4B7UA

Plasmodium falciparum l-lactate dehydrogenase complexed with bicine
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
316
structure length
316
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Plasmodium Falciparum L- Lactate Dehydrogenase in Complex with a Novel Bicine Ligand
rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords L-LACTATE DEHYDROGENASE
total genus 118
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b7uA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4b7uA02
2YUTA 1WLYA 2X0RA 1WPQA 3PIIA 5A9RA 1MC5A 2FRDA 2O2SA 1ADBA 2ZKLA 3K8ZA 4E0BA 1P1KA 2NNLD 3ZNQA 4K28A 2H1SA 3K6JA 1TEHA 3WQQA 2A92A 3WB9A 1AE1A 1KVQA 1B8UA 2J3JA 2PZJA 1EDZA 3C7AA 1Y6JA 1I3MA 1W8DA 1LC0A 5ER9A 4J1TA 4J7XA 2P4HX 2VHWA 5HM8A 4IJUA 2D4AA 4CMGA 1AGNA 1P77A 3VHRA 1E7SA 1ZJZA 1PS9A 4ZGWA 4P8RA 1DIHA 2NV6A 2OHXA 2LDXA 3JQCA 3JD1A 2HDHA 5H82A 1P45A 3VVCA 2EF1A 4B3JA 4CJXA 1E1KA 1V8BA 2XPCA 3BTOA 3O26A 1VJTA 4TRNA 3VVBA 1Y8RB 1ZEMA 3RUFA 3PEFA 2C2XA 1HKUA 4WCFC 1WMAA 5GY7A 5B4TA 1DFHA 1NQ5A 2WYUA 3QVWA 4J4HA 1PJCA 5A9TA 4RF4A 2X8LA 4CMHA 3GAFA 1JAYA 1MG5A 2POQX 4CUKA 1X7DA 4YRAA 5IFLA 1I2BA 5JYDA 1DLIA 2FR8A 3LZ6A 2FPIA 5JDIA 5TJ9A 1YE3A 5BT9A 3W4JA 2Y0EA 2PNFA 3JQGA 3OJFA 3WWZA 4YAGA 2PZKA 1YB1A 2CF5A 1H94A 4IM7A 3BHJA 5IG2A 4DQVA 2W2KB 1S6YA 4M89A 1QXSA 3H65A 4BNYA 2PD6A 4R5HA 5IZCA 1HL3A 3ANMA 3AY3A 4OQZA 2AW5A 3TQHA 3C1AA 5L40A 1YL6A 2O3QA 1QLJA 3KHUA 4XGNA 4TMFA 2V6GA 4MKXA 3QA9A 1YVEI 4QSMA 2VZ9A 2J3IA 4O6VA 3RFVA 4RPHA 4YJHA 3QWHA 3ZWXA 5IAAA 9LDTA 1HYGA 3PZBA 3EAGA 3JQAD 3DZKA 4JROA 1X0VA 3MJ4A 7MDHA 1E5QA 3CUKA 4YT5A 4XQCA 3DBLB 3RUIA 4P4NA 2Y99A 1BVUA 2PKRA 2NU9A 2NADA 1IZ9A 4B8WA 3WYCA 2HO5A 2H9IA 4AVYA 3JQBC 3F4BA 1G0NA 1UXKA 4M49A 5CDSA 4ND3A 4BB6A 1A7KA 5B4UA 4CMIA 1LDBA 3E82A 4L73A 4HWKA 1M67A 1Y5RA 5U1PA 1PQWA 1DHRA 1ZCJA 2PKQO 2C59A 1BG6A 3S1LA 4CM9A 2I6TA 2R00A 3NUGA 3HNPA 5L7YA 4OHUA 3RD5A 3LT2A 1DXYA 2Y68A 3DTYA 3GT0A 3ZHZA 4A7PA 3MJTA 5EMHA 2DLDA 3N74A 4ZQHA 1TXGA 1XA0A 3H9QA 3W1VA 4IDBA 3ZWOA 4FR5A 1ISJA 1R12A 4AJ4A 1LRKA 5I7SA 1I36A 3VZSA 2NSDA 1TVEA 1E3SA 1IHXA 3F5QA 3JQ9A 3BHMA 5HRUA 4JJFA 2CDAA 5JY6A 3HDYA 1EFLA 1T1SA 2PLAA 2PH5A 3AUSA 2V6FA 3VPFA 4PLFA 3MTJA 1J49A 4M8SA 2C5EA 1HDXA 3GN1A 3EZLA 2ZIZA 3C3XA 1NQAO 1OC4A 3IKTA 1GR0A 1SEVA 2D5CA 1C0PA 5A1TA 1BMDA 1JKFA 2P9EA 2Y93A 5FFFA 2VT2A 2YHUA 3JD0A 1UUFA 2NLOA 4Q3EA 2I67A 3V1UA 4MVJA 1YB5A 1ZIDA 2E4AA 3MJEA 1ZMOA 3ROPA 4W7IA 1O5IA 3ONDA 2V65A 1FDTA 3H3FA 1HYHA 4A03A 3WJ7A 1F8GA 3G1UA 3OJLA 1M66A 1HSOA 4BMSA 3QWFA 2B5WA 4FGWA 3ITDA 2VUSA 1B0AA 3DZFA 4MO2A 4L4XA 5A02A 4OGWA 1UDBA 1C1DB 2BFMA 4YJDA 2ZJ1A 1OZAA 2FR1A 3K30A 3OIGA 3PP8A 1R4MB 3RJ5A 4X54A 1PGJA 1UDAA 4FFNA 4BKOA 1B7GO 2VNSA 3FRJA 1B8VA 4WLEA 1PZGA 2HKIA 3IC5A 3IQDB 1XELA 1WZEA 1IY8A 2EHDA 4IDCA 3O8QA 4XZ3A 5JLAA 4KOAA 2VNAA 1X15A 3B20A 3I5MA 2H63A 1D8AA 1QYWA 2Q46A 1KETA 1P74A 3KBOA 1FMCA 3INGA 4A0SA 2JFGA 1JA9A 4PLHA 4MVJF 4FGSA 4WLVA 3ZGYA 4FFMA 4HFRA 4UVGA 4FQ8A 4CMEA 1KERA 2QX7A 3QIVA 1NHWA 1N9GB 4YAJA 1NAIA 3PQFA 3W8EA 4OL9A 3WBBA 3VOSA 4XQEA 2CDBA 3D5TA 4IQ0A 4RLSA 4W82A 5IDXA 4CLOB 5FF9A 4AICA 1XLTA 2DC1A 3R1IA 4U7WA 4IDEA 5TGDA 1SMKA 1I3NA 1QP8A 3TN7A 3OA0A 4CMJA 2C07A 4TKMA 4XJTA 3RKUA 3WLFA 2WE7A 3QVXA 5DBIA 4TRJA 4JGBA 4KTTE 3RASA 3E6AA 3AM4A 5BSFA 2RIRA 3F4LA 1HSZA 4XYMA 3F5SA 3NV9A 2X9GA 4RZHA 4S1VA 3KO8A 3G79A 4QUKA 1E3LA 3ZCXA 2NU7A 2PD4A 1BTOA 3ETGA 4BOYA 4Z3KA 1U7TA 4ZQGA 4Y98A 5GZ3A 2PH3A 2ZJ0A 1KOLA 1XWFA 4JBHA 4O1MA 1CRWG 2Y05A 3DMTC 3RFXA 1TT5B 2B35A 3FPLA 1NFQA 1A71A 3PVZA 4Y6PA 5A03A 2IXAA 1O9BA 3AOEA 1EE2A 1ZK4A 2VN8A 3HZZA 1XR3A 2HK8A 3P19A 2C0CA 4XIJA 4IZHA 2AMFA 2CUKA 3UCXA 3U09A 4IS2A 1DEHA 1I0ZA 1B16A 2D59A 4WCFB 3ROQA 4UVHA 4GBJA 3M1AA 1LSSA 4NQZA 1HF3A 1RYEA 1CETA 2A94A 1JWBB 3NJ8A 2JL1A 3D3EA 2GLXA 4EGFA 1NVGA 2HK7A 4CQLA 4U5QA 2IE0A 3FPCA 4IY1A 1KVTA 1EVYA 1WP4A 3E5RA 2JCVA 3FTNA 1AUPA 1U9JA 4PCVA 3I9KA 5G4KB 1BXKA 3BYZA 2JFFA 4PLTA 4GQAA 1OC2A 1ZK2A 3S2GA 4CMBA 3DBRA 3OHSX 4ZQEA 3UVEA 1X0XA 4NR0A 3H9UA 1A27A 1VLLA 2ZATA 1NVMB 4XWYA 3I9JA 3RSHA 4D45A 2HAEA 1SC6A 4DYVA 1ENZA 5I9LA 1OFGA 3LLVA 5IXSA 2ZB8A 1GADO 4TROA 5B37A 1U7HA 1ENYA 5B4VA 3U62A 4QT0A 3EHEA 3OJ0A 4OSPA 4ROSA 3LT1A 4B7UA 2Q1SA 1I8TA 4BNLA 1VL0A 4OKIA 5TNXA 1PJQA 3WNVA 4MPDA 3W8FA 1UZLA 4XB1A 4GGOA 1U5AA 4A27A 4AJEA 5TT0A 5DT9A 5L53A 1Z7BA 3ETEA 4R41A 1GCUA 4GVLA 4EUHA 4MJLA 1NFRA 3BMNA 1UXJA 1DC6A 3ZWYA 1EUDA 4K26A 4RPGA 4OH1A 3U9LA 1N5DA 4B3IA 2X0NA 1ENPA 4FJ0A 2ZCVA 1GDHA 4YBZA 3OQBA 4B4UA 4OQYA 2HRZA 1F8FA 3NDIA 5DOZA 1ADFA 2VYND 4BNHA 4DQXA 3ZN2A 4RLHA 4GAEA 1KY5A 4XYBA 3ZHBA 3RC9A 3HB4X 2O7SA 4BGEA 1ULUA 2WD7A 2D5AA 1EVZA 4INAA 2WD8A 3ZNPA 3QVSA 4YRDA 2VHVA 3JQEA 1T2CA 5AXDA 3P7MA 1T1RA 1KEPA 1M75A 1NX6A 4J4TA 4HADA 4LCEA 5EIOA 2X9NA 1R16A 5JSFA 4AJHA 5KJ6A 5COAA 4RORA 5JXWA 1HE5A 1NXQA 1SB9A 2B69A 2HU2A 4A2CA 4WPGA 4XDYA 4CLHA 3GFGA 4BGVA 2IEDA 2PK3A 1R4NA 1UXHA 4KUHA 3ANLA 3JV7A 1K89A 4XR9A 2FR0A 1SAYA 5AYVA 1QSGA 1PSDA 5KNLA 4MP3A 1MXFA 4OM8A 4DIFA 4TZKA 3QSGA 2QIOA 4RVGA 5JDCC 5TRTA 3L9XA 2VHYA 4WKGA 1NP3A 3QVTA 4MOWA 3OSUA 4Y8VA 1Q1NA 3F46A 2X86A 3WFIA 4K1LA 3VH2A 2OZPA 4EZBA 1WDLA 1KS9A 2AE1A 1NVTA 3BMOA 4EDFA 1ZSVA 1V3UA 3JQFC 4IBOA 1GL3A 4EBFA 4L76A 1F17A 1JVBA 3JQBA 4MP6A 1Q0HA 4L75A 1T26A 4E33A 4BUCA 3EDMA 5EN4A 1PL6A 3DAFA 4CM8A 2X7HA 4TRMA 3RUEA 1O0SA 2BLLA 2WE8A 1CEQA 1AXGA 4CV2A 3WGYA 2EW8A 1PQPA 3ZW8A 1LJ8A 1LA2A 5ITWA 1PX0A 2UDPA 3LF1A 4YT2A 4GWKA 2DQ4A 2BFOA 4FC7A 4O0LA 1ONPA 4FS3A 3WBFA 2GCGA 1I24A 4PZEA 3LT0A 4MINA 2WTBA 1ML3A 4LVUA 5C7OO 3AI1A 4RPLA 1LDGA 1LQUA 1D1SA 2FZEA 1Y1PA 2VCYA 3WGZA 1NWCA 1SZJG 5JY1A 4HUJA 3NYWA 1H93A 4NHEA 3PWSA 1P3DA 4PLVA 3OQ1A 3O03A 1I33A 4I1IA 2BGKA 4MVJP 3JYQA 2IYPA 3VH1A 4A5OA 3A4VA 2I99A 4N54A 5AXBA 4BNFA 1YRLA 3BMQB 3C1TA 4ZU3A 2Q1TA 3IMFA 5KJFA 3F47A 3OIDA 5A9SB 4D0RA 5JO9A 2DUWA 3KYDA 3V1YA 2WDZA 1TT5A 1W73A 1XKQA 2NVUB 3ROMA 3AOEC 1DPGA 1IYZA 2FN7A 3MJSA 2IRWA 2HUNA 2R00C 4R68A 4LW8A 1XQ1A 4LRSB 3UXYA 3I6QA 5F3RA 1LDEA 4YCAA 3NTOA 2XF8A 3L77A 1DIGA 3B1FA 2AQKA 3WYBA 1E3JA 1HZJA 1Z45A 4RZIA 4TWRA 2IYOA 4U6SA 3T7CA 3ENNA 2BELA 1ONNA 4NBWA 1SCUA 3A14A 4K9DA 3H5AA 2Y0CA 3S2IA 1EQUA 3F1KA 4DA9A 2G1UA 1HDZA 2X22A 2GZ2A 1R0SA 1YDWA 3PGJA 4IDFA 5CAEA 5DNAA 5KKAA 1V35A 2P4QA 3ZWVA 1UXGA 1FJHA 2ZQZA 1ZXLA 5TIIA 1CF2O 1GZ3A 4ITUA 4WGGA 3LF2A 4BO9A 1YONA 1Z82A 2RHRA 4FPXA 2DBZA 1KEUA 4JBIA 4NZ9A 4BNNA 5JAMA 3BIOA 5KTKA 4KWIA 5I8ZA 2J8ZA 1U2GA 2O50A 3PHHA 2Y1OA 4PLPA 3K31A 4BO3A 4BV8A 5KVQA 3WGQA 5L4LA 1G6KA 1T2AA 1VPDA 3DBRB 4OOFA 2CVZA 5CHEA 1GCOA 1R0KA 3U5TA 3NRCA 4TKLA 4BMVA 3DBLA 4TSKA 3O9ZA 4W4TA 1QORA 1YBMA 4CR8A 1KY4A 2CVQA 5ENVA 3ZHYA 5BNFA 1Y81A 4O63O 3FWZA 3OECA 4BO8A 3GNTA 1TLTA 1E92A 1U8XX 4I9NA 3U0BA 1HE3A 5A3JA 1TT7A 3M1LA 4CM6A 2BHLA 1NPDA 3CZRA 1EBFA 2X23A 3BMCA 4W9NA 3DEYX 1H9BA 2P5UA 1PGNA 2Q49A 5TT1A 1YB4A 3PZRA 3PHLA 2PGJA 1Y9EA 3F3SA 3TFQA 3ZWCA 2EGHA 4KQWA 3QWAA 4JNKA 3WLEA 4LMRA 3DC2A 1Y5MA 3PXXA 4YJFB 2I9PA 4L74A 1ZK0A 1MG0A 1CJCA 3LVFO 2JD2A 1NR1A 2V6MA 3PJFA 4JLWA 5T8KC 4DPMA 1ISIA 3DMYA 1I3KA 3HUDA 3GUYA 4HV4A 5KKCA 2WWRA 3OEYA 5L7TA 4CLRA 2PKQP 1HEUA 4N5LA 1YJQA 2Y1GA 1GQYA 4FFPA 3ONFA 5L3ZA 4PG6A 1LC3A 3ADOA 4MKRA 4CM7A 1EUCA 2IXBA 2BFAA 4MIEA 1ZSYA 4IJWA 1WZIA 2NQ8A 1XGKA 1V3TA 1HDYA 4YEDA 4CUJA 2V6BA 2WSBA 3G0OA 2VUUA 3GDFA 1ZXBA 3FSRA 1L1FA 1LDYA 4D7AA 4XYEA 4I5DA 2PY6A 3RVDA 4UUPA 4EITA 2E37A 1LUAA 3QVOA 1XSEA 5L95A 1I2ZA 1H9AA 1VJ0A 4JX8A 3WS7A 3OP4A 5G2OA 1C1DA 4M55A 3VDRA 1MC4A 3NT2A 4ESOA 3INTA 3DZJA 1EMDA 2AG5A 3HFGA 4YACA 2EJVA 2W98A 3FI9A 1ENOA 2EGGA 1U4SA 4I5GA 4WOJA 3BMOB 3BTVA 1RKXA 3KSUA 1NAHA 4IGEA 4CLRB 2GGSA 2GN4A 2X5KO 3RC7A 3PLNA 1E1NA 3S2FA 4D46A 5LCXA 4YWJA 3DAGA 1TI7A 4D3DA 2P9GA 4YXFA 3TWOA 4WK6A 5T57A 2ZCUA 2YFQA 3HQ4O 3HDJA 4CM4B 4DMMA 3PIDA 4GKVA 1FXSA 5GZ1A 4OAQA 3U4CA 3E03A 1AHIA 3CMCO 5F1KA 3PHIA 1U3TA 4F6LA 1LSUA 1WVGA 4AJPA 3AK4A 1ULSA 3LLSA 3L6OO 3NJ4A 5JFOA 1GUYA 1K6XA 4HP8A 3JQDA 4GH5A 2JAHA 1ZZEA 2VRBA 4D0SA 4JP3A 2R2GA 3OM9A 3SJUA 3AWDA 3NDJA 2Y66A 1P1HA 4GX2A 1JDJA 1KYQA 4DBZA 4EYEA 4LISA 1U5CA 1XHLA 1Z73A 2IEBA 4FFOA 1JLLA 1KEWA 4XIYA 4PVDA 3STHA 4J2OA 2NTVA 4A10A 4AJ2A 1IUKA 4NU6A 1NHGA 1VKNA 2O3TA 3VKUA 4FC6A 2NVBA 4FD3A 1PJBA 2O2YA 2AG8A 4ZRNA 1LSOA 4R51A 4IIUA 4U0KA 4OSOA 3GGGA 1DRUA 3QHAA 2GN9A 2FZWA 3H6KA 5G0UA 4E4YA 1HWYA 2DU8A 3HSKA 4KDEA 1P1IA 4II2A 2J6IA 4QO7A 5TF4A 3DOCA 2EKQA 3Q0EA 5I9MA 1UJMA 1A4IA 4E2XA 3WJAA 1N1GA 3L07A 4HFNA 1Q7GA 1HETA 2ZB3A 5C37A 3I4FA 3AU8A 4R5MA 1UR5A 3IUPA 3IP1A 1PZFA 1UP7A 2W2LD 3ZU4A 5DCYA 3NT4A 1WDMA 3ROKA 3DONA 3DR3A 3HE3A 1C1XB 1GFSA 3P5SA 5JAQA 2I76A 1PJSA 3C7DB 3H9EO 3O8QB 4W7HA 1ISHA 2AEMA 3E5MA 4H7PA 4LMPA 3E48A 1DO8A 4F46A 1E6UA 3PYMA 5ER6A 1U3UA 4YAKA 4R54A 3K2EA 4NPCA 1X1EA 2CDCA 2VTEA 1U2DA 2O23A 5KIAA 4ND5A 2NU6A 1ZUD1 2GR9A 4J4BA 4AG3A 3I1JA 1YXMA 4W9NC 5CDTA 1B15A 2Z1MA 4EEZA 1T4DA 1E7MA 1VE9A 3COSA 1DDOA 1LDNA 3OETA 2IZ1A 3SX2A 1HDRA 2RCYA 3FBTA 1E0DA 4ZICA 3E9QA 4XDZA 5DCWA 2IZ0A 3VAZA 5FI3A 2R6JA 3PJGA 2YFHA 4UUNA 1PEDA 1X13A 1KVRA 1PZEA 5IDYA 2VT3A 4FCCA 2W2LA 4ZA2A 2FSVA 3AY7A 3ZNNA 1EFKA 2B5VA 1AXEA 1GYRA 2A35A 3TRIA 4PLZA 4W6ZA 3DMTA 2O3JA 1H6AA 4IUYA 3ITKA 3B6ZA 1EQ2A 3GZ4A 1PJ2A 4ID9A 2Y1FA 2X0JA 5JMWA 3DHEA 3BZUA 2UYYA 4N7RA 5HS6A 3WIDA 3TL2A 1U3WA 3GF4A 3OMLA 3GZNA 4G5HA 3Q9UA 2BRUA 4FFRA 3NGLA 4EJ0A 2PV7A 3KB6A 1M6WA 1E77A 1R37A 3JQ7B 5C7IO 3GOHA 1UZNA 4CLEA 4NFYA 4UEJA 2VWQA 3ETDA 2YY7A 2QRLA 3QV1A 2DM6A 1ISGA 4GL4A 5A4DA 3QRWA 3HFSA 1P33A 3GEGA 4FBGA 4L0QA 3UAGA 2VRCD 4D79A 2NUAA 3GDGA 1DHTA 2HMWA 4OO3A 2D8AA 2GO1A 4AJIA 2AEFA 2FOIA 3WFJA 1QV6A 1ZEJA 2VTDA 3B1JA 3D0OA 4MIOA 3BHIA 3V2GA 3DHNA 3F6YA 4E12A 3BA1A 4OOEA 1DIBA 4Y67A 3RKRA 3RJ9A 4UUMA 1K5HA 3OQ6A 3EVTA 5K6AC 2D0IA 4Q3DA 4O5OA 1UZMA 3W6ZA 2IODA 4L4RA 4XGKA 5JE8A 2WMDA 2EG9A 4HNGA 3GGOA 4BNTA 4CR7A 3R3JA 3ST7A 4FSHA 3VPXA 1T2FA 2QYTA 4GX0A 4XKJA 3SC4A 3UCFA 1HZZA 4P38A 4AJLA 4L8VA 2YQ5A 1WXDA 4PG8A 1VL6A 2RAFA 5A3VA 1QV7A 3GFBA 3H4VA 2YQ4A 2QHXA 3RU9A 3G49A 1GPDG 1I10A 1P31A 3GMDA 1IB6A 4DXHA 4J91A 5JPIA 4BMNA 1ISMA 4BIIA 4TQGA 3Q9NA 1P0CA 4WCFA 1GYQA 4WNIA 4GVXA 5KJ1A 1WMBA 3DBVO 1PQUA 3VZQA 4DYDA 3QE3A 4KTVE 4BS9A 1GY8A 2X58A 3EYWA 4BNZA 2NWQA 4ONEA 1K6JA 2CF6A 3AUAA 3I9OA 2BFPA 5LDHA 4Y6SA 1V6AA 1NR7A 1VL8A 5BSHA 3DOOA 4HFJA 2PZLA 3ULKA 5CDYA 3ZDFA 3DXFA 3PGXA 4J2HA 1X7HA 4EJMA 1MX3A 3WGGA 4L4SA 3L6DA 2E48A 2YV2A 4XQGA 4YVFA 2GD1O 4FFLA 4QQRA 4CQMA 1SEPA 3TOXA 2DTDA 3PJEA 1ZH8A 1DB3A 3EMKA 4PIVA 1P44A 2DBQA 3NDRA 4YJFA 3TJRA 3GQVA 3RBZA 4RF3A 1HLPA 3GVXA 2UUOA 4YAEA 3ZZNA 3ZV5A 4EUEA 1OAAA 4DRYA 5HTOA 1Z7EA 1EZ4A 1VSUA 1Y8QB 4RF5A 1GQ2A 4P22A 1Y9AA 1YQGA 5AQ1A 5ITVA 5TLSA 5LC1A 1Z74A 2VRCA 1XG5A 3HJAA 2GRAA 4RJTA 1UXIA 4HBGA 4J90A 1D3AA 1H6CA 1DFIA 4R4JA 5I7VA 5EQFA 5A05A 1YL5A 1IPEA 5ENDA 4G65A 3INRA 1XYGA 3BMQA 2JHGA 2FSSA 3AI2A 1RM4A 3GVPA 4CL8A 4HKTA 1ADGA 3DQPA 4J3FA 3BAZA 4CV3A 4PRLA 2BKAA 3DHYA 1VSVA 3BXXA 5CG2A 5JC1A 4D41A 2QW8A 1EE9A 4KDFA 1VC2A 2ZB7A 4R3WA 2YDXA 4PZCA 1Q2XA 4UVIA 3N7UA 2WD7B 3C24A 3ON5A 5JO0A 4AJ1A 3K2BA 4I9UA 1IULA 1DC3A 4ND4A 5JS6A 2OBNA 3OJEA 5IN4A 2PWZA 4BNWA 2P68A 4KQXA 5LDGA 3DBHA 3MTGA 3CPSA 4PRKA 2OL4A 3Q11A 3U49A 2OMEA 1MGOA 1RPNA 3D64A 3HHPA 3UUWA 1T2EA 4E5YA 4N18A 4B8ZA 2WYWA 4IPTA 2ET6A 3TNLA 2GYYA 4LCJA 2J5QA 3U4DA 2G17A 4ILKA 3G1TA 1ZW1A 1NPYA 2O3UA 3GG2A 3GRPA 3IAHA 5A5FA 2EW2A 3AOGA 3OA2A 5AXCA 4ZHSA 4EUFA 2EEZA 1WAMA 1C1XA 4A73A 3OF2A 4DBVO 4ND2A 2QZZA 1B3BA 1GU7A 1MV8A 5A06A 1K6IA 1E1MA 2JKVA 1QLHA 2H6EA 3P2OA 5F5LA 2G5CA 3ENKA 1G1AA 5DP2A 1PGPA 4DLBA 4BO2A 4OKNA 1LU9A 4CM1A 1CQJA 1R4NB 3Q2IA 4NBVA 4BVAA 1YQDA 3UICA 5JAZA 2DT5A 3NTQA 2I5PO 4R69A 4IDGA 4CM8B 5I7EA 3V2HA 1LLUA 2YZ7A 8ADHA 4DPLA 2JAPA 1K3TA 2YDYA 4Q39A 3BMCB 1L7DA 1NNUA 2HJSA 1MLDA 1T25A 1V0JA 4E30A 2O48X 4BNGA 2Y0DA 1EBUA 2EWMA 2Y1DA 4XRRA 2W8ZA 5A9SA 2GUGA 2D1YA 4I9HA 3NEPX 3GA0A 4HX5A 3D7LA 2YJZA 3LC7O 4YPOA 2Q3EA 2TMGA 3GDOA 3I4CA 1H6BA 4BKUA 2PA3A 3LC1O 1ZNQO 4CV0A 1UP6A 2VHXA 1PJ4A 4DQUA 3SC6A 1KC1A 2Q2QA 4J7UA 2FWMX 4EJ6A 4DTIA 2G82A 2HSDA 1BWSA 2X5JO 3K73O 5T6BA 3CSDA 4PZDA 2JD0A 2UV8A 1D1TA 2VWPA 4RVUA 2FP4A 3JTMA 2BGMA 3EGOA 4S3MA 5AXAA 4FW8A 3M6IA 2ZYGA 3VTFA 3PHJA 5JDCA 1EK5A 3D1LA 1N7GA 4GGPA 2FPGA 3QQPA 4OYRA 4N5MA 4WLUA 1BDMA 1IZ0A 3QP9A 4YYZA 4UEOA 4BNXA 5F1PA 4E6PA 3ZU3A 4BQPA 5KOIA 3C1OA 5DCUA 1EUZA 4ALLA 4QO8A 2DPGA 3JCZA 3GLQA 1VM6A 4XD2A 2X4GA 2OP0A 3L4SO 3IIEA 2GDZA 4TVOA 1I3LA 1FDWA 3GUCA 3WIEA 1GV1A 1NBOA 3UOGA 3WG9A 2B4TO 3I9LA 4QFCA 4E5KA 5KVSA 2WJPA 4WEOA 1U8FO 1M76A 4KP7A 3V1TC 4OIMA 1P1JA 3DFUA 3H3JA 3ADPA 1JAXA 1DFGA 1GUZA 2VOJA 1DRWA 2OBYA 3LT4A 4MVJG 3RROA 1ARZA 5BNTA 5JC8A 5GMOA 1NFFA 4JJGA 3W8DA 3JQAB 1UP4A 4NG5A 1JQBA 1OI7A 1EEHA 3FTPA 1F06A 3L9WA 3SXPA 3T4XA 1EVIA 5IF3A 3NAQA 4J6FA 1V3VA 3FNGA 1A9ZA 1IE3A 1JN0A 3WWYA 1GQQA 1GZ4A 3GH3A 4PLGA 5G4LA 2EIHA 1YOVA 2PTGA 3RC2A 1A4UA 5J23A 1MP0A 3AW9A 1LLCA 5IXYA 1LI4A 1I32A 2VWHA 5COQA 4AJJA 1Z75A 2J3KA 2X6TA 3GNQA 4J43A 1VI2A 5TQVA 2PD3A 3I9NA 3RBXA 1EK6A 3D4NA 1XIVA 4GX5A 4AJNA 4BKQA 3X2FA 3JQ7A 3DWFA 3OIFA 3RC1A 2ZK7A 4YR9A 1W0CA 2OFPA 1DAPA 2EKPA 3GN2A 4BQRA 2GASA 3OH8A 4E2WA 3H7AA 3MZ0A 1SOWA 5L4NA 1LRLA 3ANNA 3E9MA 5U4QA 3WXBA 2VYNA 1A5ZA 2C29D 3I83A 3PHGA 3MOGA 3WQSB 1RJWA 2CVOA 3RUAA 4BNKA 4NNJA 3ICCA 5CPBA 4E3ZA 1D7OA 4AFNA 3Q6IA 3TSCA 4GPD1 4WJZA 4W99A 3PDJA 3RCBA 1CYDA 1W4ZA 3C7CB 4CLXA 1GPJA 1PJTA 2JJYA 2YHIA 5B1YA 4FOOA 1U1IA 1R66A 2GERA 2GPTA 4UEKA 3V2UA 4BO4A 1C0LA 1BHSA 3SBOA 4RPJA 1MFZA 1Q7BA 1TA4A 3GHYA 1YDEA 2EP5A 1ISFA 3KM0A 4TZTA 1DAOA 1PTJA 5C5IA 2B4RO 3RAJA 4Q3NA 2O4CA 3KSDO 3FR8A 4WASA 3PFWO 4YQYA 3JQ8B 3TZKA 3RWBA 3DFZA 4XYLA 5JCJD 1E3WB 3D3WA 1LXCA 1NWHA 1O95A 1H2HA 1EVJA 3KEOA 3CZMA 4HXYA 2PZMA 2Y1EA 1QKIA 2XXJA 1GEGA 1ZBQA 4YRBA 3LU1A 4U0JA 3E9NA 2HMTA 4ZRMA 4E2YA 3ASVA 2RH8A 4IDDA 4TVBA 3TPCA 3TZ6A 2GNAA 4B7XA 1XU9A 3CE6A 3JQ6A 4D3FA 5C7LO 1J5PA 7ADHA 3ZU2A 3SLKA 4CMAA 3DAPA 4YJHB 4PGFA 4CODB 4Z0PA 2QRKA 4IS3A 1M2WA 3HN7A 2B37A 4QTZA 9LDBA 2DTEA 2Q99A 3V5NA 3D4PA 4R9RA 5U9CA 3E18A 3PLRA 1U4OA 2DUUA 5EINA 1R4MA 1XU7A 2OORA 2YW9A 1QYDA 2HJRA 5G0TA 4CM3A 2GN8A 2UUPA 1VRWA 2ILTA 2DVMA 4RF2A 3T4EA 3HB5X 1U28A 4UUOA 1NASA 3MOIA 3WGIA 4L9RA 1C3VA 3ORFA 4DC1A 1WW8A 2O7QA 5HBRA 2JCXA 4RDIA 2JHFA 2UAGA 3KYCB 1BRMA 2VYVA 4JN6B 2BH9A 5ES3A 5CEFA 4IDAA 3W6UA 3GEDA 3VH4A 2FHSA 1SO8A 3D3WB 1N9GA 1DJNA 3PWZA 3QWIA 2OXIA 4ALMA 1I5RA 3I52A 1WNTA 1CERA 3PK0A 2RBEA 1BW9B 3U4IA 3AY6A 4OJNA 4ND1A 5EQDA 3ZW9A 3DB2A 1H0KA 1PL8A 2W90A 3CKYA 3VPSA 3S2EA 4CM4A 1PZHA 3DTTA 1N2SA 3K96A 5CFZA 4YA6A 4PVCA 3NTRA 4U6QA 3EW7A 4CMCA 5KVCA 4DREA 4CMEC 4PG4A 1LEHA 3WDSA 3UH1A 1ADCA 4RVSA 5A04A 1IHYA 3BTUA 1PGOA 2HLPA 2O4UX 3RQSA 3M2TA 1SBYA 1ORRA 5HWSA 1ZMTA 2HMUA 1IL0A 4DUPA 1ZFNA 2B36A 4CM9D 3PYLA 1QG6A 1E3EA 1RM0A 5TSDA 4LSMA 5BSEA 2B4QA 3KYCA 3OJOA 4PFJA 4EEXA 1R15A 4GKBA 3L6EA 4IJVA 1PU2A 5IZ4A 4AL4A 1DIAA 3E1KA 4LGVA 4NBUA 2Q50A 5DN9A 2BI7A 2ZYAA 1YL7A 2IDZA 4K6CA 4HNHA 4ZN6A 1DJQA 5MGBA 1E7RA 2G0TA 5CP8A 3CINA 3ZWWA 1Z6ZA 2HRBA 1PJLA 2I3AA 2CSUA 4WLOA 1UH5A 4Q9NA 4H16A 4OXKA 2OGUA 2X5OA 3ZWMA 2J5KA 1RYDA 1HDOA 1N1EA 1PIWA 2OOSA 3DDNA 3CTMA 4E32A 5GZ6A 2QYSA 3JYOA 5JCXA 1Q7CA 3D4OA 4J1SA 3IS3A 5DF1A 4ALIA 1P1RA 3KRTA 4JQCA 2Q4BA 3U4HA 3VZRA 2YYYA 2GSDA 4OMUA 2EKLA 1S7CA 4NK5A 3GY0A 4ZJUA 4GI2A 4XCVA 3GPIA 4BO7A 4ZQBA 2NM0A 3KXDA 4U8GA 4JXKA 5EERA 5F5NA 4NBTA 5L9AA 3ZV4A 4RGBA 4CR6A 3Q2KA 1UAGA 1R0LA 3KLPX 3QWBA 1HLDA 4NJOA 1U3VA 1P9LA 2V7PA 1XDWA 1ID1A 1DOHA 4R01A 1N8KA 3RBVA 5FEUA 1HE4A 2J5RA 3TL3A 2XXBA 4GLOA 3H5NA 3E8XA 4Z9FA 4NMHA 3RUDA 1YOVB 2XOXA 1L7EA 4PLYA 3WGOA 1Y8QA 3AFNA 3HN2A 2B0JA 1SPXA 3A1NA 4XA8A 5BR7A 3H9JA 4CPDA 4RL6A 4MIYA 2E49A 1LDMA 1W6UA 4RCVA 4E13A 1QYVA 3S55A 3UGKA 3SEFA 4WOKA 3JD4A 3PQEA 1Y8RA 2DAPA 8LDHA 2EXXA 3UF0A 2ZB4A 1FDUA 3HWRA 2VZ8A 4R16A 4BB5A 4OXYA 3JYPA 1RWBA 5I8WA 1YKFA 5T67A 4M1QA 1ZK1A 4BNMA 1R6DA 5EPOA 1O89A 4E5MA 3VH3A 1I30A 5FYDA 4BO6A 2AE2A 3Q3CA 4D3SA 5MDHA 1BDBA 2BGLA 3WMWA 1OOEA 2CMDA 4WNCA 3K92A 2Q4EA 5G4KA 1KVSA 5H81A 1FDVA 2FY8A 1GTMA 1LBEA 2QZ9A 3CIFA 1VKOA 3S8MA 2YV1A 4LK3A 1PJ3A 3GRKA 4J7CA 4RDHA 3R6DA 2X1HA 4R1TA 2W4QA 4O59O 2C2YA 3A28A 4WECA 3ABIA 1D4FA 4XJSA 2VUTA 1O8CA 4D44A 2PGDA 1MA0A 2YHIB 2FPPA 4BV9A 1QRRA 4KWHA 1J6UA 5ICSA 5AVOA 3DZIA 1QR6A 1LSJA 1ZK3A 3G3EA 3JD2A 4KZPA 3TOZA 1FF9A 1B3RA 5DOVA 4JP2A 2I66A 3BTSA 3ONEA 3O4RA 1RM5A 3HDQA 2DPHA 5IDQA 1F12A 3JQ8A 3VZPA 4G2NA 1B8PA 1OMOA 1C0KA 5TC4A 3HG7A 4YDRA 4MVJD 3KYBA 4FIZA 4BNVA 3KETA 3KOUA 4ZQFA 3ZHXA 1E5LA 1HDGO 1LNQA 2Q1UA 4P4LA 5CPFA 4M87A 4CM5A 1I01A 3KLMX 2F1KA 1WDKA 1RM3A 3DOJA 3L4BA 5IJZA 3CEAA 1BXGB 1BVRA 5IN5A 1IOLA 3SLGA 3QY9A 1PR9A 3FR7A 3ZV3A 2QRJA 4WLNA 4Y6RA 4DLAA 1DRVA 2Y1CA 4CMKA 1DIRA 2ZTUA 3JYNA 4I5FA 4RV9A 4YT8A 1VJ1A 4MVJI 1YH3A 3Q1LA 3TZQA 4DPKA 1AHHA 3AUUA 1KEVA 2C5AA 4EI2A 3SVTA 3RUHA 1J0XO 1JKIA 2C7VA 3TZHA 5KVVA 4MVJE 2RHCA 4QEDA 3LDHA 1N7HA 4NFHA 3D5QA 1H2BA 4FB5A 4WUVA 4BHTA 1PS8A 4UVDA 3FN4A 1YS4A 1NPTO 3R0IA 4GLLA 1X7GA 1KVUA 2GF2A 3NT5A 4E31A 3U3XA 1V9LA 5C3MA 1HXHA 5BQFA 3H9GA 4DIOA 3GG9A 3NGXA 1NYTA 3B70A 4B3HA 1PWXA 2DFDA 4GSKA 2HMVA 1IPFA 3GMSA 3ZWPA 5I7FA 2EERA 1HRDA 3IKVA 4NK4A 3VPGA 2CD9A 4Q3AA 4NI5A 2AA3A 3PI7A 1GYPA 2DBVO 1HYEA 1HTBA 3ZWNA 3F1LA 4J1NA 5F21A 3WYEA 2GZ1A 1ZO8A 1E7WA 2CZCA 3PFFA 4FOSA 3GGPA 3H2ZA 4JJIA 4TRRA 3W4IA 4E5PA 2C7GA 3GVHA 4WE3A 3KSZO 3UFXA 4MDHA 4DC0A 2NU8A 4GMGA 2ZYDA 4PLCA 3H2SA 3L4BC 4PLWA 2AHRA 3WNQA 1J4AA 2AEJA 2AQHA 4BO5A 3BMNB 5L4SA 4NDNE 4R1NA 3IDSA 3DZGA 3WQRA 1XQ6A 4ZD6A 1CDOA 3I6IA 2PFGA 1YWGO 3KEQA 1HT0A 3LQFA 4XRGA 2C20A 3LK7A 4FDAA 2P2SA 4CUZA 1P0FA 3EVNA 3G17A 4BNIA 5ICMA 5A5EA 5THKA 2Y67A 3WTBA 3IOYA 3ZU5A 1LX6A 1N92A 3WOHA 2VWGA 3JQAA 4E2ZA 4JBGA 5TS3A 3KTDA 1YBVA 3UW3A 4DWVA 1KIFA 3JSAA 1KBZA 3GZNB 4XGIA 1ONOA 2J3HA 2O3RA 3UCEA 4FJ2A 4IXTA 3EY4A 3GEMA 3N58A 4F3YA 1B2LA 1LQTA 1T24A 2VZ0A 3DZBA 4NH4A 5EESA 1DC4A 1UAYA 2BI8A 4P4GA 4XX0A 4C4OA 1B26A 1MXHA 3ZI0A 3QJ5A 1C0IA 3FHLA 2P9CA 3B1KA 1QMGA 3M2PA 1O6ZA 4II3A 4B4WA 1A9YA 3RI3A 1LLDA 2NVUA 1YJ8A 1SNYA 1F14A 4ALJA 1BSVA 2DBRA 1NM5A 5KJCA 4KMSA 4CQLB 3CH6A 5TX7A 4MVJM 4PN3A 2D2IA 4B4VA 1PR3A 5G0VA 4RVFA 3KUXA 4BKRA 1ZSNA 3WTCA 5JCJA 3FF4A 3ICPA 3EZYA 5DZSA 2HCTA 3EC7A 2JFHA 4A26A 5FWNA 2BMAA 3NKLA 4D42A 3KZVA 3DBHB 4C7KA 1SB8A 5DP1A 5IZCC 3NX4A 2LDBA 5FI5A 4K6FA 1XCBA 3I9MA 2Q2VA 3LC2O 3AUTA 2DFVA 4QX6A 4I5EA 4MVJH 4RVDA 3X2EA 4I8XA 4LVCA 1H6DA 1E3IA 3I23A 5L51A 4B79A 1ZJYA 4E5NA 3V8BA 4BKPA 4RQTA 6LDHA 4DL9A 3UHAA 3W4KA 2AXQA 3P2YA 3PTZA 2B83A 2OP1A 2Z1NA 3GPDG 1YO6A 4CLOA 4Q3CA 1EDOA 4UVEA 3OEWA 5JNLA 1ZVMA 1BGVA 4BO1A 1M6HA 4LRTB 2RH4A 5CEEA 2G76A 4QXMA 2D3TA 4NIMA 2NACA 4EW6A 1Y7TA 2VHZA 5CDUA 5CG1A 3HADA 5K6AA 2Z5LA 3K5PA 5TJHA 2YV3A 4UREA 4IJKA 1E3WA 2EV9A 3IJRA 4Z0TA 3CXRA 2BF7A 3PJDA 4BL5A 3AU9A 1P1FA 3H5RA 4B4OA 4YQZA 3FNHA 2CY0A 1NQOA 3MEQA 4I08A 4XYGA 5AOVA 1K0UA 4R3NA 4NFSA 4QECA 3WX0A 2Q45A 5B12A 4GX1A 2TMDA 3VTZA 2X0IA 4PG5A 1YGYA 2DTXA 1X14A 5DBGA 3WICA 3VDQA 1DSSG 2SCUA 5K0ZA 2VOEA 1CWUA 4DIBA 4E21A 2ZTVA 2C54A 4BO0A 3ZNOA 4H15A 4UULA 2OO5A 3FNFA 3GVCA 3TDKA 4IMRA 4J0EA 2I65A 1LLQA 3ZWBA 1GZ6A 1BXGA 1LTHR 4CL3A 3IUSA 1FK8A 1F0YA 1E6EA 2HMSA 1GV0A 1E1LA 3RIHA 3DZHA 3EUWA 3ZH2A 3MCVA 3TFOA 4IQGA 3JQFA 2XAAA 4GMFA 4DVJA 2BD0A 4OXNA 3A06A 5KJEA 4GSLA 3JQGB 1CIVA 1NTOA 1JW9B 3IP3A 4J0FA 5I9NA 2HQ1A 2OUIA 3L0DA 1NQTA 3JQ9C 4DMLA 3LYLA 3MWEB 4J16A 1JU9A 3GR6A 5HS4A 4Z0HO 4YT4A 3GNSA 2ZTLA 4IGFA 3FWNA 3QW2A 3WSVA 1I2CA 1PL7A 2WM3A 1OBFO 5T5QA 2AQ8A 1E6WA 3FBGA 3GVIA 4DLLA 4C7JA 3HDHA 1MFPA 5JMPA 1A72A 4IXWA 4F45A 5HA5A 1PWZA 5F1OA 1MUUA 4M54A 1QYXA 2NTJA 3OICA 4J49A 4Z9XA 2CNBA 2E6UX 4XR4A 4YB8A 3UKOA 3VKVA 1G0OA 1KC3A 2WEKA 2Z95A 3CMMA 4QFDA 2ZQYA 3O38A 4Z6KA 3VC7A 3PYXA 4BGUA 3WMXA 5K9ZA 3F9IA 3DL2A 4DGSA 2VQ3A 3K9QO 4BGIA 1Q0LA 4WLFA 5KCZA 4IIVA 5JAIA 3OFSA 5T64A 4CMIB 4CLDA 4KUGA 5KWEA 2PR2A 2F00A 1GAEO 3ASUA 3GC6A 5EJ2A 5ILOA 3SJ7A 4MP8A 1Q0QA 1GEEA 4RVHA 5CDGA 5G0SA 3WR5A 4RPKA 3WGTA 4URFA 4J9UE 2FMUA 3PPIA 4M86A 3MJCA 4UAGA 5BNIA 4CQMB 2C82A 3FD8A 1GUFA 5L45A 3C85A 1JKJA 4ALKA 3AFMA 3MWDB 2NTNA 4NBRA 4XB2A 4HY3A 4BNJA 4YAIA 4IZIA 4RQUA 3AJRA 3PDUA 2O3SA 3FNEA 4R9SA 5H83A 1E7YA 4Z3DA 1FDSA 2VYVD 2P5YA 3TZCA 3C8MA 5L7WA 1JWAB 3KVOA 4GWGA 4IMPA 3AM3A 5DBFA 2H5LA 1YBAA 5CEJA 1HE2A 3RU7A 4CQMD 2A4KA 6ADHA 4MKZA 4JCOA 1DLJA 1AN9A 5DULA 5ADHA 4H3VA 5JYEA 3KYDB 5ILGA 4D43A 1JVSA 4YJGB 2A9FA 4YJGA 4BNUA 1T4BA 1A7AA 3I3OA 4ALNA 2ZTMA 3GK3A 4AJOA 4NJMA 3PRJA 3RUCA 4R1UA 2CFCA 1T2DA 4CV1A 4FJ1A 1JTVA 2JCYA 1PGQA 2Q1WA 3ZV6A 3PQDA 4WCDA 3AM5A 3PWKA 3TF5A 2I3GA 2QG4A 3LSYA 3IL2A 1GD1O 1H5QA 4FN4A 2P91A 3WGHA 3A9WA 1LRJA 2GN6A 3GAZA 2X9VA 1PS0A 3DO5A 2JD1A 4IINA 2EP7A 4WEQA 1C14A 4R1SA 2IZZA 3H8VA 4HFMA 4AJKA 4PG7A 4XQ9A 1X1TA 4G81A 1BW9A 1MB4A 5T8KA 4B7CA 2GZ3A 1XEAA 3KV3O 2PGLA 4J9VA 5COBA 4LN1A 4Y9DA 4Q3BA 4YTEA 3R3SA 4XEHA 1QYCA 3QLJA 1BXZA 1TB4A 2E82A 3RFTA 3UN1A 2AQIA 5BSGA 4LSWA 1E7QA 5JDIC 2NQTA 1O94A 1HDCA 2UVDA 1YQXA 2WYVA 2Q2WA 3GHHA 3T7EA 1DC5A 4JIGA 5G0WA 3JD3A 4NJMB 4RO0A 1WWKA 5IDWA 4IQ8A 2W2KA 5JW6A 5DDIP 4F6CA 3VPHA 2NVWA 3EK2A 1B14A 5THQA 1ZKMA 1K2WA 3MJVA 3JYLA 1UDCA 3AI3A 4KUEA 5EL0A 4Z9YA 4J1QA 4ZVVA 5JBIA 2QQ5A 2DKNA 2HK9A 1SOVA 4JK3A 3ZWAA 1CQIA 3WSWA 2EJWA 4NU5A 3FCOA 3IJPA 1DBVO 4N5NA 3OBBA
chains in the Genus database with same CATH superfamily
4NZOA 4C1NA 2YUTA 2Q3DA 2Q5EA 4TZ6A 2XUQA 1XRQA 2FRDA 4ZT4A 2J48A 2ZKLA 5LYYA 2R11A 3K20A 4NYMR 1N78A 2CXHA 1KDYA 3WB9A 3ZVLA 1KVQA 3DXXA 5CU7A 5DHPA 3PI6A 1E9CA 4OHRA 4ZI5A 3HKEB 4RXMA 5ER9A 3GLHE 4E03A 2ZM6B 5LU8A 2Q3FA 1W76A 3D0QA 4EJFA 2VHWA 2YJ6A 3S0JA 1C9DB 4NYJQ 4DWOA 1Q3TA 5G1OA 1AGNA 3W05A 4EGJA 1MABA 2R9VA 5KYNA 5KYKA 1E7SA 1ECJA 1EFPB 1UJBA 2WU8A 5F4ZA 5ALQA 2O2GA 2O2HA 3GFVA 2LDXA 1P45A 1OH5A 2EF1A 2J31A 3KWLA 1WMDA 1E2NA 3GT7A 3PR1A 3ZQ4A 3CRW1 3ROGA 1BNCA 2DQKA 2HJ9A 3OQJA 3U44A 1NXTA 3FPFA 3O75A 4TRNA 2ZEJA 5LZ5A 5EJ6A 1TJ3A 5ICEA 1F2TB 3G0IA 1M8KA 4AM8A 2W2NA 3C7TA 1ZGAA 3QLTA 2BBOA 3FWPA 5JD5A 1E61A 5B58T 2X8LA 2VEDA 4QNRA 4YAFA 2LRHA 1JAYA 2A0KA 2AFIB 3SMQA 1MG5A 1NRWA 2G4VA 1X7DA 2EG5A 1M34B 3K5HA 3R5TA 4PW0A 5IFLA 2NUTB 3KAPA 3PUVA 1NUSA 3OESA 3C3DA 4XIGS 3GZTB 1ODCA 5BT9A 3LUHA 3M33A 2PNFA 3JQGA 2GFQA 3MNFA 3P0JA 4IRUB 1PUXA 1OIXA 1OBHA 1K1EA 2N46A 3HU3A 1T13A 5DTEA 1YUNA 3ZJ5A 2QGFA 2BKLA 4OEHA 5AKZA 1QX3A 4BC1A 1VLVA 5IG2A 4DQVA 4H35A 2W2KB 3HLYA 4ZDWA 4BNYA 1QXSA 4X8HA 3G2NA 4URUR 1Z83A 2PD6A 1AHNA 3VXKA 4QU0A 3A8TA 1HL3A 5CVTA 1JEEA 6CHYA 4B46A 5IZCA 3ANMA 3E9CA 1GA4A 4OQZA 4EMUA 3B3FA 2BE9A 3A1CA 2E4WA 1KOGA 3TQHA 1ZKDA 1YL6A 5LQKA 3KHUA 4FYMA 8ABPA 5H5JA 4XGNA 1F9EA 1SPBS 3RTGA 5JRZA 3QA9A 4B4KA 4QDTA 1WD5A 3NNSA 5JYBA 2J3IA 4O6VA 4CQJA 3OI7A 5DWVA 2OC4A 3HXKA 3PICA 4JBXA 1NYQA 2FWNA 4C9BA 3T1HB 1Q3KA 1ZIYA 4JROA 1X0VA 3FKSA 3MJ4A 4P3XA 1WSDA 1WHSA 1E5QA 4YT5A 4CFYA 4CCWA 2QAGB 4J1TC 4MGHA 1PR6A 4WSOA 3DBLB 2WFZA 4P4NA 3RUIA 5ITZB 2BZSA 1JHMA 1IZ9A 3DMGA 1O9HA 4NCJA 4ZFNA 2AJDA 3RS5A 3WYCA 4ITVA 1S9HA 3THWB 1IB0A 4GI5A 3KWMA 2B82A 3OFNA 5CB4F 5JEDA 2CJWB 3NHSA 5JS7A 1KYZA 1G0NA 1XTVA 1WG8A 3QBTA 3S40A 3B3JA 1QPGA 5B4UA 4K7JA 3V8MA 4CMIA 1T8RA 1JF8A 1LDBA 4MR7B 3ZZMA 5L3QA 5HIMA 1TJ4A 3PFGA 1RFLA 4PAMA 4AG5A 3IESA 3HGTA 4ZHQF 1DHRA 1RMQA 1ZCJA 1ZRSA 1VKHA 3MWYW 4IUBS 2R00A 3U3JA 4EA9A 5K03A 5L7YA 1I94B 5FFMA 4PHGA 2EJCA 1Q16A 1UMBB 2YHSA 2ZG6A 3CF4A 3LT2A 5F3DA 4BQNA 3ZHZA 2ZI5A 1WS6A 4CIBA 1YHNA 4OAPA 4BVLA 3MJTA 4GP9A 1MR3F 1Y80A 3BE6A 1CVLA 3H9QA 4X60A 2PCLA 3MMPA 3CLUC 2C1ZA 3DGFC 4J6EA 5TE9A 4CF4A 5AVUA 5FOVA 1WR8A 5LP6C 2PWBA 4LBVA 4JQYA 3CPEA 2EBWA 1XE3A 1DOZA 4F9EA 3KKNA 3HDYA 2QL6A 4Q1CA 1EFLA 5CK5A 3G0GA 3Q7TA 3RFUA 2QOEA 3LBYA 1E8DA 2PFKA 3ESCA 5J63A 3W04A 5FTKA 3IKTA 1SBNE 1SU6A 3D7MA 4ZQCB 4DV6B 2WKRA 3K0FB 3LH5A 3MXTA 2D5CA 2MSWA 3B38A 3QTBA 5FPQA 2EYQA 5A1TA 1O3YA 1NOIA 2FE4A 2A7XA 5I7RA 3CZCA 2ZUEA 1MTZA 4LHYA 5CDFA 2NLOA 4WBXC 1A5TA 1ACJA 2I67A 3EZ2A 3RH0A 2DSTA 3E9RA 1YB5A 4LWZA 4LHZA 2E4AA 2F48A 1CHDA 3ROPA 3C5VA 4W7IA 5DXJA 2I03A 4PGGA 1CUWA 2FSPA 3ZE8A 1T6BY 1FU4A 1V7ZA 4G5SA 4GRAA 3WJ7A 4A03A 2QZ4A 4QM6A 1HSOA 2VDUE 1QQ7A 3QWFA 3H4MA 4FGWA 4FYYA 5D3KA 2XMSA 3DZFA 3G9XA 4IFTA 3R7LA 2K2WA 2R87A 4OGWA 4Q01A 3LA8A 4YJDA 3EBPA 4JX9A 3ELDA 5TEVA 4L5AA 1Z4JA 2NU8B 1LW6E 4JU8A 1XTTA 5DCLA 1ZHOA 3K30A 3MBOA 4JQSA 3FBWA 4QPNA 2IGBA 5DHUA 1ISSA 2XA1A 2VNSA 1I1QB 1FP1D 1RWQA 3HP1A 4L95C 3QEOA 1PZGA 1DAHA 1WZEA 1Z3IX 3O8QA 3ED1A 3LW7A 5DLQC 2VNAA 4FHGA 5M34A 1DG9A 1D8TA 1JG3A 5CVUA 3MIIA 1U8AA 3NH6A 3I5MA 2AN5A 3W7VA 1QYWA 2HBZA 1AV7A 2PSSA 4Q1DA 1FMCA 3INGA 5KAPA 2BM9A 4D3YA 1N2EA 5CIWA 3KFXA 1KO8A 3LQRA 4XVRA 4IIFA 4AZ3A 5BUZA 3A6FA 1FB5A 4HFRA 3CW9A 4FQ8A 2G63A 1B1CA 4LDJA 4PEVA 1NHWA 3EQ2A 3P9RA 1N9GB 4G84A 1JHUA 1RJDA 1NAIA 1NVUQ 1O95D 3PQFA 4OL9A 3VOSA 4WESA 1MW9X 3CR8A 5DLPA 4RV5A 3AHGA 4E2FA 2IBSA 3ZHOA 1KS2A 4YMSA 1E3MA 5FF9A 4AICA 2AFHE 4YMLA 2NZYA 3AHDA 1JTEA 3N5CA 5ILQA 3X2SA 2QYHA 4IDEA 5DISB 2V5AA 3PCRB 2ORED 2VBFA 4YS6A 3HUTA 3RIXA 1YT5A 1HZZC 1L4NA 2HF9A 4RTRA 1O8BA 4LNHA 4MS3B 4PNZA 1G8MA 2XWJI 4IXMA 2Z9BA 1P91A 1XDZA 1F8XA 1IQPA 3OOSA 4PIPA 2VXCA 4TRJA 1B00A 3E6AA 1CVIA 1OWPA 4V2IA 4M1WA 3BMXA 1S89A 4DVGA 3KQPA 3F5SA 1NJ1A 4RZHA 1T8WA 3R09A 3VBCA 4B3BA 3EBOA 3HM2A 5K3EA 1TM3E 3FROA 1E3LA 3GT3A 3HYNA 5J5AA 2DETA 1BTOA 4P7KA 4BOYA 4RVNA 4A8HA 1GU1A 4Z3KA 2FWRA 1EIWA 4JJ6A 5GZ3A 1TTHA 4PFQA 3KR9A 5HOQA 3ZQJA 1Y4UA 2AUNA 2IEYA 3LDUA 4C06A 4NHOA 3MRVA 2VPTA 2AK2A 2JS7A 1I6MA 1W9MA 2I6XA 4JBHA 2IS1A 2WVHA 1CRWG 4E15A 4KXMA 2XDYA 1PUJA 3HMKA 1Z5GA 2OD2A 5DHRA 3FPLA 1TQ8A 4HYEA 3VR2D 4ENSA 5C35A 5REQA 4Y6PA 2QI9F 1NI4A 2IUSA 4P0TA 3U9TA 2C7OA 1CNEA 1MAAA 3R24A 1N9ZA 5FD8A 4OSEA 1AQYA 1EE2A 3AOEA 1N9KA 5BR8B 3LGXA 1L1EA 4UHDA 121PA 3UT5B 1QVRA 2HK8A 2WWFA 3R9WA 2AMFA 1DKPA 1VP9A 3S2ZA 4O8CA 4F21A 5C4IA 1U9CA 1TC2A 3LL7A 3EIUA 4JLUA 1D4OA 1F51E 4C4YA 1U8TA 3QE9Y 1UMDB 1YDGA 4G0XA 4WCFB 5KYXA 3VI4B 2BEWB 2AS0A 3GCDA 3BZWA 1OFTA 3O8RA 2FA9A 5IW8A 5AD1A 1A1SA 1LSSA 2NO1A 4MULA 1BC5A 1CETA 1WCIB 1JWBB 1A69A 2BEUB 2GLXA 2JL1A 1U7PA 2XYQA 3N8DA 4HEHA 5E0OA 4U5QA 4EGFA 3BWVA 3WA6A 3TRKA 1NI3A 5HKKA 1XDGA 3HM9A 2WIAA 4BUJA 3G7NA 2WMOB 1ZAKA 3TSOA 4F1KA 1EVYA 2NUPA 3C43A 3MWJA 1M34A 2HO4A 4ZGBA 2JCVA 3FTNA 3M9WA 4FEAA 2QSYA 5AM5A 5D00A 4MH0R 3WLTA 5SV2A 3I9KA 2M6KA 5G4KB 2VBGA 1BXKA 2VLBA 4PLTA 4HQOA 3UMFA 1T2VA 1ZRHA 2NO6A 3TUZC 2Y6UA 1GPUA 1XAHA 4ZCTA 2FPSA 5IANA 3R7FA 4DMRA 2PBZA 1BCSB 3C6XA 4TTAA 1GPYA 2Z09A 5EVCA 2Z2ZA 3VR3A 4DSTA 4XJVA 3IBYA 3RSHA 5KSYA 3I9JA 5LDDC 4D45A 4DYVA 4KPYA 1CTQA 2PWPA 4ZEWA 2HA3A 1OFGA 2ZB8A 4IJMA 4QARA 4TROA 1YA4A 4GL2A 1EVEA 5B37A 2GZDA 2C9CA 2R4TA 2VDQB 4GYKA 4UEWA 4XTRA 2XCLA 3GJYA 4U7TB 2XHEA 3U62A 4WFQA 1Q6ZA 3OJ0A 1FMFA 3G6WA 4Z4IA 4BAGA 3O0TA 1I8TA 5H3LA 1XNHA 4OKSA 4ZTZB 5K3FB 1PJQA 4MPDA 5ALNA 5BUCA 1NT4A 1W4AA 3EIXA 3TZLA 8ATCA 1HR0B 3EBLA 2WF5A 4CIVA 3K8OE 5C5DA 1U04A 2NXCA 2VCHA 3DOEA 4AJEA 4L6AA 4RTLA 1Z7BA 3HK2A 5FBKA 1Z7YA 1L7VC 1NFRA 3CVVA 4RM2A 4O2BA 2RHBA 1ZR4A 5DN6A 2HU5A 5TVKA 5I5EA 5DYYA 5LNK6 4GWLA 4RPGA 2IV2X 5JISA 4OH1A 1N5DA 2X0NA 2A5FA 4MR7A 3W2EA 3HZOA 2ZRBA 1F8FA 1A98A 4O4IF 4ZTUB 5KINB 5DOZA 2GK7A 1EFUA 1NF9A 4DQXA 2CFTA 2YVAA 4DARA 3H84A 3ZN2A 4RUKA 3EISA 4GAEA 4RLHA 3UAVA 2AZXA 2JLSA 3O1JC 2WD7A 3UWSA 3G8AA 5AKEA 1VBFA 1T0BA 3NC1C 1NT2A 1P29A 2VHVA 2OUKA 5TV2A 3CLRC 3P7MA 5FPYA 1EB8A 2HA7A 2CMGA 5IAOA 1ST2A 2H8KA 2O0HA 2AYXA 1LW7A 1M75A 5B3LA 2O5EA 3H99A 3DDSA 4MGYR 3BGOS 4MQEA 3ABRB 3M6AA 2H06A 4LCEA 3ZLBA 2FF5A 4NULA 1DNPA 1AUOA 4FNAA 4OFBA 3VUEA 3UM9A 1QBKC 2NT3A 4RORA 2GM4A 2Q8NA 3LQYA 2HJVA 3ZDRA 4EPYA 4A2CA 2EX0A 3DEIA 3Q72A 4EGSA 1R3UA 3GFGA 6YASA 2P11A 3K6SA 1Q22A 1YZKA 3NIFB 4NRDA 1R4NA 3AB8A 5CT9A 2P90A 3M4XA 1CSEE 4KUHA 3M6XA 3DWGA 3RKSA 4KMOA 1FRZA 1KPGA 3CUTA 1JQDA 3RK1A 1XF1A 5KNLA 3L7MA 2I2DA 3RODA 3UOWA 4AB1A 3AF0A 3V4RA 4C1BA 4UD2A 1PW7A 2W2QA 2QIOA 5JDCC 3S4YA 3ZYZA 1ECCA 2G7MC 4KSBA 3W8RA 2FOLA 4JCCA 4MOWA 4BBAA 4EGQA 4HYYA 3UIEA 4TKVA 2OZPA 4KIWA 1W85B 4MZDA 1E2FA 4EDFA 2X14A 1R6TA 4D0RA 5FL7A 3MD9A 4TQ9A 4JYBA 3AHCA 4MV3A 4UU1A 1JLLB 5KI6A 2XQGA 4MP6A 4L75A 4P84A 2FLKA 4BUCA 3EDMA 2KB0A 4F3CA 2KBFA 1R8QA 4CM8A 2QE7A 4TRMA 2UUAB 1U7DA 3RUEA 3FLMA 1IQUA 1J2YA 2BLLA 1CEQA 3AJAA 3L0CA 4HNAA 3WGYA 1F8YA 4BRUA 4CV2A 2HA0A 2Q1YA 4MUIA 1P4GA 1DX6A 5JH7A 4LDRA 4K6HA 1LJ8A 1TM4E 1FSPA 4AO8A 3OFND 4IO1A 1DEKA 4JFRA 5GINE 2GI4A 2V4ZA 1QO7A 1CUSA 2GCGA 3F6CA 3BSFA 1OT5A 5HHTA 4ARIA 1FMTA 2PNJA 4LGYA 1AGYA 4EMSA 1KAQA 5K8IA 1U1EA 3AI1A 4YJ2B 1N7IA 1NMQA 2YWDA 3PXBA 4O4LB 1XZNA 5G3ZA 1OHHD 1ONSA 1XYYA 1YRYE 3G0CA 1LQUA 2HRDA 1LPSA 1OAKA 4MR8B 2DE0X 1Y4AE 3IR6A 5HIIA 1CUCA 4OV6B 4A1FA 5JR3A 3M3HA 3I62A 1LBHA 2VK4A 4P3PA 2JI9A 4R2XA 4DEYA 1ZWKA 3IP7A 4I1IA 4QYMA 1UM9A 5B1HA 3ILHA 5HCIA 3NAGA 2IYPA 1VZ3A 5KWIA 2VH1A 1CE8B 1BX0A 5AXBA 3RU2A 4GHWA 4TWJA 4LXGA 4O2AF 1PF7E 1M6YA 4MO9A 1YRLA 3I9FA 5DGIA 5P8WA 2Q1TA 3W9UA 1Y8AA 2V9PA 1CKEA 2GO7A 2WJ6A 2XMPA 5FPTA 1TE2A 2DUWA 4A8JB 1GA1A 2F9LA 2WDZA 1TT5A 2FW6A 1NLZA 2JLXA 4JI4B 3HY3A 4ZYUA 5EWJA 2PSHA 3U40A 1VBMA 4LRSB 1SXHA 4Y0VA 1KJ8A 1MCZA 3I6QA 3WO0A 3G8DA 1ZH0A 2PO7A 4EHHA 4F2HA 4FB4A 5CCXA 3F6EX 4BCCA 4IMIB 1HOXA 2WG1A 3B1FA 4C0JA 4OLJA 4N6OA 1R5JA 2CL0X 3E0XA 1IVYA 4KO2S 1INLA 4LXXA 4RZIA 4YV0A 4TWRA 4U6SA 1TQHA 2ZRIA 1BHO1 2NZVG 2HBRA 3I53A 4A0HA 3DB1A 4JEUA 5KTYA 4M60A 3VGPA 1FQJA 1UBJS 2A8YA 2Y0CA 3ITEA 3LZDA 2RHDA 3KZMA 1FSFA 4A6XA 4UZFA 3IUQA 5ALFA 3HEAA 1EUCB 1J9ZA 2WVJA 4WZZA 2FMHA 1DBIA 1R0SA 1YDWA 5KYUB 1TX4B 1JJFA 5H3HA 4BV3A 3F73A 1QIFA 1Z47A 2GJ8A 1CUUA 2WF8A 2WJYA 3ONWA 1CF2O 1GZ3A 1T1EA 4OJTA 4QBKA 1Z82A 4O2AA 5CRIA 3BRWD 5CFNA 4HRXA 5A1JA 3PLAE 4NZ9A 1DO0A 2WF6A 2V7GA 3BIOA 4MICA 5BN4B 3FF1A 2CKMA 3MMNA 4R2MA 3EVEA 4BB0A 5M04A 1ID8A 3PHHA 1E6LA 3EXIB 4PLPA 4BV8A 1S1MA 4LYGA 4F4UA 1RXSA 5B1EA 3LECA 1E2KA 3WGQA 3TNFA 3KOYA 3Q3VA 1NG1A 1VPDA 4D6YA 4QUEA 3HV0A 2RK3A 1MA3A 4H1HA 1V6SA 3LP6A 4Y6QA 1R0KA 4C4ZA 10MHA 1F4PA 3DBLA 1KAOA 3VX4A 4BECA 1XLUA 2V7TA 4BFLA 1AUVA 1QVZA 2P9TA 4KO3S 1KRHA 4PIMA 4C01A 3UGQA 1YBMA 2G07A 1RRKA 1VPTA 4OX9B 2NYVA 4GECA 1Y81A 5FI1B 4O63O 4RCZA 4FZVA 5L3RA 5E8JA 3W1EA 4MMYB 2IYWA 4X3PA 5E6UA 2FQQA 2DRIA 3LWBA 4C2AA 4DCMA 4QREA 2QPOA 5JBNA 1ESMA 4YJ3F 3ODGA 4EPVA 5DHSA 2FJPA 4W9NA 3DEYX 3LM8A 4H6WA 2GJ9A 4O4HF 1BVHA 3IODA 5TT1A 1JG7A 1S9DA 1G41A 3DEHA 3DLIA 4DQLA 3A3OA 3TFQA 4D0NA 4EKEA 2ZVJA 3BX1A 3QWAA 1GL6A 4R8VA 3WLEA 4ABYA 4LMRA 3DC2A 5EP1A 4HN4B 3TQCA 1SOAA 4WA8A 5EWJB 2C7QA 2CVPA 5K8JB 1RCFA 1MG0A 3V4ZA 3LVFO 1Q50A 3DZCA 1NR1A 4J29A 1Z0DA 3AFHA 4PWYA 4Y2YA 4HV4A 5KKCA 2UKDA 2V45A 5LA6A 3F7MA 1L5FA 1XZHA 5D2CA 5L3VA 1B93A 1P9RA 3R3UA 1YJQA 3VYTB 5AK4A 3VKHA 5EKUA 1R6XA 3BGWA 1XO1A 3QLUC 4ZMBA 3ONFA 3OY7A 5D7BA 3ADOA 4P54A 4ZMRA 1EUCA 1YZQA 2IXBA 3K0FA 4RK1A 2XUOA 1UMCB 4XLTA 5B1DA 3SS7X 2QBYB 2C4TA 1KE2A 1OWNA 3R0QA 3T7TA 2QN7A 4MIEA 3TTUA 3VR3D 2HRCA 2IVFA 4QG3A 1WZIA 1O6CA 2NQ8A 4AD8A 1XGKA 1V3TA 1A50B 3CRRA 4YEDA 3ZI7A 4QVIA 2V6BA 2VUUA 4V2UA 3NBXX 4MI6A 1LDYA 1X7ZB 1H22A 5JG7A 1YS1X 3C5CA 3UV3A 4BE7B 5JI2E 2PY6A 2H92A 1LZLA 2IY7A 4WY2A 4HH4A 5K4AA 2E37A 1LUAA 1SQFA 2P4SA 3B6JA 4OYHA 1W5TA 2DG2A 4ENRA 7YASA 1H9AA 3MJHA 2QP4A 2W00A 4W7SA 4JX8A 2C2HA 2YNMC 1R88A 1YVDA 2WSSD 3OP4A 4H27A 4Q9JA 1EJBA 5EJAA 3WK7A 1E5TA 2IYAA 2OV4A 1GGJA 3AEQB 3VDRA 5I01A 5IT4A 3I8SA 4J0IA 4BVFA 2QJOA 3I6MA 2E3JA 2OAEA 3MT0A 5FWDA 4Z2YA 4PC7A 5JJLA 3DZJA 4GPAA 4ASUA 1E32A 3FI9A 3GWGA 1GPNA 3EA0A 3NNNA 4HCJA 1ENOA 4JJAA 4GC5A 1AD2A 3TJMA 4DV5B 1NXOA 3EG9A 3MAGA 5BW6B 1X38A 4OLFA 2EQAA 4IGEA 1DGQA 3N7TA 4F2WA 2GN4A 1C9YA 3BSWA 3PLNA 4YK7A 3UMYA 1KO1A 1THMA 3I39X 4D46A 2XMZA 1TYCA 4YWJA 3BIWA 3ZUGA 3K5IA 1BMFA 1Z6AA 5H0IA 1EWTA 4CM4B 1TF5A 1GQFA 2Z8ZA 3PIDA 3EDRA 1FXSA 4GKVA 1OV6A 4AUEA 5GZ1A 3U4CA 5KC9A 4O2RA 4LI3X 3FCUB 3PHIA 3NOQA 4F6LA 1BE8A 1Z22A 3KUCA 4AJPA 1NVWQ 2HK6A 4OGFA 3QMVA 1MEJA 1QGAA 4A2PA 1J97A 2CVFA 5LJLA 1A8PA 2V1XA 5CXUA 1G5FA 4C7MA 1KY3A 5DMXA 4HO1X 3NDJA 5FWYB 4EVQA 2Y66A 2V58A 1D09A 1K75A 3H1BA 4DBZA 4XIIA 1JDJA 4EYEA 3T3PB 2WAYA 1NMYA 4L8FA 5C3UA 4I1SA 3G59A 1Z73A 2IEBA 3QKIA 1BCRB 1JLLA 2FU5C 5CM8B 2P2LA 3PEUA 2QUZA 2NTVA 4J2OA 3DEZA 5LBIA 3JVEA 4JITA 2GOYA 3A6LA 3G8YA 5CCDA 5ETJA 2EFCB 3TLAA 1LV7A 3V3TA 1WL8A 3AETB 2N75A 5HFNA 4UUQA 5HKKD 3TRDA 3VKGA 3VKUA 2ZBEA 2R2AA 5AVJA 1KZ9A 4C7OB 4RKQA 2O2YA 1HQKA 1TCBA 4ZRNA 3TO5A 3AL2A 2OM2A 4PXYA 4TV8A 1YA8A 4OSOA 3QHAA 1R0YA 1C4XA 1RJGA 1X7ZA 4WJKB 2VLIA 4II2A 4BP8A 2C2ZA 2J59A 5TF4A 3HU2A 2YHAA 4AZVA 5L3SA 5I9MA 1Z4PX 1SIBE 1NN0A 2AWNA 2P41A 4B44A 4ER5A 3LDFA 1P4AA 2ESRA 3KZCA 1KJNA 3CQ9A 1QIKA 5BWCA 3ETJA 2H7CA 2HWXA 5DW0A 4L3VA 5EE5B 4BVEA 4Q02A 5LZ2A 3REGA 2HEIA 3AU8A 4U9IS 2AGVA 3TE6A 2PS1A 2MYTA 3FI0A 4DRZA 1Z5VA 1U7OA 1WDMA 2AFRA 3B6EA 3CC8A 4MEJA 3DR3A 4MVXA 3TQFA 3N53A 3P5SA 4JA2A 2QP3A 5JAQA 2XTAA 1YZYA 2H85A 4W7HA 4JXZA 3RRZA 2CNKA 1WUHS 2AN9A 2E5WA 1JFSA 3JPYA 4LMPA 3N8KA 4Y9UA 2SBTA 2CUNA 2PBLA 1P2FA 2RKBA 3QNMA 4KLAA 3PYMA 2ZAOA 3FMPB 4BU0A 4ILEA 1TAUA 1WCIA 4R54A 1E9AA 2REOA 4NPCA 2HWWA 1X1EA 1YQUA 1YCFA 2WAOA 5FBWB 1HPLA 2FEKA 3R3HA 4DS3A 1DQSA 3H2HA 5A6VA 2C04A 2OCDA 1ZUD1 5LYJF 2JZOA 4YCBA 3C8UA 4TLMB 5IBQA 4B3TB 3H11B 5LQAA 4W9NC 1FFEA 3MILA 2Z04A 3PGKA 1GCIA 1RIFA 3C0KA 4GP6A 5LYJA 4WNYA 2CNDA 2IH5A 3KOOA 5CDHA 1LDNA 4XEUA 3R9XA 3SX2A 2RCYA 5EXTA 1E0DA 3LPLA 2M6SA 4B47A 4ZICA 3B9QA 1QCDA 3VAZA 2IZ0A 1MZVA 1PP4A 1FFCA 2JJ1D 2R6JA 3QE2A 1BXRB 4UUNA 1W94A 2CL7X 3VMFA 3U19A 1LTKA 1KVRA 3HCDA 4ZI3A 3T94A 3FTFA 1RAFA 1UDRA 2FCAA 4WVLA 1F1BA 3SF8A 2BFDB 3AR2A 2CNWA 2PUEA 4BRZA 2DJ5A 2O1WA 3KQQA 4W6ZA 5F12A 4BVGA 2WV7A 3CVUA 1H1DA 3I09A 3BJRA 1EQ2A 5BOVA 1P61B 1PJ2A 3QXXA 1XCJA 3DHEA 2O05A 2C00A 2OG1A 1CRPA 1JDSA 1JLKA 4N7RA 4DHEA 3ZUPA 2G83A 3OMLA 1ZG3A 1NMSA 3GZNA 3Q9UA 4DV7B 1OYVA 5EZYB 4B3GA 3PC7A 3WJ2A 2KLHA 2PV7A 3KB6A 3DE2X 3JQ7B 2EZTA 2HHAA 3CRNA 1UZNA 3ZX4A 4RLQA 2VWQA 4GL4A 1TW2A 3QV1A 2A0XA 2DM6A 2NAFA 2R47A 2X1MA 5A4DA 4KWEA 2CLCX 4UHHA 3K7EA 3VR5A 4BMZA 5JAHA 4TXJA 4L0QA 3Q3IA 5DTMA 3UAGA 2BSXA 1G2IA 1KO5A 1WE2A 3VYWA 1FX0B 5BSTA 3HKEA 1DHTA 1OBCA 2GO1A 1X1BA 3NIWA 2ZJOA 1KA9H 1W4BA 4NAVA 1BIFA 4RE6A 1Z35A 5EIAA 3WNDA 1PO7A 3ILSA 1C30B 4UU8A 4B6QA 3DHNA 4ZOLA 2VXYA 4F84A 2H2FA 3U26A 1IJKA 1B0ZA 1EGHA 4R0VA 2H1HA 4OCZA 1RHKA 4NE9A 4BYGA 2QD4A 2FVYA 4UUMA 3F8TA 4M0FA 3OQ6A 5CLIA 4H0FA 4RHTA 3ER8A 1HM5A 2D0IA 5BRNA 2PCJA 3DDZX 2NZXA 1VZ2A 3VKFA 1AN0A 1XUOA 4UBJA 5J47A 5KTSA 1AQIA 2QM8A 4O5OA 1AS3A 2H4WA 5HF5A 1NR5A 3LOQA 5DYWA 3K0CA 5HUHA 2FEXA 4AMZA 2WM8A 1XTPA 1DKNA 2YMPA 4LRQA 4K2HA 1G66A 3TW8A 2XBLA 2XNDA 2BP7A 2AVDA 3RSZA 2QYTA 4GX0A 5B1SA 2ORVA 3KS9A 3SC4A 3TB4A 3UCFA 5CB4B 1V2GA 4ZP1A 2XJ4A 2XIQA 4PG8A 1CYEA 4QPJC 4DDHA 1TLFA 2C8JA 3QVGB 4F6RB 5EHZA 2QPTA 3AP2A 4CEIA 2QHXA 3RU9A 2QRHA 3JALA 1I10A 1LBSA 3QYAA 4BMNA 1L7XA 3QPCA 4BIIA 2X1VA 4LC9A 4H0NA 3ZYCA 3E2MA 4WNIA 2J0UA 4GVXA 4YUAA 2F3PA 1T9AA 1GGNA 1Q11A 3LVRE 2YS6A 2MINA 4R6WA 3ZQ6A 1PQUA 1VDMA 2OBXA 1GDTA 3LLUA 3IEXA 3K0KA 1XV5A 2R44A 3UK0A 3N05A 4FHZA 2QTVB 4BS9A 1OFUA 3DMNA 2QEQA 3RSQA 3GRRA 2CFIA 1COWA 3L7AA 3ACCA 3NHLA 4EELA 1ABBA 4ONEA 1DWPA 5TMEA 2XA9A 1SQ6A 2ZW9A 3P4UA 2H59A 5D51S 2BFPA 4BBJA 4EO4A 4Y6SA 4PF1A 1Z08A 1B8OA 1NVKA 2BDTA 1VL8A 1WHSB 2PZLA 2PYDA 4EFLA 3ULKA 4ZT5A 5CDYA 1RR6A 1XPOA 3ZDFA 2BL4A 4EQ6A 4G2NA 5FFFA 1D6MA 3NHRA 4CI0B 3D8TA 3EOBI 1CY7A 2HT6A 2KJQA 2F1RA 3WYNA 1WVIA 2NPOA 3BIJA 4O02B 3THWA 2ANCA 1E69A 3FE2A 3U3MA 1SEPA 3VV2A 3WA7A 4Z9BA 1QHXA 3PNYA 3WE7A 1CLEA 1S8NA 2C4HA 3NDRA 3TJRA 1YVPA 2VA9A 3P4YA 2UUOA 3R6WA 2PJZA 3ZV5A 5KNCD 1U0SY 4YCLA 1GSIA 1R0BA 2GVZC 2XVAA 4RF5A 1Y8QB 2WTUA 5AW2A 1GQ2A 1CQJB 1RBYA 4JC8A 1KI8A 1Y9AA 3HRHA 4N8SA 4P22A 4ZO8A 5LC1A 3JATA 2XECA 3Q7IA 3RYCA 2VRCA 3HJAA 3O7WA 3OF5A 2VZLA 4M6WB 3F90A 4WKBA 2F8SA 3UAYA 2J9FB 3HYCA 1FQWA 4QDOA 3SYKA 3SM9A 3L7OA 3QPAA 4UMFA 1C8LA 4LEIA 3D6HA 4JBYA 1NBWB 2W6OA 3G2PA 3INRA 1T5OA 2Q0SA 5FL3A 2JHGA 1K08A 2BONA 2FSSA 3MUEA 1KBOA 5DEOA 3V9AA 2AUTA 4DLSA 2H00A 1VCHA 4NYIQ 4TSRA 1G2OA 3O3NB 2ERYA 5CVDA 4U63A 1SUWA 3AY0A 5HF9A 3QVGA 4DLXA 5JC1A 4D41A 4M0EA 5FUYA 1CR1A 1JHRA 3AJ8A 3TQQA 2WJWA 1TQ2A 1GRQA 5AI0A 1V5EA 4AF7A 4KXWA 2YDXA 5KTMA 3HDGA 1Q2XA 4JBWA 2DWUA 2QPAA 4UVIA 5SYNA 3L7IA 3TMKA 1IRIA 3FGOA 2OGSA 3IE0A 3S7ZA 1W44A 2GMWA 4TV8B 2VQ6A 2YXDA 3R5XA 2OBNA 4MKIA 4ZI7B 3OJEA 1T36A 2AOUA 1R8XA 5IMBA 1WSWA 1NXWA 3D8SA 3HA7A 4J0CA 1OX5A 3MTGA 2OL4A 2VL7A 4QU8A 2SECE 2P4EA 3V8NA 3NIDB 4AZWA 2B1JA 3HHPA 3D64A 3I1IA 2PL5A 2QTLA 1M0TA 1K8XB 4N39A 1L7PA 4QRDA 4RHYA 2YW2A 1S2LA 3QMMA 3ICVA 3AUFA 3TNLA 4F7WA 1JVNA 2JVKA 2V96A 3GGCA 2J5QA 4LCJA 4OQLA 3U4DA 1SUSA 4N49A 3TQSA 1ZC4A 2QENA 3X1WA 1TRHA 1QO0A 4EW3A 1RHRA 3AOGA 5AXCA 3U7JA 4F11A 1D04A 2BMFA 2H7YA 3E15A 1WAMA 4DCNA 1U99A 4A73A 2NTEA 4GUDA 4UXJA 3CLTD 1CV2A 1UC5B 1TD9A 4E11A 1MV8A 5A06A 1Y9DA 4LDZA 3KOXA 2H6EA 1ZL2A 3ZDEA 1D07A 3LX8A 3UK6A 1G1AA 1WOYA 4MW4A 4ADSG 4DJ5X 4DRXA 4LBZA 1XI2A 5BVGB 4OKNA 1XZ8A 3I9V1 2OFFA 1L5OA 1HY3A 3D6AA 1CQJA 3HCBA 3S1AB 4NBVA 4YGYA 3NWPA 1UADA 3IHWA 1J00A 5FXMA 1K4KA 4AQYB 3UICA 2DT5A 1KXZA 3GXBA 3EMDA 3TTTA 4R69A 1IH8A 1ZOSA 3AR8A 4FNOA 3V2HA 1Z63A 2FEMA 5CIQA 2XBMA 5HDQA 2YZ7A 4PQYA 3L5KA 1EXVA 1ESZA 1K3TA 2JAPA 1Z88A 2WSIA 2YJ5A 4IV8A 4L85A 4CKWB 4E30A 1FS4A 2HJSA 2XEXA 1T25A 1V0JA 3COWA 1ZNZA 3WI7A 1JXOA 4ZOBA 4IUDS 5KOYA 3T52A 3OAAD 3EEFA 2LNDA 3UWOA 2D1YA 2K7ZA 3GP8A 1XLTC 4HX5A 1FFSA 3ER9A 3ICEA 2GLTA 1SC4A 4N01A 3LC7O 4WZBB 4IFEA 3VNRA 3WZMA 4D8WA 1IXKA 4NV3A 3RDPA 4CV0A 4D96A 3TLKA 3L1JA 4G24A 1UBSB 4I55A 1K7FB 1G3UA 4HRVA 4GC9A 5CW2A 4MW1A 1KC1A 3GWZA 4LJRA 1GZDA 1N2CA 3M6WA 2HB6A 2HSDA 1BWSA 4V03A 1UKAA 2ACWA 1DKQA 2JD0A 1QQAA 4LRYA 4NQRA 4Q7JB 2CYCA 2VWPA 3HR4A 4RVUA 4S3MA 1T36B 4B75A 3SZMA 1AKWA 2GYWA 3FVVA 4MV7A 2XI4A 1TKCA 5EEHA 3G5AA 3QBEA 4FOLA 5DGHA 2ZVDA 3PHJA 2PFSA 4GE3A 1EK5A 1FP7A 3AP1A 4RTPA 3MCUA 2IC5A 4LFAB 4OYRA 4N5MA 3IEKA 2ZITA 1JALA 1MO3A 1PK8A 4WLUA 3ESAA 5FNVF 4UEOA 4FXPA 3ZU3A 1TTTA 2FEAA 4YASA 4YC7A 3JCZA 3NVDA 4RZSA 3STWA 3L0YA 2CXTA 4RKWA 5A71A 1H1LB 1VM6A 3HJHA 2C8LA 2ZAGA 4QRIA 2OCXA 3PFCA 1QFYA 4G4SP 4JAVC 1KSHA 2B61A 5D84A 4LOHA 2NV0A 3JRXA 2MTBA 5BNZA 1IM5A 4X7BA 3C41J 3ICWA 3UOGA 3LG2A 5TQJA 2PZGA 5IUJC 1J7KA 3CUYA 2B4TO 5K3OA 3LXUX 2VDVE 1Q44A 3I9LA 3KAQA 4E5KA 1H5UA 4A0FA 1U8FO 3IV7A 4MS1A 5GV8A 2W2MA 1Z6QA 5B58C 2HU8A 3PX7A 1I7PA 1GTL1 1TZJA 3G5LA 4ENUA 1LF0A 1XRPA 2JBWA 1DRWA 3LT4A 1FFGA 1G9TA 5IT9A 2CV2A 5BVGA 3DL0A 4AF6A 2CVHA 1ZXXA 1XJ5A 3RTCA 1OXMA 3EPHA 4JJGA 3I12A 4LRWA 3FTPA 1DC8A 1F06A 3DV2A 3SXPA 3KE8A 4B7ZA 1ACLA 2ZIGA 5IF3A 1VG9B 4XSHA 3IB3A 4KIUA 4X20A 3E05A 3T1NA 3NO4A 3WWYA 1BWPA 1CJTC 3GH3A 5FNVB 3ZIDA 1TQ6A 4DSUA 1NXXA 2RGDA 3PDCA 5FHQA 4DANA 2PX8A 2FSIA 2GKGA 3RC2A 3PJRA 4RFSA 3GBSA 3BRWA 3LYHA 1LI4A 1WUYA 2YICA 5COQA 1F6WA 4F06A 4AJJA 1ZAYA 4XAQA 5HKAA 4JV5B 1NU8A 2ACEA 4JUBA 4JL6A 1XZDA 1XIVA 4LYAA 5CLJA 3EF3A 2A84A 4XM2A 3X2FA 3X1KA 3OIFA 3JWPA 4AYTA 3GEIA 1RBZA 4YV2A 2VJPA 2BDUA 1NVBA 1I9CA 2IS6A 2EKPA 2FSVC 5KDDA 4BQRA 4AU1A 1ZYUA 4EBBA 1ML4A 4I55B 5FWYA 5FPHA 3VR2A 2JIOA 3OH8A 2QD5A 4LHVA 4RFVA 4KQKA 4N03A 4QNNA 4ZCLA 3MZ0A 1SOWA 8AT1A 3OZRA 5L4NA 3IAS1 5FBHA 3B6IA 2XMDA 4DT1A 1JIVA 3DULA 4Z7OB 1RXUA 3IRUA 1Z5PA 2VYNA 4B31A 3OT1A 3V1YA 2A9QA 3MUFA 3OLVA 3WQSB 4B84A 1J33A 4DG5A 1L5KA 2AKAB 3IOBA 4F56A 5ITSA 2BTOA 4RYLA 3BFPA 1JR3E 5IYZA 3LJKA 3QKSB 2IU0A 3GIDA 4QASA 1D7OA 2O14A 3Q6IA 7GPBA 1M2GA 1UC9A 3B82A 2PGIA 4Y2VA 5UKDA 3U13A 4RCYA 2A9OA 1QUFA 4U9UA 2A5JA 4YHBA 5JRJA 2CLKB 1V47A 1M74A 2W6MA 4WDRA 3RCBA 1RXYA 1W4ZA 1X19A 3C7CB 4CLXA 1ATIA 1PJTA 3L93A 1T9BA 1ZNWA 1AZLA 4WBNB 3G85A 3A9VA 4X6LA 4HJXA 2DX7A 3E7FA 3LWNA 4UEKA 3T7DA 1Z6TA 3NCTA 2Q4TA 1YIAA 1Q7BA 3OLYA 3IGFA 1NBMA 1TA4A 3LY8A 3NJRA 3OX4A 2EP5A 3W2GA 3D6TB 3AG6A 1GVNB 1STOA 4TZTA 1PWYE 4EEKA 2O4CA 1S02A 3FOWA 3FR8A 2XB2A 2G1AA 5K3CA 3DMPA 2YIJA 1WBDA 3IDFA 3QJGA 2QZPA 3BHNA 3VV3A 1WETA 2ECOA 3NHKA 4JH0A 3K9CA 3T1YB 1JYFA 4OA5A 1JA1A 4IMJB 4D9MA 1H4QA 3KDSE 1AQUA 2H4FA 1XKLA 2JBHA 4E3WA 4LAFA 3CZMA 3A4NA 1KZYC 4HXYA 1W34A 4IWNA 1JHZA 5AMXA 4KW7A 1GEGA 3FWKA 2XQJA 5H70A 4YRBA 2G9RA 1GGKA 1DDIA 3E9NA 4K6MA 4LVOA 4UJ3A 3ASVA 3BRSA 5LLDA 4TVBA 2GNAA 4B7XA 1XU9A 4JL8A 1W5EA 4DR4B 2BFEA 2IDMA 3C3WA 4IUCS 7ADHA 4OBEA 4PX3A 3FNIA 5CVCA 3ZU2A 3SLKA 2JAOA 1Q7EA 4AY5A 5EJ9A 1EFAA 1GT91 2FUEA 3ORSA 4HB2A 4YJHB 1K06A 5J43A 1V5FA 2VUIB 3I2KA 3ILXA 3OCUA 4NE7A 1G5RA 3CNOA 2O8DB 4C89A 4QTZA 9LDBA 1IWPB 2DTEA 3AKEA 4UPVA 5CA0A 4RTNA 1NL3A 2Z4RA 1I14A 3EZXA 3QMWA 4NONA 1MO6A 2PV0A 2YBEA 3D4PA 1YU6A 4R9RA 1EUYA 1JLRA 1V5GA 2FAXA 3K0CC 1U4OA 5KSPA 1R4MA