6YASA

Hydroxynitrile lyase from hevea brasiliensis, room temperature structure
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HYDROXYNITRILE LYASE)
publication title Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis.
pubmed rcsb
source organism Hevea brasiliensis
molecule tags Lyase
total genus 97
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 1999-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 6yasA00
3AZPA 3ZV7A 4EY6A 1Y7IA 1X2EA 3CCBA 1AC5A 1LPPA 4LXIA 2VTVA 4BCDA 1VA5A 1U65A 3W06A 1MNQA 4AZ0A 4IHAA 1WHSA 3STUA 1LZLA 4OD0A 1QO7A 4UBNA 2AJDA 3EQ8A 3MUNA 2AJCA 5ALWA 1UOOA 2G63A 4M0MA 3H17A 4K2AA 1TRHA 5AHXA 5AKKA 3IBTA 3DCNA 2XE4A 3UUEA 4EZIA 2RONA 1X70A 1UKAA 3STWA 4BCBA 3M81A 3BIWA 3IUQA 3AINA 3DLTA 4Y2TA 5FPPA 1RWQA 2WHRA 1FFEA 3WA6A 4QEKA 3BDIA 1P0QA 2XUQA 4WY8A 2WFLB 1EINA 2B61A 3G0BA 3WIBA 1UK6A 1QIHA 1WHTA 1HDEA 4KJXA 3F96A 2HADA 1RP1A 2X5XA 5C8XA 4EY8A 3V1MA 1QIIA 4A23A 4B82A 3ZLVA 3E3AA 1DINA 1L7AA 3I1IA 2HU7A 4U2DA 3IVMA 1CUBA 5KWIA 1XZIA 3FYTA 4N5IX 2EEPA 1JMYA 5EHNA 3WWPA 2VAVA 3BF7A 1A8SA 1QE3A 1VZ3A 3G7NA 4AMYA 2XUKA 5AJHA 1WCYA 4L3WA 1MN6A 1W52X 1CUYA 4Y2PA 4OYLA 5FV4A 2XQIA 3STYA 5JIBA 1JKMA 1TCAA 1YS1X 4G9EA 3PI6A 2PX6A 4DMKA 5CRIA 1EK1A 3DKRA 4MYDA 2BUAA 3HACA 2DHCA 3EQ9A 2VAXA 3K2IA 2R11A 1QJ4A 2G4LA 2ZYRA 3ZLUA 2V96A 3D2CA 2H9YA 1W76A 1VE7A 5ALLA 4E15A 4B7ZA 4Y2SA 2WIKA 1QOZA 4N8DA 4WFIA 4K6GA 2WTNA 2Y2UA 3VJKA 1R88A 2O2IA 2PSJA 3NGMA 1U8EA 1TQHA 1CUHA 3T52A 4J0DA 4LKOA 2BGRA 4AB1A 1CPYA 1XRLA 2YASA 3FLEA 3N0TA 3C8HA 5AI4A 5AM4A 2PM8A 1UKCA 4EBBA 3A2LA 5JZSA 4TPKA 3V1LA 5JZ9A 5AI8A 1UWCA 5ALPA 3ANTA 4ZI5A 4M0FA 2WIDA 4OYYA 5AM2A 4C4ZA 2OCIA 4OU5A 3B3QA 4U2GA 5FRDA 2C5GA 4G8DA 2IITA 5ALOA 4L72A 1YB6A 1QTIA 2BFNA 4X85A 3H2GA 4ZV7A 1XRQA 3DYIA 2JGIA 1ODSA 4NMWA 4DNOA 2WUGA 3QPDA 4X90A 4HRYA 3A70A 3A2MA 2WU3A 4C88A 2WILA 1IUPA 5LZ4A 4OSEA 1GQSA 1E3QA 5CXUA 3WWCA 4WDRA 1GPLA 2VT7A 1H2WA 1YAHA 2X76A 3RM3A 2DR0A 4JEIA 1XZGA 3EQ7A 4F21A 2PUHA 4UBIA 1SFRA 4J0HA 3HC7A 3FSGA 3H18A 1UK7A 3ESDA 4X71A 2C0QA 2HDWA 1GKLA 2O7VA 2OCGA 1BCRA 4H18A 5HF5A 2GZRA 2BCEA 4DSAA 4W1PA 3HXKA 4J7AA 5EFZA 3C8DA 4B83A 4G9GA 4MJ3A 1CUJA 4WFJA 3KD2A 3WL6A 1FSSA 3HEAA 7YASA 1QONA 4MEAA 2HA4A 5CT5A 5AOAA 1CEXA 2V9ZA 2WLSA 1E8MA 4W9RA 2OGSA 4GI1A 1MO2A 1K63A 2I3ZA 3WK7A 3G0CA 3FYUA 1UOQA 1XZFA 3O4JA 4AN1A 4PV7A 4NS4A 5JD4A 3AZOA 4G1FA 4UBLA 2I3DA 3K6KA 1HLGA 3CXUA 4Y2JA 4U2EA 2BKLA 5AKGA 3U1TA 4BDSA 5BWBA 3R3XA 2C7BA 3D59A 2WUEA 2WM2A 4DNQA 4JH0A 4ETWA 4YX9A 1GKKA 4JYMA 4BVLA 3W9UA 4B80A 4Z49A 4BAUA 3C5VA 4INZA 1CQZA 1MU0A 1XQYA 3UMJA 3F67A 1OCEA 1THTA 2JEYA 1XLWA 2WIFA 3FOBA 3ZI7A 2GBIA 1F6WA 1QZ3A 4XIIA 2PL5A 2D5LA 1QIGA 6YASA 1MAHA 2VJBA 5KREA 1KU6A 2DSNA 3PFCA 1BCSA 3EF3A 5FUMA 4C87A 4EUSA 5AKHA 5FPQA 5AK6A 1FFBA 4N5HX 3V1KA 3QMVA 1CRLA 2O2HA 4XVCA 1YAJA 2R8BA 3IDAA 4C4XA 5HK9A 1E8DA 4NVRA 4KRYA 3FLAA 4DMCA 4OB8A 4KE9A 2PU5A 3DL4A 3R3YA 1X2BA 2I03A 5ALIA 1HL7A 2XMQA 2WJ4A 5ALRA 1EX9A 5I9IA 1QIFA 2OLEA 1CUZA 3QH4A 1HQDA 3HJUA 3TGLA 1XKTA 3IUJA 4UHEA 4KE6A 3CN7A 3IIIA 2QM0A 4MEBA 3N2ZB 4FLMA 4TGLA 4P9NA 5E4TA 4ITVA 4JNCA 3W2TA 4E11A 1H22A 5IVKA 1NU6A 2HA6A 4OCZA 1TIBA 5DWDA 3V9AA 1XFDA 5ALEA 2YYSA 5HCUA 2XQGA 2ZJ7A 1UFOA 4DMFA 4RGYA 5AI9A 3WYNA 1UK8A 5KBYA 1XZKA 4LYEA 1G5FA 1VA4A 4CG3A 5HQ3B 3R3ZA 1BS9A 5JAPA 5IVDA 4QWWA 4GWLA 4FLEA 3WZMA 2ZYIA 5ESRA 4UHBA 1USWA 1ODCA 3WK4A 1K5PA 1GPNA 1CUDA 2UZ0A 4OPMA 2LIPA 4GECA 4BC1A 5ALQA 5JYCA 2ACKA 2Z3ZA 3R0VA 3I2FA 3A6ZA 3BXPA 1T2NA 3H1BA 4WCVA 1AKNA 3I2IA 3PICA 3FNBA 2E3JA 4BC0A 3HRHA 4DIUA 2RAUA 2WHPB 3WYDA 4G4IA 5FDFA 1MJ5A 3DNMA 3QPCA 5CH5A 2PSDA 1MX9A 3HLKA 1YB7A 1FFAA 4AMZA 3ED1A 4CIBA 4Y2RA 1HKHA 3P2MA 4MXDA 1E66A 1HBJA 2WG2A 5DYTA 4PSCA 4YK7A 1UK9A 4PF1A 1D07A 1CUUA 1EB8A 3IULA 2CJPA 2OCKA 1JT2A 4G5XA 2BUCA 2H7XA 2XUPA 1ZD3A 1N5MA 3WJ2A 3TRDA 1Z68A 3RK4A 5FLKA 3D2BA 1C4XA 1VXRA 3VJLA 1CUXA 2XMRA 5CURA 5JATA 4UFOA 1XQWA 3PUHA 1O6GA 4HXFB 3W9BA 4A5SA 1UT6A 1J2EA 3RKSA 2C0PA 2QRUA 4XWGA 5AK4A 3I2GA 3UUFA 3R40A 1ZGBA 3ESBA 1TAHA 3C87A 1LBTA 3WMRA 4G4GA 4H35A 2QTBA 1C7IA 1IZ7A 4ZGBA 4ZXFA 1H23A 4M0EA 4X6YA 3KXPA 4CIAA 1LPSA 5DJ5A 3BL8A 3BJMA 3U0VA 2QZPA 4X00A 1CFJA 4X95A 3SC2A 1PV1A 1DQYA 2VQ6A 5K3FB 1H2YA 5LZ2A 3FSGD 5AI0A 4U2FA 4BB0A 2HA0A 3LS2A 2V98A 1EVEA 5D7BA 1E8NA 5LZ8A 1G4HA 3L1IA 1CUFA 5AKJA 5JD5A 2WFLA 2BGNA 4I3FA 1EI9A 3R3WA 3RARA 4BBZA 2XMSA 1PFQA 4BP8A 5AM5A 4AQDA 5A6VA 3LCRA 4EA6A 4BZWA 2ES4A 1EB9A 3PFBA 4CFSA 2ZVDA 1ZJ5A 1AZWA 1DX6A 1TKRA 5CMLA 4BAGA 1EVQA 4JYPA 1XZLA 4HXGA 1XKLA 3V1NA 4X91A 4X97A 1WB6A 4E14A 2WJ3A 1I6WA 2C4HA 2ZYSA 1DWOA 1C7JA 4OU4A 5IVHA 2WIJA 5K3AA 4OB6A 4H7KA 3MUOA 2CZQA 1UXOA 4MWTA 1YASA 1DX4A 3KWJA 4KYVA 2HA7A 3FBWA 4HXEB 3ICVA 5IH7A 2PSFA 2QS9A 4K6HA 5D6OA 3M83A 1ODTC 3EIOA 5T4FA 4FWBA 4S0XA 4GLBA 4L0CA 3S8YA 1TCCA 5AKLA 1CUGA 1ZD4A 2QMQA 1LZKA 2HIHA 3KSRA 4C6HA 3PF8A 1N1MA 1DQZA 2CMFA 4EY4A 2XUJA 1KEZA 5CXXA 1OILA 4KRXA 1BU8A 1LPMA 1M33A 4C4YA 2QXUA 5ALFA 5ALTA 3AJAA 4Y9SA 3C45A 1ZJ4A 1XZMA 2XLBA 3GROA 4GHWA 2XUOA 3QITA 1DWPA 4B0OA 4X94A 1XRPA 4J0CA 5HF9A 2VJAA 4ZV9A 2DQZA 4KAJA 4P93A 3KOOA 4AXBA 3ZWQA 5LKAA 4ZWNA 4J0GA 2WUDA 1CUCA 5HFNA 4DNFA 3F97A 5EHZA 2HL6A 4B9EA 3STVA 3QMMA 5EIEA 3AILA 1YSCA 3FVTA 2CEKA 4CCYA 5EIHA 2Y6UA 2Z3WA 4RE6A 2XMZA 4EHBA 2WSLA 5J3JA 3IA2A 4DM7A 4BAZA 5CH3A 4LXGA 1EHYA 3I2HA 4UBJA 1DWQA 4QA9A 3D2AA 2ECFA 2DQYA 2RHWA 3SK0A 5HZGA 5YASA 4V2IA 2WG1A 1LGYA 2J3DA 2PPLA 5AIBA 4GEGA 5CT4A 2VEOA 1R9NA 5HKBA 5AK5A 1TCBA 1Q84A 1LLFA 1MPXA 2OGTA 2C5FA 5JAUA 3QZUA 1ZD2P 2H7YA 4BATA 1ZOIA 4B6GA 1ETHA 2WIGA 4YASA 4AO7A 1DU4A 1W4LA 3O4IA 2AJLI 2W22A 3C6BA 1ZI9A 1GXSA 3O0DA 4MWSA 2Z8XA 4H7FA 1QIMA 2PU7A 1IZ8A 5DTIA 5CT8A 5DLPA 4IH4A 3G9ZA 1QIDA 2OPHA 5CBKA 5AI6A 2Z5GA 4FBLA 2GBFA 5ALSA 1U2EA 4Y2QA 1W75A 1WOMA 2OG1A 5C8ZA 3C43A 1XZAA 1AQLA 4GDMA 4QWMA 4ROTA 1DTEA 3L1HA 3DL7A 1L7RA 3YASA 5BOVA 5AIAA 1VXOA 1J06A 4GW3A 1MAAA 1XROA 3Q0TA 4Q1VA 3HABA 5BWCA 5AOBA 1G66A 3E4DA 4RPCA 3DYVA 1SCKA 3ILSA 1ZGCA 1VLQA 1QGED 1ORWA 2GBGA 5HFAA 2JGFA 1ZD5A 4FFWA 4Y2VA 4AO6A 3FYUB 4LYDA 2OXEA 2AJ8A 3LLCA 4F60A 2IX9A 1JFRA 1MX5A 5F4ZA 2JF0A 1DT5A 4CI9A 1XQVA 2V97A 2JGEA 4GXNA 5H3HA 2CUTA 4HS9A 2EDAA 4QLOA 1QLWA 1ZIYA 4OB7A 4LHEA 5ALUA 1F0PA 5T4HA 1TK3A 1CUVA 4XJVA 1R3DA 1CUIA 2GZSA 1WB5A 1BEZA 4H7IA 1Y7HA 4Q82A 1GZ7A 1CQWA 3VVMA 2WFZA 1QTRA 1JMKC 3AIKA 5KWJA 4BZZA 1VOTA 3FAKA 5AKIA 4H77A 4FKBA 4RE5A 2O7RA 4WDQA 1QO9A 4B81A 1WB4A 1UOPA 4IH1A 1LPBB 4C01A 3G0GA 2FX5A 3FWHA 4I19A 1EH5A 5A71A 5ALVA 2G5PA 3WK9A 4G8BA 4PO3X 3C6ZA 2PUJA 3NUZA 3G8YA 3WQHA 3LIPA 3HYSA 5CT9A 4KAAA 5IVIA 1H2ZA 3BDVA 4GBGA 1ISPA 4TVKA 2CKMA 2WTMA 5K3BA 2RHTA 1B6GA 4IQ4A 4H7DA 2GYUA 3R41A 3LIIA 2WJ6A 3ICWA 5DTJA 5LZ5A 3WK5A 2FJ0A 2Z8ZA 3WWOA 4HRXA 2XMBA 1UZAA 2XB6A 2VJCA 4Q3KA 1H2XA 4FLFA 5HQ3A 2WFMA 3VXKA 4AN0A 2GYWA 5FOQA 2WQZA 1XRMA 4C89A 1LPNA 2W6CX 4QDUA 3AIMA 4BRSA 5D3ZA 4N8SA 4DNPA 2RIPA 1YS2X 3O4HA 3F98A 2FJPA 2AJBA 4WY5A 3HZOA 3DJYA 5T4EA 1CUEA 4CG2A 1CUSA 3WKDA 3MGAA 5AOCA 3WK6A 3JWEA 5HF8A 2HHAA 1CUWA 2OAGA 4FTWA 2CB9A 3OC0A 3WKCA 4ARAA 2B20A 4BYMA 3B12A 3H0CA 5K3DA 1GGVA 5C7YA 3WL5A 5CW2A 4QDZA 5AO9A 1W6RA 4Q3LA 3F8SA 5HK8A 2JGKA 4Q34A 3PUIA 4ZREA 1CR6A 2XLCA 1JU3A 1P0IA 4EY7A 1S8OA 3DEAA 5LZ7A 3H04A 3R3VA 3BF8A 2XDWA 3S2ZA 5ISMA 5JD6A 3E0XA 2BUBA 3AZQA 3BE8A 4DYHA 3OPMA 4UBKA 2HFKA 1P0MA 2HA5A 5LKRA 3D5EA 1IUOA 4H0CA 3NOXA 1A8QA 2Y1KA 1SCQA 5BV7A 3FYUC 1QFSA 2EDCA 1AMNA 4OUKX 4Y2UA 4BP9A 3H1AA 4RNCA 4ARBA 2XMDA 1XQXA 5AKZA 1B41A 3GZJA 5AM1A 1XZCA 4N8EA 2AXEA 1ZICA 1IUNA 1EA5A 4I4CA 4UUQA 2B4KA 1G42A 3OURA 3LP5A 1HPLA 1T4MA 4KACA 1XZJA 1EDBA 3M82A 2XMGA 4G4JA 3I6ZA 5A7FA 5JZBA 1QIEA 3SWWA 4Y2YA 2JGMA 1LBSA 3DDUA 5AP9A 4BVJA 3CN9A 3DS8A 2XUGA 3I2KA 5A7HA 4CG1A 2WKWA 5CH8A 2Y6VA 5K3FA 5FKJA 3NWOA 3QYJA 2OQIA 3G0DA 2ZSIA 5AKXA 5LIPA 2VA9A 3FCXA 3WI7A 2C58A 5JAOA 1NU8A 4B85A 1R1DA 1YA4A 2YH2A 4DTCA 3VKFA 5EHQA 3X3HA 3WIOA 4HVTA 3I28A 2OGZA 3PE6A 4KR0A 4UHHA 1A7UA 4X7BA 1XLUA 2QXTA 3L1JA 3WWDA 3ESCA 5I7UA 3ZPXA 2ORYA 2QUAA 4L9AA 5FP0A 3WKEA 1CIJA 3ESAA 2WUFA 1BE0A 2PSEA 3JYHA 2VATA 1WPXA 2HU8A 1NX9A 2XQJA 2QR5A 5AKEA 2GYVA 5DYWA 4KE8A 1JJFA 4Y2XA 5A62A 3AUKA 3R3UA 2G5TA 1THGA 1JJBA 4QLAA 1W1IA 5JARA 5ALNA 4UPDA 4AO8A 1E89A 5JAHA 1ORVA 4PSUA 3D4LA 4HAIA 2QVBA 4H7JA 2VF2A 2QUBA 2XUAA 3DQZA 2JEZA 4PW0A 3KDAA 5SYNA 5SYMA 2B9VA 4B84A 3GBSA 2H7CA 1E5TA 2BJHA 4UFPA 2XUDA 2OQVA 4FMPA 3H2JA 1AUOA 3VJMA 1BN6A 2DHEA 1ACJA 3Q8WA 5E2IA 1DT3A 5LYYA 1MX1A 1EK2A 3G02A 3WL7A 2ONCA 1FFCA 2VSQA 3H19A 1KU0A 2XUIA 3C6YA 5LZ9A 1A88A 4X3CA 1R50A 1N8SA 1ZI6A 2XMCA 3VDXA 4UBOA 5T4BA 2WHQA 3QPAA 4QDTA 3GELA 1GQRA 2QT9A 3WWEA 3TJMA 2Y2VA 3PDCA 3D3NA 3VISA 2BAGA 2PBLA 4P92A 1FJ2A 5AICA 1JJIA 1BROA 5FXMA 2I78A 1XRNA 3SX4A 4EY5A 2ZJFA 2NW6A 4Y7DA 3WKAA 4QDXA 4MQLA 2RGUA 4NZZA 1VKHA 4H7EA 1WPRA 4UHDA 4J0JA 5IKXA 5EI5A 3QVMA 3F9CA 4CCYB 3I2JA 2JGLA 2WU4A 1XZDA 3MVEA 2ACEA 2QJWA 2H1IA 4IH9A 1Q0RA 4BE4A 2IIVA 1MT3A 1VJ5A 4J03A 5AH0A 3QMWA 4W1RA 3W04A 5ALJA 1L7QA 2HFJA 5HKAA 3DOHA 2WG0A 3G9TA 3KWFA 3H2IA 3EBLA 1CVLA 4FDMA 4EB0A 1SOMA 5EIAA 3GUUA 4LIPD 1XZHA 4KAFA 3RLIA 4X6UA 1XRRA 3IUMA 1FFDA 4PSDA 5A2GA 3I6MA 3QBJA 4QE3A 1Y37A 2XI4A 3WL8A 1VZ2A 4UBMA 4W63A 4LXHA 3B5EA 4UHCA 3WA7A 1Q0ZA 2QJRA 3H2HA 1EDDA 3HSSA 2K2QB 4H7HA 3G9XA 1QIKA 3PF9A 3STXA 1WM1A 1YR2A 5ALDA 1OXMA 4J0KA 1R4ZA 4KE7A 5D3KA 5ALKA 2HA3A 4K5QA 3O4GA 4DMHA 4BDTA 4DGQA 2VJDA 3C5WP 1XZEA 1JI3A 5K3CA 5ALYA 5K5EA 2PKYX 1A8UA 4F5ZA 3DOIA 2XUFA 4J0IA 4BE9A 1QFMA 3I6YA 4B9AA 3DKKA 3I1YA 1ZI8A 3HI4A 4IO0A 3G0IA 2DFPA 2YXPX 2JIDA 3WJ1A 2J4FA 1K6EA 2OCLA 4O08A 1YA8A 1F0NA 1MTZA 5E4JA 1AX9A 2CBGA 4MYSA 2DHDA 4XX1A 4QDOA 4W1QA 4AX4A 3AIOA 5ALMA 2VT6A 4CCWA 3D0KA 2HM7A 3QM1A 1J07A 5DNWA 3IB3A 2XQFA 4J3JA 4PNZA 1BN7A 1SC9A 1LPOA 4HZGA 3BIXA 4WJLA 4PQEA 2HRQA 4D9JA 5EGNA 1P0PA 3ANSA 3ZLTA 3C70A 4B0PA 3H2KA 2D0DA 3WK8A 2QOEA 5HF6A 4F0JA 4Q3OA 2J3QA 2XUHA 1GPKA 2JBWA 4X6XA 4FNGA 5C81A 3O95A 4UHFA 2ROQA 2HU5A 5ALGA 3GFFA 5CTAA 2ZYHA 2XT0A 4QZVA 1IVYA 1EDEA 1CUAA 3STTA 1ACLA 3OG9A 1CV2A 3O9MA 5CT6A 2FUKA 4A16A 3IUNA 5JANA 3WZLA 4P08A 5EHXA 4FBMA 3FLBA 3BJRA 3T4UA 2RI6A 4K6KA 4ZRDA 4BTLA 1BRTA 4MQMA 2OAEA 4DLNA 2DCMA 4FNMA 1N5RA 5LP1A 2X8BA 5ALXA 1RYYA 2PVSA 5JADA 1R9MA 1LPAB 5AK3A 2PSHA 3M3DA 3WKBA 4BTVA 5LLSA 1BEEA 4QNNA 5AKYA 4E46A 1K8QA 3W05A 4BVKA 1U4NA 3A2NA 3DD5A 3FCYA 5E4YA 3OOSA 4FOLA 3K9BA 1SCIA 3O9VA 2ZJ6A 4YPVA 1IMJA 3AFIA 1YCDA 2P8SA 1XZBA 5AM0A 1PJAA 3FVRA 1K4YA 3G9UA 1CLEA 3CCCA 2GBCA 1EXWA 2ZSHA 1GT6A 3V48A 2HA2A 2WHPA 4FFVA 5ALHA 3OTQA 1XLVA 1Q83A 3VVLA 4DSZA 1UKBA 3WLAA 2O2GA 1O6FA 3IURA 4FHZA 4U2CA 5AM3A 4WFKA 1MNAA 1QIJA 4X92A 4BCCA 4Q05A 1VE6A 1ZIXA 4HTAA 1J1IA 4BRZA 4G8CA 5DNVA 1AGYA 5DNUA 5AI5A 1JU4A 2JGJA 1LNSA 5K3EA 3GA7A 4JUIA 5ALZA 1F8UA 3BWXA 4KEAA 3JW8A 2XQKA 3OM8A 5DYYA 3E1GA 2J4CA 2Q0XA 4X93A 2QKYA 5JALA 1AURA 5I8PA 4AZ3A 3D7RA 5JASA 5C8VA 4U2BA 2HRRA 4W1SA 5A7GA 3TEJA 4UFNA 3C6XA
chains in the Genus database with same CATH superfamily
1KWKA 2C54A 3IBYA 3B13B 5LQDA 3SX2A 1F8FA 2QQ0A 2XB9A 2CNWD 3ST7A 1E2PA 1XEFA 2PMBA 4L7VA 2NU8B 1VYVA 3T9BA 2WJGA 1FSZA 5U1PA 4EY6A 4OJMX 4TM7A 2I3AA 5IDYA 2JIQA 3NAGA 4RVCA 3CCBA 3WFZA 1U5BB 4RLFA 3TAXA 1AH2A 2PS0A 2JJ8A 2CHFA 2X7HA 2BBTA 2VTVA 2BDEA 3G2KA 3OQIA 4JASB 1VA5A 4LJ4A 4BCDA 3WZ2A 4RTJA 1XZPA 1AMOA 3NT5A 3Q4GA 5FR1A 5I4BA 4ZOQI 4DM3A 1YE3A 4MI9A 1UM9A 4Z86A 1QRRA 2WW8A 3G89A 4AUKA 5EEGA 1Y9AA 1PSZA 2A1UB 1F9EA 2XXBA 4MPJA 2F9LA 3R7DA 4BVBA 3IEVA 4TYPA 2XBUA 7REQA 3K6SA 3Q9LA 2CLMB 3H84A 1DC8A 1PTJA 1G64A 1DIHA 2QE7D 3VDMA 4YRKA 3LT0A 5LYJF 2XW6A 1SVOA 1NXOA 1B4DA 3U4HA 3MSXA 1VKOA 3OZXA 3DCIA 4LRUA 2VVTA 3Q72A 3UAXA 1ADGA 1BXRB 3AX6A 1EFAA 1P4GA 1TRHA 1WKCA 3D0OA 4EF4A 3WGGA 4DILA 4F72A 3KFVA 2J08A 5DULA 3JQ6A 3DCNA 3O5AA 5J59A 3A37A 1H0HA 1YR1A 4TS9A 3RBAA 4P6VF 1DQRA 4XD7A 5G4LA 3N0XA 2JAPA 1RW4A 4EZIA 4M53A 4A10A 5IG2A 3T3MB 1H42A 2BH2A 3RYIB 1SC4A 1TF7A 1MZVA 4YAEA 4BCBA 5J4YA 2O8NA 4C2UA 1HMYA 1BKYA 4ON9A 1XA4A 3ZX4A 3ZY2A 5TQ2B 3UMBA 4ZDJA 1SELA 2G82A 3H9EO 4ZHQA 3QUCA 1P5RA 5G4KA 1EWYA 2IDMA 3WA6A 1LTQA 1XDSA 2ZIZA 5KU1A 1JG7A 3GZ4A 1RPNA 4UDXX 2HAEA 3MS4A 1E9RA 3NG1A 4LZPA 2EX4A 3AETB 1AV6A 2LBPA 2QUJA 2XUQA 4O6VA 1TYDE 3OCYA 4ZQFA 4AJJA 2XKKA 4YCNA 2ZQYA 4HDRB 3V4RA 4X1OA 2K6GA 1EINA 4G9BA 1SUPA 3UJ8A 1NXXA 8AT1A 5KVSA 4K9MA 1J1ZA 3RS3A 3BMXA 5IARA 1JG4A 3EUFA 5DSTA 4QXOA 1OZAA 1I7LA 2IUUA 4K9SA 3X1YA 3DB2A 5FORA 1BD4A 1Z4JA 3N2IA 1SG6A 4HH3C 4KJXA 4OG2A 4OP2A 3HDHA 4FIDA 2HADA 1YBHA 4HQ6A 4ZXPA 2QJOA 4H15A 4KOEC 4TROA 1UF9A 3LWBA 1FP1D 2GVNA 2HCJB 2V7PA 2VYQA 4G1UC 5FUBA 2XNDD 3V1MA 4R0MA 4B3RB 1QIIA 3OQ6A 2WTXA 4KNVA 2NM0A 1TO2E 4Y9RA 1SCUB 1PDWA 5KDOA 3ROEA 3OIFA 3E6AA 4B35A 5DYGA 4B82A 2J41A 1A2KC 2PKXA 2VKTA 1RYDA 1ULAA 3LFHA 2IUSA 5FWYB 1U8XX 3QWAA 1L5HA 4MRAA 2IUYA 3VOTA 2O1EA 1FMTA 2A1IA 3D8TA 1NW3A 2GEFA 4CM8B 3ZYCA 4MUKA 3VVBA 1Y8ZA 4GD3Q 2H63A 4P32A 4TRNA 3RC1A 3W5HA 4GX0A 2I76A 4MWBA 5IYZA 1FDSA 1IK4A 1ZOOA 3ICCA 2PGDA 4CR8A 4MR9A 3VR6D 2YMQA 2EW2A 5IJAA 2O52A 2R2AA 4BFVA 2NTYC 1NGSA 2W0SA 3EZYA 1DC6A 5CR9A 5E3HA 5B1YA 5EJ4A 1P1KA 4YO7A 4MVJA 4MP8A 2PH1A 2HIMA 2XUKA 3NWPA 3T0FA 2XOEA 1OXBB 4L3WA 3N1UA 1AV7A 1FRVA 3CR8A 3WGOA 1VL8A 3RG2A 3RUPA 3ZWYA 3SDBA 1FRQA 4MV8A 4C2BA 2QSJA 2ZUDA 4YRLA 1RWNA 5KJ6A 3P9PA 4PGAA 5COBA 1HV8A 4KMSA 3STYA 5JIBA 3NTUA 3WAJA 2B5OA 3NBQA 2HBZA 1KHTA 4EQZA 1F5NA 3LPLA 5HRCA 1V6CA 5K0GA 5HPYB 2GN4A 2PX4A 4DMKA 3G1WA 2OLKA 3LY8A 1KQOA 1SHKA 1Y1SA 3O1LA 2CJXA 4Q18A 1EK1A 3SS9X 4C7VA 2H4WA 3P4YA 3DKRA 2OOSA 3FUWA 3MFYA 3U9LA 5K2MA 2CMKA 1U0OC 5HE8A 2VHCA 3U19A 1Q12A 2VAXA 5BW8A 1E2FA 3K2IA 4GPTA 4R0VA 3TB4A 2W00A 2R11A 4QPCA 1RFLA 4EAAA 3ESRA 3LD9A 1RBMA 1AQNA 2ZAMA 3O7WA 4JJIA 4MV6A 3OJ0A 5FL7A 3WLLA 4AM8A 1O9BA 1PUJA 2ZYRA 3FB4A 3NXKA 1L4FA 1YZLA 4KQXA 2JKYA 1Y48E 1WXGA 2EX1A 4KUEA 2JG3A 2F1JA 1YQ9A 1GTG1 1T5BA 1C9KA 1W0KD 4RKFA 4G84A 5EP4A 1BH6A 2H9YA 4I1OA 4G0UA 2D0IA 3L4BC 2GD6A 2VUTA 2C92A 1DSSG 2IS4A 1CRPA 1SRRA 2WWWA 5ALLA 4F86A 1P81A 4KQJA 1JFTA 3QF4A 4FINA 5ER9A 1SULA 1AM4D 1R4MA 2FMFA 3HY3A 4H9GA 1FFGA 3S70A 1ISGA 3MAGA 1SQ6A 4UMVA 1YDGA 1KK0A 4E13A 4YP9A 1T2UA 3K8OE 4Y2SA 4XQCA 2C5EA 3MAJA 2I9PA 2YHBA 4WFIA 1CLUA 5DGCA 1CWUA 1X1BA 1OLSA 2W4QA 4CQJA 5EUCA 3ZY5A 1VYUA 2VIIA 3LPMA 2B9EA 4I46A 2IOFA 4MRMB 1TQHA 2D8AA 5IX8A 3Q1KA 1P3DA 4MGIR 4EQ6B 2SNIE 2BGRA 3OX2A 5JD3A 4FU0A 5HMMA 3SBOA 2ZR8A 4QVKA 3ZDXB 4AB1A 4MMXB 1JR3E 4J94A 2F62A 2GN2A 5G2OA 2YW2A 1XK6A 1ZVQA 3KZOA 3RC3A 1PG2A 3K9NA 1FC0A 1KKMA 2DCUA 3AG5A 1P5ZB 3MLAA 5H4HA 2Q0SA 4C7XA 1J8DA 1XOIA 1PDOA 4D9HA 1IBKB 1JSRA 5HOQA 3USCS 1UKCA 1ZH4A 2IHJA 3QVVA 4UUOA 4EBBA 4ZALA 1NVTA 1NDUA 1JV2B 4IXWA 1WL8A 4PG8A 2FUG1 1B2RA 1C9NA 1HT0A 4OKSA 3V7YA 3P9XA 1E0KA 1YZVA 4N3AA 2CJWB 1E3IA 4RK0A 3T3PB 3ESZA 5ALPA 2YOFA 1JTVA 4JLDA 2E89A 2CFIA 4MLZA 1MRZA 1QFXA 2AMVA 3QKRA 4OYYA 1YRQA 3D7LA 2VNJA 3L0YA 2X7XA 3OJOA 4HPJB 2FG6C 4WKOA 4MKFA 4CPDA 2AV6A 5C8DA 1NUQA 4U2GA 4O3FA 5E38A 4XVQA 5BWOA 1E20A 5FRDA 2C5GA 3A6HA 1ZKDA 2IITA 3L7CA 4HGPA 3ZK9A 2Q8QA 1PP4A 1A9SA 3BRWA 2QX9A 3OZ7A 2H2GA 2QTWB 3QOYA 5FWXB 1ISSA 4AF6A 2BFNA 4X85A 5LFAA 1K8ZB 2B7LA 1PJTA 1X80A 4N3BA 1XJ5A 4ZV7A 5KSOA 4HL6A 3JQAB 1XMQB 2JGIA 1IY1A 1MB2A 3CO5A 4C6RA 4O2BB 3PA8A 2WKRA 3WO1A 1KGDA 3FTPA 2GBLA 3UMCA 1G17A 4W6QA 5HDBB 4XLLA 2H1OA 1GO2A 2VWHA 1KFJB 1QV9A 5JEDA 1EFHA 3A70A 4GR4A 4W5HA 3AF3A 4DRZA 1XXHB 3RAPR 4Q9IA 3EDRA 3LUFA 5SY9A 1IUPA 1UM8A 5DVZA 1H1LA 1GNTA 4LCEA 1LDGA 2VP2A 2WT4A 4NV3A 1R16A 1E64A 1W85B 1Z6QA 2DTEA 4FXOA 4R41A 3RAJA 3TMYA 3RRJA 1R6AA 3DNPA 1E79D 2H5IA 3O1IC 3FFTA 4MSUA 4ZRMA 3B6JA 4X9XA 3GRRA 5KHOC 5C53B 4EPVA 4E5KA 1QFYA 4YI3A 5DBEX 9ATCA 4DDWA 3A9RA 5KYXB 3OI7A 1SOAA 2X76A 4JEIA 3ABRB 5DNYB 1XZGA 4ZAGA 3EQ7A 2PH7A 4Q24A 1NMYA 2FCAA 1X9GA 1I1QB 4B47A 1MR3F 1SXHA 4ZHQF 1RC0A 3N8KA 5KYGA 3PIIA 4EAQA 2ZJOA 5AHRA 1SFRA 1H5QA 3F9RA 4J0HA 5C8YB 3H18A 3L18A 1SNYA 3GVCA 1T25A 3HKEB 4XEHA 5EGSA 2XGSA 3SY8A 3DPSA 5JZMA 4R98A 4X71A 1B76A 4QYSA 1OWLA 4RY0A 1FTGA 3NRBA 1P2BA 2UUOA 4C03A 5HF5A 5LMZA 1PJ2A 2M1XA 2Q0QA 1JT9A 1O6CA 4YXFA 1HH4A 4P38A 2POCA 2GZRA 4OLHA 4E08A 3AB7A 2CD7A 3K2QA 1SC1A 2WF8A 3FZYA 4Q15A 4F1JA 1JA1A 1RRGA 3WIVA 4DSAA 2AXQA 3FVVA 4RNDB 1Z7EA 3ZHYA 4KQCA 2HNAA 3DTVA 2ET6A 1Y6FA 2BGWA 2VH5R 3UUGA 4Q03A 3VKHA 3K7EA 2P41A 4WMLA 5IAKA 5LMUB 4MJ3A 1V5GA 2Y1XA 4WFJA 1GUDA 2Z30A 2ZANA 3HEAA 3PNYA 3K09A 3B1VA 3JATB 1RJ9A 1ZN7A 4CDRA 1YB5A 4KP7A 3VAZA 1DAMA 1NSTA 4IHJA 1FUKA 1HK7A 5JFTA 2H2HA 4KO2S 1YKFA 5I7AA 4AKEA 2NP6A 1OJ7A 2DJ5A 1VHLA 1P4AA 1QRUA 3ZGLA 5FH9A 1QH1B 2KQUA 1T3TA 1ZWLA 4FKZA 1CQIB 2G0AA 2GXUA 2CLFB 2WLSA 1YJQA 2OGSA 3IAM1 1XHLA 4LXXA 4W9RA 3ROFA 2D3TA 1L7MA 1OTYA 1XD9A 1MO2A 3TBHA 4B43A 1RLIA 3E2PA 2MTBA 3V8RA 1B0UA 1E0DA 1FY2A 3AFNA 4X5OA 2A7QA 4YMSA 4BLOA 2D13A 3ADBA 2ZUBA 4Q47A 2E5LB 3KQVA 4OX9B 3GOQA 3PNPA 3A14A 4FDUA 4RFLA 3T0IA 1I2CA 5BSRA 1U0JA 1R0WA 1IXZA 3EEFA 4FW9A 4M9RA 4G1FA 1W9MA 2W48A 4MVJF 5BYBA 2WOOA 3JQFC 3MCZA 2HMWA 1TTQB 2ZKLA 3PDIB 4QUIA 5FTJA 3A36A 3D2LA 1ZNXA 4U7HA 1BRMA 4U2EA 5EJ2A 5IBRA 3TUZC 3EPLA 4Z4GA 4ARSA 4JSTA 4JIMA 4DLPA 4F45A 3DFIA 2PT6A 1YJ5A 5TMBA 3D59A 4G23A 2WUEA 3GAMA 2G07A 2WM2A 2M2IA 2AF4C 4J2HA 4AIRA 3C5HA 4KQ9A 4YX9A 6REQB 3F46A 5HIMA 3JWIA 1JF8A 1O9HA 4JBWA 5EESA 4JYMA 5KJEA 4BVLA 3KPJA 1TM1E 1I2DA 1J2JA 4YY3B 4GQAA 3KQPA 1E4EB 3GJ3A 4LYHA 3MJVA 4P34A 4BAUA 1D5CA 4WQMA 3W5JA 5JSZB 1ULHA 2WWFA 1U0RA 3OFND 1XQYA 5FA6A 3F6RA 2JAHA 1L7OA 1THTA 3T5GA 3LX5A 2XZTA 1UIRA 1EVZA 2JEYA 3G88A 2R3SA 3B3AA 2PZGA 5DBIA 1M6NA 5TX7A 1PCXA 2H8GA 3FOBA 4QPPA 5HXAA 2V9PA 4D9EA 2NUPB 2V7TA 4FZ3A 4A8HA 1VPTA 1GVNB 5K8VA 1RYHA 1QIGA 1UMKA 3CNLA 3G68A 3SG0A 3L0SA 2V9CA 2O2YA 5I01A 3AJRA 3MC1A 3L4EA 2ICAA 2JCVA 1PR1A 3RQSA 2QZ4A 4AS1A 2DSNA 1Z5UA 1R6VA 3EVZA 2D2VA 3CYFA 4C87A 4EIWA 1NI4B 1NUTA 1TOAA 1XNGA 4FE7A 4EJSC 2WQ6A 1G1AA 4HB4A 2LP4Y 2I6TA 3OLXA 5K0CA 2JLWA 4J0QA 1XK7A 5AKHA 1QHSA 4R9UC 2PWBA 1U7XA 3ENQA 2R8XA 3JALA 3V1KA 4J1TA 4PQRA 1CRLA 3IPXA 3GYBA 4G5QA 1ZBDA 1G7SA 1Y1KE 1OWPA 1ZHHA 2R8BA 5KNDD 4FYKA 2VLBA 4P2GA 3RABA 4C4XA 1EXDA 2A0FA 1E8DA 1COWD 5M7EA 1L9XA 1U7DA 4JLWA 3WAGA 1GTJ1 1R9GA 3KPVA 3SYRA 1IN4A 2FPPA 4KRYA 1AA9A 2VYCA 3V97A 4LF8B 3FTNA 3ORHA 4LN1A 3G8BA 5CB4A 1Q0PA 3WTCA 3VA7A 1Q15A 1RR6A 3C98A 4KE9A 2O0JA 2VO1A 4RDHA 3LFTA 5TE9A 2QVLA 2COUA 1X2BA 5FQNA 2PUBA 1ZAYA 1L7NA 1U7ZA 4IEIA 2B0JA 5FPTA 2H07A 2CDAA 1QYWA 3E3OA 4PTYA 4RPJA 1M2WA 2I4TA 2WJ4A 5ALRA 3TWOA 3HRIA 3LYAA 4QASA 1EX9A 2C1XA 1ZINA 2W9XA 3EARA 1P1RA 5EPOA 2BGIA 5D8DA 5I9IA 1FX1A 1L4GA 2Z2ZA 3OU7A 5L8VA 3UJPA 2EKDA 1NOKA 1B42A 3B9QA 4JBIA 1E1LA 1NC3A 4WZ6A 4YDSA 3OPQA 4OYRA 3DVLA 2IIPA 3QH4A 1R9JA 3O8OB 3THRA 2X3UA 3PUJA 4LXYA 3S2SA 1EU1A 2EAUA 3T9AA 4F71A 1L5RA 3DM9B 3IUJA 2P3SA 2QVZX 4LZWA 2AW3A 4UHEA 1U28C 5BW6B 3IIIA 4UHKA 1E18A 2NVUA 2QM0A 1G9SA 1DAIA 2YR0A 3G2OA 5JPCA 1WU7A 3TECE 2GCOA 3N2ZB 3H11B 3HA3A 1SB8A 3GT7A 3WMWA 2H0RA 4BNKA 4LDRA 2YHSA 3AOGA 4EVRA 4C07A 2ZCUA 2ZR0A 2SBTA 3KSZO 2JNWA 3FWZA 1Q95A 1ZM4A 3NAQA 3RSFA 2CJFA 4R7TA 3RW9A 2P2DA 4ZCIA 4RJKA 3BERA 3HQ4O 1TIBA 1TJ4A 4WE3A 2ATCA 3V9AA 4D8TA 1XBTA 2OHHA 2LVBA 3AWIA 2YYSA 4JLKA 4FCCA 4M88A 3KJHA 3WR5A 3LDUA 2R8RA 2ZJ7A 3L84A 4WZBE 5J2UF 2KM1A 3E3LA 3FWYA 1M8FA 2X40A 4FYJA 2QG6A 1N2IA 3Q41A 3SKXA 3WYNA 4XDYA 3UWSA 1TFRA 2WWYA 2JIOA 1IOZA 1VA4A 1W6UA 3VNQA 5HQ3B 5D1HA 4CIXA 5IJZA 5JAPA 1IZ9A 1JHPA 2YIJA 2NXJA 1FVFA 4V39A 2AEFA 1HYGA 2C84A 3AT1A 3GZTB 4GEKA 4QWWA 5DHSA 2VTKA 4ZMRA 5J58A 4UAJA 3PL1A 5I51A 2XUZA 3QA3E 3VHLB 3I9MA 4I1VA 2PMEA 2QM3A 3NV7A 5CA1B 3B20A 5CA0A 1HX7A 1FS4A 4GKAA 5EE3A 3WO0A 3D3QA 4AICA 5A9SB 2CHVA 2QQEA 1IVSA 4C7OB 4DJAA 5GJWC 4P5EA 3A6LA 4YLGA 1EK5A 3TB6A 4DY6A 2YRXA 3IXLA 4OVKA 4M8IA 1R10A 4CG0A 3AR8A 3GLTA 5FBKA 2QMOA 3I9OA 1ZVKA 1NZJA 4KWEA 3LDAA 1N6NA 3F2VA 2AOTA 4XSGA 3IODA 5ALQA 3IAAA 5E9WA 2HF8A 2PX2A 3STHA 3O93A 3EULA 5TGZA 2P0AA 2Z3ZA 3L6RA 3N58A 1ZYUA 4B8YA 1KL7A 2VNKA 5H3CA 3I2FA 4I2NA 3TZCA 2BHRA 3ZHQA 5IULC 5JCZA 3WB2A 2BTEA 3BXPA 4R1PA 4DLZA 2FSFA 1T2NA 3VR4H 2GZAA 2Z9CA 3FPGA 3N2KB 4ZKEA 4ANFA 1Q0TA 3TLBA 3DGFC 3EA0A 5K6AA 1YULA 3PQ4A 2O8CB 1BWRA 3GY0A 1F6BA 5EP2A 1D1QA 1TTHA 3HWWA 4GIBA 3FJ1A 3V2GA 2MR6A 5DDIP 1YUNA 2NYVA 2A7XA 4KGVA 4LJ6A 1FMCA 4EHDA 3C39A 1N0IA 5TVGA 3HLKA 4QYIA 4ZVNA 3GFVA 2FZKA 1ZDMA 4TMXA 3TVYA 4GI3A 4DDHA 2J3JA 3VSDA 3GLGB 3OQNA 5EWLB 3LXUX 1A9OA 2J31A 3JWJA 3RE1A 4GX5A 3PDJA 1RAAA 3D3KA 1UT8A 1RYNA 4M7OA 3WQRA 5KWSA 1E66A 1LSJA 1V3TA 3KT8A 3PC6A 1U2SA 4KOAA 5DNCA 2Z4TA 1L8XA 2LE0A 3C1TA 2DUUA 2FTKE 3IVRA 5GMOA 3UGTA 3UPTA 1BFUA 4B7CA 1UK9A 2EGHA 5ITVA 1CUUA 2EBWA 1P6XA 3IULA 1FTNA 3OY2A 4RF3A 3FHCB 1YZKA 4GLOA 4DLRA 5BNTA 1DLJA 1IPEA 1Q20A 2CJPA 2OCKA 5GGYA 4A2WA 1JT2A 4NYIR 3MGGA 2BUCA 2GCIA 1XU9A 4BLWA 4KQIA 4F9FA 3KKPA 3ZI4A 2AUMA 1F2UB 4UM8B 4E32A 1RIFA 2IH4A 2RIRA 5AXAA 1STOA 3EWSA 4KPYA 1Z68A 1CR4A 3VZBA 2BRUA 3RFCA 4JYZA 2Y67A 5A2QA 1P1HA 1VXRA 2VCYA 3MJRA 3LHIA 4JL8A 4NU6A 2XMRA 3RYCA 3FOWA 5CURA 2YS7A 1DKNA 3GGCA 4I99A 5FADA 3RROA 4ZK6A 4UFOA 1G38A 2A9VA 2OXTA 3VC2A 3JYPA 1XCGB 2EP5A 2JLAA 3BMOA 3C41J 4K26A 1O6GA 2OB2A 3W9BA 3QTTA 5IJ9B 4ME6A 1X6VA 3Q7IA 3NJ4A 1AO3A 4Y8VA 2A57A 4XTRA 2FWPA 1J2EA 4I1PA 1T9GS 1HORA 4PYMA 1V7QA 4EI2A 4YMGA 3FZGA 5KO2A 3RKSA 4B6PA 3DVAA 2FEWB 2MSLA 1R5BA 4YUVA 2F4NA 5AK4A 3SXUA 2ZSUA 4NZ9A 1JHXA 5BQ3A 2ASEA 2ZT5A 1ODIA 1FNCA 1TYAE 1Z4NA 3A6KA 1LLCA 5CIWA 1B23P 4OY3A 1JHYA 1M2KA 1M83A 4JBXA 2DUWA 2B3DA 3WP1B 3I5UA 1JR3D 3HBAA 4ECEA 3W8DA 4MRSA 3Q8MA 1QG0A 3JR7A 1G20B 3CO0S 4E51A 1C7IA 1ZN8A 2XADA 2Q4EA 3A1WA 3AU8A 3Q5DA 1H23A 1M2VB 5MFPA 2D3WA 4BU0A 3OX3A 4NKRA 4FJ0A 2OK8A 2WYHA 4UATA 2FZLA 3D1LA 2NVWA 3F7MA 3V5NA 4DABA 3UPDA 4RU1A 2EW1A 4RH3A 4ZO6A 1LF0A 4ARCA 3UTCA 4DR7B 1Y8RA 1LPSA 1O77A 5DJ5A 3ZJ5A 3F6PA 1S2LA 2OO3A 2P6NA 3IBSA 4PFKA 1QYDA 2OKGA 5SZJA 2FA9A 4HNGA 3FKSD 2VP6A 5IM4F 3II6X 5EUQB 4IX1A 4FFSA 4MS3A 4YRCA 1Y1TA 2AI3A 1YBAA 1XL0A 4MUFA 3D8SA 5HMLA 4LOJA 4WPGA 1UBOS 1JAIA 2YJNA 4G5RA 2F55A 4RHYA 3W3AA 4FR2A 5A3SA 4LCBA 1H2EA 1AZSC 4DZRA 1UBLS 5AVJA 1OI3A 3BQNB 1K0UA 3WX0A 1H2YA 4DADA 1OSNA 4DQUA 1JEOA 3ESYA 3FSGD 3IE2A 3MPOA 3QV1A 4IQ8A 4U2FA 3NHAA 5AI0A 5CFPA 1JIVA 2XKBA 2BSAA 4FN4A 1FRNA 2V6MA 2FGKA 5DN6A 4UUAA 5JD5A 3CSUA 2VHUA 2WFLA 3X2FA 2PLAA 1PJCA 2Y4NA 1NLUA 1QYVA 3DDZX 4KYTA 2H8KA 2PYIA 3V8BA 1EI9A 2QUZA 4BMOB 3EXFA 2HO4A 1JSXA 4BBZA 4LJLA 2XMSA 5JROA 1PGOA 2HV9A 3R6TA 3I58A 4PZYA 4QTUB 1TADA 3DMGA 3LCRA 1PFGA 4ZQBA 4BNGA 1TZJA 4BZWA 3LDHA 1FFYA 2KBEA 2Z95A 3PFBA 4DG9A 2YOHA 1RE1A 2ZSEA 3B6IA 3N6RA 1UFVA 1X86B 2ZVDA 4IWYA 2IA5A 1CG6A 2FE4A 4XAQA 1UDWA 4P3OA 5CMLA 1TKRA 3U1BA 2J6HA 4PG5A 4ALIA 3M4YA 4OHKA 1GZUA 1LLQA 4F2HA 1XCLA 2QN8A 3W1EA 5D3MA 5FPSA 4RPHA 2BEWA 3VQTA 5INTA 2O2EA 3KSBC 4QU8A 5AUNB 3V1NA 1EK6A 1NF8A 1PFWA 4JY7A 4QIHA 1RQ2A 2R60A 4X91A 5D5HA 2DWUA 5EJIA 2FPRA 4HD8A 4LSMA 3WQQA 5AW6A 2BHTA 1E7MA 1M2OB 5DHTA 3ZWDA 1WB6A 5MGNA 2JARA 1OX4A 2VNSA 1CYEA 2GRAA 2YOGA 2XA2A 4ENQA 2A5GA 5KDDA 3EDCA 2HXSA 3TL3A 4OU4A 2J6CA 2GH1A 4CGYA 3DFUA 3PRHA 5JRJA 2WPDA 4ZYTA 1R8XA 5B57C 2A92A 4H7KA 3UHOA 2XTZA 3VNAA 1O87A 3G9QA 1OF1A 2PEYA 4DV6B 2C1ZA 1Y3BE 2TMDA 4HNVA 2V59A 3H5VA 4P8RA 4URHA 3DOEA 3KC2A 4DMRA 1H2HA 3NNNA 1RJDA 3OE5A 3W6ZA 5IH7A 2WTUA 4I14A 4M86A 2AGVA 4X8OA 2P9QA 4KXUA 3EXHA 2B82A 2ZBDA 4QBFA 5IYZB 1B0ZA 4DM4A 1GU0A 2PIAA 5GV8A 1SUEA 4BYGA 1TEZA 1ODTC 5LUBA 1ZN9A 3MCTA 3OQPA 1HDIA 1W49A 3S8YA 1SXQA 1SH7A 2GVDC 4EECA 1QTQA 1CUGA 5DGTA 1J21A 4OMUA 4ZO8A 4BLQA 5LOVB 2HIHA 3ILVA 4YRTA 1YBMA 4C6HA 3KZMA 4UNQA 1U4OA 3DE3X 5EZ6B 3QSYA 3H0EA 4XUGB 3GFPA 1SU8A 1Y4ZA 3G5TA 3VR3D 4LBVA 1N1MA 5CVEA 3OE7D 4OQXA 4A0SA 2CMFA 4V0MA 4EY4A 4EW6A 1NNSA 1KEZA 5CXXA 2VNHA 4UCFA 4XYMA 3VO9A 4HB3A 4KRXA 3R75A 3H1TA 4JJZA 2V4ZA 4A2PA 4C7KA 1UPBA 4F84A 3MFQA 1VBNA 4RGQA 1SUDA 4JJ4A 4LVUA 3HUFA 4MLDA 5KYWA 1FP4A 1W2HA 3PNSA 5TJHA 1YZHA 4EG5A 3EYWA 2CZGA 4P86A 3QELA 2EQ5A 4Y2GA 3A6DA 4QSHA 4Y9TA 2PNJA 2AOVA 1OREA 3SBXA 5DI3B 4Y9SA 2BV3A 3OEYA 4XZ3A 2GDJA 3BN3A 3OIGA 2IZ7A 3TGWA 3GFRA 2V55B 1GTVA 3MF4A 4JI0B 3TUJC 3QITA 1TK2A 3IERA 4OIMA 2Z04A 2P9TA 1BXKA 4P1ZA 2HPAA 4BV2A 5KC9A 2JFFA 1MV5A 1KTIA 4PGFA 2R6AA 1XTQA 1RM4A 1XRPA 4X94A 3RUDA 1X74A 3FM9A 5E0OA 4JLMA 3TEMA 3ZUPA 3IT3A 5KTNA 3P9KA 1I6LA 3ZWQA 3PJDA 1FNNA 4OV6B 1W4ZA 1YHYA 2P3QA 4M1QA 3ZJVA 1B3BA 4ZWNA 3T15A 1KO8A 4DNFA 1ZO8A 1I0LA 3F97A 1I0ZA 1NP3A 1Y7PA 3GCGA 3VDQA 4CMHA 5EHZA 4YBZA 3TW6A 4O4HF 1QV7A 1YQUA 2HL6A 3H1PA 4AJOA 1GWNA 1DADA 1IDN1 1U7PA 2FE1A 2JRCA 1DJPA 4J43A 5HGJA 2GEJA 2HIGA 3DT8A 3MGCA 3R5HA 4C4OA 2OV8A 4CTJA 1NR1A 1HE4A 1Z33A 1CJCA 4N39A 2ODNA 3FVTA 4GKVA 3SZMA 1NKTA 1J8VA 3ED5A 1T1JA 4JP8A 4CCYA 2Y6UA 1QANA 5JSFA 4ZCMA 3BMQB 4YJ2A 3M6FA 1ZUHA 4F3RA 3UK1A 2I1QA 4EHBA 1U8TA 2JHGA 1F51E 3KQMA 4WKBA 4Y9DA 3GLIE 3WNZA 3SQNA 5C1BA 2VHQA 5L4SA 3IA2A 3ML1A 1J8YF 4TL6A 4BAZA 2EQAA 1C3VA 2XV1A 3CEAA 4WK4B 3RSHA 2QD2A 1VQ1A 1QO0D 3KSDO 4QJ4A 2PEZA 1V3VA 4I1RA 2OESA 5AWFC 2J9XB 4PC6A 4UBJA 3DW3X 2J32A 1DWQA 3IDFA 4NBRA 4XGIA 4E6EA 5DE3A 3RSLA 1XLTC 3GRVA 1JN0A 2CHQA 4QA9A 4MPDA 1U2QA 3D2AA 3IP9A 2VDKB 1NR5A 3FMGA 4UQOA 1HWYA 2DQYA 1WVGA 4M54A 4PX5A 3N7AA 3ANXA 4Z0NA 2FHSA 5KTMA 1OB2A 1U6IA 3EXG1 3SK0A 3SIWA 5A3QA 1RTTA 1OFGA 2IIBA 2CL5A 2W2NA 2WG1A 2C99A 3KHKA 4ND6A 3AB8A 2BBOA 4H2DA 2CYCA 3FBGA 2G9RA 5F1PA 3NZEA 2E4WA 4GEGA 5J4KA 4EITA 3BORA 3QWHA 4Q6WA 1VMKA 2JBAB 3ETEA 1N4DA 1OV4A 4TV8A 2PGJA 3EEQA 4LRTB 1LLFA 3TG8A 2IY7A 2FEOA 3FDZB 1PYOA 2OGTA 4BNUA 2C5FA 4CQMD 5JAUA 4MUEA 2NPIA 4IEFB 1PZNA 1ISHA 2D2EA 1JDNA 3LWZA 5HUQA 1AUVA 2IXGA 5A04A 2ODTX 1NVBA 1R15A 2GJ8A 1FU7A 2V7EA 4KHZA 1ZD2P 4WNIA 2NYAA 3DXXA 4GMFA 2YIMA 2EXXA 4JJAA 1ZOIA 3KBBA 3INGA 2WIGA 2QROA 4XUCA 4E5UA 4RXTA 4F5WA 4H1UA 4OHWA 1UDCA 3SXPA 5A5FA 4EEXA 1M5TA 1W4LA 3EZNA 3D0QA 3N8IA 1Z6XA 4LAFA 4MCAA 5ESDA 5AXCA 4CTKA 5A9SA 1OXTA 2X0JA 4WOCA 1TIPA 4P0PB 4Q39A 1GQOA 1E96A 2HBYA 3AKZA 1ZI9A 5I8ZA 2B6NA 2HWKA 4MWSA 1OZGA 1SD1A 2G71A 1LQUA 3O8QB 1C80A 2Y4OA 4UE3S 3U44B 4CNQA 2ZEJA 4OXQA 4EATA 3ZVKA 2DWPA 4QXRA 5KOYA 3R5KA 3U62A 4RKQA 5LP6A 5AR1A 2XCTB 1R00A 4L22A 1AF7A 1RQPA 4C3VA 2OPHA 3U61B 3MUEA 1YS7A 2Z5GA 3D9QX 4FBLA 1QV6A 5ALSA 1Y80A 1U2EA 1YONA 2WB2A 4Q3BA 5JJBA 3K8ZA 4QRHA 2ASVA 1KAHA 2GESA 1VHDA 4N7RA 5JCOC 3BAFA 1V7ZA 3D8RA 3RSQA 1PUXA 3OTIA 3TIIA 1AUXA 4R16A 4G0YA 4QOSA 4GDMA 4F8EA 1ZR4A 1FTYA 5K0JA 4LVOA 4E5VA 2PXXA 4AJPA 1WCIB 3DVSX 1GITA 3NDRA 3LZDA 1ADYA 2J5QA 5BWNA 2VZEA 3WBFA 4AY5A 3MERA 1T4CA 1EXNA 5HKKD 5CDHA 4IIFA 4JKIA 3OLYA 1VXOA 4EARA 1MAAA 2W5UA 3CBGA 1XROA 3AQ4A 3GGGA 4MS1A 4GE3A 1H9BA 2CLKB 4GBJA 4IPTA 2A78A 3EOZA 3RHSA 2FW0A 4D8YA 3AEZA 3DFKA 3HNRA 3KAJA 4RPCA 1EZ1A 1BDMA 2C5SA 2X5OA 2XXJA 5CJJA 4MB2A 4BECA 1SCKA 1DCMA 1U6JA 5I4CA 3E5MA 1NMQA 1AHIA 1M72A 2I6FA 3OQOA 1QGED 2EKLA 1KFEB 4II3A 1JEYB 1AJEA 5T41A 5BNWA 3FZNA 1H8HD 4K81B 2JGFA 1DJOA 5CFRA 4FFWA 3M70A 1DKQA 1DMSA 2FZWA 3IFSA 4FPXA 5DWQA 1D09A 4G5HA 1OPXA 4RESA 1X1DA 2CFSA 4HWOA 3WMGA 2IP4A 5C5IA 1SU6A 1SVUA 1DHTA 2AJ8A 4UC0A 2HREA 2X9QA 3JRWA 2I6QA 3FDJA 4IRMA 2BEUB 3ZDRA 1TVKA 3COYA 4PLHA 4CLEA 2JF0A 4PYRA 2F3SA 2SCUB 4YQZA 3ZW8A 4B6JA 4M2LA 4RWZA 4AMUA 4HXYA 1GQ2A 4K6FA 2QL5A 4IXNA 1IJFA 2VXOA 4A03A 2V97A 1E98A 3I9JA 2GARA 4D92A 4LNUB 5AUQA 4CLDA 4LF9B 3OE7A 3GRZA 1E99A 3L6EA 4MWGA 3MTEA 3RFXA 3MTQA 1ZH8A 2ZSDA 1URPA 4HS9A 4TKUA 4RSGA 2EDAA 4JI5B 5KNBH 4N48A 2Q9CA 4OB7A 4LKRA 5ALUA 1F0PA 2FZEA 3ZU6A 3ENNA 2YJ3A 4TWAA 4D4HA 4DCPA 5T4HA 3PHBE 3TPZA 2OZLA 3UV3A 2F1IA 1TVCA 2P30A 2HMTA 1TK3A 2AHOA 2VQDA 1KE1A 1CUVA 5IXYA 3NWBA 1R3DA 3JQBC 3CF2A 1OH8A 2P2SA 2OCDA 3PKIA 1BEZA 1K08A 5ARDA 3E27A 2QX4A 5GWXA 4DRXA 2ZROA 4Q82A 5JFOA 5LVAA 4XYBA 1TF5A 1HT3A 3L7YA 1C30B 4FNAA 3O94A 4X63A 1YS9A 4X7PA 4F1KA 1U7HA 1V48A 2GAAA 1FFSA 2O2CA 4XLTA 3IEIA 2C57A 2XB2A 1QQ5A 3KU4A 3ND5A 2Q62A 5IPFA 1WBJB 2OBMA 3R77A 1RRFA 3OPYB 4OFXA 2BKXA 3TSCA 3FGNA 1VOTA 2ESRA 2IU6A 2XDQB 2HDHA 3KYIB 3MOSA 3FXAA 4UUMA 4D26A 1WXHA 1N2BA 3H5WA 3EEYA 3FDFA 2GD2A 3H8VA 3QEMB 4FKBA 4H77A 4KK4A 4ZAVA 1Q77A 4MW4A 5AVKA 3NYIA 4QGSA 1NVMB 1GNVA 1ZVJA 2VPIA 3N2YA 4H7PA 2C3MA 4I5GA 3X1JA 1UOPA 3VM6A 1OH6A 1LPBB 1II8A 1HZZA 3R7BA 1Z0FA 1IHDA 3G0GA 2Q7OE 1HNWB 5CPFA 4BWGA 2WP8J 1VFNA 1L5MA 3FWHA 4BZPA 4C7JA 5BVHB 1PEKE 1V9LA 2D62A 1XQ9A 4LDZA 2G6TA 2FKNA 1J9GA 4KTTE 1QNLA 3H9CA 3DZGA 3DBOB 3UWOA 3QVGA 4TMVA 3OQHA 3N5CA 1UMCB 5ALVA 3KS9A 1Q7EA 2V03A 4PO3X 4YJ2F 2QIOA 2GLUA 2EERA 3OT1A 1GSIA 3IP7A 4G67A 1N2CE 4GQBA 4UVEA 3FETA 3UXEA 3I92A 2X13A 1WMSA 1QYCA 1E6MA 3GJ8A 4N0QA 4B87A 1J99A 3FUUA 3OPNA 2WJJA 2HTEA 3IVAA 3BDVA 4DDKA 1RKVA 3F2IA 4GMXA 4TVKA 2Q1YA 1Q11A 5K3BA 1YUMA 1IEXA 3EPHA 1Z4MA 4NV0A 1J2UA 3RK1A 2DWOA 2GYUA 2OD7A 3CH7A 1E6UA 1S2DA 4LRWA 4YBRA 1UDAA 3ISVA 1KEEB 3L79A 3BGDA 3OKFA 2VDQB 1G4UR 2DQ4A 2RJOA 4MS4A 4PS1A 5KOIA 3ZD6A 5LZ5A 3ITEA 2IYZA 1WZNA 2FJ0A 3E84A 4LDPA 3N8DA 4BNVA 1PEAA 2Z8ZA 2QN7A 3OSZA 4D4GA 2QNRA 4E3WA 3ADCA 1Y7LA 2QLNA 3F78A 5K8JB 4ZAFA 2VDPB 1KRHA 2XMBA 3MIZA 1QZTA 3CLKA 4DYDA 3R5XA 4ZPJA 4OQLA 5G0TA 5IS2A 2EQBA 3R24A 4H0NA 1FYDA 3LY9A 2NVUB 4CF7A 1G9TA 2QRJA 3DAYA 4RVFA 3EISA 3EXEA 3TCXB 1Q2UA 5EXDA 1YK0A 4QICA 4HFNA 1DCTA 2XXAB 2RBEA 1Q14A 1DBWA 1SVMA 2QE6A 2REOA 1C3OA 3VXKA 4WHMA 1KR2A 1JNXX 3DD1A 4Z7NB 5E6SA 2PGLA 4G8JA 4TKLA 5B4UA 2ZRHA 2HJVA 4NL4H 4YRBA 1ABBA 1SVIA 1GD1O 1Z56C 2C82A 2W6CX 4J9UE 4QDUA 3DZHA 3LGSA 2V8OA 4FCWA 1IAVA 4ZT4A 2OFFA 4WXPA 3O26A 4QBIA 4BRSA 3AKDA 2YC2C 1CS4C 3GOHA 3TLZA 3VI3B 4QARA 1DOAA 1IY8A 1IHPA 3PCXA 4ZMSA 1W88B 1A71A 1JDPA 1JQ5A 2PA3A 1O94C 2QI9C 2FETA 2BEVB 3NUQA 1TYEB 5DX0A 4I4TB 3D3JA 1RZVA 4QBTA 3T6KA 3R4CA 4MICA 4UOQA 1YOVB 4WY5A 5EP3A 1MC5A 1GGNA 4LXQA 4X7RA 3FA2A 3NVAA 4FQ5A 3SOPA 3LO8A 4CT5A 4LSGA 3DONA 1L6IA 2IIQA 2BFPA 2ZWIA 1A2OA 3MRVA 4LRYA 3FJYA 2NSDA 5G1NA 621PA 4N41A 3B8HA 3UKDA 3CLRD 3NIBA 1CUSA 2HPHA 4XCQA 3WKDA 4AMBA 2PANA 3PUYA 1JPVA 2WZBA 3WK6A 3JWEA 5TS2A 5LP6F 1EWKA 1TB4A 3O2JA 4WESA 1K7YA 2I5PO 3SQOA 4AUMA 4P4SB 3O8RA 1TUBA 5HTKA 4BMPB 3CT4A 2OAGA 3U4QA 4BFSA 2C97A 4PZ0A 3T4PA 2JJMA 3RSCA 4NOKA 3RVSA 4EUHA 2B20A 2ZJAA 4JT8A 3TXAA 5DNDA 4D46A 5GJCA 4LWPA 4M1YA 3H0CA 4WY2A 1PRYA 3K0BA 5J1SB 4L4SA 5M04A 2OAQ1 4EI7A 3ND8A 3K8YA 2GKSA 5CW2A 2ONJA 3AEQA 4AURA 1DUSA 3IUSA 2BD0A 4D79A 5HKKA 4LGCA 1BTOA 2JH8A 4HX5A 4R2IA 2KW5A 1DTWA 3RRNA 1PKEA 3ZXIA 5AO9A 4TN5A 1HNNA 3GU3A 4M8KA 3WGIA 4Q9AA 1SZCA 2RH9B 3HKDA 3AESA 3EWNA 2I6SA 3GA5A 4ISBA 5TARA 2MYPA 4ZREA 4C6TA 4EY7A 2O0MA 3H9GA 4P3PA 1C29B 2BEKA 1P8JA 5LZ7A 3DWIA 2J3KA 4P81A 3R3VA 1X0VA 2OP0A 4Q1FA 4O4JB 2XDWA 3LXMA 3W5VA 4RHTA 16PKA 4ZT7A 1K88A 2PG3A 3FSEA 2OBBA 3BE8A 2GQ0A 3B85A 3GVPA 2IUTA 4N0EA 3FOAA 3DE5X 2DPLA 3HTXA 1UEXC 5K3OA 3D5TA 2HCRA 3ZCUA 2PS9A 3M8KA 1SCDA 2HFKA 2GPTA 2JHCA 2P4SA 4B76A 1B93A 4MI1A 4DGSA 3AH8A 1TEXA 5JFGA 2Y1LA 1CFZA 2NT3A 4DJJA 1Z63A 4EB8A 4DQDA 3U40A 4KXMA 5EUMA 4AI6A 3TLJA 5KNCH 1PU2A 4H0CA 1NV9A 2YV5A 4JSRA 4IILA 3ZNQA 5JJIA 3NOXA 1JSLA 3HP1A 4CTOA 5JCXA 3OAAD 1SCQA 2RI0A 3DKVA 3EZLA 3KDPA 3E7PA 4OK3A 5A9RA 1QFSA 5L95A 1MA0A 1AMNA 1XZ8A 4OUKX 4UJ3A 4ZYVA 2PL9A 4ZYUA 5DM4A 4CM5A 2NADA 1GPYA 3H1AA 3WGZA 1II0A 4BQIA 2H9IA 1B0PA 1K89A 4D97A 4LK3A 3PC7A 4DB4A 3LHKA 4COKA 1GL6A 1CEYA 1WSWA 3CR3C 3L4SO 2IYWA 5E7MA 3G8AA 4U0KA 4H1HA 4DUGD 3ZDCA 4FMCF 4KN5A 4JA2A 1X7WA 2LGJA 3E7DA 4HB2A 1AY0A 1H05A 4N8EA 4ZAZA 4LHZA 1YI0A 5DHRA 3WGUA 2P6PA 2R4UA 1KO5A 1PEDA 4K9LA 1PT7A 5FLYA 4CR7A 4MW5A 3QE2A 4L9SA 4DJ5X 3OURA 4UMDA 1E1NA 1QVAA 2Q5EA 1Y6RA 5EXSA 3LP5A 1XEWX 1HPLA 3PC4A 1T4MA 3N2GB 2JIRA 5EJ8A 4NU8X 3AVOA 1BXZA 3W4IA 4BQNA 3SM3A 4EDHA 2DSTA 3P0EA 2NZ2A 1QU3A 1CEEA 2EP7A 3I6ZA 4BO2A 1CR0A 1KYVA 3PC8C 3T7RA 4IXDA 2G7ZA 3RVPA 2OMKA 4ILEA 2BF7A 1WBBA 4K1LA 2RARA 2A35A 2Y93A 4MA4A 3GLRA 5GONB 3DDUA 4Y1EA 4YMHA 1XV5A 1VHWA 3SF0A 1I51A 2HH9A 2CVQA 2P27A 4ZDKA 4CXMA 2FR8C 3UXHA 2XEXA 3CJTA 5CVJA 3FHLA 2QM8A 3GC6A 3ANYB 5A7HA 3LMKA 3QU9A 1PWHA 1TQ6A 4UPVA 4MTCA 2CVOA 4F3TA 2WKWA 3BIOA 3PPVA 2V1UA 1CCWA 2Y6VA 3ZHUA 3L5KA 2OC4A 1ZK2A 3AUAA 1L8QA 4V0RA 2X1HA 3NWOA 3MLBA 3NLLA 4CUKA 1Z2CA 4CT0A 3QYJA 2FMXA 2OOKA 3I01M 5JZOA 3LWNA 3BL6A 4MLCA 4BKUA 2CNNA 5LIPA 3WI7A 3D1JA 5T5QA 3NHMA 2QTZA 4NDAA 2FPGA 1US8B 4ETNA 4LJ5A 1JVSA 1PFYA 1RAIA 2VXBA 5CX4A 3BZUA 4OHYA 1KVRA 2V5UA 2FU5C 1YR8A 4B85A 3QG1A 3NORA 4BIIA 1FRZA 1VRVA 5BR8B 2C9ZA 3ZBPA 2R1UA 1C0KA 1W2GA 1X9IA 3KT6A 3ZD7A 1XPUA 5EHQA 1FDOA 2Y0BA 5FBLB 4FMDB 4BP3A 1TEHA 4E2XA 4BEJA 2OYCA 4N7JA 1G2QA 1KC3A 1Z0UA 1XVUA 4DXHA 2VYVD 4II2A 4YQYA 1E2IA 3CKKA 1G6Q1 3UWPA 4IMPA 2RG7A 5ESWA 4OXNA 5BV1A 2FWBA 2JIBA 2OV2A 3ORRA 2OD2A 5BQ5A 5AW8A 2EC5A 1NRXA 4DSTA 3GJTA 4RF4A 1FMFA 1KQPA 1HDXA 2QTVB 1JGTA 5BN5B 2N1BA 5DXAA 5JXJA 4MQ6A 1XTKA 2GETA 1RFGE 5LB2A 4CU2A 3JZMA 5FP0A 1DP4A 3ESAA 4LBWA 3ZNNA 4AG3A 4DLLA 1U8YA 3HSYA 1IU9A 3L6DA 3UJ6A 4E3ZA 5BT8A 5LDHA 2YHAA 3LBIA 2JANA 3ZTWA 1SPBS 1ZJYA 1Y6ZA 2VATA 1CJSA 4IX9A 3MMXA 3D02A 1FL9A 1EFDN 4ZO4A 1FDWA 3CVXA 3OEEA 4Q4LA 3OQVA 4EJMA 5J2TA 2ZGVA 2OWEA 3IR7A 4UM5A 5HG0A 2Q07A 4KE8A 1T9DA 3IELA 4K9KA 1T6BY 4TZ6A 3ND6A 4DLUA 2CNBA 2I8LA 2OL4A 2H11A 1ZL0A 2ZM5A 2O5EA 1HFWA 5BUQA 5JOQA 3RHFA 4FUTA 4C06A 3WSTA 1QE0A 2FW9A 2BDTA 4BLTA 5I3ZA 3QVOA 3H4MA 1EJBA 2FK8A 2K7ZA 3MWDB 4G5GA 4MYCA 4AKHA 1V5WA 4PAMA 4US2R 5B3AA 1R8SA 1W1IA 1QTNA 4PRZA 3ROMA 2V74B 4YONB 5JARA 4N1AA 2XYQA 1GTL1 3GGDA 1I13A 2NPOA 3KLPX 3HO1A 2XE8A 3GJSA 3H3XA 3QTBA 4DL9A 1EX7A 2G1KA 2BI4A 1TMGE 4GT1A 4JAVC 1P1CA 2R9VA 3IUEA 3VR4D 2FCRA 4DJTA 3OCXA 1SCAA 3B1ZA 1OFHA 4ESHA 3TSZA 1EHCA 3HBMA 3UFXB 3BFKA 4B3GA 5JAHA 2PT5A 4RIHA 4YT5A 4YT2A 3MB8A 2YWBA 4IGKA 1OTHA 2PX3A 3IJEB 2QVBA 3R7WA 4I1SA 3LY7A 4OKIA 1G5TA 2HMYB 2B4RO 4RKYA 3BCUA 4WINA 5EXTA 4JXZA 1GLGA 2QUBA 4NABA 5FOTA 3KQKA 4G63A 4CQNA 4PIPA 2HUPA 1BWPA 2ODPA 1PK8A 2WQ7A 2JEZA 4PW0A 4YRPA 1MABB 3KDAA 1BDJA 2Z2JA 4HAUA 5REQB 3ZHZA 4ZI7B 2WWHA 4OI2A 3TEFA 1NM5A 4MK4A 4AZWA 3WAKA 4LX8A 1E5TA 1IOLA 2P79A 1D7AA 4DV1B 2CHEA 2WWGA 2IX3A 1KS2A 1AUOA 3IR5A 1UC5B 1WUKS 1CDDA 3AIIA 2IHKA 3DFZA 4Z5XA 4HDSB 1P0CA 5D51S 3RUIA 2C2WA 3WSWA 3KALA 3ZWKA 2WMYA 5CG1A 5E2IA 4A5OA 2UXBB 1DT3A 3HB1A 2CDNA 1OC4A 2QGNA 5AYVA 2QL6A 2WI8A 1KRWA 3GRYA 1FFCA 5DX8A 2VSQA 1XHEA 2ZYUX 1KU0A 1MH1A 3CKYA 4PYOA 1GNPA 1EZZA 3K35A 3C6YA 3LQ4A 2J1LA 4XPIA 3VYVA 5KOJB 1A88A 1VPWA 2I9KA 2B6HA 1ZI6A 1WEKA 1EGQA 1OH7A 1PNTA 3AF2A 3FNQA 3RRXA 1ZG3A 3P26A 3CG0A 4WUTA 3SN6A 3KYDA 4A73A 1A4IA 5IU6A 1MKYA 1U0SY 4JP5A 3GK3A 3TJMA 2KJQA 3QKUA 1QYRA 1Y6GA 3SP1A 3PDCA 1MC8A 1ZJZA 2GAOA 3QU7A 4JL5A 3GQBB 2AG1A 3DMYA 3FTQA 6Q21A 1I4TD 5JS1A 1VKZA 1XTPA 1YZTA 3BWCA 3RSGA 5I5GA 3TIFA 1Q1EA 2PBLA 1JJIA 2O2XA 4PBSA 1GPBA 3I8SA 2WSSD 1CY8A 2ZW9A 5JO0A 1NE2A 4BQRA 4EY5A 1RXWA 2ZJFA 4ZZ0A 4OGFA 3WKAA 4MPRA 1MOSA 4MQLA 4KREA 2JLRA 3BB3A 4GXTA 1NDHA 2UZ4A 4XSHA 4OLFA 3K16A 1P9WA 2QA5A 3SIRA 2NUAA 3TLKA 4GP7A 5BWLA 4NZZA 2L2QA 3D3EA 1EUCA 1X19A 4H7EA 2AVNA 2PXCA 3D4BA 5FV7A 3VYTB 2A58A 4CCAA 1PZEA 1Z7WA 2G06A 3BYZA 4J7XA 5LQSA 2GS9A 2R85A 1ID1A 1XO1A 3Q10A 3WRYA 1VDMA 2QT1A 4MQUA 2AFIA 3O7MA 3QVMA 3BQ9A 5BVGA 3A1NA 4PAGA 3IIMA 3U4CA 4MV4A 1VP9A 4KQEA 3D6JA 3JS5A 4CCYB 2Z1DA 1W1WA 3I2JA 2BTQB 4H6PA 2HRZA 3FTDA 2TS1A 1Z0AA 3BL5A 2OYRA 2LZ0A 1QF9A 3UOAB 5NULA 5AW7A 3G2JA 3KHUA 1NE7A 4P4GA 4Q7JB 2YTZA 1HFKA 4GLLA 5FFNA 1FYVA 2W2TA 4JJKA 4AFNA 1M5RA 4YJKA 4L3OA 4S2UA 5AQEA 3IDOA 1ITZA 4OAQA 3SEZA 1FUIA 4DUZB 1E7RA 4LX0A 4Y6OA 4V0OA 1WUTA 3P45A 2IXEA 2J0SA 4QJ3A 1EJ2A 2YJ4A 3C1UA 2VHZA 1PQUA 1NLFA 2BGLA 4J9VA 1X9HA 3HH8A 5IAJA 3SAJA 2H52A 3WQSB 4DPMA 3HLYA 3A1VA 2DH6A 3W2HA 2HFJA 5HKAA 1XELA 2ZRDA 2NU6A 1V41E 5TPWB 1BX3A 3TRFA 2J07A 3DOHA 4EENA 2WG0A 4M55A 4NS1A 3V2UA 1C1DB 2O2DA 4HH1A 3VPGA 4Z54A 1XPOA 3H2IA 3EBLA 2WYVA 4N01A 1PJSA 4E12A 4EB6A 4QD3A 5F4BA 2QBYA 3D6TB 4TXNA 1VHJA 1Q16A 1OU4A 5DHQA 2V1XA 1Z22A 2ZAYA 1V11B 1PG0A 5FLXA 4L5BA 4TV8B 1IWBB 1ID8A 3L9XA 2JJ1A 1ZLYA 3GAFA 3KXKA 2FMHA 2CE2X 1EWQA 2LKDA 1PT5A 1XRRA 4X6UA 3RS8A 3H6GA 5JO9A 2CLOB 1DRVA 3A6JA 2ZBVA 1JXAA 4HY3A 4GXQA 1BDBA 1E9FA 3PR2B 4MW2A 1EP9A 1OBVA 1SPXA 4WK0B 3CWZA 3U9TA 5A2GA 3AP1A 6GPBA 2C2ZA 3SZRA 5GJBA 1I2BA 3QHQA 3B52X 1Z0KA 2C98A 3OPVA 2O7QA 2H0AA 3B38A 2NZUG 2YRFA 3RWMB 2PYDA 5ICCA 2D2XA 2DTDA 2QR3A 3QY0A 2EARA 2B8TA 3O83A 3SEFA 1WZ2A 1U3WA 1BKDR 2YWEA 3UATA 1YHNA 2Q4OA 2EKZA 1D1SA 1I5OA 2ZT6A 3B5EA 3EYAA 3L93A 2ILVA 2Z56A 1Y1RA 2FEMA 1Y5IA 3QE3A 2JA1A 2P7IA 3C8ZA 3E3NA 3QP9A 1CDOA 1Q0ZA 1JKJA 1JBQA 1EDDA 4O2RA 3G1UA 4FFNA 5EQDA 5ADWA 4BV9A 5K4GA 3U6BA 1KBOA 5ILQA 1TTTA 1DXYA 4Z6KA 3STXA 1WM1A 5B1EA 1YR2A 1WU8A 1K98A 3JZFA 3WADA 5AVYA 4BUZA 3QX8A 1N6KA 2Z9DA 2WWIA 4QOGA 2QTMA 1OXMA 2IC5A 2Y1WA 3QYAA 4J91A 1R0RE 5SICE 4J0KA 5J2TF 4X1IB 4PXYA 1UWVA 2XNCA 1IE3A 1ZSYA 4X45A 3SGLA 4NK4A 1LK7A 4KR9A 4DMUB 3BX1A 2VQFB 3DDSA 1VJGA 3AYZB 3DBRA 5ALKA 4TMZA 2HA3A 4K5QA 4HATA 4OF4A 1Z88A 1RD4A 1Y8QA 4URWR 4MIOA 2BBSA 2ZJ0A 4E5YA 1AO0A 2PRSA 1XZEA 4UTOA 4ZOLB 3H5OA 2IZZA 3D8HA 4TYWA 2I4LA 3SHQA 3F8TA 5TJ9A 3UPUA 5E8RA 5HIAA 1H69A 2UDPA 4TTAA 2DHRA 5EA2A 4BV3A 2O54A 1G8KA 3PXXA 2GWRA 3LHFA 2YY5A 1B2LA 5CCXA 4MA5A 3DOIA 3LUGA 3NTVA 1OBHA 4A6EA 2F8SA 1T36B 3TFQA 1CF2O 3RIGA 3OJEA 1YHZA 1G8JA 3EEIA 1KI3A 4I08A 4J0IA 1GEEA 2DFNA 3VO8A 3O4VA 3HG7A 4N47A 4TMWA 3TQHA 3WVNA 4AWBA 5EJ7A 3SQLA 3UJDA 1C4OA 4GPAA 1VBFA 1ISFA 4FGSA 5CXSA 5EQFA 5KYUB 2I1VB 2HR1A 1A2BA 4GKKB 3SLRA 3LVQE 4QYMA 1LVHA 2XYRA 4Q9KA 3GD7A 3ETNA 5K8IA 2UU9B 4P83A 2FRDC 3PGJA 5ERYA 5CX1B 1CQPA 2Y3IA 2IF0A 5CYGA 1YE5A 3QFTA 4IO0A 3ZX5A 3J81k 2G5GX 2GM9A 3KZ1E 2YXPX 4V0SA 2QUHA 4EPTA 2JIDA 1JP7A 1DAKA 3KVNA 3WJ1A 4EH1A 1W7AA 1ARZA 5AVWA 1MJGM 2WYIA 3OU2A 5IZCC 1K3TA 3N7TA 4MVXA 5FJJA 3CFYA 2OCLA 4MQFA 1TVEA 3S1AA 4X66B 5B55A 1YA8A 2CXXA 3AY3A 5DM1A 2X23A 5E4JA 3LOQA 5LDGA 4KO1S 3U9SA 4DEVA 4BUCA 4TLDA 3H5NA 3V6LA 1NYQA 5B7QA 3FOEC 1PLKA 4UASA 2Y05A 1T1SA 1NXPA 2G3YA 2FSGA 1KYQA 3GLSA 1AOXA 2J8ZA 4KBGA 4Z99A 2QYOA 5I5EA 2YN4A 2EHDA 2BGUA 2H5EA 1J07A 4YO8A 2ZRLA 2W6NA 3AF4A 1ZM2A 3PDUA 4CTNA 3N28A 2WVHA 3R7LA 3C6MA 2IVZA 1XTBA 1BCSB 1X77A 4FFBA 4PNZA 2ZIXB 3IT2A 4J8PA 4TLBA 4IIUA 2VP0A 3DLBA 4ZVTA 3DZFA 2E49A 1HSZA 1Y3HA 4A4DA 3NGLA 5LQNA 2F43B 3I9FA 5FUQA 5HS4A 1Z12A 2QXYA 2E37A 1SC9A 5FA5A 4DQLA 3EGXA 3BIXA 4HZGA 1RWOA 4PQEA 2GXSA 3NT4A 1K8YB 3CTPA 1KIMA 2GAFA 1U8CB 3E5NA 3KDSE 4URUR 4Z7JA 2FN9A 2FPIB 4RFSA 3L2OB 2WSSA 2AUNA 5EGNA 1IONA 5SY4A 2R68A 4R1TA 4KB5A 2QP3A 2WJZB 2XRFA 4B0PA 2G67A 2NTVA 2OUKA 2HJRA 5JAMA 2ACWA 3EWAA 3H2KA 4FDTA 1CY0A 1Z35A 4M1EA 4NECA 1VE5A 2GO7A 2XYVA 1KYXA 4ND5A 5JU6A 2A5FA 2Q2OA 2O5CA 2DPYA 5F9HA 4GS5A 1YC5A 1Y63A 2J0UA 2ZS9A 2HQBA 4XCXA 3ZBTA 1AQJA 1EQUA 3RS4A 2FX3A 1EFVA 1UXIA 2Q5LA 4G1CA 2DUMA 2VPYA 1E0SA 2BLLA 2HMUA 3O95A 2EZ8A 1UFKA 3LKVA 4JLOA 4UHFA 4V3CA 5LQMA 1Z5VA 2Q9UA 1EDEA 3QEAZ 1CUAA 3STTA 4ZD6A 1CDZA 1YV9A 3ZHOA 3OG9A 1YIAA 5KYYB 3ZGZA 1UBTS 3PNMA 3JYLA 4BEVA 4DEXA 1U1FA 4LRQA 5CT6A 4ZN6A 4C5CA 3AI7A 1QZXA 2XAUA 5JS8A 2R62A 3IUNA 3L6BA 4JX9A 4QDJA 2AYXA 3QLVA 1D6NA 1SU4A 5C46F 1NMXA 1W93A 2RI6A 4K6KA 3TO5A 3UMRA 3VUFA 1T0BA 3DO8A 4EKNB 3T5BA 2ZS8A 1BRTA 4NNPA 3KB1A 3FVQA 5JSYA 1IIBA 4DRYA 1N77A 3LGAA 2HPVA 4W5WA 3DLAA 3WYBA 1TL7C 1DL5A 2OQ2A 4FNMA 4MAAA 4OXYA 1NT4A 2X8BA 4MV9A 4EO7A 3F4BA 2ZJYA 1RYYA 2PVSA 3JAKA 4JGBA 4IYRA 4EM6A 5C4GB 2IV3A 1LPAB 1WJGA 1E3MA 3SKYA 3E53A 4BMYA 3ZDZB 3E4CA 1KY3A 3EZFA 5LU9A 1A9XA 1SVNA 3WKBA 3ZDYB 5LLSA 1NVVQ 4HJXA 4DCMA 4S2EA 1EP2B 4WGGA 2GBLC 1PVOA 1QUEA 4FDLA 4L6IA 5HE9A 3W7VA 4EMUA 1P3JA 5D85A 3AJ9A 1IZYA 2Q3JA 1U4NA 1E7WA 1WXDA 3EG9A 3OPXA 2HHLA 4GM0A 1DBIA 3CE6A 1CP2A 5E4YA 1JDUA 3H5LA 1SXJA 5LXTF 2W8BA 4CQMB 3J81A 5EC8A 1R64A 2F6RA 1R7RA 5HYVA 1Y1PA 1YBFA 4P3NA 1BMFD 3RSZA 1OJLA 4QG7A 2NYUA 3SS7X 4CETA 2Q6LA 1WSBA 1ZHFA 3BWEA 5LC1A 2L17A 3JD3A 1LXCA 2WM9B 1EIZA 1OYYA 2MSCB 1PJAA 5J47A 1ZITA 3FVRA 4L4YA 1MJGA 2QVGA 2RHLA 1O8BA 4JBNA 3E5HA 5KNLA 1CLEA 3P9IA 4C0XA 1EXWA 5FNVA 3C8UA 1SB9A 2PLWA 5E1MA 4EI9A 2DH5A 3AXSA 5JSKA 3F74A 2BISA 1GT6A 4YMTA 1TUEA 1XVVA 4RZUA 1KEUA 2YNMA 3BJIC 3IBFA 3E03A 3GJXC 2ZSBA 3ODPA 3ZCVA 4B6FA 4WZBB 3U09A 1HYQA 1U7WA 3DC2A 2O2SA 3OTQA 4DSZA 3LHSA 4RTLA 1GUBA 4ER7A 3CX7A 4XFKA 3WLAA 4B46A 2O2GA 1KH2A 1UBCA 2O3JA 2ZSKA 3LCUA 1T6ZA 3V32A 4ALLA 5AM3A 3FY4A 3VR1A 3EZ6A 2QD4A 5DH9A 5L3QB 4W5JA 3H9BA 3TIVA 3ZV4A 2BMWA 3NHLA 2JD2A 4X92A 4RPLA 1FPMA 2CSUA 2AE2A 5FBWB 3EW7A 4V38A 1GR1A 3ZTTA 3NTXA 4AJ2A 2AYYA 4MOWA 3UV6A 1I9CA 3K09C 4PG6A 1Z4IA 4Q05A 1VE6A 3TTSA 3NW9A 2FPSA 1XDGA 2JASA 3BJZA 5FBZA 2O8BA 5CDFA 4ZQIA 5DISB 2ZQZA 4G8CA 2DZDA 2VBFA 2K5UA 5EYPA 1PK9A 1E5DA 5HJ5A 5ITSA 1FP7A 1VBKA 3SQMA 1J33A 3T54A 5A3RA 3V42A 1LNSA 4MQ5A 2DX7A 1K6MA 2P4EA 1HE8B 1N6RA 5ALZA 4KQWA 4WNYA 2PZMA 4L8YA 3N8GA 2H4JA