2X9QA

Structure of the mycobacterium tuberculosis protein, rv2275, demonstrates that cyclodipeptide synthetases are related to type i trna-synthetases.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
236
structure length
231
Chain Sequence
FQLGRRIPEATAQEGFLVRPFTQQCQIIHTEGDHAVIGVSPGNSYFSRQRLRDLGLWGLTNFDRVDFVYTDVHVAESYEALGDSAIEARRKAVKNIRGVRAKITTTVNELDPAGARLCVRPMSEFQSNEAYRELHADLLTRLKDDEDMRAVCQDLVRRFLSTKGATATQEQVCMDYICAEAPLFLDTPAILGVPSSLNCYHQSLPLAEMLYARGSGLRASRNQGHAIVTPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords CYCLODIPEPTIDE SYNTHETASE
publication title The Structure and Mechanism of the Mycobacterium Tuberculosis Cyclodityrosine Synthetase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 82
structure length 231
sequence length 236
chains with identical sequence B
ec nomenclature ec 2.3.2.21: Cyclo(L-tyrosyl-L-tyrosyl) synthase.
pdb deposition date 2010-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16715 CDPS Cyclodipeptide synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2x9qA00
2X9QA 3OQVA 3OQIA 3OQJA 3S7TA 3OQHA 4Q24A 3OQIB
chains in the Genus database with same CATH superfamily
4RANA 2YBDA 3LUKA 4YVFA 3OTGA 2VPXA 4UE3S 4HS9A 1Y1QA 3MLBA 3PGLA 1ACJA 1K3TA 3VR4A 1NT2A 2AJ8A 4WJKB 2PU7A 3FPJA 2FEXA 3CCBA 3KJFA 3ABOB 5EIBC 4R1PA 3OESA 4GMHA 3UC5A 5FTNA 3HXQA 1IBSA 1KPIA 1PS0A 5P8WA 3TTSA 4BJHB 2OHVA 3PD1A 3F71A 5FHRA 4Z3OA 1I1QB 2J9RA 4P80A 3TD9A 3V4FA 4DIFA 2G63A 2ZAIA 3GEEA 3COVA 2H54A 3LUDA 3WK5A 1W0KD 4DANA 5I7VA 4QM7A 2X0NA 2R8RA 4JEHA 3VPBA 1NJ8A 5GIOE 8ATCA 2G8LA 3YASA 1LPNA 1QMGA 1WMSA 2QF7A 3TOSA 3EWSA 3ER9A 1YJ5A 2GRUA 1I24A 2F48A 1P2SA 2JDIA 3IP6A 3KQMA 5G0VA 4EITA 3DZJA 4LTDA 4UHBA 1MIHA 2FK8A 1JHXA 3DWGA 4B40A 3CF2A 4DWVA 3AKCA 4LMRA 4G09A 5B37A 4QRDA 3ZU3A 2VSQA 2VJBA 5T3YA 3EARA 3ZW7A 3SN6A 4JI8B 1VZ2A 3BXHA 4IDPA 4BMCA 4WESA 2WNHA 1G60A 3AIOA 1SUSA 3G59A 2VP5A 2FW8A 3E0XA 4KIJA 5TNXA 1XRSB 1PE0A 1QZXA 2JCVA 2HDHA 3LUAA 3GGJA 3UBMA 5EHNA 4HVTA 4EAQA 3PENA 4I6JA 4P7KA 3VSAA 2W2PA 3WLOA 2FMXA 4CE6A 3IXQA 1VJ5A 4FIDA 1E66A 3GG2A 3IEXA 2SHKA 4P32A 4ENQA 4ZYZA 4Q9KA 1G42A 4LRQA 2E6KA 1KC1A 3D7SA 2JZCA 3LDAA 1AKYA 3NBFA 3IIKA 3RBZA 1VE5A 4JA0A 2UUBB 4KTVE 1JR3D 1Y4UA 3PIDA 1LI7A 1H3FA 1Q91A 3UXHA 4E3ZA 2F9MA 2XDAA 2V1UA 4C4SA 4BWVA 5D01A 5KHLB 2GEDA 1CUGA 1LPAB 5JSQA 3PHCA 5G1OA 4O63O 3WLNA 2G04A 1RPAA 1NWHA 3G7SA 5ESWA 4F0JA 2DHCA 3AG6A 1FXUA 3EPPA 1RP1A 5A03A 3DV2A 4HHEA 1SMKA 3I8XA 2AC7A 2WWXA 3B6IA 3B6KA 1F9EA 3BKXA 3ZYCA 4JI2B 4BXOB 1RZRA 3PNYA 4E22A 4CKCB 2DM6A 2CMHA 3L6BA 1GPKA 2A9VA 4HQOA 3NHKA 1NHGA 3QBJA 3E2PA 2MYUA 3BKWA 3LAWA 10MHA 2WKWA 1TUBA 4QYMA 4OGLA 1BXRB 1E61A 2QB5A 3UUFA 1JVBA 1Z5GA 3MYRA 3I0MA 3Q12A 4J43A 1GZHB 4DJEC 2M1XA 4ZZ3A 4D82A 1N57A 3TEMA 5DM60 5HFJA 3BZUA 3HHPA 4LX0A 2RHMA 1C3OA 4RVNA 4KLAA 1SFRA 1Z6TA 3E35A 1H2EA 5EZYA 4PZDA 2BM8A 2JH9A 4Q4AB 5H9WA 4KQXA 2ZYRA 4YB8A 4FWIB 1NX9A 1WCYA 4GZ5A 3FE2A 3GLFB 2Z5LA 1K5DA 1SKBA 1GU1A 1Z7YA 2I1VB 2WTAA 3BWBA 3VMMA 1F4PA 5ED0A 3K4PA 1MAUA 4AU1A 1K88A 3L43A 3PHJA 4YPOA 2XKKA 5JANA 3IQGX 3VKFA 1N75A 1OOEA 1OYOA 4MW4A 2ZYSA 4X7RA 1CIVA 1H3NA 1PZXA 3C7KA 3O4RA 4PSUA 4X63A 3BJRA 4XFKA 3VR4D 2BSQA 2PV7A 4PV7A 1J0CA 3VHXB 3IQWA 3TTUA 4MS3A 1E63A 4JNCA 4O2AF 1Q15A 3A1NA 5AKXA 5HS6A 4KR3A 4ZVTA 3HXLA 4LDAA 3DAPA 3KHKA 3HJUA 3DO5A 4F86A 2C1XA 3RM3A 5BN4B 5JD4A 4C7VA 4QXMA 1U7UA 2V6IA 3IILA 1L1EA 4LQLA 4XQ0A 4RTLA 1ZR2A 1PP4A 4GWLA 1IZYA 2X19A 4WASA 2Z8YM 4PAQA 4HB3A 1BX0A 2COUA 3H2HA 1MAVA 1TI7A 4FQ5A 4KB5A 4R16A 5FL7A 2YZGA 2JDID 4Z1MA 4C9BA 3AGQA 1T4MA 4ON9A 3ZS9A 2R8ZA 3CINA 5JATA 1JKFA 2OHGA 1BVYF 4I7EA 1JWBB 2DFPA 4NL4H 2J4CA 3KEGA 1V2HE 3SC4A 1BD3A 1WPXA 1XCBA 1UJNA 3LUBA 4GOOD 1XX6A 5K3CA 4IYJA 3CGWA 5FBHA 4ZVSA 1E3QA 3HYRA 1JDSA 4H9GA 5HIMA 1TXGA 2XNSA 3JQ8A 3RO7A 3AKZA 2J3MA 1W4ZA 2IHZA 4E2ZA 4UHHA 3LDGA 4BLVA 3L07A 3SPXA 1E2FA 1UBHS 4IJ6A 4JLVA 1NYQA 4OGFA 3F1LA 4UHKA 4JXJA 1V5FA 5IC6A 2P9QA 4KIUA 4WT7A 3A4TA 3E15A 5HE8A 3P4XA 5EEGA 1NSFA 2C0QA 3R2JA 1LF5A 3L8CA 3LBYA 1IUPA 1YR7A 3Q9LA 1IY9A 2W93A 4NYMQ 2PLNA 3CRQA 1ZU5A 3I1IA 3N05A 5HMLA 3FIJA 1EA5A 3P9YA 4O4IB 1T1RA 3F9CA 1ZXXA 1X94A 2FEPA 3BHNA 4MQFB 4ZHQB 2PZAA 5HVNA 4FB5A 4FM9A 1U28C 3FTPA 1VIAA 1RXVA 2B0CA 2AFHA 4BFXA 1ZGCA 3QEJA 4EAAA 5HZHA 3EWAA 4QJBA 1K8YB 1RDFA 2VBIA 2JJYA 2OWDA 2X0JA 5DTEA 3EFHA 4UQPA 4LYJA 1FFGA 4BO0A 3NPAA 1E9AA 1CNFA 4RGBA 4RTNA 3PHLA 3CU5A 1GSOA 3WV5A 3H18A 4DLKA 1FQJA 1P1JA 4YRZA 3JRNA 1NI4B 2D1SA 2Z2ZA 5AW7A 3T54A 3BWCA 2GGSA 3Q15C 1Z3CA 3CH6A 4PLZA 4RKWA 3Q8KA 1VHDA 1FF9A 1ZGJA 2BCEA 2IYZA 2ZVJA 3C3WA 1YDWA 3DBHA 3H42B 4X45A 4UU1A 5TV2A 4EPTA 3I34X 4KNWA 4J0JA 3EZXA 4L2IA 2RGYA 4CF4A 1AIPA 3UGJA 2C94A 4GXNA 4Z9FA 2I2FA 3ABIA 5BQ5A 2JBAB 3D31A 6GPBA 2ISQA 4XYLA 3T3EA 3EXG1 4R9RA 2REXB 2QN8A 5COBA 3F97A 3UJNA 3C5HA 2J85A 1T15A 2ZIXB 1OUMA 4B81A 4M6WA 4ME6A 2YWCA 4AZ0B 5DF1A 3DAFA 4D98A 1XVLA 2Y77A 3CW2A 1TZKA 4L6IA 3ODGA 4PLVA 5TF0A 4DAEA 1HKHA 5F98A 2P69A 1F20A 5EKUA 1U0FA 1B7GO 2G9UA 1H0SA 3D6FA 4ND6A 1XA4A 1SQGA 2RD2A 3EC2A 3JWGA 4A0HA 3DNMA 2GCPA 2IV2X 2PMCA 3HWX1 1JEYA 3QFTA 3W6ZA 3RS4A 2VWGA 2ATIA 4JBLA 4CTJA 5BMVF 1WUKS 2PRIA 3KUXA 4W7SA 1UXOA 3KNZA 3J81k 16PKA 3ELUA 4PSVA 5K8JB 4Q9JA 5EZ5A 2BZ0A 2VDWB 3OOYA 5AW9A 4CV2A 5I7WA 4C7JA 2I71A 1N25A 4JLSA 1P75A 2O8VA 5IT0A 4DR7B 4EJSA 5I7SA 4UBOA 3DBRA 1EEHA 4LMPA 4B2PA 2V65A 3T34A 4KQHA 5E6UB 4HDRB 2X6RA 1MLDA 2PX3A 3G9XA 4EKNB 3JY6A 5B12A 5F4ZA 2HK9A 2COKA 4NV0A 4WA7A 5ARDA 2J48A 3JWIA 3TSAA 5IABA 1M74A 4IV5A 3V7UA 1JHAA 5FL7D 1FPMA 4MKRA 4RQTA 5M29A 4R8SA 4CNQA 3OFNA 1ZS9A 2ID7A 1WUYA 3L6DA 1CT9A 1CIJA 4RO0A 1PT7A 1I4WA 1TMOA 1L4LA 1BJRE 3KSDO 2CXTA 3ND6A 4G2TA 3ZD8A 4B71A 2RI1A 1J25A 1LI5A 1DAMA 3FDJA 3U80A 3IE2A 3N5KA 1X1QA 3UYLA 3LL4A 4DG9A 5BV0A 1JYEA 1YHNA 2DSNA 3DE6X 1FUUA 1FPQA 3RSHA 3VZQA 2HLDD 1MTOA 1UK7A 3H6KA 3R3WA 2X15A 4YT8A 4U2CA 3EVDA 1IN5A 2ZQ5A 1OLSA 2I66A 3HDGA 4BPBA 1TMKA 3HP4A 3VU1A 1VZ3A 4PXYA 1U3TA 5C1IA 4TWAA 3ETNA 3L0ZA 5KKCA 3H1TA 4KMMA 1E9CA 1O3YA 4OAPA 3CNBA 4CLDA 2CDNA 2WNSA 3CE9A 4HX5A 4OHWA 2VKQA 3D7RA 4NX2A 2I80A 3HV0A 5AK5A 1KJ8A 2OAP1 3K09A 3SZLA 3WOVA 4BLUA 3U4MA 1M34A 3RSLA 1JIQA 2PUFA 5K3FA 4JP2A 1QC5A 1A9SA 3RVSA 5KVQA 2FVYA 3PDIB 5JDIA 1T4DA 5ECWA 5HFNA 2H7XA 3VO9A 2QK4A 4D9BA 5C5CA 3I45A 4UUAA 5ALUA 3CVVA 2PGLA 3SHQA 4EY4A 3I9JA 4MA4A 3NRJA 4CF3A 2V45A 1HY3A 1RCUA 2A1TR 3QE3A 4YJ2A 4MDEA 5DNWA 3C3CA 1X42A 1UQUA 1EDEA 4UULA 4BLTA 4Z8XA 1PV1A 1F2TA 5B3AA 5JBQA 1UWKA 2RKOA 1A9QA 3C5WP 1QV9A 3B5IA 2O8CA 3NEAA 3OQ1A 3HVIA 5DYTA 4EUKA 4F4CA 2C3OA 3GV0A 5I7EA 2IY8A 3NIBA 4JC5A 3AUTA 2I54A 4CMIB 2V7TA 4WZAA 2XXAA 2WD8A 2PZEA 3OMLA 4X94A 1S8OA 2HWXA 2BMAA 3LVQE 1TW2A 3RASA 2EIHA 1E2GA 1CETA 1PWHA 1SO8A 2A5DA 1ZJJA 3R9IA 3RBVA 3G0IA 4F9EA 3PGKA 1OC4A 1H2XA 1JLLB 2VUHB 3Q6NA 1DKMA 2GK7A 3P2KA 2AH5A 1Z18A 4L5JA 3ET5A 4HQ0A 4I1YA 1DE0A 1NIPA 1Y89A 3IDAA 3UNXA 5FLYA 2I2XB 1QBKC 4KV9A 2IY9A 4QUKA 1Z0ZA 4GL2A 2Q1YA 2HIHA 2WVGA 5DIZA 3VR5H 2BTEA 2GM9A 3CNQS 3OE7D 5H81A 1TQ8A 5KTMA 3EGDA 4KPUB 1N5JA 4TS3A 4R7GA 1JUDA 1UWCA 3ZVLA 2QAJA 3S28A 4HDMB 4HDAA 2V97A 4A8TA 3LUCA 1BXGA 3R7AA 1D2CA 3A8TA 3ND9A 5C2JB 3GUYA 3L7KA 3ASZA 2PVCA 1PJRA 2PG3A 4PBRA 1I4TD 1KVUA 1V3UA 1KSHA 3FWNA 3VPAA 3KHSA 3OPVA 4DF3A 1T9BA 3P32A 2X8BA 2W6IA 3OFND 5CJ2A 1Y7TA 5IDXA 2DFTA 2EZ8A 2LRHA 3FFAA 4U00A 5JSZB 3A1SA 1MOPA 4GYWA 3GAFA 4IIJB 5BUSA 1USKA 2PZBA 2W2TA 1ZRMA 3FUCA 6REQB 2FMFA 3Q1KA 3LLCA 3NW9A 1U8FO 2VDQB 3GLIB 2PLRA 2C4VA 4KWTA 3CR3C 4YDRA 3G0HA 3SSNA 2A5LA 1JXQA 3CH5A 3MSXA 4D3FA 2G5TA 2QYOA 3HRHA 2ZE6A 4C2AA 2WKSA 1R0LA 3HUEA 4ZFNA 4FUQA 2AXPA 4NCNA 1YIOA 1EE9A 1LJLA 3ESBA 4XE5A 1GXSA 1X77A 4R71A 2BHTA 2FPPA 2VNIA 3LU1A 5JFTA 4XTRA 2OBFA 1G1AA 1P80A 2GTHA 5SZKB 4BNDA 1ZPDA 4KOEC 4AO8A 1N2CA 2PQ6A 3B70A 4U0KA 3W2FA 4D4HA 1DARA 3PITA 3TEJA 1QKKA 3FA2A 2PD4A 4GPAA 1QHSA 3SSOA 4WN3A 1I7NA 2YHIA 3LA8A 3WBFA 4J91A 4U8HA 1Y5NA 5J43A 4MUMA 4BKOA 4ND1A 4XFJA 3LBHA 5HFAA 4ND7A 1BKDR 1QR2A 2IF0A 5IAKA 1Y63A 2BM1A 3TD2A 4XRGA 5CRIA 4ZU3A 4A5SA 4RL6A 4XI9A 4O08A 3C4JA 2MR5A 2PMWB 2CXQA 1GG2A 3H6HA 2YUTA 5D00A 6LDHA 1BA3A 4QDZA 3RK4A 4RKQA 3L2OB 1CY1A 4EHNA 4UU7A 2VQEB 1CQIA 3T3MB 1JQEA 2CCGA 2GK4A 2JJMA 4JV5B 1SC6A 2FUCA 3RUEA 2ZM6B 4HGOA 5KYXA 4HSEA 6YASA 5D3ZA 5SZIA 6ADHA 1PF7E 5FPQA 1TM4E 2HQBA 3AFMA 4QDJA 5DW3A 3NMUF 1U9CA 1R8SA 2PLFA 2NVUA 3DLAA 4WUVA 5BQ3A 5KVCA 5D6NA 5EHGA 3KZKA 2AJBA 4H35A 4LRYA 3TLKA 1L5QA 3AKEA 3IUSA 4FXOA 1DBQA 2Q3CA 3EVZA 4JUCA 2XRZA 2Z9DA 2OCPA 1Y9DA 4IIHA 3CMMA 3JQ7B 4LXXA 3JQFA 4YMSA 3RS2A 3WBJA 1ZNWA 1NIJA 1ZUWA 2QG9A 1GKLA 2EZ9A 2IZ6A 1MG5A 2Y3IA 4JIGA 1N9KA 4CL3A 3DMTA 2F17A 3W8NA 2D1TA 1PYGA 2VDLB 4E7OA 3DOUA 3K0BA 4OVKA 1Y8CA 3QH4A 4R6XA 4UD2A 3HSSA 3SCZA 4NEHB 5JG7A 3CUVA 1CZKA 3OUTA 4NH0A 3K7EA 4N0MA 1V8OA 1DAFA 5EJ7A 4AKIA 1Z8NA 3EEQA 1YUMA 2XNCA 3GROA 4QEZA 3MT9A 4KBFA 5EFZA 4CMCA 1GPJA 4G8DA 4WPGA 4OUDA 4B7XA 5J9FA 3U62A 2F3TA 2YNMD 1REQA 4KVFA 4UU8A 2C2GA 3FPAA 2ECFA 1FU8A 1RHKA 2QLTA 3IDZA 5ADVA 5K8VA 4D97A 1VIMA 5A0VA 1WHSB 3SU8A 2ID8A 2ZQZA 3IP8A 3NUZA 4XYEA 2ZLBA 4PQEA 1JTEA 4CUKA 5FTLA 2ZI5A 1M2VB 3P5SA 1XTRA 3ZWBA 1ZH6A 1BX1A 1J00A 3M5WA 4G36A 1LGYA 3AF3A 4EEXA 2A78A 721PA 2OV2A 1MMFB 1WDTA 1YNOA 1RHRA 3TGPA 5FBRB 3O03A 1KAMA 3WNCA 1EQ2A 1EFHA 3NBMA 1RXYA 1XZNA 2IEYA 1SXGA 2IQ5A 1TECE 4D5EA 3K6SB 1U2QA 4PZPA 5I9MA 2J5KA 1OAAA 2Z6AA 5EXEA 3I04M 2FJ0A 3DVQX 4QLOA 1GYQA 2W2LD 3AR8A 1FUIA 5DHFA 5TMBA 3WOHA 5ADHA 1OH5A 3IEIA 4XR4A 5HCUA 4CGZA 1MHTA 2I2WA 3MB8A 3QYAA 3RU7A 2HT6A 2XE4A 5B4VA 1CJCA 3TINA 3AETA 5B7QA 3VQTA 1XTPA 2ZGVA 3RT9A 4XLTA 5TIIA 1SGWA 3FW1A 1RJGA 4ZYUA 1AQJA 1ZMRA 4JMLA 2V5AA 2PBFA 2ZUBA 5LQJA 4ZYWA 3PD7A 1T13A 4TS4A 1XRPA 3IBCA 5IJXA 2YQ4A 4NS4A 4EX7A 2DR3A 4REQA 2QD1A 1A96A 5AVVA 3QV1A 1WUJS 1FSPA 3DEHA 2GZSA 1P61B 4BQRA 2EF1A 5EKTA 2TECE 3PK0A 1GQQA 3CZ4A 1L8QA 2WA2A 3OKFA 3QIVA 4N01A 4L95C 4NJMB 3W2TA 4D8VA 1IZZA 3BFJA 4FSHA 4KDFA 5F2NA 2AFIA 3V1UA 1R0YA 3O1HB 3VNUA 1EKXA 2Y71A 2AEMA 5CW2A 1KMHB 4MQUA 1Z37A 1ZOLA 5AKKA 3JYQA 1S01A 2G0NA 1I7DA 2JEZA 2OECA 1BHO1 1XD8A 3M2PA 1NU8A 1DV1A 4WZ6A 1JSLA 2V6BA 3C74A 1L1FA 1JEOA 2HIAA 1C30B 4Y2TA 4KO2S 4PG7A 4XD2A 3C4QA 4BLSA 2WZCA 1D1QA 4PTLA 3KKOA 5H3LA 3WP0A 3R74A 5EJEA 2XMRA 2W2OA 3E0QA 4XDYA 4M7PA 4BKUA 1XZQA 4JVSB 2MYNA 1YDGA 1Q1GA 1E94E 2A57A 1P6QA 4QUHA 5NULA 4KNYA 2I03A 2YC2C 3VSBA 5LZ9A 1VSVA 1YZQA 4FFRA 2VUSA 5JO0A 3WADA 2RONA 4ZJUA 2AZTA 2QMUA 5K6AA 3WWYA 4RK5A 3U4DA 1DKNA 2Y1XA 2J9GA 1QLHA 4FLMA 4B0PA 4F5WA 2DGDA 1ZNYA 3IR6A 5BR1A 2WAYA 4DL9A 3EJWA 4DLNA 5T5QA 4M0PA 1Q0HA 3V97A 3GLHB 2MMCA 1UT5A 2D2IA 1R6BX 4TKUA 1VRVA 1L7XA 4KQJA 4F6LA 1JHDA 3PC8A 1NJ6A 4I50F 1DEAA 4KDRA 3LH5A 1I6LA 2BLNA 1B3BA 1D09A 2CUTA 3E4DA 4JLMA 4GOKA 4Q4HB 1GCOA 1SHJA 3MT0A 2OXTA 2JG3A 1K5PA 2CMKA 2Q4OA 4Q1AA 5BNFA 3ZY6A 4CIAA 3T9CA 2RIRA 1M1YB 3HCNA 2ZWMA 1C4WA 2HA4A 3A4IA 5SYAA 3BWMA 3PHGA 2N1MA 1CS0A 1V4BA 2OL4A 1D2MA 4URYR 4WL0A 1XTVA 1DG9A 1Y6GA 2EQAA 4PC2A 2L18A 3N2GA 1E3WA 3O95A 4W8HA 4D0LB 1E2JA 2BH9A 1WCIA 2WJJA 4URVR 3M6WA 1WDMA 4BVFA 5EWMB 2QE6A 3ZE7A 4EHIA 2XNKA 3ZUPA 3T15A 1Q1QA 1UZNA 4FW9A 1S2LA 3DBLA 2ZSKA 3K3PA 3K0AA 5CH5A 3T5BA 4YMHA 5LMCA 3E9ZA 2J0QA 3OD1A 2A0FA 1X38A 3WNVA 1Z0JA 4OKIA 1DX9A 2R7KA 3NTXA 2AYZA 3RREA 1Y3CE 3ED5A 5DX1A 4BX8A 4C6TB 1EIZA 1ZBQA 4HH0A 3FLAA 5ALLA 4BQQA 2QUBA 2ORVA 3RTEA 1EGVB 3COYA 4ZYXA 5L4LA 5ALSA 2ZRHA 2QZJA 5FWYB 4B6SA 4YQZA 3K4QA 4QBIA 3F78A 2ASEA 4YUVA 4EQ6B 4H4DA 5C8YF 4NC9A 3C1UA 3L9XA 4J7AA 4GUAA 3H9CA 2R6HA 1V96A 3LQQA 2IGBA 1XRNA 1PFVA 4QLAA 4XJSA 3WLTA 1Y3FE 3FD8A 1XTUA 3W5VA 2OORC 4V3CA 3RG2A 1UEJA 2GF2A 2CYBA 3CX3A 3JQ6A 3TRIA 2SKCA 3A05A 1M8KA 2Z98A 1ULHA 3ZDRA 4YR7A 5C52B 1K4KA 1KOJA 1T5OA 3EXAA 4LKRA 2QX8A 1RI5A 1TFUA 2BBWA 4DLTA 2MMGA 3D6NB 5BSRA 2VPQA 4PWZA 3BTUA 4F2HA 5HIIA 2JA1A 2QMZA 4RA6B 1JI0A 3C39A 1QLJA 2Q4TA 2VTBA 4KCGA 2P3LA 3KWMA 4JVLA 4AT1A 1RAEA 5D3QA 3THWB 5DCYA 1C1YA 1J97A 1W96A 3JZFA 1GGHA 4F06A 5BVHA 1XC7A 4XDZA 5K4AA 1Z2PX 3FUWA 1QIMA 1DAOA 3RYFA 4F6RA 3PL1A 4RFSB 1CFZA 2C7RA 4YUAA 1S96A 4FGWA 3VDRA 1RMQA 4G0YA 2FYTA 2J9FA 3ZI7A 1JIVA 3BG5A 4X1KB 4D96A 3ROEA 2HBQA 4JNKA 5I9IA 1DKOA 1DC4A 3DF9A 4HO1X 2RDMA 4E3WA 2RHTA 4EY6A 4BO4A 4BQFA 1E7YA 3JAWB 3D6JA 2BWJA 3L04A 3V9PA 1LWNA 1CUXA 1ZGHA 2C7GA 3FFBA 3H4MA 4NHEA 4MAFA 3EDYA 4GE3A 5KX5B 4L5YA 2CKMA 4BEVA 2P2DA 3LRXA 2R8OA 2WJZB 1R4MB 4NNPA 3AJRA 4IXDA 3TOVA 5HQTA 2R3SA 3STWA 3D3EA 3AP2A 4ML3A 4OXQA 2YKGA 2VBCA 1C9JA 2C9OA 3DFMA 3IBGA 1K08A 4RKYA 3GJXC 1NKSA 3FPLA 3IESA 3IBYA 4U2FA 3E2IA 4R4JA 2NUPB 2PKCA 4UFNA 4AN1A 1K5GA 3N6VA 3AHHA 1EE2A 1G66A 1MX9A 1M6VA 2JJQA 1GNLA 2IIPA 4HL6A 2C9ZA 4CQMA 1TU3A 3AVXA 1H6CA 5IVHA 3K5PA 1TQDA 1ZCAA 4YAKA 3W06A 3ACBA 1EJBA 4GX5A 5GY7A 2IXFA 2YWDA 4N7RA 4V0LA 4DCSA 3P71T 4HYEA 5AVWA 1UXJA 1HWYA 4RTOA 1IXZA 4XWKA 4KGZA 3BGVA 1BCRB 2VTVA 1JEQB 4LY9A 4DQ0A 5LP1A 2FKNA 3EPLA 3WK7A 1ZLXA 4GBMA 4AKEA 4BJ5A 4OFWA 3E22B 1WXHA 2GBCA 4EBBA 4JD5A 5AXAA 2O5VA 2X8WA 3SHFA 4EUFA 2I2AA 2DHQA 3B1ZA 1PNTA 2FZCA 4ZYYA 3FOWA 5IC5A 4UVDA 1GQOA 3HEBA 5LZ2A 2QMHA 1E20A 3IGFA 3GLQA 4WNAB 1ETUA 1N8SA 1YUNA 3W4IA 4B0OA 4CN9A 1ZQ1A 3U40A 1H3EA 5BSWA 1FOEB 2CNKA 2P5SA 2Q3MA 3DSRA 3FPEA 3DZKA 3GGGA 2FWIA 3W1EA 2UYCA 2QL7A 4MRMB 4YXWD 3PS9A 2JLQA 3R77A 4QU0A 2IGTA 3EXHA 1A97A 3GNSA 3QU4A 2RBEA 3KKMA 2EXXA 4LFCB 2G67A 4DCNA 5CDTA 3GBSA 3U4CA 4BMOB 4W5RA 5LL6P 3L7AA 4DBZA 1KR5A 4L07A 5LQAA 3IELA 4N49A 2J33A 4ES6A 3EVFA 1VLJA 5C1PA 5IZCC 1GKYA 2NNLD 1IB0A 3QU7A 3COSA 2RHCA 5CVJA 2FSVC 3OEWA 3IAFA 1QOPB 1KK0A 1TF5A 3CV3A 4NMLA 3RS7A 2AMVA 4B6OA 2C2ZA 3EEIA 5FIUA 5EWJA 1OXVA 5CW1A 2AD1A 3TS1A 3HUTA 4MRVA 3BIXA 1OC2A 2BBTA 2QQ5A 4LWZA 2J0EA 2WZQA 1K98A 3D1LA 2UU9B 1F0PA 4M21A 2GZ3A 2XA9A 3HN6A 3F3KA 5IEBA 4EEKA 2RAVA 1EFPA 1EGHA 2J7PA 2PHZA 2XGOA 5FTJA 3RABA 4E5UA 1Q11A 2QDXA 1EMDA 1AB5A 1QQAA 4KR7A 2JVJA 1XNJA 5ETJA 2QLBA 3HR8A 4RKFA 3REOA 1FNMA 1G18A 5DMHA 1GZVA 1J07A 4BLRA 1XR3A 4WECA 1TVKB 4R9NA 1GAJA 3I73A 4X85A 1XYVA 4KXNA 3AR4A 4D9KA 4OM7A 1NN5A 2O7RA 4FFBB 1QVVA 3K30A 2R2GA 5FLEX 3PX7A 1HMPA 4AM8A 3F5FA 1ZMTA 2PT9A 2IYOA 4PM4A 4P53A 3SYKA 4Y2QA 4ERNA 1ZN2A 3G13A 4DGQA 1Y3IA 4MPJA 4XQEA 2JI7A 4Z7JA 2C04A 4Q3KA 3WC4A 5CLLA 1P72A 3PXEA 4MUXA 1KEVA 4D57A 1NG9A 4A6PA 3T9EA 3AJDA 4W6ZA 2XUOA 3QPWA 3ETLA 4CKXA 3VNBA 2C2YA 2RC6A 1PJ4A 1SBTA 1ZG3A 2GHRA 3A14A 4II3A 4AMGA 5C4IA 3K6JA 4Y1FA 4XWYA 2H1RA 3MB5A 4HNSA 4F92B 2RCNA 4BKRA 1MVLA 4KR2A 3OUZA 1BS9A 2PZGA 4LZLA 5CCXA 1VHWA 1GNSA 3VVBA 3MGAA 4JYMA 2YJGA 2EKLA 1JZSA 5BR8B 2B1JA 3DPSA 1QZUA 2FPXA 3QFSA 3IQZA 2JGRA 3WDLA 4CQMD 1PG2A 2EKBA 2H1CA 2QR2A 1Q0UA 2ZYWX 2CXXA 1NBOA 4YROA 5CA0A 3WAJA 3ZS8A 1YS4A 1C8LA 1J8MF 1DJOA 2GDJA 1ZJZA 3DLCA 4R3WA 4ZT7A 3ZKWA 2JIOA 4I55A 2WFZA 1CQZA 3A1WA 2B3TA 4O0LA 4E33A 4EQZA 2BL4A 3OM1A 3EFBA 3ZWOA 3ETGA 1IBCA 1EUCA 2I9PA 1W48A 1NFQA 3AO0B 3OBBA 5KSPA 3AR2A 3D81A 1IRXA 1AGNA 4GI3A 1YFLA 2YV1A 5IK2D 5KSZA 5CFQA 1F0NA 1ECLA 2PTHA 4N03A 1A8HA 1QH1A 4B31A 4BZXA 1B14A 2OGWA 3RPEA 2Z8YA 2ATXA 3DFUA 3VJKA 4E46A 2HO5A 2ZB4A 3N3AC 1MG0A 2WIKA 3AB7A 5EIEA 1WV1A 4K5QA 3CN9A 5JVDA 4H15A 3LPDA 3CLSC 3HY3A 1QGOA 3QVGB 4AJLA 2YWXA 5DP2A 2YHAA 3DULA 5KJCA 2HD4A 2H7CA 1BHSA 1XT6A 3NLLA 3DGFC 2OQRA 3ORSA 5D8DA 2BJHA 1B8NA 4HS4A 1VJRA 1HDCA 1WNTA 2INGX 1ILEA 3WTBA 4PVDA 4ZANA 2R6R1 3EFOB 4MVJP 4NAVA 3OZFA 2P5UA 2I62A 3V4PB 4YIHA 3Q8XB 3S5JA 1CX9B 1XLTA 2QR3A 2XVMA 4M7WA 1W2HA 5DXJA 2AOXA 3BL5A 1QVZA 3LOUA 1QM5A 4DE5A 1XMOB 3ABSB 3H8WA 4HX2A 2OA0A 2QVLA 5A4JA 5JASA 2UZ1B 1U8TA 3FYUA 3PUJA 2L42A 3QQPA 1WQ3A 4YAGA 2OBYA 1EPUA 3T5GA 4FGJA 1NW8A 4Y1RA 1FJGB 3IB3A 1XN4A 3RADC 2JNWA 3TAHA 3C6KA 5FF9A 3TUJC 3QUQA 2ZUSA 1XXHE 4XQCA 2IL1A 2B4AA 5B57C 4R1OA 4IH4A 4FHGA 1T3SA 1T8YA 1GNTA 3I4LA 4NPHA 1ZVMA 4S1TA 1QH8A 1UMBB 3BHMA 1YVUA 3R1IA 2DP4E 4J1NA 1G0OA 4W9NA 1MB2A 4M98A 1II9A 1DTEA 3HJAA 4PRZA 5EL0A 3C7DB 1PR0A 1V1RA 4PN7A 1FY2A 5JADA 1J9GA 4U7FA 1SWVA 2F00A 4YWHA 2HN9A 3GH1A 2P9YA 4N9WA 4G01B 4HN4B 2EX0A 4BMSA 3EGXA 3HKCA 2P1RA 3E3NA 2CLHB 2GHIA 3L4BC 2C4WA 4HFMA 4OFXA 2VDOB 2F9LA 3KVYA 3K0FB 2GD0A 1V3VA 3H5AA 2O9JA 3AEXA 3NHPA 1NW6A 3C48A 3MLAA 4Q3OA 3RC9A 3CKLA 3WFIA 4TSFA 5TRTA 4C1NA 2A5JA 5FKJA 5ICMA 4FZ3A 3MJ4A 2H2HA 5DVZA 4KXXA 1JHOA 3RGWS 2O8FA 1IZ0A 1LSSA 1LNSA 5LLTA 1D04A 4Z5XA 5ITZB 4DEYA 5CFPA 3P2JA 4NBSA 3TR5A 1X13A 3OECA 4GO1A 2JGIA 4PPNA 1LLDA 4IIVA 1I2AA 5AJZA 3IQIX 4Q19A 3TLYA 3ZU5A 5A7FA 4ABTA 1EP1B 2E4ZA 2ZSBA 3F7OA 4MVJA 3T52A 3T3GA 3WSTA 3ZV4A 4DMGA 5LYJB 4ZXPA 1UC5B 4RY2A 4JUAA 2PYDA 1KEZA 4RD6A 1IJBA 1QP8A 5DNAA 3W5BA 3GAZA 4DV4B 4OHYA 2MINA 3LFHA 1RAIA 4WV3A 1HC7A 3BK1A 3IX7A 2DBQA 2G9VA 4PANA 2O8DB 1RSZA 1E4VA 1YOBA 2OHIA 3T6KA 3PC6A 5JQGB 3THXB 4B3TB 3HBJA 5CU7A 4TKMA 1IYZA 3T3IA 2QTHA 2A0YA 1DJQA 4GQIA 4KK3A 1KAOA 2X1HA 3ROKA 2N9UA 1KF0A 1NG1A 3K0EA 4QUJA 4A73A 4F3KA 4WUTA 4DUZB 4F3CA 5AHWA 3SE7A 1BX3A 3M6FA 2I87A 4N9QA 1L4NA 3GC6A 4PZ0A 4Z9YA 2R00C 1EFTA 3HDVA 5SY4A 3TLMA 1NONA 5IXSA 4OOEA 2YWGA 4DLUA 4K9PA 3GDGA 3KELA 4CN8A 2O8EB 4LF6B 3C5EA 2HSDA 1KJIA 4Q1CA 3ZDCA 4PZYA 4A8JC 4KXUA 4MZDA 1TLTA 4R8KA 4ATNA 1P74A 4DR6B 1OBHA 2BE7A 3X1YA 2I3DA 2BHLA 1CEQA 1C50A 5AXBA 4KN6A 3I62A 1ORTA 3B6ZA 3C3JA 4BZPA 4EIWA 3WL3A 4B3JA 1LNQA 5KNCD 1ZINA 5A3VA 2VP3A 2XKBA 3N7AA 1S9DA 2H4ZA 5KAPA 3BK2A 4TQUS 5AIAA 5JAPA 4OHXA 3VR4H 3ECAA 3A3KA 1WX1A 1DDOA 1I7SB 2NVOA 4BGUA 2Z4RA 4RBNA 3IEUA 1PYOA 1D7OA 3DDWA 1H2FA 1KVRA 1OXUA 3LE8A 4B43A 4BMYA 1I2ZA 5JMTA 4QX6A 3BWVA 1X7ZB 2BMFA 3ND8A 4OOFA 1QKJA 2AN5A 4LFAB 5KTSA 4NENB 3NH6A 4UHJA 4YIKA 3VR2A 3CRMA 3WLEA 3OKCA 3GLSA 4E6PA 3PHIA 1KBZA 1E2IA 3PRKE 1ZW1A 5LQDA 4U2GA 1K7EB 1U1GA 1XD2B 5BPHA 1HPLA 3P9QA 5C18A 1SOVA 3RANA 2JGKA 3JQGB 4GU5A 4TLDA 3L3BA 4RNDB 3F9IA 3ET4A 3AI3A 4HH4A 3G2IA 4XX0B 1W19A 2RGXA 4WGGA 4CM8A 3O92A 5GQSA 4CF6A 2OQIA 4P38A 2YBEA 3TGWA 5B1IA 3RH0A 3ISVA 1KAQA 2HZ7A 5A4MS 3KHTA 4QDOA 4BV3A 1MJHA 4HLQB 2LKCA 1Z35A 3SYMA 1CC1S 4L02A 2HF7A 5EJAA 4OHZA 4DM4A 1O58A 3AYZB 5KQRA 1EX9A 5DGCA 4ESOA 3CB4A 2WFLA 4ZI5A 4MYUA 1AHNA 1C8BA 1RRPA 4PQGA 5CNJA 4JN6B 4Y0NA 1WLYA 2YVLA 1CY2A 4CIWA 5KAMA 3E53A 4B82A 4RIHA 1Z7BA 1ZMXA 4TSFD 1QOZA 5E7MA 2CHVA 1MENA 2NSLA 5BN5B 4N0EA 4E21A 1BMDA 1X7WB 2JKZA 5B58T 5KCZA 1YC5A 5LQUA 2YFKA 3K8YA 3J7TA 4CM9A 1W5TA 5D1NA 5IEJA 4IF4A 3EWIA 1JWAB 2VCHA 4P3KA 4YJGA 3TQTA 2ZXUA 1ECBA 3ZGYA 1DIGA 3HE3A 3TQQA 3VU9B 4CMGA 4DXHA 4TKVA 3GUUA 2WWYA 2F55A 1ZXBA 3VZSA 2CT8A 3QKUA 1EAYA 5LQCA 1YS2X 1IQ0A 3V1NA 3NDBB 3AXSA 5C5EA 4DLVA 4H1VA 1FC0A 4GX0A 3BD8A 4Z9AA 3D8NA 5FA8A 4DCMA 2ZIGA 3O7MA 4CHTA 2FJUA 3PT9A 4LGVA 4W6QA 4PGMA 2ZPTX 4I4LA 4IGFA 3NOXA 1JECA 2A3RA 3CA8A 1G3QA 2FN8A 1O97D 3LSTA 3NTRA 4LUCA 5JWHA 2BGMA 3HJCA 4IP0A 3AV3A 2FR0A 2VJQA 1E99A 2GZ2A 3MRVA 4ARSA 5B5SA 1LF0A 4V1CB 2XCRB 3LUFA 2DPHA 1DFIA 2RFLA 4G26A 4LC0A 3ZWNA 2WT9A 1GLNA 2PAAA 3UIEA 3WYDA 2BFBA 4KYVA 3I76A 3U49A 3CUWA 4JJEA 3CG4A 1BTOA 5IKOA 5GP1A 5BV1A 1JKJA 3MWYW 1DKUA 2YC4C 1YSCA 3GVCA 3WLQA 1A9ZA 2ENUA 2G88A 2X22A 3IOBA 2QRKA 3Q87B 4D6YA 2CMFA 1VLMA 3SYRA 3N39C 4O02B 4EECA 2NXEA 4ALLA 5DN6D 2OOKA 3PF8A 1A4XA 1IJEA 1Y34E 3LG2A 1PKXA 3KKNA 2E18A 1PS8A 4QQNA 5LA6F 1KIMA 2J6HA 4TS9A 4BATA 4CV0A 1GM5A 2FGJA 3PUXA 3VI3B 2C78A 2P9FA 3V7FA 5FTMA 4GG1A 1VLZA 5AKZA 1YS6A 3HYCA 3KT6A 1YK0A 3FVRA 4LZAA 3IAEA 4BEWA 3K70D 2P6RA 3PE4A 5FPPA 4KO4S 1QAOA 3EOAI 3KE8A 1DNPA 1KXJA 4YAEA 1EVIA 4Q6WA 4G4IA 4LF8B 3PPVA 1NDHA 2QM3A 1D2RA 3IMEA 4TQGA 5AICA 2GLUA 4B4WA 4LNHA 4Q18A 3DMGA 3J81A 2P68A 2HL6A 2HLNA 2IP2A 1HL3A 2BHRA 3CLKA 3OPXA 3QWHA 4RENA 4XCVA 5CXQA 3JQQA 2B4KA 3R8FA 3AYXB 1US8B 4X6YA 4PZ9A 2GETA 1RKBA 3TTVA 3D4BA 4JJKA 1ZJ6A 4TMWA 1A4IA 3PXGA 2HRCA 2NU7B 5BW5A 1WIWA 1V11B 2YR0A 3GVXA 3GP3A 3Q4GA 5HZKA 5LPNA 1NF9A 1P2UA 3ZDDA 3FSEA 1QHHA 2GBLA 1DJNA 1A5TA 3MIIA 3PV0A 4HGYA 4A0RA 4F3YA 1ORIA 4KIFA 2WWVD 4P4SA 5SICE 3PNLA 1QF9A 1UC9A 2Q29A 1GR0A 3HZHA 3NBXX 4QTYA 3SS8A 3LLUA 2WW8A 4GKVA 4CLEA 2GPJA 3GCZA 1ONBA 2ZJOA 5A3RA 2FUG1 1N9GB 1QFZA 2JCBA 2P9ZA 1Z4QA 2HMAA 3F3YA 5FBLB 1SA0B 4L4ZA 5ITSA 4Q3NA 3EPJA 3UUWA 4F2DA 2XT9A 1YA6A 2FMUA 3QENA 1R6VA 1TQ4A 3R7DA 1JSZA 3AM4A 3GRZA 4L8LA 1DIBA 2B25A 5A4IS 1P0MA 3BSFA 4G1EB 2D0DA 4UW9A 1U2EA 1TLFA 2AG0A 2ZJBA 3DVAB 3MGCA 1ESCA 4LECA 4LJ4A 2JIDA 3ZY3A 4BMDA 1G7TA 4D2IA 4P83A 2PS1A 2EKDA 4UXJA 1LXCA 3O2NA 4LHSA 3ZV7A 3KD3A 4M8LA 4N3GA 5JH7F 5MHTA 1CXZA 1V9CA 2PNJA 3B20A 4CM9D 4GGOA 2BLLA 4EJFA 4CLXA 4BFSA 2EG5A 1EWRA 4TUYB 4XVRA 2P2ZA 2OD7A 4IUCS 2VJAA 1SCIA 3DT8A 1T2CA 4BAGA 1B6SA 1Y6FA 2QYSA 2ZXFA 1T8RA 4JC4A 3TW6A 4MVCA 3QSYA 1YB4A 4O4HA 5AM2A 5MDHA 3O31A 3PT5A 3A1VA 1AKQA 3OT4A 3T5MA 3TMYA 2VVTA 3L0YA 4F4HA 1BQ3A 3G0CA 4HAWA 5J1SB 4BQIA 3AFOA 4MMYB 4B3GA 3BXGA 3P0FA 2Z5GA 2NNWB 2F64A 3SC3A 4HEJA 1YIDA 2H1LA 4UOQA 4FIZA 1LBEA 2XVAA 1EZZA 3LGAA 4ZZ0A 1CZHA 4U9HS 5JNUA 4MJLA 1SHLA 4H7FA 3SEFA 5A2QA 4CL0A 3WHIA 1EYZA 4NMMA 3PX2A 4EVRA 2AOWA 4UMEA 5FUMA 4OG2A 3LCVB 4O4JA 1GVNB 2QZZA 2FZEA 3H2KA 1HDIA 4QSHA 5ICCA 3W7AA 4QC2A 2C98A 1X7DA 3B6EA 4NZNA 4BB5A 4DRXA 4XTCS 1OIWA 2QE7A 2QJOA 3LW7A 1AKMA 4FINA 2VUTA 2ROQA 4JITA 5ES4B 2QZPA 1G20B 4DUYB 4L8FA 3BXFA 4J76A 4IQ8A 4HRVA 2IZ1A 1PNVA 4HKTA 5BUZA 2ZRIA 1NN0A 1Q6ZA 1P0QA 1VYHA 2FPLA 3A9UA 4HUQB 4X7BA 1YNSA 3SKYA 4MW9A 1T0IA 4EMBA 1QP4A 1GRNA 4OFBA 2FNAA 3WG9A 4P2GA 3I2IA 3IPYA 1VJTA 4P1ZA 4XLZA 2WM3A 2YFYA 3DJYA 2I99A 3K32A 3P9SA 4H2DA 4YP7A 3OCZA 5ALVA 3I04A 4ZEXA 5HIAA 3ZDBA 3A6LA 1JU4A 2QAGC 3N28A 2CW5A 4G24A 2PEYA 1Z16A 1RZ3A 2MSDB 3WRYA 3EW7A 5JU6A 1BYUA 1KOFA 2E5FA 1R66A 2AQIA 2O1WA 3TD6A 4WEOA 4CKBB 2JIRA 1SCQA 2DBZA 1PYDA 3H1EA 5LZ4A 4OL0A 4CCYB 4JWKA 4UAJA 5IYZF 3SFTA 4RPIA 4JEIA 4YMIA 1NASA 4MTCA 2PU5A 5BOSB 1HQDA 1WU7A 2FUEA 2WINI 3G9QA 4PBSA 2OC4A 3HJBA 4JX8A 3LSYA 3N0WA 4JU8A 1GA1A 3WQHA 3RJMA 4C22A 3BDIA 2PQMA 1HI9A 1VXRA 2UVDA 3FYCA 2WLSA 3BFXA 3OJWA 5IBRA 1EE1A 5CDFA 1X80B 2QVXX 3CTPA 4Y18A 1BNCA 5D5HA 3R9XB 3GEHA 1GQSA 2C4UA 1M2FA 1XQ6A 4LKOA 4JLUA 1N6NA 1Y6ZA 1JEJA 3VI4B 4Q48A 3V2UA 1O95A 1SCUA 1MH9A 2EDAA 9MHTA 2ECOA 1E2EA 3CPEA 6NULA 1DIHA 4E0BA 3DTNA 4LRWA 1OA0A 2O3RA 1I2CA 2Q5LA 3KVOA 4MWEA 5MFZA 3O1LA 3X1WA 5IH7A 4O3MA 3FMGA 2O2ZA 2ZIWB 1G8YA 1EDZA 1VM6A 3QLEA 2WABA 3PCRB 2W70A 4MWDA 1QIEA 4M37A 3M89A 2O06A 2C4MA 3A9CA 1KWGA 3WLSA 1AXRA 1O5TA 2EC5A 3BD9A 5FOTA 4Z2YA 2H4HA 3S0JA 3VAAA 4BFYA 4C7XA 1UH5A 3I8OA 1Y80A 2PQ2A 1GZ4A 1BMFA 3C3MA 3OEED 3PPYA 3IMKA 4H60A 2AFRA 2FZKA 4YGXB 1V5GA 2PKRA 4IQ4A 2YFHA 4YX9A 4OP2A 1NJSA 2J5XA 4B7AA 5BW8A 4GYKA 3H75A 4NNJA 5K01A 5EI5A 3BE5A 1B26A 3KUDA 1ZHOA 3K0CA 2E2WA 3LCMA 3K35A 3VOTA 2KBEA 1U1DA 1N5MA 2GO7A 2WUVA 4EATA 5AW4A 1E3IA 4K0RA 1E1QD 3FXAA 4DN6A 3DCNA 1DBWA 4F93B 1GGEA 1MDBA 1UJBA 4DARA 3FCXA 4LOIA 3LGXA 5CLHA 3NJRA 3ADPA 3RS0A 4DA4A 2IS4A 2OBMA 4ZVLA 1UMCB 4M9CA 3P9KA 3BIFA 1GU7A 4UZFA 1JNXX 3RFFA 1YZYA 2FPRA 4WOKA 3U17A 5J2TF 1FTGA 1JW9B 1BDMA 1D0VA 3GPBA 4NEGA 1PKEA 2G08A 1U3UA 3BZWA 3PQEA 1N7GA 1L4FA 1NXVA 1XBTA 2OYSA 3BDVA 3M49A 3PQFA 2GAFA 4Y9DA 5CH8A 2ZRAA 4X93A 3G89A 1XZFA 1WUHS 1UADA 3GNQA 4EY7A 2P5TB 2QNIA 5BSKA 5H4HA 1UZUA 3QNUA 1JDVA 1YRYE 5FDFA 1T5LA 4PAGA 3D6HA 4GMFA 5DT2A 1A5ZA 3SR0A 2QE7D 1TFRA 1QXSA 3C24A 4RF2A 2XJ4A 5KYUA 5K0CA 2JJ8A 1NXOA 2XOKA 2XQIA 2QVYX 3NC1C 3KJGA 3QY9A 3WNQA 2A9PA 4YMLA 2C7QA 4AKTA 2NQTA 1NOJA 1GP2A 2I3BA 4D7AA 1WR8A 3FMOB 3RAJA 2GYWA 4I3HA 3CPHA 4GDMA 4RH1A 4CPDA 4DNQA 4OHRA 3G9UA 5JNVA 3ZY5A 3D4NA 4EYSA 1JQAA 3L1KA 3EF1A 2DQYA 3E18A 1M8FA 4DLAA 4EHJA 4MYDA 1JWLA 3EGCA 1NUHA 4R5MA 2VHWA 2JD1A 2WIJA 3DW3X 4RZ2A 1T3HA 3R3HA 4L9AA 3W7VA 4PFSA 3V42A 5CA1F 5CVUA 3AF5A 1N7HA 2GA8A 3D5TA 3GT4A 5F51A 1ADCA 1FU4A 2D8MA 3LNTA 3ZWWA 3T7SA 2GBPA 4IWNA 1U9ZA 1WXQA 3EG5A 4KYUA 4QOGA 1QORA 2AR0A 1EK0A 4BJ1A 3P0JA 4UUNA 5A5DA 2W4IA 4KR6A 3CF0A 2E48A 3Q2OA 2Q3BA 4A6XA 3HNPA 1XAHA 4OHBA 2EQ5A 3WY9A 3UJBA 1A9RA 2WHPB 2BFPA 3INRA 2FN9A 4KE7A 4LZZA 3FRHA 1LI4A 1UPBA 3LT0A 2C5HA 4XIIA 5BYKA 3D4IA 2J46A 1B1CA 1EESA 2H3EA 1Y8ZA 1OI4A 1IN8A 4AFNA 1CDDA 1Z29A 1PQ4A 2AXEA 2V59A 4V0QA 2C57A 1O95D 3QNWA 4DDUA 1TF2A 4OU4A 1U11A 5DHTA 4DREA 3NM5A 4RGYA 3RHZA 1HEIA 5EKXA 2J5RA 4ARCA 3KOWA 2QVGA 4MV8A 1NYLA 3UMFA 2C97A 3OJ0A 3VYSB 4PNEA 1IM2A 3TZ6A 1PLLA 5A6VA 3OP4A 5CCDA 5FT9A 4HUJA 5E7JA 3ZDQA 1M2OB 5KPJA 3K9CA 1DCKA 3GLGB 1AUOA 1D2EA 4WY5A 2C29D 3VBEA 4B6JA 4DW8A 2R8YA 1N4AA 5D87A 5BRNA 1J1ZA 1H2WA 1Q6YA 1J9ZA 3CUEF 3N2IA 4F46A 1JPJA 2JCGA 2X0FA 2YINC 4DQVA 1FP1D 2QPLA 3GMDA 1TM3E 3N53A 9GPBA 3V1MA 4XX1A 4WKNA 1WSWA 3QPDA 2LPMA 2GJ8A 2P3QA 3EH2A 5G0TA 2G1UA 1FMFA 2ODEA 1QYRA 4Q1VA 4KGXA 4XCXA 2VWQA 3ICEA 1R4AA 3JYPA 3V1KA 3B36A 3G49A 1N2EA 2QMYA 5ECYA 3TGLA 1AZSC 3ASYA 3SXUB 2UXCB 3AW9A 1GJRA 5K0FA 2FPGA 1Z07A 2J3KA 3LHIA 3Q11A 5CIWA 3R8XA 1ONSA 2DE0X 4TV9A 2HEGA 2ZVPX 3NANA 4E15A 4OLAA 1JFFB 3G2NA 1VLHA 4B3SB 2W98A 4RVFA 4YI3A 2DSTA 1ZCZA 2VTEA 2VWPA 3HI6A 4O29A 5AQEA 4D1YA 3UH0A 3VC3A 1X2BA 3BGIA 2IV3A 1XZAA 2FHSA 4P3YA 1RWKA 2HHLA 2XCOA 3IP1A 1GUYA 2HJRA 3R6TA 3ZBPA 1EVEA 3ETDA 4FYYA 4BWYA 4XVHA 3VXKA 3HN2A 4L4YA 1ZHFA 1HEYA 4ZHSA 2WU4A 1EUZA 1EFLA 1UFVA 3G85A 1GPDG 1FDOA 4PGHA 3RHTA 3RJZA 4IHJF 5B6JA 5LWQA 4FFMA 1YJAA 2NUAB 3B1KA 5KWVA 4PCVA 3BMCA 3HRIA 4J6FA 1N6OA 4KXVA 4NV3A 4UATA 3KTOA 3ORYA 1PV2A 3N75A 1TAGA 2B21A 4URWR 4AURA 1Z8FA 3P20A 2PH7A 2JH8A 3VJMA 1XTIA 5GINE 2HV8A 4LC1A 3SZGA 1XRRA 2ZJ8A 1OROA 4BNUA 4RM2A 4M9SA 3BTOA 1E6UA 3WGOA 3GJ8A 2QRGA 1E1YA 1ZGAA 4IDHA 4RVGA 4Y98A 4Q12A 5H3CA 2QN3A 1T6ZA 4MLDA 1Y3HA 2L82A 2QHXA 3O3CA 3H97A 3I9V1 1GN8A 3RUFA 2MT9A 4BRSA 2X0RA 1BWPA 2QIOA 2WJ3A 3MTEA 2H1WA 3O0DA 1OV6A 1F2UA 1T5TA 5FBWB 1M0TA 3U81A 4GH5A 1B41A 1O6CA 5GVSA 2ZI3A 3QELB 4IDBA 3DOFA 2BMWA 1Z4JA 4QECA 1MCZA 1KDRA 2BEWA 3AEUB 3ZEIA 3M6UA 3LZ6A 3KG2A 5J2UB 3SIWA 2ZB3A 1U7PA 1ANKA 5EHQA 4Z0NA 1TVCA 2OC9A 1YR9A 5J4YA 1H1TA 3ORRA 1LBTA 5KJFA 4XARA 4ZQFA 1P2DA 2WZDA 4BNYA 3QP9A 4F9FA 4LHEA 1JDJA 4RTSA 2DERA 1KBOA 1P31A 2VT7A 3HABA 3KDSE 3KZVA 1UEXC 3LLMA 3TLGB 3SKVA 3NP9A 3SF8B 1MBZA 2L0XA 3FPKA 1RFGE 3NAGA 2I6UA 3F74A 4NBRA 5JYDA 4OA8A 3FKQA 1QIJA 4MR8A 4F4FA 4OK5A 1FRNA 1XLWA 1TM1E 4O6VA 4ZEMA 4KFSA 1E77A 2BCGY 2BKXA 2XCLA 1Q0RA 1TX4B 3HCFA 3M83A 3VC7A 1BEUB 3NTUA 3O8DA 5LB4A 1SVSA 3EXIB 5KSWB 2AMYA 3CGGA 4JJ6A 4EI8A 2ZIZA 1NRWA 3KXIA 5F5XA 1QO9A 3W78A 5HUQA 2OFOA 2ZULA 3KS9A 1ULTA 2XYVA 2M98A 5CVTA 1DO0A 5EVJA 4RGQA 2NU9B 1DAGA 1LLFA 1PEDA 4GZLA 5KWIA 3I4CA 2H2WA 2ISSD 4KRXA 3E48A 5JR3A 2ONCA 2KW5A 4QATA 5C3MA 2XMSA 3VDNB 1B0ZA 3V6MA 2QJWA 1ACMA 1D5CA 1KC3A 1OT5A 4B32A 2AE1A 3QWBA 1ZR4A 1I6WA 4JVNA 1DCTA 3JCZA 1P7WA 1CHDA 3RKSA 1GPLA 1MHPA 4FWTA 3B82A 1Z5ZA 2JGJA 2YMMA 5AKJA 2MSKA 2ZCUA 2J3LA 5L3QA 2D0IA 3FHCB 3WSWA 1RE1A 2AWNA 3HWRA 4B7ZA 1F3LA 1N6IA 2FUG6 3C7CB 3W77A 4AS3A 1DIAA 2NVWA 4KITB 5JXIA 2JLZA 5G4KA 5TVKA 3BEOA 3QHPA 3SG0A 4LXIA 4P0TA 4ZQGA 3WLFA 1MC4A 2OCLA 2PL3A 5IM4F 3MK31 1KO7A 4IY1A 4AVYA 1T9DA 4AWXA 5P21A 4AICA 3KTDA 4YUXA 5FA6A 1QRAA 2G76A 5K0BA 2IPAB 2E6UX 3KKPA 4F3RA 4EF6A 1UXKA 3IDSA 3V6LA 1VPWA 1XK6A 3V34A 2PD6A 3GG9A 5FULA 4C0LA 1DWOA 1KP2A 4Q9NA 4EJSC 3TCNA 3FJYA 1E5VA 4EKGA 4FB4A 5K51A 2PK3A 1IOZA 2B30A 1EBFA 3CKKA 4YREA 5H83A 4EB8A 2FLWA 5CJPA 3JATA 5CDSA 3V8QA 1UBCA 4G25A 3ABRB 2AN1A 2QTCA 3F5MA 3QG5A 4XVCA 1JHRA 4OMUA 5HBGA 2PGJA 4BN0A 1G17A 2NYVA 5IJ9A 1A2KC 3T3HA 3TNFA 3DZFA 4RKRA 5A3SA 4B35A 3AHJA 5B3JC 4S1VA 3IHWA 1FBTA 1HG1A 1XEWX 3EGIA 2IXBA 2ZJFA 3ZGNA 4AJ1A 1AMOA 3U16A 1TT5B 2B5VA 2WVAA 1UBMS 3N8GA 5FXMA 5DWQA 3DHVA 1A95A 4D4KA 2GX6A 3HXTA 4KI7A 2BI7A 2X2EA 4X71A 4NONA 4X24A 1H2ZA 1TVMA 5C53B 1ETHA 3DE5X 1XO1A 1Q0ZA 3F6BX 3QUBA 4BO7A 1NLMA 3SZUA 4LJYA 3OJLA 1QG6A 4LXTA 4JHXA 3ZVKA 2R1VB 4RD1A 4B5LA 2UUOA 1RQ2A 1X14A 3OQBA 3T12A 4QDTA 3ZZMA 3JZIA 3PVZA 1O8CA 4FT4A 2AKEA 2VWHA 3L18A 2AC4A 5FWAA 1TT7A 5D86A 2WPNA 3G02A 1CZUA 1HF3A 2DT5A 4J1TA 1YE8A 4Z8YA 3GLIE 4R6WA 1ZYUA 1RJWA 2J0VA 3GCGA 3ISTA 3K09C 3Q5GA 2NTNA 4MJ7A 1U4SA 2FFJA 4ZC1A 1FSSA 1W25A 4JI1B 3IS3A 4GVPA 3EEFA 4H77A 1G59A 2HKIA 1SUEA 1WPRA 2FJPA 3AF4A 4P5DA 2DLDA 2A84A 3KJNA 4RD3A 5HIKA 3IHKA 5JDIC 2NZJA 3TRDA 5I5EA 1TU0A 2YXBA 1CR6A 1SHKA 1SU4A 1KETA 1S3GA 2QTRA 2BP7B 3L9WA 4PYLA 5HF8A 2CD7A 3HCCA 2LR0A 3F6CA 3VAZA 2DUWA 2ZUFA 1DDIA 1S89A 2VS1A 4KPYA 2RGUA 4OHPA 4XGQA 2C4KA 3IDFA 2QRUA 3E7WA 5CB6A 4JODA 3MMNA 4CF5A 2HPZA 1IIRA 5C51B 3TNYA 3AVOA 4DZZA 2PGOA 3E8MA 4PC1A 4K9OA 3LM8A 3LX5A 4C0HA 4MGIR 3VPGA 1DAHA 2WTNA 4GF5A 1NKVA 1U2TA 4P7BA 4ZMRA 2OLJA 3MOIA 1OF1A 2WJPA 3UN1A 4LYEA 2O8NA 3RUDA 3C43A 1EUDA 5IXJA 5BNWA 1PTJA 1OLXA 4DIKA 4BXOA 4H08A 1RXWA 2F67A 3JR7A 3BMNB 1KBQA 4S1NA 1KARA 2IIBA 5DWVA 5A0TA 2B1IA 2HMWA 4XB2A 1Z36A 3LQFA 1D6SA 2ECQA 2X4DA 1H2RS 1EP2B 1YR2A 5EZYF 2D0OB 2FSGA 1BXRA 2H1SA 5FOWA 4XOIA 3U7RA 4REOA 2C5FA 3FCSB 3FR7A 4DMUB 13PKA 1P1CA 4Y7DA 1OTHA 3ZX4A 4ER0A 1JJAA 2I4MA 3D64A 3F7NA 4FGLA 5EXPA 3GJ6A 1WKCA 2I9KA 5IJ0B 2Q9CA 4FDMA 1JBKA 4J8PA 2PZKA 4COKA 5KYGA 1JPNA 3IEPA 1PFUA 5JJBA 4AXXA 3WAGA 1HMYA 5GADl 4Q4AA 1MXFA 5FQOA 3F98A 3BRWA 2XWJI 2HWWA 1SXIA 3TWOA 2C2XA 2PX6A 1LDEA 3GLFA 1ADFA 2QP3A 1LPBB 1UODA 2FPOA 2L2QA 3BFKA 3LHKA 1QUFA 2IUFA 2VUIB 3CR7A 4IGAA 1WHTB 2VJKA 5TSDA 3ZZTA 5AI0A 2C3UA 4H6XA 4JYPA 3SM3A 5JNTA 2JVKA 7REQB 4P7FA 5DBEX 4ZAXA 2VL7A 3AJ8A 1R0CA 2XMBA 3CBQA 4MW7A 5A7HA 2OFWA 4WACA 4PG8A 2OPBA 3VHXA 4K46A 1NOIA 1C1XB 4IKEA 4C21A 3BE8A 3ZHVA 1SPBS 1E7RA 2NO6A 2QRMA 2VNHA 4UUMA 2XLCA 4Z0HO 3I6ZA 3MFQA 3PDHA 1P1IA 3I3OA 2A0XA 5AW5A 2ST1A 2V9ZA 3ZE1B 4YJFB 1DZ3A 4LXGA 1YDHA 3TZEA 4DIUA 3O2JA 2QQGA 4BVLA 1X0VA 3KXPA 1TYEB 1USGA 4FHZA 5CIYA 4HN2A 2ZYUX 4UUQA 1V1MB 1PJBA 3QOYA 4JLOA 5J63A 5BSGA 1YTUA 3EVBA 1XNGA 4TQAA 3E84A 3UA3A 4MR7B 2CHUA 4WXPA 2ANBA 3LY9A 5ALXA 2AJLI 4PAMA 5HOQA 4GOND 2ONKA 4G89A 3CRW1 3FHOA 1L4UA 2OP1A 3ZHYA 4F3NA 4BP3A 2Y6UA 1DRVA 2A5GA 1CBUA 4QUAA 1X8KA 4WNCA 1XZMA 2P7IA 4C03A 3M3PA 1DT3A 1YO6A 4MV1A 2PMDA 3D59A 4I5FA 4GMGA 2CZCA 3RSZA 4BAUA 3ICQB 3DTTA 1EX1A 4HGZA 3TN7A 1ZC4A 2GCGA 4OXNA 2GEVA 2FE1A 2BBSA 3R41A 5AW2A 3B8HA 2VAPA 2RK4A 4QXRA 5BWBA 3AQIA 2YS6A 4KXYA 4B7CA 1W2WB 1RRKA 2BJVA 2CBXA 3KUCA 4CFZA 4MUGA 4LGMA 2N47A 4J0DA 3W5IA 2APJA 1VB5A 4DVJA 1J99A 1J1IA 4Y6RA 3QOFA 3ANLA 4X0EA 1K9SA 4FJ1A 1WW3A 3UWKA 3QUAA 4PHTA 5D84A 2B78A 5UKDA 3ZHOA 1E4YA 2W0MA 4O4IA 1M7GA 5J59A 2KSQA 2H5JA 3K5IA 1P0FA 2QQ0A 1NXQA 1ZVQA 4MQFA 2PX4A 1MAWA 4LJRA 3BRCA 2GCOB 1CEXA 3ROGA 3P2MA 2VOEA 2XMCA 5JRJA 1KI2A 2V4UA 1YS9A 4Q93A 4YRAA 1A9OA 4F5ZA 1PRYA 4TTJA 2GZ1A 4KN8A 3GX1A 4TPKA 4ZTBA 1HT0A 4D4LA 5JCPA 5AKYA 4X8HA 1J22A 3AOEC 5EQFA 1NI4A 1C4KA 1TGYA 3H86A 3BWYA 1Z62A 3T0GA 3DS8A 2XDQB 3PQ8A 3JQFC 5BSMA 3IT2A 5TY0A 3EY9A 3QX8A 2DPXA 4MYRA 1C7IA 3AL3A 1GCAA 3SDZA 1W0CA 3TMAA 1W75A 5HXAA 2GJKA 1P7YA 2JBAA 4N3BA 4D9HA 2ZBQA 1SHUX 2NLOA 2ZUEA 3KXKA 1A98A 4BYMA 3GXBA 3KUKA 3W2GA 4CW7A 4ZALA 1AM4D 2GPNA 1T9HA 2VT3A 4KE9A 1U81A 2MTBA 5GONB 4U7DA 3T5AA 2WQ7A 2ZIXA 1WCXA 3O94A 4MI9A 4RF3A 1E9EA 2YRXA 3E9CA 1NNLA 3VDMA 4EO7A 3AY6A 1UANA 5BQXA 3PR2B 3QBDA 2X7JA 3Q2IA 1M2JA 4K1LA 4DV2B 3H8VA 3BRWD 5AOBA 2ZSJA 1JP7A 3HS3A 4EG5A 3FNGA 2IP1A 4WDRA 5DYGA 1DTWB 3MWFA 5DLEA 2GVNA 3KLNA 4CJXA 3PQ2A 4L6CA 2D06A 4LY3A 3BSYA 3GLHE 4M8IA 2LKDA 4P9NA 4BPRA 1U5CA 4HDSB 1YZUA 1ZK0A 2UVPB 4MZXA 1U8UA 1SOAA 4LMAA 3H9JA 1JG1A 1JJVA 2WSMA 3P19A 1FYFA 2PZFA 3DYVA 4WFIA 1BXKA 1YAJA 3ZE6A 4D41A 2VDWA 2CJXA 1VKZA 3D4OA 3AFIA 3T1OA 1M1YE 2QY6A 4FS3A 4A0GA 1JT2A 3DTVD 4GM0A 2X76A 5DNYB 2BN4A 4DR2B 1YFJA 1PFWA 1T4GA 1HTBA 2B1GA 3HL4A 1PSWA 4IQFA 2XCTB 1FSGA 4HDRA 2XSZA 1L5OA 4AROA 4GDFA 1J5EB 1JF8A 1YCFA 3PIRA 2O54A 2XV1A 1IK6A 3QITA 3SC2B 1T91A 4K9NA 5ANRB 3UFXA 1JGTA 3BXXA 3F8TA 1TKCA 3Q2KA 2E4XA 1V71A 2CNBA 2H31A 3DZHA 3GDHA 4IF6A 2WKRA 3HFRA 4KU4A 4PO9A 1TM2A 2YWFA 1GOTA 2EU8A 1K8QA 2ZR0A 1DJPA 2FMKA 2NO1A 3EOBI 1KIAA 3QU2A 4ZP1A 3AILA 1GIAA 1V3QE 2EFCB 3M5DA 3GPCA 2XZOA 2JARA 3N59A 2REBA 5CVCA 3QJ5A 1E6KA 1Y9JA 3DD5A 5IN4A 1K2WA 3WI7A 4H59A 3KO8A 4PPYA 1IULA 1Q3HA 3O2QB 1XAGA 3BUSA 4QXOA 4TMTA 5F5LA 5H02A 1HR0B 1D4OA 4OATA 3W79A 5FUXA 1U7OA 3OIVA 3A37A 5ED4A 1WXGA 2Q3JA 2YCBA 1G8MA 2HSEA 3LP5A 4J29A 4J3JA 1Z5NA 4X6LA 4AP5A 2PUJA 3CYFA 1CF4A 3OU6A 3RUCA 2P7HA 3FM9A 1F8UA 4RXMA 3I9V6 2YDYA 2XB4A 4QXQA 1DDGA 2JHGA 1DEKA 3OIGA 1A50B 4G9EA 4IWYA 2AWOA 4II7A 4G0OA 2QX7A 1WP4A 4JB3A 4PYMA 4QGBA 1HX7A 3EZ7A 1D9ZA 1P2FA 1CB7A 3A4NA 4FKBA 1KMQA 4DCUA 3DMPA 4K2HA 4FNMA 2YJTD 4KRGA 4HTFA 4CMBA 2NTJA 2QM7A 2WD7B 2BAGA 4ANFA 4AY3A 1KNQA 2ZB7A 4YJ2F 3B52X 2JFVA 1EM8B 4TWJA 5WRFA 1QYWA 3JD2A 2ZTLA 3PDIA 4ACBA 4E70A 3SWWA 2RJOA 4L85A 3IOCA 1C14A 1LQTA 1NYRA 2F3QA 1ZGZA 2VTKA 3G68A 3OCCA 1SXJB 2QX6A 2WYVA 4KXFB 1N8NA 3DL0A 4CV1A 5MGNA 4RTRA 4RDHA 1H8HA 4IGKA 1NZFA 2VZ8A 4Z4QA 4B3FX 1IB6A 2MOKA 4ZAYA 4U2EA 1WSDA 4R54A 1VB3A 4O33A 5K6AC 1JHVA 1XJCA 5ALZA 1E2DA 2OCAA 5AJXA 4WKBA 1QTNA 4YJKA 1G5HA 1UMDB 4B8WA 1YF3A 3U0VA 2OSVA 3HEMA 5L3ZA 3IALA 2R25B 3NUGA 3WYBA 4Q7EA 1C80A 2QLNA 1AUXA 3PC8C 3QVWA 1C9YA 1KQ3A 1TK2A 3BORA 3OFSA 2HK6A 1QTIA 4U39A 4CMIA 1KS9A 2WIAA 1A4RA 1RLOA 2RB4A 3GEGA 2B5OA 2GHQA 4AC9A 4IDEA 4EVSA 3PGJA 2OYRA 4UPEA 3ZVNA 1I3CA 3ANYB 3BWEA 1E6MA 4XLLA 2ZPUA 3K05A 3BIOA 3WZLA 4BYGA 2RGNA 1RZUA 2Y0DA 2RH9B 2E4UA 4DV5B 1PQYA 2XB2A 1T4CB 2AJDA 4FE7A 1JLLA 1RXCA 3VR0A 1TMGE 1EFUA 3MTDA 3GCWA 4WDQA 4MVJH 4NZYA 3Q3JB 1BIFA 3KYCA 3L6RA 4I1RA 5B1DA 1TJ3A 1YOVB 3ZTYA 4TL8A 2CDRA 2H0QA 2DG2A 3EBLA 3M5CA 1WZCA 1WF6A 5DPMA 5DYYA 4EPVA 4QGSA 2A5FA 1XHLA 2A33A 3WGTA 1ZOIA 1MH1A 4RY0A 4N82A 4PNHA 4F4IA 2OZLB 2WHRA 3S6JA 4KPUA 4Q00A 5A5VA 3TSWA 1F1BA 3VTZA 2G1AA 3RYHB 3GAAA 5JCJA 3T3DA 4HQRA 4R2WA 4GPIB 1GNVA 1ACLA 3PPXA 1WSAA 1T8UA 4HDMA 2XSZD 4JLWA 4OIFA 5DJ5A 5SZJA 3RC1A 3WX0A 1MRZA 3SC6A 1U94A 1YA4A 3JAKB 4C01A 4WCVA 5IF9A 2B8EA 1M75A 2FRXA 2I4RA 4PGAA 2PX5A 2WF7A 3TFQA 1VPLA 1JB9A 4XASA 5KYWB 2YW2A 1F4LA 1KJNA 4NQZA 2HTEA 3LBAA 1AOXA 1SULA 4AWAA 4O25A 4Q82A 4IIJA 1CUYA 1VE7A 3NYWA 2GDZA 1DUSA 1KSFX 1X86B 1D8AA 1ZMBA 3AZOA 3RNLA 3UJ8A 6REQA 2OXEA 1W1IA 3WKDA 3BE4A 4D25A 4HP8A 3P2OA 1P3DA 2GSWA 1G9SA 2VYNA 3GLIA 4HNTA 1HV8A 3NFYA 2VC2B 3VJLA 1FBNA 3GQVA 4JXKA 4EYQA 3ZW8A 1RHMA 4MNTA 2QJFA 1PHRA 3H0EA 5DASA 3ZWYA 1GILA 2EIXA 2BE9A 3CS3A 5D5PA 4ZRDA 4QG7A 2VH5R 4TTQA 3NTLA 4I3GA 2B1QA 4I4NA 3P2IA 4FPXA 4Q66C 1ZIDA 2GNAA 2YY5A 2NZYA 3AUJB 3PRJA 4CM4B 1A4UA 1FLDA 1AQLA 3L05A 1RAFA 4WLUA 1YBHA 2GN0A 1CY4A 3B9BA 4QFBA 2WK1A 3UUEA 5LD2B 2QD2A 2ZJ2A 3GGDA 3NT4A 3Q0TA 4EFMA 4YAOA 1AD2A 3JRXA 1D2HA 1KVQA 2H1HA 3JRWA 3JD1A 4JI3B 3GUCA 3U7QB 1L5MA 3USCS 5CBKA 2VJMB 3HY4A 3ZHTA 4BLQA 4RUKA 5KOHA 1BMTA 1JQJC 2DTDA 3B53X 4UEOA 1XAIA 3VV3A 5MF6A 3OQNA 2V5UA 3A58B 2WUEA 2Y67A 3PVSA 1RACA 1G2QA 1Z28A 4KACA 4E4TA 2H08A 1FX0B 1H8HD 3DKKA 2QXYA 1HTWA 2H17A 3LMKA 1ECPA 3R0QA 1E1RA 1HO3A 1G6Q1 2E9SA 5AM0A 1G3IA 3UWSA 2FRDC 5KYVA 4P8RA 2ZITA 1TF7A 4INPA 3U31A 1LBQA 3VNAA 3EXFB 3OM0A 1I51A 2Q0QA 3MCTA 2YXLA 2RJ3A 2WU1A 4NK4A 1VLVA 2R62A 4UPVA 3ZU2A 4L0DA 1W4BA 2BMDA 2W4QA 3WIBA 5BSTA 1KE1A 3PC2A 1ZNQO 2ZETA 2AZ4A 2Z4SA 3AUAA 2W00A 4QICA 3U19A 4NG4A 3T1VA 2D3TA 4JEMA 1FEZA 2O3QA 1WY7A 5B2ZA 1I6KA 3OCWA 1ISMA 2I34A 3IJPA 3ND5A 3ZZUA 1ZIXA 3JQ7A 1ID8A 1B3RA 4G0MA 5FLKA 1LC3A 5IAEA 2TS1A 3VH3A 1MJFA 2X5JO 2X8LA 4AO7A 3TW0A 5CD1A 2CL7X 1B0AA 1SKMA 2QTTA 3H1AA 2WT4A 1M6HA 1NJFA 2RGAA 1VOTA 4G4JA 4EY5A 5LNK1 3AI2A 3NB0A 1MC8A 3GJ7A 1M1UA 2O8BB 1XNHA 4PCLA 1QIIA 5E6SB 1QCCA 5A9SB 1ZUHA 1I2MA 3LXUX 3NC0C 3KJIA 1PUJA 4L75A 3PYLA 1WB6A 3QXJA 5CT8A 1YQEA 4BCBA 2PJRA 1QTRA 1N2GA 1ZICA 1Q3TA 1XZGA 1J0EA 3AUXA 3G9TA 1HFWA 4P35A 2GTIA 2ILVA 1KA9H 3PDCA 2PRSA 4FOPA 4BS9A 5D1HA 1LLUA 3B1WA 1WA5A 4J3FA 4RVOA 4Y9UA 3ILSA 1WHSA 1EZ1A 4ITUA 2Z6UA 4ARUA 3NG1A 4D9IA 1PDWA 1Q74A 2XPCA 3NHBA 2Q5HA 4XH9B 2G5PA 1LV7A 5BYJA 2R1ZA 3TRJA 2P2YA 5K4GA 1XVVA 1M2VA 3SBDA 5DKFA 3W05A 2BC9A 2ZRDA 1FNNA 3H2SA 1L7MA 1G8PA 2CXHA 2CNDA 2HOQA 2LIVA 2R68A 2WF5A 4L72A 4IM7A 5JMWA 1W36D 1HOXA 3DTYA 1H2YA 4RK6A 5FOSA 2Q21A 4F3TA 1GA4A 3Q6MA 3BCUA 1XQ9A 2FX5A 2FW7A 3BEDA 2UVQA 4RZQA 3AIIA 2VYND 5CM8B 3RUIA 3O1IC 4I50A 2HJSA 4U9UA 4ZYLA 3BJIC 2CNWA 4A9AA 3ENWA 5I7UA 3QX7A 5LMNB 1KJ9A 3EE6A 5EMKA 4NZ9A 1ZD5A 3CVUA 1OZGA 2ZSUA 2D5BA 3CLVA 5T7BA 3RJTA 4QEKA 1N3BA 1V3TA 2DC1A 2ZOSA 4H1TA 4UHFA 4UM5A 4FHFA 5I5GA 1H22A 5A6SA 3DCJA 4HV4A 1EK5A 1UDXA 3DW1X 4WX2B 2H8KA 3KFVA 4ZOLB 4RX1A 5KTKA 5DCWA 1E1NA 1FP2A 3F49S 2R11A 2AVNA 3OX4A 4WAUA 4A6EA 4YRKA 1VCOA 1NVVR 4I4TB 3TQIA 2JLCA 1S0UA 1JAXA 2D7JA 1UP4A 2JIMA 2OUKA 4O4LF 2JL1A 1UC8A 3D8RA 2ZWAA 5C9ZA 1KMMA 2VXBA 1E9RA 3UJCA 1AV7A 4A2CA 4DB2A 2RH8A 4ZWNA 4MP8A 4NJMA 2JGDB 2IZZA 2V0CA 3KPUA 2A0UA 2YVQA 2VHYA 3IQHX 1XOIA 1IONA 1NV9A 2VF4X 3O75A 2DUMA 1TZBA 4OUKX 1NUTA 1JBEA 1ODCA 1NDUA 1KMHA 3NM6B 2ATCA 5E9WA 1E2KA 1YTLA 1ZM4A 2QW1A 3K71B 2IZOA 2ZTUA 4XFDA 5FNVB 4GRIA 4MV6A 1ISJA 1CJKC 3O21A 3CLUD 4L76A 1CKEA 3RWBA 3V3KA 3MYYA 2FCAA 4PZEA 3UT0A 1K68A 4Q05A 1C30A 3OC6A 5JI2E 2ZU6A 1I5RA 4II2A 2ZBPA 3NOVA 1AHPA 4B75A 3U1BA 2EX4A 1QGDA 4QJIA 5IX8A 2QLFA 2HRBA 2X4LA 3BSSA 3SHOA 1QJ4A 2HJ9A 1X39A 1U7TA 4L8VA 3H8SA 1RIIA 4K1XA 5AVJA 2IQIA 2FWMX 2PN1A 4DV0B 2ADMA 1NRIA 1CUSA 3H2BA 1SUIA 2JRLA 3FUVA 4W1SA 3ERCA 2Q5OA 3GLHA 3AP3A 3G5TA 3F3MA 4RPLA 4C43A 1BYIA 3G2MA 3N58A 1MB0A 1PT5A 1NXWA 3QEKA 1OIXA 8OHMA 2Z2KA 5KDLA 1K27A 4QAQA 5F77A 2C2WA 1DKQA 3IB6A 3L93A 4DKXA 1F14A 4YP1A 4DSAA 4NU5A 1W1WA 4Q4HA 4JJGA 3H13A 3ZYZA 4B6FA 1E0JA 3IUQA 3UWOA 2I65A 2JH3A 2K2QB 2FKAA 4NZZA 2GPSA 3ORFA 4ILEA 3RVKA 4TTVA 1M1YA 4AB1A 2CEKA 4ROSA 5K03A 1GTZA 3GWGA 3NKVA 3CF6R 5J5AA 3HM2A 2H52A 4PHCA 5F4BA 5DSZA 4HDKA 4HYTA 3WBBA 3AI7A 2WMOB 3U6KA 3WHPA 2AN4A 2P9HA 2Q4RA 2BYTA 1M5TA 3QHAA 2YVKA 1G1MA 4MKFA 4DM7A 1XLTC 3OLVA 3QEAZ 5EWMA 1VDMA 4YONB 1LS1A 2QGNA 1ZEMA 2HPHA 5DBOA 1HL7A 2BJWA 5BRAA 1YD7A 1VHTA 3ZY4A 3FYUC 3OO1A 4HX9A 1QGED 1IXSB 1U5AA 2H4YA 2GF9A 3PNBA 4HB0A 4C6TA 2XHZA 3DOIA 5AM3A 4RZXA 2Z95A 5KZMB 1CUZA 1KQGA 3W2IA 1EX7A 1NSYA 3WRWA 1QWSA 5E6RB 2JJ2D 4HWRA 1T8SA 3RS3A 4ZQEA 3UGQA 1FXWF 1Q95A 5FWYA 3G2HA 1L3CA 5D3MB 1TU4A 2WU0A 3Q98A 4EHHA 5JROA 2IU4A 5FNVF 3MAGA 4HGQA 4EQ6A 4NFSA 1UJ4A 5JALA 4ISBA 1Y5RA 1PJLA 3O4HA 4QTXA 3X44A 2HTFA 2QSYA 3JQCA 2I33A 2NW6A 1PT9A 2C2HA 3KJQA 1QG2A 1XZJA 2WBLC 4W9NC 1JBQA 1SBZA 2PGAA 4TL7A 4YMGA 4K3UA 1T2AA 4M0UA 5I47A 3A31A 4FFDA 3PXUA 4V24A 3T4XA 5KTOA 1NR7A 2WWHA 1EAMA 2F8MA 2GT1A 4S3MA 3JV7A 3OF5A 1N5KA 1V39A 4QT4A 1RQXA 3AK4A 3CFYA 3K92A 5H3HA 5LWHA 4IVPA 4BUJA 1D1TA 1NJ1A 1D03A 3AEZA 3ELYA 4QSMA 1AJEA 4EI2A 4RA6A 4EG1A 1AK1A 1X1BA 3S55A 4ZDJA 1ZA1A 1Y7LA 2FWAA 4OBBA 4Q4DA 1VSUA 4BTEA 3THWA 4BMPB 3FPSA 3ZHUA 2NTYC 4IH1A 2FN4A 3V1YA 2YN0A 4EJ2A 1JYSA 1Y7HA 2P65A 4FZVA 4QQ8A 5CNMA 2O59A 1PG0A 2IUTA 5LYYA 1XNRB 4RFSA 3LVFO 3ZH2A 4NQRA 3HRKA 4CLRB 5JXGA 3HUUA 4ISCA 4RHYA 4TN5A 1VKNA 4X1KA 3ZGXA 4EW1A 3UVEA 1ULBA 2OXFA 2PKQP 3VAYA 1U98A 2HIGA 4M60A 5KQGA 2TMGA 1QNFA 3M6MD 1QQBA 1T2FA 3JAWA 4IDQA 4K9DA 4OV6B 4RPKA 2RBGA 3SFZA 1F6DA 1JH8A 1YB6A 4JBGA 5A04A 5KX5A 3FSGD 1UFOA 5CFZA 2IEBA 4U5XA 2PFKA 1R4MA 1I4DD 3CKYA 1KQPA 4Y3UA 1O97C 4LJKA 4NZPA 4WGFA 4YYZA 4Z9BA 4MVWA 2ZYIA 4ZU1X 1MRSA 1XZLA 4FBGA 5J3JA 2NUPA 1I6MA 3ZGVA 5IKEA 5IANA 3RR2A 3D2BA 1C0KA 3HKBB 2D4AA 3GGOA 3IQFA 2B6HA 4H0FA 3STVA 2IEAA 2WG1A 1JKXA 3DPIA 5AJTA 3PEFA 2B37A 2II6A 2EHJA 2YRFA 4GLLA 3IP3A 4L4UA 3LRPA 1P4SA 3B1FA 4I8IA 3R40A 4QJ5A 5GM1A 3NHWA 5IHXA 4YCLA 4K9MA 1BCRA 4QREA 1JEQA 2NTEA 3RSGA 3PR1A 1I4LD 1F51E 3OU7A 4X8LA 2JAHA 2UYYA 4XUGB 3E22A 4IMPA 1IHOA 3DOEA 1PHPA 5EUQB 3V4OA 3PUVA 2KB0A 4F8EA 5K3EA 2IYAA 3DVRX 2V7EA 3LDHA 3BD6A 4YV0A 5A1TA 1H85A 3ER8A 3HCEA 2ZJ6A 3V9AA 1M33A 4C1BA 4F1WA 1Y8RB 2TMDA 3IXMA 5JD6A 3KDPA 3K70C 3FJOA 5L40A 5KJ6A 2HYDA 2NZXA 4KBGA 4MEAA 5JSUA 2YZ7A 3KSZO 3QVKA 1C3XA 1GCUA 1RU3A 3HN7A 1H1LB 4OHFA 1C29B 4BCDA 1OREA 3GFPA 5HK9A 4FZ5A 4UM7A 2VDMB 4H7DA 1RFLA 1I33A 1CUBA 1IVYA 2ZYVX 1HLGA 4HAOA 2WSYB 4JWTA 2HX1A 5EUBA 4UNQA 3WJ2A 3SLRA 1Q92A 4HGRA 2XY4A 4L4RA 2ZWVA 4D5GA 3S7TA 3B3GA 4EGFA 5B3LA 3ZIAA 3DVLA 1KAGA 4FW8A 4PRLA 3PC4A 1GKKA 3Q5DA 3WLKX 1RJFA 5TPWB 3ACCA 3B48A 2P0EA 3V8NA 4YLYA 1E79A 1AZWA 3CW8X 1GQRA 3VGPA 4Z4FA 1USWA 4HNRA 1C1DA 4KMOA 1JU9A 3HBNA 5JYEA 5AK4A 1P4JA 4RYLA 5LUAA 1F8YA 3JTEA 3EWNA 3L7OA 5LBUA 5KVSA 4Y9SA 1G98A 5IMBA 4X84A 2XE6A 4MGZR 1XWIA 5L8VA 3CN7A 3ENKA 2C58A 1T0UA 4HMPA 2R97A 2PUVA 3DDCA 4RADA 1TMYA 4R2JA 1MO4A 3WQQA 3VDQA 1VL5A 2G4LA 5F3DA 1GVHA 3MLEA 4HWGA 4OLJA 4A8JB 4INJA 3WWEA 4GWKA 3D1JA 4GKBA 2ZSDA 1OASA 1IQUA 1KI8A 3BS4A 2GOYA 4JVOA 2FPIB 4HEHA 3SE0A 4DILA 1XPUA 4HQFA 4FN5A 2GARA 4BO3A 3H5OA 2OBBA 5E1OA 5DGDA 3ZEAA 4ENVA 4ARAA 1TVKA 5EQJB 4K3VA 2Y1LA 2BEVB 4FFBA 3PHHA 2AOTB 1E6LA 1X3LA 4AYTA 4FDTA 2CV2A 4IH9A 1KDZA 1KJJA 3GVHA 3ZOZA 4CHGA 4GVXA 1JFRA 5G02A 5T64A 1UPFA 1W85B 3NBKA 2GWHA 2HU2A 3VBCA 1L6RA 4FQ7A 1DWPA 3K2BA 2PL5A 3LQRA 3VHRA 5C80A 4Q3BA 3JTMA 5K6TA 1AKNA 2CXRA 2ZB8A 1QYDA 1CLEA 5A5GA 1N1EA 2D8AA 3W6OA 4AQ7A 2YYYA 5IFKA 4HB4A 1GL6A 2O14A 2WPDA 1QG0A 3JQ9A 4FUTA 2PR2A 3BOSA 3NT2A 3W1VA 3ZDFA 4F1KA 5CA0F 5F7JA 2FI1A 1SM4A 3UJ6A 4EWLA 1WW8A 4I55F 1AO0A 1QDUA 4IRXA 1OB5A 1YE3A 3PPIA 1Q77A 2J9ZB 4FYXA 2ETXA 1PCXA 4Z1OA 3IL2A 3OIDA 1LDYA 3NOQA 1XVAA 5IH3A 2Y1CA 1R27A 5DXAA 5EG5A 5J58A 4KAXA 3CM0A 5JQGA 2DRIA 3TZBA 3TVTA 4DQXA 2EEPA 4F96A 4BRZA 3B1VA 4Y0AA 4CU2A 1X8XA 1PR9A 1O5IA 1KVSA 4LX8A 5GGYA 1OHHD 1IY8A 1U0LA 3MUEA 4AJJA 2JLVA 3BN3A 4KH0A 7MHTA 3HNRA 2CK3A 2R87A 3I6YA 3K72B 1FJXA 3S2GA 3DUFA