4B7UA

Plasmodium falciparum l-lactate dehydrogenase complexed with bicine
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
316
structure length
316
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Plasmodium Falciparum L- Lactate Dehydrogenase in Complex with a Novel Bicine Ligand
rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords L-LACTATE DEHYDROGENASE
total genus 118
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b7uA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4b7uA02
4L4SA 3U5TA 4PG5A 4RVFA 1I2CA 3LYLA 2ET6A 2R6JA 1VPDA 4HFNA 4I9UA 2AQKA 2VQ3A 2J3IA 4HFRA 4LMRA 4FFPA 2EJVA 4BNZA 4EUHA 4U7WA 1BTOA 3OFSA 3PI7A 5I7SA 4U6SA 3GFGA 1DIHA 4PG6A 5IZCC 3WIEA 1LUAA 5KTKA 1HE3A 5JLAA 4CM4B 4UULA 3OQ1A 2A92A 4MIYA 1IHYA 5A04A 2WD7B 4RF5A 1GZ4A 1SPXA 1IY8A 1DLIA 1D1TA 1QYDA 3TRIA 5DP1A 3WFJA 3B1FA 3PRJA 4XYEA 1C1DB 3UCFA 3DXFA 3KO8A 1V8BA 3ROQA 2CZCA 3RI3A 4GSKA 3ZGYA 5I8WA 4DA9A 3SLGA 1UUFA 3N7UA 3I4CA 3ZU3A 4BNFA 5ICSA 2OZPA 3A9WA 1EVJA 4NR0A 1DDOA 1NX6A 3U49A 2XPCA 3VH3A 5F5LA 4CODB 2NSDA 4NPCA 2CVOA 5AQ1A 4Y6SA 4JLWA 4YA6A 4C4OA 2Q4EA 4TRNA 4U5QA 1PJBA 1T25A 4GKBA 2D3TA 3E9QA 1QYCA 2J6IA 4PLCA 3BMQA 3W6ZA 4BNYA 1A9YA 2IXAA 3C3XA 4TMFA 2VN8A 2YQ5A 3QHAA 3LQFA 1VL6A 3R0IA 1UP7A 1DC3A 1NPDA 4FFNA 5AOVA 5B1YA 3BTSA 4EYEA 4BO1A 4AG3A 5TIIA 1F12A 2HK7A 4NBRA 2DFVA 1P31A 4WOJA 1B8UA 3ITDA 3KB6A 3WXBA 5JAMA 1GEGA 2BGLA 1IE3A 2YZ7A 2QHXA 3MWEB 2BLLA 1CF2O 4JJIA 4R4JA 5F1PA 1ORRA 4J1TA 2JAHA 1HLPA 3IP1A 1LDGA 4CMEA 4E2XA 2JAPA 4K28A 9LDTA 2FSSA 4BKRA 3K2BA 2WEKA 4CM1A 1NWHA 3GFBA 1U9JA 5THKA 1SCUA 1ENYA 2YYYA 3F46A 4XA8A 4DGSA 2GGSA 1PR3A 4Z6KA 5JCXA 4EGFA 2GYYA 3WGIA 2JCVA 4WNCA 1XEAA 4BV8A 4BKPA 2IDZA 1D1SA 3CIFA 1BW9B 2RAFA 4F46A 1UZLA 1DJNA 4YJDA 4GI2A 4R41A 4YT2A 2X0IA 1KVRA 2P91A 4J3FA 1LSOA 4NJMA 1J5PA 1JU9A 4UREA 3RKRA 3VDRA 2WE7A 3WYBA 2PGJA 2Y1GA 3FN4A 3GPDG 4YQYA 5IZCA 4CJXA 3PLNA 3P19A 3WGTA 3QW2A 2Z1NA 3CZMA 5GZ1A 4D0SA 3RCBA 3L6OO 1Y9EA 2AQHA 1XQ1A 4B4WA 1E92A 1ISMA 1GCUA 1HSZA 3ZH2A 1NVTA 3OA2A 5C7IO 5L53A 1FDUA 3OM9A 5DF1A 4NU5A 5DZSA 1PJ4A 2X0NA 4XYBA 4JP2A 4PGFA 1H6BA 3C7AA 4NFHA 4KZPA 3RVDA 4R16A 4CM5A 5A06A 3WQSB 2DC1A 3NGLA 4PRKA 1X7HA 2OUIA 3IUSA 2O7SA 2TMGA 3RFVA 4EJMA 2NTJA 2RH8A 4NBUA 2ZTMA 3JCZA 1RM4A 4K26A 5GY7A 1P1JA 3LU1A 1KC1A 4H15A 5EQDA 4QTZA 2AMFA 3AW9A 1UXGA 2YJZA 4TRJA 4NBTA 1UR5A 2BI8A 2PNFA 1GZ3A 4BNWA 3Q2IA 3KYDA 4JQCA 1DRWA 4AJEA 2DUWA 4F6LA 3FI9A 1AGNA 3RASA 3L6DA 4O63O 2CF6A 1DSSG 5CDUA 3F5QA 3ASUA 5DBGA 4J91A 3E9MA 2HMUA 2VZ9A 3MCVA 2GN4A 2Y93A 3B6ZA 2EG9A 5K9ZA 1NQ5A 3LT2A 3RROA 1DC5A 1H5QA 3HE3A 3P2YA 3RSHA 5JDIC 5F5NA 5EPOA 3VPSA 1EUZA 1DIGA 1G0OA 2NVWA 3K96A 3WJAA 1Q0LA 1G1AA 1PGPA 1IULA 3UUWA 3FF4A 1N2SA 2NU6A 2RH4A 2X86A 3PIIA 3QA9A 1Y6JA 4D3SA 2P5UA 1EZ4A 4CR8A 4Z9XA 3HN7A 4JJFA 5A4DA 1ZNQO 4U6QA 3I9OA 4IDFA 4W4TA 3HDQA 4F45A 3VKUA 1C1XB 1I24A 1HTBA 3K31A 4XGNA 3OH8A 4E2ZA 1LDEA 4EI2A 5EINA 1OC2A 2ILTA 2QG4A 4AJJA 1DB3A 1ZJZA 5G0WA 1EFKA 3ZNPA 2Q2QA 4I1IA 8ADHA 4A2CA 3MJTA 3SXPA 1ONOA 3ZV4A 1IPEA 2O3QA 2PV7A 4H16A 1HDXA 2G1UA 2LDBA 3JQDA 3LZ6A 4KUEA 1LLDA 3FPLA 4Q3CA 4RVHA 4R3NA 1I2ZA 1Y8RA 1GQQA 2UYYA 5F1KA 1IZ9A 4XJTA 3ZN2A 1H6CA 2O50A 2O3TA 1TLTA 4XDYA 3RIHA 2EP5A 5IJZA 1G6KA 3WS7A 5EL0A 3TZQA 1JVBA 3FBGA 3GVXA 3NT5A 3EZLA 5DCUA 5I9NA 3RAJA 2V6BA 2VCYA 4YJGA 4HNHA 3O8QA 3O26A 3TJRA 4AJPA 5JNLA 1DO8A 5BSGA 3LF2A 4BGVA 1SEVA 4JBIA 1KYQA 5DDIP 1LI4A 4IJUA 5I7VA 5IZ4A 3MTGA 1EE9A 1QORA 3T7EA 3ZDFA 1JA9A 2EERA 3HSKA 2X5KO 2FPIA 3HDJA 4QUKA 4CM7A 3K9QO 4O1MA 3FNHA 1PIWA 4YT5A 5CEJA 3UKOA 2ZTUA 3ZU5A 1N9GA 5HBRA 5CPBA 1QV7A 3M6IA 1GQ2A 5I8ZA 1JN0A 4RQTA 4B3IA 4KP7A 2ZK7A 4TZKA 2QIOA 1YE3A 2O48X 3V5NA 2FR8A 1Z75A 1MA0A 4MIOA 4B79A 4MOWA 4NFYA 1QV6A 2Q3EA 3JQCA 3LT1A 1LSJA 5G0VA 1EMDA 4LN1A 4WUVA 1P0CA 3RFTA 3PWKA 3U9LA 4NZ9A 2ZTLA 1BXZA 1LDNA 2NADA 1M76A 4X54A 4J9UE 1SNYA 1YBMA 3HJAA 4XQCA 4NK4A 3VZQA 3PXXA 5A9SA 1IOLA 4CQLA 2WYWA 3QV1A 4QFCA 1K2WA 4N7RA 1WDLA 4UVEA 2AG8A 1NAHA 3GZ4A 3PWZA 3W4KA 2YDXA 4IQGA 1QRRA 5B12A 4FSHA 2V6FA 2VWGA 2W4QA 5HA5A 3PFWO 2HMTA 1GADO 3I9JA 5DULA 1HDCA 3BMNA 3GQVA 4GMGA 3RJ9A 4R68A 3DMTA 1E6WA 3W4JA 1X0XA 1ZK1A 1DC6A 4B4UA 3CZRA 4CV1A 3JD1A 4RF2A 4OJNA 1NHWA 1AXEA 4BS9A 1PS8A 3C1AA 3OQBA 1TB4A 1H6AA 1E7MA 4R1SA 5FI3A 4BNUA 3NTQA 2PGLA 1P33A 4TZTA 4CMGA 4BQPA 3JQ8B 1GUYA 3V1YA 1HT0A 4Q3DA 4DQUA 1GDHA 3BXXA 1U3WA 1MFPA 1R6DA 4R9RA 4TKMA 3UH1A 3CXRA 4UAGA 1O0SA 2B69A 1R4MB 3ENNA 1SBYA 2J5RA 2HJSA 3MOGA 4ZA2A 3ENKA 3AM5A 3RFXA 2I65A 4IZHA 3TSCA 5CAEA 4UVIA 5COBA 1PGOA 1KS9A 3IMFA 3T7CA 3X2EA 3CEAA 1HYEA 1YQXA 5THQA 3R6DA 4BGEA 4NK5A 4GGPA 4QO8A 1ZUD1 1T2AA 4MP6A 1PZGA 2AE1A 4MVJI 1R0KA 3IUPA 3UCXA 3INTA 2C59A 3SJUA 2EKPA 3ZWPA 3IQDB 1LLQA 1WVGA 3ZWWA 3NDJA 1PZFA 1PJSA 1R0LA 4I5GA 3OMLA 2HRZA 3DMYA 5L7YA 4RLHA 4QX6A 3VPXA 3B20A 1GYRA 1JVSA 1YKFA 4IINA 5KVQA 1QLJA 3SEFA 1R4NA 4J0FA 3RBXA 3AFNA 4Y6RA 1YL7A 1AHIA 1N7GA 2EXXA 2QX7A 3DHNA 2FHSA 4NJOA 2YUTA 4OOEA 1Y5MA 4CL3A 5FEUA 4Y98A 5IDQA 4Z0HO 1GD1O 2GSDA 4YDRA 2IRWA 4QSMA 2XAAA 4CM4A 1XYGA 2EW2A 2I67A 3WMXA 4WCDA 2B5WA 4D46A 3I23A 4M89A 5CDGA 4BNXA 5JFOA 4A73A 3WYEA 2Y0CA 5BSHA 1Z73A 2QYTA 4BB5A 2C5EA 1PS0A 4I5FA 3ZW9A 1IZ0A 4I5EA 4Q39A 3ONDA 2CUKA 4AICA 3RC1A 1GUFA 3WTCA 3ROMA 2ZYDA 1N1EA 5G0TA 3CUKA 3I9KA 4BNMA 5A5FA 2OO5A 2PLAA 3WGQA 5DOZA 2JL1A 3IJPA 2GDZA 2Q4BA 5CDTA 3RUAA 5A9SB 4BMSA 5L40A 2DBZA 1H93A 3UW3A 1C0KA 2JD2A 2BFPA 4MPDA 3WTBA 3L4SO 2BGMA 3DTTA 2Q46A 2GPTA 5K6AA 2EV9A 2VYND 3EC7A 2R00C 3LDHA 4RZHA 1ZKMA 1JKJA 1GUZA 2NUAA 4BVAA 3D5QA 4R1TA 1UDCA 3UF0A 3WJ7A 3HUDA 1ZH8A 1E6UA 8LDHA 3PHGA 4G65A 4IGFA 4IDEA 2HCTA 5U1PA 2HMWA 3HADA 4FFMA 3S2IA 1E7WA 3PHIA 3CE6A 3A4VA 2O3JA 2AG5A 3BZUA 4RVUA 1UJMA 1E6EA 1XHLA 2EF1A 4LSMA 3GMSA 3GVIA 1DIBA 2C2XA 1DRUA 3V8BA 1V9LA 4YACA 1R16A 1WW8A 1HSOA 2WSBA 3U4DA 3WGYA 5CEFA 1BMDA 3D64A 5HRUA 2DT5A 4MDHA 2WD8A 4DLBA 3DBHA 4D79A 2YHUA 3Q1LA 4TSKA 4L0QA 3FCOA 4GVXA 3UGKA 3W8EA 2YDYA 4J2HA 3U3XA 2X6TA 4NJMB 1YBAA 4ZD6A 1PU2A 3IOYA 2P9EA 3Q3CA 5L51A 4TVBA 4O5OA 3DBRA 3GF4A 1DEHA 2WDZA 3PTZA 5H82A 5BSEA 3MEQA 1J49A 1T2DA 3RJ5A 3U4CA 4CQMA 1ULUA 3DC2A 3OJFA 4J4TA 4R54A 4WLUA 1XELA 4CLHA 3QVWA 3DZBA 1KVUA 1KY5A 1KEPA 4CLXA 1ZK2A 4HX5A 4E0BA 2E6UX 2QZZA 1ZSVA 4XYGA 4YJFA 2YV3A 3CH6A 1Z82A 1OC4A 2CDAA 1MX3A 1DAPA 4B3HA 1W73A 1QYWA 2IZZA 2AEJA 4J1NA 1HDYA 1PGNA 4FJ0A 4WLNA 3AOEC 3DTYA 5TRTA 5HM8A 1D4FA 5FFFA 1RM5A 4K6FA 4NG5A 2G5CA 1DOHA 1Y8QB 2NU9A 4OO3A 1A9ZA 2V6MA 4MP3A 3ETEA 5K0ZA 4RPGA 2OXIA 4A5OA 4BO8A 3OICA 4M55A 1DLJA 4A10A 3E8XA 1A4IA 3AOGA 4BKOA 4UVGA 4YAJA 1NR1A 1HXHA 1U8XX 4XRRA 2Y66A 4CLEA 3V1TC 4AJIA 4YBZA 3INRA 1C0IA 3K2EA 2AW5A 3LT0A 4XB1A 4BHTA 2F1KA 3WLFA 4XB2A 4WCFA 3DBLB 2WTBA 2GN6A 4FIZA 2X23A 5CPFA 4YAEA 3AI3A 4J7CA 5B4UA 4O59O 1KY4A 1PL7A 4TRRA 1BSVA 1RKXA 1U3UA 1ZCJA 1DFHA 1PQUA 5C7LO 1DHRA 3AM3A 3M2PA 1L1FA 1VJ0A 3PGXA 3FNGA 1LTHR 4M54A 1E3WA 2YQ4A 1BG6A 1YOVB 1YH3A 3GVPA 4B8ZA 4E2YA 5JMWA 4W7IA 3I52A 2PZKA 1ZK3A 3AM4A 3AUSA 1EBFA 3H9EO 3K5PA 4HXYA 1HDZA 3QY9A 4D45A 3PHJA 1XGKA 3ADPA 5HS4A 2GZ1A 2YW9A 2A4KA 3AY6A 3QWHA 3WNQA 1GV1A 4R01A 4FD3A 1QKIA 2DTDA 4RPLA 4E5NA 1GL3A 4NBWA 1WDKA 3DOOA 1GEEA 2VUUA 3GNTA 4DWVA 1JTVA 4IS2A 2J5KA 4WGGA 1T1RA 3B1KA 4WCFB 1FJHA 1Z6ZA 3DL2A 1D3AA 3DEYX 4K6CA 2OHXA 3AUTA 4S1VA 1P44A 2FOIA 4IS3A 3AI2A 4HADA 4Y6PA 4OQYA 4J6FA 5BT9A 1DXYA 2NU7A 2AQ8A 3O8QB 4G5HA 4PLGA 3ZWXA 5TJHA 1Q7BA 4R5HA 3VDQA 2Q2WA 3FRJA 5LDGA 2HDHA 4DBZA 1MB4A 1NQTA 5JYDA 4WE3A 3JQAB 1YL5A 5KVCA 1PL6A 1ZK4A 4Y67A 4OGWA 4XKJA 1GFSA 3H65A 4NBVA 4ZRMA 3I4FA 3UXYA 1N8KA 3IKVA 4ONEA 2HLPA 5ADHA 5B4VA 3QP9A 4ZQFA 3PJGA 1HLDA 2I6TA 3AJRA 1H9BA 3G17A 3NUGA 4J43A 5GZ3A 5T57A 4CUJA 2VWQA 3BHJA 3OF2A 2O4UX 1MFZA 4OKIA 4WEOA 3EVTA 3D7LA 1CWUA 3MTJA 4PLVA 4UUNA 4YJHA 3VTFA 4EZBA 1KEWA 4H3VA 3WR5A 2AHRA 2X1HA 3FTNA 3RKUA 1H0KA 4OSOA 3GGGA 1I3MA 3OA0A 1NTOA 4L73A 4A7PA 1BW9A 2GCGA 5JS6A 4CQMB 1GR0A 4OXNA 3BMQB 1M6HA 1V0JA 4LGVA 4BNHA 3PP8A 2O3UA 3OJ0A 2ZQYA 5CP8A 1UXKA 3NEPX 1NAIA 1V3TA 4NHEA 3FWZA 2E49A 1HWYA 5TT0A 1J4AA 1P3DA 2VRCA 3PPIA 3H2SA 4RORA 5ICMA 1U5AA 3DAGA 2VRCD 5I7EA 5ER9A 4J2OA 4J49A 3MJEA 3GPIA 4W82A 1EQUA 1WWKA 4AJ4A 7ADHA 5TX7A 2C0CA 3UN1A 4P4GA 2VOJA 4FB5A 2Q1TA 2B5VA 2DM6A 4EITA 5FF9A 4NI5A 2NTVA 4WASA 1KVQA 4ZQEA 3WOHA 2DUUA 4WCFC 1PEDA 2WE8A 1HKUA 4IXTA 1ISGA 4CV2A 3M2TA 4IUYA 3OIFA 3GN2A 2DBQA 1E3WB 1M2WA 2H63A 4GLOA 4D43A 3Q2KA 4YT8A 4LVUA 1PSDA 1A7KA 5C37A 4KQXA 1XLTA 2JKVA 1QYXA 1XQ6A 5A03A 4MVJG 4HY3A 3PJEA 4IDAA 2Y1CA 3VZRA 3TQHA 2AE2A 2IE0A 1I01A 4XQEA 5KWEA 1XWFA 3PQFA 5T6BA 2D2IA 5TC4A 4CL8A 1DFGA 1JW9B 1RPNA 3JYQA 3Q6IA 1JAXA 1N92A 2BMAA 5ENDA 2EEZA 4W9NA 2IEBA 3QWAA 2JJYA 3LC7O 1HE2A 4I8XA 2EGHA 4RPKA 3UICA 3ZCXA 5ER6A 5ILOA 4BNIA 2RHCA 2D5AA 4AJ2A 3WNVA 4O0LA 4CM9A 4NIMA 4BB6A 2XF8A 3ETGA 3JD2A 4AJNA 4CMIB 3VKVA 3K92A 1Y9AA 3G79A 3HWRA 3KYCB 4LVCA 2D5CA 1VE9A 4B4VA 4CPDA 2V6GA 3F4LA 3TWOA 4PLHA 1VL0A 3HG7A 3GGPA 4IDGA 4IIUA 3RQSA 3ZHXA 4DBVO 4CV0A 2Q49A 3JYPA 4RDHA 3BMCB 3EUWA 3NT4A 1I32A 3WLEA 4W99A 2W2KA 2FR1A 3G3EA 3FR7A 3COSA 3NTRA 1HE4A 4B7UA 2OP1A 3AUUA 5BR7A 2PWZA 2C82A 3F1KA 4LSWA 4GBJA 4ALKA 2VHZA 5TJ9A 1DBVO 4DYDA 3AUAA 3JYNA 5TT1A 3V2UA 4E4YA 2P68A 2V7PA 1X1TA 4RDIA 1GYPA 1E3IA 4BO4A 4EEZA 4YVFA 3D4PA 5ITWA 3WGZA 4JJGA 1EVIA 2HSDA 2W98A 5JMPA 4ND2A 1T26A 4PZDA 5TQVA 2FWMX 3PLRA 1Y5RA 1GCOA 4BOYA 1EDOA 2DFDA 5T64A 4PLPA 3AY7A 2FN7A 1LQTA 2BD0A 3E5MA 2TMDA 3DZIA 5AYVA 4Z9YA 2HMVA 3H2ZA 1I3KA 5JY1A 3OEWA 4WLVA 4DMLA 3HHPA 2EW8A 1P9LA 4LK3A 4ZGWA 4YXFA 2Y05A 1ZK0A 4IJVA 1CQIA 5FWNA 1PWZA 1H2BA 2JFFA 3EW7A 3ZWNA 2I99A 3D4OA 3FD8A 5EMHA 3WQQA 1P1FA 5COAA 5JC1A 2DPHA 3KLPX 3PWSA 1MUUA 4DPLA 5A3VA 3UOGA 4KTTE 2HQ1A 1ZVMA 4U0KA 3ANMA 4B4OA 2GLXA 4J90A 2HK9A 3GEGA 3UVEA 1N7HA 3FHLA 5JBIA 1VKNA 4CLOB 4R69A 3WBBA 4GQAA 2PR2A 3AU9A 2VHWA 3JQ9C 2OGUA 4TVOA 3JD3A 1P0FA 1QMGA 4FW8A 4MO2A 3HN2A 5LC1A 4JNKA 3ANNA 2NQ8A 3QSGA 1P1RA 1PX0A 5IAAA 2WWRA 2RBEA 4BIIA 1KIFA 4LRSB 2NV6A 1T2EA 4GX2A 4CQLB 1KEUA 2O3RA 1VI2A 2I5PO 3QIVA 4HFJA 5KVSA 2W8ZA 4Q3AA 1WAMA 2EJWA 5TSDA 2O7QA 4LW8A 1AUPA 4DLAA 3VH1A 5JAQA 1MG0A 2PZMA 3VH2A 4M87A 1UAGA 2P5YA 4GAEA 2FPGA 2UDPA 3H6KA 4J7UA 4OQZA 3S1LA 4E32A 2ZB4A 5C5IA 1E5LA 3PIDA 3TFOA 4JGBA 1T24A 2IEDA 1YB1A 1DFIA 1M6WA 2HKIA 4RZIA 3PFFA 2GN8A 3F5SA 4PFJA 3DWFA 1QP8A 3DOJA 3PQEA 4RV9A 1N9GB 4EDFA 1GZ6A 2C7VA 1RWBA 5JE8A 4P4NA 4CQMD 1B14A 1LSUA 3H4VA 4A27A 1ZW1A 2P9CA 4INAA 4OXKA 5G4KB 2NNLD 2CF5A 4FQ8A 2Y1OA 1LX6A 4N5MA 4QT0A 1C3VA 3D1LA 1V6AA 1A5ZA 4FOSA 4IJWA 1NM5A 2PA3A 1OI7A 2GZ2A 2VWPA 1YJQA 1LDYA 4IQ0A 2PZLA 4QECA 1NXQA 4J4HA 1SB9A 4XX0A 1I36A 3M1AA 4FJ1A 2UVDA 4ITUA 3MJSA 1WMAA 1Z45A 4GMFA 3QVXA 2JFGA 4NH4A 3K73O 1U5CA 2B35A 4E30A 2DBRA 2XXBA 4YAKA 1Y1PA 3GG2A 1OAAA 4J0EA 1IUKA 1R0SA 1FXSA 4ILKA 3X2FA 4BO2A 1W0CA 2QYSA 1P1HA 4R51A 1X14A 3P5SA 1BXGA 3WDSA 6LDHA 3NGXA 5JDIA 4NQZA 3ZV5A 4BKUA 4YQZA 1NNUA 3ICCA 2PD3A 1F0YA 2OFPA 1VSVA 3MJCA 3PYXA 3WGGA 4BKQA 1ZFNA 1P74A 5TNXA 1SO8A 3DHEA 3KSZO 4Y9DA 3F9IA 4BGUA 1BXKA 4BNGA 5A3JA 4OAQA 4MVJP 4OKNA 2EKLA 1A7AA 2DTXA 1YDEA 3JQGB 3GAFA 1PQPA 3KXDA 2Y1EA 1EK5A 4IJKA 4Z9FA 2GERA 3IKTA 1X7DA 4LMPA 4PG8A 1EDZA 1T1SA 5JXWA 3ZZNA 5I9LA 1NPTO 1VJTA 3KVOA 4OSPA 2B4RO 1XG5A 4JK3A 4UUPA 4MVJH 4RVDA 1U28A 3DO5A 3Q11A 1JKIA 1HZZA 4D44A 3VVBA 3E03A 1A4UA 1ZEJA 3NRCA 3E82A 4II3A 4CM6A 2Y1FA 3TNLA 3HB5X 1ULSA 2X0JA 2Y0DA 4GX5A 4HUJA 2POQX 3JSAA 3MJ4A 2VTEA 2WM3A 3ZNQA 4R1NA 2RCYA 1C0LA 2CY0A 2P2SA 3L4BA 4Z3KA 4ZQBA 5U9CA 5HTOA 4YB8A 1OBFO 1V35A 1LJ8A 3S2GA 1J0XO 3AWDA 3LC1O 3O03A 3QQPA 3RBVA 2VYVA 5JO9A 1E1KA 2VZ0A 3DZFA 2JFHA 3LK7A 2QRKA 4XGKA 3OIGA 1GAEO 1N5DA 3RUCA 2PKRA 4CMJA 1PL8A 3KSUA 3H5NA 2NVBA 2HRBA 1SC6A 2UAGA 4PLWA 4TKLA 3GLQA 1M67A 2NVUA 3OJLA 1U2DA 2V65A 4MVJF 3E9NA 2CD9A 1X7GA 1QYVA 4Y8VA 4P8RA 4GKVA 4XQGA 1S6YA 3WX0A 1E5QA 2PZJA 2EKQA 4D41A 4XIJA 1R66A 2G82A 3GC6A 4MKZA 4RVGA 5G4LA 4L74A 2VUSA 5L3ZA 1MP0A 1TA4A 2EHDA 1DHTA 2VNSA 3PHHA 3H9JA 1UZMA 1PJ2A 2B4TO 2IYOA 1FDSA 1H9AA 4KWIA 5BNFA 3C8MA 4PIVA 2ZYAA 3ZU4A 3MZ0A 3EMKA 4K1LA 1RM3A 4YPOA 3JQ7A 1TXGA 3PDUA 1DPGA 1YO6A 3I83A 1VJ1A 2BI7A 4N54A 5DBFA 2ZYGA 3LSYA 5G2OA 4UEKA 3U0BA 3DAPA 3ONFA 2YHIB 4BNNA 4BO0A 3HZZA 5ENVA 1GQYA 5GMOA 2EGGA 3GAZA 3LT4A 1HDGO 3PEFA 4FJ2A 2CVZA 4P38A 4ESOA 5CDSA 2X7HA 1LDMA 3UHAA 5H83A 3P2OA 1GYQA 4YJFB 5LCXA 1ENZA 4CM3A 1WP4A 5FI5A 3VHRA 1YDWA 3L6EA 4D3FA 5F1OA 4BMNA 1H2HA 4AJOA 1EVYA 1HZJA 4G2NA 4EW6A 5JDCA 3JD4A 1ID1A 1U4OA 4GLLA 4QFDA 3D3WB 3OSUA 3SVTA 5FYDA 5IG2A 1D7OA 1LRKA 2W90A 1HYGA 3EAGA 3EK2A 4S3MA 3ABIA 4ND1A 3PQDA 2O3SA 5BQFA 1NQOA 3GHYA 4HFMA 2IZ0A 1PTJA 3AI1A 2IYPA 1E7YA 1U3TA 4UVDA 2NACA 3JQBA 1MLDA 1CIVA 3QWIA 4XD2A 1RM0A 4XRGA 2I3AA 3RC2A 4IDCA 4BO5A 4DIBA 3LF1A 3JQAA 1IYZA 3BTUA 2IODA 4EBFA 4QO7A 4PN3A 5TS3A 1E7SA 4ALJA 5IDWA 3IJRA 5KIAA 4RO0A 3GK3A 1I2BA 2AA3A 3KEOA 1RYEA 1UP4A 3GNSA 4DXHA 3G0OA 1BRMA 1YGYA 4OM8A 6ADHA 3B1JA 1WLYA 3EZYA 4BNJA 4Q3NA 1ZIDA 2D0IA 5JCJD 3KZVA 1YJ8A 4H7PA 1TT5B 3QVSA 1A27A 3H3JA 5L4SA 3G1UA 2NM0A 1RJWA 3S55A 4FOOA 2GF2A 2DBVO 3NTOA 4KWHA 3B70A 1KOLA 3OETA 2I3GA 3TZCA 4BO6A 4BNVA 3O38A 3WSWA 1IPFA 1YONA 5CG1A 2D8AA 4R9SA 4FPXA 1U8FO 1O94A 1V3UA 2EWMA 2WYVA 3BHMA 3QVOA 3VOSA 3U62A 3S8MA 3F47A 2BRUA 3DMTC 4MVJM 4NDNE 4AJLA 1EVZA 1JWAB 3IAHA 3RUFA 2QZ9A 2UUPA 1U7HA 3WMWA 4ALLA 1IHXA 3C24A 3E1KA 3BMOA 1BHSA 1KETA 4JXKA 4E6PA 2GRAA 2BFAA 2JD1A 5ES3A 5F21A 1HETA 1K0UA 4KDEA 2J3JA 2HO5A 1MC5A 1TI7A 3Q9NA 2ZJ0A 2Q2VA 2DPGA 4ROSA 1VL8A 1VSUA 2BF7A 4I9HA 4IGEA 1TT7A 1B15A 3GMDA 1K6IA 3DHYA 4QQRA 2NTNA 4YAIA 2H5LA 1BGVA 2A94A 4Q3EA 1E0DA 3GRKA 3INGA 5A9TA 5B4TA 3ROKA 1Q2XA 1YB4A 2OBYA 3L4BC 5B37A 2FSVA 1NBOA 1NVMB 3HQ4O 3DQPA 5HWSA 1ISHA 1YQGA 2GUGA 2GN9A 1B8VA 2J5QA 1B7GO 4HP8A 3K6JA 3NJ8A 4DPKA 3TPCA 1WZEA 2VYNA 4IMPA 3WYCA 2Z95A 1L7EA 3GDFA 3BHIA 3TN7A 3HDYA 1W6UA 4E5PA 1LRJA 4P4LA 2Q99A 4MVJE 1NR7A 1HL3A 9LDBA 1YB5A 5IN4A 5EERA 4D0RA 3E6AA 2C5AA 4ZQGA 4FFOA 4DTIA 3U09A 1UZNA 4UUOA 1U3VA 1HEUA 4L76A 1PJQA 2CVQA 2Z1MA 4TRMA 1HDRA 2C54A 1I10A 3W4IA 1JWBB 5MGBA 1NYTA 3JTMA 4I5DA 3KRTA 5TLSA 4WLOA 1MC4A 1QG6A 5J23A 3H5RA 1YL6A 2PKQP 1FK8A 4KDFA 5DBIA 1CDOA 1Y8QA 1I3LA 4XR9A 4U8GA 1NPYA 1DIRA 4LCJA 4GPD1 5L7TA 3ETDA 3VAZA 4E2WA 4FCCA 3DFZA 2DTEA 3C85A 3D3WA 3H3FA 3KOUA 1BDBA 1CERA 1R4MA 2DU8A 4FR5A 5DP2A 3HFSA 1LU9A 1E1LA 4QEDA 4DQXA 3R1IA 4OOFA 4HBGA 4RF3A 3GRPA 1QXSA 2W2LD 4FDAA 3VZSA 1IB6A 1ADCA 4XR4A 5T8KA 1LQUA 4CMBA 4CLRB 5EIOA 3TOZA 3L9XA 1SB8A 3BIOA 1ADFA 4CUZA 3BTVA 4YR9A 3KV3O 3SC4A 3KYBA 3C7CB 1X0VA 1XKQA 3MWDB 3CMCO 3Q0EA 2A35A 5JDCC 3P7MA 1P1KA 1KBZA 3G49A 3DBVO 3ON5A 4I9NA 2NU8A 3F3SA 3ZHYA 3IL2A 4GX1A 3JQ7B 1AN9A 1SEPA 1MV8A 4UEJA 1SZJG 3KUXA 4B7XA 3WIDA 1ML3A 2B36A 3KSDO 4EUFA 3L77A 2G0TA 3ZU2A 4TROA 4IM7A 5DCYA 1DRVA 4JX8A 3W8DA 4DYVA 3K8ZA 2OMEA 3OJEA 3VH4A 1OFGA 4W6ZA 1C1DA 3IDSA 1C0PA 5L4NA 4YEDA 2OP0A 3HFGA 2I76A 2HU2A 3ADOA 4QXMA 2WD7A 5EESA 3WSVA 3RUDA 2IZ1A 2JCXA 3PK0A 1QSGA 1ZEMA 2GZ3A 3WB9A 1XU9A 5EJ2A 4FFLA 4B8WA 3NV9A 5IN5A 5K6AC 4RL6A 2I9PA 3H8VA 2FRDA 3A1NA 1B3BA 3KTDA 5IDYA 2C20A 1FMCA 2H6EA 4AL4A 2NWQA 2OOSA 4CMIA 2PD4A 4RLSA 3N58A 1DC4A 2J8ZA 3VPFA 2YFHA 3GVHA 3WBFA 3L0DA 4DIOA 2O23A 1N1GA 2UUOA 3N74A 3PYLA 1CYDA 4N5NA 1XU7A 3KETA 5KJ6A 3GDOA 4IDDA 2HJRA 1PJTA 2OORA 1F14A 1PZHA 4XYMA 1XDWA 4CMHA 1PWXA 1WMBA 2Y99A 4WNIA 3FWNA 1ADGA 1KEVA 4RJTA 4E5YA 4HV4A 4FC6A 1Z7EA 4ZU3A 1YXMA 2Q50A 1SMKA 1U2GA 3ZWYA 4F6CA 1E1MA 1WNTA 1WXDA 2Y68A 1ONPA 3EYWA 3G1TA 5AXBA 3W1VA 2VWHA 1CJCA 4E21A 3BMOB 2Q45A 3GG9A 3OP4A 2PY6A 3ONEA 1NP3A 4XDZA 2NLOA 3GEDA 3FTPA 3KEQA 3WWZA 5IXSA 4XQ9A 1JQBA 2X5OA 3F4BA 3QWBA 3D0OA 3U4IA 2ZB8A 5KJCA 2YFQA 1ONNA 2CDCA 1UDBA 2ZKLA 2D1YA 3GNQA 3ZV6A 1LEHA 5ILGA 3C1TA 4WLFA 3H7AA 1ZMTA 3DZGA 5CDYA 4DC0A 2W2LA 3TOXA 1E7RA 2X0RA 4BNKA 1ZSYA 1B0AA 1TT5A 4EJ0A 4BMVA 5L4LA 3AFMA 5F3RA 1NFRA 3E18A 3SLKA 4GWKA 1F8GA 3W6UA 1I3NA 4OIMA 1HYHA 2XOXA 4AFNA 4II2A 3NT2A 1R4NB 3ANLA 1Z7BA 3QWFA 4XEHA 4DPMA 3DB2A 2OL4A 4KUHA 4YT4A 3JYLA 1MGOA 1DIAA 2LDXA 3NAQA 1XCBA 4OYRA 1I8TA 4YAGA 2I66A 3BTOA 3QE3A 4GWGA 4EJ6A 4CLRA 1EUDA 3WG9A 1FDVA 3GZNA 4KTVE 3RC9A 3W8FA 5MDHA 4XGIA 2W2KB 4OMUA 4RCVA 3V2HA 5IFLA 1GPJA 5IXYA 1LXCA 5L9AA 5KJEA 1B8PA 2CNBA 3GR6A 4TQGA 3H5AA 4BL5A 1JDJA 4FC7A 2Y67A 4LISA 4MINA 1I5RA 3ZWBA 1NQAO 4CLDA 1GTMA 1ZSNA 2IXBA 4WLEA 1BWSA 3I5MA 3ST7A 2Y0EA 3GH3A 1PJLA 3SX2A 4PZEA 2CMDA 4KQWA 1J6UA 3KYDB 2DKNA 1T4BA 3HDHA 4OH1A 1Q0HA 3H9QA 2VZ8A 1PR9A 3A28A 4CM9D 5JW6A 3ZWCA 1CETA 3I6IA 2BHLA 1NASA 3I9MA 2OBNA 4M49A 2P9GA 2UV8A 4ZRNA 3GT0A 4C7KA 4KMSA 4XCVA 3LC2O 3PYMA 4IIVA 4J1QA 4DMMA 1K6JA 2BFOA 2P4HX 4I08A 5KCZA 3ITKA 1XR3A 4ALIA 3JQFC 2R00A 2X9NA 3UCEA 2VHYA 4B3JA 5A5EA 4DUPA 1E7QA 1R15A 1X13A 3D5TA 3ASVA 5G4KA 1PGQA 1UXJA 1T2FA 4AJHA 3K30A 5AXCA 1AXGA 3SJ7A 4CUKA 2Q1SA 3R3JA 3LVFO 3VVCA 2C29D 2FZWA 5G0SA 2FPPA 4CMAA 3VC7A 1E77A 3SC6A 4E33A 4O6VA 2ZB3A 4AJKA 1EQ2A 2VOEA 1Q0QA 3TL3A 1NFQA 1I30A 5CG2A 3ICPA 4A26A 3RU7A 1Q7CA 1UDAA 4PZCA 3PZRA 4RPHA 5JCJA 5JC8A 1KVSA 3VTZA 3U4HA 1ZXLA 4ZICA 3MOIA 2B37A 4JROA 4G81A 5DN9A 5KOIA 4DRYA 1O9BA 1ZO8A 1EBUA 3HB4X 3KM0A 1HF3A 1YBVA 1VLLA 3PGJA 5BNIA 3ZNNA 4DL9A 1O89A 1HE5A 2AEFA 3BAZA 1YQDA 3TZKA 3MJVA 1ZBQA 3RUIA 5A9RA 2PK3A 3OQ6A 3NDIA 1KVTA 3OHSX 4WKGA 4C7JA 4D7AA 4DLLA 5EN4A 4RGBA 4ALNA 1FDTA 4DQVA 2YY7A 1CEQA 1VM6A 5CEEA 3DONA 1XSEA 1B2LA 5JAZA 2X8LA 4ZHSA 4TWRA 3JQ9A 1ISIA 1PGJA 2PGDA 3I3OA 3NYWA 3O9ZA 4WK6A 4J1SA 4YJHB 2ZATA 2ZQZA 2PTGA 4YCAA 4L8VA 1W8DA 4LRTB 4OXYA 5AXDA 4PG4A 3GY0A 2VHXA 5A05A 3ZHBA 3DBHB 4YRDA 1ZXBA 2WJPA 3TZHA 1P1IA 3UFXA 1I0ZA 1PS9A 4MKRA 3CKYA 2AEMA 2ZIZA 3I9NA 4HWKA 3JQGA 1MG5A 3FSRA 2A9FA 1LSSA 3AY3A 3FNEA 3KBOA 4J4BA 4GVLA 1LBEA 1Q7GA 3RUHA 1IL0A 1B3RA 2R2GA 4ND4A 1QLHA 4XYLA 1ENPA 2QW8A 4D3DA 1KERA 1F8FA 2YHIA 1VKOA 4ALMA 3BMNB 4ND3A 1NWCA 1T2CA 1H94A 1BXGB 2D4AA 4J16A 3O4RA 4PLTA 1WDMA 3EGOA 4M86A 5TF4A 5GZ6A 3RUEA 2BH9A 1Y7TA 1EFLA 1C1XA 2C2YA 4E5MA 3D3EA 2ZJ1A 3NX4A 4K9DA 1EE2A 1B26A 2O2YA 2NQTA 4UEOA 4BQRA 4L75A 5BSFA 3UAGA 4CV3A 1PQWA 1LC3A 3JQAD 1LLCA 1VRWA 3AU8A 3F6YA 5EQFA 3DAFA 3ZHZA 1CRWG 4FGSA 4Q9NA 3ZWAA 1EK6A 2QQ5A 3FBTA 2CFCA 4J9VA 2C7GA 4CR6A 1S7CA 4WEQA 4FGWA 4ID9A 3T4XA 3BMCA 4WOKA 4XIYA 3RU9A 2X9GA 3E5RA 5KKAA 1P77A 4IY1A 1UXHA 4YTEA 1ZMOA 2ZCUA 4OHUA 1U4SA 3IC5A 4RQUA 3GVCA 2GO1A 2E37A 3STHA 2CDBA 4FBGA 2O2SA 2BGKA 4R3WA 5KJ1A 3VZPA 1VC2A 1JKFA 2D59A 3BA1A 1DAOA 4EEXA 1Q1NA 3I1JA 4PG7A 2DLDA 3KHUA 2PH3A 1EUCA 3QJ5A 5KJFA 4MP8A 1M75A 1T4DA 1WZIA 4N5LA 4PVDA 3DR3A 5DOVA 3I6QA 5JYEA 5L7WA 2AXQA 3ZWOA 2VT3A 4YJGB 1E3LA 2HUNA 4E5KA 1QR6A 2JHGA 2O4CA 4HKTA 4MVJD 3TFQA 2VTDA 1JLLA 2JHFA 4MVJA 5IF3A 1FDWA 2J3HA 4YYZA 1PJ3A 1RYDA 3QVTA 4R5MA 5JO0A 4DREA 1K5HA 1GV0A 3JD0A 3DZJA 4LCEA 2JCYA 2VNAA 4Z0PA 3L9WA 5H81A 3GOHA 3OIDA 5T67A 4IBOA 4PVCA 1O8CA 2DVMA 4XWYA 3GUYA 2X5JO 1R37A 3TF5A 1PJCA 3GGOA 4JN6B 4RF4A 4JBGA 5T5QA 1LNQA 5TGDA 1O6ZA 3NKLA 3M1LA 4CLOA 2X9VA 3RWBA 4CMCA 5JPIA 3ZWVA 5CHEA 2B0JA 3T4EA 3KLMX 4AVYA 2GR9A 1TEHA 5HS6A 5ITVA 5I9MA 5L45A 4M8SA 1NFFA 4IQ8A 5LDHA 1LA2A 1YS4A 2X58A 1ISJA 4FFRA 4M1QA 2Q1WA 4A03A 1P45A 3PZBA 2PKQO 4L4XA 1NVGA 3GA0A 1F06A 1CQJA 1SOWA 4GSLA 4RPJA 5KKCA 3GZNB 3CSDA 1V3VA 1UXIA 2WMDA 1LC0A 3OECA 3QLJA 3RC7A 1AHHA 3WGOA 5BNTA 5DT9A 1I33A 3OBBA 4JCOA 1PZEA 3GUCA 2QRJA 2C07A 3Q9UA 3RBZA 1HRDA 1SOVA 2RIRA 3LLVA 5JAIA 3WICA 2X22A 2VUTA 1BVUA 3JQ6A 2G76A 2G17A 2E4AA 3JQBC 4MKXA 3L07A 5CFZA 4WECA 3CPSA 4IMRA 4YRBA 4XZ3A 1XA0A 2PD6A 2DQ4A 3SBOA 1JAYA 3JV7A 4Q3BA 3TL2A 4E12A 5C3MA 1ZZEA 2B4QA 1E3JA 4W7HA 3H9UA 4KOAA 2DAPA 4E13A 1GU7A 3EHEA 2HMSA 1A72A 2JD0A 3LLSA 2EIHA 3R3SA 3A06A 3JQ8A 3PVZA 2PH5A 2P4QA 1YOVA 3TZ6A 2AQIA 4E31A 1X1EA 5DCWA 2HK8A 2ZCVA 3NDRA 5AVOA 4JIGA 1Y81A 4WJZA 3JQFA 2WYUA 3ZW8A 5JSFA 2Y1DA 3OEYA 1K6XA 4IPTA 2BELA 3FNFA 3KYCA 1BVRA 3ZI0A 5C7OO 3CMMA 3GDGA 2E82A 4JP3A 4ND5A 2RHRA 1AE1A 4YRAA 2H9IA 2FR0A 1OMOA 3OJOA 4BNTA 1EEHA 4GH5A 4IDBA 4IZIA 4YWJA 1B16A 1L7DA 5A1TA 3I9LA 1D8AA 1ADBA 2SCUA 3PHLA 1YVEI 1K3TA 5DNAA 4NMHA 1X15A 3ZV3A 4BNLA 4BGIA 1KC3A 3CINA 5IDXA 1GY8A 2BKAA 4RVSA 3IIEA 5G0UA 4D42A 3EVNA 4DVJA 3PDJA 3PJFA 4HNGA 4PLYA 5T8KC 1E3SA 1OZAA 2FMUA 4PRLA 5A02A 1UH5A 2Z5LA 1U1IA 2GASA 3IP3A 1LLUA 2NVUB 1ENOA 2CSUA 1SAYA 4J7XA 1Y8RB 3H9GA 4BO3A 5KVVA 4B7CA 4NU6A 3PJDA 4JBHA 4MIEA 3AK4A 3DBLA 1O5IA 3EY4A 4ZQHA 4FS3A 3ROPA 2GD1O 3ZWMA 4GX0A 4CR7A 4URFA 5AXAA 3ULKA 1U7TA 4CMKA 3VPHA 5KNLA 3DZHA 1LDBA 3CTMA 1TVEA 5U4QA 4WPGA 4DIFA 4BO9A 2FY8A 3TDKA 1WPQA 3FR8A 1G0NA 1NHGA 3WGHA 1BDMA 4GGOA 2YV1A 5L95A 3GHHA 5COQA 4EUEA 4L4RA 2ZTVA 2VT2A 4E3ZA 2XXJA 1HDOA 2FP4A 2BFMA 3D4NA 4CM8B 1XIVA 4ZJUA 2VHVA 2Q1UA 1O95A 1F17A 4FN4A 1UAYA 2GNAA 2FZEA 3IS3A 4DC1A 4ZN6A 2QRLA 5JY6A 4U0JA 1YWGO 4AJ1A 3V1UA 4KUGA 4W9NC 3C7DB 4OL9A 4PCVA 2ZB7A 3AOEA 3GN1A 4R1UA 7MDHA 1ZJYA 2F00A 3BYZA 4F3YA 1MXHA 3JQEA 1UP6A 4XJSA 1GPDG 2VRBA 2PFGA 4PLZA 4UVHA 4PLFA 3C1OA 3DDNA 1Z74A 1W4ZA 3F1LA 3FPCA 1DJQA 1C14A 4NFSA 2EP7A 2H1SA 4N18A 1FF9A 4BV9A 3HNPA 2YV2A 1OOEA 4BO7A 2HAEA 3E48A 1YRLA 3DBRB 1E3EA 2VYVD 3DFUA 3DZKA 4MJLA 3V2GA 4NNJA 3NJ4A 1M66A 3VPGA 1H6DA 4L9RA 3WQRA 4BUCA 4GL4A 4CM8A 1A71A 4Z0TA 4UUMA 4CMEC 2J3KA 4ZVVA 2E48A 4IXWA 1LRLA 5I7FA 3S2EA 4Z3DA 3WFIA 4P22A 3GEMA 3JYOA 3ORFA 3DOCA 1ISFA 1ARZA 1MXFA 1E1NA 1K89A 3ZNOA 3WWYA 3S2FA 4A0SA 3QRWA 1R12A 3EDMA 3A14A 3RD5A 2B83A 2X4GA
chains in the Genus database with same CATH superfamily
1IVNA 1N2IA 1XMVA 2WA1A 3M5DA 2XXAB 3JASA 3K6RA 2AQKA 1THMA 3SJAA 4HAXA 5FJIA 4F8YA 4FFPA 2EJVA 2CFRA 4QYIA 5IC4A 3LOPA 2OZLA 4EUHA 5KDOA 1BTOA 1E66A 1P4JA 1Q0PA 1UQUA 3PI7A 4LRQA 4ZODA 1N2CA 5F98A 4Z9BA 4GF5A 3TBFA 2XB2A 2WTEA 4G4GA 3UPUA 1JZQA 4B6PA 4RKYA 4PG6A 2A2ZA 4LDZA 2UUBB 2FPKA 3X0DA 1NBMD 4UULA 4B3MB 4IWXA 1GAXA 2A92A 4MIYA 3H86A 4YRPA 2PJZA 2IVZA 4KYUA 1R74A 1IY8A 5HUHA 3AFOA 5A4JA 3TRIA 1QYDA 5DP1A 3B1FA 2EJUA 3CNOA 1OTHA 1Z8HA 3P94A 1PJRA 3PRJA 1C1DB 4QUGA 4X61A 2OY0A 3G8AA 4XYEA 3TQIA 1V8BA 3CJRA 3OOYA 1U7WA 2CZCA 2HK6A 4MZXA 1KR5A 5E3IA 3RI3A 3ZGYA 1QMPA 4DA9A 5LMCA 4TMZA 3CLSD 4I3GA 4D8VA 3RSCA 1EFCA 4BNFA 1RIIA 4ZI3A 4Q9DA 4P58A 1DDOA 4UBLA 3LBIA 4KYIB 1VMEA 1JL3A 4CODB 1DV2A 4YROA 2CVOA 1NF8A 2F2TA 3H13A 1XZKA 3A9RA 1H65A 3L7LA 1T25A 1XK7A 2C4WA 3C3MA 1MAWA 4GKBA 3I61A 5CT9A 3BMQA 2G9RA 4D26A 2IXAA 3C3XA 3C43A 4TMFA 2VN8A 5H16A 2YQ5A 1BQ3A 3S5JA 4A92A 2O7NA 1R6UA 4PBRA 4IAOA 1YACA 3V46A 4V3BA 3KAQA 5AOVA 4PZ0A 2V3WA 4G1FA 5B1YA 3NHRA 4BO1A 1K4MA 4FDTA 4AG3A 5TIIA 4K2HA 2ZR9A 1F12A 2HK7A 5ELLA 1P81A 1A5TA 4MQEA 4DSOA 3K9FC 1E64A 1JFFB 4DA8A 4WOJA 1B8UA 3ITDA 1M9NA 4G0NA 4O8ZA 4P4TA 3CZ9A 3VV3A 3W8NA 1GEGA 2FW8A 4AX8A 3BXEA 2YZ7A 3MWEB 2CV0A 1PYGA 2BLLA 1ZLXA 5CR9A 5FAKA 1ZL0A 4JJIA 2XMDA 3SK0A 2PJRA 2XVZA 4NECA 1R27A 1HLPA 4CN8A 1LDGA 3A3OA 3D4BA 3NKFA 3QEMB 3PB3A 3L41A 4YMLA 2BKEA 1ZLYA 3K94A 1SKQA 2FRDC 4CM1A 1J97A 3GFBA 1L7BA 2XNJA 3LHDA 4GDFA 1GTRA 5THKA 1SCUA 3F46A 4Z6KA 1DWOA 2GGSA 4U8HA 1H3NA 4EGFA 2GZDA 4OA5A 2JCVA 4TTTS 3VGPA 3WGIA 4DANA 3C8DA 3ABQB 1XEAA 1UK8A 3OLWA 4ZQCB 1H0SA 2PBZA 3N53A 1IRXA 3B3GA 5J4LA 1Z2EA 4KH0A 1YBFA 3LX6A 4ZCPA 5HMMA 4CKXA 1BQEA 4DNXA 1I4OA 4XDGA 3PTAA 3B6EA 2J45A 1KMQA 121PA 1UMCB 2P91A 2FSFA 4H7IA 4G86A 3DEFA 4HDMB 4MVXA 3CPJB 1JJVA 1JU9A 1QCYA 4UREA 3VDRA 3PUIA 1MH9A 4BX3A 2DFKB 2H06A 2XVXA 2I8CA 4B3CA 2R6R1 1GGMA 4EHIA 2A0KA 3ZQUA 3NWPA 4CJXA 3P19A 1M2OA 5GZ1A 4TN5A 3CLUD 2VJMA 2J3MA 2XHEA 3D6UA 1YOBA 3A6PC 1C41A 5LZ8A 4IVNA 4AO7A 4CQJA 1AQJA 1FVXA 2HDOA 5EG5A 5ESDA 5MGNA 1TUBB 1NVTA 2WKWA 1RS0A 1TIPA 3HABA 3R5TA 5IBPA 3G9UA 2WZCA 1KQNA 1XNRB 5LBUA 4ER0A 4BLVA 3JX9A 2JAQA 4HRYA 4O4JA 1ZJJA 4JP2A 3UXHA 5AVZA 2QXUA 4J6EA 4UHCA 2ZZMA 2R4TA 2G25A 4RH0A 4NF2A 1UIMA 2SCUB 1XWIA 3KQSA 4AQDA 3RAFC 1V5WA 1YZKA 4KPFC 4DV5B 1C7IA 1CUUA 4R16A 4DLUA 1EM8A 1EH5A 1VXRA 1D9XA 3HR8A 5BORA 1QRSA 1TPYA 2J0UA 4BLUA 4IMJB 3Q7IA 4PRKA 5FBRB 1X7HA 4F2HA 4L8FA 4HUQB 4M36A 2NTJA 3ZE8A 2OG1A 4WESB 4OHRA 2ZTMA 5H8WA 3H3XA 2CXNA 4K26A 2YHAA 1P1JA 4FYJA 4FDLA 2F9FA 5EQDA 4AYWA 3K0SA 1EBBA 2AMFA 1V6CA 1ZX1A 2B6HA 1UXGA 3CCCA 4E4TA 1Q21A 3A0UA 4DAOA 3OZGA 3MQ2A 4DS3A 3SIXA 2F7SA 2OHIA 1QFMA 4HCJA 3AIMA 4BNWA 1B6SA 3JAKA 5ESRA 2C96A 2ZM5A 2WF6A 2R1TA 3BB3A 1FBNA 5M3BA 2A5LA 3ICEA 1C50A 1I3CA 1G7TA 3HR4A 1ML4A 4BV2A 4FLFA 2I91A 4N5IX 4OL0A 3TTTA 2G28A 3TOSA 1AGNA 3L6DA 2B8NA 1CTQA 4TSRA 1DSSG 3D59A 3F5QA 5ALNA 3ASUA 1J9ZA 4LTDA 4EGQA 4G25A 3LG2A 1A2KC 4ZGBA 2QTNA 2C7PA 1FP2A 1CY0A 1S2IA 3CY6A 4BJ3A 5HRCA 3HZRA 2P62A 4HPWA 4PHCA 5E0KB 4UNIA 5DYGA 5K9ZA 3LT2A 4RJ2A 1DC5A 1H5QA 1M72A 3E2PA 3RROA 3RSHA 1I9GA 1A7UA 5KTPA 5F5NA 3ELDA 1UT8A 1QAOA 4QARA 1EUZA 1DIGA 1G0OA 4Y2GA 2XGSA 4Q66C 3IEUA 3MILA 1NLUA 1R4ZA 4C7VA 1Y80A 3WJAA 5KYXB 4ZO8A 3AV3A 1H2XA 3CT4A 3GEPA 1PGPA 3IBSA 1GNLA 3GCGA 3HO8A 1OWOA 3QVVA 4KFRA 1XRMA 1Q1ZA 3PIIA 2O0KA 4M88A 1LZKA 2CC2A 4IZ6A 4I1PA 2JRCA 4A23A 2P5UA 3ZQ6A 2FWBA 3GJQA 5LZ2A 3OPMA 4OHKA 3R8CA 2A5YB 1I1OA 1ZNQO 2V7XA 3E7WA 3PCXA 3VU8A 1MDFA 1XPJA 4GYWA 2I80A 2IX3A 4JWTA 4BU1A 3VKUA 4C2AA 4EHHA 1KF0A 2Q1XA 1KI3A 3C74A 5PNTA 3FOFC 4H27A 4MW5A 4BQEA 1VJDA 1JRLA 3HCBA 2HLHA 4EI2A 2IBMA 1OC2A 2MDTA 3R5JA 2A1UA 4OK3A 1RP7A 1C9MA 2HRRA 3BRWA 3Q15C 3AHFA 3GI1A 3U6KA 1H2YA 2O9JA 3PL1A 1V3QE 5CDFE 5LIRA 4Z9AA 2TECE 1KHHA 2WABA 1XPRA 2I0FA 3ZNPA 2D1FA 1WXWA 1QK4A 3GCZA 3JQPA 4FFWA 4URYR 5CTJA 3FKJA 1UMBA 2P2CA 4JYBA 2FWJA 3PNOA 3DFKA 1WZCA 1KSHA 5BR8B 4OP2A 4ZVLA 3VR4H 1U0BB 1ACMA 2PV7A 3OQPA 1NN1A 5FFNA 3VJLA 1RACA 3C6MA 2EFHB 1JEYA 3LZ6A 5AIAA 1YU6A 1LLDA 1ODIA 1X8XA 2OO5C 4Q3CA 4LC0A 3Q98A 4QATA 4RVHA 4PZAA 2V96A 4D5GA 4F6RA 4MKHA 4NYIR 2UYYA 1Y3FE 3QG5A 1H6CA 1CS0A 1PZMA 3LBNA 1WM1A 2QSUA 1JR4A 1MPTA 1TAGA 4S35A 4EAAA 4XDYA 4UOQA 3EHDA 1G6KA 3RF6A 4C03A 1YZLA 4QEKA 1P39A 4PXYA 3JRNA 4H1HA 2B7CA 3TZQA 3NOQA 3V48A 3FBGA 3AYXB 1UIRA 4F4UA 1Z3CA 3I1FA 4KH1A 2WV9A 2IHZA 5DCUA 4TTVA 2GM4A 5CM2Z 5I9NA 3L0OA 2XTAA 1FJXA 1XLWA 1YD7A 5TGTA 4YJGA 4LOIA 4RJLA 3JARB 3TLKA 1PNTA 1USIA 2P2ZA 4GQIA 4IOKA 1NXOA 4YYEA 4B84A 5JNLA 4UNNA 1YMVA 2WUEA 3VSEA 1QO7A 4CCYA 4U7TB 1BGXT 5DDIP 2C5BA 4M7WA 3LPLA 2XCIA 3OESA 3BGVA 2P6NA 2FPXA 1U02A 5CA0F 2DPYA 5TB5A 2RHWA 4O1MA 4YT5A 4MPPA 4M1TA 2BFDA 1ZVJA 1XDGA 4ESEA 2PRZA 4F71A 3DO8A 1U0SY 1YS1X 4F0JA 1CVIA 2GLUA 4KIFA 3I45A 4R7ZA 1EFVB 4JJ6A 2YBDA 5HBRA 5CPBA 1DARA 4I14A 4A6EA 4ASUD 2JFUA 3R0QA 5DM2A 4B80A 3MWKA 4G84A 4B3IA 4KP7A 1GAJA 2QIOA 1YE3A 2YIJA 3V5NA 3FPJA 4MIOA 4B79A 2CXXA 1QV6A 3JQCA 1TUBA 2GFIA 4O4LF 3H5OA 2E1RA 3EAQA 2GXAA 5EWLB 4EG1A 3NETA 3UAOA 3E70C 5DM4A 4WUVA 5CUQA 3UANA 1QFXA 4XGRA 1U8ZA 3R20A 2QU7A 4RTKA 4QXPA 2AFRA 1SCAA 1SNYA 3HJAA 4H0FA 4X54A 3ZCUA 4ZFNA 5BWNA 4HQFA 3L4JA 1FTNA 1SIOA 1RPZA 5A9SA 2DB3A 2VA8A 3FIUA 3FVRA 4I1SA 5BQ3A 4PAWA 5CA0B 3BE5A 1O4WA 3CUEF 2P2GA 3BRSA 2WTAA 3ENWA 4HGQA 2W6IA 4N7RA 4P7JA 3P5BA 4L50A 3V9AA 1XVLA 5J3JA 2J0UB 3QLVA 4RTPA 1ZJ4A 4MR7B 5TQ0A 1NOIA 2VWGA 2H7VA 3C5HA 2RBGA 3T38A 1PV2A 4YY3B 2P1ZA 3DUFA 3W5AA 2AJ8A 3BMNA 1L5WA 4GMGA 2EBHX 4GSYA 4R68A 3HEMA 4UU7A 3RJ9A 4FI3F 1I6MA 4GMHA 2WLSA 1T4CB 1P0IA 1ZD8A 2PX5A 3JD1A 1TB4A 4MYCA 3WWZA 4LJ6A 1YZYA 4R1SA 5FI3A 3NPMA 5FBWB 4BNUA 4EG7A 4OX9B 2PGLA 1USWA 2SBTA 3JQ8B 2ZSHA 1GUYA 1HT0A 1U2DC 5E7JA 3TTXA 2C9DA 2R66A 5HKOA 4JI0B 1MFPA 3O4FA 5DGTA 4R9RA 4NENA 4YCBA 1H5UA 3UH1A 3CXRA 2DYKA 4KQJA 5AHKA 3ENNA 3RAEC 2E4YA 3PHCA 5AJWA 3GDHA 4HDNB 4FBLA 3DKIA 4CDRA 1WD7A 1CR2A 3KR1A 5IEBA 3VFDA 1IOWA 5K2OA 3V4OA 4S04A 2QJTA 3TSCA 2OBBA 4QLAA 4ML3A 5CAEA 1KYYA 4UVIA 4MQEB 1KMIY 1R0BA 4QXAA 1YQXA 3R6DA 1E1CA 4BGEA 2BSXA 1N0VC 5FI1B 4TL7A 4QO8A 1ZUD1 1T2AA 2FEAA 5DX0A 2PL1A 4G97A 3LCUA 4XW2A 2RGUA 4MVJI 2QVLA 1NA5A 1RXYA 4Q1BA 3WWPA 5KTRA 3SQWA 1KYVA 3IUPA 1XCGB 4Q5IA 4N7MA 2R7LA 3ZWWA 4ER5A 3FLAA 1VDZA 1JZTA 4D4LA 3RSLA 3HBLA 5ALUA 1PJSA 1YDGA 1OXBB 2L2QA 2ZWAA 3OMLA 3IP5A 5EFZA 3DMYA 4QXOA 3WNCA 2PZGA 4C89A 2C2KA 4P33A 2YWCA 4CRWB 5AVJA 4A4DA 2WJWA 3OLXA 4HGYA 5IM4F 3MTQA 4KVAA 3AIIA 1YKFA 1ZY2A 2POCA 1TC1A 2QGFA 4XE5A 5KVQA 3SEFA 4MYUA 1R4NA 4O29A 4I9GA 4J0FA 4FE7A 1P60A 3AFNA 2KMLA 2YWGA 1FFGA 3A4IA 3P9KA 5F1YA 3WYDA 2IH2A 2EL9A 1T8RA 4OOEA 4FP9A 4LQLA 4Y98A 4ZJYA 4Z0HO 1GD1O 2GSDA 3VO1A 1B23P 5JYCA 1P91A 1NVVR 3BD6A 4YQEA 1Z0FA 2XAAA 3IAM1 2X41A 2I67A 3WMXA 2WP8J 1ECLA 3D3KA 3V2IA 5KSWB 4CEIA 4QA9A 2ZDQA 1X92A 1TLFA 4UOEA 4ZXPA 5I01A 1GUBA 4Y0VA 1EX6A 4A73A 4DABA 4BQQA 1Z73A 1XFAA 4BFVA 4KAXA 4BB5A 5E7MA 2C5EA 4KRFA 3ZW9A 4QPPA 1EFTA 2CUKA 3WZ2A 5E0OA 3GLGB 3L8HA 2GFQA 3C1UA 2JIDA 3BX1A 5FQNA 3CUKA 3LY5A 2OO5A 5KAPA 4DSNA 5AUQA 4FB4A 4OXXA 1JZSA 3F3MA 3SICE 3GEHA 1U9ZA 3IJPA 1X1DA 2R1TB 2VDWB 4Q4JB 4Y30A 2GDZA 4EHDA 6NULA 1IN7A 4EELA 1W4RA 3N0VA 5L40A 5KO2A 2BHSA 1H93A 3LP5A 3VR6H 1ZCAA 1C0KA 1KZ4A 1M1NB 3ORSA 3T1YB 2IGTA 1QDEA 3VUEA 2BFPA 3I2YX 2HZ7A 4MPDA 3CF0A 3L4SO 4F5EA 3OTOB 3GJ5A 4ZO6A 1EJ0A 1R0XA 1O8BA 4EHAA 3P0JA 4F9FA 1J0BA 1BE0A 4XM0A 3WQHA 4H60A 3EC7A 5EXDA 1ZKMA 3UJ8A 2C8VA 4JELA 4BVKA 3BE8A 2HUPA 4HUQA 1GUZA 4DM7A 4LFAB 4X65B 1N1DA 1V9SA 5DBHX 1QUEA 3T52A 4ZEVA 4B3GA 1A1SA 2HWXA 3NPAA 3PHGA 4G65A 3ZY4A 2CLDX 5D51S 2FA9A 2ZIAA 4PGHA 1MC8A 2UVPA 3H5TA 5H59A 1WJGA 4FFMA 5D6OA 5EZ6B 5J9FA 2GXUA 4ACBA 4OJQA 3A3YA 4EQ6B 4EMSA 1UJNA 4HYYA 1OLUB 5B55A 2BP7B 1KZ7B 2AG5A 1WXGA 4LYJA 4O4JB 1TA0A 1E6EA 2EZTA 2ST1A 1XHLA 1HT1E 1HPLA 3DA8A 3DDCA 3ESAA 4KIWA 4DCCA 4UCXA 4YI3A 2BHRA 5K0FA 2QR3A 4S1NA 3GVIA 5T4BA 3ET5A 3HPRA 1JFTA 1DRUA 5FWXB 4RKWA 5CBPB 3A1FA 2PZBA 1ZC3A 3U4DA 1BFDA 2WSBA 5CLHA 3VYWA 5HRUA 1YRAA 1N5LA 4MDHA 1FFWA 4O4IA 3ZIUA 5B30A 4DLBA 1ONSA 4RADA 1MRZA 3F0TA 1MJ5A 3DTVB 4K8OA 3F97A 4ND6A 3IQWA 4M3NA 1U7XA 3FCOA 4GVXA 4HLDA 3R9IA 3V1NA 2H1OA 1J8VA 1QH1A 5F2EA 1Z4QA 3U3XA 2X6TA 3K9LA 1YBAA 5J1SB 3A6HA 4TVBA 4YRSA 3DBRA 2ZE8A 1PV1A 2DPLA 2NSJA 3DYVA 3F3YA 3G0BA 1W75A 1AQ6A 2RB4A 3PTZA 2J0VA 3HBFA 5H82A 5IHPA 4MRVA 1IJBA 3VDMA 1J49A 1PTKA 1T2DA 3NH6A 1G3RA 2ZJ7A 1JECA 3OJFA 1M2NA 1C9JA 3SLKA 1VJGA 1Z4KA 1XELA 4S2UA 4Y7DA 3ZS8A 1OASA 2A78A 2XWSA 5ALGA 3QVWA 2HV8A 4LDJA 3R3WA 2WK1A 2WW8A 3EVAA 3EIFA 3EXFA 1H2ZA 3IKMB 2ZRMA 2ID8A 4HX5A 2OXCA 2LP4Y 1XJ0A 5J5AA 3QMWA 2E6UX 4X1IB 3MAAC 1APBA 5B5SA 2OD7A 4IG4A 3RSZA 5K20A 3DAHA 1EWVA 2OWDA 3FUVA 3HY6A 3IP7A 4QOSA 5C32A 3M6XA 4BC0A 4ZPXA 3QMMA 4TMWA 1NI4B 2VDUE 4DJFC 2E6KA 1AUQA 4IIFA 1T6NA 3RPEA 2QLTA 4B3HA 3FSGD 4DEYA 5HUJA 1W73A 3DE2X 4JLVA 4E1AA 4AMVA 1Y6GA 2GAAA 3A10A 4X62B 5TRTA 2GEBA 1D4FA 4U9IS 1HOXA 3O4GA 2YRWA 1RHJA 3PUZA 1VPVA 1JLKA 2NU9A 3OZUA 3TSOA 2V6MA 1ELOA 4N03A 2H3EA 2TRSB 2WTMA 3W5UA 5EHXA 1SK8A 1CFJA 4A5OA 2NXWA 3COYA 4BO8A 2X2PA 3M4ZA 1JHAA 1DLJA 2JKZA 2OILA 2BFNA 4GVPA 4KAJA 4UNPA 1TQ6A 4I1YA 4BKOA 4TLMB 3BQNB 5LUBA 3VYUB 4CZ2A 1HXHA 1TUEA 3L1JA 4CLEA 3ECAA 1T0JB 3QELA 4JJ4A 2C5HA 4NMLA 5EXTA 4C29A 1PW7A 1S3IA 2HSGA 4KN6A 3B60A 3TNJA 2QRVA 1PJZA 3WLFA 3QPUA 2EQBA 3AF6A 1FTWA 3DEIA 3G2NA 4L8GA 3AI3A 4JA2A 2O7VA 4O59O 3OOHA 1D2HA 1T0IA 2IEAA 1KY4A 2QTBA 4GZ3A 4PPFA 3R76A 4LOJA 1WQ4A 3WL8A 1BSVA 4RL4A 1U3UA 1DFHA 1CRZA 1GQRA 1NRIA 1CLUA 1PQUA 1K66A 4DMHA 3TECE 1DHRA 3F5DA 4DMUB 3FI0A 3AM3A 3B1YA 4BZXA 1O97C 3BXFA 3TRKA 1VJ0A 4LYFA 2WIKA 3S70A 3NHAA 3FSEA 4OHBA 1PV4A 2RG7A 4ZMRA 1BG6A 1IN5A 1ZQ9A 4E2YA 5JMWA 3NV7A 2CJWB 3CUYA 1DBQA 3GP3A 3HB0A 2Q1YA 3BWBA 4XM2A 4MRRA 1JIIA 2FV8A 2D54A 1LPSA 2YYSA 4X1KB 1DEXA 3AUSA 4C05A 5I7OA 1FSSA 1NY5A 3QY9A 4KQ2A 1OX4A 3PHJA 2CXQA 3ADPA 4FBMA 4QUHA 1XYVA 1Y3BE 1V9CA 2A4KA 4GOLD 3QWHA 5EKDA 1W52X 2FDRA 3C4QA 1ZGAA 4A8JA 2KM1A 4F92B 2G4VA 4FD3A 4KQ6A 4YLGA 4M7RA 1CEEA 4NBWA 4MMYB 1KZ9A 4RLQA 4DWVA 2LE0A 4OBXA 4N3NA 4XM1A 1FRQA 1NBAA 2ZQ5A 3ANXA 3UG6A 2C42A 1Z0ZA 1YB7A 3UT5B 4DKJA 1QRAA 2Z58A 3LQQA 1D3AA 3OCWA 4V02A 2JPDA 4K6CA 3R3UA 3RRJA 4X90A 4E70A 3NM6B 4OGFA 4DLYA 3GW8A 4S1VA 1ZOPA 3TPFA 3RS5A 3ZQJA 1BMFD 1JQAA 3A9SA 2PS3A 2I2CA 4OQYA 4E14A 2JVJA 3D8SA 2NU7A 2AQ8A 1NMQA 3I6MA 3KQHA 1Z5PA 1IY2A 4G5HA 4BVEA 4C0LA 1Q7BA 4R5HA 1WBDA 1ILWA 4D6PA 2YVQA 4ECEA 1MB4A 3O8OB 3VOBA 3H2HA 2GEJA 2D5LA 4MCAA 4PYJA 1LF0A 2CBZA 4F7DA 3QUCA 3M6AA 2WIJA 1Z5VA 2IT1A 1M8GA 3DB1A 4OGWA 2SECE 1GFSA 3UXYA 4NBVA 2GPSA 3I4FA 2GS9A 5CURA 4B31A 3IKVA 5K3FB 5ADHA 3PQCA 3U7JA 2CB9A 4EFDA 5LD2C 2ZUDA 1HLDA 5LQKA 4UBMA 2WVAA 3UMVA 3OG9A 4B32A 3LRPA 1E0JA 4YMVA 4KO4S 1RRVA 2YBEA 1MFZA 4MWOA 4X20A 3EVTA 3GO4A 1ZMBA 4MVWA 4YJHA 2GKSA 8AT1A 1O95D 4HDSB 4GGMX 3AVQA 4O25A 5CIYA 2X1HA 3RKUA 1H0KA 4OSOA 1DS6A 1XJCA 1FTQA 2RGNC 3BDVA 4UM5A 2ORED 1JDBB 1XJWA 1FRNA 4LZJA 4M4SA 1ZH2A 4Z54A 1ANKA 1BW9A 2J08A 4TV9F 5F7ZA 4FXPA 5A5VA 4MGZR 1HEYA 1ZD2P 1GR0A 5SZIA 1Q1GA 4CQMB 5DBOA 1VJRA 1V0JA 4K3VA 3KZCA 5LZ7A 3WISA 2O2GA 5CW2A 1P19A 4S1TA 3KOZA 1UXKA 3MTDA 2Y8EA 3T3GA 1V3TA 3AR9A 1CT9A 4MCHA 3NVDA 2E49A 2QAGC 2OGZA 4O33A 4I4IA 4JYAB 3I53A 4QC2A 1H2RS 1FUKA 1LH0A 3PPIA 1VKJA 3RAGA 3M4XA 2XJ9A 2C3MA 1AB6A 4G23A 3WHLA 1EE1A 2Q3HA 4J49A 4L51A 1JHYA 4UHEA 3CHYA 3OZSA 2VK4A 2P41A 3HY3A 4JLKA 1UWLA 1Z6AA 2HIGA 2X15A 2AXPA 3KHKA 4ZVTA 5AVYA 1WWKA 1TVKB 3EODA 3DOIA 4KE8A 1E2LA 4C6SA 3NKVA 2GBLC 2VOJA 3QK7A 1NVKA 4BP9A 2Q1TA 1IM8A 4FB5A 3NU1A 2V7BA 4BVHA 4EITA 4NI5A 4PHFA 4JQYA 2ECOA 3DOHA 3E4DA 1JGTA 1YE8A 221PA 2ZCJA 3WOHA 2DUUA 2NP7A 3PNKA 3FHTA 2RGEA 1HKUA 3KKNA 4KEAA 4EQ6A 3OIFA 2QP4A 3GN2A 3F5FA 4BEJA 3QEAZ 4Z1MA 1E3WB 3WLOA 5AJUA 4LNAA 3AMVA 3LBAA 4GLOA 3BCRA 3ZXSA 3BK7A 3Q2KA 4P08A 3DKRA 2ZVJA 3W5HA 2Z6AA 1JJAA 2CUTA 3KPWA 1M2JA 2WZDA 3OUUA 4XTRA 1Z3IX 5GAJA 2VFAA 5IH3A 2LCQA 2H11A 4FNMA 2ZI6A 3TLZA 3S2ZA 1S2NA 3FOCA 1N4DA 4JX9A 2WJ6A 4HY3A 3A6KA 5ENVA 5DYWA 2Y1CA 2RHMA 3V97A 3UMRA 4G4JA 5JS8A 3T95A 3QJGA 1RPNA 3JYQA 3Q6IA 5ENDA 4AB1A 1O6GA 4W9NA 3C4JA 2IEBA 1W93A 4M83A 5IBRA 2B8EA 4I8XA 1UKCA 1YZFA 3ZV7A 1GRQA 3GA7A 2ZBDA 2C2MA 1SIWA 2V54A 1T5HX 2VDWA 4Q4JA 3Q12A 5E9JA 4QJ4A 2AZMA 1VB5A 4NDZA 4N3BA 3REFA 3H2KA 1OX5A 1KAGA 2G1KA 4R0VA 3SX4A 3UMFA 4MWZA 4KNVA 3C7TA 4Q02A 1GU1A 3S1AA 4C4AA 1L7OA 5HKLA 5BN3A 1U11A 2HF9A 3OE4A 2ZR0A 3HWRA 3QOFA 2D5CA 3FWHA 4S0ZA 4DMFA 2V6GA 2XWJI 4HH0A 4PLHA 3TWOA 3EVEA 4CIYA 3GGPA 4IDGA 3RQSA 4RA9B 1IN8A 2TMKA 1R00A 4JLMA 2Q49A 4RDHA 1U1FA 3PC8C 4GI5A 3A6FA 4CEIB 4W99A 1X39A 3WQBA 1RAAA 2FQYA 3COZA 2C92A 2OP1A 1TTPB 2YJGA 1NF2A 2PWZA 3I8OA 3OWHA 2MIIA 4H6XA 3RO7A 5KWJA 1YS2X 2MSWA 1EFPB 2E0IA 1Y48E 2WMNB 2VHZA 4ZI5A 1UODA 1DBVO 2PV0A 5TJ9A 4DYDA 5TT1A 2O1SA 1P62B 3ETNA 3FPEA 3REQB 4E4YA 2GILA 2V7PA 3HU2A 3BIXA 1NG9A 1GKUB 4RDIA 3THRA 4MUEA 1E3IA 1SRQA 4IDHA 2DF8A 3G9XA 5AKZA 5ITWA 1LK5A 5A71A 1Z34A 1JDTA 1R18A 3K09A 4RSMA 5JMPA 4ND2A 1VE1A 2H4JA 1RSZA 4ZOQI 2LCIA 4PZDA 5J2TB 1UKBA 3PLRA 1TJ5A 3IESA 1IEQA 3NDBB 2FI1A 5K09A 3C5EA 3AEQA 4Z53A 4M9SA 2XMCA 3GFOA 4G36A 3MWDA 2XB9A 5FWDA 5BNWA 4YUWA 4ZVSA 1A8QA 1H2FA 2JFBA 2OEPA 1U3CA 3MELA 3NHWA 5MFPA 4WLVA 2H17A 3HHPA 3NR2A 4EZEA 4NU0A 421PA 4KGZA 2NPFA 1I1HA 4IHAA 3ZZTA 3GJ8A 4IJVA 1S9DA 2RHDA 2W22A 2ZS7A 5LLDA 3W5BA 2QSYA 5U4XA 3WA6A 1D4AA 4JODA 4X8OA 3F67A 3JWIA 1NVXQ 4ARUA 5I51A 3H2IA 2I2AA 3EW7A 4C6RA 3S0JA 3ISVA 5JC1A 1A8IA 2WA2A 4J2TA 5COAA 2DPHA 3KLPX 3PWSA 4MUIA 1MUUA 4JT9A 1LPOA 2YXNA 4REMA 4DUZB 3D2AA 1Q84A 3ANMA 4HX2A 5I9IA 2R5NA 3TMAA 1N1MA 2HWKA 4JI3B 1KK0A 2B0CA 2HK9A 3PEUA 2UXBB 3GEGA 3UVEA 3FTFA 3A1WA 3GLKA 4CLOB 5JMOA 2F4NA 2GVZC 4DZZA 5F9MA 3BXHA 2XRMA 4GQAA 4Y1RB 2A3RA 3AU9A 1R8XA 1C3OB 3D0RA 4RPIA 4TVOA 4F8JA 3KT3A 2IDKA 2EWWA 3OZBA 2NXEA 4RZ2A 3ANNA 3QSGA 3V4LA 3ESXA 2GF9A 5IAAA 4U39A 3BXZA 5IT9A 2AX3A 4QM7A 3K70D 1SG0A 2WWRA 2OCDA 3EEIA 3UM9A 1LFDB 4MS3B 2RBEA 1DAFA 3UXEA 3QSYA 1KIFA 2DY1A 5BWOA 4QELA 2AW3A 2Q6LA 4GE0A 3FFXA 4CQLB 2I5PO 5KVSA 2BWJA 1UPTA 2QUBA 5BW5A 2GPJA 2Q0SA 2UUAB 3H17A 2IKSA 1B8NA 4OBEA 1BCRA 4QDXA 2OCIA 4DLAA 4O8CA 2JGNA 4BEWA 4DR4B 1MG0A 1X1AA 2PZMA 2EP8A 3CZQA 4BPBA 3PPVA 4J7UA 3S1LA 4UXJA 4MA0A 4E32A 1DX4A 5C5IA 1WP9A 3EEQA 2HQSA 3SM9A 2BZ1A 2COUA 3SC3A 5FWAA 3U3RA 2IEDA 1PNVA 4FZRA 5KC8A 5L6LB 2FQWA 2V03A 2WKQA 4PXSA 5EPUA 2DWPA 1M0SA 1S2GA 3Q2OA 5HBGA 5FR1A 3ND8A 3PNQA 3PFHA 3ZOZA 4RV9A 1S3FA 1V8OA 2C7VA 3CNBA 5JE8A 3T4UA 1PRYA 3K6KA 1V71A 1LSUA 4ADSG 4XWWA 2QJRA 2FW6A 3TZEA 1NW4A 1YI0A 2P9CA 3PQ4A 4HWSA 3WDMA 3KJQA 5AJTA 5LQMA 4LFBB 2PXHA 4OEHA 4Q7JB 2QI9F 5B1EA 3TKLA 1A5ZA 2NU8B 1NF3A 3DLCA 1VIVA 3TTYA 1OIXA 1OI7A 3E3AA 3N6RA 4KQ9A 3EPKA 1UBNA 4IQ0A 4QECA 2X3UA 3MS7A 3FTQA 1T0BA 3C4VA 1H1DA 2YN2A 2UVDA 4EY4A 4YRKA 4FE3A 4RMNA 1Z45A 5BPFA 4GMFA 1AQLA 4X84A 3TTWA 3OHPA 1JDSA 3DZCA 2A0XA 3M34A 5D3MB 3RSFA 4YV7A 3P2EA 1C30B 1YK1A 2B35A 2QX9A 2DBRA 2FSHA 2XXBA 3IAS6 4JXJA 4E30A 3K1YA 4XSHA 1Y1PA 2J33A 4IUBS 5LA6A 4YP6A 2REOA 2G63A 2J1LA 4E07A 3EN0A 4RSGA 5CM8B 4Y18A 1FS4A 3NBKA 1UBFA 2OVBA 2QYSA 1OPRA 4RNDB 3S81A 1LBIA 4R51A 3O21A 4B7AA 3ZXYA 4RTJA 3DDOA 4WZAB 3R7DA 1BXGA 1EFDN 1JT2A 4UOZA 5JDIA 2G5TA 1GTL1 2AL7A 3ELYA 3N75A 3ICCA 1E9VA 1F0YA 1Z5ZA 3GFFA 4H3HB 3MJCA 5IM5A 1I6LA 3FW1A 1N6LA 2XNHA 1RYNA 4NXMB 3OQVA 5FNVB 4GR9A 1SO8A 4RAOA 3KSZO 2IOFK 3KVNA 2AC2A 2F6RA 4O2BB 4UU0A 1DELA 1BXKA 1CNFA 5ULLA 3TM5A 4HQ0A 5C81A 3TB6A 3VR6A 3O3CA 3PNVA 5JSHA 3OCJA 1A7AA 3SKVA 2DTXA 1T9ZA 2ZJ8A 1QM5A 2X0FA 1JH9A 3OCXA 2QQ0A 2Y1EA 1EK5A 3CGWA 4G5FA 2F9LA 4J3NA 3NEYA 4LMPA 1S02A 1ST2A 5EA2A 1KJ8A 5JXWA 1S4MA 3UH0A 4KKVA 2Q7DA 4GP9A 5AM4A 3P97A 2W71A 1PKEA 2B4RO 1XG5A 4IXMA 1QHYA 1P2TA 1WDTA 3HVIA 1UL1X 3H8WA 1G7CA 2GMWA 4RTOA 3Q11A 4TSFD 1HZZA 3I0NA 2BUCA 3E03A 4MPTA 1A4UA 1IH8A 3TLCA 5FBVB 3NRCA 3P8ZA 4AUMA 3HB5X 1ULSA 3IT1A 3NIDB 4HUJA 1Z39A 2POQX 6ABPA 5BR4A 4FGLA 2XKAA 3ZNQA 2FDCA 4F72A 4EHKA 3L4BA 4Z3KA 5U9CA 2Q3CA 2WWIA 3AWIA 4LPSA 1AMOA 4RIGA 1OBFO 4U4AA 5I5GA 4ERNA 3L01A 3ACCA 1E9BA 4FYPA 1GPNA 3LC1O 1JDNA 4LX0A 3L8EA 4LXTA 4KQFA 3QW4B 2VYVA 5JO9A 2PTHA 2OD2A 2VZ0A 3DZFA 4MVCA 3MCUA 1JYFA 4YBRA 5EWLA 4EUNA 4BXOB 3QVUA 3LK7A 1P7WA 2QTVA 1B0UA 1GAEO 1V7ZA 3OIGA 2PKRA 1AMNA 3DH0A 4L8LA 1NW6A 1D0IA 2APJA 3OOSA 1DXOA 3DPIA 4KW7A 2VJDA 4TKLA 2UAGA 1OTXA 4LHEA 4XWGA 3SOPA 4BKMA 2V65A 2AI1A 4MVJF 1ZUNA 2MMCA 3KCNA 2BFFA 2BT4A 3LD9A 4WT7A 1UKVY 1WBJB 3ES9A 4BWGA 1MB2A 4DJDC 1UPFA 3LC0A 3U7QA 1S6YA 1AKTA 1XOIA 3ED5A 4I66A 3WIBA 3WX0A 1E5QA 2BOVA 2D00A 2EKQA 5ELXA 2G82A 1YJBA 1T3HA 3OM1A 5G4LA 5J63A 3RSGA 2N42A 2EJBA 5L3ZA 3G0IA 3VR2D 1YA6A 3PUXA 4XSVA 1JPUA 3H0EA 3TIFA 3H9JA 3ZDZB 1KKUA 1K6EA 4L9WA 1PJ2A 2B4TO 4DEXA 4DXDA 1FDSA 1H9AA 3OD1A 4ENUA 2W5UA 4BVFA 1DCFA 2II6A 1QGOA 2XUQA 3EQZA 3FOAA 1VCIA 2BY4A 2WBLC 2ZROA 3LIIA 4XWAA 2G8LA 3N2GB 4XDHA 5EWJB 3HJTA 4BCBA 2P2LA 4IEEA 1TXGA 3FCEA 4V0ME 2FEPA 3Q7EA 2CLIB 5CNMA 1P9WA 1D9ZA 1VJ1A 2BI7A 2NQ2C 3H1PA 1ORWA 4LIPD 1L4GA 5DBFA 3LSYA 4HK4A 4UEKA 3SZRA 3NBAA 5B3AA 3VZDA 5H70A 4URXR 4L6CA 4DADA 621PA 2VTKA 2YNMA 5GMOA 3TMYA 3FUCA 4P38A 4M9RA 4IHJA 2YMQA 1Q3HA 5LKAA 1GYQA 2W2TA 1IM5A 3PFGA 5F2NA 5DRTA 2AKYA 3ELUA 1UEXC 5KNDD 1GDDA 3VYRB 2EFCB 4X71A 2YOHA 4BMNA 1GILA 4R7GA 1HZJA 3NMUF 3LVBA 3EVDA 4ZREA 3VV2A 4EW6A 1UMBB 3DEAA 2JIQA 5BV8A 3JD4A 1ID1A 1XXHE 2R6GA 1CZHA 4DMKA 2IJGX 1C4OA 2HA7A 1KDVA 3GPCA 3OSUA 2PH7A 2FH5B 1HYBA 3TIIA 1VMDA 3AVPA 4RSRA 2DLCX 4OGGA 5IG2A 1D7OA 4MWBA 3BGSA 2AHOA 2C9ZA 4ND1A 4S3MA 1FYDA 1CRLA 5DIZA 2V7GA 2IZ0A 3AB8A 2IYPA 4QU9A 1Z9BA 1NQXA 1TO6A 3IQFA 2O1EA 4UVDA 3JQBA 4K05A 1MLDA 2CNWA 2BF4A 4QYWA 4R9NA 1A9PA 2VQDA 4XARA 1WZ2A 1TO2E 1MQ9A 3EF0A 2I3AA 2A9QA 3GD5A 3H1TA 3UTCA 4BO5A 4BX8A 4DRXA 1ZI9A 4KREA 1FBTA 2VCEA 4LI3X 3DFMA 2W6JD 2IODA 2VDNB 1NM5C 2ANCA 3T35A 4ZYVA 5FOTA 5TS3A 4L22A 4ALJA 2EZ9A 4E7OA 2BONA 2OBFA 3FA2A 1KJZA 1EVKA 4OK5A 4RO0A 4TKVA 4DUGD 3UIEA 3KEOA 4A82A 4OCZA 1UP4A 5GJCA 3UW1A 1K7CA 1X80A 1VTKA 1I0LA 1HQYE 1YGYA 3A32A 3IR5A 1ZI6A 5EZYA 3DLAA 5A3SA 5T6MA 3SVZA 1YGPA 4BYGA 4RK4A 2Z9BA 4QLOA 5DM1A 4EB3A 3OO1A 2HU5A 3LXXA 1ZIDA 3O2SB 4P1ZA 4UFNA 4D4IA 2GD2A 3N7TA 4G8DA 3NBYC 5EKTA 4Z4FA 3ZWKA 1RFGE 5CLIA 4ZHQA 5L4SA 4EGCB 1Z4MA 1W0KA 3G1UA 4RDCA 1VBKA 2R65A 4FOOA 1U8AA 1KOLA 4XVRA 3Q4GA 4MV7A 2I3GA 3TZCA 3EPJA 1N2ZA 2YWXA 3ZJVA 1H22A 1IPFA 4X92A 5CG1A 1GQOA 4R9SA 4HD8A 1USGA 821PA 2H00A 1RJEA 1O94A 1V3UA 4R2WA 1RLOA 1NZDA 2WYVA 3FDIA 2XX3A 3QVOA 1WD5A 3U62A 3AO0B 4Q7QA 3BK2A 1KY2A 3DMTC 4K86A 4IOMA 3PQ5A 1JWAB 4MVJM 5L3SB 4H18A 2UUPA 1GZ5A 2HRDA 2HXYA 3CO5A 1L5HA 2JEZA 1IHXA 1OB5A 3EGVA 2IYFA 1E2HA 1JV2B 3BMOA 1CJKC 1BU8A 1A2BA 1BHSA 1I4WA 4AWAA 2C2ZA 1HETA 3TNYA 4ARAA 5HIMA 3QOYA 1KQOA 2SHKA 2QN1A 4QWMA 1C7QA 1NX9A 2VK8A 1MC5A 1V11B 4LZOA 5F9HA 1N33B 4JJ7A 2GCIA 2ZJ0A 3T5CA 1Y82A 2P5TB 4ROSA 1VL8A 2FG6C 2QLFA 3RQIA 3BD8A 4I8DA 3ZIAA 2IFTA 2BF7A 1Z6YA 3LV8A 1KSGA 3WJ2A 4D4JA 4ZYLA 3GMDA 3KSMA 1E6KA 1K6IA 4QQRA 3GFVA 1TO1E 4C04A 1NDQA 4N40A 3FYCA 3FYDA 4O1IA 5FL3A 3VVMA 2NYUA 2FWRA 3MBIA 4GUDA 3OQJA 2CW5A 1GVNB 1RAHA 3GRKA 4Y1RA 3LHIA 3INGA 3GRRA 2G1JA 4U2EA 3OLCX 3ENVA 5CCDA 1YB4A 2OWEA 3ROKA 3SHFA 1E0SA 5EP1A 2E4ZA 2YIDA 3GDWA 3L4BC 2ODEA