2X9QA

Structure of the mycobacterium tuberculosis protein, rv2275, demonstrates that cyclodipeptide synthetases are related to type i trna-synthetases.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
236
structure length
231
Chain Sequence
FQLGRRIPEATAQEGFLVRPFTQQCQIIHTEGDHAVIGVSPGNSYFSRQRLRDLGLWGLTNFDRVDFVYTDVHVAESYEALGDSAIEARRKAVKNIRGVRAKITTTVNELDPAGARLCVRPMSEFQSNEAYRELHADLLTRLKDDEDMRAVCQDLVRRFLSTKGATATQEQVCMDYICAEAPLFLDTPAILGVPSSLNCYHQSLPLAEMLYARGSGLRASRNQGHAIVTPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLODIPEPTIDE SYNTHETASE
publication title The Structure and Mechanism of the Mycobacterium Tuberculosis Cyclodityrosine Synthetase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 82
structure length 231
sequence length 236
chains with identical sequence B
ec nomenclature ec 2.3.2.21: Cyclo(L-tyrosyl-L-tyrosyl) synthase.
pdb deposition date 2010-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16715 CDPS Cyclodipeptide synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2x9qA00
3OQIA 4Q24A 3OQVA 3OQIB 3S7TA 3OQHA 2X9QA 3OQJA
chains in the Genus database with same CATH superfamily
4KV7A 3QVGB 5AKYA 2Z04A 3W2IA 2DGDA 1F2UB 1NF9A 3ANMA 3QXSA 4HMQA 2NNWB 2O4CA 4ZJYA 3KEMA 3SYRA 5AUOB 3WAGA 5BXYA 1SC6A 2ETVA 1GP2A 5EJMA 2PSHA 3INTA 4J7XA 3VTFA 4OTZA 4EPVA 3PUHA 1SUPA 2OFWA 2G6TA 4EHDA 2WTUA 1PR5A 2MSDB 2P2ZA 4QL3A 3S27A 3DG9A 4BTVA 3WJAA 2C5HA 2EFYA 2WJJA 4HAXA 2IDKA 3OJFA 4M0MA 1K9SA 1Z6GA 4RDIA 2WLTA 4YRZA 1H93A 2RAPA 5EPOA 4ZI2A 1WCV1 4UU1A 3RHFA 5EGSA 2GZMA 4H4EA 4XARA 5EMMA 2H1SA 4R31A 1U2GA 1ZOSA 1W9HA 2FEMA 4FJ2A 2VDNB 3K71B 3EMKA 1VJCA 1V45E 3K0CA 3SI7A 1SY7A 3ZH2A 3UJ9A 4DLWA 3RVKA 4JWTA 2ZBUA 4PZEA 3VKUA 3CE9A 2CZCA 5F76A 1LWOA 1YQ9A 2WD7B 2UZAA 3M81A 3NOOA 2J3QA 5KQRA 4YXFA 1H05A 1KI7A 5BW6B 3DMRA 2VSOA 1ZVMA 4CMCA 3C0KA 5KJ6A 3WIEA 1I3MA 3OBBA 3ZCVA 3GP3A 4P32A 3TH5A 4ZVVA 4X84A 5G1PA 1GNRA 1ZXXA 4FFBA 3F5FA 2QTFA 3QKUA 4JJEA 4M7OA 1U9JA 4YMUA 3CT6A 3HUFA 2OV6A 4KH0A 3TLJA 2JD0A 1GL3A 2A30A 4QYXA 3UK2A 3IBFA 3K6KA 2HDWA 1RYDA 1Z83A 4WADA 1US8A 4QUHA 4HFNA 4DL9A 2WV7A 3HR7A 4F8EA 3PJRA 1JIUA 4HGZA 1FMJA 1REQB 4ZEXA 3U3RA 1MJGM 3RFUA 4DHWA 2EIHA 2W2OA 3P52A 5FPHA 2H4HA 3O4GA 3ZDEA 2EP7A 1W8DA 4IMRA 4QBIA 1E20A 2PWZA 2VH1A 3TZCA 2QG6A 1MR3F 2WB4A 2ETXA 4JI6B 3TLEA 3UFXA 1IJKA 1IZZA 1ONOA 1RXYA 1TUBA 2WZQA 3KQSA 4WK4B 4IILA 4ZD6A 1FTSA 2DTDA 2JGRA 4KE6A 2WIKA 2YIVX 3IEIA 4AP9A 2CMGA 1OBVA 1XAHA 1TMYA 3QITA 5C1IA 5JH7A 3V8MA 3P2JA 5B3JA 2C03A 4ZHQA 3U16A 3G2OA 4IH1A 1XXHE 3A0RB 4LOIA 2DQ4A 3ERCA 4TLEA 3HP7A 3FPHA 4CEIB 1I8TA 3IO5A 1I4OA 3JR3A 4G1EB 3ANLA 3HNPA 3KVOA 4P93A 3FAKA 3L8GA 4Y6PA 2NVWA 4QICA 5AVJA 2G9RA 4DIFA 4B3HA 3N3BC 4RPIA 4UNNA 4W9NC 1JW9B 3CF4G 4PX5A 4RHXA 3LHDA 4JBLA 3RHTA 1KZHA 2IS1A 1LSOA 2XOKD 2W5UA 4KNWA 3U3MA 121PA 1WUJS 4EAQA 4KIGA 1NMQA 1D04A 2SKCA 3NM5A 1U7XA 2AHRA 4MRSA 4AX4A 1F06A 4BNLA 3FTNA 1J4AA 2BV3A 3QE4A 4YX9A 4J7CA 2ZB8A 2HFKA 2B78A 1S2DA 4RJIA 2W2KB 1TD9A 1KY2A 1XRLA 1PHRA 4N7JA 3R9KA 3GEHA 1UC8A 3OTIA 3ZNQA 3RARA 4E7OA 1ZCBA 1E2NA 3KKQA 4NL4H 4FWTA 4ZVQA 2N1MA 2JI4A 1KFCB 2CFCA 1R0CA 2JLXA 2CLLB 3P2OA 3VNBA 4HGRA 4BKUA 5G0VA 3H04A 5L7WA 4HNSA 4HEQA 3HEAA 3SBXA 2Q3CA 4UTRA 3PQ3A 4QOEA 3A31A 2A0UA 4QUEA 2OMEA 3LQQA 3WMFA 1EZ4A 3I34X 1DKPA 3B48A 3I8SA 1UANA 4DREA 1UJNA 4XFDA 1DFGA 3W9BA 4LDAA 4TXJA 3LNCA 2QVBA 4JLAA 3NRCA 1SG6A 4I9UA 5CXQA 2YZGA 2E7ZA 2ZRDA 3DVQX 1DIOB 4PC7A 3QWAA 5AUPB 3ZIDA 1R5BA 1V16B 3OE4A 4A26A 4LFAB 4NXMB 4G6ZA 3JQBA 1M1ZA 4EM6A 1MW9X 4M9ZA 1G5QA 4RADA 2Q3BA 3CBQA 3N0TA 2G08A 3FUXA 4HT3B 1Q1NA 4OHKA 3T99A 1C2YA 2HC9A 2ZJ7A 3HU1A 1J1UA 3T06B 3PWKA 3W5UA 1U8EA 3UA3A 4LUCA 3R8XA 1ORRA 1PEYA 1Y81A 2DY1A 1UMKA 2Q4EA 2ZQZA 5DRYA 5EIOA 5KBYA 2I6SA 3FCAA 1M6NA 4TSKA 4HGQA 3OQIA 4HDRB 2NYAA 2YH2A 3DEAA 1M1YB 1C3EA 3JASA 4Q19A 1IFXA 4FOPA 2HJSA 5DHAA 5EVJA 4G9BA 4DQDA 1FFHA 5GMOA 4FE4A 3ZZMA 3TUIC 5EXSA 1U3FA 4RDXA 5DN6A 3AH8A 1J20A 4TLLB 3T3EA 3VDNB 5CRIA 3ETEA 1YHZA 2WWTA 4S04A 2YFYA 5E9AA 1B6TA 4EGJA 2GI4A 1QS0B 4HQ0A 4MYTA 1HO3A 1XG5A 3PFNA 2QD3A 3VAZA 3JQ8B 4PZCA 4WNIA 4EMTA 2YV2A 3HB5X 2YFQA 1ZUNB 4LC9A 5EXDA 3RIYA 5JW6A 3G8YA 4G0QA 1Y3IA 3PXUA 4I4TA 3RVQA 3UAYA 1LJ8A 1E64A 3IDFA 4N49A 1KP9A 3F3KA 2WHYA 4FDMA 3SX4A 3MT0A 2OZLA 4IHKA 3ADOA 1JI0A 3PFGA 3HN7A 4E4TA 1JJAA 1IK4A 1G8PA 2CSUA 4LNHA 4RPLA 2BKUA 4UNPA 1YBHA 5ALZA 1OZHA 3RC1A 1JI3A 4H3KB 1WZCA 2HLHA 4QASA 2RI1A 4O4LB 4MS3B 2IYXA 2CHEA 3OOSA 3R76A 5EMKA 5IKOA 1DO2A 3LBYA 1I6LA 1O3YA 5AM1A 3N75A 5IAGA 3WRYA 1BXKA 1VKJA 2JFVA 4Y6SA 5J58A 4DV3B 2VDWA 4GLBA 1U2RA 1OI4A 1M0SA 5JS2A 1NR5A 1BFKA 2IX3A 5KTTA 1THGA 4H7IA 1VSUA 4OI2A 3RC2A 5J4VA 4CODB 1L7AA 3MGAA 1FFYA 1N0IA 3AIMA 2VTEA 1LBHA 4AY2A 3CVUA 1EJ0A 1X77A 4UUMA 3JATA 1LC0A 2P6MA 3G0CA 4XEHA 3IBCA 4CCWA 1GZUA 1IAQA 3TDNA 3K73O 1D9ZA 2XT9A 1PLJA 3OFKA 3Q2IA 3LWNA 2L0XA 5ESWA 3V2GA 4I1SA 2OZPA 1YRBA 5DBIA 5JECA 1QK3A 4QELA 4BN4A 2YYZA 3CLVA 4MGHA 1Y6FA 2ZUEA 2DBVO 3OUUA 1BCSB 1INLA 4O2AB 4CLOB 2X23A 3WFJA 3L7OA 4MR7B 4UDNA 1OX6A 2JFUA 1HKUA 1E99A 4QGAA 5HKLA 3KAQA 1S8AA 1DDOA 3OUTA 4IVPA 4KE9A 4OF4A 5DNCA 4MYRA 4ZAGA 1ADYA 1KBOA 1LVUA 2ODPA 2CZQA 3JQCA 4R7ZA 3V4FA 3DZCA 2IBTA 4Y2UA 2AKYA 1XAGA 2Y1KA 3KJQA 2ECQA 1QGUB 4L8FA 2MCFA 1AV6A 4FMCF 5FBQB 2WFMA 3L4KA 4URWR 3ZCUA 2BI8A 4M54A 1DLJA 2O48X 5J5AA 3GARA 4UHDA 2NMVA 3NH6A 4M60A 5DNDA 3EAGA 1MTOA 3QVGA 4Z9BA 2VK1A 3W1VA 1Y6ZA 4D44A 4PSUA 1K6JA 4IF6A 3OCVA 3SJUA 5D85A 2D1FA 3PDHA 4IJMA 2QOEA 5GPBA 1NLYA 4KNVA 4NP6A 3SR0A 1E9SA 2C92A 5CFZA 1QE5A 4EGAA 2GPJA 4ALIA 3OHMA 4WXMA 4C5CA 4LECA 4LCEA 4YCAA 4EF6A 2I4LA 2TMKA 4ENWA 1FNNA 4BDSA 2JH3A 3AESB 3AVPA 1HSOA 1WV0A 4EKNB 1GA4A 4WXEA 1S0UA 5GAJA 4LPKA 2X2FA 4UDOA 3K4PA 1C9KA 1NU8A 2V4ZA 5KC9A 4A1FA 1Z0IA 4PXAA 3NJ8A 4GMHA 4YUXA 1PP4A 3RVLA 2ZXEA 4WLVA 2TYSB 3BULA 3M1YA 4LRWA 1GPAA 1KY3A 2FRVA 5H1YA 5I9SA 3P2KA 4H7KA 2WD7A 3H1PA 3JYLA 3LPDA 3OFNA 5EE1A 5GWXA 1M7HA 4Y6QA 4B84A 4ZCQA 1XHLA 2SKDA 4MLZA 1VA4A 4I50B 4DSAA 1T26A 3UXEA 3T7AA 4G0VA 3TTXA 5K8TA 1KVQA 2HIHA 3KLOA 4U9HS 3I52A 2GD2A 4QIHA 3GCWA 3OKFA 4ZQHA 1SIBE 5ECWA 4RTKA 1IJBA 3O8RA 1SXJE 4G36A 2PK3A 1S3FA 3QKSB 3QU2A 4DB2A 2GBIA 3QPBA 4YMVA 1SC9A 3QHQA 1WM1A 1ZBDA 2QYSA 4IINA 4WZAA 3EG9B 4M49A 3U1VA 4YJHA 4EG7A 2NVUA 1MTZA 4UCWA 4L0CA 2FPXA 1JHAA 2Z57A 1M6EX 1UUFA 4LXXA 5AK3A 3G3EA 5FOVA 1KY5A 4ILKA 1GGEA 3HV0A 4HSEA 1SPXA 2PT6A 2XIJA 3DC2A 4CM9A 1FCJA 4LJSA 1T8SA 3SICE 3QEAZ 3KHKA 1ZA1A 1GUZA 3HFGA 1TT5A 4XR9A 3KJZA 4LWQA 4CN9A 1CNEA 2G82A 3I32A 4RNDB 5TT0A 4UE2A 1GY8A 2JFYA 2ACWA 4D3ZA 1L6IA 3COZA 4OYHA 1AURA 1T0JB 4YUAA 2D6FA 4BBZA 1RI5A 3NYIA 4O4HB 2AC2A 4P4SB 3R4VA 3MBKA 3VMMA 1P4GA 2QSUA 3WNQA 1A8PA 4ALJA 2RCNA 4TTQA 1CVIA 4NJMB 2XUKA 4CEIA 4PLZA 4YRMA 1NJ2A 3FVWA 2YWFA 1YULA 4P0QB 4N5MA 3VFDA 5DSXA 5F2NA 4RM2A 3JTMA 4LSWA 4RVSA 1P1FA 1J90A 1YE8A 4U7WA 4ZO4A 5J1TB 1M5RA 2VF7A 2GD0A 2NZ2A 3H1EA 2F00A 4BMOB 7MHTA 2BR4A 2C5LA 2XVMA 1RI3A 4FHZA 1PNOA 4KIFA 1PS0A 1XPRA 2XNCA 4UBOA 3B51X 2XADA 3P45A 1GPDG 1QCYA 2C96A 2J7PD 3UC5A 1ND5A 4KEAA 2ANBA 2Q5FA 2WHRA 5CVUA 2B7BA 1QIEA 2W2KA 3LT4A 2V4UA 1C8LA 3ACDA 1HT1E 1ZGCA 5JAUA 3Q5EA 5CB6A 2X0NA 1IY8A 3KZMA 1TCBA 5B2ZA 1P33A 1VRCA 1I4TD 1XXHB 2FW1A 4UTPA 3DBHB 3KHSA 1LDMA 1LKZA 4JLSA 5EHGA 5FTJA 3RUHA 3WLTA 1ORWA 1ZNZA 2QZPA 3K1TA 5DSZA 2F8MA 1E3EA 4UBIA 5BNIA 2QN9A 5JQGA 3FMVA 1PT7A 1EUZA 3HKCB 4RPCA 2C4UA 4U2DA 3T3DA 3QW2A 4PAGA 2NTYC 1G9SA 4M8LA 2KSQA 1I0IA 4MRNA 1C7JA 1KZ9A 4EHHA 2WF7A 5CYGA 5FKJA 3H5NA 5BSGA 4Q3DA 1U3GA 1OX4B 2SCUB 2KX7A 3OJLA 1P73A 1XRRA 1UPCA 3UWDA 3G6KA 5F1OA 4M8SA 3ABRB 7GPBA 2PUTA 4MUIA 5FNVF 2ZBFA 1IOZA 4DYHA 5F51A 2X8WA 2D1RA 3L6RA 4Y2JA 1TJYA 2NPFA 3SMVA 2AFRA 3HVKA 3N53A 1YL7A 4KQ1A 1ZM9A 1NFQA 4A15A 4Q1VA 4GXNA 1P31A 1IUOA 1Z5PA 1PJLA 3Q7QA 4INAA 4G01B 4Y6LA 5B7NA 1NMZA 5CURA 4EKIA 2HYIC 2NZYA 3OCJA 1FP7A 4EB3A 2V59A 3WWYA 5A4FS 3B6IA 4R8VA 4AAYA 1G6Q1 4HDRA 2D8AA 3BRCA 1ADGA 1PL7A 1RFGE 3AHJA 4NH4A 1Q0UA 5HS6A 1WUYA 2VHEA 1IB0A 1DUIA 4TV9B 4WCFC 2GFQA 5AI6A 4YMIA 2P67A 3GBVA 1RKBA 2W7TA 4OQXA 2P9HA 1WKBA 1FZQA 1K4MA 2PSFA 2LTAA 4ZC8A 3OEHD 4ND3A 3Q6IA 3T8YA 1M2OB 3P9IA 5AK6A 1MMFB 2E2WA 5FI3A 4TL8A 2QU8A 1QS0A 3B13B 4DV0B 4BV2A 4CDNA 3V32A 3RHZA 1T8PA 4XAQA 4ZI5A 1M8FA 2D1QA 2MYTA 3GPCA 3JQ8A 3WLKX 5IFLA 4LDNA 3OURA 4JA0A 1J8VA 2DUJA 5I3CA 4DB4A 3ECSA 3DFFA 4IGFA 4YAJA 1JLLB 1PUIA 3UJ8A 1DX9A 2Y9PB 1L4GA 2WVJA 1VXOA 3ZHRA 2H5IA 4YAOA 1HR0B 3OHPA 3NT2A 4V0RA 1JJIA 4QYIA 1OJ7A 3H7IA 5EJ6A 1L7RA 3HWX1 3T12A 5FUVA 1C3JA 1PZNA 4PGFA 1GPNA 2D2VA 5HG0A 4W8GA 2AZTA 2ENWA 2HLDD 3HJHA 4O4LA 4MS3A 3T6KA 5BRAA 3A28A 4BP9A 2QM3A 2BLLA 4HEA6 1M2WA 2ZT7A 1MOSA 4GBGA 1YJCA 2IXDA 2A5JA 2O0MA 5L4LA 1USVA 1EK5A 3N28A 2B83A 4PSKA 1CY8A 1M0TA 1ZSYA 4INJA 5BSKA 1D2HA 4GAEA 4DXAA 1DU4A 4KJZA 4G1FA 1EQ2A 4D3XA 3W3ZB 2F59A 1N6HA 5CVJA 4JUDX 5K6TA 1B8OA 4RBNA 4FT4A 1QPBA 4BQNA 2WP8J 5AM2A 1Y4DE 4C7OA 4DLPA 1RWVA 1E18A 2VDKB 4DSNA 1RE1A 1LJUA 4DT1B 1HI9A 2G8NA 2BMJA 2QNRA 3QKIA 1G5HA 3K2IA 4B3RB 4RTRA 3OE1A 2QYTA 1BE0A 2FWJA 4HUJA 3LY9A 4GRAA 2O0KA 1SXIA 3AFHA 2L17A 1OVMA 4K9KA 1AD2A 1PK8A 3ICCA 5DTEA 1BCSA 1GNTA 1X6VA 2GYVA 3DAGA 2GAOA 3O4FA 4NRDA 4O2AA 2IYRA 4RQUA 5K2MA 4CLOA 5CMLA 5INTA 1CJSA 1Z9BA 3M6UA 1RYYA 2R8OA 1FNMA 4MR7A 3G9ZA 2GAAA 2V58A 2Y71A 2HXGA 4OXXA 5ALTA 5THQA 1P1BA 5DLDA 2BEUB 3FVQA 1P5FA 2ZRPA 2EFJA 1EX1A 4RETA 3RAPR 4DEVA 4BEWA 2WE8A 3GLIE 3U7RA 1OA0A 2MSWA 3DLTA 4FGKA 3UK0A 1QXSA 1JEOA 3PLNA 1HQYE 4RZIA 4EFNA 1R6DA 4LF6B 1QGUA 2A92A 3AO0B 1U1IA 1PG0A 1WWKA 2AC7A 3H86A 4LNUA 4DUPA 2P35A 1FSZA 2HW8A 3QUSA 3GRVA 2P1DA 2I2AA 1ZAYA 5BQXA 4GXQA 2FMHA 1P3JA 4Z7QB 1Y5NA 2RH5A 3SS8A 4EYGA 3GT7A 1XL0A 2HPZA 4ITUA 3IJPA 2IEBA 3MHPA 1COZA 4YPVA 3H9BA 1NMEA 4HPJB 1CY7A 1BS1A 1NVXQ 4FI3F 4GPAA 2IYZA 1PWEA 5EXEA 1A9QA 1J5XA 1I9CA 3QWFA 4CI9A 2J9RA 3G8AA 1ZLYA 1NASA 2J0UB 3AESA 3K4HA 2QXTA 5AKGA 1A5TA 1N2GA 2YFHA 1JG6A 4ND2A 5H83A 1KI1A 2E5WA 2P0AA 2BSQA 2CE2X 2IGBA 4RPJA 4P7KA 4X6LA 1U04A 4BCCA 5CITA 3V1UA 2Q8QA 4YCCA 1Z13A 1QVRA 1JR3A 2GAJA 3VX4A 2P9JA 3PEYA 1XK7A 4FT2A 1OLXB 1CUZA 2FK8A 3GUUA 4F56A 3NKVA 3UJNA 3BXZA 1AN9A 2YZ7A 3OOEA 2HPAA 5T67A 1R0XA 4LBVA 2OENG 5DT9A 1FS5A 4U2FA 4Y18A 4ZU3A 1MV5A 5JADA 1MJHA 1HNWB 3FTFA 4X8HA 3W4IA 1CVLA 4WOPA 5EQDA 5AVYA 2NV0A 1QFZA 1I7PA 2BI7A 2VG8A 3DV9A 4JT2A 1RZVA 4OLHA 4FZ5A 4A6EA 2A4KA 1N25A 5DO9A 5COQA 3ZWYA 4DFDA 3QKSA 3AUJB 3BICA 1VLQA 1VKRA 1ZD9A 4MVJG 4NS4A 4YWJA 4BFLA 1E0JA 3LY8A 2OV2A 2Q1SA 1WZUA 2HJ9A 3U17A 3EG9A 4MMXB 5IVPA 3BF8A 4WD3A 1TJNA 5L40A 3A1NA 1XTJA 3HVJA 4B4OA 2ZUSA 1H0KA 1YC2A 2PJUA 2RHTA 3D6UA 3EIFA 1AV7A 1V43A 1O03A 2A35A 2WWRA 3C6ZA 4DC0A 3DOEA 4QEZA 1MENA 4P3NA 1BD4A 2K7ZA 4JCOA 4C4RA 4DPKA 4DDUA 4W7HA 4CL2A 2QZ9A 3JQDA 1N1GA 2A5YB 3FNEA 2ZSEA 5IYZB 4K0RA 2ZSDA 2XSZA 3OIFA 4RS4A 3LL7A 5IKEA 4G1MB 3KYIB 3ZIAA 3GDGA 1T0IA 1SBIA 1SRQA 3KAPA 3L6UA 5U1PA 3COYA 4EJSC 3ZDAA 1SXHA 4A2WA 4KYUA 3PD0A 1MOPA 4DLSA 5KPJA 3UICA 4MVWA 2BGWA 4O4HA 3NHMA 1E79D 1IB6A 1YDHA 1GL6A 2BFBA 2VHWA 3M6IA 4KWCA 4LV5B 3ZR4B 1C4XA 4J0IA 5FIUA 3UBTA 4OK5A 4GU5A 3LCMA 2JRCA 5SICE 3AM1A 1GPJA 2RONA 3P2MA 1VI2A 4P2BA 2YN4A 4QFCA 1ZU4A 2QRMA 3SC3A 3Q9SA 1PGOA 3HKEB 3X1ZA 3HVRA 4R2MA 1Q20A 2FUG6 4G5RA 3RUIA 5TX7A 1SUSA 3WGYA 2GPNA 2QAGA 1RLIA 3RUDA 5AW3A 1ZDMA 2HA6A 3B53X 3UGJA 1FXWF 4GS5A 5AQ1A 4J3NA 4NK5A 2L82A 4D9MA 4C87A 3DD1A 1GQRA 1JIQA 1G6OA 3KFVA 4UQLA 5LP1A 3IB3A 3L82B 3NBFA 4CR7A 2YQZA 3ZJTA 3R6GA 3LK7A 2WZBA 4QSHA 3FTQA 4DA4A 5DBEX 4A91A 3TBFA 1B6SA 1M5UA 3DMNA 2W6IA 3R0VA 3QEMB 3SEFA 3EOZA 4PYJA 2F3TA 4Y1GA 2KE5A 2PJDA 1T2FA 4DXHA 5BMVB 1ES9A 3SXUB 2R7AA 2P7HA 1J42A 2AT1A 2P2NA 4Q05A 4WINA 1SJ9A 2GZ2A 4HWOA 4GOXA 4XUEA 4ZP1A 3QPUA 3PHIA 5IAKA 1K5HA 3CX8A 4GVXA 5I4KA 2PSSA 2HCJB 1U2PA 3QRWA 3PNKA 3Q0IA 2WE7A 4YEDA 4F5DA 1VLLA 5FOTA 3OF2A 4LOHA 5H7XA 3DDOA 3W2GA 2IEGA 3C6KA 4JEIA 3HKCA 3OZXA 4N0MA 4AY3A 5JSZB 2F8SA 4D4KA 4FDTA 1YR9A 4IXWA 1H5UA 1NXWA 2W4MA 1JQDA 1Z18A 2IHKA 2WUVA 3OZFA 1CQJB 4DARA 2H9AA 3AG6A 3JQ7B 2PYDA 2IQ5A 1OOEA 3RW9A 3I6ZA 2CDNA 2ZWOA 1AU9A 2SCUA 4YRBA 1R5OA 1G8AA 4H17A 4C4TA 5EE9A 1SCUA 2UYQA 1ML4A 4CHGA 1MAVA 2FOIA 4MV0A 5GZ1A 3R3YA 4B2PA 2Q5EA 4IF4A 1LFDB 1XO1A 2JC3A 4R5MA 2BGKA 4QREA 4FLFA 4W8HA 2J87A 4EO7A 1CK4A 1M74A 3W0LB 1CWUA 1YF3A 5H5JA 4DCGA 4QLBA 5KCZA 1HLDA 3JD0A 3ICQB 4HB4A 1LPPA 3DEHA 1KOLA 3ZPXA 4DMFA 5ABPA 2J4FA 4CM4B 1Z62A 2R6ZA 1TZJA 4RSGA 4F2DA 1QNFA 2B98A 2Y0BA 3WGUA 3A6LA 2YDYA 2FE1A 2BF7A 2B4AA 3C7AA 3I2GA 5JAQA 4L57A 4KFUA 1ABFA 5C3UA 1AGNA 1RBYA 2GA9A 1TYCA 1N2OA 1ZXLA 5LA6B 3QIAA 2XWQA 1T2AA 4HH4A 4TVBA 3V7YA 2A3NA 3R3UA 1C5KA 4O8ZA 4BLVA 2FFHA 3R0IA 4C6RA 3HJRA 3GMSA 2JVKA 1GILA 3HMKA 5LXTB 5DSTA 5CDTA 5I7OA 2QRVB 2BELA 2PTGA 2F6RA 3KWLA 3V1YA 4C08A 4E3WA 4HJRA 2R84A 1QGAA 4IPTA 1OR8A 2VJBA 5C51B 1DAHA 3T3MB 4MCIA 3NLLA 5KOHB 1Z7EA 4N1AA 3NHJA 1BGVA 3RROA 3TGLA 1V39A 2DERA 4G9EA 1E3SA 2VAMA 1HZZA 1M6VB 1U0GA 3JD4A 1JLLA 2JJYA 2R47A 3NPMA 2XMGA 1E6EA 1BMQA 4JKOA 1IWPB 4OJNA 1S2IA 2ISQA 3EASA 1L7NA 1UH5A 4ZEMA 3E23A 4ZI7F 3U1BA 1U7PA 3MBOA 4CV0A 2QTTA 4N3AA 3KSZO 3WMWA 2HF8A 2JAUA 4H4DA 4JVOA 3DL7A 4OQZA 4Z7NB 4TMZA 4BO8A 4GH5A 5CDFA 2PKWA 1R0ZA 3CNOA 2DRIA 3IBTA 4WY8A 3W6UA 3ENWA 1R9NA 3BDAA 4AVYA 5CFQA 1S7GA 3JQGB 5JXIA 1BDBA 1TM3E 3UMCA 3NMUF 2VHZA 2O7VA 4RVGA 3PKIA 2JASA 3EIQA 5H80A 1N2BA 3TO5A 2FQWA 1XMJA 4HATA 3ADBA 1J8DA 4CKBB 4BUJA 5C1BA 5REQA 2P2LA 3WSTA 4OFZA 4BZZA 3Q6MA 4GF5A 2JATA 1V6AA 1AC5A 4KNYA 1ZD3A 4XFJA 3AVTA 4WCFB 1J23A 1E4EB 3GDHA 3O7WA 3QU5A 3BTOA 4CV2A 5FAKA 4IM7A 4AZ0B 1FFAA 1LVGA 2PRSA 3DWEX 4KPFC 4ER0A 4DT1A 5B57C 4HUTA 2NP6A 1UDRA 1BHJA 2QZJA 3A6GA 4LYYA 3KOOA 4WUTA 5IEJA 3UV7A 2OD7A 3B5IA 1NR7A 1M76A 4HJXA 4R9NA 3RANA 1QE0A 2ST1A 4UATA 4KMMA 3L5KA 4K2HA 1XEWY 4LYHA 3PF9A 4Q9AA 3T41A 1C0EA 2JFBA 1EJ6A 5EMJA 4D98A 1BFDA 2UU9B 1HPLA 3BB1A 3NFYA 1X7XB 1KIAA 2VPQA 4RTMA 1F38A 3E9ZA 4NJEA 3ZJ4A 1G17A 3E8XA 1S7CA 4KE7A 3OI7A 4DUGA 5KZMB 1AGXA 2VYFA 3FFTA 3A6DA 3GJ7A 4WK0B 4W1QA 2QI9C 3A11A 4FYWA 2GZRA 4QBFA 3O8CA 2JLRA 4KLAA 2WU8A 2ECKA 1QH9A 1WX1A 4JFAA 2R5WA 2WJ3A 3G9QA 3UJAA 1TK3A 2O3RA 3ES9A 5EIWA 4CIVA 2ZAMA 4BGUA 1RLUA 3IR5A 5ALWA 3SM9A 5KYGA 4MICA 2IYUA 2QL5A 2X8AA 4MRAA 2O52A 3O74A 1IZ8A 4KLZA 5D00A 5HMLA 1JB9A 5B3AA 1SD2A 5KCMA 4OJTA 3ZE7A 5A3RA 2YXBA 4I8IA 2J0UA 1QPZA 5HBRA 5ELXA 5FR1A 2O2ZA 4L9AA 3B12A 2Q29A 1JSZA 1GZDA 2B9VA 1DHRA 1XTVA 3GLIB 2BM0A 2H4YA 1UBFA 1Z74A 1M3SA 3M7IA 4MKZA 4L4UA 5JASA 4DNPA 5GONF 5EEGA 5TJ9A 2HMAA 5EQJB 4XJXA 2W11A 2YJ6A 2ZCUA 4UBNA 3VZRA 1T2UA 1DT5A 1OLXA 4XLLA 3KYDB 1G38A 2H17A 4GZ5A 3HM9A 2JIDA 1M66A 4MI1A 1BJRE 1T4BA 2HCBA 1O5TA 1JF8A 1W4RA 3D7LA 4AMGA 1R5NA 3JQFA 2PL1A 4OH7A 1RZUA 3AUTA 1AKYA 1WW8A 3HCCA 1XEAA 5HS4A 1CF9A 2VQDA 4QOJA 4ZIRB 1EE1A 3K0AB 1P1IA 1TU4A 4RJTA 5K05A 2J5KA 5M7EA 4O6VA 3FH0A 5HF5A 4GGPA 3ZN2A 3ZQJA 1TMKA 2C8KA 3TOVA 2IOHA 4G41A 4ALKA 4BJ6A 5C1PA 4KXUA 3NAMA 5DCYA 4PYNA 4XDYA 1H22A 3VZDA 1TZBA 1ZWKA 1NN1A 3AEQA 5EFZA 3EWIA 1GNQA 3KUUA 3LPLA 3MTIA 4NS1A 5FPYA 1N2IA 3KELA 5J2TB 1GPBA 3RYCB 1J39A 3OKCA 3O9MA 2AFHB 1SKUA 3I8OA 3DVRX 4L5YA 3RNOA 3KXIA 1U4SA 3WTCA 2PTHA 5IYZA 4TUYF 2OYCA 1BHO1 1BQEA 3GGGA 3I30X 4NYIQ 5DX8A 4KI0A 3NX4A 5DNUA 2BL4A 4KR0A 2J85A 4ER5A 1F4PA 1GO2A 1LVHA 4G84A 3LQ4A 1QB8A 1KAHA 1P45A 1JYFA 1TCVA 3L7CA 5JZOA 5K0GA 4GSKA 3GVXA 2XEDA 3IUSA 3W8RA 1DAEA 3WLHA 3I0NA 1SXJA 4DJAA 3QVLA 5G0UA 3DO5A 5FUQA 4ZDWA 1J0CA 4PINA 1DJLA 3RV3A 1E3DA 2A1UB 1PQYA 3AU9A 5LR6A 3CX7A 2IHBA 2EF1A 5FA6A 4H4CA 3CN9A 4AKIA 2W6NA 1T43A 4IWNA 5JSKA 5CVTA 4PLPA 2WF6A 2J45A 3VHXB 4D9CA 3BS4A 5HKOA 1DADA 1E5VA 3LTEA 1QQ7A 5AW4A 2FN9A 1JTVA 4QFDA 5L3ZA 4EUKA 5F1YA 1KTVA 3QYAA 4MLPA 4UHHA 3M89A 3OT1B 3MMPA 4E5MA 1L3IA 2WF8A 4KXWA 1AOXA 3GLSA 3QEMA 3UQZA 3AQIA 2QKYA 3BD7A 4MVJD 2WFZA 2NSDA 1Y3FE 3DDWA 3V7WA 2P90A 3VYVA 5A9TA 4JYPA 3SXUA 3T7DA 4RU1A 3AV3A 3IAFA 1PJBA 1YMVA 1KEUA 1ZXBA 4WKGA 2X6RA 4LJ7A 4XVRA 1K2VN 1QE3A 3VGPA 2VLBA 7AT1A 2K4MA 2HK6A 4GD3Q 3LC2O 5A9SB 4EJSB 1UBGA 3GJQA 3VPSA 5A5FA 3D0RA 3GGOA 1ECJA 3TSYA 4HD8A 5JSZA 2QT9A 2IU4A 3U1TA 3WNDA 3D8UA 3HB4X 4R69A 1CF2O 1C3XA 1UK6A 3C45A 3ZXXA 2F1IA 5KTYA 1IXKA 3F2IA 4UNQA 5FHRA 3JQ7A 4MXDA 4XJTA 4DWJA 1IOWA 2QLMA 3X44A 4OHFA 1X70A 1YS6A 3NXSA 3Q2OA 5AT1A 4YI5A 2JAPA 2CEAA 2XGMA 4X7BA 4KR2A 1WEKA 5FF9A 3VR6A 5IMSA 4AJIA 2FFRA 2HF9A 3DVAB 2VN8A 1PJ8A 2HWUA 2QD5A 4WXPA 3RRYA 2Z2YA 4QECA 1LX6A 3RWBA 1YS4A 4P58A 1AA6A 3DR3A 5EZQA 2QW8A 4MHSA 2F7SA 2GYYA 4YMSA 4CUKA 1KEVA 2ARKA 4OQFA 1G60A 1T0BA 2ZK7A 3ABIA 3EVDA 5EY5B 3WGNA 1UFKA 1XMIA 4G23A 4B87A 5CFLA 4QGGA 3G0OA 3TIIA 4BO5A 4E5DA 2VDMB 1SVUA 2ZJ2A 2ZYGA 5FA8A 5K0FA 3UWPA 5L3VA 4OMCA 5HTKA 1W93A 2I7CA 3S81A 1ZS9A 3NOQA 2FP3A 4FQ7A 2EC5A 4C05A 1OFUA 4QO8A 3ZE2B 3MSXA 4BU0A 3ZQ6A 2OILA 2DAPA 4DIKA 3SIXA 3H2HA 2FZVA 2QRVA 4KZPA 3IIIA 1EB9A 5KYWB 1P7YA 2Q9CA 4BE7B 3ESXA 3N8GA 1D3AA 1MIOB 1UP6A 5BN1A 3WLRA 5K09A 2CXRA 2E4VA 3SLKA 2WMNB 5J2UF 4NBKA 1ZVQA 3CH7A 4XSHA 3I1YA 4QUJA 4BMVA 5TPZD 4OXIA 1CR6A 1P9OA 3Q5DA 4ETNA 3RFXA 4NK4A 5JYCA 4ENSA 3CC8A 1OLUB 3F74A 3PLRA 3EQ7A 3UH1A 4JNCA 3MWJA 3ZY6A 1RAEA 3EWAA 3VPXA 2XMSA 1UZLA 4UHBA 1GU1A 2BMEA 1M7GA 1NBHA 1OIVA 2REBA 4N82A 1GTL1 5AWFC 4BE9A 1H8HA 3A9TA 3G88A 3BDIA 2BUAA 2ZXFA 1HRDA 3K3PA 1N77A 1YBAA 2BEKA 5KUTA 3JQGA 3QE2A 5B64A 2QDKA 4TM8A 4D80A 2IBSA 4J2TA 1Q17A 2C0CA 1RMTA 2EWWA 3G8BA 4KVAA 4X20A 3VOAA 3CVOA 2E5FA 1JBQA 2RAFA 4REQB 4BV8A 2H7YA 2YUTA 2PZAA 4OXNA 2ZRCA 4B2IA 4EMSA 1QO9A 3OQNA 4PG4A 2R3SA 3FMGA 3G0DA 2WU3A 4LF9B 4WCFA 1E4EA 4R98A 1WUTA 4MW5A 5BPFA 4CG3A 5L4SA 1GL9B 1CDOA 5KNBH 3KEGA 3ZY2A 2CXQA 5EESA 4AZ0A 1YS9A 2W2VA 1R3DA 2VT2A 5FUYA 4B1FA 3ZYCA 4ZCRA 1LLCA 1YR3A 4TKZA 3BRWA 3S55A 1MU0A 5ETJA 2BGJA 3C48A 4OHVA 2R2AA 4E13A 1R7RA 2J41A 1VCNA 1W4BA 4YRFA 3JVUA 3ADPA 4QRIA 3AYZB 1IPFA 2W93A 2VTBB 4EG1A 3QVSA 1H6AA 3N8NA 3E53A 2FJPA 3PTLA 5FDFA 4TPKA 3NIDB 3W5BA 4YLEA 1T3TA 4R41A 4JLMA 1X7XA 1QFYA 3C3EA 4RDCA 1QBGA 3LLUA 4NZNA 4C14A 3DE4X 3FZNA 2D3TA 1P77A 2A5LA 3F46A 4GM4A 1ZMXA 2V3CC 1EDZA 1YR1A 3VBCA 3FLBA 4CCYB 3M5CA 3BXPA 2W48A 1ZH2A 1VYVA 3FCOA 3Q2KA 4HMOA 4MITA 5E9QA 4C6SA 3ZHVA 4POOA 3ZHXA 1D2EA 2R96A 2CLIB 3HBJA 5GIOE 1ZGGA 2D59A 2NXNA 4YUVA 2VYNA 3RBAA 3GLRA 3UHJA 5E9WA 1DO0A 4R1QA 5IUKC 5CA1F 1ONPA 1P7CA 5BSMA 2PM8A 3TE7A 3MCTA 2EJCA 2D00A 1XKLA 3RRZA 3D8TA 1K7YA 2GKSA 3KD2A 3UWOA 4DIOA 1RBQA 1CR0A 2RHGB 1RD4A 3TDKA 1U28C 2CMDA 3GAZA 5JAPA 4ZXPA 3WIOA 5IG2A 4RK4A 5BVHB 3GLIA 1VG9B 1RXWA 4EK9A 1NKSA 1ZVKA 3LU1A 2GSDA 1RMYA 4US0R 5SZIA 1PI3A 1Z45A 2J46A 4Z7JA 5T57A 2CW5A 5B1SA 2WJVA 2ZRAA 1Q7CA 1XNJA 4Z99A 3FMPB 4RCVA 2XR1A 5KNCA 1CUJA 3T5PA 3EZ7A 1XX6A 3ADKA 3AR7A 3GNSA 4F2WA 3GJ0A 5AKKA 2NUTA 4HRVA 2Z30A 1FYXA 1H42A 1Y3AA 4H1TA 1X2EA 1FS6A 3LUPA 4Q66C 2JGLA 1E4VA 3FN4A 2F43B 2FWPA 2JIRA 1JA9A 4JP8A 1GXSB 1FFCA 4ENTA 4DR7B 2Z0MA 4JX8A 2GMWA 2YFKA 3TI9A 2OCLA 3ZV5A 5A3QA 5E7IA 4R40A 4ZIRA 4K6KA 1GR1A 1ZFNA 2P8JA 1MHTA 1PT8A 1EYZA 2FSHA 2O07A 4QTXA 3HVUA 3VISA 2VAVA 4ND6A 1O95D 3ZZ1A 3THYB 2I65A 2XJ9A 3KLNA 5KI6A 3L8CA 1PX2A 1P9WA 4UQOA 3MOIA 4PPYA 5DP1A 3MWDB 5A6SB 3TQQA 1H69A 4G1UC 2Z5FA 4RIIA 4LOLA 2O1WA 3PENA 1LQUA 2CY0A 4D9KA 1YRHA 3LY5A 2G4LA 1AMNA 2UYHA 4DBVO 3ROPA 3RYCA 4YCDA 5EN4A 1GAWA 1PT6A 1WAMA 5DOVA 4X0EA 4ECEA 4DV7B 1RXUA 3FNIA 1EBFA 1X3LA 3ZD8A 2Q49A 2BCJQ 1RR6A 3EVCA 4PLGA 1R3UA 2QTMA 3L2OB 5I9BA 1JHDA 3D3QA 3HYCA 3K35A 3ZC3A 5LBIA 1DT3A 1BX3A 2J4CA 1R0YA 4UM7A 3HDJA 3ESYA 1TZMA 3CV3A 3QHAA 1DB3A 4MDEA 3E03A 4F5WA 2JFGA 1W87A 4F71A 2R2GA 3KTFA 2VHJA 4DJ5X 4CIWA 4PAOA 4XIIA 1L5FA 1KI8A 1U3WA 2NTEA 3Q85A 4H0NA 1WDKA 1GRVA 4Y6RA 5BYAA 4FYYA 1HOXA 3A6PC 4ZOLF 1SOWA 1YD7A 721PA 3GIDA 3MCVA 5DHRA 3UUEA 2C1ZA 4L85A 1X2BA 4A8JC 1Y7IA 3ZEAA 3L4BC 1YASA 1ZI6A 2BZ1A 2Z5LA 4KU4A 5HFAA 2PHZA 1KIMA 2BMFA 3ELWA 2HIAA 4EW6A 5CEJA 1S02A 4NZ9A 5CLJA 2X41A 1E2GA 4AUMA 2QAIA 3OX1A 9ABPA 3AZOA 4OHBA 3BE8A 3IO3A 1DKQA 2MYPA 2CLKB 4W82A 4ZFNA 1Z26A 2OB1A 3OT1A 1F6WA 2GKGA 3ROKA 1YO6A 3MTGA 1I7LA 4XFKA 2WFLB 4MUMA 1CUBA 1O94A 2B4TO 3DCYA 2Y0PA 1KJ8A 4FW8A 4GT1A 3WGKA 1PKXA 5GM1A 1LZKA 3PDIB 2RGXA 3ZY5A 1FFWA 1VYUA 1ZJ5A 3IPXA 2EBHX 3GC6A 3TIXB 2PUFA 1JVNA 2HSEA 1ISPA 3MUFA 4R9UC 5IH3A 5LQKA 2CF5A 3ONWA 4A8TA 3CPEA 1VL5A 5C5CA 3OMXA 4M1YA 2V7BA 1MD9A 4C2AA 1E96A 2PKQP 1NBMD 2H2HA 1HE2A 2VOJA 3L1JA 5DTJA 2XNJA 4C76A 4NBVA 1NJ1A 4HLUC 4EFMA 1Y4SA 2HHLA 3IPYA 4MW4A 4BX0A 3HYSA 4HVLA 1X7ZB 2OUKA 3C85A 4QOHA 5THXA 4AJ2A 3ED1A 1AE1A 3NHWA 3P7MA 3PIDA 2FPRA 2JS7A 3DVAA 3IP5A 3ZE6A 3WGHA 3IBGA 1AHIA 3HA2A 4F97A 3ZS8A 4YMHA 5EHXA 5ED4A 2EBWA 1AS2A 4W6ZA 3HJUA 2V98A 3FGOA 4MQEB 2WYUA 4UU7A 2C4KA 3QJGA 1DELA 1QTQA 3QUCA 1ICEA 1M83A 3H7AA 3Q7EA 1E0KA 4PWZA 1TYZA 5AKHA 4WECA 2WI8A 4QGHA 1AMOA 2I67A 5DJ5A 4KDCA 3L4JA 2QR3A 3H9JA 1V9SA 5EJ5A 1JPNA 3SEAA 1Q83A 5DT2A 3V8BA 4G0XA 3I2HA 2GA8A 4A1OA 5ITZB 3UAOA 4H6VA 4NOKA 4WCDA 3HM2A 1ZD8A 2SECE 3DDZX 3SYMA 3IEVA 1QAMA 1ZHFA 3CB4A 3O82A 2CFSA 4IMJB 2FI1A 1DQZA 1VLZA 1BOOA 1ZCZA 2AMYA 1CY4A 1FUYB 2OZVA 3H2YA 2OV3A 4G0YA 2QPAA 2FPOA 2ZJ8A 2DETA 2JKYA 1EESA 1YI8A 2BZSA 4QDZA 3WDKA 1TVMA 2HRRA 1U0BB 3ND6A 2QBYB 3VKWA 3UK6A 1W29A 2P4UA 2ZI4A 4D42A 3CZQA 4BMZA 1FYWA 5ILOA 4C7KA 1FQWA 3E9MA 1XJ5A 4YAUA 3TEFA 5EERA 4C7JA 2O19A 1CEEA 1Z6QA 3AFGA 1P6XA 2G07A 2JH9A 3CH6A 4GICA 3D8BA 5HBGA 1BA2A 2GJKA 5KWIA 1FYVA 1LF5A 2C2WA 1XLTC 2PX2A 3SQLA 4ZU6X 3WS7A 1G8SA 4TLMB 3AEUB 3AHDA 5K6AA 2TECE 3JAKA 3PC3A 4AI6A 4NAUA 1DE0A 1FU8A 1PGPA 3BM5A 2M32A 5T3YA 2CSXA 2XRFA 4OAOA 3EIOA 1LNZA 1GNPA 1CLUA 2CVQA 2CLDX 1Y8RB 2W6JD 3DLIA 4V0LA 1OFVA 2GNPA 3DMYA 4REQA 4X61A 3DDHA 2RK4A 4FMCB 4Z4QA 4P5DA 3IVGA 4YRSA 1D0VA 4TT3A 4DTCA 2VF5X 2GZ3A 1QLHA 3OZVA 4A7PA 3INGA 3T5MA 5TY0A 7MDHA 2YHIB 1G9TA 5AJVB 1E4OA 2ODAA 1QTNA 5KPDA 4J0CA 2I3BA 2GILA 2HAEA 1EXWA 4G5HA 1TIBA 4G4SP 4NYIR 4JL8A 4RVCA 5HGJA 1GGJA 1ZVJA 2HY7A 2SBTA 2NNLD 3GVCA 3H0KA 4HRAA 4KPGA 4N7RA 4BNVA 5EIBD 2CNNA 3QXHA 3NP9A 5K4AA 2ZUUA 2OKCA 1VQ1A 3NNSA 3OP4A 1DCFA 1T29A 1TYBE 2UUPA 3EFHA 4F3YA 2VO1A 3MJFA 4XASA 5GONA 1AGPA 2YMPA 4PYLA 3LXUX 2C7PA 4K03A 1MFPA 5IPFA 1NQOA 5BWOA 1OC4A 1D1SA 1EM8A 1NOKA 3DJFA 1HDCA 1DFHA 1QK4A 2IDJA 2W2QA 1M8GA 1ZK2A 2XB6A 3IQXA 4MGYR 4ZYZA 3RADC 3T3HA 1DQNA 4I9HA 3PJDA 4G1CA 2BN4A 3SU8A 3FWKA 5IXJA 1PR9A 4CCYA 2GCOB 1RKUA 5AK4A 5LSAA 2QTVB 3SD7A 1E2MA 1JLKA 1F8XA 1FDWA 5HKBA 1OWNA 1VPWA 2FDCA 5GQSA 2RGUA 1G5FA 5BV2P 1L5SA 5LB4A 1ZAKA 1JHYA 2HJWA 2EL7A 3LJKA 3OPYI 1V0JA 1QIIA 1MZPA 2W2MA 3STVA 2O3JA 3KVYA 4HDSA 5KQSA 1QIJA 4NMMA 3T7KA 4XH9B 5GJCA 1T0PA 2YWCA 1ZC3A 5CDYA 1QNLA 5TRTA 1UAYA 2ISCA 3AL3A 4MDYA 3DT6A 4L3OA 1I0ZA 2QLLA 3MQ4A 3BX1A 3ONEA 3LRTA 3LVRE 3D6NB 1HFEL 3LE8A 3AQ4A 1D2RA 1SBQA 1J5EB 1VKOA 2G0NA 3UB4A 1KAGA 2J5QA 4MQMA 3TZEA 1BDIA 2RKOA 4GG1A 1T6XA 3WRXA 5SV2A 1EHCA 4ZARA 3RRFA 4F0JA 1G63A 3RKRA 4HWKA 3N58A 3DTVD 4WH0A 3IVXA 4IQ0A 4EY6A 3E4CA 1UOQA 1VPDA 4M9RA 3RSCA 4EJ6A 1QYIA 3N2EA 3T9DA 4EIWA 5BN5A 4Q37A 1A04A 1VKZA 1XWIA 2DHQA 3KFXA 4RD4A 4BUCA 3C39A 4JB3A 1A9YA 4ZCSA 3KQNA 4RF5A 2PUVA 4B6EA 2F43A 3GRPA 4J0HA 2OFFA 4Z9FA 1XJ0A 3T9BA 4C3VA 1RP1A 3HNRA 3OWHA 2VCEA 1P7PA 4GEGA 4GPD1 3QBEA 5IDWA 3B1JA 3PC8C 4M1OA 1YA6A 1V3TA 4LDPA 4FD2A 5FQOA 2V0GA 1PNTA 1A8SA 1QAOA 3JYNA 3T15A 2FFQA 1SCKA 5H0IA 2GHIA 2LE0A 4RQBA 3AR2A 1ZM2A 3JARA 1GDHA 2F62A 2X9VA 4ZGGA 1SCNE 2PH5A 1YJ8A 4DC9A 1KI2A 3FMFA 4L7VA 4JLJA 4BAZA 3FOEC 3THYA 2QJWA 3DZKA 1T35A 3WGJA 5C8ZA 3ZXYA 3W2TA 4D5EA 2ZETA 5A6SA 3RC3A 1G3QA 1QYCA 4RTPA 3K9QO 1MQ9A 4AJLA 4DLYA 1PSZA 2B8TA 4WFIA 5ALXA 1GTSA 3PYXA 5FFMA 1WUIS 4MP6A 4S05A 1N5LA 5IC4A 1RLMA 3JVDA 4GNKA 3VYWA 4B8YA 1P1CA 4YRGA 3NCTA 2IC5A 1I14A 1NNI1 2BR5A 3K30A 4GZ3A 2QUJA 5DBGA 1PL0A 4IZHA 1DRJA 3TGWA 1HNXB 2ICAA 4U2GA 4CL3A 1FDRA 2JCBA 4NZMA 1UDCA 3ZHOA 3ZOKA 4KGVA 3AEYA 3QA3E 2X2PA 3A3OA 2ORWA 4MTCA 3VO1A 1H2WA 5CB8A 4EB6B 4BLTA 3ZVNA 3VKHA 1AUPA 4FYKA 1PJSA 1WSDA 3QY9A 3K5PA 3ABZA 4IGAA 1NBIA 4HEA1 2X5XA 4UJ5A 4PR0A 1GUDA 5EUCA 3L6EA 3E18A 4CMEA 3GFSA 4B7UA 5EJ8A 4QQKA 4N47A 3PA6A 3SSOA 1KFBB 3CYFA 4I1IA 3EFBA 2ZBQA 4MYCA 1LDNA 2F64A 2ZGVA 2EYUA 3IT3A 3U4MA 4MJ7A 1P8JA 3CZ5A 2FUCA 4JBXA 4C4YA 4DY4A 4HAIA 3LNTA 2Z56A 4JENA 1C0IA 1E7WA 2G36A 4P1ZA 4RSMA 4C0QC 1A9SA 2Q4TA 3KK0A 3T9CA 4YV0A 4G65A 1XTUA 4OFXA 5G4LA 3KEFA 5FNVB 3WHIA 1ECCA 1Q84A 2NO6A 5CD1A 1J56A 1UDXA 4L0DA 3DEIA 4BO7A 3G7UA 3NHAA 3VR5D 3SIPA 3FBGA 4Q00A 5LDGA 2Y1OA 3A2KA 1NQXA 3EH2A 2Z8YM 2P40A 2IUYA 2ATVA 4UMEA 4EGQA 4EP1A 1U6JA 1QVWA 1USWA 2O8CB 3IMEA 1WCIB 2CVFA 1OXBB 2J31A 2GGSA 5KYYA 3TUZC 3KLPX 8ATCA 4Q4JB 4TMYA 2JFXA 4WJZA 1T4CB 3IERA 2JHFA 1XEWX 4WN9B 4B81A 1N4DA 1YB4A 4I1VA 3QOYA 2WUDA 2XQFA 4AXBA 2XKKA 13PKA 1MH1A 5AM0A 1ZNQO 3L02A 3OEYA 3GNTA 1R9MA 2VZ9A 1YIOA 1ZGJA 4K8OA 3CM0A 3F90A 3MT9A 1E98A 1KZ1A 2OQVA 4KRYA 4Z0HO 3UCEA 2Q27A 4AWAA 4LIPD 3LKZA 3CGWA 2P8SA 2BC9A 3JPWA 2X6TA 4H3HB 4PPGA 3AONB 4IVRA 3WOHA 5C46F 1E1LA 3ZLUA 1F3LA 4K9MA 2BHNA 2XOKA 1I1NA 1UKAA 1Z6ZA 1PRYA 1UPTA 2OXRA 1JYSA 4QATA 1Q1QA 1TMOA 1SQ6A 4PXSA 3MQFA 3D4IA 3TR0A 1N6OA 4PSDA 3W78A 1NHWA 3AFNA 4PRYA 3RODA 1KJIA 4NG4A 3BK1A 2GPWA 4ZO6A 4GYKA 2JLSA 4UEKA 5FBZA 1NZFA 3RSSA 1MB3A 3EGIA 3T4EA 5L9AA 3F3YA 1OF1A 3GOHA 2WJGA 3ZGNA 2A7XA 1P0FA 1PNQA 3MVEA 4MCHA 3RSOA 5JCZA 4A0SA 5ITZA 5J4YA 1OIXA 1TQ4A 2G1JA 1KP2A 4CDMA 1SK9A 2PVCA 3DBRB 3DOJA 3HDHA 1J9GA 4B74A 4HHEA 1O9GA 1U9IC 1KQGA 4GKJB 2NT4A 1FUKA 3DMHA 2A0XA 3TW6A 1HTTA 2CCKA 2C88A 1ESMA 2WKPA 3KZNA 1MQSA 4PC3A 1NBEA 1GUAA 4FKMA 1JIJA 2GXSA 4QRDA 4Y2GA 5A2QA 2ZUDA 5I7HA 4X95A 5JNLA 1Q7GA 4UUOA 9MHTA 3PHCA 1L5VA 4J76A 3OD5A 3F47A 1A88A 4BNKA 5JU6A 1XALA 2AGVA 2COUA 3C3XA 1P2DA 4KO4S 3VPHA 5JAIA 1QRUA 2QBYA 3OH8A 2QE6A 4B48A 1YQXA 3DEZA 1JX6A 2GUGA 1NT2A 3JD1A 2HHJA 4JQYA 5JJKA 1QRRA 4WGGA 4EUNA 2IUTA 4FMPA 3TB4A 1HT0A 3T5DA 4WBNF 2D5CA 4CLEA 1H4SA 4RORA 1H1LB 1S3IA 2ZJZA 5DH9A 1ZO8A 3VX3A 1SCDA 4JB2A 3UV6A 2OFPA 3AEUA 4CU5A 5BY2A 3F1KA 2WNHA 3IDSA 1V9CA 4C30A 1V11B 2E82A 2DPMA 1T6NA 2OHIA 3NHUA 2O20A 4GZMA 3C1UA 3TKYA 2OCPA 3W6PA 2GEKA 1D2AA 2YXLA 4IV5A 4QBKA 4B3SB 2NXJA 2RH4A 3NATA 3QVKA 2IVFA 1GYQA 1OFIA 4S0ZA 4C0BA 1Z4LA 2BTQB 3ND9A 3VDRA 5B55A 4OI0A 1KPHA 1YONA 1R4NB 3DV0A 2IH5A 3A4IA 4YONB 4F5EA 1SHKA 3M9XA 3FROA 3KOYA 1KSHA 4EY5A 1ISHA 1I3OA 3RVSA 1QAQA 1SC3A 2H51A 1CV2A 2JFNA 4H1WA 1UWKA 4DNOA 2DC1A 4RK5A 4OB8A 5D2CA 3WB0A 4EYEA 4NHOA 1ID8A 2FUG1 3RE1A 1YACA 2JLQA 1E92A 4RL6A 5AW1A 3DYIA 4M6WA 3EPKA 1N57A 2B36A 1PR2A 2YCBA 3AXSA 4BNDB 1EE2A 2FTKE 5AK5A 2F4NA 2HCRA 4GHWA 2QM8A 4UPVA 1KSJA 3FPAA 3NALA 5CGZA 4EHIA 5B6JA 4OXKA 5ALIA 1YQTA 3QENA 2ZRBA 2FZGA 3O4HA 3FYTA 4JBNA 4L50A 1Z17A 1YZQA 1TT7A 1R0LA 5C0OE 3IKLA 1U94A 4HWGA 5FB3A 3DO6A 2VJMB 4C4XA 1E1QA 2HQOA 5ULLA 1X1CA 1E62A 1SQSA 2EZTA 2IXEA 3KALA 3MJ4A 1U0RA 1Y89A 3BWCA 1G6HA 1OQAA 1Y7LA 3ITEA 3DOIA 4LJ9A 5FWXB 5LM3A 1YR6A 3PPXA 2K2QB 2BDUA 3FKQA 4OFBA 2DUNA 2QB5A 1G5IA 3VR4D 1VLJA 2HCTA 3AIIA 3FOWA 3UMBA 1R1DA 2ISSD 4WLFA 1OILA 2EL9A 5IKMA 3NNDA 1ZNYA 2JFHA 4BBJA 1RYEA 4R8KA 4XOUA 1JHZA 5DW3A 1RBZA 4QVIA 2ET6A 1O0BA 3AT1A 1YTUA 2XZLA 1YCHA 1Q1ZA 3IQWA 3FYDA 1LLQA 1QQTA 2P27A 1NONA 3N7TA 3O31A 4X8MA 3RS4A 4ES6A 5KSZA 1Z5ZA 3D3WB 3K94A 4M83A 5DB4A 2C98A 2XKJE 5SY4A 3BTUA 1GQOA 2FSUA 2ZUTA 3WBBA 3MUOA 3PRHA 1KF0A 2WUWE 1SELA 4D5GA 1NV9A 2DT8A 1YBVA 3TSWA 3G5MA 3UJ7A 1DRUA 4BATA 1RKQA 2B1JA 4BNWA 4DNFA 1QU2A 1WMDA 2IW3A 2PRIA 3DTNA 3HZRA 1O6BA 4F2HA 2PUEA 4CGZA 1HE4A 1GKLA 4M88A 3TX2A 3TLBA 1DC3A 2VRNA 3I09A 2L2QA 5U9CA 3FDZB 4FMBB 5I7RA 1RWQA 1TF7A 4FYXA 3N8KA 1U5CA 2EEPA 2OQRA 3NPAA 3OQPA 5F23A 1IMOA 2VP9A 3P0FA 1JBKA 4BNUA 3JRXA 3NBUA 2R66A 4EUHA 3V55A 3L0IB 1SXQA 3TR6A 3V9AA 1E3IA 3CS3A 3OFJA 3ZZNA 4B47A 4IQ4A 1CDDA 2VJCA 1HDGO 4ZKDA 3ICWA 3WK9A 1ZU5A 4YV1A 3ELYA 4F96A 3I04M 2E1PA 4NU8X 4RIEA 2O8DB 4B7CA 1G0NA 2IEZA 2VXBA 3H2BA 4WEQA 2Q3MA 1TXGA 2QUKA 2X8JA 3DPUA 3JWEA 4HV4A 2C9CA 1WDWB 1IBRA 2Q6OA 2KM1A 2ZIWB 3ICVA 4QM7A 1FUIA 5CT9A 1U9CA 1J22A 2PT7A 3CTPA 3MIIA 5A0FA 3SQNA 3F5QA 2XTJA 4L6AA 3ROMA 1PD0A 1FFXA 3A4YA 1V1JA 3JD2A 1Q16A 2KS6A 2R1VB 3C7TA 5ESRA 4Z1OA 2FMXA 3R7DA 4NHEA 4OQNA 3QTTA 2IXGA 1JNYA 1T6YA 2P4HX 2QVXX 2XQKA 3AY0A 3PRYA 4AZTA 3JY6A 2CE7A 2JEZA 2YOHA 3UXYA 3K5WA 1PFWA 2ZVPX 4PZYA 5EAIA 5F64A 5ITWA 3THSA 1L4MA 1M2GA 1EVKA 4RJLA 3RLFA 4K7JA 1P0QA 2WYHA 4DE5A 2QVZX 5AVZA 2NZJA 3K1ZA 1A7KA 1NG1A 2P1RA 5KIAA 3EVAA 2B8NA 4EB6A 3K6SB 2ZS7A 4TZ6A 3RSQA 3RUFA 3UPTA 2IZ6A 3E82A 5C3MA 2CXXA 3W3AH 5CVEA 4WKOA 4BC0A 1VLHA 2C9BA 3W4KA 2HNAA 3IYLW 5H4HA 2D4HA 1QCCA 4Z2AA 4MP3A 5K3EA 1P18A 4J9UE 5DLYA 2JGIA 4YDSA 4PHCA 2H0QA 3CSDA 1GTG1 2AZMA 3FYSA 5LJIA 2I3DA 3AJAA 2ZWIA 4K6OA 1XDDA 3SK0A 3G5TA 1G5TA 1KEEB 5A71A 4AS2A 2PLNA 1P5RA 2XE7A 3D8RA 1ZN2A 1U0EA 1AKWA 2J9FA 2IY7A 5FP0A 4BFXA 4BE4A 4QT4A 5FNVA 3I2YX 3EEYA 4HNHA 3PC7A 4U9IS 2EQ5A 1IY2A 2GTHA 3T7JA 3E15A 3GZNB 2DTEA 2JGFA 1HF3A 3PGKA 3ZWNA 4QFBA 4BQEA 3DE3X 4PCUA 4IJUA 2ZWAA 4QLAA 4YPFA 3SMQA 4O08A 2O8CA 3K8OE 1P17A 1VTKA 1TEXA 2OXEA 1NM5A 1CW2B 2E4XA 1T4CA 1CUYA 4DM4A 1D0IA 1SQFA 4OHRA 5FFFA 5LQAA 1P44A 5AHXA 3VNAA 1PX0A 3JWIA 3LUHA 4KTVE 4EYKA 1G18A 1DC6A 3HB9A 5AP9A 1QP8A 1GAQA 2QUHA 3OPXA 4WCVA 1LRKA 2COEA 5D3ZA 2JA2A 4BXOB 3UV3A 1OTHA 2V5VA 1FP4B 1ORIA 1HBJA 2LPMA 2XUFA 3BOSA 1CUEA 2GCGA 4P7BA 1L4FA 3U49A 4TQUS 4AY4A 3C24A 4PG5A 1JMYA 1Q77A 4BJ1A 2O2YA 2X4DA 2AFVA 4HYQA 5EWJA 3X1KA 3NDJA 2JZOA 3IDOA 1UMCA 2BKXA 2WNSA 3D6AA 2VEDA 3SQXA 2G4VA 3IAS1 2EDAA 3A06A 1QIDA 2AI3A 1O54A 3F7MA 2D2IA 4MHTA 2CB9A 3RU9A 4CG2A 1O08A 2ACVA 3CCBA 5THKA 1NLUA 4QJ5A 1WPQA 2C2XA 3PPWA 2CL6X 4G8JA 3GFTA 5ALKA 1MO5A 1DWOA 1O8CA 2B1GA 3TBKA 5JRJA 1AZSC 1Z0UA 3MF4A 2YOFA 4MJLA 3FBWA 2ZCVA 2OCYC 2FKNA 2YWRA 1K3UB 1MG5A 2G0TA 2VP4A 2GPBA 2EBUA 1AZTA 4ZVTA 4LTNA 1OY1A 1MAUA 1R6AA 1RHQA 2ATCA 3FNHA 4HDKB 1JDJA 1QLJA 2E37A 3RSGA 4NXNB 2ZIEA 3N07A 4E0BA 1DP4A 1GSHA 2PD4A 4PG7A 1T36B 5ICEA 1PV4A 3C74A 1KY4A 5IDQA 1OH5A 3I9FA 3AF6A 5DBFA 2XHEA 4P53A 5E7QA 3RQIA 4CT0A 1J21A 3ZUPA 2J6IA 1R64A 4EB0A 4MWGA 3GV0A 4HLUA 2HA0A 1VL8A 4OHPA 2F1OA 1W5FA 4OI1A 3UAZA 4E5NA 1NC1A 1OXTA 3C1TA 3THXB 3CH5A 1BH2A 4HUQB 4JOQA 3A36A 4EL5A 3WGLA 2ONKA 1RXEA 1V8DA 4KB5A 4KN6A 2ZYDA 2X9NA 1IY0A 1DIRA 1P4JA 4IEEA 4EBBA 5JTTA 1UZUA 1M6HA 2JHPA 4QAJA 4Q9IA 1GG2A 3ZE8A 3C1OA 3HA7A 4S0XA 2DQSA 4P38A 1R74A 2ZE8A 1DKUA 4OK6A 2R00C 1H1LA 4ASUD 5ECDA 5LOVB 4HOYA 4ND8A 1SMKA 3R6TA 5JD4A 1EM6A 4PZ9A 1YB5A 1YK1A 4Q4HB 3MWEA 1JIVA 1SXPA 4HGYA 4Z0NA 5CTJA 1YC5A 1JXOA 3O7MA 3FBTA 3J80A 2GZSA 1L5WA 4IZOA 4Y2SA 1GLNA 3PG5A 3TJZA 3WL6A 4YC7A 2HWYA 3IX7A 3FSEA 1EP2B 4JI5B 3WWDA 1AQNA 1UPXA 3CVVA 3QBVA 4QZVA 2NYVA 2A57A 3G6WA 4X3PA 3FNRA 3NGXA 3UY4A 1KP3A 1BN6A 2P2DA 1SQ0A 2SICE 4WVFA 5K1ZA 3UUWA 2BT4A 1RCFA 3F9RA 1NKVA 2P78A 2YZ2A 1UJMA 4FHEA 5TXGA 5KDDA 4UEOA 1DXQA 2WD8A 1OBHA 3TTSA 5KOYA 5TPWB 4IDEA 3BGOS 4YRPA 4NCHA 2I1QA 4GBMA 1JA1A 1WSBA 3K2EA 3CUWA 1DKNA 4K9QA 4BNDA 4L51A 3B38A 2QW0X 3GK3A 3BD9A 4Y3UA 4FEAA 1C1DB 4GX1A 3HBLA 4LJRA 1VSVA 3A6HA 4D8YA 4DLNA 3EF0A 4BEVA 3NVKI 1RWXA 1W85B 3AX6A 3EZYA 4YJ3B 1J0AA 2JVJA 5CXSA 5E6UB 1PTKA 4EQZA 3ZGZA 2GCIA 5GONB 4TVOA 3J81k 2ZVQX 4KE8A 3NANA 1PW7A 5B1DA 4YY3B 4DUYB 2AOUA 2D62A 2NU7B 3IJEB 3QVXA 1J0EA 5NLLA 5FWXA 1XZGA 2ADFA 1VLVA 2PZGA 2CD7A 2H4ZA 5F7XA 1Z2EA 4RTLA 1LPOA 1HORA 5EXTA 3W79A 1N1DA 3OEEA 2ERCA 3AY3A 2QYOA 1QIGA 1RYFA 1ZEMA 4JZYA 1W49A 3DZDA 4XTCS 2DECA 1CUXA 3BSYA 1J8FA 4MRPA 3X1YA 3NHZA 5LZ4A 2XZTA 4JMLA 2A88A 4JUAA 3IEXA 4BMYA 4KAXA 1BZYA 3JVIA 4GYWA 2ZDQA 2P9BA 4GI7A 1SVWA 4IS2A 4WDQA 3T1VA 3DUFB 2OP0A 3QE0A 3ZTYA 2RH8A 4F6RB 1G98A 2VYQA 2I6FA 3EVBA 2FPKA 4EKEA 1QO7A 4G5XA 1OLSA 3H42B 1WKVA 2ZJFA 3LZDA 1JKMA 2WZDA 3DLPX 5AJXA 4U2KA 1E1KA 1PVDA 1EWQA 4TUYB 5HJ5A 1UZAA 2WWYA 3S5UA 4RUKA 2IYVA 5C52B 2RHJA 3FDZA 3S44A 1GHTA 1KI9A 3EEBA 1XNQB 3QX8A 4E6PA 2G67A 3TRIA 4QDTA 3R24A 3BIFA 4M9QA 1RJWA 2BBSA 1DOZA 1V8OA 1A98A 3R2JA 4H1HA 5B6IA 2RI0A 4B9AA 4I3GA 1O95C 4XXHA 3UOGA 4NESA 3LC7O 4Q6WA 5A2GA 3MGCA 3RAGA 4Q9NA 3FCXA 4UXJA 3ZWMA 3VOTA 3AFIA 3OIUA 1SVMA 3SEQA 1FMFA 1YTLA 1QRTA 1IVYA 1L5KA 2YRXA 3R3XA 3FKSA 5DN6D 2TRSB 1J06A 4IIDA 5FPTA 2H3HA 3UW3A 5BQ5A 1SH7A 1NUSA 2CXNA 2ZRJA 2VOEA 1FXWA 3OLCX 5DMXA 1HDIA 4L2IA 1Y1SA 1X1BA 2OOKA 4PZAA 2NO5A 4ZAVA 4B3BA 1L9KA 3I53A 2XUOA 4XB2A 3SJZA 4CMGA 1B6GA 2XI4A 5KAPA 4KTTE 1I2CA 4WPGA 4BWGA 2FKAA 3CB2A 3VNSA 3FTEA 2V54A 3BCUA 4OX9Y 1MXHA 3R6LA 5F3WB 1PVOA 4HSGA 4TRNA 3BHIA 3DCIA 4D3FA 1QG4A 3N8IA 2OO5C 5BOSB 2ONZA 3NRBA 3UG6A 3VYTB 3DZHA 4J6EA 4EECA 3BE6A 3G89A 2XTZA 2QVLA 3K6SA 4COOA 3N8HA 4NENA 4CUJA 3UXMA 2MSKA 1ZW6A 2IGTA 4K26A 1EX7A 1NATA 2Z4RA 3EJWA 2IEYA 2Q1TA 4HAYA 4L9WA 4NCNA 4ZCLA 3ZWKA 6CHYA 1KWKA 2GF0A 2AVDA 1PV1A 1U2DC 1OWMA 4NG5A 4OHUA 2R8EA 2ZZKA 1Q6ZA 1ZI9A 3JYPA 3PC8A 2A58A 3DWFA 2ODBA 4KO3S 1X3SA 2JZCA 3NDBB 2AOXA 2DPXA 3A4MA 1ZN7A 2NUBA 4EEZA 2PUAA 1KEEA 2PBZA 3TN7A 4D3SA 5TE9A 1WSWA 1WD7A 4EPXA 1CUCA 1XTKA 3U7FB 3ID6C 2OHGA 1MOQA 2OHFA 1E6LA 3EDOA 1CYDA 1QYXA 2WUFA 1IVNA 2WTNA 3L0DA 4N5NA 4OMFG 4WTOA 3R7BA 4AMUA 4EY3A 1Z25A 4DJJA 3UA4A 3CISA 1E2JA 3MTBA 3W6ZA 5BYJA 1Z8DA 2B5VA 4MVJH 3ZWXA 1ZJ6A 1YIDA 3GZNA 1NHGA 4H7DA 4KMRA 4YTEA 2AI1A 1KTIA 3K0BA 4BFZA 4IIXA 4AY5A 3DMPA 3G68A 2VJDA 2DLCX 5C8YF 5CFOA 4NV0A 2MYUA 1TUIA 3ETNA 1GQFA 1U02A 5CUQA 4ZALA 4GL2A 3ANXA 3Q72A 2FQXA 3B9QA 3THOA 5DYYA 2J67A 1V8BA 4IEIA 2RIRA 1ISIA 4WOKA 2ZU6A 3N9IA 2PYIA 1KNQA 4DEYA 3BWEA 3OMLA 3PD1A 5HQ3B 2NQ2C 4XX0B 2PGDA 3BWDD 3HUDA 2G9NA 4DRYA 1QVZA 3C4VA 1JT2A 3M33A 5DOZA 3H1GA 1L5YA 1XEFA 2QNIA 3REFA 4D9NA 1ZP6A 2XCTB 3JZIA 3ITNA 1QDEA 1NJ5A 4F2GA 1UPFA 2YMQA 3LOUA 4ZA2A 3RIMA 4A0QA 5J2UB 1CTQA 2XMBA 1BS2A 3OJOA 4P31A 2VBIA 3B3AA 3ZW8A 4BASA 1IN6A 5B58C 3WWZA 1AJEA 2C59A 4XRGA 1TZCA 2D2FA 1KSGA 4Z6KA 3A70A 4BQRA 5JJ5A 1ISGA 3UWMA 3GLVA 3CCFA 4KPUB 5BN4B 2ZREA 4BBPA 2E3JA 4C01A 4M1KA 4ZI7A 3AHGA 2FOXA 4N0PA 1FRZA 3BL5A 4YIKA 3UUGA 5CDHA 4MRMB 3N0VA 3Q8XB 1QG6A 1KH3A 3BZWA 1Z35A 2WA1A 4BO4A 3PEWA 3L8DA 2BHRA 4HNRA 3WLFA 3OIWA 4E30A 3HUUA 3EXEB 5AYVA 3QBJA 4CWAA 1VFPA 1Z29A 1FNSA 1PK9A 1RJDA 1W5SA 3DOUA 3HXLA 4DA8A 4OLAA 3WQQA 4PCLA 4QNRA 1K7XB 4BV3A 3ACCA 4I6EA 4JYMA 1UQUA 1Q6YA 1BW9A 2AR9A 1C1XB 2WSBA 4MV4A 4PYMA 2H1IA 4ZAYA 4N41A 3HK2A 1TC2A 2UUOA 2J6BA 3OIYA 3MB5A 1C8KA 2ILVA 1T36A 3I0ZA 2PWAA 5CHEA 4Z8XA 3V8EA 5ER6A 2OD2A 5AOAA 2ECOA 2WRZA 1C9YA 1LI4A 4XSGA 5ICSA 4KL8S 4AL4A 4ARAA 2AJBA 3BTVA 5EP4A 5LN1A 1O6CA 3THXA 2FCAA 3DOHA 3CRQA 4I8XA 1QIMA 4J0QA 1E6CA 4CYMA 1NBWB 2WK1A 4QTYA 5ALLA 4O3MA 3D31A 4EDHA 1V25A 3ETCA 2PD3A 3NQ41 2YHAA 4ZZ3A 2QRUA 2NO1A 2WDZA 3HFSA 1SRRA 3I2IA 5LMCA 1AHHA 1T8WA 4A6XA 1TAGA 4BP1A 2XV1A 3UJPA 3HCDA 5BV7A 3C6YA 2OXFA 2UYYA 1PHPA 4GE0A 2JNWA 1KRXA 4I5DA 2PT5A 4NH0A 4DR5B 5H59A 4BC1A 4YJKA 3ROTA 4Q4HA 3ZDDA 2F1JA 1EH5A 3QLJA 4JBWA 4MGZR 1EA5A 2C4MA 3R7LA 2GESA 1ZUD1 3RH0A 4CM9D 2R5FA 3QVUA 2FQQA 2O2EA 1SIWA 3NHRA 3S8MA 3VO2A 1Y5IA 2PX8A 4HGPA 4H31A 4EFKA 3ZZTA 4WXRA 4ED9A 3PNLA 1E1CB 1XT6A 4N0EA 3Q10A 3Q1KA 2ZDHA 2UUCB 2XNDD 4X41A 5FX2A 3TECE 2B4RO 5JZ9A 3VZSA 3BWVA 4HLCA 5FWNA 3SJAA 4B44A 2NXCA 3Q3IA 3WMRA 4LRTB 1U9IA 5EIBC 3H4IA 1L4UA 3ETLA 2YWHA 5NULA 4TMTA 1C50A 1G3MA 2FQ1A 5TPWA 4CL0A 5HRAA 3R9XB 2XUIA 4TYQA 9LDBA 1E32A 2P2SA 5KS2A 2HRBA 1DUVG 3EIXA 1Q7RA 1ZGZA 1A7UA 3WXMA 3ZVMA 1R00A 4RA6B 1U7OA 2AQ8A 1M8PA 3GEGA 3WXBA 4MAFA 3QOWA 4RJ2A 4GX2A 3SHFA 3WICA 4F1KA 1PSDA 3EXFB 5B53A 5TQ2A 1VRWA 1XVVA 2DE0X 3HU5A 1C1DA 4RVUA 2YTZA 1HG0A 1YWGO 1JS1X 2PQ2A 1E4YA 2QD1A 4JLVA 2F17A 3VO9A 1QRSA 1DUSA 2BJVA 3D02A 3ZNPA 1W85A 3N2KB 3WKEA 5KU7A 1PS8A 4X3CA 5E6UA 4M1SA 2GXAA 3EAQA 1XQVA 2GOYA 1UINA 3IA7A 3LKBA 4J4TA 4JCCA 1C9MA 3O9ZA 1YZFA 3FYHA 2NM0A 2JBHA 4MA0A 1JJVA 3W5SA 4WY2A 4RAQA 2BDTA 2QX7A 4MOWA 5EWMB 1HDOA 3T3OA 1T2DA 3PCRB 2DUMA 4RM3A 2JGEA 2N0SA 2QX6A 1KEZA 3LRPA 2O3TA 3CEHA 4FD3A 5ALYA 1RM3A 2B37A 2CJFA 2VBFA 2XGGA 1E9RA 2BMDA 1DGQA 1LRLA 1VLMA 4L75A 1II9A 1Z0ZA 5ALEA 4ROSA 1OLOA 2OBFA 5SZKB 1A5ZA 4RMHA 2A33A 5IC6A 2W6PA 3H5OA 4HTFB 2QL9A 2W9XA 5HR5A 4UEWA 5AJYA 4KG7A 2O2IA 3I3OA 1PEAA 1JAYA 2VUUA 3H16A 3JVVA 2CMKA 1ZCFA 2CHGA 4GKVA 3AGQA 2PKRA 2CLMB 3NHBA 3ETDA 3DQZA 4I2NA 2UYOA 4RJKA 4E08A 1L0BA 1VOTA 4F6RA 1MOZA 1H1DA 1MLDA 4DPLA 5BWMA 4ZCTA 4MGKR 4GNRA 3FZGA 3TZHA 2HHHB 1NX6A 4HQ6A 2VUSA 3WWCA 5MHTA 3CZAA 1B0ZA 3GRAA 4B33A 4IJ5A 1S6YA 4EZBA 3GW8A 4ZTUB 2PNJA 1UR5A 4TUYA 4LZNA 1FPMA 2QU7A 4QNNA 1JQJC 1P80A 3TMKA 1W7AA 1KI6A 3HABA 3CJQA 3IT1A 4MVYA 4PNPA 2KW5A 1VM6A 2DU8A 3A9RA 3OLQA 5FXMA 5SYMA 4AIRA 2X8BA 1HK7A 1W2WB 2FSIA 3HV2A 4BX3A 5HCIA 1QH8B 4YROA 5IK2D 4JXJA 3PKZA 3FDFA 3GJ5A 4KXFB 2W2XA 3KT0A 3D4BA 5EMNA 1HYGA 1P2GA 1I2ZA 2P79A 4LXGA 3K9BA 1KYZA 3DHNA 1E9BA 2XE6A 2REQB 4MK4A 4ZVSA 4F46A 2VRCA 4LY3A 4TKUB 1Z6YA 2JJMA 5C8DA 3VH4A 1B14A 1YQGA 1KKLA 4NU6A 4RMJA 1PTJC 5C2JB 2CNBA 1OWOA 3GRZA 1TLFA 2HNKA 2GUWA 3IUEA 4O33A 3TEJA 2YL2A 4RVFA 2BP7B 5JXHA 4QX6A 4OU4A 1O1YA 4Y6OA 3I6QA 3EVEA 3N6RA 5D7BA 4ZU1X 1R4ZA 3W1WA 1UEXC 1NKTA 1NFFA 2QN1A 3RD5A 1SIUA 2FZ5A 3BA6A 4MVCA 4H16A 4K81B 4U63A 3EZ6A 4JBHA 5IWAB 4V2IA 2AYZA 1E2HA 3LO8A 1DWUA 4YBRA 4TVSA 4ZZIA 1H3FA 1F2TB 3GBPA 3ODGA 4D8UA 2XAUA 3KSAC 1HE8B 4E2WA 3STWA 3KR2A 5BOSA 2O5CA 2Z2XA 5FEUA 3W5AA 4UM8B 1TKRA 3RRBA 1B4DA 1IC6A 3WAJA 3H2KA 3JWGA 3NBZC 3R7WA 4EHAA 5AXBA 5KDLA 4B43A 1YZLA 5C8VA 3HO1A 4C0JA 3OCZA 5D6NA 3HH8A 2HMVA 3H3XA 3ZGOA 2J9GA 2O06A 1QC5B 3A2MA 2IPNA 4KDRA 1VHDA 1VJ1A 4W8OA 5LUBA 4AMBA 1PWHA 3TG2A 4DABA 3HADA 3MNFA 3I83A 4LZWA 1G6KA 1SOVA 4IJKA 4MYUA 2BFNA 2EKDA 2QPLA 2AHOA 2VZ0A 5DYGA 2VDUE 1Q1EA 4MWBA 1DIHA 1E9DA 1QQ5A 2XTAA 4Z86A 5LZ7A 5JXJA 2QP4A 2Z6UA 2Y93A 4FHCA 3WV5A 2Q5LA 4IDHA 4UUQA 5G3YA 1VJRA 3NHLA 2FA9A 3PGLA 3L7AA 2WJ6A 3PX2A 4MR9A 2PMFA 4MS4B 3A27A 4DJEC 3HI4A 1ZY2A 3PL1A 4ZK6A 2ODTX 4G37A 2B35A 1C4KA 1SM4A 2F48A 4GW3A 3CY6A 4F11A 1ULHA 1M5TA 4YUYA 4HF7A 3AOGA 4MIOA 2HDHA 3VZBA 2IHYA 2P68A 3B3QA 3L7MA 2XEXA 2EQBA 2BRUC 3GGJA 1YZYA 3PB3A 1KMCA 4KQHA 4U6NA 5CW2A 3QWIA 3GPDG 3UNXA 1A8QA 4QBGB 3F9CA 4MVXA 3JQEA 3SNHA 3V2UA 1V4VA 4MKXA 5HQ3A 4JQZA 4O2BF 1EHIA 5CFNA 2D13A 1UODA 4X1OA 2X9QA 4E7PA 2WAXA 3UTCA 4TQAA 4OM7A 3TX6A 1A5BB 2CYBA 1RQXA 3WGQA 2RHBA 3D4PA 3FF1A 5K3SA 4A0HA 1YZVA 3U09A 1AN0A 5C31A 1Q3TA 1WCYA 3H97A 3MK31 1TU3A 4MQUA 1BJKA 2QGZA 4M1ZA 2AVNA 2IUUA 5J2UA 3NDPA 1CUAA 1GLGA 1ODJA 1H0RA 3HCEA 5G02A 5BT9A 4DS3A 4DYVA 2PUDA 1ZOLA 2BM9A 1QTRA 1USGA 2B82A 3NJRA 4ZVRA 1GGMA 1NXOA 2WIJA 1VDZA 4CKYA 3CE6A 3N2IA 4JL5A 2Z3WA 4KPUA 5KB3A 5BN4A 4XWGA 1E61A 1R2QA 2WBLC 1FLVA 1VGQA 2IEAA 5T5QA 1PFKA 2DYKA 2VT6A 3EW9A 2H1WA 1U7HA 3E4DA 1R88A 4MRMA 1O58A 5CT8A 5E1OA 3T7EA 4ENRA 2ABWA 2O54A 1Q50A 4PRLA 3MFQA 3Q12A 3LA6A 2AN3A 4BN5A 2VPYA 3EXEA 1KQPA 3HWWA 3GO4A 1AGRA 1HFKA 3IV9A 4W7SA 4OM8A 2I71A 2ID7A 4YXWA 5C7LO 3BK7A 4WK2B 1OTXA 2H65A 3NDIA 1C1XA 3BHJA 1JR3D 1RWNA 2JIMA 4RGVA 5F78A 5IW8A 2NO9A 4RZSA 3TRKA 3KU4A 2YVQA 1QK5A 3EZXA 3FGPA 3SHQA 2QT0A 1LNQA 3ZIUA 3U6BA 3NKFA 1P4RA 1L4YA 2I8LA 3K0KA 3WOVA 4DCVA 4RJJA 1K66A 4P8RA 1P9LA 2IYSA 4JFRA 4LF7B 1QKJA 4FCTA 4Y30A 1Y1PA 4HDNA 1V4NA 2PAAA 3GHHA 3O2NA 4F45A 2UXBB 3FYUC 1FYFA 4IMPA 1ZZGA 1KS2A 5EZYF 4NOJA 2XXJA 4Y6GB 3M3PA 2QROA 1ZK0A 4MMYB 1SCBA 3HJTA 4BO9A 3P27A 1UKZA 1VYTA 1QCZA 2H31A 3E9CA 1IU9A 1U6KA 3TOXA 1LI5A 4MROA 4DQ0A 2JLAA 4E5YA 2Z1MA 3OZAA 4MKGA 5HILA 4Q9HA 1NJSA 2FPPA 2HIMA 4XYGA 2L19A 4XZ3A 4YHBA 1UCFA 4H18A 3D5QA 2Q9BA 3IAHA 3BZBA 1KVTA 4EYOA 4JXZA 2OAQ1 4DJFC 4CT4B 1SUCA 3T95A 1II8B 3JAWA 3LHFA 5CM9C 1N6IA 1V35A 1JSLA 1C8BA 2PKQO 5K8UA 2XSZD 1X8JA 4NABA 5LZ2A 3R5KA 1P4AA 16PKA 3ZIAD 1E1CA 1DVRA 4S24A 5CP8A 1UDBA 2FW7A 3H99A 1TC1A 3O73A 3ZI0A 3TINA 1CU1A 1X80B 3N5KA 5EIEA 1QHGA 4HX2A 1FUUA 1WETA 4L73A 2RC6A 1MPTA 4TXNA 4X6YA 1NQWA 5CA1A 1NA5A 1WQ1R 4TTVA 3PEUA 3G9UA 4JVNA 3R9XA 1K98A 3TM5A 5K4GA 4HB0A 3DL2A 2CLHB 5E2IA 1H2BA 4J0EA 1T1SA 4ZZ2A 3R6DA 1ECFA 2V7QA 1KARA 4HLQB 3EXFA 1U8XX 3V8PA 4KN9S 5KMGA 1GZ6A 4HLNA 1LFAA 3EUFA 4DDKA 3QE3A 3I5YA 3N2KA 3F6YA 1L3CA 2GAFA 4AIIA 4J0FA 4B9EA 2FUNB 2CDCA 1CF4A 1BRMA 1KR5A 5IABA 1FJXA 1KQOA 3SIWA 3WA7A 3JSAA 5I8ZA 4WK6A 1AKVA 2FEAA 4NV1A 5EOVA 2AH5A 2DVMA 2RC5A 5JDIA 4HAVA 2W6ID 4R9VA 3SZOA 3WO1A 3GDOA 3S1SA 2FWNA 2VEOA 4B46A 2HSZA 2JRLA 4QQFA 5KYNA 2IYTA 1JZQA 2M1XA 2NW6A 3TFOA 1N1MA 1EUCA 2QF7A 8LDHA 2AV6A 4RH1A 4HTFA 3L06A 1U3UA 1GARA 4LWZA 2Q4DA 3COSA 1UXKA 4RE5A 4ZCIA 2XRZA 4CQJA 4RVDA 2GBCA 2P5SA 3PFHA 3LAWA 2OG1A 2GPTA 2FH5B 1L6RA 1V8ZA 1XP5A 2QV0A 2X9GA 2HHAA 2AS0A 3GD5A 5LKAA 1HQKA 5M2QA 1MH9A 3OQBA 3QGMA 3OF3A 2AYYA 2QQGA 2VVTA 1KDOA 1RRPA 5KNDH 2OC4A 4GMXA 3VDXA 1E89A 4KN8A 3GLUA 3DKKA 5A03A 3DM9B 4MUEA 4EA9A 2QENA 5J4HA 5EUBA 3IHTA 4MAMA 2J09A 5HUHA 3O94A 3PS9A 1YZGA 4C0HA 2V7WA 3RJZA 3SNKA 1ETHA 3VRHA 1W1WA 3H87A 3KZVA 1XNGA 3UG7A 1ZICA 3L8MA 3R77A 4IQ8A 4NY1A 3WKDA 1U7UA 2IYNA 5FWAA 5TR9A 2H1OA 1OHHA 1MNAA 3HCOA 4D0SA 1Z7BA 5ARCA 3DKVA 1IL0A 3O92A 1FTNA 1OT5A 3QF4B 1X38A 2OQ2A 1RQ2A 4K3UA 1PW5A 2Q9AA 4G26A 1CUSA 4PBRA 3IMKA 1OFUX 3PEEA 3RYHB 2OCXA 2ZJ5A 3G2LA 3MILA 4JIMA 1W8IA 4S1TA 5AOCA 1PBNA 4C5BA 4K86A 4BQSA 2FMKA 4M2LA 5C37A 3RGWS 1LLDA 2C4NA 2B69A 4HCJA 4RLQA 1M1NB 4JD5A 5ER9A 1KMMA 4JMPA 4XWKA 5LMUB 1XXLA 2BP7A 1FQOA 5I7AA 5ALJA 3FA2A 4EA7A 4B73A 3BH7A 1N6RA 1YS7A 2HPVA 3D7RA 3B1YA 4KN5A 4L95C 4IFBA 4RVHA 1O5OA 4MUNA 4X97A 5CDUA 3WLNA 5ALHA 1JPUA 1X7YA 5E1DA 2Y99A 2HV8A 2IIPA 1CY0A 2RG1A 3A9CA 3QWBA 3S1AB 1ACLA 4QTUB 1DEXA 5KYX