2X9QA

Structure of the mycobacterium tuberculosis protein, rv2275, demonstrates that cyclodipeptide synthetases are related to type i trna-synthetases.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
236
structure length
231
Chain Sequence
b'FQLGRRIPEATAQEGFLVRPFTQQCQIIHTEGDHAVIGVSPGNSYFSRQRLRDLGLWGLTNFDRVDFVYTDVHVAESYEALGDSAIEARRKAVKNIRGVRAKITTTVNELDPAGARLCVRPMSEFQSNEAYRELHADLLTRLKDDEDMRAVCQDLVRRFLSTKGATATQEQVCMDYICAEAPLFLDTPAILGVPSSLNCYHQSLPLAEMLYARGSGLRASRNQGHAIVTPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLODIPEPTIDE SYNTHETASE
publication title The Structure and Mechanism of the Mycobacterium Tuberculosis Cyclodityrosine Synthetase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 82
structure length 231
sequence length 236
chains with identical sequence B
ec nomenclature ec 2.3.2.21: Cyclo(L-tyrosyl-L-tyrosyl) synthase.
pdb deposition date 2010-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16715 CDPS Cyclodipeptide synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2x9qA00
2X9QA 4Q24A 3OQHA 3OQJA 3OQVA 3S7TA 3OQIA 3OQIB
chains in the Genus database with same CATH superfamily
5JJ5A 3H75A 3WWPA 2FMIA 4BQOA 2JFWA 3E2IA 1I4OA 3CKMA 1KP3A 1BWQA 3GAAA 4R7TA 2FEXA 3IB3A 1VPEA 3HL4A 1QHYA 3AIKA 2QTTA 1ADGA 3EZLA 1NJ8A 1P9NA 5JARA 1ZCBA 3X1JA 1T5OA 5AK6A 1L4KA 4Y1GA 5E95A 1Q0QA 1Z47A 2O06A 2E5FA 3PCTA 4AF7A 4R05A 3H1PA 3HO6A 3ZI0A 3C5VA 5L3VA 4EYOA 4GOKA 3KYDA 1VGVA 3QHQA 5BSEA 2PKQP 1ZM9A 4Q7QA 1TIBA 2QZJA 3QI2A 4BC1A 3L7JA 4R2LA 5K3CA 2VT7A 4D3YA 1JIUA 1AGRA 2A0YA 3LDHA 1CSEE 4R9SA 3T9AA 5DXAA 3IPAA 3WSVA 4EABA 4QOSA 1UK7A 4HLUC 1R9JA 1ZUNB 2P6OA 3CB2A 4BGUA 3LCMA 4A6XA 3OCVA 4INAA 2WAAA 4Z99A 1BFKA 3WNBA 5D3MB 5T4EA 3W2IA 1YS7A 4H4EA 1LI5A 1GV0A 1PJLA 3ZDQA 2EFJA 2G09A 4PX2A 2PKYX 1ZCJA 3K09A 1ID1A 1Z56C 5HCIA 2GKOA 3INRA 4K05A 3LLUA 4EA9A 4MJ3A 1GGVA 1O9HA 4CLRB 4IO1A 4BNLA 1J9EA 4MW2A 4U8HA 3ZZ0A 5AW7A 2R85A 1RXCA 1JIQA 3KP1A 1S8FA 4X65B 3HCEA 3N9IA 1XJQA 3VPBA 2J0QA 2AFHA 4UPVA 4NZPA 2EKDA 2HA0A 3HGMA 3WLPA 4RTRA 5KOHB 2Z6AA 3EGIA 1MB0A 1D2AA 3LDGA 1SB9A 3HCPA 3OQBA 3QVUA 4JVOA 2VF2A 4CMGA 3WJAA 4IIVA 2PLFA 3JR7A 3UN1A 1UC4B 1ZGHA 5EG5A 1KI2A 1JRLA 2DUNA 1S02A 1F2VA 1YB6A 1K86A 1PYGA 1LBIA 1M75A 4URYR 2WWHA 1K66A 1QIGA 1SG9A 4U6NA 4XGIA 1XJCA 4JT2A 1HNWB 4K6GA 3DDWA 5L53A 4O0LA 2P2GA 4LIPD 4CM9A 3HWSA 3IUYA 4HQNA 2ZRCA 4LE0A 5B3KA 1Z0UA 3CR3C 3CZAA 3O3OB 1UH5A 5E3JA 5JZVA 3HDGA 3V4OA 3ZWDA 3CY6A 1H6DA 3MN1A 1K3FA 3AHIA 1KMMA 4URHA 3RBXA 4UW9A 3S1LA 4IICA 2AD5A 2YTZA 3P4UA 3W3AH 3JASA 3ELYA 4OHXA 4KNWA 4RWZA 5L7TA 3I76A 2WU1A 1PX2A 3E7DA 3ESXA 1K3UB 4EKDA 3VH1A 3QIAA 3DDHA 3HKDA 1A9XA 4A2CA 2AW3A 1J33A 2AC7A 4AG5A 5HRCA 4BVEA 4LJRA 1Y3IA 2ZYVX 5DHUA 3ODPA 2UYOA 2NPFA 4AN1A 3GRAA 5IUNC 4MPRA 2PV7A 3B7PA 5TX7A 2QM0A 2HX1A 4R9NA 4OHMA 1NF8A 2AG6A 5HF8A 3WKEA 2BEWB 1JAYA 2YR0A 4J16A 5AFSA 2NO9A 3WXMA 2GCPA 3QE4A 1EFVB 1U28C 2NU6B 4L4XA 3UJAA 2XQFA 3CRW1 3ROFA 4A10A 3VGPA 4WZAE 3WYFA 1XLTC 5LVAA 1BX1A 1CEXA 3EASA 5REQB 3MS4A 1E1RD 3C70A 4Z3KA 1WXWA 1X7YB 1CUCA 2UZ3A 2VUSA 2WFAA 4M1WA 4JFAA 1PQYA 2X0IA 4JSYA 3VYRB 4G5GA 3QLTA 5EMNA 1O95C 3UOGA 2XBUA 1E3IA 3DOEA 2Q5CA 2MSDB 3GEIA 3N74A 3UH1A 4A8JB 2QUIA 3I0ZA 3L3BA 3N2EA 1E3EA 2AN3A 3JTMA 1FLAA 1LC3A 2B8NA 4OKNA 5JYEA 4ZAGA 4UOZA 3ANSA 4NV0A 4P54A 1G3QA 1AA9A 5SV2A 3ETCA 2FUKA 4XUCA 3MJVA 3ZHRA 3I04A 4XJSA 4M0CA 4IUYA 4OJTA 2GMWA 1WW8A 1FXWA 3SR3A 3GEGA 3VC1A 4AF8A 3P2OA 4Y2UA 3B89A 3AF5A 4HAOA 1ISFA 1E20A 1UK8A 5TQ0A 4B3FX 2RAPA 3PJGA 2PMBA 1XL1A 2D1YA 4LMBA 1OTYA 1ZW6A 5IP5A 2E4WA 4Q4JB 1PHPA 3TZQA 5JAIA 3Q9SA 1CU1A 4TMTA 1FFYA 1FFBA 2YHIB 4DJEC 1MAHA 3RS5A 2F62A 3GNQA 4M4SA 4EH1A 1P33A 4TQAA 2R1UA 1SXPA 3ND9A 3SE0A 4O5OA 3AOEC 3MUFA 2PX8A 4QYMA 1FPMA 1GPBA 3MNFA 4F9TA 1KH3A 4Z7OB 2QN6A 3LPMA 4YLEA 1H22A 1CQPA 4G5XA 1JTFA 2KS6A 1XYVA 4GP6A 1RLMA 5K6RA 1KZHA 1Q7GA 1C30A 1K6EA 1AUVA 3FMPB 4HNAB 2ZTSA 4MKRA 4HQLA 1OLUA 2ZUCA 4EHBA 3D2BA 3KE9A 3KU4A 2YWBA 4GWKA 4LZAA 4MQEA 1J8QA 4C78A 2Y8EA 1PLKA 2FPPB 2ZRQA 2XYQA 3KETA 1TF5A 2OPHA 4X6YA 2Q3MA 2QR3A 5JANA 2Q4TA 4UM7A 4CF3A 4W1QA 1NV8A 1OH6A 4W5WA 3T95A 4OI1A 2ZBGA 4IJKA 5AKHA 1WUYA 5L6MB 4CNBA 4GZ6A 4F3RA 4BNKA 3ZY6A 5H8WA 4W9MC 1QHXA 3KOXA 4R2WA 3EEIA 4ES6A 3SHTA 2EQ5A 1JEDA 1NYTA 4US2R 3PNMA 3ZIUA 3GPBA 2AUTA 2ZUSA 3AB3A 3R75A 4MGYR 1K2VN 3R7NA 3ZE9A 2PZJA 1OROA 4D0RA 2MHCA 5FHQA 2EHDA 2H9AA 4I4LA 2NPIA 4MKGA 4G0WA 3ROQA 4AIIA 4YFVA 4LRUA 4F4IA 5IWCA 1LRKA 2JAXA 4C4OA 2OVFA 1QO0D 1TO1E 2Q5LA 5KUTA 1R37A 2ID9A 2ZYGA 1QNFA 5DU2A 4O1HA 3OD1A 1K8RA 1JKJA 2EGHA 3H3FA 4UHJA 5TPWA 1OW3B 1PNTA 1WCIA 5KYNA 2R1TA 2PXXA 3V7UA 1PJAA 1IU9A 1CB0A 4NCIA 4MHOA 3EVFA 3G59A 2BW0A 3L8YA 2DOKA 3KKEA 1J8MF 3RC7A 3BVPA 1NR1A 2FSUA 2HWYA 3RHTA 4C7OA 1DRKA 1UIMA 3FWKA 3CLUD 1QU2A 1Y6ZA 2ATCA 3AZOA 3T99A 3TTXA 2C2XA 4J3FA 3JD1A 3A6ZA 4MWTA 2O3RA 2UKDA 3F7TA 3PHHA 4UZFA 3E3AA 3MWLA 3VH4A 3K4QA 4HS4A 5JAUA 2JFYA 2EP7A 5CTJA 3IUPA 1E1NA 2H85A 3K2QA 5THKA 1IAQA 4W82A 3PEEA 3SF0A 4AS3A 3ZHOA 4JI0B 5FORA 4LWQA 2W2LA 1EBBA 1ONPA 5ILGA 3LX6A 1JR3D 1E92A 5EESA 4B73A 1ZM3A 2FSVA 3BCSA 2ZATA 3E3MA 1F0YA 2VRWA 3KRTA 1VKOA 3RBVA 5LNK1 4HR7A 1FRZA 4D56A 1ZVVA 1VL8A 5DN6A 2G1AA 5L9AA 4C0JA 1CIVA 1ABBA 1GIAA 5G0TA 3IHWA 3UH0A 5A4IS 1B1AA 1JT2A 2C5FA 3EVEA 3OOYA 4LBWA 5EZ5A 5CFNA 1DKPA 2CVFA 3LQYA 1O08A 4OOFA 4EPVA 1NQTA 1X1BA 4UTVA 2J1LA 2PMCA 5KNDH 4L22A 4JUFA 3ZJTA 3C4VA 2P4QA 3U1VA 2X4LA 1YJXA 1C5KA 1NYQA 2IEZA 1HE3A 3DULA 2IL1A 4ZT3A 3VR2A 4XVUA 4F8JA 4TZ0A 1DDGA 3T35A 2Q3DA 1FSPA 2IHVA 4IGEA 5I45A 3RU3A 2VYNA 3TTSA 5A4KA 1GZHB 3F6CA 3NTLA 2A5LA 2G08A 4MEAA 2RGGA 1VSVA 4TUYF 1TI7A 4ZT6A 3Q0TA 5HMMA 4AJKA 4HDKA 1OC4A 2JIBA 2UYQA 3K0HA 3V4ZA 1E0AA 2ISSD 4OQPA 2GAOA 4H7JA 3G9TA 5C18A 2CW5A 1K4MA 1KC3A 3AZPA 1TA4A 1WHSB 4K2AA 4NS4A 1WKBA 1VJ5A 4HGRA 4UJ5A 2VRCD 5FOSA 4PVDA 5DISB 2VZ9A 4KUGA 3I9V6 3KT6A 3U09A 2Q5QA 1EUCB 3BGSA 2VRNA 3L7LA 3PUWA 1N0WA 3E22B 1AT1A 1I2ZA 4ICIA 2JIDA 3T7TA 4JZKA 1JDBB 5H82A 3Q1KA 2Y1CA 4TVKA 1JFTA 4EJ2A 5CBPB 4ZYTA 3I2GA 3LOPA 5JC1A 2ZCUA 3W6UA 4IHAA 4EITA 5AR1A 1JW9B 3ZU5A 2PWZA 1P4GA 2O7NA 4ESHA 3F73A 3IVRA 1SVOA 2X41A 4REMA 5H68A 3HP4A 3SZLA 3ZGYA 2I5PO 5K0JA 1HT3A 1MVOA 1LTHR 1HQCA 1PUJA 4KVZA 2XOKD 4UDXX 3NPMA 3REGA 2R7NA 3CRQA 3EG9A 3QHPA 3VV3A 6ADHA 1V3UA 1XCPA 4I2NA 1XV5A 3L01A 4MYUA 3CRZA 2DAPA 2IYAA 2C77A 4Q48A 4B6JA 4E51A 3Q7QA 3F49S 2PGXA 3DL7A 1G18A 4IO0A 5I7EA 4X8LA 3SBEA 2XCIA 1BD3A 5B1DA 1EHYA 3JW8A 1D8TA 3BXZA 3MJRA 4URUR 2NVUB 1TJ4A 4YRLA 3LPLA 1FFCA 2R8YA 3FLEA 3FH0A 2WP0A 2E37A 1EM8A 4AO7A 5KC9A 5JQGF 3IMFA 3ICEA 1FRFS 1ZBDA 4R40A 2ECQA 3TDKA 1D6SA 3GK3A 4L3WA 5BQOA 2JH9A 4I5EA 2C0CA 4J4TA 4NENA 3UBMA 4L6CA 3A1VA 3I28A 4EA7A 2BDEA 3BH7A 4DV4B 2V7UA 4YJHA 1GXSB 2WB4A 3OT4A 2Z2ZA 5AICA 3TIGA 4B34A 1NJFA 3HA5A 3VJRA 1Y1KE 3BTVA 3QVMA 1B8PA 1TPZA 3ZWYA 4DRXB 3OA2A 1PJQA 3U3ZA 5HRUA 4DV5B 1DNPA 1U0LA 1EGHA 1PQPA 2OKGA 4UTPA 1XK7A 3HKBA 2WJ6A 1NF3A 1XZIA 2CSUA 4V2UA 3ETLA 4A2PA 4AUEA 2CLSA 3JY6A 4XLTA 1CETA 2FHPA 3QFRA 1GO2A 2HV9A 4WUTA 2FP4B 3B6EA 1YONA 2J9FB 3R0QA 4HGYA 2WQ7A 1NDUA 1J20A 3WLQA 2W48A 1Y1LA 3I9FA 4P92A 1U5AA 2XUPA 2BYTA 4O2BB 3GN2A 2H16A 4CL0A 1E1MA 1KSFX 2H17A 2FX5A 2PZKA 4LZWA 4Z1OA 3ILHA 2L2QA 1FFSA 4EB8A 3G68A 2O3JA 2EOAA 4MINA 4X20A 1ZMBA 4JI7B 2FPLA 5ILQA 3BHJA 1FNDA 2WYOA 3T0IA 5BR4A 1M1YE 1C3XA 3EN0A 5HQJA 2UYCA 4ZZ2A 1XRSB 5ADVA 1TNDA 5IBCA 4CM6A 3WLJA 4IYRA 1OGJA 4JQZA 4FJ2A 4PPGA 3UJNA 1LX7A 4KR6A 2XA9A 2O5RA 2V8OA 3E9EA 4AJLA 1YZYA 1LDNA 3MBOA 5DEIA 1XHFA 2DLNA 4ECAA 1U5BA 2QN8A 3S2YA 1RLIA 1GQYA 5T8KC 4Y3UA 3E05A 4K6OA 3G0BA 2VPXA 3MC1A 2VG8A 3BQNB 4L0CA 3UB2A 4HNVA 3N8HA 3IPYA 4LJKA 1L5FA 5FL3A 5FF9A 3S27A 4KH0A 3TI9A 3NHRA 2OUIA 1QWOA 4MV7A 4UUAA 2XGJA 1O58A 2YS6A 3AEXA 3VU3A 4AJEA 4BQSA 8AT1A 2C9CA 4PNPA 2C2MA 3WWEA 4FIZA 3JQ9C 5CW2A 1DQSA 4EW2A 1NVEA 2VRBA 1C3JA 3CLUC 4LA4A 1QZXA 2JFNA 4EW6A 1KVSA 4QGGA 4EYSA 4TRMA 4TXJA 2FAXA 4NEHB 4U7JA 5LJLA 3FHOA 5CB4A 1UK6A 4WDQA 4DV3B 1KORA 3HJNA 1MABA 4RS3A 1V11B 3EBPA 5HM6A 2JZOA 1SBZA 4FCCA 2I4TA 2XQKA 1NQ5A 3DT8A 2ZUVA 4PG7A 2QIOA 1C3EA 2WYVA 3HV0A 4CDMA 5KREA 1UFOA 3OLZA 5K6TA 3GNLA 3HRIA 1QCYA 3GR6A 1TM5E 3K9GA 4RL4A 4EGQA 2XADA 5FTJA 2P2SA 2H0RA 4M22A 3TTWA 1AUXA 4YAGA 1UJCA 1M34E 1TEXA 1JLRA 2HLHA 3FKSA 3RC9A 2J4CA 1KZYC 2WZDA 1G4UR 4JJ8A 3G3EA 4QBGB 4A23A 3AESB 3PI7A 2H6EA 1GAQA 1T1GA 2LIVA 1MH9A 1NI4A 1TMYA 3OIUA 5KSYA 1K9VF 1E9SA 1U3UA 2FK7A 5L51A 1ESDA 3DWGA 1HLGA 2I7TA 3I6MA 3EFOA 4N76A 4Y30A 2RI6A 3L07A 4UTRA 1WOMA 4AUMA 3KQNA 3VZRA 1VE5A 2CC2A 2ORYA 1L7AA 5GIPE 4KJXA 3DW1X 1ITZA 1R16A 4N6GA 4HXFB 4OAPA 2C8KA 4P0PB 5LD2C 4LJ5A 5E4YA 1DXHA 4LSGA 3NZEA 5BR1A 1RKQA 3GLKA 4QU5A 1XT6A 2VDWA 1NUQA 2A59A 1JXOA 3HVJA 3OCJA 4DA8A 3S8EA 3CZRA 3M5WA 4G1UC 3VC7A 2QWXA 3HP1A 1NUPA 5LQJA 4OQMA 2JLSA 3ND7A 5AM5A 1DG9A 1GKLA 1GL6A 1JUDA 1ZD2P 1J2UA 4W1RA 1I94B 3L1KA 4QUDA 3RQSA 3TW4A 2WHXA 3M1LA 4XX1A 3EX7C 2AUMA 2ECFA 2F3QA 5T57A 4NH4A 5U4QA 1NW8A 1SWVA 3FBGA 4RGVA 1EPUA 1WD7A 1TKAA 5KNBA 2SKCA 1BS1A 1ZINA 2ES4A 1QOPB 3WDKA 4TZTA 3FJYA 4QLOA 5DWDA 3BIJA 3LP5A 3QPDA 2I2DA 2BFMA 5KYUB 3DUWA 2QNRA 4WZBB 3L1HA 1CRLA 1TKRA 1FDVA 2E2WA 3PWZA 1Z6PA 5BXQC 4YRAA 5BV0A 1IB6A 1OV4A 1RZVA 1T0IA 4JI2B 3VKUA 2H7CA 2A86A 3MMZA 3S44A 2H59A 2EP8A 3CZPA 4OHCA 1OTXA 2QA5A 2ZZMA 4CM4B 4AN4A 2JJ8A 4FMDF 1WO8A 1QC5A 1CZOA 1V7PC 3DVSX 4G09A 1BS2A 3NANA 1UR5A 3S2GA 3UEOA 4DADA 2GM4A 1CP3A 3AFOA 2WICA 3B9QA 3MA0A 3GHYA 4I5FA 4LQCA 4PV7A 3RT9A 4MWEA 3VZBA 3L6OO 1NJGA 3I8SA 2R8OA 1Y8QB 1PGOA 1BCRB 1GCIA 1PJ2A 1PVVA 2OV6A 3W2EA 3IULA 2ZJ7A 4BLOA 1JJ7A 4HZUA 3W3ZB 1LRJA 2YC4C 3DV0A 1XL0A 2OGUA 1CVRA 3IODA 4Y9SA 1RKVA 5SZKB 5JZOA 2HRDA 1DDIA 1U0EA 1MO6A 1SEVA 2CF6A 1H3EA 3KJHA 3MTBA 4LJAA 3OT5A 4YI3A 5K4AA 3RB8A 4E5YA 3HBLA 4GPTA 3FUWA 4JT8A 3K7EA 1KZ7B 3H97A 5KTNA 1XCMA 2YBEA 2QPAA 4HDSA 4M3NA 2XWBF 1PR0A 2WUEA 1H2RS 3I34X 3N2ZB 4TS1A 4CDRA 2PUEA 2PGJA 4U2EA 4B32A 5K20A 3CW9A 5CVJA 3WZMA 4NJMB 4GUDA 2WM8A 3ZHYA 4BQNA 3I53A 4Y0VA 3W9YA 4RPIA 1FXWF 2IUYA 1ZRSA 4UZSA 5GOZA 3QLVC 1HTWA 4X90A 5EIBD 3ZX4A 4MMZB 1RQ7A 3W04A 4EY5A 1YASA 1A2KC 2Y0EA 1UC8A 3R5JA 5ER9A 3RASA 5CLFA 1AQYA 1H2HA 1QFYA 4P08A 1D9ZA 2HSEA 3GJZA 2PFKA 3U7RA 2AQKA 1A4RA 3FFXA 4UUQA 3SQOA 1JV2B 3G7NA 3U7QB 5KYYB 4TL8A 1T1EA 3UGJA 2H9YA 2RAFA 3K73O 2YDYA 4FYIA 5FA8A 4BV2A 4E7PA 4OK5A 4N0PA 2VXBA 5EIWA 4ZGBA 2B4KA 4RD0A 2OP1A 4XYLA 1L4LA 3GLHA 2Z9BA 1VFNA 2V0CA 1YL5A 1HNXB 1V1JA 1XZKA 1Z2OX 5FUBA 2PLWA 1X8XA 2YWCA 2CHGA 4H0CA 2RHMA 1UODA 1T3HA 1QGAA 5FYDA 2B4RO 4R5HA 4N6NA 2R96A 2NTEA 2X8BA 1A72A 4RSMA 2EJVA 3ISTA 4WESA 8ABPA 5EHIA 3IP1A 4TROA 1TT5A 4BP1A 3LHFA 4C3VA 5B4UA 4MS3B 1X86B 4N5LA 3SSNA 3WLAA 3ZNQA 1MO2A 1VJDA 3ENNA 1HDRA 2FPKA 4LISA 4WE3A 1THMA 1WF6A 5AJWA 2X42A 3H1TA 4G4SP 3RJ9A 3UAOA 5JD5A 4C0KA 1BMFD 4P2GA 3A2NA 3PHJA 1TEVA 2VDKB 3PLRA 2C57A 2BGIA 2PD4A 2BFFA 3F96A 1TM7E 2BMDA 5ALVA 4BLUA 1DKUA 2RGCA 4RCYA 5CJPA 1OT5A 1RFGE 1UP4A 4GOJA 3TD6A 3OETA 1E1CA 2WKQA 1A98A 5L6LB 3KAKA 4PO1A 2B20A 1NDQA 2XMRA 1E2KA 2J3DA 1G6KA 3NM4A 4JGGA 5JFTA 3VYUB 1EX7A 2AX4A 2W2XA 4RORA 3DPSA 3MLAA 4RKQA 3C6ZA 3RNOA 4HGZA 2AOUB 2H1FA 4WLEA 4MUYA 3U81A 1O6ZA 3FDIA 4LSZA 3UMCA 3JQ8B 5K8LA 3FGOA 1E7YA 3N05A 1U3WA 2R6AA 1MVLA 2ZQYA 4LRQA 3V8PA 3AEZA 1KR2A 4IS3A 4MGEA 1CT9A 1T2VA 2PSEA 5C7YA 2QZPA 1ZIOA 4Q24A 2HUPA 2MINB 4IIJB 1P4AA 5HDBB 3LTNC 2HU8A 1QLWA 3I64A 1CHDA 2WYUA 1M2HA 3QF7A 1XYGA 3KB2A 5AKLA 1KAOA 4IOKA 4UDOA 1NKTA 5EGSA 5C1PA 4DVGA 1Q7EA 2O5EA 5CEJA 1OTHA 1H94A 4NKRA 3TUJC 4ZI7B 1X80B 4OV6B 3NYIA 3TJZA 1GPYA 2R84A 1AKNA 5E4TA 4HD8A 4R1MA 5ESDA 3TQRA 4ZDJA 1X0XA 4LXGA 4QJ4A 4RK0A 3PP8A 4PZAA 3MZ0A 4ZHQB 3JRXA 3RHSA 3SC2A 3ORYA 4PSKA 5KNBD 1Z5OA 4F7WA 4W9NC 3OIVA 4W5OA 3ZCRA 4HNQA 4IIDA 5A3QA 5IS2A 3IMKA 5DX0A 1VSUA 1XNRB 4M0LA 3F9IA 4MWOA 1G4HA 3VI4B 2O0MA 2PGOA 3DBLA 4EUSA 1IEWA 3D8SA 2KSQA 3KAPA 2CHQA 3O8QB 3TMKA 3U44B 2F55A 1JVBA 4YK7A 1UK9A 4YIKA 3NWOA 3FCOA 4XJXA 3ZWNA 1CQIB 1F0PA 4MA0A 1DPGA 4ZC8A 3TEFA 1KMHA 5KKCA 1JPJA 2KBEA 4ETIA 1DIHA 1KK3A 1PZMA 1SBNE 1SWWA 3DTYA 3LUHA 2JDIA 1JIJA 4IIEA 3LQKA 1VI6A 2GYYA 1BC5A 3AR8A 3EEQA 1CIPA 2WTUA 3QE2A 1U0SY 4O2LA 4I1UA 5BN4A 2WQ6A 1JG7A 2O8BA 3VV2A 1VGRA 1U8YA 5FOUA 1P5FA 2XWQA 3KD2A 4JBNA 4JU8A 4IG9A 4KXWA 4D57A 5CAEA 4N40A 1JXMA 4CEJB 2Q3HA 3OJFA 3BIXA 1ONOA 4NY1A 1G3RA 1MLDA 3OQOA 1UKCA 1SKBA 2IYLD 1K97A 1U02A 4GOLD 5JNSA 4BXOB 2RC6A 2V7BA 5IUJC 1Y5NA 1U1CA 2J4DA 2FEAA 4L76A 5B30A 4OHYA 1JEAA 4XVHA 1Z82A 4IUCS 1PD0A 4XGKA 4IJUA 1P9LA 1YR9A 1VE7A 4R83A 2W8BA 3WG9A 5HJ5A 3CVWA 5CR9A 4XIFA 5IJAA 1N2CA 3MELA 3PX7A 3QKWA 2E4XA 4X91A 3KUKA 3IR5A 4F0JA 3KQWA 4KLRA 1V2HE 3PTAA 3K30A 2WB2A 1EDDA 1YOBA 2ZJYA 3DYIA 3GLFA 2HCRA 1MV5A 4IJVA 1U4SA 4MWSA 1SD2A 3QKRA 4CLXA 1E9BA 4YAEA 1T5LA 2IV2X 3MWFA 1SCBA 3R3VA 1RACA 2GF0A 4MYTA 4V38A 3TAXA 2UUBB 1FOEB 3DKRA 1VKRA 1MOPA 1E64A 3LCVB 3ZE6A 4ZCMA 1JFSA 1CUDA 1VJ1A 1RQGA 4BZZA 4WOBA 3X1XA 5EIBC 2Z6VA 1SCUA 5DTEA 4DREA 4RTJA 1PNQA 3D6UA 3GP5A 2C7GA 3EMVA 4HYTA 2XUDA 1NR7A 3EHDA 4BCBA 3QU7A 4WECA 3D4LA 1YS1X 2OP0A 3B3GA 3KEQA 3MCTA 1Z8FA 4M21A 1IVSA 1FU7A 3OZVA 3RAGA 2JI9A 2X1HA 2PGLA 4OQLA 4BE9A 1MA0A 3GUVA 2YH2A 1TOAA 1PBTA 4AMYA 3B1WA 3ZNNA 2ZIAA 3D4IA 1Y4ZA 3ZX5A 4NECA 4LGVA 2B9VA 3JYLA 1KVTA 4ROSA 3NXKA 1X2BA 5KSWB 2CEAA 2P8SA 4AD8A 2IHYA 1PU2A 4YRSA 3TUZC 2JS7A 1E3SA 1JIXA 4Y1EA 3UENA 3LL4A 2DETA 4DJDC 5DM0A 3JD2A 4MVJD 3BMQA 4J7XA 4P35A 3QWHA 4PZ0A 3M6FA 3TRIA 2GBCA 4NDAA 1V6SA 1XNJA 4L72A 4QUIA 4ZQEA 4BATA 1UMKA 2IU6A 3IDOA 3R7FA 4ZMSA 4OLBA 1UANA 2B2NA 5CX1B 2FR0A 4ZI5A 4JYZA 2HCFA 4KQWA 1WU7A 4M37A 2XA2A 3TB4A 1M6VB 2ZBUA 3AW9A 5IKXA 3EPLA 1UKYA 2JEYA 3RJZA 3WWZA 2VDMB 3AOGA 4JJIA 5EMMA 3UG6A 4F1KA 1J06A 1Z2AA 2GCIA 1FYDA 1DWPA 4J6EA 1LUAA 2FVXA 2C4HA 3HFGA 4R1QA 5D01A 5KDOA 2J31A 3KQYA 3H6GA 1ODSA 4BMXA 1IRXA 1KI3A 1SK9A 2IW1A 2FG7C 4ZA2A 2PMWB 3EAQA 1ZKDA 2A57A 5ITZA 2BSQA 4B40A 4YJGA 4CUZA 2IPAB 2GZ1A 2Q0QA 2GF9A 3RVDA 3AP2A 3VR4H 2AX3A 1IBCA 1KEUA 4CKEA 2GHTA 3RH0A 2PL1A 2B34A 5IAOA 5F52A 1JYEA 2VQDA 3THXB 5AJUA 1ADFA 2FJ0A 3ZJYA 4HUTA 1DRUA 3NJRA 4EPYA 5BOSA 4RO0A 3KR0A 4CE6A 5FFNA 1NW9B 1CV2A 1HMPA 4CQLB 2COEA 3KQSA 1XZ8A 1Y42X 2B0CA 1Q1ZA 1KYYA 2JFFA 7YASA 3WL4A 5C7LO 1UFQA 2JLAA 2I78A 4E09A 2HPVA 2NZVG 4EELA 3PQ7A 5IARA 2P2YA 1UFKA 3DFFA 3FVVA 2IOQA 1YZ3A 4NU5A 3FCCA 3N5KA 2R4QA 3D8RA 1Q0TA 4POAA 1NMZA 3EK2A 1G1MA 2H52A 4CUKA 3FDJA 2NZUG 1ZAKA 1JLMA 4WOKA 3DWIA 2ZXFA 3ISJA 1AS0A 4M0DA 1GM5A 4V0MA 2G9QA 5JWOA 3R0ZA 1RZRA 3WISA 4Q7JB 3SM9A 2P4HX 1LS6A 1CS0B 1GSHA 2RB4A 4MEBA 5AO9A 4KPUB 5DLDA 3ABRB 4JB3A 1GDDA 2GEUA 4RIFA 2CNWA 2YWJA 2CGEA 1PJBA 3MWEB 3OSZA 1BMTA 1QF7A 4HL6A 1XROA 1J6UA 4BMPB 4Q21A 1G21E 3Q3JB 1V6AA 1Z3CA 2AN1A 4W5RA 1E2DA 1RADA 1SKAA 2C61A 4TKLA 3RKSA 4QJ3A 2L0XA 2X8JA 2YMPA 3NATA 4WJLA 1PGJA 3N7TA 4X3CA 1QDEA 3DAFA 4O4HA 4Y0NA 3BD6A 3W5VA 3C5HA 1YZTA 4FUQA 1M8PA 4JYMA 1H6CA 4JP1A 2BR3A 1N8SA 4EY4A 1F48A 2X9VA 5BW5A 4QFCA 5B58C 3L41A 4TQ9A 2ZJ8A 3OP4A 4X9XA 4YRRA 5B53A 4TV8A 1E5LA 4X45A 4R8LA 1H0RA 2DPYA 4B71A 3CMCO 3V9PA 4L5IA 4PHCA 1XTKA 1J0AA 1EB9A 2PZLA 4OUDB 2AOWA 4DZZA 2XUJA 3CPEA 2AN5A 1EFCA 3K5HA 3ZJ5A 3AM3A 2QHXA 4HKTA 3GCWA 4DQDA 2QVGA 5U9CA 2RGNA 4RA6A 3SVTA 2WT8A 5JI2E 4CGZA 1EM6A 1I6MA 3ROEA 1VZ2A 3WXBA 3G8CA 2FH5B 4AKGA 4MI3A 2FW9A 3I01M 1YMVA 2DFNA 4R9UC 1BJRE 4GQIA 1F9EA 1DADA 2QZ9A 3UJ9A 3GVCA 3OEYA 3G8YA 5JU6A 1V3VA 2B8TA 4KDRA 3HC7A 2JGNA 2RIPA 1TADA 3AT1A 3F1LA 4MWCA 3BSSA 1XWWA 4KO8A 4WZZA 5BQ5A 1D6MA 2R6GA 1E5DA 4QUEA 1KO4A 1FRQA 3O84A 4LC1A 1VYVA 2DGDA 4E32A 2CDNA 4NEGA 3W5AA 4CEHA 5IT4A 4GSLA 5GZ3A 4GR5A 1E5TA 1O1YA 1WZNA 5H9VA 2DVMA 2HA3A 3BWDD 4U2GA 4O2RA 1TJPB 2V3WA 2D13A 4WT7A 1YVPA 2PSJA 5DI9A 1EXMA 1JQ3A 3VNSA 2R62A 4MRRA 2C4TA 2RIRA 4FGKA 1QUFA 2CLHB 4EG6A 3LXXA 4ZGGA 2ZJFA 4S1NA 4B76A 1OAAA 2ODTX 5LA6B 1COZA 5HGJA 4Q3BA 4BQFA 1XAHA 3DJYA 3IUEA 3SF8A 4BCCA 4CM9D 4EZBA 2C4VA 2CXNA 2OENG 1ZUD1 2WWXA 4I55A 2ZSIA 5EZQA 1RE1A 4AAYA 2BV3A 1JEYA 4CEIA 4M60A 1Y9EA 4ID9A 3TF5A 2VYQA 3WMFA 3U4IA 4Z2AA 5AUOB 3KKZA 3NHKA 3PX2A 3IL2A 2Q4DA 1ZKMA 1AZWA 1LPOA 1RJDA 2GJSA 2XI4A 3L6DA 1VXRA 4X6UA 3NVAA 3WB0A 1NXWA 1ZS9A 4RY9A 5G40A 2NUTA 5CCEA 4RPCA 4YT2A 3PNKA 3UMFA 2BCJQ 3S40A 3A6EA 1MGPA 5DYYA 3L1VA 3OWXA 2YXBA 5C34B 2K4MA 2QR5A 3QUQA 5A4JA 1ZGAA 5KTYA 3NNSA 1DXOA 1QGDA 2I3DA 2PD6A 2FQXA 4KUHA 1P2FA 3STVA 3CT4A 4FKZA 2W6ZA 1G8SA 1SZCA 2DT5A 2JAWA 3K96A 4YWHA 1A77A 2ONZA 3H8JA 3SG0A 2QP4A 3ZW8A 5HJEA 2PXAA 1TU4A 1Y4SA 5BSWA 1QCZA 4FWTA 3CUEF 3D7LA 4BX9A 4M2LA 2BHSA 4Q00A 2C4MA 1XF1A 3DWEX 3WGOA 2WVJA 3WHIA 4DARA 1QO7A 4U7DA 4EENA 1QLHA 3DZCA 4P5PA 2QDKA 5UKDA 5JCPA 1UQRA 2EFCB 3ZKWB 3JAKA 1V5EA 3NTOA 1VKZA 3T34A 5FWYB 4CPDA 3R7WA 4OYLA 2C99A 2HEGA 1KYZA 3REFA 3GB9A 4BGIA 2Z9CA 4YA6A 1GR0A 2IPLA 4J0EA 5T64A 4RDHA 1NBMA 1SA0A 5KTPA 1Z17A 5D2CA 3N8IA 3WL7A 1C9DB 1Z4MA 5A9TA 1RPJA 1ZK3A 4FJ1A 3RF6A 3TR6A 1UL1X 4ARAA 4JNKA 3M4ZA 1KO5A 5HIJA 5I4KA 1AV6A 2X6TA 3AHGA 3HPQA 3RIEA 1HT2E 1SU4A 1E9CA 1WHTB 4EX7A 5EHXA 4S35A 5DXJA 1OI3A 2WF9A 1ODJA 4MDYA 1W2GA 3R3JA 2ID7A 3K1AB 1SCAA 3AKYA 2POCA 2QPTA 3T5BA 3ZEAA 1YR8A 2OOSA 1E5VA 1AJEA 3JVIA 1E3WA 2ZT5A 3P9PA 3CBGA 3EH1A 3LC1O 1GPH1 3O2JA 3N7AA 4K3UA 4I50F 4MJXA 1TTPB 5CDFA 3VMFA 1YKSA 3I2FA 4M6WA 3ZCPA 1IFXA 2AMFA 4NBNA 3K0FB 5LKRA 2XGMA 2VSQA 3MINA 3TRKA 1UBTS 1FE8A 4DQVA 3BC1A 3LLMA 4D4LA 3RRYA 1AKVA 1X1DA 3E9MA 2R00A 4GOXA 1VSBA 4AZ3A 1QYRA 1G55A 2YJNA 4HEQA 1NHGA 4BNYA 3PVCA 5MFZA 5KDLA 4DJ5X 4HSEA 1F3OA 3AVXA 3JYNA 4Z49A 4MOWA 5JMOA 1WBBA 3QEAZ 3WNQA 4DANA 5E3HA 2YJ5A 2YICA 4CJXA 1S9HA 1QP7A 2BTEA 1GTL1 3KZVA 3C24A 1J21A 3QGMA 4AIRA 2C03A 2QSYA 1YQUA 3KVNA 5EC8A 2JLUA 2JW5A 1U4OA 4TS4A 3NDBB 3KDSE 4ZMBA 4Q37A 1JG4A 5EYPA 4W8HA 4FR2A 1L4NA 4URZR 2WTXA 2CNNA 4ZZ1A 2H7XA 1JVNA 3QTTA 1XAIA 3JVDA 3ULKA 3LHKA 4BNDB 4DDVA 2AFIE 4EB3A 2FGKA 1HRKA 5FUWA 4UFPA 5BV2P 3DM9B 1J90A 2NV0A 4YMLA 3NCHA 2A4KA 4GKAA 3NKFA 1Z33A 2JGLA 3C3CA 3G8DA 1JDNA 4ZZ0A 1I2CA 5B3AA 1BH6A 3WIVA 1W0KA 4F6CA 1NBEA 2BUAA 3RGGA 3J80A 2JEZA 2WJGA 3LT1A 4GRIA 5CGZA 3AF1A 1VHDA 1JFRA 5CNIA 1Y0BA 1L7EA 1TZMA 4R1TA 1XKQA 2P9YA 3IHTA 4PE5B 5F7OA 1HDOA 1QP0A 3KJZA 3WK5A 2O4UX 4YYEA 4ISCA 1YBAA 3T3PB 1QYVA 1D2MA 1V48A 1W5BA 2CVOA 4G2NA 3OIDA 4L5CA 2WTMA 2ZRAA 3VM6A 5CFMA 1EKXA 3C8DA 3B13B 2YFHA 2ORIA 3S0JA 4AO6A 2B37A 1MB4A 2EARA 2ZKIA 5HHTA 4EK9A 4S05A 1YTUA 2XUQA 5FPSA 1S3FA 3I1JA 1PAUA 1WY7A 2IOFA 2YWRA 3CPHA 4QFBA 4TMZA 1H1TA 2SKDA 1H2YA 2PZEA 4PLGA 3X1DA 3O8OB 4DLXA 3DGEC 1N2OA 4MB2A 1LK5A 4TL7A 1T5BA 4BFZA 8LDHA 3FHLA 3RSFA 2IXTA 5BVHB 3N59A 4ETMA 3VZSA 1JA0A 4ZC1A 4ZAWA 4KKXB 3ICQB 4CR8A 1QE3A 2P75A 3E5NA 4AVYA 1CFZA 1JAXA 3WAKA 2W2LD 1L7OA 4JB0A 3RUDA 1R64A 2YIJA 2BSXA 3PGVA 3AU9A 3TQSA 3Q5DA 2LXNA 5E9JA 5BN5B 3F7MA 2ZEJA 1B0PA 2VH5R 4QTTB 4DLLA 5LUBA 4GL2A 3SXJA 5DN6D 3FBTA 1JF8A 3EDQA 3IJ5A 2ZVJA 1NG1A 1SGWA 2C3YA 2ZRDA 4HWPA 1R0KA 3D81A 4Q7EA 3A3KA 4Y18A 4B9AA 1X1SA 3EDMA 5LDGA 1E9EA 3H86A 2VPQA 4HUQA 2Y27A 3K6JA 5D5QA 3KDPA 3U37A 4BLPA 1REQA 1ZUWA 3VR2D 4F38A 3R5SA 4KIFA 3TW8A 3W9BA 2NXEA 1KWKA 3UTDA 2VYND 4OQQA 2W2TA 1PNOA 1T6ZA 4YUXA 1Z15A 3I0NA 3OX1A 1SVMA 4D9KA 1TM4E 2X5XA 1EWKA 3O95A 3DAPA 4UUBA 3RIGA 3M4XA 4KYUA 2BRUA 3S7TA 5BUQA 3CE6A 4YP5A 1QHFA 2J7PA 4IHJB 4C3ZA 1FP4B 1L4GA 3CH7A 4J16C 1CRPA 1OSNA 1BX3A 3AYZB 3DMRA 4XUDA 2FZEA 4FYVA 2HRQA 2QXUA 3ESCA 3PNLA 4WKNA 3O5AA 1HGXA 1LD3A 4LDNA 4IGKA 2PZFA 2FUCA 4G2TA 2Z2IA 3FFBA 4FFPA 4YJ3B 3QW2A 3FKJA 1OLXB 4N5IX 3OHSX 4QODA 2BY4A 3PDHA 2FN9A 3PRYA 3NBUA 2PD3A 4LOIA 5BYAA 2HEIA 1N92A 4AMGA 4TS3A 3PRHA 5I47A 1EUDB 1ZN2A 1V8BA 1ULZA 3KS9A 4HLNA 3TR0A 3KALA 2DLCX 4EEKA 1UOEA 1U6IA 1KOLA 2QY9A 3LHDA 4D3DA 2VUIB 3OZAA 4QPCA 1LH0A 3CX7A 1LEHA 1U0TA 3BDVA 4RMJA 5E2BA 1H5NA 5AJXA 1UPBA 4IILA 3TQFA 5AUPB 4URXR 3RAFC 3DZHA 4DTIA 3AU8A 4P3OA 2FXIA 1I0ZA 1NLFA 1QVRA 5A2QA 1NVBA 5KHLB 1FFXB 2FX3A 2IOHA 3VKVA 3RR2A 1D4OA 3BE5A 1N5JA 1FLVA 4JVLA 2WWIA 4MRSA 5DXFA 4LVOA 2ZI7A 3A4VA 4CN8A 4KE9A 4YN3A 2VYVD 4TTSA 5EUQB 4KR9A 3I1IA 2YHSA 1G17A 3WGKA 4Q19A 4EHHA 1DB3A 1Z4PX 2OCBA 3O4HA 1BE1A 4Q9HA 5J40A 1N1DA 2QTBA 2I7XA 5JY1A 2RJOA 2ZB4A 1YHNA 1H6AA 5B12A 1A5ZA 2DFLA 2DFPA 2GPBA 3R77A 5CB8A 1T8SA 3KSMA 1ZSYA 1KERA 2FF7A 5EL0A 3OMWA 2HSDA 4MUNA 1T15A 4JENA 5CYFA 2EWVA 3OEEA 2W0SA 1GUZA 1IJEA 3IQXA 4P53A 4IVRA 1RKXA 3C39A 1E6MA 3E0XA 3Q3GE 5ICMA 4MAMA 5KU7A 1FBNA 2J9GA 4QYIB 3OZTA 3RVQA 4PXYA 1A5AB 3TWOA 3AEKB 3W6PA 1BDIA 4WDRA 2J09A 2BPOA 3P9KA 4YR9A 1CRZA 1G2OA 2Z9DA 1DAEA 3K6RA 4IXWA 2DBYA 3D7KA 4DA7A 3DL4A 3AO0B 1QIEA 2H31A 2WAXA 4RIHA 1K7CA 2QUJA 1CUHA 2G07A 3QZUA 1XVLA 1DEOA 4JITA 2QGFA 3W4IA 5TXGA 1T26A 4O4JF 4HNGA 5C1OA 4QJBA 1C50A 2WWWA 3ML1A 3ZI7A 1UXOA 4WXEA 1CQXA 2Q0SA 2EJBA 1DQYA 1YBMA 1USIA 3DNMA 3DYVA 4ZOCA 2WU4A 2PIDA 4HMQA 4B35A 5K3OA 1AUQA 1T9GS 2D0PB 2EKBA 1XRQA 4ND4A 4O4LB 4TYPA 2XV1A 4LAFA 3WKBA 1NQVA 1B73A 3IR6A 3AERA 1YRWA 1G21A 3LECA 3QKUA 4KYTA 4S2UA 1QVWA 3JAWA 3W4JA 4D92A 2ZU6A 3C3YA 4UTOA 2FMTA 4CETA 5K8JB 1LLUA 1EZ1A 3R6TA 5DTQA 1TA9A 1A5SB 4I6JA 1FIUA 4B3TB 2XAUA 1F60A 3CUKA 1E5QA 1RQPA 1M67A 3AF2A 1GRVA 3LLVA 5B1IA 4TTQA 2H06A 2X3UA 4TYNA 2PXHA 1B6SA 3BFKA 5EGNA 1EHIA 5F4ZA 6REQA 4F3NA 1DBWA 3WBBA 3K70D 3M6IA 2E4AA 4U0JA 3I83A 5TVGA 3GVPA 1OI4A 3OH8A 4D81A 1UOQA 4OOEA 4Z9BA 2P3SA 3EDRA 5LQKA 3DP7A 1GT6A 3QU4A 3TIIA 4JV5B 5LUAA 1W49A 1HT1E 3E2MA 1L7QA 2DMRA 1W5TA 3P45A 1JU3A 4OTZA 3UFBA 1YF3A 1P6XA 2FSVC 3IYLW 3K6KA 3L7DA 1DAKA 3IAXA 1XMPA 2UVPB 2R11A 2OSVA 5LSAA 2YCBA 5HKLA 1R4NB 1TVEA 3O74A 5L3SB 3LMKA 3DE2X 3FKSD 3OZGA 4X3PA 1VSTA 1CRQA 4PF1A 1J23A 4L5BA 2N75A 2OZEA 3VKWA 4HX9A 2BP7B 5ULLA 2QVBA 4HAYA 3L8HA 1CIJA 3V1LA 4PYJA 2IYTA 1F0KA 1S2DA 3GJYA 7ADHA 2NG1A 2QR2A 5AW5A 5AKXA 2R0QC 3QMWA 4GKVA 4ZJZA 3GZNB 2IQIA 1HV8A 3JQFA 4F2WA 2CJWB 2QT0A 3NWBA 5JS1A 1ESNA 3MAAC 4JAVC 3RJMA 1JJBA 1KAEA 3C6XA 1ZP6A 3ZV4A 5I48A 5HNKA 5DN9A 3FYUC 3G23A 3TIXB 2B1GA 1FSGA 2KJQA 1FFGA 2W2MA 3LC7O 1F06A 3FZNA 2PS3A 1U9YA 4ARBA 1ZNYA 5IKOA 4QEDA 2VZLA 3N39C 4FZVA 2R2GA 4EO9A 5IT5A 1V0JA 3ICOA 2UZ1B 1DFIA 3HYSA 3KJXA 2WTBA 5E1DA 1ZMXA 2MOKA 1Y3CE 3OFNA 2MR6A 1SCJA 1SUPA 2C3PA 1QCCA 3N0XA 4RH0A 5KTOA 3OZEA 3ED1A 3UGQA 3MIZA 5C8XA 1LDYA 5ITSA 4B6QA 1OT3A 3EMKA 3RYHB 3MBKA 3MOGA 3PE4A 2BFEA 2H0AA 1OD6A 3ZH9B 5HZHA 5IN4A 1SQ6A 1VHQA 5E8JA 3U80A 4EF6A 3JSXA 5JAMA 5CNKA 3R0XA 2WC1A 3M5DA 4JXKA 5IDVA 1E2UA 4B9EA 1OLSA 3RT7A 2JD2A 1XTVA 4Y2QA 3AXTA 4ZOAA 4ZDWA 4RGQA 4A2QA 1NUTA 1WMDA 3AJDA 4D4MA 2X15A 2FPMA 2V4MA 2H1RA 2JHAA 5BRNA 4B3CA 4PFKA 4GE3A 3BA1A 1XFDA 1KFJB 1VFPA 3EISA 2RHJA 3PG5A 4XARA 3GLIA 2BF7A 2F59A 3FVWA 2FOLA 2QT9A 4QICA 1LLCA 2N0SA 1HZJA 2Y68A 3PHLA 5CB0A 3LQQA 1KPIA 3K15A 4Q3AA 1NMYA 4KKVA 1N2JA 1CKEA 4IZOA 4MUKA 1II8A 5CLIA 4JXZA 3EZYA 1RJWA 1S8NA 4JA2A 2BTQA 2Y1LA 1JSRA 3JQ7A 3KKOA 2P79A 3OIGA 3P0JA 4H7KA 3D4OA 3TBFA 4NG5A 3VZDA 3RUCA 5GV8A 4RYLA 2SECE 4AX8A 2B4QA 2E9SA 3BH0A 4L28A 1M2NA 2ZRBA 4UHCA 4UASA 1GRNA 1IATA 1SAYA 3HXKA 4PFJA 5LXTA 2CKDA 2XQIA 3KVYA 2ERYA 1V4BA 1KNQA 2Y0PA 3IAS1 1JJIA 1R50A 3O4RA 1SPBS 2CJFA 2QYSA 3OLCX 4J2OA 2XBLA 4KAJA 4PC7A 3TVYA 4DV1B 1IN7A 1SZPA 2Q99A 2CXQA 1ZC4A 3ELDA 4M89A 2XUKA 4XX0B 1IEVA 1ML3A 1RMYA 2F3TA 2XNCA 5FHRA 5IMSA 3SR4A 2GJAA 1LLQA 3D3KA 4QPZA 4EG5A 3U4QA 3CQ9A 3L0OA 4M8NE 1V5GA 4OK6A 5KWVA 3ZDCA 2C04A 2NWQA 1R0ZA 1X77A 1YBFA 3NIBA 2H54A 1E3DA 3VVMA 3ND5A 5PGMA 3K31A 2YHUA 2VPWA 4BPRA 2J30A 3GJ0A 1DC3A 2R751 2LPMA 5ES4B 3Q0IA 1YFLA 2AW5A 1I3CA 1VOTA 3D64A 3OJWA 1I4DD 3SEZA 5CA1B 2HL6A 4RCVA 3CTMA 3RARA 1W4LA 4C04A 1NW4A 2QD4A 6CHYA 2GJ4A 1HDZA 5BQXA 4MRVA 2D5BA 5EOVA 4OFZA 1XVAA 2FRDA 3OE4A 3T5MA 4ZZIA 3TLGB 1UKEA 2EAUA 3LBFA 1GY8A 4Q3NA 2DSNA 3VI3B 1TTQB 1UT6A 4JXXA 3KJEA 3IAEA 4N18A 3SQWA 3WRYA 1VCMA 4M9XA 2NU9A 4AQYB 1RIFA 2VF4X 3SHQA 3N28A 3TPCA 2XDYA 4TSFA 4YCBA 1EGVB 3QPWA 3VDXA 4TX1A 4YRZA 2NXNA 2HPZA 2AJ8A 4NG4A 3UK1A 3UAWA 5IXYA 3EAGA 1KJ8A 1OXVA 3GUZA 3R5FA 4JI3B 2FN7A 3NEJA 3CZCA 5ISMA 1EDOA 1G9TA 4R7GA 1MC8A 3N2YA 5J2UA 1PEKE 1JDZA 3OM8A 5HXAA 2Q3LA 3PS9A 2I2CA 2OCLA 3TGPA 5JVDB 1ATZA 4US1R 1GL7A 4NYJR 3RVRA 3WYEA 3ZWOA 3MJFA 5GV7A 4EFNA 2IH5A 2QZZA 2P9QA 2PKXA 4CIBA 4B75A 2QD3A 3EQ9A 1ULUA 3E82A 4HNSA 4OFWA 5ADWA 1JSLA 1YAJA 2GEFA 3SSAA 5AKGA 2D4HA 1B8OA 3NONA 3ZDZB 5FXMA 1Q0ZA 3HEBA 4UNPA 6LDHA 1F8GA 2RHLA 1X7HA 1TLTA 4QHYA 4W7SA 1ESZA 3HHEA 2D0IA 1H23A 4B79A 4M99A 4MUMA 4JP8A 1Z0ZA 2PNJA 1CUZA 4F6RB 4JB8A 3K70C 1ES9A 4IXDA 3ZDYB 3KHUA 3CN9A 3FPGA 4LZLA 3NORA 2WHQA 3DMDA 3PWKA 4D26A 2NIPA 1OI7A 4JGIA 1QGZA 5CK4A 3RKRA 5M3BA 2FQQA 3HVHA 2FDRA 1N6KA 3EPRA 3PWTA 4DEVA 4OU5A 5K3EA 1YB4A 3NJ8A 4B2YA 4LCBA 1GAWA 4E2WA 2Q0HA 1KRWA 1FU8A 2AFIA 3O0DA 1FDWA 3SDSA 1TZ2A 1BCSA 3UHPA 2GPWA 4HJXA 4HDAA 1QGED 2ZJOA 1M2VB 4QRIA 4NCBA 3PIRA 5A3RA 2JAUA 2ZJ6A 3CBQA 2DG2A 4RHYA 4X1YA 3AFNA 3STXA 3OTOB 3PUZA 3Q7PA 4HTAA 4P6VF 3NP7A 1IHXA 2FEPA 5HK8A 1T6NA 2GPJA 2O8DB 5JROA 1MIOA 1YU9A 4L9SA 3MCVA 1HKHA 3RVSA 4PXAA 3K0EA 4YMWA 2ZIZA 1T3ZA 4FYHA 5FA5A 4BCDA 3GMSA 2IPNA 4QT4A 3G0HA 5EXXA 2WVHA 2OAP1 3DDZX 4JN6B 4OQ4A 3JQDA 1QQ5A 1P1HA 3W5BA 1L9KA 4PC6A 5H7XA 3WBJA 1OV6A 4H1TA 4DLWA 3TSOA 1WXFA 5F1KA 3H2JA 3MVEA 4HPXB 1XEXB 5FJIA 3CW8X 3MAGA 4PX3A 5CH8A 4ZD6A 3M3DA 4HC4A 5H70A 3D31A 4A0QA 1R12A 3WHLA 1N2HA 3WLTA 1L5WA 3T1VA 3UV7A 1SCDA 1LU9A 2XNKA 3BMCB 2FZCA 1SVUA 2Q3EA 3N2GB 3R74A 2DKOA 2JEOA 4CG2A 1KAGA 2CK3A 1A4UA 4D46A 5IZ4A 4N5DA 3V34A 1VJTA 4GLOA 4U5QA 4KMOA 2O2IA 3L0SA 2Q21A 1ZD5A 3PQCA 1A9XB 4PO9A 2G77B 5D5HA 4ASUA 2HMWA 5JHHB 4BLVA 3RC8A 1M76A 3DAHA 1LY1A 5B2FA 4RDXA 1N2GA 4BO8A 2BFCA 2VAPA 3W2FA 3PC8A 2VF5X 3IIJA 2O7RA 2AN4A 2HPAA 3HACA 1HQYE 3QVLA 1L7VC 1EEXB 2JDID 2VBGA 3RFUA 3B6IA 3H11A 1IM8A 2JAPA 4BAZA 4F4FA 1G3IA 1K63A 3ON5A 4KQ6A 1W46A 2C92A 4KOEC 4B47A 3KT0A 2ZSAA 5LYYA 4IMJB 3LCUA 2ODQA 4JLWA 1JAZA 3D1VA 5HVNA 1TW2A 4KO1S 1BG6A 1XTRA 2Z8YM 4ZCIA 3O2SB 4ARSA 4QT0A 5IAKA 4ZDIA 2R6HA 7MDHA 1XA0A 4RK7A 3VH3A 5ANRB 3AIOA 1IM2A 4J0FA 2H1OA 3ET5A 2IZ5A 5JD3A 4CRWB 4WGFA 3V48A 2XYHA 4YCNA 4DIEA 3USZA 3B82A 3IH5A 3WY9A 3HV2A 3DVQX 4FFNA 4I1IA 4REQA 4BZWA 4EAQA 3R24A 1PT7A 3DMPA 1L5HA 4DEXA 1QG6A 1KF0A 4QOJA 5BV7A 1P4HA 2OCKA 3O3CA 1E18A 3ZHUA 1Z4LA 2XLBA 1UP6A 1VCHA 2GJ9A 3KQMA 2FEMA 2P4SA 2VL7A 2VUHB 2VXOA 1P4JA 4NULA 4C2AA 4ENRA 2ZAIA 3ITEA 1Z7EA 2QJRA 1Q7RA 5LZ9A 2BTOA 1ZPDA 3KWJA 5K3FA 3RRMA 2HHLA 5TQ2B 2O8FA 1CUUA 2WM9B 4O33A 4BV9A 4UU1A 4BP3A 4M9UA 3FWNA 3BPSA 3HCFA 5ERXA 4E2XA 5GJBA 5F5NA 1CUWA 2R8ZA 1W85A 4IIHA 1H1LB 4OXXA 4URFA 5EY5B 4BUCA 1CZHA 2QW8A 3KU1A 1T9ZA 3N70A 3BTSA 3V7NA 4K40A 4QGBA 2K5UA 4OQYA 2YWFA 3IBCA 4DJFC 3ZQJA 2AJDA 5AVVA 1USWA 1OLUB 4BFCA 1CUFA 3GBPA 2IW3A 3QX8A 3WYCA 2F9MA 3GBSA 1TJ3A 5LBUA 3IMCA 5C8YF 1YI0A 3D02A 1U1IA 3EA5A 3P5SA 4GL4A 1N9ZA 3I9LA 2X5NA 3CA8A 1U0JA 4WXMA 2WFLB 1KSJA 4FR0A 3MQ2A 4INPA 1TW3A 1Q2UA 1JIIA 1B3BA 1I14A 1OYYA 1IQPA 1NN5A 2HC9A 4BQQA 3E4CA 1KI6A 1ZH0A 2A1IA 5ALSA 3ROMA 4F5EA 5KO2A 1JR2A 3AR7A 4ANFA 3KSRA 4KYIB 4B82A 2QTHA 4LXQA 3NRBA 3EXIA 3GJQA 4HXGA 4QXQA 3Q2OA 4D45A 5JD4A 4BWGA 3LDUA 1TJYA 4OQNA 3OZSA 5GONB 1CLUA 1G8KA 1XZLA 2OC4A 3I4FA 1RHQA 2QX8A 3HWX1 2QPLA 3H2BA 4RESA 2O57A 5DHSA 4HNRA 3BX1A 1R4AA 2D3TA 3LAWA 5JOQA 2V7PA 1Z3IX 4Z4IA 3H99A 3WQRA 3VC3A 4HGPA 5JBQA 2VI5A 1PBNA 5CW1A 5JCOC 2HQSA 1KSHA 2R1TB 2YVAA 3GMDA 1JVSA 3W90A 5EJFA 4BPBA 1X1AA 3UOWA 3QEMB 4JP3A 1GZ5A 4D5GA 2G9ZA 4PAOA 2XAAA 3AEUB 1EX6A 1D5CA 2GUGA 2UZ0A 2W90A 3PNBA 1EVYA 2LZ0A 2FSFA 1ND6A 3AEQB 3AUSA 3F8TA 3K4PA 4MQ4A 5IN5A 4F60A 5LZ4A 2D62A 4QREA 3K2BA 3P9CA 4EGJA 2ZYAA 4IINA 3TD2A 1VL6A 5KU1A 1K27A 4UULA 4RVUA 3MJDA 1SHJA 3SQMA 5JNVA 1CUJA 3LUFA 1WM1A 4TV9A 3TBHA 4DZRA 4E1BA 3LE8A 1E9VA 1WX1A 5KINB 3ZW7A 2X7XA 2C98A 1ZLYA 1E8NA 3JVVA 1N5MA 2AC2A 3PC4A 1E7QA 4GBMA 1ZH4A 4MUAA 4ZGWA 3HA2A 3D0QA 1SUCA 4ML3A 4EB6A 2UYHA 2PXCA 4R84A 2X1VA 5E0KB 3OIWA 2OFWA 4B3MB 1HLPA 1XP8A 1JQLB 4LHSA 3AI2A 5IMBA 1JHOA 2ZRLA 2KX7A 4HPJB 3K1YA 2ATVA 2QVXX 2IYPA 2WOJA 3QKTA 3URMA 2G25A 1GV1A 2OFPA 5FNVF 2PK3A 3HU5A 1B16A 3PC7A 3SEQA 5JISA 5LP6F 1RZRD 3F3KA 5K8TA 1U1EA 4TTIA 1E4YA 1N7GA 1TO2E 1Z28A 2I3BA 1Z5ZA 2YFYA 1EK1A 1DOAA 2HXYA 2CNWD 2PM8A 1GG2A 1AQLA 2Z1DA 4MVYA 2FK8A 2GX6A 2AF4C 1ZOOA 1NNEA 1I9GA 1T4CA 2Z56A 1NOIA 1UKBA 4Q34A 4XKJA 3DVAB 3FYUB 2NVWA 5CBKA 4Q6WA 3Q5GA 1TA0A 1TAQA 3D3NA 2ZJ0A 4BJ5A 1R3UA 2I55A 1K7YA 3Q6MA 2VQ3A 4WCVA 2H48A 2M32A 1X42A 3RRNA 3T12A 3N7UA 2VAVA 1YI8A 5LYJA 3TKAA 1T9GR 1JL3A 4OPMA 4F92B 3EZFA 4MULA 5E9WA 4X6LA 2P77A 3GG9A 1BAPA 2R5WA 1NPDA 2WD7A 3A1DA 1JIKA 3INNA 1KS9A 2WVAA 4H18A 3LRPA 3RVPA 4C22A 5JZBA 3ZZUA 1DTSA 3BE6A 2BHLA 4H0NA 1MDBA 1KJ9A 5K05A 5B5SA 2IYOA 4LC9A 3QUTA 1XZHA 2Y1GA 5DHFA 4JODA 3V8BA 4V0QA 5DPMA 2XMQA 4KXUA 4JXJA 5ECYA 3G1TA 1AZTA 4MVWA 4R8SA 3TB6A 3ZXIA 2DZDA 4TKUA 4DDHA 4L8VA 4JMLA 1UXKA 2PS0A 1NZJA 2RK4A 4F9GA 5JCXA 2I6GA 4PAGA 3S2EA 1E2LA 3EG9B 3OLVA 4OSEA 1YQXA 3PPYA 1FJXA 3CC8A 3PDWA 1O8CA 1BJTA 1T43A 3ITDA 1MT3A 5BSGA 2OAQ1 2EFEB 3CLRD 2PLRA 2BKVA 1GRQA 1ZN8A 5FBVB 4RPKA 2F64A 1EP3B 2PZ8A 1FNSA 2R9VA 1EM8B 1FJHA 1ZUNA 2PKEA 1H93A 2DBQA 1BJKA 1IL0A 3T1OA 2VT6A 3EGEA 3NYWA 4QDJA 4INOA 2J07A 5D3MA 4ZVKA 2BMFA 3IP7A 5F9HA 2V5UA 4XE5A 1TGYA 2JARA 2FJPA 2ZE7A 4YASA 1Z2CA 2P5SA 2BH9A 2XLCA 2D5CA 1ZSNA 3ZU4A 2Q6TA 3STYA 3ITNA 1R0WA 4V03A 3R7LA 2D2FA 3U7EB 4DPMA 3V33A 4I81A 4X8HA 4WX2B 2O6LA 1EQ2A 2NX2A 2Q28A 3L8MA 3OQ1A 2GD1O 2V3VA 3A6KA 5FI5A 4NU8X 4OSPA 1E32A 3RLIA 4IOMA 5DW0A 2ACEA 1RXEA 2QNBA 2CLIB 3UW1A 4DR7B 2BH2A 1DIOB 2PT6A 3RTDA 5KOHA 2AEJA 4RZXA 5CJ2A 3U5ZB 1SU6A 2A8YA 4CT4B 2RH4A 2V5AA 3AF4A 3LF2A 3NRCA 5J9FA 2LNDA 1VGQA 4POOA 4CKZA 3ZWBA 1CUYA 3C7KA 1NONA 4Q01A 1T2FA 2MSEB 3T9CA 4XQEA 1CF9A 1QHSA 2Y2UA 3E7WA 2P91A 1IQUA 3DZIA 2Z98A 3LDAA 4MNTA 1CNEA 1LPBB 1AQ6A 1DJLA 2CNDA 2ENUA 5H1YA 3VX3A 1KQFA 2ZYUX 1K68A 4HB2A 3U2QA 5TY0A 1R7RA 1B2RA 5JNLA 3L77A 4NF2A 2JKYA 2GASA 2VATA 1RI5A 2AVNA 4RANA 1NI5A 4Z51A 1Z5NA 2EJUA 1TAUA 2G17A 2RGBA 1MNQA 3P7MA 3O9MA 3ZJ4A 5I6DA 4YMSA 2Q3JA 4BRWA 4LHWA 4NRDA 5DWQA 2HJGA 1NQAO 1OR8A 4DCUA 2F1OA 1PR4A 1SQ5A 3FRJA 4M49A 4RIIA 1EEHA 4UZEA 4QA9A 1UBOS 2D54A 2QKYA 1OWLA 2WJPA 3L8FA 3RKUA 3C48A 3HLTA 3H4MA 2QV7A 1IHUA 4DMCA 1T4DA 1SCNE 4OJMX 3IKJA 2GN1A 4QIHA 5J2TA 1DXYA 2BLLA 4Y2TA 2X14A 3BRQA 1Z0DA 4MJ7A 5L4SA 2NSDA 4IH1A 3P0IA 4IJWA 2YC2C 1WZEA 3LFHA 4K88A 1Y3BE 4PZCA 2ONCA 2OV8A 3E9YA 5CYOA 4EVRA 1DEAA 1R9GA 1U0NA 2PLNA 3HWWA 4K1XA 4MAFA 4EHAA 1V6CA 4WCFB 5PNTA 2AXQA 4TLEA 5C2JB 2Y92A 3CZ5A 4FDMA 4FLFA 2BEWA 3WAGA 3RTBA 2JVIA 5ALWA 4I9UA 2WI8A 4DAOA 3F8WA 1PSDA 1Z4IA 2I8CA 2JD1A 5CB4B 4LBYA 5KDDA 4A15A 1L8AA 1D4ZA 1DKNA 1NBMD 1YS6A 2NU6A 3LIIA 2YWDA 4J4BA 1YIOA 4GLBA 4JUAA 4Y2PA 4ZYLA 3DGFC 4B7AA 3U4MA 5REQA 1R0LA 2ARKA 1SOWA 4V0LA 2PNFA 3LY8A 4MVCA 3LFTA 1FUKA 1U7PA 1X7YA 2B35A 2EQBA 3NBZC 4UHDA 3DS8A 1ECCA 4W1SA 3ZGNA 4MA5A 1JFFB 4A8JA 2BI7A 2P41A 2RGAA 1WABA 4CTOA 3VR4A 2X7JA 4K0KB 5HR5A 4A5OA 1YCDA 5A9SB 2WNSA 3ASYA 3VPHA 4R69A 5DHAA 2IZZA 2PGDA 1WQ3A 1XN1A 4M0KA 1VDZA 4HDCA 4GEGA 3OO0A 3OQNA 4RVCA 4YQEA 4E88A 4AJHA 4C4PA 3TZLA 3CNLA 1UPXA 2OORA 2B83A 4Q4JA 4K81B 3WLIA 2EQAA 1N33B 1R9NA 2X0NA 2WIFA 2YHIA 5BSKA 1RD4A 3WFJA 3IKMB 2J3JA 4M9RA 2ZJZA 4EB6B 5EIOA 1TT7A 3E9RA 3RW9A 5HKKD 2RD2A 3EPHA 2CB9A 4R5MA 2WU0A 3A0UA 3EWNA 4XZ3A 2WZCA 4HAIA 4PLHA 4R1NA 5BUSA 1HTTA 1EIZA 4XFJA 1DWUA 3V4PB 3PR2B 1Y7PA 3WLLA 3MCUA 4KX5A 2AFRA 1TMOA 4L85A 5CB6A 3GRFA 3HRHA 3T9DA 3MJEA 2ZM5A 1Q77A 4YDRA 4PS0A 3W06A 1DKQA 4L8YA 1KEVA 4NEQA 3O8RA 4TYMA 3QJGA 2X0RA 4HNAA 1P6UA 4ZVRA 4I2VA 1JHPA 3HH8A 4QBTA 1UZLA 4OXQA 2IDKA 1JJFA 2ROQA 4V02A 3X0DA 5FP0A 4AJJA 2Y0BA 4PPNA 4L75A 2QP9X 1XB2A 4ZWNA 1CYDA 4QKQA 5FUYA 4D43A 4PIVA 2K2WA 1VM6A 2FPPA 4JS0A 4IDAA 3RVBA 2P3OA 3H6HA 1NMEA 2RGNC 4R2MA 3WB2A 3KQOA 5LMUB 5A03A 5JSYA 3U16A 1CR6A 1J2JA 2A6PA 3ZHTA 4C03A 2JGFA 1RBYA 1W0KD 3E1SA 3F3SA 3L1JA 4J0JA 4LK3A 1YMQA 1Z0JA 4G8DA 4KEAA 2RGWA 5FWAA 2DPHA 5M34A 3PQ6A 4A92A 4BB9A 3CLRC 5FTKA 3DQZA 3BILA 3MGKA 1BKDR 3UUFA 4EKYA 2Q4OA 1IY8A 4HSGA 4QYWA 3AVOA 1JQBA 1K5HA 1NXTA 1VMDA 3AFGA 2D8AA 2JIOA 2YVUA 3H1BA 3V2GA 3BKXA 4YGXB 3AHJA 4QL3A 5E0OA 3PJFA 2QM8A 4EIWA 5CA0F 1I1QB 4QDUA 3USCS 5EJ4A 2KQUA 4FS3A 5DULA 3ZTYA 3L4KA 1VP9A 2E4YA 2RGUA 4IRUB 2NO1A 4JUCA 4HZUB 3K1ZA 3KJQA 3NV9A 4OP3A 4DV0B 4EARA 3DV0B 2BGLA 3J81k 1QORA 3D5EA 2EJCA 1JMYA 3C6QA 3CISA 2XZPA 3AR5A 3OY2A 4J7CA 2Y1WA 1XNHA 3FPKA 4K0RA 4WZAB 3T4EA 3TJMA 2V1UA 4X64B 2WWYA 1G5HA 3PCXA 3DOFA 1JG3A 1T1IA 2XEXA 4KMRA 4FMCF 4LMAA 1XPOA 4FYJA 1PZXA 1HSZA 2FMHA 5HMLA 4J29A 4DF3A 1W94A 4Q9AA 2QU8A 4YUYA 2JLWA 4X61A 1SUDA 4JYPA 1U65A 4PR3A 3ENZA 3A11A 1KZ6A 4IDNA 4CM5A 3AW8A 1ISRA 2QG6A 5B6JA 1KMCA 3RSOA 1DIBA 1JHMA 1YB5A 3HKCB 1DEKA 1L9XA 2DSTA 4JR1A 4H1VA 3WLKX 4BLRA 5JXIA 1YSCA 1N1EA 3OLQA 4GF5A 1S6YA 3DKVA 4GXNA 1ZXLA 2XQJA 1U0HC 3FF4A 2BBTA 3BIWA 3OESA 4J8PA 3P19A 4MLPA 3WI7A 3VMMA 4BFXA 4QFDA 2QQEA 5BSTA 2M6LA 3TQTA 2ZDGA 3I1YA 4UBIA 3GXBA 1NYRA 2P30A 4DLBA 2YRWA 3GRKA 3FNEA 4R51A 4RV9A 5KYGA 3VYWA 5B7PA 3O4JA 5ALYA 4E3WA 4XB6B 3GVIA 2J5RA 3TZBA 4ALJA 3O31A 1EWTA 4X62B 4BFLA 4KVGA 4MUXA 4EL5A 4KOAA 1ZHHA 1SUBA 1OVMA 1LK7A 4EUEA 2C1XA 4FFLA 5A7FA 4MVJH 1PDWA 2VA9A 3K92A 1TAGA 3DFIA 3P9RA 1COWA 1GGKA 1MORA 3CWQA 4XPIB 4IQ0A 1KGDA 2O2DA 9ABPA 1LC0A 4C30A 2IWHA 1SXJE 3E9QA 3T1YB 4MJLA 3UQYS 1IG0A 2PG3A 2XE6A 3DO5A 1C0LA 3GJTA 3HWRA 1G98A 1ZJWA 1TT5B 4A27A 3M1YA 1X7WB 3HU3A 3VNUA 3WRVA 2WT9A 1N3BA 3QPBA 4NESA 4WK2B 1X1RA 2Q4EA 1PG2A 3ADDA 5I9LA 1D6NA 1KIFA 3QVWA 1WHSA 3D5QA 4XR4A 4NK5A 4EDHA 1ANKA 2ORED 2NMVA 1CE8B 3LVFO 2BEUB 1JHAA 1XMVA 1Z45A 1H4TA 3S70A 3TNLA 3QLUA 1EUCA 2FWMX 4ZFNA 3B3QA 2W37A 3MF4A 1QTQA 2BGKA 1RXSA 3E22A 5DBFA 2GEVA 4FCVA 4GAEA 4WFJA 4WIAA 1GA1A 5G1PA 1DAGA 4E6EA 1HSOA 4HZIA 3UCFA 1F4LA 2TRSB 3BL6A 2YS7A 3DF9A 3CHYA 2CDAA 4GLFA 4EMSA 5AIAA 4YX9A 4PYKA 4FNOA 4M7WA 3R40A 4EY6A 2JGRA 3D9QX 3G13A 1JG2A 1RAGA 1ZVQA 3ABSB 3F5DA 3GDWA 2AUNA 3PDJA 3RK1A 2DP4E 3B70A 3NW9A 4IEEA 4J90A 4U63A 2HADA 2CJPA 2FV8A 2PUVA 1E96A 1HM5A 2F2TA 4MRAA 3R4VA 2QLJA 5DLPA 5F5XA 5AVYA 4NABA 2J9RA 3QM1A 5E6UB 2LP4Y 3ZQUA 2ZM6B 4KI7A 5EQFA 3RM3A 2X4IA 2VN8A 1QVAA 1MAUA 2ADOA 2GM3A 2BL4A 3DVRX 3JR3A 4M1YA 4RPGA 4RWEA 4BFUA 1DQPA 1DTWB 1MX1A 2NVUA 2ZZKA 4N03A 5CK5A 3CNEA 4CI0B 4F4DA 2D2XA 4S12A 2A7QA 5CG2A 2G04A 2G7MC 1NBOA 1PS9A 1RVDA 2ZUWA 3TSYA 3WV5A 3ZWKA 1OHHA 2CXOA 3CTPA 4KUEA 4DIBA 4CIYA 4I9GA 5IF9A 2R00C 3OEED 3OE1A 4U02A 1PQUA 2CJXA 2WUFA 3QVGB 1GKYA 2XTJA 3WK4A 1VIAA 1IJKA 1VA4A 3KQKA 1P2UA 4IMRA 3LGXA 4NLLA 2JLBA 2QRMA 2H4WA 2YW9A 4XOUA 2C7VA 3PBKA 3ILYA 2ZUFA 3NFYA 2AR9A 3V80A 1KY2A 5KAMA 3ZD9A 4WBNB 2WSSA 4DRXA 5LU8A 3SLGA 2CZCA 2F3RA 3A06A 3EUFA 4CLHA 2BMJA 4DR2B 2QORA 3N0RA 1R1DA 1GFSA 3L4BA 4N0DA 3OKPA 2VVTA 5G41A 4ZAZA 1AXRA 3G89A 2R68A 4TN1A 7ABPA 3DBLB 3HDYA 4FHEA 3C6KA 4IJ5A 4LGYA 4D4HA 4EDFA 5EIXA 1VCIA 1UBNA 4F97A 1U7ZA 3MB8A 5CH3A 5ESRA 1P2DA 3RFTA 1I3NA 3ZBQA 1K5PA 3NVKI 1P8JA 2J9FA 4YV0A 5HKAA 3JWJA 1P1RA 4B6FA 5IBPA 3D1LA 1F2TB 2W5UA 1C7IA 3PJDA 4LYFA 4O2BA 5DZSA 4C14A 3MFQA 2XF2A 2I3AA 4A5SA 5ADHA 3VQTA 1O0SA 4LXUA 5DDIP 1E2JA 1RQNA 2C2GA 2IP2A 2O8BB 5BN4B 4U1RA 3UMBA 3V42A 1U8ZA 4FYKA 1G5QA 3GNTA 1DSSG 2C4KA 2FRXA 2OM2A 1Q95A 5EIHA 4YFYA 4I3FA 3ECSA 3JZDA 3VPGA 3ZHBA 4BFWA 3OX2A 1ADJA 4HMOA 2H2IA 3GGDA 3TBKA 5K3BA 1TKBA 4G4IA 3V8VA 1K75A 5C31A 1L5VA 1DXQA 5E4FA 2Q9BA 3ZIAA 5LYJF 2IHUA 2W2NA 5CEEA 2ON6A 4B4VA 2W8BB 3TOCA 5CDUA 2GR9A 4E5SA 3DOIA 2D6FA 1L0BA 5CFZA 2AGVA 5E9QA 1SG6A 1Q22A 1U31A 4JBIA 4DA9A 3FAZA 3FGPA 3TMYA 5IZCA 1T3SA 3FYCA 4X1IB 1AN9A 4HWGA 4TZKA 5AHOA 4LJ8A 3FPEA 2PJZA 3DNFA 4WKGA 2P11A 1I2DA 3LCCA 4CTMA 3ZGZA 1NTOA 2VPIA 5D5PA 3NDIA 4CMKA 5KQPA 4PICA 1F2UB 1HPLA 4LYEA 1XMQB 4V0NA 4CKBB 1RC1A 3TXXA 1CY8A 1AXGA 3UJ8A 1HRDA 2Y76A 3HZRA 3OY7A 5DBIA 4ZTBA 4EM6A 1I8TA 1K8ZB 3LK7A 2H1CA 4HUJA 4KTVE 4A26A 1DTEA 4E03A 2VP2A 4EUKA 5KQLA 1ZONA 5DVZA 4PLPA 1T8WA 2GQ0A 1XIVA 3OWOA 3OKAA 4L4SA 4EMUA 4FGLA 5DSXA 3HSSA 4I46A 3IO3A 3O8CA 4RF5A 2EBFX 4PO3X 3U9LA 1ZIPA 1ZIYA 2Q1YA 3PC3A 4CLOB 2RHCA 4IY1A 3LT0A 1SQFA 1J1ZA 3AESA 2BGUA 1YJ8A 2C4WA 3SJBA 4EFDA 5BV8A 2QRLA 2P9BA 3EG5A 4RKFA 3ET4A 1Q7BA 3OFND 3C45A 1C80A 2ZREA 3EB9A 2WKSA 3JWIA 4OQFA 2NUAB 4N0EA 5DOZA 5K2MA 4AZSA 4LRSB 1XQ1A 1LSUA 4FDAA 4G36A 1RYYA 4IQGA 3V7WA 5KOJA 2PL9A 3L0IB 1C2TA 2UXBB 2EATA 4KSBA 5EHZA 2ZJ4A 1ENYA 1PFWA 3HM2A 1JIVA 3KXLA 1JG6A 1O2DA 2WSYB 2WNHA 3KVOA 1Z62A 2D8MA 4XYEA 4YDHB 1QTRA 2OZPA 2CXHA 3M9XA 2FEOA 4ZO8A 1J8YF 1AHHA 1M8KA 2VFAA 1ZGZA 1TIPA 2G72A 3HDQA 3IESA 4C0BA 4D3SA 3LKDA 3SWWA 2PUFA 5AJVB 4OIMA 3M3HA 1AZLA 4HQFA 2GXQA 1F12A 3I12A 1CDOA 5DMXA 1FRVA 1CUGA 1M1YB 4JBWA 3L8GA 5JV5A 1I4TD 1EFTA 3GPCA 5ALDA 4A16A 2R8RA 1GZ7A 1RWOA 2ZUBA 3MXOA 4L4UA 1IXRC 4OHVA 2FFAA 4IKPA 5DRTA 5KYUA 4ENQA 3G2OA 3G7UA 4BX0A 1DFHA 2FLVA 4WZBA 1F6BA 4C0WA 4EYKA 3M81A 2J3LA 3VOAA 4DYHA 1OAKA 5HZMA 1NZDA 2D1TA 4LCJA 2ONJA 3QKSA 2PZAA 4LFAB 3KKPA 5MN4A 5ED0A 3EXHC 4XCVA 4KQKA 3T06B 2WJJA 2VZ8A 4HDNB 1ORVA 3C8MA 3M7IA 1LNSA 4CM4A 2MYTA 1Z0IA 3AFHA 3P0HA 1PYOA 4JGBA 4PNZA 4RM3A 5EQTA 1H8HA 1AX9A 2IBTA 3QU2A 4HB3A 4QRDA 2X8WA 4XOIA 3QP9A 3KELA 2PYZA 2OCDA 4R1LA 1Y8QA 1BCRA 1ZD4A 2I71A 4X95A 3BICA 3KSDO 3IBFA 3NFRA 5K8VA 4ZCRA 1JQJC 3WBFA 3TKYA 3I61A 1SC6A 2Y4NA 9GPBA 3W1EA 2A9FA 3O8BA 3Q11A 4H3VA 1A76A 3T7DA 4CFYA 2NTVA 4FFRA 1OMOA 1Z5VA 2B92A 3G9ZA 4E08A 4P4TA 4W5HA 2ZLBA 4LWPA 1CEEA 1BGXT 1G5IA 1P1JA 2FUG6 3JPYA 5F7ZA 3UYLA 3AWDA 1OFHA 3HB5X 2YWGA 1SEPA 1QRUA 2F6RA 4QXOA 3A1UA 4HQRA 4EG7A 3NHMA 2AHOA 3KVVA 3LOUA 4LHZA 1LXCA 3CXRA 1JE1A 1M34B 2W6NA 5IFLA 4TSFD 1MBZA 1L5YA 4O4HB 1KE2A 1E7SA 3AOEA 4RLFA 5FAKA 1LLDA 2HSJA 4YCCA 1PUIA 4BQRA 4AS2A 5EIEA 5EQDA 1YB1A 1LV7A 1MJGM 1XZGA 2Z5GA 1RYZA 2A0WA 4F04A 1UXGA 5SZJA 1WKCA 4YO7A 3ZVLA 4XWTA 3DE7X 2BHNA 3BK1A 5F77A 1QOZA 1FSSA 4MDHA 5FI3A 2PBFA 1JMVA 3R20A 5IKMA 3RADC 4CL8A 4GI3A 3AHHA 4H7DA 1FP1D 1PEAA 2OC9A 4LJ4A 4BFSA 3PJRA 3OTGA 2OECA 5KYYA 3A36A 3GFOA 3DLPX 2WJIA 5IJ0B 2QXYA 2YXDA 4JI4B 1CWUA 1Y4UA 3MSCA 3RRXA 5NLLA 1E0KA 1SZDA 1B42A 1H9BA 2C9OA 1E94E 1J07A 5U4XA 1MEEA 4JOCA 2H18A 3KSBC 3KHKA 4L1KA 5F2OA 4QUKA 4HN2A 4AM8A 2QJOA 3EZNA 2ODBA 1WZCA 3LLCA 3H9QA 3IR7A 1PT9A 3OI7A 3G5LA 1BE8A 1U4NA 3WYGA 1C0PA 3H9GA 5JD6A 4CKCB 2HHAA 1DBVO 1NAHA 2M98A 1XUOA 3D6TB 1SMKA 3DM5A 4NICA 3VUFA 1NJ2A 1SBQA 3T6KA 1IXYA 3FLAA 4JY7A 2ZSBA 1DJQA 1XNGA 3RRJA 4M36A 3IP9A 1HLDA 3ZHVA 4D4JA 1FYFA 5E9AA 5IC4A 3T1HB 1APBA 1ULAA 2KE5A 3IJRA 4BO0A 1X7GA 1OLOA 2A58A 4JP5A 1KJNA 4PYQA 4CIAA 1EQAA 3MTIA 1UWLA 3W0LB 1YRYE 4D9GA 3JQFC 3OLXA 3PNYA 3IMGA 5KJ6A 4EAAA 4KQXA 2AOUA 2WP8J 3BJIC 3WKDA 1K98A 1E4EB 3JQ8A 3NAMA 4ERNA 3ZV5A 2BBSA 1AUPA 4E94A 1X8LA 1KAMA 4LKOA 2JLVA 2DBVO 1LPPA 5KYXB 4P7BA 3HBJA 2ODNA 3H9JA 4Y98A 1NYLA 1JEYB 2AG1A 2F90A 2VO1A 1JLSA 4RJ2A 3OPYB 2KM1A 4KDCA 2J33A 3CF4G 4KQMA 1DBIA 3TX6A 3F47A 2YZMA 5DTIA 5JMWA 4S04A 4J1SA 4M53A 2V0NA 3O1JC 4I4TB 2BZSA 2DTEA 1DCMA 1J2RA 4H7IA 1CJBA 2CK3D 2Z1NA 3ICCA 1UF9A 3L0DA 4LZNA 1J99A 1OWNA 3CNBA 5SICE 4ZI7A 1SB8A 3KLPX 3FUTA 1TJ5A 5GGXA 4EJ0A 4U7PB 1LDMA 2NZ2A 3ZTTA 4ASUD 4BBZA 2QG4A 3OC0A 1A2OA 1G5TA 2XXBA 4FZ3A 5JJKA 5ALJA 4ZHQA 2ILTA 5F64A 1MFPA 3GYGA 2PR2A 2V6IA 4MV1A 4RV4A 1PF7E 2ZAGA 2WIBA 3RLFA 4D79A 2WHPB 4CF5A 2NO5A 4D9CA 4LY3A 2HCTA 1GKIA 1QK5A 1V7ZA 5LQNA 3LYLA 4IVQA 3MJ4A 1MQAA 2PBRA 5ECWA 1X92A 5BSFA 5BMVB 4HH0A 3O8QA 2B78A 1L5ZA 2Q6VA 4MS4B 3VPXA 5A1TA 3U44A 4DNFA 4J4HA 3CF2A 3KPUA 2X7HA 4R1UA 2HPHA 1SRQA 3FOAA 3KZOA 3OPQA 4NIMA 2VPPA 5IDYA 3UJDA 1SUEA 2EP5A 3BZBA 3I92A 3K0AA 4FK8A 4ALNA 1IPEA 3L7BA 1QR6A 1EFPB 1J25A 2VCYA 1OX5A 2DUMA 3N1UA 2ZP1A 3NASA 1Z37A 3BOSA 3E9CA 4AY2A 3K5WA 2VK2A 2ZBDA 3ZY2A 2ETXA 4GVPA 5DYTA 5B58T 4QDKA 4PGGA 5EUMA 1NP3A 1AN0A 2H8KA 3PUKA 4TSRA 2CCGA 1WMAA 4Z7NB 1BX0A 1AGNA 3LL7A 2XB6A 4TVOA 3DYBA 1GGFA 3BS4A 3BBLA 2CYCA 4XSHA 2RFLA 4BXOA 3UQZA 4LOAA 5KCZA 1A5BB 2WU3A 2ZSEA 3CU5A 3R3ZA 1XQ6A 1NPTO 2EFDB 4KFTA 2Q7DA 1NG9A 1WB6A 4RDCA 5BUCA 2G83A 5JSHA 1B4DA 2IBSA 1O6GA 3Q3IA 1E3WB 1I6LA 4NONA 4XQ0A 4OYRA 5JXWA 3FTQA 1YBHA 3AUKA 3GJ7A 3CRMA 5J4HA 4DLNA 3WGZA 2JJMA 1JILA 4L95C 2D2VA 3J7AC 4WOCA 1D1TA 4G5HA 2CYBA 1MQ9A 3PSHA 4TMYA 2FRDC 3K1TA 5T3UA 2GRUA 1EGQA 4FJ0A 3T1TA 1CF4A 3TLXA 3QXJA 4FILA 3NGLA 5FKJA 4V1CI 4K26A 3ASUA 3GDGA 4WSOA 4A6DA 5JZMA 1OXBB 2QQFA 3JVEA 4LSWA 4MW0A 3WRYC 4DCJA 5IKEA 1OH8A 1KDRA 4KFCA 2JFBA 1Q3HA 4FI3C 4GYWA 1CUXA 3MQFA 4A2WA 4KPFC 2ZQZA 1DCTA 2XCOA 1D7AA 1E2BA 4RZUA 2AYYA 2HF8A 1JTEA 2MSCB 3QHAA 3BJZA 5F9MA 3VTAA 2QE7A 2Y6VA 2FGJA 1HFWA 1KKUA 4QWMA 1A5TA 3WMWA 5IULC 1BMQA 3AVPA 2Q6KA 4MVJI 1ISSA 3VZCA 4CIWA 3DR5A 1WXHA 1QFMA 3DLTA 4ZU3A 1YCHA 3L8EA 1RT9A 4B3RB 5MHTA 4P3XA 4LZJA 4KQFA 1QAMA 5ETJA 1PLJA 4DT1B 1OZFA 5AW0A 1BGVA 4F1WA 1R0RE 3AB7A 2QVCA 5C5IA 1W9HA 5I8ZA 4YAKA 2NYVA 4CGYA 4DWVA 1PGQA 2LW7A 4B6OA 4UBOA 1CEYA 3H5OA 1KZ1A 5IW8A 1EXDA 1DZIA 1N6NA 1RKUA 2GDJA 2JHGA 2JL1A 3QELB 1G8HA 4YTEA 2RK6A 3ANNA 3BTUA 1PSWA 1R0SA 1HKUA 1QDUA 2G0TA 3BXOA 3EGXB 4MV4A 3T54A 4TLCA 3U56A 2FN8A 4FOOA 2CXUA 4JLPA 1L8LA 2DH6A 1ST3A 3HYRA 2QUAA 4P5DA 4Q66C 3NH6A 4D6YA 1SXHA 1THTA 2YUIA 3EZGA 2JLYA 4M0EA 2HDHA 4DM3A 3BE8A 4DSOA 5JQWA 1KKLA 2J3EA 2X23A 1GU7A 1YE3A 2PQ6A 2WSBA 3LBYA 2ZBFA 1T5HX 3T9BA 5MN5A 1XRLA 2GM5A 3KKLA 1M6VA 3ROKA 4B7XA 7REQB 4O2BF 1F2DA 1EA5A 1HNNA 3FHTA 5INTA 1I6KA 5FUVA 5B1EA 2PQ0A 5DYGA 1O5IA 4HN4B 3DLBA 4GZ5A 1E9FA 4QXPA <