKRA 1FC0A 4FDTA 1G8FA 4AO7A 5EWJB 3ZVNA 1BX1A 7REQA 1O6GA 3LUBA 4Z8XA 1WXHA 2IPOA 4GP7A 1ZMTA 3GDFA 3HUDA 1CNEA 3D1VA 4TMKA 1JAHA 4WESB 1QIGA 2AT1A 3C3KA 3TN7A 1U2GA 4RL4A 4M7OA 1T6NA 1IN7A 2EZTA 1J0BA 1BMQA 2W58A 3QXJA 1WQ1R 2YJZA 1H1LB 1P19A 3A6JA 3L82B 2I55A 1TK9A 3ZOKA 3SLGA 3QTTA 1VB3A 2V4MA 4G0YA 2IOHA 3Q72A 3AX6A 3H2IA 2ESRA 4INPA 3SYNA 1JEEA 3EZYA 3RT9A 1GT91 4ZTUB 1QZZA 3FCUB 5C4GB 2D8MA 5KTOA 3SKYA 1LDNA 4Y9SA 1BHQ1 3I6MA 3LG2A 2QTCA 4KBGA 4XX1A 3F7OA 3PE6A 3O9ZA 4OM7A 1KO1A 3L6EA 2NO1A 4UOEA 3T1OA 1FUKA 5L9AA 4LTMA 3LDGA 4LGVA 4F96A 5LMUB 1XTSA 1V8DA 2ERCA 3PC4A 3KOZA 2H63A 1XJCA 3WWEA 1IWOA 3D8BA 2YQ4A 4D82A 4F45A 1YQTA 3ASZA 1AKWA 3UENA 2HJSA 2YFKA 1G16A 3WWZA 4CM9D 2QA5A 3H9EO 4C6SA 5LR6A 2NM0A 3QBEA 2XB8A 2O8NA 1L7RA 4NMLA 1M5UA 3ICPA 3W79A 4EYKA 1NP7A 3IDQA 3PQ3A 1KDYA 5F3WB 4LVUA 4DLNA 4RA9B 3E61A 4Q16A 3VZBA 1A88A 1DXYA 4WTOA 4PINA 5I01A 1L4GA 3H7AA 1XTIA 4O4JF 4ZAGA 3N2NA 2VSNA 1FPQA 4Z0NA 3EEYA 1W1WA 5AXBA 5KPDA 2RKWA 2DRIA 1U8FO 3LT1A 1P7ZA 3R3XA 2IXBA 5JFGA 3JWHA 2A84A 2X40A 4Y0AA 4OXRA 4OXKA 5BXYA 3DFFA 1HQKA 2JHGA 1YRHA 4B46A 1OT3A 2P3QA 4NS4A 1UDBA 3GRRA 1NU6A 4LK2A 4U2KA 1SCIA 4ZOBA 2II6A 4BNLA 4HNGA 3IIEA 5E4FA 1DE0A 2CLCX 1CFZA 1QE3A 4PO8A 1TPZA 1S2GA 3OZUA 2VYND 2LR0A 3MW8A 4OKSA 4J2TA 4V0NA 1NT4A 1YAJA 4KXYA 4JITA 4MCJA 1KAEA 2CSXA 1EYZA 3H42B 4FUQA 4RJLA 1XTVA 1CQIA 1YONA 2FWMX 3F96A 3PNSA 4Y3UA 3AM4A 4GL4A 5B5SA 2VHTA 2ZTVA 1L1QA 2ACEA 5JD4A 1YI1A 3KAKA 4JCCA 3C8MA 3VPXA 3DYVA 4YMVA 4CL2A 1CE8A 1E3WA 4I4TF 4M0CA 1P80A 3Q5EA 3ESZA 1CYDA 1BCSB 1IL0A 1JW9B 2IP2A 2RFLA 2WWXA 1NURA 3RS2A 5KU7A 1HMYA 3QX9A 3U5ZB 1JTVA 2RHCA 4ZYYA 1CJBA 3U6BA 4L75A 1NONA 1A71A 2E49A 2NWQA 2JCSA 4HUQA 4LJ5A 4PTYA 1ZH6A 4YMUA 5EHGA 1GQFA 2EF0A 4XR9A 3UJNA 1ZVVA 1TQ8A 4CJXA 2Y8EA 4RIHA 3QMVA 3M3HA 3V42A 4JI5B 1RABA 2JA2A 4GNKA 4TRNA 1IOVA 4IJKA 2REQA 4LYDA 1U1CA 5T64A 3MWDB 3CUYA 1OLUB 1WDKA 2IYWA 5J5VA 3NOOA 5BSRA 4GP6A 2IZ5A 4QGAA 1TMKA 3NVKI 1E9AA 1DZ3A 3PLRA 4JC8A 1M54A 1O6BA 1E69A 4RV9A 3ZCRA 4GPBA 3ZDBA 1C9DB 4B82A 1E5VA 1G9TA 2HOQA 3MGAA 2GCOA 2H2DA 5AKHA 3VDMA 3WHIA 4REQA 2YRWA 1PNQA 1FSZA 3QNMA 2W0SA 3ONEA 2RGCA 4IQ0A 3QA9A 3NT4A 3V6LA 1PV1A 2BZ0A 3VU9A 2IYLD 5EA2A 4ZANA 5HSGA 2V1UA 2H4XA 1W0KD 5CYGA 4CLEA 2DBQA 2EC5A 2ETXA 3EG9A 1OGYA 3K96A 5EGSA 3N1UA 2H3EA 4DTIA 4YCCA 1YA4A 3FTDA 3NAGA 3GUVA 3LHKA 3SQLA 4YRMA 3OFJA 4ASUA 1B0PA 1ISPA 2QROA 4OX9Y 2H7CA 2K2WA 4TYQA 2P2DA 4U3JA 2HA0A 4Z4FA 2CGEA 2ZU0C 4ZT6A 1W7AA 3UTDA 4Z49A 4ONEA 1M8PA 3KFXA 1F2UB 1X1AA 3PU6A 1ACLA 1SR8A 3HO8A 5BR7A 5IPFA 5CYFA 4MS4A 5HG0A 4B32A 9MHTA 5A6SA 4H17A 5EJEA 2CLIB 4OYLA 4WZAB 2FSVC 4PSDA 1J0AA 4G1BA 4D4KA 4OPMA 5IDYA 1X1DA 5SZHB 4JJ8A 3KYCA 4BFZA 4DY6A 4KV7A 2BFEB 4PAWA 2I54A 1EX9A 3WDMA 4FGUA 3UAVA 4F2WA 5JISA 1MOZA 4BKMA 5CYPA 2QT1A 3G2IA 3RO7A 1PQWA 3DP7A 3W1WA 4E2FA 4YRNA 1O87A 3TR6A 1P2FA 2W6JA 2HJRA 4C21A 2XB9A 2Q5HA 2H4YA 3ZE1B 2GILA 3IMKA 1XTBA 3GOHA 4Q39A 3S5JA 4PZDA 3ANXA 4R81A 4FYWA 2X2OA 3EF1A 4YJDA 3DZJA 4WNAB 1JAZA 1ZINA 1BDBA 1E77A 2M6SA 4ND7A 5G40A 1MA3A 2HJHA 4HXEB 3UB2A 3P9NA 2QRLA 3WNDA 1UBJS 3H6KA 4ZHQA 3AGQA 4I1PA 5FOVA 1PJQA 2E6UX 2JJ8A 3F5DA 4UEOA 1XWFA 3REQA 4IIHA 4JEHA 4LWOA 3PHGA 4XJVA 2VCHA 3IEPA 2XUKA 5LXTF 5LQRA 2MT9A 1ESCA 4MW4A 4MNTA 3WKDA 2D5IA 4QVGA 1WHSA 4QGBA 1E3SA 1NYRA 1KRWA 1NY6A 1KR2A 2B6NA 3ZIAD 2EQ5A 3MWGA 3S2FA 1MJGM 4HDSB 5HK9A 2JGJA 4C4YA 1L8LA 4MS3A 4MX8A 4R1TA 3RSHA 2LGJA 4ETNA 3AEZA 5H16A 3NDJA 3WAGA 1QR6A 3I92A 2IRWA 1D1QA 2W0MA 4FYJA 4CV3A 1Y5NA 4WNYA 1JJ7A 2E37A 4MEBA 2G7MC 5HF9A 1KEVA 3HB5X 1SQ6A 2GEJA 3NOQA 2ACKA 3PC7A 4IHJA 4M0PA 2C9MA 3GHYA 4NCNA 2WY2D 1QH8B 1SHZA 4HH3C 4R69A 4WY2A 3R7DA 3CKLA 4JZKA 4J3NA 3I52A 1P77A 3D1LA 4PCUA 1HEIA 5LN1A 1ENYA 1NC3A 2BM9A 3B2NA 3PDCA 1NI3A 2ACVA 2YWDA 2QMOA 3PRJA 4JROA 2H9YA 2NNLD 3VOTA 5KSWB 2JAOA 3TRKA 1I4WA 2RC5A 3HXKA 4X1KA 4WD3A 3WKAA 1Q0RA 2M6KA 3RSSA 4DBLE 4UARA 2D5BA 1I2MA 1VP9A 1AQ6A 3MBKA 2EP5A 2YS7A 3NB0A 4LAFA 4HATA 1C4WA 4NCHA 2OCIA 4Z3DA 4FFNA 4OFXA 3I2JA 3GZTB 2O0JA 5H4GA 4R9RA 4TQGA 4XJXA 1E0SA 3PYXA 4KVGA 3SQMA 1AA6A 4CGZA 3PITA 1EWYA 1HDOA 4HL6A 2MIIA 4IH1A 5KNBD 4GRAA 1DG9A 3EULA 1UBNA 4LCBA 3RUPA 2O8FB 1NQTA 4MRPA 3SKXA 3C7KA 2B3DA 1W85B 1LW6E 3AI2A 4P4TA 4MI6A 2WHYA 3V5NA 1A2OA 3B3QA 4HN2A 4TN1A 3KEGA 3ZK9A 4XSHA 3K2IA 1I2AA 3EPLA 3CM0A 2VUSA 3RREA 1M6WA 2OQRA 3ONFA 3UC9A 5B3KA 5CGQB 1OJLA 2JB9A 5JTTA 4JCOA 3KFLA 1QO7A 3HJAA 2NSJA 4AWAA 2HD4A 4C7OA 5FL3A 1P2GA 3EEBA 2H1CA 3QLVA 2JLCA 3ZPXA 1R0SA 2I2WA 3WLPA 2XRZA 1PR1A 2EKZA 1ISJA 2GD6A 2X7JA 3GH3A 4N3CA 4O6VA 5SZKB 4F2DA 1VG1A 4NV1A 2WG2A 4G5XA 2AUMA 3E05A 3OOYA 4LRYA 3EE6A 1X87A 1P4RA 3WY9A 3ILSA 5CT9A 3OZEA 3IMGA 4N40A 3WO0A 4ZOCA 4D99A 3HZOA 1L4KA 3WMFA 3F7NA 1F5SA 3K5IA 3W34A 1A97A 5AKZA 1CRPA 4P32A 4LFAB 4BRUA 3UMMA 4X3PA 2FX3A 2BP7A 3CLSD 1JHYA 4NJOA 1XF9A 5LZ9A 3PC3A 4O25A 3B1KA 2GYVA 4XOIA 4OI1A 3DMPA 4EB3A 2CCJA 4KDRA 4MPTA 4RA6B 2QXYA 4CKWB 5BWMA 2WSIA 2PZKA 4KLZA 1K8QA 1T2FA 2WW8A 2X8WA 1GFWA 5I51A 5K8TA 5L8VA 3C6YA 4I9NA 4JJKA 4LGMA 4RYLA 4UUNA 5EKTA 1M1YE 5C4IA 1LI4A 2O9JA 2FU5C 1P2UA 1UQTA 4HTAA 4TMWA 3RFTA 4I08A 5LZ4A 1W5AA 4G0ZA 4M7PA 3NH6A 3HB9A 1SBQA 5C1BA 2X5XA 2I8AA 1ZK2A 4RPJA 4RMNA 1ISSA 1TTQB 2C54A 5T67A 3TO5A 2HK7A 4MWBA 4EY4A 4DUZB 2ZE8A 3U16A 3CX3A 4R01A 4U7WA 3QX3A 3QENA 1MB0A 1QIFA 3TVDA 4IJMA 4RZ3A 4KPFC 1SAYA 4K87A 1TA4A 2JBAB 3PEYA 2PDAA 3KXKA 2GK6A 2WPDD 3LGSA 4RACA 4O08A 5DBGA 3RVNA 5GP1A 4NPHA 5LMZA 1U0JA 3HB4X 4UNSA 2QLJA 4PX3A 1F8FA 4F9TA 2W2MA 2XB6A 2LRHA 1N7IA 2VDQB 4D9HA 5FBQB 5FPYA 1J8MF 3RC1A 5AVSA 3ZWBA 1ZSNA 3GIWA 1LDEA 3OZTA 3I64A 4XQ9A 4RTPA 1T3GA 2RIRA 4NHEA 3VX3A 3EUFA 3B6EA 1CS4C 3ITKA 4Q7LA 3U3DA 3WK6A 3COSA 5IDVA 5J58A 3MOSA 3P9ZA 4HGZA 4G84A 1EA5A 3QKWA 2I71A 4AC9A 1KGSA 1I1QB 3BXHA 1B0UA 1R0XA 4MO2A 4OTZA 4YFVA 3FSGA 3UHOA 5FPQA 2QLMA 2OV4A 1RAGA 1NP6A 1N1GA 4J2HA 5CVDA 3U7JA 3LWNA 4RTQA 4MGZR 2F9MA 5A3RA 4NYJQ 5EUCA 3GP8A 4G5FA 2GJ9A 2JLZA 1WHTB 2C1EA 2XOEA 2PIDA 3H75A 2D3TA 3CXUA 1NBME 1QIHA 1OOEA 1XCMA 3DMRA 1C3LA 4KR0A 4DEXA 2A35A 4JVSB 4EKIA 3JVDA 5KNCH 2FUEA 5AVYA 4GDMA 1T3SA 1M8FA 3PGVA 2MSWA 9LDBA 5IHXA 1WXEA 1R0RE 2I2CA 1J09A 1UWCA 1JQLB 4HYQA 4AURA 2IUSA 1RLUA 4KEAA 1Y8RB 1QB7A 3L0BA 4B3HA 1JH8A 3VSDA 4NWIA 5EVCA 1WSAA 5KJCA 3K7EA 3QBVA 5FCDA 4D3SA 1FX0A 2ZR0A 1YRBA 1E2HA 2J3JA 3GEMA 3ZX4A 1IY1A 3MLEA 3TLZA 1R6BX 2JGLA 3UPDA 1V6AA 4RJTA 3SFVA 5JSFA 3DLBA 1VKZA 3FPKA 5B2EA 2RGXA 3AXSA 3FPAA 1LJ8A 3JYOA 1HYEA 2ZJYA 4GF5A 1V9LA 1PEAA 1YL5A 1IY8A 2B61A 2FZVA 3MT8A 4HQ0A 3M6UA 4HTFA 4LNUB 3DT8A 3ZGNA 5BMVB 1X7WA 3P1JA 2C78A 1U3FA 3B1ZA 4ZVLA 1P1KA 3KJXA 1YC5A 3BBLA 5F5NA 4INZA 3IVMA 1F1BA 2CNBA 4Q3BA 2WOJA 4UNNA 1WMAA 3UWOA 1AUVA 2QDXA 4DWJA 5KYVA 2N0SA 3U4MA 1AB6A 1MFZA 2B1RA 3ICOA 1P60A 2JFXA 1R4AA 3IEKA 3PNOA 1O58A 1PL7A 2XXBA 1ML4A 4JKIA 4F3RA 4ZJPA 1GR1A 3BXXA 3GFFA 2OY0A 3N74A 4QYSA 2PWAA 4YAGA 3F98A 2C20A 3H19A 4RHUA 5HA5A 1NW5A 4MPDA 1YC2A 5L6LB 2V59A 2YYSA 2FUCA 3CUVA 2CJWB 4B3GA 1UBLS 3ZY3A 4FEYA 1PUIA 3GDGA 2HWXA 5K0NA 3SM9A 5AW7A 2GNOA 1SU4A 5EOVA 4ZVUA 1PW7A 5H3LA 4Q34A 5J59A 2I1WA 3WHPA 5IVHA 5K6AA 1VE3A 2EHDA 1E4VA 3HJUA 3NEJA 5CDGA 3AI3A 1EFTA 3FMPB 4KITB 4F91B 5K3AA 1EHIA 2IYZA 1PR0A 1SIUA 2HCJB 2JHAA 4UASA 4X1YB 1W88A 2PL5A 4C03A 5JDCA 1VHDA 2R5WA 4URVR 4LEIA 4DSUA 2QAJA 3OJ0A 4WASA 1P2TA 2JLVA 4XX0A 4K40A 5LBIA 3TM5A 3ECAA 3LT5A 3T5BA 3P2EA 5LQDA 1RHUA 1SA0A 1SOWA 1VL2A 4MJLA 1U98A 3HY4A 4XGQA 1UC8A 1KAQA 1FFXA 3HXLA 3NVDA 3P0RA 4RHEA 4ZODA 3IALA 2PL9A 1W75A 3RSQA 2BF7A 3E3OA 1VSBA 2C9YA 2CKDA 3AFGA 3CZ4A 4B87A 2I99A 1AF4A 2XE8A 1AVTA 2WSLA 2R25B 4L7VA 4RMHA 1RM0A 3RE1A 4D0SA 3WNBA 5KYYA 4DY4A 4N39A 3X1JA 2TECE 1P81A 5G0UA 1TGYA 3F6YA 5BOSA 4CDMA 5FDFA 4KOAA 3D3JA 4ESHA 2IV7A 1UADA 4XEUA 2Q27A 5TIIA 2Z6QA 3FUVA 2PGDA 4GYKA 4JT9A 2ARKA 1JJFA 3PKJA 2R6AA 2XA1A 1N1MA 1L5HB 2PHZA 3K0AB 1JB1A 4MKHA 2ZWPA 1J9ZA 3GCGA 4XH9B 3CO0S 1ZK0A 2V7WA 2YVQA 4C05A 5JAOA 1CP2A 3L0SA 3LQ4A 4Q02A 5T4FA 1Q21A 4HZUA 5TB5A 4RMGA 1W4BA 1N2EA 5EP2A 2FETA 4PQFA 4PFJA 3WG9A 4AQYB 4HQNA 2JD2A 4BB6A 6ABPA 4BNFA 4EL5A 5LWHA 4FFMA 3A1VA 5DYTA 1ZJZA 4MWGA 1KXZA 3QXCA 1O03A 4KDFA 3KKZA 2X9GA 5JT1A 1OXUA 1TVMA 1W2WB 5GV8A 4G4GA 3QBDA 3UICA 4ARIA 3FROA 3HU5A 1A8PA 2XDAA 3KUUA 4L8WB 4O2AB 3USZA 4EUHA 3SLKA 4ZQCB 4P0PB 3SG0A 5CFRA 4FIDA 2FR8C 4JWKA 4CV0A 3K30A 4HF7A 3LU1A 5CDFA 5KOHA 2H1OA 4ZT5A 2ZS8A 5LVAA 1KOJA 3H5OA 1CZNA 1V8FA 3JD0A 2O2YA 3D4IA 4M1MA 5AH0A 1EE2A 2Z5GA 4DNOA 2P35A 4JU9A 1HE8B 1SUIA 3FMFA 4DREA 3LDUA 2OHXA 2NPIA 5AI4A 5A02A 1IBCA 1P6QA 2QY9A 1EUCB 2JLQA 4F3NA 1WXDA 4JLWA 2HV9A 1BW9B 1ESMA 1FLNA 2G9UA 2SHKA 4FGSA 5JBQA 3CURA 3KJNA 1UWKA 2AMFA 2VHUA 1TAGA 3NOVA 3Q3GE 2R1TA 4IV8A 1GQSA 3WMEA 4C76A 3LMKA 2XUOA 3O4GA 4J29A 3TQHA 2QTHA 3H2BA 5DT2A 3T1YB 4INJA 1F7UA 3FKJA 3G0BA 2CHQA 5FEMA 5IKOA 1GQOA 5BRNA 1LK0A 4O5OA 2Q4BA 3AKEA 3RBZA 3F9IA 3L07A 4JGGA 4L5IA 3WLOA 1ZMBA 1ZWLA 2RGNA 2J4FA 2X0NA 4LHSA 1KZGB 3V8EA 1PJRA 3DKRA 4XUCA 3CCFA 1T25A 2W8ZA 3KAPA 4J75A 4OFWA 5C5EA 2REOA 1GSIA 4CIXA 3KJZA 3WGIA 5LQJA 2X3YA 3QYPA 3TF5A 2HV8A 3JAWA 5FOSA 2R6R1 1LFDB 3BBPA 4XXHA 3I2IA 1QIJA 2YHBA 3STHA 4OBXA 4CMAA 3Q6IA 5DHFA 1CB7A 2J5QA 1PIWA 1JU9A 1JHPA 2ZRKA 1J2UA 3A36A 3K09C 4IO0A 1YS9A 2EFDB 1M6HA 4JU8A 1WV0A 1DI0A 2RHWA 1CQPA 2Q6TA 2LVBA 3ZBQA 5LNK1 1H5UA 4PSAA 2XGSA 4IVNA 4HAXA 4MYUA 4NYIQ 4X7BA 1OX4A 4OO3A 1GL7A 1TOAA 4GOOD 4NFHA 1Y9ZA 3VH4A 3F6CA 5CM2Z 4BNYA 2PUAA 1PZEA 4DQDA 2Y1OA 4DDMA 3VPFA 1H6DA 1QM5A 1AK1A 4JDPA 4ESEA 4YUZA 1CY2A 4ZJUA 1MB4A 4IO1A 3K9GA 3KKLA 1RQRA 2G71A 3LQYA 2JGDA 2YUTA 4DNPA 1QLHA 4XM2A 3STWA 2Z3WA 4ZAFA 1LLQA 3QVVA 1E6LA 1GM5A 1U3CA 5IWCA 2ECQA 3IOBA 3JQBC 5LLTA 2NAPA 2ZJ2A 3SFTA 2O4CA 4FYYA 2WF6A 5FOWA 1CX9B 3DWGA 2Y05A 3NVMB 4NFSA 5F5LA 5DLPA 1I5RA 4FC6A 5EWMB 3LUDA 4MZDA 3TNFA 1RRCA 3VKHA 3VJLA 4KXXA 3C41J 2UKDA 1IN8A 2YCBA 3FCOA 4EGSA 1G6Q1 3ASVA 3U3ZA 4YPFA 2NPFA 1K7CA 1ISMA 3P71T 2O0MA 3VPDA 2OBMA 4BKUA 2Y1CA 3DMYA 2WT8A 3REFA 3U19A 5BNFA 3S3TA 2DR2A 2XAAA 3HI6A 1U7DA 4IGIA 1MIOA 3ROEA 3CPJB 4D4LA 1YKSA 3FJYA 4YO8A 4KHPB 2PYDA 3CH7A 3BSYA 5EXSA 2QF7A 1SVSA 3U3OA 2ZSIA 1AXRA 2UXBB 3QJYA 2OBXA 3RBAA 2OAGA 1SVNA 2RHRA 4II7A 4K9QA 3VOSA 3SC6A 3DVAA 3PCRB 2HA7A 2VNJA 1AHPA 3N8HA 1J2YA 3QJGA 3KT0A 4N9QA 2WP0A 2PZMA 3L0CA 3WSVA 4ALLA 1C4XA 1C81A 4MVWA 2WKPA 3UUWA 3DZGA 4MI3A 4BRSA 1A2QA 1H8HD 2JKZA 2R4TA 5BW8A 4O4HF 1OC2A 3RFFA 1KK2A 1UBUS 5DTJA 2Q46A 4BX2A 2ZRNA 5CDTA 2GUWA 3WJ7A 1RP7A 3AJRA 1R4NA 1XMIA 4L9RA 3THOA 4HQRA 2C97A 1M1NA 1FRVA 1R0BA 3BQNB 1X74A 4L5JA 1X0XA 4G4SO 1IN6A 1N9KA 2GXSA 4NHOA 5TVKA 4RULA 2D6FA 4A92A 4J16C 2C29D 1QB8A 3D3NA 2ZRQA 4NZZA 3DGFC 3AQIA 4UJ5A 2PXXA 4ZTBA 1L5LA 4JI8B 4FNGA 2H08A 2O3RA 4H4CA 5B3AA 4BQNA 4XQEA 4ZZ1A 2H0AA 3SMVA 3RUAA 4RK0A 4HH1A 3CZRA 5JQGB 4L50A 4WEOA 5K3CA 4JLKA 2AOTB 1JR3E 2Q41A 3IP5A 3DCYA 3SPXA 1MX5A 3PHBE 3FIJA 4KXUA 4MWTA 1Y8QA 4LW8A 3WKEA 3LFTA 1KARA 4H4DA 4HWTA 3RTAA 4MJ7A 1GAXA 2CVOA 3BB3A 1EPUA 1EVEA 3BREA 4AZ0B 4ROSA 4RS4A 3ZHCA 4LKOA 1XZDA 1OI4A 2EJWA 1KRXA 2K4MA 1UT8A 5IJWA 4UM7A 3L40A 3OE7A 2PO5A 3ZU2A 3GVXA 1WUHS 3FN4A 1XZHA 1UBHS 1AO3A 5TMEA 1K88A 5AKYA 1T8PA 2GEVA 1EXNA 1J06A 3FIUA 2NG1A 4EECA 5JSZB 1EVLA 2MR5A 1UBFA 3ZY6A 3AXTA 1RMQA 2ZT7A 3WBKA 2FGJA 3B1YA 1XMQB 3TLAA 5ADHA 4RLQA 3W77A 3B78A 1H1TA 3HVRA 2C9OA 2ZBRA 3GJ0A 4FYIA 2B92A 3E5RA 1W94A 1P29A 3L7CA 4YJGA 2B4TO 3F78A 3OA0A 1QAOA 4EK9A 4HPWA 1H85A 2Q4DA 4MVCA 4ZOEA 2WVAA 3HK2A 1MZPA 5C51B 5LP6F 1N25A 5KOYA 4CEJB 5D87A 4MS1A 2ZJFA 2IV3A 2WNSA 1E2IA 2HK8A 3ZLJA 3QOXA 4JL8A 5CW1A 1TC2A 2IV2X 3GVIA 3NEPX 3L8ZA 4UCQA 4ALKA 3SM3A 2OD2A 1GQYA 3UMFA 1AG9A 1WB5A 3B6JA 2P2SA 3F3KA 5J9FA 1LGYA 3DO6A 2FEAA 5K0FA 3PRYA 5DE3A 2BDTA 2OE2A 3W2EA 1ZN8A 5EL0A 1LJUA 4R2XA 3N2IA 2QI9C 3H5NA 3N05A 4LOLA 1JU4A 1C9MA 1C3EA 1FJHA 2ZB7A 1W36C 3M7IA 4PNEA 3LFHA 1EX1A 1RFLA 2D8AA 2AXPA 2BGKA 4X7RA 4HRVA 1NRIA 3G17A 1BXRA 3PIDA 2IOFK 1ZI6A 4EJSB 5JZOA 2EFJA 2WA1A 4M54A 4YUVA 3X1YA 1XZFA 1Z3CA 2B4KA 2WM2A 3ZY5A 1WVGA 3GAAA 1J39A 1G21E 3KDAA 2YIVX 1KH1A 1SUPA 3Q9NA 4FDMA 4IGAA 4NU0A 3WI7A 5ABPA 3OC6A 4MXDA 4RIGA 4FMPA 4FFSA 3RJ9A 1AQLA 4MTCA 4U7PB 4AZ3B 5CA1F 4P80A 3KL2A 1EXWA 1NF2A 1ZUNA 2CHFA 3I73A 3GA0A 4OHCA 1SUWA 4PWYA 4GKKB 2QX8A 1H4TA 1JHVA 4FGJA 4H18A 4JYPA 2VF4X 2AK2A 5DGDA 1ZH4A 2B4RO 1WU7A 4QPDA 5G4LA 2NT4A 5LNK6 4LF5B 3EN0A 4JLNA 1BHO1 3DMTC 1D6MA 1I9CA 4XCQA 3UCXA 2G36A 4UFNA 2QW8A 5A9RA 4K0KB 5CHYA 4DYHA 1L4HA 1WS6A 5T5QA 2RHBA 3UUGA 1M0WA 1KQOA 1IZ0A 1YGYA 2W6PA 3KR9A 2W2QA 4MWCA 4S1WA 4ARZB 1GPYA 1V71A 4M1KA 2JHPA 3O1HB 1TYCA 3QU7A 1VCMA 3ZDEA 3COYA 2HWKA 3DEJA 4KO2S 4NRDA 3SXPA 4C0HA 2QM3A 4K46A 5CA0F 1M67A 3G2OA 1NX9A 3PPWA 2PZBA 1Y34E 1IATA 1S0UA 2WVJA 4IZOA 1FTQA 3GLIE 4M8LA 2ZULA 4OHPA 1Z4QA 1F4PA 2A0XA 3AYXB 4IAOA 2IBSA 1HE5A 5FBHA 1KYIA 2IEDA 3ZUGA 2FPUA 1C9KA 1V7QA 2I6UA 4Y2RA 5DIZA 1AOXA 4MV3A 3O92A 1JIKA 3V8QA 1ADGA 3EK2A 1LRKA 3UMCA 3OSUA 2OLJA 1QV9A 1VE7A 3EQ7A 3D1JA 1FNMA 3S7TA 3DOHA 4GX1A 1E99A 3DWIA 1ZOOA 4WBSA 4QJBA 1H2ZA 4KQJA 3BG5A 1V1JA 4WK4B 4LBZA 4IPTA 4EY3A 2F67A 3NM6B 4MDYA 3ZWKA 3E9EA 5DULA 5E95A 1GAJA 4I81A 1C1XB 2I3GA 3IT1A 3NDRA 1DJQA 5FP0A 3EPKA 4FXOA 4WOJA 3ACBA 1TCAA 1AZTA 2VR1A 5I9SA 2Q1SA 1E9DA 2OCXA 1AV7A 2GWHA 5DSTA 1X1BA 2LTAA 4QUGA 4YP1A 2RMKA 2I34A 3L5OA 3WLFA 1JALA 2P9TA 4X20B 5CB4F 1WW2A 1H0KA 4RV4A 1H6CA 1EI9A 1J4AA 4CM9A 1PR2A 1ZH8A 2JCBA 2QL6A 4JR2A 4N47A 1RYNA 1PKEA 4ICIA 1AE1A 4JIGA 1HPLA 5CBPB 3M1IA 5JDIA 2XQGA 4UM8B 4Q4AA 4WUVA 4N65A 1TK3A 5IJZA 4RD3A 4CM8A 2ZIUB 1OC4A 1KJZA 1EDZA 3EZNA 4D9EA 4IKEA 2IZZA 4OH1A 4EYGA 3L92A 4QRIA 3RAGA 2Z04A 2Q0SA 2GXQA 2HU8A 5DLEA 1P0PA 3IHLA 2NU8A 3IRUA 4D3ZA 1JNXX 1KXJA 4RE5A 4F97A 3OUUA 1ZGZA 5FUQA 3Q7PA 2F1JA 3DNPA 3I6ZA 1XHLA 4IIUA 4AMGA 2QLTA 4BVKA 5KVCA 3BL5A 1L3BA 1C7RA 3IOEA 5ALQA 5CD9A 1AMUA 3R41A 3ENNA 1NMYA 1B93A 4ISCA 4C0SA 1NJSA 3DLHA 1DMSA 3K72B 3DWEX 2A1UA 2JIQA 2EGUA 3BH7A 3HNOA 1KZHA 2GYYA 3O90A 1NUQA 4EGCB 5ARCA 1E2EA 3MUNA 3QFCA 2PUJA 3IQZA 3UFXB 1K92A 4CE6A 2A33A 3Q3CA 4TXHA 1QVAA 2IF0A 2G06A 3I9OA 3BWCA 2VYNA 1XKQA 3KPWA 4I55F 5DI3A 3V8NA 4A73A 4G09A 1JQEA 4FR5A 1NPDA 1A4RA 1UXOA 1KSFX 4AP6A 2ZJ3A 2ZJ8A 1HLPA 4R5MA 3ENZA 3N2KA 1GPJA 2WK1A 4IIYA 3OX3A 2AEMA 3SHQA 5DBEX 3SK0A 2FHSA 2HH9A 4ZEOA 1DC4A 2HLNA 1TXGA 4XUGB 3T1VA 3NHZA 1VRCA 2FZEA 1W9MA 2OSVA 5E6SB 5JYCA 4AMVA 2AWNA 1A8HA 4UEQA 3BDVA 3N7TA 1US8B 4W5TA 1P7WA 3C15C 4C2BA 4ZOLA 1FRNA 4A8HA 3ZLVA 2PMDA 4FGZA 2B4YA 2VXCA 3JQ9A 4YXWD 1JG7A 4EH1A 2BMJA 4YJ3A 1RPAA 3SLRA 4D6PA 3NM5A 2AC4A 3GA7A 3STYA 3VO2A 4FCVA 5EZYB 3S44A 5CXQA 2RAUA 4DV7B 1E6WA 2F64A 1L4YA 4I19A 4O4IB 1UOQA 1C8VB 1QOQB 3OQMA 3K35A 3PXAA 1FZTA 5CLFA 1BQ3A 4FONA 3UT0A 4YT2A 1NV8A 2OZLB 3EWIA 3MUFA 4HWOA 5IW8A 2WFZA 3LP5A 3IIKA 3KZOA 3WDLA 4TYYA 1CQJA 1TYZA 2HF9A 2I29A 1RVV1 1R8XA 2PYZA 5AM0A 2RK4A 3FNRA 4X85A 3VI4B 4DG5A 1UKEA 1ZISA 2GO1A 2I7XA 2P9EA 3DV0B 4E2YA 4EZIA 1RM5A 1QFZA 4BVEA 3LA6A 2VAWA 2V55B 1TMOA 4V2UA 2P0YA 1P9LA 3BD9A 3EFOB 3F5FA 4H3KB 5BNIA 5KDOA 1YZNA 3CE6A 4HLUA 4LXGA 3KQLA 3RC2A 2NZXA 2OHFA 4C22A 4EG5A 3VNQA 4EO4A 1WCYA 2QRJA 3T0FA 4MRRA 3D7NA 2QK4A 3H04A 4ZI7A 1G5HA 2ZQ5A 2ZRCA 4PPFA 1EIZA 2FW7A 1D5WA 4EHIA 4R6WA 4E6PA 4IOKA 3ST7A 2ZM5A 1Z62A 3DMNA 3L49A 1GNLA 4D9JA 2DFDA 4XGNA 1ICEA 3CF2A 2QN6A 5TC4A 3N2GA 1V4VA 5EQFA 5HIAA 4TV8B 3DYBA 3GPCA 4FP9A 1XTUA 4GRIA 4ITUA 2VPYA 3NTVA 3EEOA 3R8FA 3GBPA 5GY7A 4PO3X 1D7OA 1N8TA 2YWJA 1YNOA 2QIPA 5TQJA 4EWLA 3GWGA 1GZHB 2E21A 3EEIA 3G3EA 3NTQA 3WL6A 1AURA 3IUPA 3LVBA 1DQRA 3GLVA 5JAPA 1XJ0A 1R8QA 3KUKA 3GW8A 5HPYB 4R2MA 4S2UA 3RJMA 4PNHA 4C3UA 3TEFA 2FP4B 2Z08A 3HKEA 4HS4A 5HF5A 3AK4A 2R2GA 2WBLC 1DRWA 2YTZA 5CG2A 3O74A 3LH5A 1K7SN 1B7GO 2IZ1A 1H4QA 3C6ZA 3KBBA 2WTEA 2WVGA 3AR4A 1KC3A 2YXEA 1I2DA 4HX9A 4FW9A 1RLOA 1JT2A 2XV1A 2YXPX 3MJTA 4RSRA 4CWAA 3AHGA 4JQCA 4KHZA 4Q12A 3ISJA 2P67A 2CY0A 2AN1A 5DBIA 3PPXA 4M1WA 4KQ6A 1A8QA 1F38A 2IWRA 4AI6A 4ENPA 1XMJA 2WU1A 2DWQA 4G1FA 3ROFA 1E9BA 3K0KA 1UP4A 4YQFA 2FN7A 4YPOA 3HWX1 2GPBA 3ASUA 4N1AA 3UJ3X 4NI5A 3CKYA 1YRWA 3GCDA 5J5CA 3UJBA 3A1CA 3ZIAA 1BVHA 2XADA 3Q0EA 4Z9FA 4QYMA 4EY8A 5HZMA 2JFHA 1WZIA 1B4DA 5AW2A 5I8PA 3K8OE 3QVGA 1NQAO 1VP3A 1SBYA 2PRZA 1UKYA 3F5QA 4LRXA 2DTXA 5ETJA 2JI4A 3V80A 4F93B 3WTCA 3ADBA 1NR5A 3M9WA 1XMSA 3ONVA 3QLUC 2ZPUA 3HRIA 3R5HA 2J7PA 4ZI5A 2A5YB 4AW9A 3QMPA 4LY0A 3WLJA 4C7JA 2XQIA 3EH1A 3WL5A 2B8TA 4FFBA 1SUAA 4XPIA 5FADA 2J7KA 2A0FA 2CDAA 2FRXA 1HEUA 2QVXX 3AHIA 1BU5A 2V5VA 1YBVA 3AB8A 3KHTA 3S4YA 4D80A 3UMJA 3KQKA 2J9XB 4NNOA 5C53B 4OBEA 3V1LA 4FNAA 1JJVA 4DUPA 3HL4A 3KCNA 1V4BA 1RWKA 4KOEC 2QNIA 3GJ8A 4UZSA 1KYYA 4BO2A 4HDQB 1YZKA 3KQNA 3LY5A 2YXLA 5E9JA 4KFCA 3FVVA 1KRHA 1K5HA 3BQ9A 2ANBA 2ZXFA 4Q9HA 3MHTA 1VDZA 3B3GA 3OBBA 2ZRAA 1NXQA 1NKSA 3MWFA 3SEQA 3HCWA 5B55A 3LPMA 4REMA 5FNVB 3FB1A 4A8JB 2CK3D 2ID4A 1ZJ5A 1I3KA 2HU2A 2YMPA 4K1LA 4BKOA 4QQ8A 5DBHX 2Y0DA 3IHWA 4Z86A 2W22A 4NZYA 4W9NA 3QEKA 5KNBA 2MSDB 1VDMA 2APJA 3A4TA 4G8BA 1XLUA 5K99A 5F7ZA 1G1MA 1JL3A 3UVEA 4L8GA 4LOIA 1T3HA 4EGQA 4RETA 4F3YA 4AJOA 3I5XA 4LHZA 4LF6B 5JR3A 2FH5B 1JTEA 3FLAA 3K5WA 4MUKA 4ATNA 1UEJA 4YASA 4YR7A 4JBIA 3S8YA 4A0FA 2VWPA 3TLGB 2V45A 2L18A 1V3VA 3K9QO 3UOAB 1J5EB 3LP8A 1OGJA 3ZE8A 4WN9A 4ZQBA 2BZSA 1TM1E 4YMWA 2QR3A 5KVQA 1N8NA 3RHZA 2O8EA 5BYBA 2AFHE 4E3WA 1EINA 1J8VA 3DOIA 2DBVO 3GDWA 2KBFA 5IBPA 2ONYA 4AQDA 5AJHA 4YNBA 5NULA 1KYZA 1OXSC 3IDZA 1L4EA 1W44A 5H02A 1UJMA 3RU7A 5T3UA 1YWGO 3Q40A 4QECA 3B3JA 3WADA 3W6PA 2CMKA 1FW6A 5C1PA 2H06A 2EXXA 2G04A 3B2EA 3RYTC 2VP5A 1M6VA 1XNGA 2A3RA 2IT1A 3BA1A 1EM8A 3E3NA 4MVJP 4Q01A 3UO8B 4AJJA 1E6UA 2A9OA 1BCRA 1GSAA 1E2PA 4DLYA 1PTJA 4DJJA 3C5CA 1HDXA 1TGVA 3D4BA 5B4TA 3GP5A 4J0JA 2AZTA 1T9GR 2XKJE 3EGXB 1D1PA 4FB5A 4RVUA 1RXSA 2C8VA 1X8JA 1T35A 1TIPA 5F23A 1F8UA 4WZZA 1NI4B 4AZTA 1T0IA 4IIBA 1NX6A 4YYEA 1NVEA 1RKUA 1PS8A 2WTXA 4JT2A 5FAKA 4KLRA 3T9CA 2UZ3A 1SULA 3HCCA 2PMEA 2Y4NA 3SE0A 2XA9A 2RAVA 3ND7A 4N12A 1QHSA 4PRZA 3CW2A 1JDBC 2AZMA 4X3OA 1P45A 4BTEA 3RIMA 1XX6A 4E5SA 3B38A 3OJXA 3P0FA 2BGRA 4KREA 3P9IA 2WPDA 4PLCA 1C1DB 1O2DA 3C1AA 4IIJA 3FY4A 3B1JA 4D9BA 1PSZA 3FYTA 3KYDA 4FWIB 5FO0A 5DXJA 1N6PA 5JD3A 4FILA 2QG9A 1QH1B 2BKLA 3H4VA 5JALA 5JC1A 2YVAA 3AY6A 1ODKA 4EUFA 4YJFB 4NZOA 3I34X 4RD2A 3BFKA 1A8SA 1L4BA 1NVGA 1RHRA 2B8NA 2PBLA 3ECCA 3NYRA 4RUKA 5JOQA 1JXAA 2GSWA 1KP9A 1I0IA 4O02B 3TEMA 1F2DA 1G8AA 4DJEC 4EMBA 5JI2E 1CCWA 1LBTA 2OO5A 2WJVA 3UW3A 3WAJA 1QZTA 4FHFA 3T06B 5GJWC 4MVJE 5D84A 5K0GA 4TLLB 2GR9A 4DLXA 2VTBB 2EYUA 4GPEA 5IULC 5JC8A 3LOQA 5SZJA 5DNDA 4DIFA 3PEFA 1HDGO 2XQVA 2ODTX 3LZDA 4ZVPA 3CUTA 3QUBA 3S27A 1R9NA 2VF2A 3OQIB 3WK5A 4EPVA 2B2NA 4LDPA 1YJ5A 4ER3A 3W7BA 4J0FA 3HDJA 3VAZA 3FR8A 1ID1A 3VTAA 1YKFA 3VNBA 1TLLA 4EPTA 5KSYA 1KH3A 1QYVA 3A1SA 3ONDA 4UHFA 3WTBA 2NVBA 4DZTA 5BQXA 2C2YA 2EHJA 4WV3A 1H65A 1B2RA 1NVXQ 4FMDB 4PC6A 5KUTA 1KK3A 5D3MA 4BFLA 4RX1A 3WMXA 2NZ8A 1XUOA 2ZIFA 4CF7A 1RWNA 1E5QA 2VTVA 2WJJA 4R7GA 2C5BA 3EJWA 3KKQA 4ZT7A 2VDWB 1TJPB 3HVUA 1PLKA 3QEMB 5I8WA 2SCUB 3HCFA 3PWTA 5FTNA 1IBLB 1EAMA 4FQ8A 4NEHB 1T9ZA 2CNWD 1QVZA 4NL4H 5BRJA 1M1YB 2OYSA 4MDEA 4NU5A 4J4HA 4TX1A 1GZ6A 1Y7TA 2HRBA 1YMQA 5EKSA 4E2XA 4IQFA 4O2BA 5BQOA 2WWIA 3AUYA 1AKRA 4LHWA 3NAMA 1KFJB 3D3QA 3UZUA 3R5SA 1L5OA 3LECA 3O4HA 2Z6UA 2BEUB 4DB2A 2MWMA 3HZHA 1XP5A 1QJ4A 5ELLA 1CRLA 3K0CC 1B15A 4I5GA 4LVCA 4M9SA 5ALPA 4UHKA 1EB9A 1T8WA 1FRQA 2DYKA 2ODAA 1WDLA 4FW8A 4E5PA 2JAUA 2BR4A 3D6TB 1TJNA 2XF2A 4QOJA 4B17A 3K20A 5CK4A 4DWOA 2BFBB 3G9QA 5ISMA 2Q2VA 3B5EA 3SBDA 4DHWA 1FSGA 5GJBA 3KOYA 1Z6TA 1Y9JA 3DL0A 1JLMA 5EE5B 1OV6A 3MCWA 4UFOA 1E98A 1KDOA 2L19A 2QY6A 5DV9A 4F2HA 3SF8A 5ES4B 3PQFA 4IRMA 2WM8A 3H9BA 3B6MA 3AUXA 2YN0A 2NOAA 3L3BA 1XB2A 4ZDJA 4JR1A 1M33A 3MNFA 3FYHA 3NATA 1RLMA 3IQHX 2JF0A 2O57A 2ZLBA 5EINA 1FY2A 1MQ9A 3I6QA 3O4JA 3JQRA 3VHXA 3NONA 3D3EA 3TVTA 3W5JA 2V6JA 2CLSA 4DMRA 3AESB 5MDHA 2FMTA 1D9ZA 1H05A 3OJWA 1HNWB 1GJRA 5EMKA 4R1SA 2OKGA 3NYWA 4XIJA 3SJ7A 2HDHA 3WOVA 4ZEXA 4BGDA 1LI5A 2WJPA 1K8ZB 5CB6A 3DCIA 3SICE 3DZIA 5AW3A 1YF3A 1ES9A 2VLIA 4W7IA 4ZQFA 5ALOA 1NXVA 1X1RA 1GZ3A 2H2WA 3Q88A 1ORIA 2BY4A 3ES9A 2Z8ZA 3TE7A 3TR0A 4DLLA 1QUEA 2Z3VA 2XUGA 4PZPA 3GFBA 1E0DA 3TPCA 1HQCA 5T4HA 4ER0A 1L6RA 3N2YA 1RYZA 1WL8A 5JXGA 2K7FA 3O9VA 4JAVC 2H8KA 1R6UA 5KKCA 1Y98A 4QASA 4MVJG 2FFQA 4JC0A 4PZ9A 4B9EA 2D7CA 2WTMA 3Q7TA 5ENVA 4AF7A 3PC2A 5F33A 1WF6A 2V1XA 821PA 3KXPA 3KUXA 3WKCA 1C8LA 4HXYA 4G9GA 4YROA 1CR4A 3WQRA 2PGXA 2Y1WA 1Y3BE 4NNPA 2P2LA 2VZ9A 4PYLA 1K4KA 1PV2A 3OWXA 4WX2B 4BFVA 2IS4A 2PKQP 3MTDA 4F5DA 3IMCA 3NMUF 1R5NA 1M6EX 1B1CA 3ISVA 3WB0A 1ZM4A 5LD2C 5TARA 1AGNA 3UKJA 4BTLA 2C3UA 3M3DA 3LNTA 5TQVA 4FT2A 4UKDA 3E4CA 2CW5A 5EWLB 5HRCA 4N4AA 4QYIA 1XPRA 2P9YA 1E9VA 3EUAA 4LOJA 1EHCA 1K7YA 3UANA 2Y3IA 1WKCA 4BDTA 4L95C 4DADA