2X9QA

Structure of the mycobacterium tuberculosis protein, rv2275, demonstrates that cyclodipeptide synthetases are related to type i trna-synthetases.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
236
structure length
231
Chain Sequence
FQLGRRIPEATAQEGFLVRPFTQQCQIIHTEGDHAVIGVSPGNSYFSRQRLRDLGLWGLTNFDRVDFVYTDVHVAESYEALGDSAIEARRKAVKNIRGVRAKITTTVNELDPAGARLCVRPMSEFQSNEAYRELHADLLTRLKDDEDMRAVCQDLVRRFLSTKGATATQEQVCMDYICAEAPLFLDTPAILGVPSSLNCYHQSLPLAEMLYARGSGLRASRNQGHAIVTPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure and Mechanism of the Mycobacterium Tuberculosis Cyclodityrosine Synthetase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords CYCLODIPEPTIDE SYNTHETASE
total genus 82
structure length 231
sequence length 236
chains with identical sequence B
ec nomenclature ec 2.3.2.21: Cyclo(L-tyrosyl-L-tyrosyl) synthase.
pdb deposition date 2010-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16715 CDPS Cyclodipeptide synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2x9qA00
3S7TA 3OQIA 3OQVA 2X9QA 4Q24A 3OQIB 3OQHA 3OQJA
chains in the Genus database with same CATH superfamily
3TZHA 3E48A 3KCNA 1SCKA 1WSWA 1ESDA 1G5IA 5SY6A 4R1TA 5CLIA 2LD4A 1AHIA 5EJ7A 2GXAA 2DCMA 4GBED 4GIBA 4YMVA 1HTBA 3G5MA 4WEOA 4OI4A 4TOIA 2FEPA 3UOWA 4XWAA 4HI0E 3KZXA 5HW0A 2XRFA 1V2HE 2GX6A 4P58A 1J5PA 3HXQA 3D0QA 2HMVA 1L5NA 3H2SA 3N58A 4GP9A 2IS4A 3NOXA 2XXJA 4J16A 3EPLA 3M1IA 2OO5C 2C3MA 3C2QA 3W5CA 3GVCA 5E7JA 3WGGA 4C7MA 5BR8B 4X3CA 5BR1A 1ZD9A 1P4JA 2PMDA 3L0DA 2E4YA 1L7EA 1JFRA 4GZ5A 3VR5H 1EFRD 4K3UA 2WM8A 4MUAA 2QTCA 1KE1A 3OIGA 1XLVA 3SZLA 2IYFA 1DKOA 3EG9A 3HPRA 3OFJA 3P32A 3QVUA 3UWMA 4AWAA 2OG2A 3O82A 2QS9A 2IPNA 1EMDA 3OKCA 4HZUB 4L6AA 3ND8A 4JHLA 1K2VN 3WGVA 5KS2A 1KJ9A 4FNOA 1S9HA 4LYFA 3UMBA 3BCHA 3TMYA 1TQ2A 3OX1A 5EIFA 3F7OA 2PJRA 3LYLA 4K2AA 3TPFA 3R3JA 3GEGA 4LKOA 1ODSA 2AJLI 4RVDA 1JNXX 4RDHA 3DVAA 2F17A 3UJ3X 1USVA 1X86B 2C7RA 5TXGA 3FLEA 4QXOA 2YRFA 5LWHA 1K2WA 4RJLA 1UXOA 3WYCA 3N8GA 3DFMA 2WNSA 4M76B 4UQPA 3PWZA 1HR0B 4A82A 2CGEA 3OPYI 3OZSA 4DG9A 1F3OA 1KAEA 1PD1A 4MR9B 4QPJC 1PG2A 3UK2A 3ZVMA 5AVOA 1NBEA 3WSVA 1JJFA 3BB4A 3N2EA 3I72A 4GM4A 2ZCUA 4FMDF 2GXUA 2YTZA 2LCIA 3PIIA 5ILOA 2GEDA 3EJWA 4NESA 4OQYA 2J5QA 3SEFA 4OHBA 2QM3A 4UEJA 5FAXA 7GPBA 3NXSA 3A1DA 3ZYCA 3DAPA 2ZI9A 3V4PB 3ZR4B 4R1OA 4Z86A 1M1YE 4MKZA 4YP1A 3UAZA 1WSAA 3V2GA 4C30A 4B76A 2NQ2C 5GJVC 1IYZA 2JFFA 3N2IA 2IEAA 2W98A 5ELMA 1PAUA 3E7FA 1R0SA 2IYOA 1XDSA 4P35A 1K66A 2QXUA 1IM2A 1SUEA 1Q16A 2OGTA 1IC6A 5DO9A 2P1RA 1NMXA 1UDAA 1LWOA 3PENA 4LYDA 3SG0A 4YLYA 1GDHA 2Y6UA 1DQSA 2BFDB 4YUXA 1SUCA 3K16A 1N2XA 4N9WA 5JAOA 5FLYA 1JZTA 4ZMRA 2L42A 1KO7A 4DV3B 5ALOA 2CN1A 4WQMA 1G59A 2C9ZA 4H7DA 3GRUA 5G0VA 1UT5A 1FTSA 2C4MA 4XFKA 5D85A 2WLTA 3CO0S 3M6VA 4PXAA 3KQKA 4W8GA 1PO7A 1PZXA 1CKEA 1XKLA 4EKNB 4ERXA 3U9SA 3PNLA 5ELXA 1KARA 3ICCA 1COZA 3WLQA 1Z2OX 2JCXA 3PLRA 2YHBA 3I5MA 4XJXA 3WL5A 3R40A 4M9UA 5B64A 1BVUA 2I0FA 2HU8A 5FTNA 4IIJB 4I36A 4RZHA 1R4AA 1HNZB 2A7XA 1Q5PA 3FNQA 3TSWA 3M83A 4PZEA 1ZBQA 1OPXA 3FUUA 2E9SA 3C7AA 3PE4A 4MIOA 3GEDA 4R9SA 3DAOA 1IH8A 3HK2A 1SR8A 5WRFA 1CR4A 1Z5NA 4NBNA 1E20A 1JE0A 4UHJA 1EDZA 2Z9CA 5ALYA 1T26A 3CIOA 1JL3A 1N5LA 2HRRA 1IHUA 2X4LA 3A36A 4P5EA 3HP1A 3SLKA 1V96A 3FZYA 1E0JA 3F49S 2HRZA 2XVYA 3R4CA 2QTTA 2Z2XA 2P5TB 5AVRA 2C29D 1FCJA 2NXCA 2HR1A 2VSOA 4F71A 1SELA 4CDRA 2C2WA 3DHYA 4KLCA 4D0RA 1MZVA 4JT4A 3DCJA 3N5CA 1KGSA 1M7GA 5E6SB 2YJGA 2FPMA 2GRUA 2YOFA 3EJ6A 3MJ4A 1AS0A 1ECLA 2WSMA 4Q3NA 4PQRA 521PA 1YR1A 3P9SA 4GXRA 5K0ZA 1QAOA 1ZNZA 2EJCA 4YP9A 5DXJA 3UJHA 1GKIA 4L4ZA 3DVLA 3OPXA 2QYTA 4R2IA 3TTXA 2J0UA 4D9KA 3AONB 2WW8A 5KYWA 3ZLBA 1VFNA 3P4UA 4Z4GA 1GA1A 1TK9A 1PEAA 3ADOA 2H29A 3MYYA 5G40A 4DMUB 5KBYA 4RENA 4HVLA 2XDQA 3F8TA 5JJCA 2GERA 4W8HA 4YIHA 3MW8A 5J4KA 2HLNA 1JDZA 3JASA 3ETDA 2ZI5A 2FWJA 3ORQA 3ZU4A 3AM4A 1H1LA 4K2HA 3QEJA 2C57A 4F92B 5IZCC 1QG4A 2WJJA 3VNQA 4B43A 1ZRSA 1I30A 5KO2A 3KUCA 2Q3CA 1KZHA 4AJ2A 2GR9A 4GMDA 1EK5A 1EUZA 1HYEA 3HEAA 4DT1B 4EI8A 3R9XA 4LJ8A 4DY6A 1N25A 1V39A 3Q7SA 4H0CA 4RH3A 4DDTA 1TK3A 4C0JA 2GN8A 4OSEA 3OWOA 1NU6A 2JEZA 1M2NA 4RA6A 4M1KA 3LDUA 1T8SA 1YB7A 3HCOA 4PC1A 2PX6A 4LXGA 4AKEA 1EVYA 1VL2A 2C2XA 4IY1A 1WRBA 3CX4A 4L9AA 4M8LA 3UF0A 5LDHA 1GLVA 2R7MA 3COYA 4RHYA 3C14C 4L3VA 1TECE 2VPIA 2O7RA 3AHEA 1WTAA 4UBIA 4G5OA 3N8KA 1GGJA 4Z3DA 2I65A 2HLDD 4RA9B 4YUYA 5D01A 4CM7A 3GFFA 1T0BA 1U5CA 1LQ2A 3L6CA 4EARA 1WETA 5AJXA 1GAXA 3H1TA 4ETWA 3A25A 3Q6NA 4ARAA 3NHLA 3BORA 4AAYA 1THTA 3VI3B 1EFUA 2HWKA 2HEIA 1B3BA 5KX5B 4WKCA 1NRWA 3A2KA 2VPQA 3FPLA 5EZYF 4I7EA 3DBOB 4U9HS 3EDQA 5L51A 3NORA 4JMLA 3TD2A 4EYKA 4N40A 1CF9A 3RJMA 3SX2A 3ZJVA 5J2TF 4KO8A 4EMTA 2B61A 2I03A 4HB4A 1J0XO 3VKHA 5KKCA 3P2MA 2DQKA 1EFLA 4AYWA 4YMWA 2EP5A 4U2DA 4JL5A 4RLHA 2RHWA 2VUHB 3HV0A 3WJAA 1Z4PX 2YV1A 4N0QA 2CLCX 2PLRA 2PRYA 3WK5A 1GSOA 4J7AA 5IM5A 4A27A 4E7OA 5TQVA 1EK0A 1TZ2A 2Q1YA 3DMNA 2NZWA 2Z5GA 2AYYA 3B7GA 4DCMA 1T6NA 3W9BA 3M3HA 1W8DA 3IQEA 2RHLA 3ZV3A 3RSQA 1Y1TA 1F2VA 1TMYA 3WO1A 3HJCA 2YYYA 3M7IA 4RELA 3QITA 3I76A 3PVSA 1QFZA 1KEEA 4U2FA 3MTAA 5CGQB 2C04A 3VYSB 1LF0A 2R66A 3E8XA 1DJNA 2O2CA 3H9UA 5DK4A 5B58T 5GIOE 4DV5B 4YDQA 4D79A 3OZBA 1M5RA 3DUWA 4RJIA 3RTEA 2JLYA 2GO7A 3M3DA 2Y27A 2DETA 3VNUA 4I3FA 1Z33A 5EZ6B 1RWWA 1RRMA 3O03A 3I61A 3MUOA 1Q22A 4NMXB 4DV4B 2P11A 2WU1A 3ZHXA 3USCS 1NXQA 3OEWA 4QHTA 3F3YA 3GNTA 4PS0A 5DH9A 3ZQKA 1Z0DA 2VZ8A 1G7RA 1D7AA 2FG6C 1Z35A 2HZBA 5T6MA 3FWHA 2FPGA 5HZHA 2JAQA 1DBVO 4URHA 3TAHA 2FP4A 4E5NA 4K40A 4QTTB 4W5HA 3HL4A 4C4OA 2X4GA 4DDUA 4WLOA 2NGRA 1JQDA 4I4TB 3ULKA 2ZRCA 4P93A 2NUPB 4LZZA 1T8PA 2QPOA 1J0AA 3R3VA 4RXMA 3AVUA 1BKYA 4G2TA 5EXPA 1THMA 1T1SA 3AUYA 1Y3HA 3GPIA 5AHRA 1A9TA 3KETA 4IX9A 2Y0EA 3HZOA 4MGKR 4TVKA 3D3EA 2A1TR 5CFLA 5CHYA 5ALHA 4FYKA 2MYUA 4IHJB 1ZD8A 2BFEA 2I8LA 1GN9A 3KTDA 4HDNB 4Z0NA 3UHPA 2E5FA 4LS3A 5BQXA 3NBUA 1GYRA 1CUDA 3OJ0A 5G4LA 1JKIA 1ZN7A 1VKHA 3HCEA 3OLQA 1K98A 2O2DA 1PYDA 4GI3A 4XWWA 3R5FA 1IRIA 7REQA 4TYYA 2WU3A 1FFDA 5AOAA 4G5SA 2OC4A 3LRPA 1BDIA 3NJRA 4QELA 1K3FA 1E2GA 4IR7A 2YVAA 1G20B 4ISCA 3VR4A 3K73O 3SN6A 5T6BA 4XA8A 1ODFA 3ZGYA 1V5GA 5ESXA 3JTEA 1K8ZB 3HKCA 1ZVVA 4KQFA 4RZ2A 1TMOA 2R7AA 4FN4A 1CY8A 2F9MA 4MAFA 2QHXA 2RGXA 5TPWB 4OX9B 2DZDA 5EPEA 5K2MA 5GVSA 1J2YA 8ATCA 4XYBA 3OG9A 2F9FA 1J1ZA 5JOQA 2QMHA 1V1JA 5TVGA 2RI6A 3ROMA 3UJPA 3DV0A 4NIMA 2E21A 1VBFA 2GLUA 3G9UA 3T1QA 3L1KA 3ZI7A 2WB2A 2BONA 3BJRA 3ZWAA 2VWPA 2VN8A 2FF7A 2WTMA 3LFUA 4MV4A 1ZGJA 1R2QA 2B82A 1NE7A 2C5AA 4KR3A 1SCNE 1T6BY 4WXPA 1SCAA 1RBYA 2QXTA 2WAYA 1EDEA 1ECJA 2DPHA 4V0QA 4AZVA 2PH3A 4BNDA 4BVGA 3LTNC 4PCUA 1E9VA 1MFPA 1DEAA 2BE9A 4Q4CA 1P60A 2AXPA 1V41E 2Q8NA 3QMPA 4O4LF 4DBLE 1GXSA 4PC6A 3OOJA 4XYMA 1SKAA 4DGQA 3HM9A 1Z0SA 3TQFA 2D2VA 3AQ4A 2CF6A 1SVWA 1ZL2A 4ZEXA 4P83A 2ZVDA 2PJZA 1L7RA 2A8YA 3NIFB 4TZ6A 1M8FA 1UWCA 3JY6A 4WOJA 3BC1A 4M46A 2OPHA 4FEGA 4Q4JB 5CFOA 1G4HA 3A05A 1YQTA 1JXQA 1GQQA 1YDEA 1ZJYA 3QV1A 1SIBE 4KHZA 4PZLA 3WLLA 1OWPA 4DYHA 3D64A 1AB5A 1BVRA 1ULUA 1GPBA 3O0DA 1Z74A 3UT5B 4UHKA 1ES9A 5GOTA 3G9QA 3DTVA 3PQ3A 4KPUB 4EO4A 2JI9A 4O4JB 4J7CA 4KJZA 4I0WB 4II3A 2I1WA 3UC5A 2I4LA 1NXSA 3ICOA 5I5GA 3GARA 5H80A 1V7QA 5CA0B 1QDUA 3L6EA 4IMIB 1C7IA 3TOCA 1UIMA 3LF2A 3WMWA 3M4NA 4JI3B 3QSYA 2IF0A 4OLFA 4GMKA 5JSFA 5FPSA 3P0JA 2O8FB 1T0HB 3I6IA 1MGOA 2J0QA 3CLKA 2D5CA 2Y05A 3G13A 4R3WA 2G9NA 3D3KA 1SC3A 3KM0A 3DMGA 4LOIA 4P7BA 5AVJA 3MWYW 3S7ZA 4QGHA 1MW8X 2P6NA 2PA0A 4KH0A 4YMGA 1BXGA 2EZTA 3LDAA 4UHFA 3ZX4A 1KEKA 1ZSYA 1RYEA 1VZ2A 2B4AA 1DAGA 2EHDA 3EK2A 4L8GA 4TV9F 3W5UA 1M83A 2UYQA 1X13A 2B69A 3GJZA 3RRJA 1VYUA 3DC7A 5KEIA 2G3YA 4PZDA 1PHRA 1PR0A 3CUKA 3GRYA 5COBA 4W5RA 1VIDA 3PQ5A 4YRJA 3VPCA 5K4GA 1U1DA 1TD1A 2DFNA 1RPJA 4E2FA 3LHFA 4MS4A 5HQ3B 3DKIA 2NXWA 2GK7A 4HLCA 1RC8A 4L6CA 5KYUB 1BDHA 1GEEA 1YQXA 2IIBA 3NVMB 4QYSA 1Z5WA 4XWOA 2X9LA 4NONA 2EEZA 5A4KA 2ZGVA 1U7HA 2BZSA 3FLBA 4LBWA 1YQWA 4M0KA 1F5SA 1BMQA 4C7KA 1XFDA 5JPIA 1C3EA 5LC1A 2C3UA 3K1ZA 5BRAA 4JSRA 4LJSA 3KLPX 2X8JA 3MWGA 3KT3A 4FFNA 4NCHA 5HKKA 1PR5A 1VKOA 2UUCB 1R5BA 2W00A 4LZPA 1XZEA 3T4PA 2E49A 3MLBA 4UNIA 3THWA 4MLCA 4LC1A 3ZCQA 3I09A 4PS1A 2O4UX 4EG3A 4DUGD 3EPHA 2HADA 2OCKA 3OZXA 5EIWA 1P1IA 1P1HA 2I3AA 3DS8A 3DXZA 3PQCA 5FWAA 1E2JA 2I7DA 4TN1A 3W6UA 2VOJA 3ZK8A 5ARDA 3KTAA 1U02A 3SQMA 4C4AA 4OKNA 3JZDA 1VP3A 3LDFA 4TYPA 4BX3A 1GUYA 4UVEA 4Z9AA 4M9CA 4EKGA 4ZQCB 1R27A 1OTHA 2DT5A 4LBZA 1OLSB 4DQVA 1CEEA 1QG0A 3NV9A 3OZWA 4Y1RB 5M34A 1BFDA 1H4TA 1SUDA 3EZFA 3SF8B 4DEYA 1JUDA 4OQNA 3L6UA 4CKXA 1T9CA 2OXIA 1SUFA 5K51A 3EZ2A 2HL6A 4RD3A 5B55A 1YR6A 2HSJA 1Q0SA 1OXKB 1Z36A 3QOYA 3W06A 5NULA 2Y4OA 4D82A 1ZM4A 1HDEA 2IZ5A 5LZ7A 1YKSA 2MWMA 4MR8B 3HU1A 3NX4A 3FF1A 1V11A 4C6TB 3DW3X 5KOJA 2WKSA 1FFBA 3KEFA 4NSNA 3PT5A 1OYVA 4AW9A 1CNFA 3KJNA 5KNDH 1GPMA 3LBIA 8LDHA 2WSSA 2B98A 4BU0A 2F4VB 4QLOA 2EV9A 1T43A 3MWEB 4QXMA 1NYQA 1ZVQA 3GUHA 1DKRA 3KVYA 3TN7A 2IYYA 4CMEC 4HNSA 4IZHA 1E69A 1LPBB 2BHRA 3U17A 5JVDF 3DE6X 2OZLB 5TPZA 3BGOS 3QHAA 1IAQA 1GPAA 4G8JA 1L8AA 1JR2A 4FYHA 4QTXA 4BUJA 3RJ9A 1YRHA 1GV0A 2CK3A 5IRCD 1KYXA 5K3BA 2P79A 3MWFA 4BO8A 3EXFA 1HQCA 2DQ4A 4J1SA 3E61A 1HT3A 1LSJA 2ZYAA 4ICIA 4MVJH 5ALNA 3WKDA 1I3LA 5ESRA 4DXHA 5FPKA 1N34B 1I8TA 2E4WA 1KI3A 3JYLA 5HILA 4MQLA 4H16A 1CJCA 3T3NA 1J49A 4J07A 4EW6A 1GO2A 1RXIA 2QZJA 4ARZB 2HLPA 2OMKA 4L15A 1I4LD 4LISA 3AVPA 5TQ2B 1KO8A 1LNSA 3MTGA 2FZEA 2PAFA 3ND5A 3S5JA 5K3OA 2JVIA 4CM8A 2H57A 2ZTLA 3RYFA 1MTOA 4CN9A 3MAAC 3S70A 4PPGA 5AESA 4TKVA 3DOIA 3A9WA 4Q34A 4A5OA 3PZRA 1TM2A 1U0NA 2NPOA 5HUQA 3AEZA 3BL6A 4AN4A 4WVFA 3ED1A 1QHNA 4U2EA 4LMRA 4RU1A 1SUIA 1W73A 1J5EB 4B4WA 1BMDA 4E15A 4EUFA 3B1XA 1MVLA 3PUIA 4MVJG 5TMPA 4A36A 2FR8A 4GQAA 1FRFS 1GSAA 3GH1A 3EDCA 3RSZA 1B23P 4O08A 1HYGA 3BXZA 4K1XA 2CFSA 3KC2A 2NYRA 3JATB 1O0CA 1AQLA 1OH7A 4D9GA 4KDCA 3UTCA 5KVQA 2GD6A 1GAEO 4W4TA 2OHJA 4KLNA 4ESHA 2C3PA 3DDCA 4RMGA 4A9AA 4UNNA 3PXDA 4LXUA 4QPDA 4X8LA 5L9AA 2ZYHA 2XX3A 3PI6A 3NBKA 1UZMA 3IBYA 2AD5A 4NG5A 2VP5A 5E6UA 1E63A 4DR1B 4ZDWA 1RHJA 2UXCB 3FTEA 2H4JA 1P39A 1S2GA 4PLFA 1PR3A 3ETLA 3WNZA 3EW9A 3CRRA 4BZWA 1OPRA 1PV1A 2BMJA 4EPTA 2VDWA 3GNQA 4JC4A 1WZ2A 1UPXA 5DLPA 5BORA 1BA2A 2GRJA 5JTUA 1L9XA 4X8HA 2Q5FA 3KDPA 3ER6A 1ZW6A 3LHKA 4MARA 2WMYA 4R0VA 2CB9A 2Q21A 4XLZA 4EMBA 1FP4B 3GEEA 1WZEA 4BP1A 1O6GA 3HCDA 3PKIA 1PUJA 4B0PA 2A0XA 3H5VA 1LVUA 2F1HA 2R65A 4HDCA 3RSSA 2A92A 1MV8A 3I9JA 4KRGA 4CQMB 3RKSA 1UOEA 5IC4A 1BYUA 3LV8A 3O9ZA 4RHUA 1CS0A 4UW9A 1WV1A 3H99A 1SG6A 3OESA 1KJIA 1L5MA 1WY7A 4ZK2A 2HU7A 3LCRA 1A9SA 3ZVKA 2C8JA 1Z0KA 3QE3A 2ZQYA 2QR2A 4PQFA 4EB6A 3QSGA 1PBNA 1TT5B 4I4CA 4LY0A 4PYRA 3PQ2A 1FLNA 2DTDA 2JASA 1CUEA 2P4HX 3D6MA 3BSWA 3LO8A 3QY9A 5D5PA 4I3GA 1RVDA 4YI5A 4CDGA 3V80A 1IN7A 3E18A 2CHFA 1X1SA 4WCFC 1Z07A 2FW9A 3SBDA 5A4MS 5CB8A 5HR5A 1LSUA 2PX0A 5ED4A 2XA9A 4UBNA 1U98A 3RS3A 4RJKA 2QMOA 2QGZA 2VTKA 5CLHA 2WQ6A 1ZH2A 2BFOA 3PKJA 1VLJA 3UWSA 2IOYA 1LBTA 1J8MF 4D96A 3A0UA 4JJ6A 1FYFA 1YIDA 4BZPA 5H9VA 2QPLA 1RLTA 2YY5A 1IXZA 1XMVA 3DLTA 2XWQA 2XB9A 2CYCA 3H2YA 5HJEA 1P1RA 4DBZA 2FN3A 2JJQA 3CNEA 1TQ6A 3MVEA 1CRLA 2OORC 5DPMA 3U6BA 3IUJA 4WHMA 4QRIA 4ZU3A 3G7NA 3QVVA 3VPDA 2YWGA 1O6ZA 3L43A 4A1OA 4B3MB 3SC3A 4ANFA 3QVGB 3ZYZA 5E0KB 2WT4A 3RC9A 2G1UA 3AF2A 3STYA 2HMYB 2Z43A 5H1YA 3WHPA 1EWQA 1QP7A 3SHWA 1O8CA 4AULA 2GS9A 3WDKA 3A9VA 3GRAA 4I1YA 3U19A 3A11A 3BB1A 1LJ8A 3ACCA 1D1PA 5ELLA 1SQ6A 4HDQB 4ARSA 5KVSA 1PR2A 4HD8A 2AFIA 3GA5A 3GD5A 3IP8A 3LCMA 3NQ41 4OK6A 4Q3OA 4LYEA 1F8XA 2YW9A 4XB1A 4ZVSA 3SZUA 1N8TA 1YMQA 4BOYA 1TPZA 1W2WB 3DTYA 2O8EB 4A0FA 2G0AA 1XVAA 4NATA 1KJYA 3HXPA 1QH1B 1NW8A 1AKYA 3EZXA 4AQDA 5EJ5A 2BGRA 4EA7A 2ORVA 1PR9A 3DB1A 4HSEA 2BKVA 4GQBA 1DOAA 4P0PB 3CF0A 3QX9A 1L8OA 5JCXA 3TRIA 3CNLA 4QZVA 2WEKA 5I9SA 3ZWKA 2VDVE 1LUAA 2NU8A 4KQMA 3SFVA 4K8RB 4HYTA 4RLFA 1TW3A 4DM4A 2JGJA 2PJDA 2QMUA 4Z3KA 1QO0D 1BW9B 2XYQA 4HS4A 1JHVA 3GJYA 4Z9YA 2Z6QA 3HACA 3IMGA 2PUVA 3IKVA 3SFTA 1ZNYA 1U3GA 1D2NA 4CEJB 1HEIA 5JD3A 4PEVA 1H94A 3ZCRA 1QZUA 4HDMB 5HMMA 4XQCA 2FLVA 4EY8A 3FR8A 2Z8ZA 1PFWA 1WXEA 4FS8A 3CVOA 4KITB 1CQWA 3MGKA 4TS3A 5ETJA 2GAIA 3EVZA 3ROGA 1YA6A 4DA7A 1CZKA 1C7JA 2Z8YM 5KJ1A 2ALJA 3BULA 5LXTB 2E18A 3DJYA 3GRPA 1MHTA 1U0BB 2X4DA 5BV1A 2AI2A 2O0LA 3AJ9A 1L6RA 2V96A 5AUNB 1UOPA 1ZZEA 2XOKD 3LF1A 3PHGA 3CF2A 4WVLA 3SEAA 4ZV4A 3BDIA 2WD9A 4EW2A 1UXHA 3EIHA 5DW0A 3H5AA 5DASA 3WWPA 3CNHA 5E7IA 2W48A 4C4XA 5KYYB 3RS8A 1SXJE 3OY7A 4ZI7A 3N70A 2WT9A 1Z2EA 5DIZA 4CF4A 1SOMA 1OXBB 5HG0A 2IEGA 3SYKA 3ZBUA 1OWMA 4NAVA 1EPUA 4HDSB 3FI9A 1A2QA 1UBMS 1KFBB 3DP7A 3FPKA 3SIWA 1Y6GA 3R24A 2NNWB 2M1XA 1JU3A 1WXWA 2Q3DA 4BNNA 2NN3C 1VP9A 2DT8A 2E6UX 1P9LA 4FFLA 4CUKA 3O6VA 4P0QB 1KZ4A 4RVGA 3T9BA 1N6IA 3V7NA 3PICA 2X5XA 5AJUA 2YV2A 3CBGA 5PGMA 3UMJA 2I22A 4RMHA 3QEMA 2OA0A 1H6DA 1SXJD 4EG5A 3KX2A 1UC8A 5GOZA 3UWOA 4HN2A 4A1FA 2ABWA 3EGCA 3H3XA 5BRNA 4GX2A 3PPWA 5D1NA 3WZ2A 2PSFA 1Y6JA 4IYRA 1XPRA 5LUBA 4JBLA 3FSJX 2BN4A 3PSAA 4BEVA 4F86A 3PEYA 2W4MA 1FIUA 4JP8A 5F64A 1X9IA 3N76A 2WM9B 2D7DA 1GA4A 3WLEA 1FYVA 3H8SA 2Z09A 3JQCA 3Q3HA 3EVBA 1Q1NA 1ST2A 2LPMA 1RRPA 1SVMA 2XQVA 4Z9FA 1CNMA 2ZYTX 3K9NA 3WGMA 2W9XA 4IIHA 2P40A 4YRBA 1UM9B 2BGLA 4RTKA 1YMVA 4XIIA 3SMVA 2EWMA 3P0FA 2XMQA 4D6XA 1UKVY 3JQRA 1WV0A 1EE9A 1IY1A 2HWYA 1RWMA 3PJFA 4CMAA 2V58A 2L19A 4LFBB 1ZVJA 1JV2B 2VSNA 4QOJA 3WICA 4B3HA 1VM6A 4DADA 1CIPA 5CM2Z 3EWSA 1H3FA 1UXIA 2ORIA 3LT5A 1VLVA 5DYWA 1PW5A 1VRWA 4LVNA 3LDHA 3P9CA 1N3YA 3WNBA 3UK0A 4YAKA 1W1UA 4DV1B 5B7PA 1F20A 5I7WA 3QYFA 3U4HA 2ZBQA 2B20A 3KXKA 3WKCA 4F1KA 1TTQB 2GILA 4G8CA 4UKDA 4AMGA 1OBOA 3LA8A 4U2GA 2KYRA 3PSHA 3AEKB 2AOWA 4C3UA 1NN1A 4O25A 1DX9A 2Z5LA 4A5SA 3AP2A 4D6YA 4GD3Q 3KOUA 1FDUA 2Y99A 2XUIA 5DM4A 2GEBA 5KC8A 1C8VB 4HUJA 4KDRA 4XH9B 5EUBA 3EW7A 1BVYF 4K6GA 2B94A 2JIOA 1QCCA 2AH5A 1IQPA 4BO0A 5BV2P 3RAFC 1NMSA 1CW2B 3AZQA 3GELA 4HNAB 3T5DA 1DG9A 1S1MA 3EDRA 5CT6A 3GGPA 2JH3A 1NJFA 2ID8A 2L69A 2QTHA 2ZWOA 3KD3A 3W6PA 1XT6A 5EFZA 4D57A 4M60A 4TRNA 4IIBA 4TKVB 1YOVB 3W5JA 1Y9ZA 3FOFC 1NUUA 4OQ4A 5E4JA 4LYHA 3ENWA 3BHNA 2H54A 3MCZA 2CWDA 4WXYB 4RMNA 4ZI2A 4ENWA 3DEFA 3GJRA 3RLFA 3PQDA 1OBFO 3MUEA 3D1JA 4LQCA 2P6PA 2WYIA 1JG6A 1MQ9A 2Y1LA 3DOOA 2JD0A 5C3MA 1QB8A 1AQ6A 1W4LA 3N0VA 3QLTA 3RSHA 5C8XA 4QKQA 3TZBA 1XZIA 4BN5A 4NE2A 4XTCS 1IHPA 1QB7A 5FBRB 3KUKA 4L8FA 1G9TA 3WIBA 3Q72A 1DPGA 4A6DA 4HSGA 4XD7D 1RZRD 4ENRA 2VAMA 3GFQA 4MJ7A 3L40A 3PLNA 3OOEA 4UAUA 4CM5A 4IXNA 2XUHA 3PJRA 4NHEA 3CNBA 3FHCB 5C1PA 2YQ5A 1RMTA 4LVCA 2CFOA 3R6LA 3LPCA 4D02A 1AQJA 1PQWA 1U0EA 4OM8A 3A3OA 3II6X 1F4LA 3ZIAD 1DRWA 2GA9A 4L9SA 3WLFA 4REQA 3IUBA 1Y4SA 4DNOA 3P0EA 1V45E 1Q7BA 1WXGA 1UC9A 2ZR7A 2OP0A 1XRRA 2PTGA 4KXMA 4N3GA 1X7YA 2UVDA 3K31A 4FKZA 3S40A 4AJKA 5FWNA 3A2MA 3JQ9A 3V8MA 4HRAA 1N6KA 3FUCA 2VJQA 2H1WA 2V98A 3AP1A 2FPPB 3Q5DA 3HZRA 2I3ZA 3HEMA 4HRXA 3PV0A 3L4SO 4ZVOA 1EE2A 4US0R 4ONEA 1VKNA 3DO6A 1N9KA 4G4SP 1YVDA 5DBHX 5EJ4A 5JI3E 4X65B 4TZKA 4RTRA 4CG0A 4QM7A 4YT2A 4TXMA 2QTVA 3OJLA 2J41A 2K2QB 2OT3B 3BERA 3ETNA 1J97A 1CF4A 1E3JA 3TEJA 4US1R 3EIUA 1U94A 4DABA 2Y1EA 5IKXA 3T1NA 2WZBA 1W85A 2ZQ5A 3LQRA 2ONZA 3PPVA 4FI3F 3DULA 3RU9A 3BPSA 3OF3A 4QXRA 3ZE6A 4DV6B 1T1JA 2QX7A 1JDUA 4PFSA 2G5PA 2JLRA 3HHPA 3BFJA 4X9XA 3U44B 5LVAA 3O8BA 2VDPB 1E1CB 1MX5A 2OESA 4OHUA 2JLVA 2ZJ2A 4AIRA 4BGUA 3TR0A 4ZREA 4TV8B 2VHQA 1USUA 1EWVA 3KQUA 1JDNA 2VYFA 3AG6A 4LX8A 4FVTA 2OM2A 3H9EO 4NZYA 3TMKA 2FRXA 3ANTA 3VV3A 1USWA 3U09A 3P9ZA 4KI7A 1SIUA 2I4NA 3U7JA 1M8JA 1T9GR 2D5IA 2PZBA 4H3KB 3EFOA 1AGXA 2A33A 2JCYA 3M81A 1DAFA 1KEVA 2CVFA 3DO5A 1S7CA 1WHSA 2BM0A 2XGSA 3I9OA 1LI4A 5BQPA 1HWYA 1SXJB 3HH8A 2YQZA 2ZEJA 4B83A 5L6MB 4CJXA 3LU1A 5A3RA 5EZYA 2QRNA 3MRTA 4J3JA 3D4NA 1OYOA 2H0RA 2V74B 5TT0A 4BWVA 1JHYA 2G4VA 5DV9A 2VHUA 3ENQA 3PC8A 1Z6PA 2ICAA 2ZU0C 4G25A 3NHSA 2XCTB 2O5VA 2QZSA 2MSWA 4QJ3A 2NVUB 1Y82A 2OCYC 1J39A 3QVMA 1BFKA 3ZDRA 3ZE2B 4KX3A 4JDUA 2X4IA 4K81B 1DTSA 1ML4A 1MR3F 2EYQA 3MINA 1FMTA 4GDMA 4JGGA 1IE3A 3W5VA 2FG5A 3CX3A 2JGAA 3B2EA 1RWXA 1UPAA 3W5HA 2IUTA 3C87A 4QQFA 3AERB 3EZNA 5AI6A 2XVXA 5IYZF 3V5NA 4D80A 2ADOA 4EHBA 2R7KA 1EHIA 3V46A 4NC9A 1FK8A 2C5EA 3OOSA 3WL7A 4XQGA 1TADA 4WLNA 5ALKA 5KYWB 3F67A 3LUDA 1XQ1A 4ND7A 2YYZA 4X94A 4ZALA 2ZAMA 5HKBA 3U4CA 5A06A 4PICA 1ESCA 1JU4A 4R69A 1C0EA 2AGVA 2XE7A 1TUGA 3HC7A 3I05A 4LECA 3K9QO 3VO1A 5JS1A 3UJ7A 1P2VA 1QAMA 4BMVA 1IY9A 4TMYA 2NT4A 5FA5A 3L01A 1HQKA 4RTNA 1FUEA 3MAGA 4LEIA 3TYXA 1H9CA 4UUQA 3RRNA 1N3BA 3ONNA 1QORA 3HL0A 1EDBA 4L3OA 3T7TA 4FCVA 4XVHA 3J7AC 1W48A 3OE1A 3PUJA 4KPEC 3WQSB 3MZ0A 3U1TA 2C7QA 2IBSA 1IXRC 1XP5A 3ANYB 3DL2A 4FMBB 2G80A 2HUPA 4ZOBA 5EHIA 5K3CA 2PQ6A 5L7YA 3EEYA 1DEHA 5EJ9A 4KRFA 1VMEA 2INGX 1EVQA 3IAS6 1XMPA 2ZUWA 3HDJA 4DMMA 1X1DA 5G4KB 4WNIA 3CR7A 4JYBA 2OAQ1 1FLDA 1AM4D 2JANA 4BO1A 2HYIC 2FFRA 2IK8A 1XCBA 3LDGA 4IG9A 4FHEA 2J59A 4MNTA 5H3HA 1YB4A 4FJ1A 3X2FA 4NZNA 5LA6B 2F3UA 3S2ZA 3BIOA 4ENSA 1N9GB 3LWDA 3Q7PA 5E2BA 3FGZA 4TKUB 4DM3A 4RVSA 2QN7A 1H0RA 4BDSA 3ORFA 3OZTA 3WL6A 4RUKA 5B2FA 1W19A 1ZESA 2XUKA 1VFPA 3LUGA 3DCIA 3PC3A 1QVAA 4R05A 1ZM7A 3N28A 1Q74A 1N5IA 3D0RA 1DRVA 1L1EA 3ZV6A 3B6IA 4Q4HB 5KTTA 2V7WA 1Z2NX 2IELA 1J2EA 1UQTA 1NI3A 3AB3A 4V3CA 1OUMA 2R4QA 5E1MA 5A3SA 3WQRA 4ETIA 1LK7A 4CKCB 3MOGA 3UAOA 3ZCSA 4F45A 1R37A 1K6EA 1R8JA 1FDVA 2C2ZA 2REXB 2QE6A 1NU8A 4FEEA 4KH1A 1Y0BA 5HWSA 2W42A 3KVNA 1BE8A 2X0DA 2A0UA 4P98A 5HMLA 4D8WA 5BUQA 1WB9A 1NN3A 4F4FA 4WK2B 1NJ1A 1QK4A 4U02A 4OI1A 3ZKWA 3AM1A 1R15A 5B3KA 4L8WB 2Z5VA 5JARA 3WLJA 1G2QA 4AUNA 4AJOA 3GL9A 5KYGA 3WYEA 1FMJA 1KDVA 5CBPA 4W5NA 3Q7IA 3J80A 3OSUA 1QP0A 4HDAA 3IAAA 3T1VA 2Q6IA 5AXCA 4ZOQI 2EW2A 4M8SA 1TJ3A 3VNSA 3U4QB 2O8CB 3H1AA 5JEEA 1R4NB 3FUWA 4OHPA 3DB2A 5I48A 4I50B 4AF6A 1OBHA 3OLZA 2J3JA 3R0XA 4QU5A 4YMSA 1C5KA 2CMHA 2QD5A 1YVPA 1Z5OA 3HCCA 2X8AA 4AZ0A 3KLBA 4TYWA 4WH0A 5GPBA 1PS0A 1RZVA 2VNJA 1F51E 1NR7A 2H7VA 4ABYA 4Y30A 4EJ6A 2IWRA 2WSLA 2VBIA 2XUQA 4CL8A 2AK2A 1JFLA 1YZVA 2AMFA 2C58A 1M1XB 1Z4KA 2AN5A 3B2QA 5A5VA 3OPYA 4L08A 3VMMA 1AKWA 1L7QA 4ZZ2A 4YJKA 4G0QA 1B16A 3CCFA 4QRHA 2WHEA 5L3ZA 1U7ZA 4KLAA 3N39C 2VSQA 1QE3A 1Z7BA 3INNA 2ZIFA 4LRSB 5EYPA 1YIAA 4H0FA 4JLJA 5KHOC 3HJFA 3CH4B 2R6DA 1SBZA 2PBLA 2XCUA 3NTOA 2UUOA 4MWDA 5CR9A 4AZTA 2B1IA 5LZ2A 4UTRA 1CUZA 4B3RB 1U90A 4BKPA 4U3JB 4YAOA 4OB6A 3KS9A 4TT3A 1WJGA 2E5WA 1BGXT 1OBCA 3FBGA 4AJ4A 3TUJC 1EAYA 4G6ZA 1I36A 5KAMA 1AKUA 1QRSA 2AE2A 1UF9A 3MS4A 4C2UA 3OIUA 1Y81A 3JAWA 5AVVA 1SXQA 1JHPA 3OMXA 5DHPA 4JP2A 3SHOA 1NVAA 3W1WA 4FUTA 3AVOA 4ADSG 1KQFA 3DVSX 1QYXA 4DQ0A 2JLUA 2MSDB 3PGKA 1DADA 2ZIXB 1YJ5A 2AFRA 1XZAA 1E1MA 2BIFA 2IHYA 3I39X 4HPJB 3T5GA 4MOWA 1QHXA 2F1OA 3JD4A 1JA0A 1TE2A 3JQAA 1US8B 5DHUA 4W6QA 2V0GA 1JZSA 3GLVA 1A8QA 2OECA 5HK9A 1MQSA 4RD2A 1D4FA 3K0AB 3C97A 4U2CA 1EX1A 1VA4A 3MC1A 5CJPA 4EFLA 5CD1A 2VHJA 1ZH8A 3PS9A 3D6TB 2V6JA 2FSFA 4MCHA 2HK9A 1X6VA 4GO1A 4PFJA 4XDGA 1GWNA 5D84A 3S8MA 4CGYA 5KIAA 2EIHA 1L7BA 4H0NA 1DEXA 2X9NA 1FC0A 1IUKA 1ILWA 2XNDD 2ZTSA 1LA2A 3A9RA 5F73A 3RRMA 3IE2A 5DNEA 3V1KA 1L4UA 3AKCA 3CCBA 3O21A 1NM5C 1U80A 3SJAA 3JVUA 3PWSA 2I54A 2C2OA 1GG9A 2OEPA 2B92A 4KQJA 1CDEA 4WXMA 1KTIA 1LRJA 2W8ZA 3W2FA 2EDCA 1NURA 3C6QA 1DKMA 3KYDA 1GA6A 5TMDA 1N2IA 2I3DA 1G9SA 3AIKA 3IIKA 2Q0QA 4LV5B 5DRTA 2ZRJA 3ML1A 1MNQA 3D6NB 3I9KA 1EG2A 2WILA 1I0ZA 2DYKA 1PX2A 2XQIA 4YCNA 3LRTA 4A4DA 1I6LA 2OQRA 4BN0A 4DE5A 2JCBA 3M82A 4IFIA 1UT8A 1JR3E 2GQ0A 2J9FB 2VCHA 2CE2X 3CWCA 5LJIA 3IDSA 3T52A 4G97A 4R8LA 2QTVB 5LXTF 4EZBA 4YA6A 3OTIA 4MW6A 4HVAA 4XYGA 4FOOA 2PL3A 1GTSA 1FFXB 2XQJA 1LDBA 1PX0A 3TDNA 3A1VA 1QH9A 4HWPA 4KAAA 2VFAA 3OEHA 4I8DA 5IWCA 5KOYA 1NNLA 1OXVA 4B3GA 2VHVA 2AR0A 3SX0A 1P62B 3VR3D 4CCWA 1GZHB 3P27A 1XTSA 4L7VA 2FG7C 1JKXA 4N41A 1IHOA 1QS0B 1KA9H 1GNTA 5TC4A 2P2LA 4BP9A 2GAOA 2W8BB 2PO5A 5E9WA 3FMGA 1RZUA 3OM1A 3A1WA 2H31A 4B7ZA 4PGFA 5ALTA 4S2EA 2J9YB 1E2UA 3Q8KA 2BUCA 4KQXA 4URFA 5IEJA 1M74A 3DPSA 1AH2A 4KCGA 2H2WA 1PSWA 4G1FA 2NZ2A 4JV5B 3DMTC 2B2XA 4HZIA 4JUCA 2UZ0A 1IOLA 1Y42X 1ZL0A 3GIDA 3ZQUA 2IIVA 4U7DA 1VE9A 1NVDA 4NG4A 2I2BA 2O8VA 3A26A 5GV7A 2PUCA 5E9QA 3HB1A 3GDFA 4YI3A 1M3SA 3KZ1E 4MQFA 1TUBB 4PU0A 3I32A 4C4PA 4E2YA 3KFXA 1G291 5AM2A 3QWHA 3RU3A 5JSKA 5JZ9A 1XVVA 4P3YA 2X5JO 2DR2A 3RVLA 5BNWA 1L6IA 4F5YA 5LQMA 1UMCB 2ORYA 3EDMA 2FW1A 1YACA 2J4FA 3G79A 1KJWA 5JYEA 5EIAA 4XQEA 1T4DA 3PWKA 2R3SA 4R0MA 2R1TA 3NZEA 3P5BA 3C5HA 5DN9A 4NCBA 4R2KA 4RCYA 5TY0A 3FCSB 3H1BA 1S8AA 5LB2A 2Z4SA 4V1CB 1ZAYA 2V7UA 3Q2KA 1BOFA 3B6KA 4HQ0A 1G8YA 5ENDA 5FLEX 1E5DA 2VZEA 1JEJA 1PJ8A 4OFXA 3TLEA 4BP3A 4H7KA 5A3JA 1T2VA 3RD5A 2J67A 3T12A 4CIBA 2XDYA 3GROA 2AFHE 4MYUA 5FTJA 4J7XA 1WCXA 3I5AA 3UEOA 4GLOA 3ME5A 5F7OA 1J7KA 1JPUA 3P0HA 2ZVQX 3WRYA 3JU3A 3IAFA 4MYHA 2BFCA 3N2GA 1E8MA 4QBIA 5AWFC 3HLKA 1GP2A 3OQVA 2ZTUA 3RSFA 4IZIA 3U80A 2Q29A 1X74A 2A3NA 4G9EA 4EJSC 3RU2A 4CXMA 2R751 3LUHA 4BRZA 3C3CA 5H83A 3UMFA 2ZK7A 5BQ3A 5LIPA 1G8SA 4C4RA 3D8RA 5C8YB 3R44A 1RQPA 2FN9A 1MT0A 4WJLA 5I01A 4MPDA 3CEPB 3U4MA 3JRNA 1KY3A 5CGZA 1L1FA 1EWKA 1KNQA 1T13A 3N5KA 1NOJA 3Q0EA 1RAFA 2VF2A 1I1HA 2YJNA 3P2JA 3CNQS 3N3BC 4IIFA 1T8UA 4D8VA 4X85A 2AZXA 3I28A 1NQOA 1NVKA 4K03A 4X61A 3H5LA 5CG2A 3PHBE 1ID1A 2XUZA 2O52A 3DLCA 3LM8A 4Q1VA 3OUUA 5ALFA 4A8HA 4AX8A 1U9IC 2JFUA 3CA8A 4P4NA 4YGXB 4C29A 1CB7A 3OA0A 1Q15A 5GJBA 2VNAA 4KR7A 4G2NA 5IDXA 1IK6A 3LOPA 1N2CA 1P6QA 2XUOA 3UMCA 5IH3A 3HJGA 4HXGA 1ZHFA 1N3IA 2B83A 4P34A 1XBTA 1BWQA 4ED9A 1PYOA 1Y8AA 5JO0A 4YV7A 1E18A 3U31A 3DL4A 3C8MA 1NVXQ 1TZMA 3SYMA 1MOSA 3PDIB 4PLVA 2HZ7A 4CMGA 4CWAA 3REOA 3NYRA 3X44A 4HEJA 4BKMA 5GGXA 4H6PA 1P0FA 2JA1A 3UAGA 3IP3A 3U1VA 1JLLB 2CXOA 4LUCA 2MTBA 2H4HA 3A3KA 2C3OA 4HAIA 1FRQA 2Y1KA 3KQVA 3I3SR 1MX9A 3BZWA 2CMKA 1E64A 3ID6C 1IEQA 3H17A 5DLDA 4CCYA 1ADFA 1D6SA 2X42A 5JAIA 2FFHA 1HE2A 4IKOA 4QDJA 1PZNA 2PJUA 3P26A 4Q9LA 5HGXA 5IYZB 4FX2A 3EXEA 4DJJA 4LHWA 4ARZA 4DCUA 3IEMA 2V55B 1GUZA 1XGKA 2Y4NA 2HY7A 2YFKA 2H1HA 4PPFA 1C1HA 1XZQA 4QPZA 4TWBA 1JTVA 2PH5A 2DP4E 4LDAA 4D9BA 4II7A 1JLSA 1GGFA 3M4YA 5DXFA 3S6JA 2Q8PA 4EA6A 1U4OA 1SQ5A 1QJCA 1TTPB 5TGDA 1N0WA 4UTZA 5FWDA 2QRVA 4BNFA 2FSIA 5LA6F 2F3TA 1QIJA 2VYVA 1CP3A 1EDDA 1L5SA 3GZNA 1BOOA 4KP7A 5EHNA 3K1TA 5F35A 3GLGE 3NC1C 3VH1A 5AM3A 1KJZA 2QDKA 4RJJA 1HDGO 1U04A 3RTGA 1QHGA 1RWBA 2QVBA 4EEXA 4P4LA 2LCQA 4LV8B 4YUWA 1Z8DA 1JFSA 1U0LA 4YJ2B 1RJFA 1TD9A 1A9RA 3NAGA 2FFQA 2OYSA 3L7OA 3O92A 1MBZA 2M32A 3ZKAA 4QUEA 2O0MA 3EUEA 1GUAA 3OPMA 4C07A 3FY4A 2R5WA 1XLUA 5ITWA 1E61A 1LV8A 1OIWA 3KKKA 2AWNA 1KWKA 1RADA 4BB9A 5JS8A 1TJPB 1ZOIA 2BGUA 1LLDA 4YPOA 3THYB 2XBMA 1PT7A 1P5JA 1QVWA 2CNWA 3EXAA 4PWYA 1YO6A 4URZR 4D4HA 1RIFA 4DSNA 2N0SA 3TLAA 5CT9A 5FADA 1NYRA 2PWYA 2ZKIA 2ZU6A 1XTUA 4H4DA 4RD4A 1R3UA 1CEYA 4ZO6A 1T1IA 4ZHQA 4GGPA 5KI6A 4DTCA 4DLLA 4X91A 4BHTA 1QK3A 1RCFA 4KUGA 3TTUA 4LNHA 4B73A 3X1YA 4C43A 2XXAA 5FLKA 4LV6A 4OQDA 5JYBA 1C1DB 5FUBA 2BEUA 2K7ZA 5DHRA 1XB2A 2X9GA 4K9MA 1KI7A 4OFBA 4QHSA 3W77A 1RM0A 5H70A 5ERXA 2R47A 3KU1A 1ZD5A 1HFKA 2VQ6A 1PT9A 5UKDA 4C5CA 3O90A 4J1QA 3GK3A 3WLSA 1HNWB 4CV1A 1MAHA 3G85A 2F90A 5DE3A 4GBMA 2ONYA 3VSAA 3RVPA 4C89A 1M2FA 3RYHA 4R40A 1V1RB 1VZ3A 3T3HA 3SWWA 2ODBA 5GONF 1KI6B 2D1QA 2GHRA 1Z75A 3PITA 1B43A 2ZB2A 3HCNA 6REQA 3IC5A 3EHDA 1PDWA 3UY4A 4CE6A 2QRJA 3EG9B 5KJ6A 4IEIA 4UNPA 5DMHA 3H5OA 5JSYA 3A3YA 4YRGA 2YZ2A 4UBMA 1PZGA 2HA4A 1M6VA 4WN3A 2QN3A 3FAKA 1L4MA 2D0PB 1CF2O 3KJEA 4FFRA 4DCTA 3WYAA 5JCZA 3TVDA 5DXAA 4NZ9A 3WRYC 1SBQA 1FFAA 2I4RA 3OCWA 5G0WA 4GOJA 2VSYA 1RXUA 4PQGA 3D7NA 1NULA 1N5JA 3TZCA 5IVKA 1JQ5A 4F12A 1W94A 5FI0B 4UTNA 2FPOA 2H8KA 2PRZA 4K88A 4YPFA 1EGHA 1Z12A 1SU6A 3I2YX 3NB0A 3NC4A 1TRHA 4I50F 4Y2JA 4QNNA 5AXDA 2WIAA 3RIHA 4BQFA 2IEDA 5IBPA 3VX4A 4KXWA 3AEXA 2K2WA 1NPDA 2QLJA 1NYLA 2RHRA 2XR1A 5DWVA 2BBTA 1T0PA 1XZLA 3WLMA 2RKBA 3AJEA 4UU7A 1SVOA 3QJYA 5IH7A 1T0UA 4KEAA 2E55A 5LR6A 2ZKLA 3J7TA 2WJ4A 2VJYA 3PJDA 1BWPA 1YC2A 2IIPA 2VF5X 3NYWA 2GK6A 4PZ0A 3OFND 2IXGA 4JIGA 1MGPA 4WOCA 1Z6XA 4RM2A 4DWVA 2AMVA 1W2GA 1U11A 3NLLA 1WDKA 2AQKA 1G42A 1V5WA 3AJAA 3QBTA 4L50A 4BLUA 4PSVA 3A9TA 4F3CA 3FYCA 4KQEA 5IZ4A 1TYEB 1EA7A 3VHRA 3T3MB 1FDTA 2FW7A 4EPRA 5M7EA 5EIHA 5J5AA 5DYIA 1T2CA 5FPYA 2NU9B 2OKCA 3U4AA 1KYYA 4ETMA 4J0IA 4BV8A 2UUPA 3IV7A 2HV8A 1B73A 1J2TA 1RYFA 1YDGA 4IV0A 2CT8A 5JDIA 4F84A 4W5TA 4R4JA 3ZJ4A 5BWBA 4XGRA 1FUYB 4DIOA 1A5BB 1Y8RA 2NXJA 4WPGA 4OPMA 3TW8A 4AFNA 4JQYA 1GRQA 3NWPA 3QU2A 2MIIA 2D06A 5GZ6A 4FONA 4M0LA 3IV6A 2JZCA 1GM5A 2CXTA 2H8GA 5L4LA 4F56A 3G8AA 3PQFA 1DEOA 1I6MA 3D4OA 1E2QA 3IBFA 4DQUA 4UXHA 4RTQA 2G0TA 2Z4RA 3B1VA 4R8MA 3EC7A 3IE0A 3QF4B 4BIIA 4DSAA 4YT8A 3ZJUA 3HN6A 4KKXB 2CVZA 1Q1QA 3KPWA 4FHGA 1WD7A 3KYJB 2FV8A 121PA 3SZGA 5C5IA 1YRWA 1P5RA 2OFPA 4RAOA 4F8JA 3IOYA 5IM4A 4UQLA 2HTFA 2ZJBA 4AKSA 2C4UA 1QVVA 1QJ4A 2ET6A 5GM2A 1ZICA 2KQUA 1QCYA 2DWPA 1N8KA 2HBRA 2Y0DA 3DDWA 4GP7A 4PZCA 3INGA 4LGCA 1K8XB 1NBOA 1XEWY 1E5XA 4BO3A 4ISBA 3ZHQA 4J3FA 3SDSA 3BHJA 4M86A 1QZ3A 1JJIA 4LY9A 4P82A 4EHFA 1DS6A 4HADA 4WBNA 4A0SA 4WKNA 2JJ1D 2BF4A 1XZJA 1KIMA 1GGHA 2IYWA 4I1PA 4OYHA 3S2UA 1N6LA 2JAWA 5JAZA 3LT2A 2BBWA 4EIWA 3OMWA 2PR7A 4QG7A 4JSYA 2ES4A 1HK7A 1R64A 2ZYVX 4Q3CA 3WB0A 3WJ2A 4E70A 3BN3A 4QASA 5CMLA 2B8WA 2VK1A 3HCFA 3BWVA 5BMVA 2H00A 3OVMA 4WFJA 3H0EA 1ACMA 3F5QA 2V1XA 2FA9A 3NM4A 5AVKA 1CLUA 4QA9A 4Q7MB 4PPNA 3DMYA 2W6OA 4RVHA 4RV9A 3E9NA 1QHHB 2UKDA 2F3QA 2GFQA 1V5IA 2O1EA 2O3TA 4L0MA 2YWXA 3WBBA 4DQKA 2IYAA 4F1WA 5BSFA 1FJGB 1JHRA 3LY8A 4PLZA 2GCOA 4HWSA 2YOGA 4WEQA 1NBIA 4BV2A 5FUQA 1MJ5A 2HO5A 3IH5A 2VC2B 2Q7DA 2VEOA 4L73A 3TRKA 5B2EA 2IT1A 1UM9A 1XRJA 4HH1A 3AIIA 4I9HA 4F38A 1JDJA 3PFBA 3U9TA 4AZSA 3OCVA 3ZUPA 4KYUA 1Y3BE 1TRKA 1FMLA 1JLRA 2C8VA 4Q18A 1ZGAA 2GF9A 4BMOB 4L2IA 1LFDB 2B36A 2PSDA 1CR6A 2G5GX 4E46A 5HS4A 1X7XB 2WHPB 2ZRMA 3QVGA 4ZDIA 1YCDA 1E1RD 1I01A 3QX7A 3O5AA 3HUFA 9LDTA 1K0FA 4D41A 3V1YA 2LZ0A 1HT1E 4F5ZA 1CVIA 4H4CA 1TL7C 3R0VA 2J0VA 1BN6A 2V45A 4UTXA 3WIOA 3ZX5A 4CKEA 3L0BA 4CVNA 3R7AA 5ILGA 1X19A 1Y5RA 2BP7B 1SZJG 5KVCA 3TUIC 4N39A 1BX3A 1GQRA 2QQGA 1O96A 1LSOA 1OCEA 3BIXA 3FYDA 3GG2A 4IDFA 4U7FA 4UAVA 3VHXA 2YMMA 2X7XA 5CB4F 4X6UA 5IKOA 3W6NA 4B34A 5I51A 2VA8A 1M0TA 3RAEC 1IPEA 1QYRA 1ZGZA 3H2KA 4ES6A 4RTLA 2CDNA 2Z30A 4G1EB 1JR4A 2VAVA 4PC2A 5E9JA 3CVXA 2LWIA 2YICA 3CG0A 1IBLB 4QQRA 1H85A 3NEYA 3CURA 3LY5A 5FV4A 2QRQA 2AOXA 3NUZA 1QQ7A 1SVNA 4JP3A 5D51S 2QD3A 4Z8XA 3H11B 3W2EA 1TJ5A 2DKNA 3HDYA 4X84A 5AW6A 1KBZA 1KDTA 1WB4A 4TYMA 2Q3LA 4JUAA 3T7DA 3K70B 5F1KA 1CC1S 2WTUA 2FMHA 5FA8A 3DFZA 5BUZA 4F3NA 4YK7A 3KKOA 4IRUB 5AM5A 2NUBA 3H5RA 1GTZA 2HMAA 3O4JA 5JLAA 6ABPA 1J24A 4CEJA 2NO6A 2Q6KA 2HJVA 3PR3A 1FF9A 3OX4A 3PNBA 4YQYA 4FDMA 4DMLA 1SCIA 4EZEA 1RQXA 2C42A 1EZ4A 1XQ6A 2FOLA 1WDTA 5FO1A 3T7CA 4F8EA 1MEOA 5C4GB 3SQLA 1EUCA 1QV9A 1A9ZA 2ZSKA 2AFVA 4CDMA 4WJKB 5CG1A 1VA5A 4BZXA 4OO3A 4TSKA 1GHTA 1WWKA 3BEDA 1V48A 3T8YA 1CJVC 2OZPA 1P45A 3ESAA 4HBGA 1TC2A 2EF1A 2E4AA 1DC7A 1DB3A 4JZYA 4HWTA 4M8KA 4YO7A 2AG5A 4RLSA 1HUQA 2M1ZA 2EJTA 1TX4B 4JVOA 4JYPA 1TGYA 2HCFA 3E8MA 1YVEI 1UBGA 2WF5A 3N87A 2X8WA 3O73A 3PF9A 1PG5A 3DG9A 4O2LA 3VDXA 1UBEA 4V0OA 3D2AA 2D74A 1P0IA 1VKZA 2C84A 4FFVA 2D4AA 5AK5A 3U3RA 1BDBA 1RBQA 2OTCA 1QFSA 4BGIA 2BR5A 2COKA 2FPIB 4FSHA 5LU8A 2NO5A 2ZYUX 3GXBA 2P2DA 1HYQA 5EWJA 3TGLA 5THQA 4ZGGA 4K46A 4IO0A 4NARA 4U7GA 4GOMD 1N0VC 2PUEA 1TFUA 4NJEA 1JPVA 4YRKA 2V4UA 2X2EA 5K0TA 3R8FA 4ZVNA 2F43B 4GS5A 4L8YA 1S0UA 3OIDA 1QK5A 1AMOA 2IUYA 1TAQA 2AQHA 2ESRA 3B52X 3SR4A 3QEMB 3TQSA 4XR9A 1R9NA 3OECA 1CZLA 2JBAB 3Q3GE 3PNQA 4QOGA 4MUNA 3MHPA 2PGOA 3VISA 1JE1A 1XD9A 4Z49A 1VMIA 1SD2A 2PXHA 5FPQA 1JWLA 3R3SA 3L4EA 5FWYB 2KHZA 3PA8A 1MXFA 2OUKA 2QLTA 4A8PA 1MG0A 4A26A 2IEIA 2OOKA 3DEAA 2GNOA 2WMOB 3KJFA 3KU4A 2VDNB 3PR2B 4Q7EA 1Z22A 3Q9UA 4FYPA 5ISMA 4JBGA 4PC3A 2FSHA 5CCXA 4E88A 4YT4A 3ICEA 4L78A 1NQXA 3W9SA 1SURA 5B1HA 5BSKA 2QJTA 2ZUSA 4MITA 4B6GA 5JZSA 4URUR 4MLPA 4AN1A 2X1VA 2BVNA 2W8BA 4NQZA 1GKUB 5EWMA 4JLBA 5TRTA 5B4UA 3WBFA 4QO7A 4ZEMA 5M04A 3D2LA 3FNIA 2V03A 3H9JA 4CHTA 5T5QA 3COPA 4ZU1X 3RSGA 4FJ0A 4MW7A 3IEKA 1TCBA 3L7MA 3NBFA 1NQAO 1NX6A 1RXCA 3O1HB 3TLKA 4NCAA 4RE5A 3A4NA 1KZYC 1MU0A 1M8PA 2GN9A 4OAPA 4MQUA 1YONA 1ENZA 1NXXA 2YNMC 3GQBB 5TVKA 4PLHA 4Z2YA 1WKCA 1ORVA 2C9OA 2FRDC 3DF7A 3IVRA 3OIYA 4TTSA 4J91A 2ZTVA 1T1EA 3D7RA 3IDOA 1WMBA 1EJ0A 3INYA 3OQIB 4RK7A 3UUGA 3VMFA 1XHLA 2QGNA 3EFHA 1KZGB 1IATA 3TXYA 3HBJA 4K9PA 3ELYA 3EVFA 4AXXA 1JH9A 1Z2DA 1BXRB 1PD0A 1ZD3A 2QL9A 2SCUA 3LC7O 2V1UA 5ALPA 1EIWA 2B5VA 5EL0A 3WLAA 1KI4A 1U5AA 4KE7A 2ZB3A 3PDCA 3C5WP 3GRCA 4JI5B 2B30A 4U8GA 4XD7A 1Y7IA 3C3WA 1UJ4A 1WXDA 2ZSEA 1N5OX 1YRBA 3IUQA 2IPAB 4DG8A 1DFGA 1IWPB 1NQUA 1Z0JA 2O8NA 3LC2O 5EJMA 1U2DC 2IYXA 4MVCA 4ZCLA 1WP9A 2Y0CA 4ZT4A 3HKDB 1QUEA 2QD1A 4E09A 2C4WA 1GPNA 4NR0A 4RS3A 3I2HA 2IXTA 4P54A 3DV2A 3WQBA 1SIOA 1UFOA 1ZNXA 1YOVA 3RVJA 3W3AD 4JYAB 2FX5A 5CEJA 4IIYA 2QR3A 3S81A 3LZCA 3KNZA 1L4KA 4X92A 4E4TA 5B1EA 3C1OA 3U39A 4G8BA 3P0RA 1VJRA 4KXLA 4QUAA 5A7HA 4FWTA 2DEUA 4U5XA 2BZ1A 3EGWA 1W52X 1VB3A 2H1IA 1NLMA 3PXBA 1L7AA 3MLAA 4IPTA 2G71A 2ZJ4A 1DBWA 4QJ5A 5KYXB 3FHTA 3E9QA 3FTFA 2Q5IA 3WSWA 3EB9A 3HCPA 1RI4A 3OE5A 2IDZA 1ZUNA 5AKZA 5CT4A 4HMQA 4YREA 2VDRB 2RBGA 2VJAA 4Q1AA 3ZXXA 3FPAA 4BVAA 1SJ9A 1M2VB 1O9GA 1U0OC 3B3JA 4ZVVA 3VR2A 3T3IA 4F7DA 4RDCA 4L5AA 3R9XB 1G8MA 1QGAA 1NF3A 3AT1A 3ODGA 4NRDA 4ALKA 1OASA 2FK7A 1CUWA 5EMNA 1VIVA 2HDOA 3DOEA 3VRHA 5HNKA 4OJQA 4D4LA 2BR3A 3BDVA 5DWQA 1XD2A 3PTAA 4QYTA 2SNIE 5EGSA 3BD7A 4D8UA 4RA6B 3DZDA 3SBOA 1ZJWA 4KYTA 4V38A 2ZI7A 4WD3A 2QP9X 2ZUUA 5H0IA 5AW5A 3IR7A 4TLAA 4CFSA 4BNDB 5KOHA 2XODA 4FGZA 4PVCA 5BNZA 5FBWB 3WGQA 1HKHA 1I7LA 1EFTA 3L06A 4EY6A 3L04A 3TF5A 1Q0PA 2XB4A 3AF4A 3BTOA 3LP8A 4YALA 4BNXA 1JVNA 1F17A 5IARA 5AOBA 4R8SA 4OBEA 1Y1LA 5A0FA 1UWKA 5DTEA 2VXBA 1YFJA 2GBIA 5LZ5A 2OP1A 3TSOA 2TS1A 3IMKA 4EO9A 2O57A 5EUMA 4X66B 2HMTA 1HA3A 4CPDA 1E5TA 3FDJA 4Q7QA 5HRCA 1WXQA 3ZG6A 2OCPA 4A92A 5LZ9A 3PC7A 4IAOA 1K75A 3F6CA 4D3FA 3OPNA 3U40A 3N9IA 4PGHA 3WYNA 1YU6A 1WLYA 1W47A 2PR2A 2VF4X 2VTEA 4UBOA 1BYIA 1UPCA 4BMPB 2P4QA 1W44A 4NZMA 3WGZA 1RRVA 3MTBA 1PHPA 1G1MA 3PG5A 1A4IA 4GVXA 1I4EB 3IQZA 2AXEA 3BMCB 4BDTA 4D97A 1QKJA 2I6SA 2HPVA 1XPUA 1XD8A 2MYTA 5JCJA 1U7PA 2H5EA 1QDEA 2XE6A 2MYPA 2E85A 4IOMA 3P97A 4BV3A 3S4YA 1YZGA 3QX3A 1K63A 1HL3A 1WG8A 4OVKA 5AK4A 3U2QA 2I8CA 1GVNB 1PWZA 2RHGB 3ROEA 2IYLD 4GC5A 5JANA 2ANBA 4P36A 3H4VA 1RHQA 3QLUC 2XTZA 3G2JA 5EUCA 5DSZA 1N75A 3PDUA 5H4GA 2XWBF 1NVFA 2GZ1A 2J5XA 3NONA 1WCYA 2GPBA 3QW2A 2C9BA 3HB4X 1KMHA 3O3MB 2E4VA 5IG2A 1XALA 2PLFA 3P9RA 2FGJA 1P3Y1 4I2VA 3UIEA 1VCNA 1HFJA 2BDTA 1ISRA 2KWIA 3JPWA 3LXMA 1B00A 3N53A 3RVQA 1WA5A 3AKDA 3UA4A 3DM9B 1WVIA 3A28A 1W0JA 1Z8HA 1QX4A 4PHFA 2LKDA 1Z28A 2PGLA 2FWBA 4ZOCA 4IGKA 4WY5A 2QMEA 2R60A 2IITA 4Y2QA 3TCXB 4MWOA 1XU4A 3KT6A 4GPTA 3Q5GA 3AR5A 4EJSB 2JHCA 1F1JA 3W4KA 5BO5A 2R86A 4X8OA 4AO8A 4EG4A 1BCSA 2W43A 1XNRB 1GR0A 4JR1A 3WLRA 2PGDA 2ZJAA 3TE7A 5FYQA 2X23A 4CKBA 3DA8A 4P38A 4B09A 3FGPA 1MABA 2NLOA 3LCCA 4N7MA 4KGVA 1G2IA 3FYUC 4ZQFA 4ZQHA 1IU9A 5FFFA 3TTWA 2N1BA 4Q4AB 4BS9A 1PGOA 2G17A 3DZGA 1HE8B 3TXAA 5KPJA 2XZLA 1CIVA 1FVFA 1VHLA 2I1QA 3T95A 2AKAB 3K94A 1B0PA 1U3VA 4UHBA 4XPIB 3ASYA 1WB5A 1XIVA 1D2RA 1TI7A 4Y0VA 5HCIA 1C8BA 4RY2A 5HJ5A 1S8OA 3U60B 4LHZA 1KBOA 4OXXA 1XTBA 4KBYA 1U8AA 3CE9A 2YHIA 4FNAA 3P71T 4MZDA 4AMUA 2VP0A 5HIIA 2NTYC 2PT9A 3FMOB 4DLPA 4MW5A 1NLZA 2X58A 3JQAB 1IAVA 3OZGA 1SU4A 4ZI5A 5EIOA 1N8SA 2DQYA 1YK1A 4P32A 2G36A 4X41A 1VG1A 3SJ7A 1NW3A 1NNUA 2YBEA 1DDOA 3PTZA 3JD0A 1QF9A 2AG0A 3D3QA 4RY0A 3W2IA 4KQ9A 2H9AA 2I4MA 2PYZA 2ZSBA 1Z56C 2IA5A 2I78A 3QWFA 4KXQA 3I0MA 2I33A 1RJ9B 4GZ3A 4MK4A 5ICGA 3N86A 1EK2A 5LQNA 5ALWA 3OHMA 2V6GA 4MUBA 1LXCA 3KJGA 4C88A 1FXWF 5BP7A 2OL4A 2GDJA 2QG6A 1PNTA 2RHMA 4HUQA 1Q14A 1YCGA 2HA0A 1MLDA 3V1LA 2AMYA 3B20A 1L7XA 2PXCA 5FI5A 2G09A 1AIPA 4J3NA 3WDLA 1Z8NA 3FZGA 2JJ2A 2EJVA 1GQSA 4TMFA 5MN5A 3DEZA 3NMUF 1TYZA 4CIYA 1JIXA 5CNJA 2VUUA 2QBYB 3GFPA 4J0JA 4WZ6A 4KN9S 4M0DA 3PX3A 2IP2A 1FP4A 3AB8A 4R9UC 2V6FA 4FXPA 5A2QA 1NY6A 4D9IA 1IOVA 2K87A 5FWXB 3QHQA 1SC9A 2DE0X 1P8JA 5L45A 4G0VA 3GRFA 4NYIR 4YECA 5SY4A 5JAHA 2MR6A 1V8ZA 3M6IA 4TKZA 4CKCA 5JRZA 3KBBA 5KWSA 4X7PA 1H0SA 1CFZA 3EZYA 4MROA 3RO7A 1YASA 2OO7A 2WFLA 5CVJA 2VHCA 2AI1A 5HXAA 1IZ7A 2D4HA 2WHRA 5BUSA 2D3WA 3QMMA 1VLHA 4C0QC 2CJWA 1IBSA 4KMRA 4U0KA 4M1YA 4YRCA 2XBLA 1OIVA 1SG9A 2H1FA 2XYVA 1GKYA 3SE0A 1X0XA 5LLSA 5ERGB 4D4GA 5TX7A 2OXEA 1R6TA 3U0BA 4B3SB 3ZKWB 4HHEA 1FRNA 2PYDA 2YYAA 4B35A 4Z4HA 3ABRB 2XXAB 3ZTYA 2C59A 1YKGA 1RPAA 4JOBA 4B4VA 1E3WA 2UZ1B 4JVLA 3LKZA 5ALUA 1LB1B 5AM1A 4N12A 3ONVA 3FDFA 5T3YA 2O3UA 4QGSA 5JNSA 1OZ0A 2IPMA 2X19A 3A1NA 3WNDA 3KOOA 1ZMXA 5JMWA 4V2IA 1D8TA 3OU6A 5EMLA 3S44A 2WTAA 4JUBA 1G4UR 1RMYA 3CZPA 3U7QB 3SYNA 4HY3A 1NUTA 2FDRA 3AR6A 3K0SA 3G2HA 3QKTA 1AA9A 3LJKA 5DGIA 1E1YA 1KRHA 1RLJA 3A1TA 4PNEA 3KO8A 5IANA 1F60A 5IDYA 8OHMA 2JLXA 1M8KA 1M7BA 2DAPA 1TK2A 4QREA 1DINA 3QVXA 2GT1A 1L4LA 1NFRA 3GBVA 1BXRA 2SCUB 2VQ3A 2ID9A 2VJMA 3ANMA 2PRSA 4GOLD 1N5MA 3TL3A 4I4IA 4E6EA 1P4GA 2CLSA 1WTCA 2DM6A 4LTMA 3KOMA 1CNEA 3Q15C 3K6KA 3ZGZA 3H0CA 3GLSA 5CK4A 3BD9A 2Z2YA 2VYCA 4MPRA 4IVRA 3WYDA 4QODA 2BFBB 4RIFA 2EWVA 3HVJA 2DH6A 1U2EA 2QTMA 2BMVA 2G77B 1TVCA 3JZIA 4NBRA 3UICA 3UXMA 5IDQA 5KQSA 1CS4C 3BFPA 3BGSA 1G3QA 2QNBA 3CNOA 2DHDA 4KPGA 5EVJA 4QUGA 3D6JA 5JJLA 2PN1A 3EVCA 3R7NA 4YV2A 4N7RA 4RHCA 3H1FA 5EEHA 4YCSA 3MJSA 1I3NA 1F1BA 1W34A 4ND8A 3ZGOA 1AF7A 1KVUA 2HWUA 1KFEB 1ND5A 3L1VA 4YDHB 3NH9A 3NTQA 4ZCRA 2E1PA 1GU0A 1U81A 3K4QA 5JY6A 3TKAA 3OO1A 5K6RA 4L0DA 2BKUA 2H1LA 1WPQA 1MPTA 3DLPX 3GGDA 4OQLA 1D2HA 4GVPA 5EKTA 1W25A 1ADJA 2JFPA 3NALA 1TM1E 2AKYA 4WN9B 3RJ5A 3RRYA 4P86A 1K97A 4DJFC 3MEQA 2YWHA 4QYXA 3EVGA 2GEUA 2C8LA 2Q50A 4IG4A 3LP5A 1CUSA 1V9LA 4P4UA 1ODIA 2RG1A 1WOYA 2HFKA 3TK1A 4BLTA 3I8OA 1DCFA 3SPXA 4I4NA 2D2IA 2OYCA 1HQDA 2O05A 1SBIA 3KTFA 4LKRA 2QT1A 5DBFA 5E8JA 4FOSA 4FEYA 4F9GA 5KOIA 1ZIYA 2HPAA 4H59A 3O0TA 3O4VA 4LZLA 1DRUA 1U2DA 4TMVA 4F6LA 2AX3A 2I3GA 1WUHS 2JJ2D 2R00A 3KPUA 3C7CB 2PL1A 3PB3A 3TQCA 3VX3A 3CF4A 1L4NA 1V95A 4EX7A 1FY2A 2VRWA 3ZW8A 1IOZA 4WCDA 2QYHA 4MEBA 3MS7A 3DT6A 5BYJA 4ZCTA 1WBDA 2X2OA 5JTTA 1HE1C 1NN5A 2FXIA 3BE6A 3JR3A 1EP3B 3R09A 5EFOA 1RI5A 4RGVA 2ODWA 3KYDB 5CXXA 1GZ5A 4TQUS 4YRIA 4JXXA 1UZLA 1ZWLA 3KP1A 1BQ4A 2BCEA 3DSRA 4FDLA 4FOLA 1G63A 4GHWA 4JLUA 5GMOA 5LP6C 3T38A 3V33A 5FTKA 5CCBA 3GT0A 1HV8A 4M8NE 2XNJA 3UATA 5BQFA 2XSZD 1LI7A 2GLTA 2NU6B 1JLMA 1IBCA 3HJRA 4AT1A 5BOSB 5I47A 1MAWA 2Z1DA 1QO7A 4O4IA 4FE4A 2PGXA 1I0IA 1NW9B 4GFDA 2GVZC 2X77A 3B1JA 5CYFA 5DBOA 4ZA2A 2RH4A 3I1JA 4CLHA 2R00C 1T4BA 2O8EA 3CLTC 5C7OO 4LJAA 5AVSA 1NV9A 2ZJFA 5EGNA 3I5XA 2R11A 4LHEA 2PCLA 4D56A 1J06A 3MG9A 3IBTA 2BLLA 1BEZA 4RQUA 1EJ2A 2O1WA 3IHLA 2PXAA 1L1QA 4CM8B 3IUPA 1ZUIA 4GSYA 3BKWA 4EDHA 5LD2C 3GCGA 2LDXA 1GAQA 2G5TA 1RAIA 3AF5A 2FX2A 4Z1MA 4N1AA 2DMRA 4EUSA 3LO5A 3IDAA 4YQEA 5AR1A 3B13B 3ZCTA 1D6JA 2H1SA 1HRDA 3PGLA 1AN0A 2ZE8A 1YL5A 1TKRA 2ZBFA 5EAIA 2APJA 4H17A 3KUDA 5GGYA 1D2AA 1T5BA 2VZLA 3OZFA 2FVXA 3SC2A 3C6MA 1CU1A 1NRXA 1ZH6A 1KAMA 4DIUA 3BHIA 4TMXA 3AYXB 3EYWA 3I2IA 3K0BA 5IJAA 2EBUA 4HEA6 4EA9A 4RBNA 2IEZA 1T2UA 4IJMA 1T3LA 1DE0A 4RE6A 2NAPA 4HPXB 5K3SA 2GJKA 3CISA 2OMEA 5REQB 3T34A 5DK6A 2I99A 4HMPA 2HJHA 5BSTA 3TOZA 3REQA 1GRRA 4TQGA 3RIEA 3EC1A 5D7BA 2Z56A 3W5AA 4RXTA 2QV7A 3RGWS 5HZKA 1SC1A 1FMCA 4L5IA 1U4NA 5C8VA 1A27A 1JXAA 1XR3A 1ZN9A 1I7QB 2DC1A 4RULA 1J00A 2CXRA 3EEBA 4EJ0A 4IIUA 3C74A 4KQ6A 3FOEC 3QA3E 5D3ZA 2WJ6A 4HVTA 1KJJA 3VR3A 2GAJA 1E96A 1EGAA 2IXDA 1CRWG 2VOEA 3ORRA 4TT3D 2AK3A 2P2CA 3VC7A 1P2FA 3D8BA 2ZLBA 2JI8A 2XCLA 1N2BA 2WBLC 1XJ0A 4CM9A 4ER6A 1P74A 2DG2A 5EXDA 4LSMA 1CJMA 3MRXA 4EFKA 5EOVA 5LBIA 3UWPA 1UT6A 4Z53A 5ITZB 4Y1EA 5IAGA 3WOHA 2UUAB 4C5AA 1XEXB 3D8TA 1MAVA 1BJKA 2B1QA 2F43A 1II8B 1QFXA 3OLWA 2Q0HA 1B42A 2O3JA 4QO8A 1G16A 1RKXA 4X1YB 2YVQA 1EI9A 3PUZA 4N3CA 3N05A 1YJ8A 4HRVA 3ZWOA 1TTHA 3IAUA 1RQLA 1H0KA 3DE5X 1DI0A 2JBAA 1CY2A 4IJ5A 2A5YB 5CDFE 2IYRA 1GL9B 4JLSA 1RPZA 4O59O 5CITA 4EPWA 2BFWA 1AF4A 1DQNA 1RCTE 4Z54A 5B3JC 2OXRA 4ACBA 1YRAA 4MKHA 1CE8B 2NQ8A 1EBUA 4MVJE 4QECA 4BV9A 3VJRA 1L7OA 1DBQA 5CX1B 1YB6A 4TTPA 3E7PA 4BFTA 3BK2A 4LBVA 4N6OA 2H4WA 4C7BA 4CL2A 3COZA 3H9CA 2FSVA 1RP7A 1R4ZA 2G1AA 1PSZA 2NSHA 1H1TA 1E1DA 3BL5A 3ES9A 3PD1A 4LVOA 1XVLA 4NCXA 2C2KA 3AEQA 5C34B 4GKVA 1DBSA 2X40A 3DZBA 3UJ6A 4B5KA 1PCXA 1ZJZA 4CW7A 1MO4A 1MXHA 2ZPAA 3DFUA 1JQ3A 1YUBA 2OLJA 3JV7A 4HGPA 2OV3A 3K0HA 3WIVA 1C81A 3RANA 1N6OA 3AL2A 3BA6A 4GM1A 4JN6B 1BXZA 2QUHA 3SBXA 3SHTA 3WY9A 1XLTA 1WUTA 3D0KA 3IDQA 4A0QA 1PL6A 2B35A 1TO6A 2BFPA 1DBIA 2XUDA 4XGQA 4S1VA 1U8TA 1JLHA 2GPAA 4NY1A 4X54A 1VGRA 3EUWA 3D6UA 2H4XA 4GKKB 5M2QA 3BL8A 4NZZA 2JG3A 2GZ3A 4GPZA 4OMCA 2BH2A 4J0GA 5EE1A 3PQEA 3TSAA 5HYVA 1D0SA 1KIAA 3E03A 5IKPA 4Z7NB 3L5KA 2XT9A 2OR3A 1QBKC 1YA4A 1NNI1 2QPAA 3B3GA 4IOLA 1UP6A 3CUEF 1U28C 3JTMA 4GRIA 4KTTE 1JYFA 2I2AA 2LR0A 2V54A 5FIUA 2J87A 1U0TA 3EXEB 1CUCA 4LYYA 3WWCA 4B33A 5ITZA 2RD2A 3TCKA 1IZ8A 3CR8A 2DUWA 3K0FB 1P7YA 4BASA 3FM9A 1PZMA 4PN7A 4FGKA 1Y6FA 1KS9A 1QH1A 2ZT7A 3HCBA 2UYCA 4LNUA 3T9CA 3DTVB 2XUGA 3RSOA 2RAPA 5C1IA 4N47A 1E5VA 3OWXA 2X14A 2WJWA 5AI4A 3K09A 3QKSB 4JC8A 5BNFA 3WV5A 1WBBA 1D8AA 3R0JA 3WNCA 4BX9A 1EM6A 3B3AA 4WNCA 2NU9A 3SNHA 3RU7A 1QWSA 2X8BA 3S2FA 10MHA 3JQ8A 4WINA 1M0EA 2VNIA 3FKQA 1QE0A 3M1LA 4JOCA 3WZLA 4JI1B 1T0JB 4PG6A 5KYXA 3DPIA 2Z6AA 2QL6A 2WUVA 1JKMA 4IV5A 3AJRA 3QIVA 3I42A 1PV4A 5KQMA 3DE0X 3PGMA 4OSOA 4XWKA 5IJ9B 1I24A 4MCIA 1R88A 3IELA 4C3VA 2P3LA 2FZGA 1M2OB 4ZEWA 5JCPA 2NZVG 3NVAA 4RK5A 4QTZA 3IV9A 1K89A 3KYCB 5ARBA 4UMEA 2EGGA 2C1ZA 2VH1A 3DAHA 3F46A 2BDUA 2QIOA 2A58A 3EQ2A 2G5CA 3C45A 3NHKA 4TVBA 1N6RA 5C7IO 2WB4A 4FINA 1WDLA 2MMCA 3QFFA 4JK3A 3RT7A 5A9RA 4HOYA 4H6WA 4GAEA 3COWA 2FLWA 3KL2A 2PMWB 4I9UA 1DWPA 2J3MA 2O6LA 2QRGA 2WYUA 4A6XA 2DPMA 3JAKA 4BMNA 1F4VA 2WK1A 3RROA 3A6KA 2C3YA 2KMLA 2ZBGA 4H60A 3PGA1 4WX2B 1XU9A 2Q2WA 4X44A 1G8KA 2ZTHA 4MB6A 4ZHQB 4DCGA 2XADA 4EY4A 3QFRA 5U1PA 3GJ4A 1X7ZB 1I94B 3IODA 3KWMA 3W9UA 4IHQA 2GKOA 3OH8A 5FX2A 2BEUB 1QF6A 1PN3A 1DC3A 3NVKI 1DXOA 5K01A 2ZOSA 2IXBA 3NEAA 5IJ0B 5CDTA 2XH8A 2KJQA 3QLUA 5CK5A 4XJSA 1QQTA 2O4CA 3K6SB 2B8JA 3LPAA 5TR9A 1SN7A 5B57C 3OT1A 2JHPA 3VU1A 1GL3A 4DEXA 5AK6A 3CVUA 2ZBVA 1Z7WA 1CVRA 1F2UB 3CW2A 4GOND 4R8RA 5CT8A 4Z4FA 2WWIA 5BV8A 1R5NA 3O1LA 4PN3A 2ODPA 4ZKDA 3KQHA 2WG2A 1CZRA 1CUXA 2NQTA 2A9FA 5LQSA 3ERCA 3O75A 2C4TA 4B44A 4X3PA 1SHKA 4R1QA 4Y1RA 4JXZA 3AEUA 1Y37A 2B4KA 3BMQA 4MYCA 4QE3A 5DLQC 1RXVA 5EIBC 3FUXA 4LMBA 5CFRA 1NFFA 3EIQA 1TVKB 1Y4UA 3Q88A 1QOPB 1IUPA 3B1KA 1M6VB 4AP9A 4WK0B 3IGFA 3RUCA 4BBAA 4Q03A 4RZXA 4KOAA 1CVLA 1L5FA 2J7PA 4TRMA 3OETA 4HB2A 5KOJB 3THOA 4OUDA 1O97C 1T36B 2FFBA 3FG9A 3ORYA 4X45A 1W0CA 3VZRA 5KNBH 1FFHA 2OAGA 2V7QD 4WOKA 1LPSA 2CVPA 1D1QA 2O2EA 3A6ZA 4YACA 5KSZA 3EODA 4ML3A 4TWJA 4IFTA 4LXQA 4DPKA 1A7UA 2PZ8A 4GC9A 4I99A 3SLGA 5JZOA 4NPAA 3SOZA 1VPLA 1X1TA 5T8KC 1IBKB 3C3KA 1DJQA 5H81A 1XKQA 1YE5A 1XL0A 2N3ZA 5KDDA 1I14A 1ADBA 1P1BA 3GLKA 3KK0A 3BRQA 3ETGA 4PIVA 1XJCA 5IDVA 3UGQA 5ES3A 3ZHZA 4BFYA 4ND4A 4Z0TA 3DLBA 3PPXA 3DCYA 2I9KA 1V7ZA 5ERYA 4EJSA 4EL5A 2XYGA 1QV7A 4OG2A 4IO1A 4AS2A 4F2DA 3MCAA 4WBXC 2C4VA 2RKWA 4XASA 4D81A 4OKIA 1U8YA 4NL4H 2XUAA 2OORA 5AIAA 2XYRA 5FTMA 3H19A 3T0FA 3B85A 4F60A 2QM8A 4EYQA 2YXEA 3MK31 1V4BA 1WMFA 3R3HA 2G9UA 2XUJA 1RPNA 4M1QA 1IUOA 5D00A 3RHSA 3C48A 4C0BA 2DCUA 3G5TA 2BKEA 4X5OA 2I6XA 4NYMR 2CKMA 4ZANA 5F51A 3VOBA 5A1TA 5EIXA 1UWVA 2UVPA 2PD6A 3FSEA 1K6JA 1O03A 5B1YA 1EFVA 1ONBA 5BT8A 3KHKA 1M34E 2DUNA 1Y5NA 2FSGA 2C0QA 3ELDA 3FBTA 5AHKA 3D59A 4JLVA 1POWA 1S89A 5GWXA 4GLLA 4HN9A 5A6VA 3AVXA 4AUKA 1XWIA 3IAS1 3B6JA 1Y80A 2XMDA 4IMJB 4D8TA 5KDOA 4G4GA 2AV6A 2VTBA 4IQGA 5HTKA 1JSZA 3BGVA 3S55A 1KQNA 3X1MA 4I50A 1YH3A 3FIJA 3KZCA 3CLTD 2KLHA 4BFZA 1Z29A 1ABFA 3EMVA 1MHPA 5ALZA 3RG8A 2IYSA 4I46A 2O0HA 3LXUX 4F72A 4CYMA 1XRMA 2D13A 1P9OA 4H1VA 5IPFA 1Z5ZA 1O6FA 2AXQA 2GHQA 3ESDA 4Y1FA 5AKLA 3REQB 3UHJA 3NDPA 2FUG1 5EJ6A 2EOAA 4WZAA 2WQZA 2CMGA 3F3MA 3SKVA 1AGNA 3LW7A 2DKOA 3CF6R 4ND1A 5JHHB 2IVZA 1T3GA 1G18A 1GFIA 2BWJA 3QNUA 4L5JA 2PNJA 4DFDA 2BRUA 4OHXA 4PFKA 1C2YA 5E6UB 4O8ZA 1AHPA 3QIAA 1L5HA 3PBKA 2LVBA 1UJNA 3L05A 5IHPA 1N6HA 4OJNA 1W5EA 3E82A 3GLIE 2I76A 1TMKA 1XC7A 1P5HA 3HGQA 6CHYA 1X70A 4CMIB 5C5DA 3I52A 4LSWA 2JLSA 3N6XA 5ER9A 3L0OA 3GPDG 3FKJA 2F59A 1SY7A 5EE9A 5C9ZA 2RCYA 2R96A 4PANA 1R8QA 4XSHA 3WGNA 3BMNA 2VK4A 2DFKB 1MJGA 1PLKA 1ZQ1A 3GHYA 3KZKA 4AO6A 3J81k 4HNGA 1Y33E 3RQSA 4F3KA 2AC4A 4D8YA 5HE8A 4FGUA 4B79A 4A2PA 3C6ZA 2FN8A 1MVNA 3RVMA 4OBWA 2JLWA 1ZO8A 2Q6OA 2ZIXA 1V1MB 3KQSA 1IONA 4G07A 4OEHA 2PKWA 4H7FA 3BIJA 2WICA 4KQHA 1XXHA 5IZCA 1N77A 1LPOA 3E22B 4NS1A 2IHKA 4Y98A 2NO0A 4D45A 1GDTA 2H1OA 2CUTA 3CINA 1UKAA 1S3GA 1QOZA 3GBSA 4AZ3B 3TECE 1JEAA 1N5KA 3A1FA 2CV0A 4L9RA 2M6RA 3QUAA 1K6IA 3HWSA 3KEGA 1GVHA 4YMHA 3DHVA 1MORA 6NULA 4BXOA 2WTEA 2KLBA 1J90A 2W4IA 2WYHA 1ZZGA 1ULHA 3OCYA 5LOVB 3GLFB 2J46A 2DXIA 4Y9DA 4J75A 3AETB 2B99A 3B7WA 3ZHYA 3DZKA 2ZT8A 3QBVA 2ZRIA 4KRYA 5EE5B 4BVLA 3OKFA 4EJ2A 2FDCA 4RQAA 4PYKA 3LOQA 4DY4A 5BSVA 1X9GA 1QMGA 4BQOA 4MRPA 2WFAA 3MJDA 1A8SA 1MP0A 1BXKA 2WAXA