4B7UA

Plasmodium falciparum l-lactate dehydrogenase complexed with bicine
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
316
structure length
316
Chain Sequence
b'APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE DEHYDROGENASE
publication title The Crystal Structure of Plasmodium Falciparum L- Lactate Dehydrogenase in Complex with a Novel Bicine Ligand
rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 118
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b7uA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4b7uA02
1BVUA 4A7PA 1HDYA 1I33A 1UH5A 4BNTA 1Q7GA 1D4FA 1ZUD1 4UEOA 3NGXA 1NPTO 3BMCB 1FJHA 4I5FA 1TVEA 1V9LA 3GGGA 2WYVA 4R54A 3P5SA 4QTZA 3A28A 5HA5A 1JAXA 3V1TC 1IZ9A 4AG3A 1P1RA 1JVSA 1B14A 1Y8RA 1GYRA 4OSPA 2Y67A 4J1SA 1QLHA 4BO4A 3HJAA 4BMNA 4FFRA 1VPDA 3OFSA 2P9CA 4W7IA 4R4JA 3RUFA 3V1YA 4CUZA 1GFSA 1GQQA 1Z6ZA 4YA6A 3CSDA 1RWBA 2DBRA 1DPGA 4E33A 4CLXA 5ENVA 5F1KA 4GGOA 2BMAA 5A3JA 3GMDA 2O2YA 4BKQA 3C1TA 3BMNB 4BO1A 1SZJG 4LW8A 3VPGA 4E4YA 1MXFA 1EBFA 2OORA 1PZGA 4NFYA 4NMHA 3SBOA 2ILTA 5CFZA 1TT5B 3L6OO 5JCJD 4NK4A 1ZCJA 2XF8A 2HO5A 2C07A 2Q2WA 4BQPA 3ZHZA 2FOIA 3Q0EA 4CM4B 3PZBA 4B3IA 3GA0A 4BNMA 1DC5A 2BFMA 1Q1NA 3WJ7A 4B3HA 2JD2A 3RUDA 1LQUA 3MJVA 3RVDA 1JWAB 1WWKA 1CF2O 3INTA 4B3JA 5LCXA 3HDHA 3IKTA 2ZTLA 1JA9A 2PH5A 3M1LA 3MOGA 4Y67A 1MFZA 1VSVA 2FN7A 3OJLA 5EERA 4ZD6A 1ENPA 1F06A 1OFGA 3FBGA 5IDXA 3BTUA 4N5NA 1YL5A 4HX5A 4CM8A 3FPCA 3NX4A 4IGFA 3WWYA 3RC7A 4JBHA 1Y9AA 4IDEA 5ILGA 3QQPA 2DKNA 2XAAA 1X0XA 1LLUA 1ZVMA 1Y5RA 1UAGA 1UR5A 3PVZA 4S1VA 3BMQA 1QKIA 2O2SA 1U28A 3VZPA 5DF1A 3KTDA 1DFHA 2GZ3A 5BQFA 4EJ6A 4YDRA 2YHUA 3OEWA 4PVCA 4ZQBA 1BHSA 3VKVA 3WQQA 3WOHA 2ZK7A 4N18A 3D5TA 3F6YA 1B7GO 2AHRA 4I8XA 5CDSA 3D5QA 4M55A 2XXJA 2VCYA 4D3DA 1ZMTA 1GPJA 3KLMX 3MJEA 4XQEA 1R4MB 3Q6IA 3ONFA 1H6BA 1LDGA 1U8XX 1ZIDA 2X8LA 4RVHA 5C7LO 1WMAA 3FNHA 4MKXA 3JQDA 4BOYA 5IZCA 2PGDA 2VHVA 2PD4A 1UJMA 5DOZA 9LDBA 1JKFA 2VNAA 2YQ5A 1E0DA 2Y1FA 1N1EA 4NH4A 5TF4A 5KJCA 3KBOA 1EQ2A 1LU9A 1K0UA 3JV7A 5BR7A 4IGEA 4J16A 3EGOA 3ONDA 4CM6A 2WSBA 3LT0A 2G17A 3CEAA 3JQAA 2DBQA 2YDXA 3DR3A 5ER6A 5T8KA 3TZHA 3TZ6A 4AICA 4CM3A 2NVUA 4XWYA 4JX8A 2HMTA 2YV1A 5JDIC 1NFQA 1N9GA 4Q39A 2DC1A 4ALIA 3LQFA 1L7EA 3RC2A 5FWNA 1O8CA 1LLQA 2C2YA 3NDRA 2Y66A 5TJ9A 4Z0TA 3UHAA 1JAYA 4ZU3A 3GVXA 1DIHA 1P1FA 1Y9EA 4J9UE 3EC7A 3DQPA 3VTFA 4MOWA 4MVJI 2X5OA 4KTTE 1Y8RB 1Q2XA 3U3XA 4DMLA 4OSOA 2C59A 2NLOA 3G1TA 1LA2A 1MG0A 1YOVA 2J8ZA 5DCYA 1B8PA 3DHEA 1DFGA 1P77A 3PFFA 3C7AA 3ORFA 3I9MA 4WLFA 1YB5A 4DQVA 4XIYA 5TS3A 5THKA 4D3SA 1DB3A 3G3EA 4OIMA 3ETEA 5G0TA 1BWSA 1SB8A 1LNQA 3UICA 2NUAA 2B4QA 2P5YA 2ZB7A 4M86A 2D4AA 1RM0A 3DMTA 3QHAA 4CQMA 3WIDA 1O0SA 2I5PO 4RPKA 4CMCA 4GKBA 1E1LA 4WLVA 4KUHA 3TRIA 3AY6A 1P74A 3QWIA 1WDKA 4DREA 2F00A 3ADPA 3TL2A 2WE8A 1KYQA 3BAZA 3DFUA 2CDAA 4CODB 1R0KA 4YRAA 5KJFA 2P9EA 4BNXA 1CIVA 2VQ3A 2RBEA 1V3TA 3I9KA 3U4DA 3WGGA 4A10A 3ZWVA 4TRJA 5IF3A 3VZQA 1SPXA 2EKLA 1ONPA 5L9AA 1M6HA 5EIOA 4BNYA 1J5PA 2DQ4A 4TZTA 1C14A 2GR9A 3OHSX 2FSVA 3S2GA 4WASA 1P44A 4YWJA 4IIUA 3VHRA 5FI3A 2VWHA 1XQ1A 3RI3A 4CM8B 3VH3A 2HMUA 5JY6A 5LC1A 3ROMA 1UUFA 1DC6A 4S3MA 2BKAA 2CD9A 2IXAA 3BMQB 4MVJP 1ZK1A 4FOSA 1ULSA 3KUXA 1ZK3A 4YJGA 3OICA 4D43A 4D42A 2GRAA 3S1LA 1Q0HA 4J1NA 2AE2A 4QO8A 3E82A 4YT2A 4JBIA 3GVCA 4CR6A 2PA3A 4FR5A 4FB5A 2YJZA 3QVOA 1VI2A 4X54A 3ZV3A 3M1AA 1M66A 3GGPA 5DCWA 4HUJA 5KVSA 1EMDA 5EJ2A 1Y5MA 4LVUA 4DMMA 4YT4A 3CMMA 2AQKA 4WKGA 2WTBA 4OQZA 3W1VA 4Z6KA 5BNIA 3GHYA 4PLTA 1LSJA 4MIOA 4XB2A 5EESA 2DPHA 4L4RA 4Q3AA 2E49A 4BNVA 3M6IA 4R1NA 1B8VA 1T25A 3D1LA 3H8VA 4EITA 1YKFA 2VT2A 1DJQA 4UVDA 1QSGA 4ONEA 3RD5A 4IQ0A 1G1AA 3JQAB 4YACA 1WZIA 3INGA 2G5CA 1R15A 3DZFA 4II3A 1PS9A 4J43A 4Z0PA 3JYNA 3U09A 2VRBA 2O3TA 4L74A 2W8ZA 1UXKA 3EZLA 4MVJH 3E48A 4A26A 3WBBA 3KB6A 4KQWA 4XYMA 5EMHA 3GDGA 3L4BA 4B8WA 4GX1A 2Y1EA 4BNKA 3FCOA 2CZCA 1X1EA 3F46A 2IXBA 1NHWA 4UVGA 4Q3CA 4QT0A 3ICCA 1R16A 1ZXBA 4BNWA 3OECA 4DC0A 1ISHA 1RM5A 2WM3A 1GEEA 1YOVB 3K96A 1ISJA 1NQAO 4UUMA 3AUTA 2JAHA 1EFKA 3PJGA 5F1PA 2OBNA 2B4RO 3MJ4A 5DCUA 4CJXA 3VH2A 3EY4A 5L3ZA 1MX3A 3VKUA 4K1LA 5JO0A 3ASUA 5DBIA 4BGIA 2H1SA 1XG5A 2W2LD 2V7PA 4YEDA 5T67A 1ZSVA 3SVTA 4OYRA 2B4TO 1B16A 3MWEB 3QRWA 4Q3BA 3GR6A 5K9ZA 2OMEA 5COBA 4YPOA 3QV1A 3VPSA 5IDWA 4EW6A 2DPGA 3UOGA 2HJRA 5JW6A 3AFMA 1HZZA 1NR1A 1QYDA 3T7CA 3NT2A 4QECA 4U8GA 3AK4A 4G65A 4CMIA 3VZSA 3DONA 3LT4A 4ALLA 2VN8A 4ZRMA 3EAGA 1U3WA 3MWDB 4D0RA 3NTRA 5L4SA 1LQTA 5IZ4A 2UDPA 1ARZA 4KMSA 4PLFA 1L1FA 1EBUA 4Q3DA 4EUHA 5CDYA 4E3ZA 4YJGB 2DUUA 2DVMA 1MUUA 4URFA 2GUGA 3ZV5A 3IQDB 1Q7CA 1T1SA 5CHEA 4A27A 1QYXA 2X58A 3WYEA 1BW9A 3BIOA 1O6ZA 3NTOA 2X23A 1EK6A 3GOHA 4LN1A 4BNGA 5L7WA 3C1AA 3HDJA 4DYVA 3PJDA 4J0EA 4KQXA 3NTQA 1D1SA 4BO8A 3NAQA 3T4XA 1H2BA 4PLCA 3ZV6A 1N92A 3QWAA 3PYMA 1JKIA 3I83A 3UCEA 3IOYA 3UUWA 5DP1A 5CG2A 4MP8A 1X15A 1OMOA 2CFCA 5B12A 3HN2A 4MJLA 3FR8A 1NVMB 3KYBA 1MGOA 2QHXA 3GVHA 4ITUA 4J0FA 1S7CA 1UP4A 1XHLA 4O5OA 2NSDA 5KJ1A 1A4IA 3PHHA 3V2HA 1YGYA 2W98A 4DLAA 4E32A 2P9GA 1ZK0A 3MTJA 1X13A 2YYYA 3EVNA 2CDCA 2BHLA 1TXGA 1TEHA 4R69A 3NUGA 2RH8A 1T2FA 1UZLA 2NU6A 1PU2A 1HYHA 2YHIB 5JAZA 4HNGA 2FR8A 2B5WA 3W6ZA 1ADBA 1N2SA 2YW9A 4CMGA 2EKPA 4QX6A 3RAJA 3C85A 2O4UX 3QLJA 4F6LA 3WX0A 1E77A 3JQ6A 1NAHA 4R3NA 1T4BA 1LDNA 2HCTA 1HZJA 2X6TA 4OHUA 3ZNNA 1RJWA 2I3GA 3VPHA 4E5MA 1X7GA 1D7OA 3OP4A 3QA9A 1CJCA 1E7WA 4L75A 4F46A 3GAFA 1C1DA 1E7SA 4C4OA 3U4IA 2WYWA 3G49A 1WDMA 1HE2A 4E12A 3LLSA 3TF5A 3L4SO 4BNJA 1IHYA 3RU7A 3K8ZA 3QVWA 5IJZA 4XJSA 1PGNA 1J49A 4B7CA 4P38A 3M2PA 2PD6A 5JDIA 2I9PA 4N54A 1HT0A 2WMDA 4OJNA 3H65A 4PG7A 1DC3A 3NEPX 4QEDA 8LDHA 3DOCA 1AHHA 1LC3A 5FI5A 2PKRA 3ZHYA 2HLPA 1DIRA 1KVRA 3ZU3A 1YVEI 4GMFA 4M49A 1BSVA 4E0BA 3RBXA 2ZQZA 1Z7BA 2IDZA 4KUGA 3OJEA 1MC4A 1E5LA 5IFLA 2POQX 3ETGA 3QWHA 2EGGA 2LDBA 3D4PA 4UREA 3C24A 1PQUA 2QIOA 3CTMA 3NRCA 2R00C 1HSOA 2C5EA 3N74A 3CZRA 4OOFA 4LRSB 1P33A 4GBJA 5CPFA 4FS3A 1ZJYA 3FD8A 2CY0A 4H7PA 4TROA 1P0FA 2VOEA 4HBGA 4K6FA 4AJHA 2QYTA 3Q3CA 1IL0A 4RO0A 3MTGA 3HE3A 1RM3A 2SCUA 3JQ8A 4CMIB 5U4QA 4QFCA 3G1UA 2GN8A 4K28A 3F5QA 3C1OA 1DIAA 4MO2A 2NTJA 2C0CA 1G0NA 4FBGA 2FR0A 1R6DA 1EUDA 2E6UX 1ZBQA 1PS8A 1UDBA 4ALMA 1Z74A 4TQGA 1WDLA 2ZIZA 3CXRA 3HB5X 2WJPA 4CR8A 2Z5LA 1U5AA 3MJTA 1X7HA 3UFXA 3GG2A 1N7HA 2W90A 5I7FA 4JGBA 1F12A 1V3UA 3INRA 1YDWA 3PYXA 1O9BA 2D3TA 4CM7A 3LVFO 1YXMA 1BW9B 1B15A 4GMGA 1H0KA 2I76A 4QSMA 3E5MA 3GRKA 5CG1A 4TRNA 1NASA 4FFMA 2A9FA 4XGNA 4C7KA 3IC5A 1YBVA 3AUUA 4HFJA 4E5KA 2AQ8A 4ZICA 1ZK4A 1WXDA 2HUNA 5U9CA 5JYEA 4TRMA 4FFNA 1CYDA 3FPLA 4GQAA 4RDHA 2PKQO 4PZDA 3GK3A 3E9QA 2X5KO 4J3FA 4XYEA 3TZCA 1G0OA 4I9HA 4L76A 3DBHA 4MKRA 5JE8A 1MP0A 3RKRA 3GC6A 4AJKA 2FWMX 3DDNA 1AGNA 3KEOA 1ID1A 1W4ZA 3JD4A 2O23A 4ID9A 1ZZEA 4N7RA 2VYVA 1ZXLA 4NBTA 3DTYA 2VWGA 2PLAA 3PGJA 3E5RA 5CAEA 2B36A 3PDUA 1JW9B 1LDYA 4AJNA 3LT2A 2A94A 1AXEA 1X7DA 4NJMA 1EVZA 1QLJA 5B4VA 5HTOA 4XRRA 4IDFA 1I0ZA 3E18A 3RASA 3TFOA 3WGIA 4B4WA 3ETDA 3QP9A 2RHRA 1IULA 2GERA 3WQRA 2VWPA 1LDMA 1PJQA 3PHLA 2YY7A 4FJ0A 4CV2A 1GEGA 4J4TA 3B1FA 3I9NA 4GLLA 4J1TA 4INAA 1EDZA 1ENYA 3FN4A 5KIAA 5KNLA 1E7MA 2OHXA 4ZRNA 4AJ2A 4EI2A 5ICSA 1W8DA 1QMGA 1C1DB 2QX7A 2YFHA 2E4AA 1XWFA 2RCYA 3SLGA 1U3TA 1IOLA 4FC6A 3OMLA 4AJLA 1EVJA 1Z82A 1BXGA 3GZ4A 4J90A 2HMWA 1JQBA 1ONOA 4E13A 2BH9A 3FTPA 1EQUA 3L0DA 2IEBA 3H3FA 4WCDA 5A05A 4MP6A 3JQ7A 3H7AA 4BO2A 2OZPA 1ADGA 1NPYA 1I3NA 1P1KA 1QR6A 2Q2VA 2Q2QA 1W0CA 2VYVD 3IJPA 3T7EA 5KCZA 4WNIA 4IQ8A 2VRCA 5AYVA 3MCVA 2GDZA 5BSEA 2AG5A 4XYLA 3OJ0A 2DTDA 2VZ0A 2VUUA 4B4VA 4ZQEA 1HYGA 2B5VA 3ZWWA 4B4OA 1NFFA 1MA0A 3OJFA 2RIRA 4QXMA 5DT9A 4ROSA 1MC5A 3WBFA 4D44A 4AJEA 2X5JO 4W9NC 4OAQA 2P5UA 4UVEA 3G0OA 1UXHA 4CLOB 2IZ0A 3JQ8B 2GCGA 3ZHBA 2X9VA 4BGVA 4DBVO 1LI4A 4CLHA 4JQCA 2B35A 3DBVO 2Y93A 1T26A 4AL4A 3BYZA 3RIHA 1EVIA 5JCXA 2X9NA 3DHNA 1NXQA 3KSUA 1YBAA 2Q3EA 2X0IA 4UVIA 1OC2A 3RUEA 3VVBA 4WCFC 3ULKA 4CV3A 4R1TA 1XGKA 2FSSA 4OKIA 3PHGA 1T2EA 4Z3DA 4LRTB 4IINA 4L8VA 4PG6A 1M6WA 4PRLA 2PZMA 3EK2A 2V6GA 4OMUA 2I99A 1GV0A 1PGPA 3NT5A 4NIMA 3PZRA 4MVJG 3GY0A 2AXQA 1MLDA 2FR1A 3D3EA 4IMRA 4RF4A 4QFDA 5CDTA 3DZKA 1GU7A 3LF1A 2BGKA 2C82A 2I65A 3DBLA 4PZEA 5FFFA 2BLLA 1A71A 1HDXA 2V6FA 4FQ8A 2IYPA 3V8BA 1TI7A 2AQHA 1LSOA 1UZMA 2EERA 5GZ6A 4XCVA 3F3SA 1NQTA 1WW8A 4J6FA 4GH5A 1TB4A 1HXHA 3QY9A 4UUPA 4XA8A 1UDCA 4NR0A 1Y81A 4P8RA 3V2UA 3H2SA 1E6WA 3DBHB 5G4LA 2J5RA 2ZTMA 2VTEA 3HFSA 4PCVA 2GO1A 3NGLA 1UAYA 3I4FA 2PKQP 3WTCA 3OA0A 1UP6A 1UP7A 4IY1A 5AVOA 4D41A 5JS6A 5HS4A 3L77A 4PLGA 4CR7A 4RLHA 4NJMB 2D0IA 5T5QA 1PX0A 1ENOA 1N5DA 2G76A 2GNAA 4U6SA 2E48A 2NM0A 3WNQA 3DXFA 4CUJA 2I67A 3GEMA 4YB8A 4CQLA 1QXSA 3LK7A 1PR3A 2NQTA 4PIVA 2HRBA 4YJFA 1RYDA 4WE3A 1QV7A 4AJ1A 4FGSA 5IAAA 1C1XA 3SEFA 2OP1A 2AEJA 1ZSYA 5I9NA 2GYYA 3KVOA 3GUCA 1VJ0A 3Q2IA 1H6DA 1H9AA 3PLNA 1ONNA 1LC0A 4FC7A 1BXGB 4QUKA 5I7SA 2OP0A 4IZHA 2TMGA 5ILOA 2AQIA 3W6UA 5AQ1A 2JL1A 5IXSA 4RZHA 4XQ9A 4UEKA 4E2WA 4KUEA 3LSYA 2JFFA 4ZQGA 1LXCA 3G17A 1VL0A 3RROA 1QV6A 5KJEA 1PWZA 2EG9A 4R16A 3SXPA 5AOVA 4BO3A 4ILKA 3KSDO 3OBBA 3HFGA 3AWDA 2C7VA 3RUHA 4DC1A 4U6QA 4ESOA 3L9WA 2FPIA 3VDRA 3IP1A 3P7MA 3EDMA 4TVOA 3R1IA 3UAGA 2AG8A 1Y8QA 4NBRA 3N58A 2UVDA 4M8SA 3JQAD 3PEFA 3O4RA 4YAGA 5BSHA 1VL6A 1GUYA 3LZ6A 3TOXA 3NDIA 3I1JA 3FWZA 2PZLA 1GY8A 4Y6PA 4J7XA 4ZJUA 3B1KA 3WXBA 1PTJA 5T57A 1GTMA 3E1KA 5JBIA 2NACA 1KC1A 1XCBA 2QRKA 3TFQA 4A03A 1K3TA 4E2ZA 5A9SA 3K30A 5A5EA 4RCVA 2VOJA 3PGXA 5K6AA 1YDEA 4M87A 5TRTA 4MVJE 4RVGA 1MG5A 3LC7O 1VL8A 1JDJA 3BA1A 1AN9A 1OAAA 4PGFA 3AI3A 4RV9A 5BNFA 4LMPA 1XR3A 3WGQA 4EEXA 5EINA 2D2IA 4J4HA 4XEHA 3P2OA 8ADHA 1DLJA 5THQA 2P4HX 2NWQA 4DQUA 1XU9A 3PJFA 4J9VA 4PLYA 2GF2A 4LISA 5TLSA 1PGOA 1NYTA 3WGZA 4LSMA 1ZW1A 1KERA 3AJRA 5IN5A 2UV8A 2C5AA 1GPDG 4BKPA 2P2SA 5L45A 2R00A 5JC8A 3WR5A 1B3BA 4HADA 3SLKA 2O7SA 2BF7A 3AOEC 3KZVA 3PIDA 4YRDA 2ZB4A 1VSUA 4OL9A 4Z0HO 3H2ZA 3DBLB 3RWBA 4XDZA 4CQMD 1I8TA 3PHJA 3ZZNA 1BGVA 1HWYA 2DBVO 3QJ5A 1DSSG 4KDEA 1ISGA 2IE0A 4KZPA 4A5OA 4CMBA 3GUYA 1KVTA 2JCXA 1HDGO 4A73A 3OEYA 2ZYDA 3PTZA 1LLDA 4LCJA 3WGTA 3R3SA 3SC6A 1IE3A 3QVTA 4J91A 5CEJA 4IDBA 4GSLA 3GNTA 1SOWA 2W4QA 2X86A 3RSHA 4WJZA 2Y1GA 3WMWA 4YR9A 4ND1A 4FN4A 4NBWA 1T1RA 3A1NA 1NPDA 4XYGA 1JVBA 3E6AA 4CMEC 1RM4A 1Y6JA 1HE4A 3FSRA 4WNCA 4CM1A 1K6IA 2CVQA 2FMUA 3MEQA 4CMAA 5L4NA 4IPTA 2OO5A 3AU8A 3KLPX 3ZWCA 3RC1A 3DMYA 1KEPA 2YUTA 4BNUA 3O03A 1BVRA 3GNQA 3FR7A 2NVUB 3DO5A 4P22A 4R68A 3RKUA 1PR9A 2GN4A 3EW7A 4J49A 4NHEA 5IXYA 3ZW8A 2ZATA 2VZ9A 1PGJA 1OI7A 1N9GB 3D0OA 1MV8A 4YJFB 3FRJA 4KWIA 4U0JA 3GEDA 4N5LA 1MB4A 1ZEMA 5DOVA 4K26A 5CDUA 3QWBA 1VE9A 1NX6A 4LK3A 2GZ2A 1E92A 1KVQA 2J6IA 1VKOA 2YV3A 5G0UA 2Y05A 4MPDA 1DHTA 3CINA 5HWSA 4BNZA 3PIIA 3Q2KA 4WECA 3ZNOA 1PJCA 5JSFA 3KSZO 4LCEA 4TMFA 4EGFA 2VHYA 4FCCA 1KC3A 1LDBA 4EBFA 1GR0A 4FDAA 3S2EA 1DBVO 4XDYA 4Z9FA 4MDHA 1CEQA 3ANLA 1N1GA 4L9RA 3JQ9C 3BXXA 3ZWNA 4WLUA 3W4JA 1E7RA 5TX7A 2AE1A 2CVOA 3FWNA 4IMPA 3E03A 4OXYA 1YBMA 3PPIA 5EL0A 5KVVA 2PNFA 2R6JA 1E3EA 3PJEA 1P1JA 4WOJA 4YJHA 3WICA 4O1MA 4RVDA 4R01A 1P1IA 3UGKA 3S55A 1WZEA 3M2TA 1HLDA 4TKMA 1E1KA 2QRJA 4XB1A 4BV9A 4CQMB 3KM0A 2ZJ1A 3OIFA 1I5RA 3W8EA 2DM6A 3R6DA 3F1LA 5TIIA 3CPSA 3KHUA 3BMOA 4D3FA 3UKOA 2G82A 5EQDA 1FXSA 2GPTA 5A9SB 4ZN6A 4JJFA 1BXKA 1H2HA 1XKQA 1S6YA 7MDHA 4CLRA 4BS9A 2PTGA 1F8FA 5KKCA 4E31A 5ADHA 1P45A 1VM6A 4PG5A 1IB6A 2EJVA 2WWRA 4YJDA 1Q7BA 4TSKA 4GL4A 5C7OO 1ML3A 2ZJ0A 1J0XO 2HK8A 1R4NA 2ZTUA 2H5LA 2G0TA 1LEHA 3WNVA 3S8MA 4FPXA 1DLIA 2CF5A 5GMOA 2FPGA 4DYDA 2EP5A 4DTIA 2Q46A 1YRLA 2QRLA 3K92A 2PH3A 2JCYA 2EXXA 1K2WA 3R3JA 5JMWA 3RUIA 3TPCA 1LJ8A 5BSGA 5G0WA 3U4HA 1SEVA 2HKIA 1E7YA 4BB5A 1E3WA 1U3VA 1PGQA 1UZNA 1P3DA 4BNLA 4L0QA 4AVYA 4O59O 1HL3A 4K6CA 4UVHA 4ND4A 2CVZA 2PZJA 3GN1A 3I9OA 3P2YA 3OIGA 4EYEA 2FY8A 4W9NA 1D3AA 2EW8A 3RCBA 2O3RA 4OGWA 1EK5A 4JLWA 4CPDA 3NJ4A 2Q50A 3H9GA 3MOIA 1I3KA 3IMFA 3IS3A 1E1MA 2PV7A 4RZIA 3U5TA 2JFHA 2NNLD 3H6KA 4BMSA 3ONEA 1NVGA 2X0JA 5HBRA 2O3UA 4II2A 5COAA 1CETA 4WCFA 3ROQA 1V35A 2HRZA 1NQ5A 2B0JA 5DZSA 4E6PA 3HB4X 2EIHA 1K89A 5F21A 3UXYA 1PEDA 3EUWA 4CMJA 1VLLA 4IJKA 4B7UA 2X0NA 1P1HA 2VUSA 4LGVA 3RJ9A 3WJAA 1T2DA 5L95A 1L7DA 4IXTA 2OGUA 3KXDA 3JQBC 3O9ZA 3PXXA 1Q0LA 3H3JA 2GZ1A 4C7JA 4WLEA 2ET6A 3PI7A 4B79A 4GVXA 1DOHA 5CP8A 1FDUA 2RAFA 4WUVA 1F8GA 1ISMA 1HYEA 2BFOA 1A27A 1U2DA 1GYQA 3VVCA 4DA9A 4Z9YA 1BMDA 1PZEA 2GN9A 3S2IA 3A9WA 2X9GA 2ZCUA 3STHA 4DPKA 3PLRA 3V5NA 1HF3A 3GDFA 1Z7EA 4XRGA 5KJ6A 3H4VA 1KBZA 1PL6A 4DGSA 5KWEA 3JYLA 2Q45A 3ZW9A 3W4KA 4BNHA 4XKJA 1GZ6A 4XGIA 2GSDA 5F5LA 3H9UA 1QP8A 1Z45A 3DAPA 3IUSA 4NNJA 1ISIA 2JCVA 3Q9UA 4H15A 3QE3A 1N8KA 4P4GA 1QG6A 4JP2A 5AXBA 4CM9A 3PYLA 4BKUA 2G1UA 4YJHB 1B8UA 3JD1A 3PP8A 5A02A 4YT5A 4GX0A 1MFPA 4XIJA 4YAEA 3F4BA 1FF9A 2A35A 1IYZA 3JYOA 4W99A 1WVGA 4H3VA 4D7AA 1ORRA 2NTVA 4RGBA 2NV6A 4XQCA 5IDYA 4FSHA 3RBZA 4ALKA 1YWGO 1TLTA 3BMOB 4QQRA 3GVIA 4HXYA 1Y7TA 4PLPA 4BMVA 2D5CA 3OIDA 2VTDA 1E3JA 3U0BA 5ER9A 1KEVA 1FDWA 3JD3A 4CLRB 4XYBA 1EVYA 3ROKA 2OXIA 4Z3KA 4YCAA 5H82A 3GNSA 2ZB3A 4YBZA 4J1QA 5JC1A 1ZO8A 2HK9A 4FGWA 1E1NA 1GAEO 4W7HA 1TT7A 4Y9DA 4AJJA 4MINA 2GN6A 4O0LA 1NBOA 3RQSA 3OJOA 3UCXA 3C7DB 4ALNA 3ANMA 4G2NA 1R0SA 4U5QA 2NADA 2A4KA 1DIBA 3PFWO 5A5FA 4CUKA 2HMVA 1U2GA 1ZNQO 2F1KA 3W8FA 1SOVA 1B0AA 2Y99A 1E7QA 4TVBA 4E5PA 2DAPA 1E3WB 3PHIA 1BDMA 2OFPA 1HDCA 3ZH2A 4GWKA 2C29D 5KTKA 1I3MA 5EPOA 3WGOA 3LLVA 5DBGA 4PLWA 3IP3A 4CL8A 1TT5A 3LU1A 4BO6A 1PJ4A 3LDHA 3TWOA 2TMDA 2UAGA 2BGMA 1F14A 5DULA 2JJYA 5L4LA 4RPJA 3FF4A 4L4SA 1NM5A 2O7QA 3OQ1A 5HS6A 1PL8A 4NU5A 1D8AA 1R0LA 2BELA 3KYCA 3ZNPA 3HN7A 1PWXA 4GAEA 2QZ9A 4WLNA 4DQXA 3I9LA 4RQUA 3A14A 3GPDG 5JY1A 3IJRA 4B4UA 1YO6A 4GVLA 4AJ4A 1PIWA 1HETA 4IDDA 3H5RA 4NU6A 3LT1A 2Z1NA 4XGKA 3F9IA 3HHPA 4KTVE 1ZFNA 3B1JA 1LX6A 2IEDA 3BTOA 3DZHA 4TRRA 1I01A 1PSDA 4OXNA 2YQ4A 4U7WA 3JYPA 3KYDA 4DPLA 1B3RA 3WQSB 1KIFA 1CRWG 5TQVA 4DVJA 2XXBA 4RF5A 3AFNA 3NYWA 4E5NA 3AOEA 3WS7A 2W2KA 4BO0A 3IL2A 1E6UA 2DFDA 1OC4A 1DDOA 1X0VA 4YAKA 2Q1WA 2VT3A 1KEWA 2HQ1A 4L73A 2C54A 2IZ1A 3WFJA 3V1UA 2PWZA 1DAPA 1GD1O 1ZSNA 1DJNA 2O50A 1XDWA 2FP4A 3D7LA 5B4UA 3QWFA 4KDFA 4NFSA 4W4TA 1GZ3A 1FK8A 5I8WA 3AW9A 1LLCA 2B37A 2Y0DA 3PQDA 2ZKLA 3U9LA 5FEUA 5CDGA 3CKYA 4R5MA 1E6EA 3E8XA 1NVTA 3JD0A 2OBYA 2WD8A 1I36A 4JJIA 4F45A 2EF1A 3GG9A 2Q1SA 2CF6A 3OH8A 3ZWBA 4XQGA 3LC1O 1KETA 1I30A 3O38A 3C8MA 3ZU2A 4CMEA 3AI2A 2NU7A 1VKNA 4PLZA 1DXYA 2A92A 2PK3A 3D3WA 5GY7A 4NPCA 1O89A 3H9JA 1F17A 2WE7A 4IDGA 4ZQHA 1YL6A 1U8FO 2GD1O 2XOXA 2NVBA 3L07A 3TJRA 4JROA 4MP3A 4RF2A 3PDJA 1NHGA 2JAPA 4Y98A 3AM3A 4EJMA 1SO8A 3DWFA 3GMSA 4NFHA 4NDNE 4BO5A 1UXGA 1HE3A 1ZKMA 2BRUA 3AOGA 3VPFA 1DAOA 3VOSA 5A4DA 4RLSA 3UW3A 5MGBA 3L9XA 3I3OA 3WFIA 3WWZA 4CV1A 1HSZA 4I08A 3UF0A 3O8QA 5I8ZA 1I24A 2VHXA 4NK5A 2NU8A 3K31A 1XSEA 4CLEA 5A3VA 4IDAA 3GH3A 3JQ9A 3H5AA 4IBOA 1JTVA 4FFPA 1YQGA 3SJ7A 1ISFA 2AEMA 4WEOA 1DRUA 3Q9NA 5JLAA 1ADFA 1PJ2A 4ND3A 1JKJA 5AXCA 1FDTA 3PWKA 4AFNA 5C3MA 4BV8A 4RPGA 3EVTA 4IS2A 2IYOA 1UDAA 2OUIA 1NAIA 4YAJA 3AY3A 3BHMA 4E2XA 2R2GA 1EUCA 3MZ0A 5JPIA 5U1PA 1IPFA 3PRJA 1GV1A 5IDQA 5JNLA 2Q1TA 4TZKA 4ZA2A 4R1UA 4PZCA 2VHWA 4OO3A 1KY5A 5ICMA 3UN1A 4XR4A 5C7IO 4IXWA 3KYCB 4IM7A 2PFGA 2VRCD 3DTTA 3VPXA 5C5IA 6ADHA 4F3YA 1XELA 2QG4A 3DBRA 3DZJA 3TOZA 2Y68A 5A9TA 4ZQFA 4ZVVA 5I9MA 1UXJA 3GF4A 1QORA 1I32A 4G81A 4UEJA 3WGHA 1GZ4A 2GLXA 4WEQA 3A4VA 4WK6A 3NKLA 4Y8VA 3KEQA 1GDHA 3V2GA 2AA3A 2DTXA 4RF3A 4J2OA 3RUAA 2EHDA 3DOJA 3KYDB 1ULUA 2EKQA 3A06A 4HV4A 2CSUA 1LTHR 4J2HA 2YDYA 3PQFA 5ITVA 2W2KB 3I9JA 1A4UA 3GFBA 4NBVA 3NT4A 1B26A 4MVJF 2PR2A 1G6KA 1I10A 3OETA 3JQCA 1GADO 5JAQA 3CMCO 4BHTA 1YE3A 4DXHA 3TSCA 5JXWA 1HDOA 3B20A 4OXKA 1WPQA 4YT8A 5CPBA 2EJWA 3K9QO 4I5DA 4ND2A 3WB9A 1PJBA 2YV2A 4D79A 9LDTA 3BTVA 5ITWA 3OA2A 4OM8A 4E21A 3GLQA 4BO9A 1EEHA 3GQVA 2Q4EA 4ALJA 4KOAA 4WPGA 4JBGA 1CQIA 5JDCC 2Y1OA 4JCOA 4FFOA 5G4KA 3FBTA 5F1OA 1VRWA 2D8AA 1T2AA 4PN3A 1Z75A 1H6CA 1YJ8A 3D3WB 2EWMA 2UUOA 4NBUA 4Y6RA 4QO7A 3H9EO 3JQBA 1X14A 1YJQA 2ZYAA 1DRWA 1T24A 1VJTA 1V6AA 4WGGA 4EJ0A 2VWQA 1LRKA 3GGOA 1C3VA 2WEKA 1T2CA 1IHXA 4UAGA 3HDYA 3JQ7B 4DIBA 1IPEA 1T4DA 3WTBA 3EZYA 5IG2A 4JXKA 1R66A 1PJTA 3RBVA 1HLPA 1HRDA 2EEZA 3BHIA 1ENZA 2ZYGA 4FOOA 2IODA 3TQHA 2AMFA 5G0SA 2D1YA 3WYBA 4XJTA 3W4IA 1CQJA 1PQWA 3GAZA 4O63O 3GZNA 1IZ0A 5T6BA 3ABIA 4GX5A 2V65A 3JTMA 3LC2O 3ZU5A 5TNXA 1HDRA 5T64A 1C0PA 3O8QB 1YQDA 1XQ6A 2NTNA 1NNUA 3AI1A 3I23A 2DFVA 3OSUA 3WIEA 1SB9A 1YL7A 2QZZA 3HSKA 5KVQA 2CMDA 2Y0EA 3JSAA 3OQBA 3WLFA 3KO8A 3RC9A 1IUKA 1C0KA 1SMKA 4YRBA 2HSDA 3I5MA 3IDSA 3GT0A 3ASVA 4YTEA 1ZEJA 4LMRA 5I7EA 4HP8A 4R1SA 5A04A 2BI7A 2UUPA 2Z1MA 3ZWOA 5LDGA 4ZHSA 1DHRA 2FZEA 4R5HA 4D46A 5HM8A 2I66A 4HY3A 3JQFC 2O3JA 1QYWA 4R9SA 4CL3A 3UH1A 1KS9A 5TJHA 3QW2A 1K5HA 1AXGA 1PJSA 2PGJA 2UYYA 1KVUA 4HNHA 4OOEA 5JO9A 3HUDA 1F0YA 3VH4A 1X1TA 3GN2A 4HKTA 3TDKA 2H63A 4F6CA 2EP7A 2X7HA 3RU9A 3WSWA 4WOKA 5DNAA 1EDOA 3DBRB 1A7AA 3CE6A 1EUZA 3CIFA 1C0IA 1LDEA 1NQOA 5BT9A 2WDZA 1JWBB 1XEAA 4RVUA 5B1YA 4BQRA 1WAMA 3B70A 4U0KA 4JJGA 4BGUA 1U1IA 1K6JA 4O6VA 1PS0A 3ZWXA 3ROPA 1NR7A 5TGDA 4DUPA 4EZBA 3KRTA 1KOLA 1U9JA 3QVXA 4XR9A 3FTNA 3ZWMA 3JCZA 5TSDA 3ITKA 4N5MA 4JK3A 1SCUA 1CERA 2B69A 1PJ3A 5DDIP 5JAMA 4A0SA 4BVAA 3JYQA 2DU8A 3Q1LA 1GL3A 2FRDA 4TKLA 1YH3A 5BSFA 1D1TA 3SC4A 4P4NA 4Z9XA 4J7CA 1BRMA 4GKVA 4OH1A 1HDZA 3X2FA 1DRVA 1OOEA 2ZQYA 3OF2A 1EFLA 4D0SA 1GUFA 5A9RA 2JHFA 3IAHA 4NG5A 4CQLB 1W73A 1GQ2A 5AXAA 1KEUA 1KY4A 5K0ZA 1C0LA 1VJ1A 3DAGA 1A5ZA 4NJOA 5G4KB 1C1XB 1NWHA 2O3SA 3GEGA 3PK0A 4LVCA 3HNPA 4CMKA 1PZHA 1U4OA 4IJVA 1I2ZA 2VUTA 3ZWAA 5IN4A 4RJTA 1SAYA 1QYVA 5CEEA 1EE2A 3DZBA 4R3WA 3FNEA 1U7HA 3K2EA 2B83A 3DAFA 1A9ZA 1R37A 5JFOA 3F1KA 2GASA 4XX0A 2W2LA 4P4LA 1M75A 2C2XA 4L4XA 3ENNA 2PZKA 3QVSA 3ZWYA 3FI9A 5KOIA 3F4LA 5FYDA 3OM9A 2DLDA 1GUZA 2YZ7A 2J3JA 4NQZA 1WLYA 1EZ4A 2YHIA 4BIIA 1P31A 3GZNB 1YB1A 2VHZA 3FNFA 1Y1PA 4RPLA 3ON5A 3KOUA 3HZZA 1DFIA 4JN6B 5DP2A 4H16A 1Y8QB 4Q3EA 3UCFA 1DIGA 4E2YA 4KWHA 2NQ8A 3GFGA 1BG6A 4D45A 4JP3A 2VYNA 1GYPA 4M54A 5L53A 2H6EA 5JMPA 1WNTA 1RKXA 4IIVA 2IRWA 1E3IA 2J3HA 3O26A 4FIZA 4HFNA 4B7XA 4B8ZA 4MVJA 1ZMOA 3X2EA 1PQPA 3U62A 1H6AA 4GWGA 4PG8A 1U5CA 2C20A 3ADOA 3GVPA 4BUCA 4RVSA 1HKUA 4DL9A 2HU2A 4RL6A 4YQYA 1BXZA 3GRPA 3HDQA 5L7YA 4RPHA 3VC7A 4G5HA 4DWVA 1A9YA 1O5IA 4FW8A 5G0VA 2JKVA 4FD3A 3ZU4A 1HEUA 4PLVA 3IIEA 3DOOA 2P4QA 2CDBA 4IUYA 4KP7A 2WD7A 1ZK2A 5DN9A 3ZHXA 1E5QA 3WDSA 2YFQA 3IKVA 2I6TA 2BGLA 5L51A 4E5YA 1YS4A 1I2BA 3F5SA 4I9NA 5TT0A 3MJSA 4HWKA 4K9DA 1A72A 3AUAA 3DZIA 4BB6A 1CDOA 1V0JA 1RYEA 1LSUA 1U4SA 5A03A 2HJSA 2X0RA 2JHGA 2Y0CA 3L6DA 4YYZA 4E30A 4BGEA 1H5QA 5COQA 4W6ZA 5F3RA 4CMHA 2X4GA 1MXHA 2O3QA 4WLOA 3LYLA 5B37A 4FFLA 3I4CA 2O48X 4LSWA 2VYND 2O4CA 2X22A 3EYWA 4MIYA 5HRUA 4JNKA 1J4AA 2FPPA 5I9LA 4MVJD 4IS3A 4NI5A 3OQ6A 3QIVA 2FHSA 4IJWA 1ADCA 3ZV4A 2JD1A 2QQ5A 1BTOA 4DIOA 3WYCA 5IZCC 3ZWPA 4FJ1A 4Y6SA 1Z73A 1WMBA 5G2OA 5MDHA 1XA0A 5FF9A 3PWSA 3D4NA 3TL3A 1BDBA 3DL2A 4MKZA 4EDFA 4BKOA 5A1TA 2V6MA 3RJ5A 2V6BA 4CV0A 3IUPA 3JQEA 5T8KC 2VZ8A 3AM4A 3I6IA 4UUNA 3WGYA 2E82A 4W82A 1EE9A 1JLLA 1GCUA 5EN4A 4GPD1 2EW2A 4PFJA 2PGLA 3D64A 3KV3O 4YXFA 1XLTA 1PJLA 1U7TA 4AJOA 4I1IA 4ND5A 2FZWA 1LSSA 2HDHA 2ZB8A 4GSKA 2EV9A 3FHLA 3ZGYA 3T4EA 4TWRA 4CLDA 1K6XA 4YVFA 2I3AA 2X1HA 3H9QA 1CWUA 3R0IA 3PWZA 4Q9NA 2QW8A 1YB4A 1QYCA 4R41A 3ENKA 3VH1A 3GHHA 4EUFA 1B2LA 3U4CA 4AJIA 5KVCA 4I5EA 3JQGA 1UXIA 2OOSA 4BNNA 2GGSA 2VNSA 2HMSA 1TA4A 2HK7A 3HG7A 3NDJA 3BZUA 1FMCA 1I2CA 4IDCA 3BHJA 3TNLA 1YONA 4BNFA 1DEHA 2PD3A 1P0CA 4R51A 3TZKA 2H9IA 1E3LA 3NJ8A 1M67A 4YQZA 3AUSA 2J3KA 5L7TA 3DMTC 1Q0QA 1SBYA 1O94A 5CEFA 3GPIA 5JDCA 3EHEA 2JD0A 2J5KA 3HADA 3ITDA 2RH4A 1H94A 1ZJZA 3BMCA 2Q4BA 1XU7A 4GGPA 3VDQA 5ENDA 5AXDA 3S2FA 5K6AC 5J23A 1NP3A 1H93A 3F47A 3D4OA 4IZIA 3RFVA 4IQGA 5H83A 4BL5A 3P19A 2CUKA 4DIFA 1J6UA 1JN0A 3CZMA 1DC4A 1DO8A 1LRLA 1M2WA 1R4NB 1YQXA 1GQYA 1SNYA 2NVWA 3K5PA 5JYDA 1IY8A 1LBEA 2IZZA 4IJUA 3NV9A 4R9RA 4PG4A 5DBFA 2BFPA 4OQYA 1LUAA 1M76A 2WD7B 3DC2A 2EGHA 3G79A 2J3IA 3WG9A 5F5NA 3Q11A 3ZN2A 3C3XA 5B4TA 5GZ3A 3K2BA 4PLHA 2D5AA 2WYUA 4CM9D 3BMNA 3ANNA 1HTBA 2PY6A 5ES3A 1U3UA 2JFGA 3LF2A 4J4BA 5LDHA 3JD2A 4MVJM 1SEPA 2Q1UA 4DLBA 6LDHA 1XYGA 4PVDA 1GCOA 1V8BA 2LDXA 3SJUA 4AJPA 4BO7A 4CLOA 1ZH8A 2CNBA 4UUOA 2P68A 1A7KA 4CM4A 3KETA 3FNGA 4MIEA 4PRKA 3VZRA 7ADHA 4XZ3A 1KVSA 2ZTVA 2Y1DA 3BTSA 3K73O 1NTOA 1FDSA 3JQFA 3PQEA 3EMKA 4GLOA 1FDVA 4HFMA 4J7UA 3ST7A 1PZFA 3HQ4O 1VC2A 2Z95A 4GI2A 3E9MA 2DBZA 4WCFB 3UVEA 3ZI0A 3DHYA 2OL4A 5L40A 1N7GA 4RVFA 3TN7A 3VAZA 3I52A 3TZQA 4HFRA 4A2CA 1AUPA 4CM5A 2J5QA 4M1QA 1NWCA 3W8DA 1WP4A 2Y1CA 3MJCA 1AHIA 3AU9A 4XD2A 4RDIA 3DZGA 3SX2A 5TC4A 1JU9A 3DFZA 3HWRA 5I7VA 2BFAA 3I6QA 2Q49A 3E9NA 3ZCXA 5C37A 1AE1A 1I3LA 2ZCVA 4ZGWA 4I5GA 2NU9A 3VTZA 4FJ2A 3WSVA 3RFXA 1O95A 4I9UA 4OKNA 4UULA 3ZDFA 3C7CB 3COSA 5EQFA 5TT1A 3RUCA 3L4BC 4BNIA 1R4MA 3L6EA 5A06A 1R12A 3WLEA 3H5NA 3DEYX 2XPCA 2AW5A 3N7UA 5JAIA 3ICPA 2BI8A 2HAEA 2Q99A 1PL7A 5H81A 4RQTA 1OZAA 5KKAA 4DBZA 5BNTA 1E3SA 1V3VA 4Q3NA 2RHCA 4YAIA 1RPNA 1SC6A 3K6JA 2QYSA 3QSGA 4NZ9A 3AM5A 3JQGB 4BKRA 3CUKA 4GX2A 1LRJA 3DB2A 3U49A 2P91A 5GZ1A 1W6UA 3B6ZA 4DPMA 1NFRA 2DTEA 2DUWA 3ZNQA 1HE5A 1QRRA 4M89A 4DLLA 2AEFA 2E37A 4RORA 4EUEA 1XIVA 4JIGA 1P9LA 3AY7A 2BD0A 2DT5A 3GDOA 1OBFO 2D59A 3WMXA 3CH6A 4DRYA 4EEZA 5JCJA 2C7GA 1H9BA 3RFTA
chains in the Genus database with same CATH superfamily
4WXMA 3UHPA 5C8ZA 3WL7A 2QTCA 4YJ3F 3R7LA 4Z4FA 3I45A 1H22A 3FJOA 1D4FA 1ZUD1 4LBWA 4URYR 3OZRA 4AY2A 1NPTO 3BMCB 1RBZA 4I5FA 2XVAA 3ME5A 2ZJYA 3QEOA 2WM9B 2DJIA 3SZ3A 3EAFA 2JI6A 2FZ4A 4WKNA 4Z1MA 3SF0A 2JVKA 4LBYA 2ZW9A 4ACBA 5C7YA 1SBTA 3D1JA 3CUVA 4Y2JA 3AVXA 3NRBA 3K05A 5AK5A 5HA5A 4PIMA 1JAXA 2OGSA 4UHHA 1IZ9A 3D2CA 1BWPA 4J2TA 5CXXA 4F97A 3V8EA 3EGEA 4FTWA 2CJWA 4YHBA 1VMEA 4C3OB 4ETIA 4OSPA 1F1BA 3HJAA 4BMNA 4FFRA 1E32A 3ZDZB 4AQYB 4NE2A 1HZZC 4P33A 3UMVA 4ZMRA 1PT6A 3NBYC 4KH1A 5KCMA 3E05A 1D0VA 4HRAA 2ZYSA 1HE1C 1Z6ZA 3HXOA 4X9XA 2X4IA 3CSDA 4YA6A 1DCTA 1TZ2A 2DBRA 3QF7A 3M6FA 5DHSA 5DHRA 1F0KA 3EH1A 2R65A 2XD4A 1NJ8A 1QOPB 4NE9A 2W6IA 4GGOA 2HI0A 1WZUA 2HWKA 2V1UA 1WDTA 3BMNB 3D59A 3IE2A 4HPWA 3LPMA 1CZNA 4MAAA 3ZC3A 1VMAA 1NUSA 5KSPA 3ZEIA 3ZE0B 2GSWA 1PZGA 3EFEA 2F3QA 2P5SA 4NFYA 4B85A 3M6MD 1VQ1A 1VGQA 2ZG6A 1SPBS 3L6OO 5SY4A 5JCJD 3IBFA 2I2FA 3H4TA 4UNQA 4EG1A 2Q2WA 4KCGA 4HMQA 1P2FA 1LPAB 5IS2A 4ID3A 1SVSA 1URPA 1ATZA 4P86A 4CM4B 1KK1A 1PFKA 3RS4A 3WGMA 4BNMA 1DC5A 4J75A 2NO0A 4JKYA 1AMNA 4Z1MD 3GCWA 4B3HA 3R2JA 1RQ2A 3MWJA 2I3ZA 3RVDA 4JGIA 4QT4A 4HUQA 1JWAB 3FZGA 3EVFA 3DS8A 2GJ9A 3WADA 5LCXA 3HDHA 1H1LB 3WV5A 2PH5A 3H2IA 3M1LA 2EX1A 1AGRA 4Y67A 1VSVA 5FTLA 2FN7A 3OJLA 4XWTA 5EERA 5BQ5A 1F06A 1AU9A 3OQIB 1DQPA 1A1SA 1SFRA 3CE9A 4LF4B 1ZESA 4QHSA 1XA3A 3FPEA 3OZTA 4LA4A 4TTSA 3R4VA 4ZO9A 3RC7A 2BSQA 3GUVA 4JBHA 3WAKA 1YBHA 2P5TB 2AOTB 2DKNA 1M9NA 2XAAA 2IF2A 2W2XA 3HV2A 3UJ3X 5M5BA 1JUDA 3QOFA 3RW9A 2W6ID 3BXHA 4E5PA 1U28A 2WWHA 3VZPA 1B6RA 3MTIA 3E9YA 3KTDA 5EA2A 1L5HB 1X7ZB 3PC8A 2VH1A 4EJ6A 5CYGA 2XMQA 5CDFA 4ZQBA 1IBSA 1M1YB 1U2DC 1RKQA 4PVCA 4FNOA 4XEUA 1ZM2A 3RE1A 4RTMA 1NG9A 1TFRA 5A5DA 3F6YA 2C84A 1EP9A 2B8TA 3FHJA 5H9VA 2P9TA 3ZTWA 4KHPB 3EPPA 1Z8DA 4WXHA 2R44A 5DWVA 4D3DA 2OWEA 1ZMTA 3MJEA 1GTVA 3Q6IA 3ONFA 1XV5A 3F78A 3FRHA 1DEOA 4WBSA 2AKYA 5DO9A 5EUCA 1G41A 1Z6XA 2PCLA 3FNHA 3FPFA 4OY3A 2L18A 3WLSA 4MKXA 2VJQA 4OB6A 4YP6A 1W36D 4BOYA 3UKJA 4NE7A 4IKPA 4D8WA 3RC3A 4CEJA 2PD4A 9LDBA 2GKOA 2VNAA 1ISSA 1JI3A 3F3MA 3SNHA 1SG6A 1CFZA 1POWA 2GEDA 2BTQB 1KRXA 3UJ6A 1SGWA 4NH4A 4V2UA 5JJIA 5CLIA 4L51A 4PYKA 1TOAA 2WWIA 2C96A 4IGEA 3P0IA 4IEIA 3K70B 4TWBA 1F7UA 521PA 3QVGB 3BWBA 3CEAA 3JQAA 2QVXX 2YDXA 4KL8S 4RFSB 5ER6A 4C1NA 1PWYE 2O07A 3DA8A 1NFQA 1V43A 4DDUA 1SM4A 1N9GA 3AVUA 5LYJB 2DC1A 2R4TA 3KEGA 3HB7A 1UOEA 3LCUA 2A3RA 1L7EA 3LQFA 2P6PA 4FDMA 4EZEA 4XWKA 5FWNA 1GSOA 1A97A 1O8CA 3UOWA 3FYTA 1T4MA 2Y1XA 3CLSC 4RYDA 1TK3A 1G4AE 1P7ZA 2GVNA 2PSDA 5FOWA 2OO3A 3VVLA 1LBIA 5HQJA 5JPDA 1NXWA 3VKHA 3JASA 3EC7A 3LKVA 3K32A 1KOJA 1IC6A 5F78A 3OE5A 3LHIA 3QMMA 1XTSA 4YGYA 5DEIA 2R66A 4MPRA 2B30A 4I14A 3U3JA 2XDAA 1Y8RB 1KZ6A 1Q2XA 1XQXA 3DWEX 2WWTA 4DMLA 1IVNA 2NLOA 2F6RA 3IOMA 4IVQA 4ENUA 2VEDA 1WP9A 2Q27A 3G1TA 3P2JA 1ESMA 4D4JA 5HM6A 2VHEA 3ORYA 3EULA 1Q7RA 2J8ZA 1FXWF 2GQ0A 3W3AA 1P77A 1XYVA 2P2NA 3NNNA 3ORFA 1U0HC 3PFFA 4YCDA 3UJ9A 2EVWX 1Z5UA 4DQVA 5DTQA 1AMUA 2XZOA 5THKA 4Q9AA 4KGVA 3FPGA 4X00A 2YXEA 1DB3A 4OIMA 5FA8A 2FWRA 5AWFC 3S27A 4D3SA 1BWSA 3GO4A 1MTOA 3KU1A 2NUAA 2B4QA 1AUQA 4CG3A 4WOCA 3DMTA 1BX1A 5IWCA 3WIDA 3JPWA 4CMCA 4KUHA 1VLZA 1YT5A 3EIUA 3G2QA 4BP1A 3LBFA 1K5GA 4L5AA 4U02A 4HATA 4DR5B 3AY6A 1UJ5A 5JJLA 4L5CA 2GDJA 2R1UA 5FWDA 3OFVA 2F00A 1JTFA 3RB8A 3IVGA 3O1HB 4H9GA 5KJFA 1WUJS 1CIVA 2Z04A 2ZYWX 4C0KA 1DXHA 1V3TA 1H2RS 4Q9KA 3WAGA 3WGGA 4C4ZA 1L6IA 2ZR7A 1O57A 4MDFA 3BB1A 3TTTA 4B43A 2WM8A 3TVYA 2C5GA 1WU7A 3CC8A 2AOWA 3D8NA 5ALVA 1XE3A 2JIBA 4RTQA 1QH8B 4AIRA 5EPUA 3SHVA 3S7TA 1PG0A 2CXNA 4AIIA 2FSVA 3LPLA 2W0MA 4YWJA 3CNQS 5FI3A 4MCHA 3I0NA 2NPFA 4CM8B 2ZKIA 1FRVA 1PVVA 2P9ZA 5AK3A 5LC1A 4M46A 4AZ0B 3CNBA 5FUXA 2HLDA 5SYAA 3ROMA 2J0SA 4R8MA 4CWAA 1OU0A 4RENA 1KSGA 4JIMA 4MVJP 3LBHA 3ZJVA 3NCTA 4EHBA 1TMGE 1FRFS 3KUXA 1ZK3A 3OZWA 1MAVA 3LKZA 3P9PA 4G8BA 5TXGA 2OQVA 1EX7A 4B48A 4D43A 5FOUA 4CIWA 4AP5A 3QUTA 4D42A 5L6LB 1Q0HA 1DAEA 2I6SA 1JIIA 1PW7A 3E82A 4YT2A 3SXJA 2YZGA 2RGUA 4IJQA 4K3VA 1RI4A 5C4GB 5EWJA 4WESB 5J3JA 1CR4A 3F8WA 5KHLB 2GFQA 3M1AA 4MTLA 4V1CA 2G9QA 1G66A 1RQGA 5DCWA 5KVSA 3ND9A 1YAJA 2KB0A 2YQZA 3O5AA 4GECA 2YS6A 3PPYA 4OG2A 5EKXA 4DMMA 3CMMA 3M4NA 1I1QB 2EBWA 2H06A 2AQKA 2XCIA 4C4RA 5KDDA 3L6UA 2GK3A 3P20A 4OQZA 2EJUA 4KE6A 3A1TA 5A2QA 4Z6KA 2I1WA 3IQGX 3K0KA 3GEBA 4YDSA 3TNDA 5FAKA 5JH7F 1GGVA 1SCJA 4J1TC 1LSJA 2C2WA 3K15A 3NFRA 3QFRA 4MIOA 2DPHA 5TQ2B 3E7XA 3WK7A 5BNZA 1EUYA 2Q7DA 4YXWA 1U5BA 1SBNE 5L3QB 4YRZA 1PYDA 4HLCA 3A4MA 3NP9A 1AZWA 1RIIA 3CNEA 4LJYA 4UVDA 3RD5A 4XVHA 3KDPA 1REQA 4RD1A 5T4BA 4YACA 3NALA 3CLUC 4JR1A 2HEIA 2HLDD 2UVPA 3SM3A 3TL6A 3INGA 4OMCA 2BFDA 4P54A 3LYAA 5EKTA 1G8PA 2DUMA 3O84A 2EBFX 4HQNA 1PS9A 4II3A 3REOA 4EG5A 2XZTA 1YACA 4Z0PA 1G19A 3LDGA 4HSEA 1YZFA 2JAWA 2W8ZA 2WF8A 3I01A 3NHSA 3OEHA 4PGHA 3KX2A 1FUYB 3E48A 4JJ6A 3NNSA 3WLLA 2HHAA 1A88A 3KB6A 1JHXA 1MB2A 4EB6B 2QLMA 3H6HA 4EKIA 3S2UA 2YWHA 3TQQA 4B8WA 2IUFA 1PTKA 1XZHA 3TEMA 4TTTS 4AXXA 3H19A 4KQ1A 3TYXA 3O3CA 4P0TA 4Q3CA 4RSRA 1QYIA 4MLDA 3LHDA 2HPAA 1R16A 1CY0A 3OZSA 3OECA 1RC0A 4DC0A 1QH9A 2AC4A 2OD7A 1FMJA 1G5FA 3SBDA 4EPXA 1R6UA 1YOVB 3K96A 1SD5A 5CVDA 2W42A 1NQAO 1OXUA 3IQHX 5IBRA 2GNOA 2ONJA 1EFKA 2O52A 5AJHA 3STWA 1Y3FE 2BDEA 5JI2E 1THGA 1YKGA 2YXDA 3QMWA 2RONA 4H6WA 4MYSA 2GBLA 5FPTA 3NIBA 5LA6B 3VH2A 2P9JA 4E1AA 3P0HA 1CB0A 3CVXA 2FWNA 2VPQA 2GAAA 3FSEA 1E9DA 4RKWA 3H87A 2HJVA 3F9CA 2RKOA 2BCGY 5GONB 1ECPA 5AUPB 5JQWA 1NF8A 3TLJA 2V7PA 3PC7A 2GCOA 3SSMA 1Z15A 4MRPA 4BQNA 2B4TO 3OEHD 1B16A 4PZ9A 1GN8A 3TOCA 4PAGA 3EMVA 4Y2GA 5IVIA 1RHQA 3S2SA 5C52B 2NQ2C 3L6BA 4DCSA 3BKWA 2OMEA 3C4VA 4BTLA 3I2KA 1ZNXA 3VPSA 1S3IA 5IDWA 4EW6A 5AVZA 5IUNC 2HJRA 4JVNA 3W2FA 5JW6A 5ALKA 3BH7A 1CZLA 4HDKA 1T0HB 1YQQA 4WI1A 4ZYYA 1LK5A 1QYDA 1WABA 4MWSA 4TYMA 5FBQB 1ODLA 1P3JA 3NT2A 4M22A 5JSUA 2X40A 4O4LB 2XB2A 1K98A 2BONA 2D4HA 5CH8A 2YZKA 1KZ9A 3ZHTA 3EX7C 3OIYA 3OE1A 1BGXT 5HCIA 1SOAA 4W6QA 2Z6UA 1E1CA 1N6PA 3EAGA 4HAOA 1RBMA 2ZWVA 3EA4A 1P7VA 3NTRA 3PRYA 1NVWQ 3PGKA 4IVRA 3SE7A 5LL6P 1ARZA 1NXXA 1UPAA 4PLFA 1L1FA 4TTJA 1PUXA 4N5HX 2FZ5A 2H00A 2PXXA 3CX4A 5AI6A 3IT3A 1JSCA 3CCFA 3H1TA 3MT0A 3GOQA 2J5XA 4V0RA 2O2HA 4ZI5A 1JHVA 3PVSA 2Q1XA 3IMEA 4G3XA 3IQDB 1MRSA 2CL5A 4KV9A 3V32A 1DUVG 3THXA 4F5WA 4UM9D 3LUDA 2QUJA 5LJIA 2W6MA 4Q1BA 4GFDA 2X2OA 4HNSA 1BW9A 3GYBA 1O6ZA 3N8IA 4YJKA 5K0JA 1EK6A 4GZLA 2B82A 4KQXA 3NTQA 1D1SA 3QSYA 2DFPA 1MEJA 4EY6A 3H4MA 4RY8A 3SEAA 1CXZA 2QLTA 4IDQA 1E2GA 1CUVA 1VGRA 6GPBA 2O8BA 4UTVA 2GJ8A 4H7JA 3UUWA 4RELA 3IA7A 1X15A 3QKWA 5AKJA 1YAHA 2OBBA 1TKAA 1U1GA 2ZI5A 2XXAB 3KJFA 5FO0A 3FR8A 1RHKA 1UEJA 3LUGA 5C1BA 4Q37A 4JEIA 1GZHB 2RGBA 1CEEA 1UP4A 5DX1A 4QBFA 2NSDA 2F62A 1UKBA 2QV0A 4R2LA 4CDMA 1A4IA 1M1UA 1Z2EA 3DEFA 3DEHA 3NYIA 4M0FA 3RS0A 4N3NA 3V2HA 1M2HA 4LRYA 2OBFA 1Q77A 1W76A 2QMOA 2P9GA 1P9NA 2WKQA 5HYVA 2IBSA 3HUFA 3TO5A 3NU1A 1CUYA 1U7ZA 4PE5B 4GOJA 4AURA 1FQKA 2P0AA 3K8YA 3WL8A 4DLNA 1RYNA 2XKAA 4JU8A 3TINA 4ARVA 4TV9A 2ONCA 3VJKA 4Q18A 1UZLA 3DKPA 1HYHA 1XWIA 2VJBA 3T5BA 1K63A 4HNGA 3LY5A 1O6FA 5CCEA 2B5WA 1XHFA 1Z7WA 4XDHA 4YLYA 1L8QA 4CMGA 2EKPA 2IEYA 3RAJA 5KNBH 2O4UX 2BDUA 1PL0A 1CUWA 1XQ9A 4ZTBA 3KR9A 1E77A 1NF9A 1DQZA 4CTMA 2NUPB 2TSYB 2X6TA 1LDNA 2HCTA 1Y7IA 2NNWB 3K6RA 5BMOA 1UQRA 3P32A 5EOVA 3ZNNA 2W4MA 4H1WA 1NF3A 1J90A 1RXUA 3P96A 4TQAA 3GDWA 3GFOA 1X7GA 3FPAA 3OP4A 2PZEA 1HGXA 3O82A 3KZKA 3M83A 1K9VF 5DLYA 5CCBA 1LWNA 1E7SA 4FMCB 3B2EA 3OPMA 4AY3A 4C4OA 4G0QA 2NSYA 1WDMA 1HE2A 3S1AA 5IFKA 4UQOA 3OPYB 5DXFA 3WGVA 4Z4GA 1T3HA 3HXMA 4CQJA 1KQ3A 2ZAGA 5D5QA 2ZWMA 4RD0A 1JFRA 3D8TA 5IJZA 2EBUA 4NCAA 1LLFA 2XYVA 4C21A 5A62A 2HHHB 3AETA 3M2PA 3MUFA 4IRMA 1DC3A 4QEDA 4A2PA 1DELA 8LDHA 3HYSA 1F4LA 5IW8A 4D25A 1T2VA 3ZJ5A 2BAGA 4QJ4A 3QI2A 1KVRA 5A4KA 3ZU3A 4TWIA 3NKVA 4FFDA 1BSVA 1Q3TA 4IWXA 2VDQB 3X1MA 5HJEA 4B75A 1XZKA 4YDHB 1E5LA 2GS9A 2POQX 3I34X 3KR1A 4WGFA 2Z0MA 1QQAA 2PMFA 4UREA 5AH0A 1BE0A 3NRCA 2Q0XA 2R00C 3EGXB 5JNRA 1IHPA 4WL0A 1HTTA 3EQ7A 1P33A 1VG1A 3TW8B 4N48A 3WP0A 2QY9A 1DBRA 1MQ8B 2XIJA 3BXPA 3WK6A 1SQFA 5BN3A 3OAAD 3UYKA 4JB8A 3BEDA 2C7QA 1AY0A 3LV8A 1X38A 1XLVA 4Q6BA 4BLQA 3L0CA 5HUHA 5FULA 1IL0A 3B3GA 1TW3A 3HE3A 3JVDA 2FW1A 1T0JB 3SE0A 4QFCA 3HBNA 3G1UA 4ZJPA 2P67A 2ZB2A 3GYGA 3F5QA 3A1EA 4ZIRA 3K6SA 4MO2A 1Z0AA 3AHDA 3MVEA 5FUVA 5BYKA 4FBGA 5BSWA 1EUDA 2LKDA 4ALMA 1W5BA 3ZQKA 3HB5X 3HJNA 2Z98A 5KZMB 1GGHA 6NULA 3MJTA 3UFXA 2EQ5A 3T9DA 1Z6PA 2WP8J 5AOCA 3LVBA 1VL5A 1VPEA 1F12A 1V3UA 5DYTA 3VYVA 3W6PA 1R0YA 1WY7A 2FRDC 3NHBA 3KLNA 2HCBA 4RD4A 2V1XA 3CZCA 3ZXSA 3HTXA 4D3XA 1H0SA 4JEMA 1K8XB 4PANA 2O0KA 3D7SA 4XUDA 3T41A 1YXMA 1XYYA 1EZ1A 1US8B 2KSQA 2ODPA 2H3HA 1JEJA 2OO5C 5EWLA 1WCYA 4NBKA 1FMTA 4GMGA 3L82B 1H0KA 3P0EA 1HC7A 3BFJA 3H11A 3WGUA 4DYHA 2MSDB 3MOSA 4L57A 4UAJA 3W9YA 1AO3A 1IBRA 4FFMA 1AQIA 2IHJA 3IC5A 2CHQA 4EJFA 4BMYA 4YQFA 1J39A 1ZK4A 1II9A 5AI8A 1GCGA 1WXDA 1SVMA 4RHUA 4MICA 3DE3X 5FKJA 1Z4IA 4YRNA 3FPLA 2H65A 3QVJA 1T5TA 3RRJA 4UUAA 1VKHA 2DQSA 1I2DA 3FCYA 3GK3A 1F2UA 4J3FA 4UBJA 4FGKA 4RTNA 1BDIA 4W1RA 4M1OA 3BPSA 2F8LA 1J56A 2YICA 1Z56C 3DBHA 4MKRA 3S28A 3UJCA 1G7TA 1P8JA 1KNQA 4HQKA 4PSDA 3R7WB 3VHXA 4CU5A 1GU0A 3BRSA 1AGNA 1R3DA 1YD7A 4Q4LA 1T8TA 3JD4A 2D2VA 2O23A 4GYKA 1ZAYA 1ONBA 5KYTA 3SKXA 2I4NA 3DTYA 1I2MA 2XZLA 2B36A 3PDUA 1JW9B 3DO6A 3TR5A 1G291 3DE2X 3JZIA 1M1NB 1LPOA 1P5RA 4GI3A 1QPGA 3VU9B 4GXNA 4G5RA 4Y2PA 2FUNB 4TMKA 1RWWA 2FXIA 3MS4A 4NYMR 3V7NA 4E22A 1K6MA 4TTRA 3R7NA 2AXNA 4Z9AA 4JB0A 4OUDA 2WAAA 5DHFA 2GERA 2CNLA 1KAHA 3E5NA 2C5HA 3RSOA 2SKCA 2NUBA 3OUTA 4LHSA 2J85A 3E2PA 4J7AA 2WHQA 1ENYA 2P8SA 5FOTA 2FSUA 4XOIA 4ZRNA 2VO1A 4FYXA 5ICSA 3PQCA 1KDOA 2QX7A 1TZBA 1C1DB 2YFHA 3PUZA 4BBZA 5EJEA 2W93A 2MTBA 3WI7A 2E4AA 1E0AA 1JQJC 4W8HA 5B1SA 1RXSA 1ZGHA 2RCYA 4YMIA 2ZZKA 4YUXA 1HO3A 4DMGA 3H86A 1N6OA 4H59A 1G6HA 1P7CA 1AQ6A 2E5WA 1EVJA 3GZ4A 3MW8A 3H3XA 4FEGA 4J90A 1KKUA 4X6YA 1JQBA 5EYPB 2AEEA 2VI5A 1G17A 3P2EA 2IT1A 2WTXA 4KR9A 4N3AA 5ELMA 3AESB 1Z8FA 4DB2A 3PD1A 2H1IA 3NORA 3MF4A 4MP6A 4BO2A 1MN6A 1Z0DA 2AX3A 2R8OA 3PSAA 1UMKA 1RI5A 3R7AA 3TG2A 4RTLA 1HFWA 4KWEA 1I3NA 5IKEA 1EK1A 3QE4A 4DQLA 4IQ8A 2VRCA 5IT4A 2FG7C 4TM7A 2VP6A 1NBHA 1ZAKA 2ZYTX 1GL9B 1V2HE 2SBTA 4JUIA 2B4AA 1LW7A 2ZRMA 3GLIB 4PEVA 1EFPA 1T10A 1VP3A 2B5VA 4REMA 3ZWWA 4BNDA 1YE5A 2G06A 4RK6A 2FHPA 4XD7A 4ZREA 4CTNA 2P90A 3HJCA 4RA6B 1NFFA 2M2IA 3MHTA 5EZ6B 4GICA 2GN0A 1EJ2A 2IH5A 4ROSA 4HNRA 3U7RA 4AY6A 3EDYA 3UUFA 4GPBA 3B52X 2GBFA 3AGPA 3R0VA 4UPEA 4OAQA 1EWYA 1XXHE 2P5UA 1RWQA 3DQQA 1UXHA 2WJJA 5KU7A 1N5JA 3EY9A 3LT5A 1YZNA 3F7NA 2WIFA 3EA0A 1ECBA 4P7JA 1JR4A 3ZX4A 4BGVA 1FA9A 1DAGA 4C3ZA 1LI4A 1U0JA 1RAAA 4O2AF 3FUVA 4JQCA 1T0BA 4MVXA 2Y93A 1T26A 2OEPA 3B6EA 2I03A 5DTIA 1RZ3A 3BYZA 4LGYA 3RIHA 2HSWA 5HQ3B 2Q3EA 3CN7A 1F4PA 5FNZA 1V41E 4UVIA 4QFBA 3UV6A 2COUA 4DUYB 1TA0A 1XCGB 3LCRA 3PQ6A 4CV3A 3L7KA 4KB5A 3FUXA 2FSSA 4B3TB 4NNPA 1T2EA 2X8BA 4S1PA 1Q0PA 4Z3DA 3ZVNA 1AKVA 4L8VA 4HL6A 1E4YA 1M6WA 2ZBDA 3OFKA 4PRLA 1I4OA 1XZQA 3MTDA 2PZMA 3SZOA 3FTEA 4FUQA 4OMUA 5K3EA 5KNCA 1JG6A 4P0PB 1XCLA 1RABA 1H8EA 1PJAA 2BCJQ 1H4TA 2R8ZA 1KEEB 5GGXA 2AXQA 3D3EA 5AW0A 4V1CI 2C97A 3IDZA 4L15A 3RHZA 4UM5A 3GMTA 3DZKA 4HWSA 1GU7A 5DEOA 5KTTA 2BGKA 1XQYA 2C82A 2I65A 3DBLA 5AJYA 5BSUA 1SUWA 1XLTC 2M1XA 1D1QA 2IYFA 3ESCA 3IJEB 3TH5A 3GEIA 4B44A 1H5NA 3ZE8A 3O4JA 3ZXXA 2V0GA 1G55A 2IDKA 3IEUA 4A8JB 1MABB 3KD2A 4C0JA 4F2GA 4N7JA 3N5KA 3U56A 2C8VA 4WBNA 2CK3A 4GNRA 3WLPA 1K0FA 1AS2A 1HXHA 4NR0A 3U7QB 2UKDA 1NI4A 4P8RA 1G8FA 1J5EB 2D1FA 2J5RA 1L4GA 1QVWA 621PA 3KQUA 2ZTMA 1Q0TA 3ZE1B 2UYHA 3HFSA 4PCVA 5EZSA 1Z6GA 4KE9A 5ITZB 3ZD7A 3WTCA 4MV4A 3OA0A 4H6VA 1UP7A 4NTZA 2OWDA 4NPHA 4BJ5A 3HCNA 5IWAB 5AVOA 5DBOA 2PX2A 1IHDA 4A36A 3K0FB 2PZGA 2R79A 1TUBB 1VDZA 1I51A 2WIBA 5LLSA 4DY4A 4I3FA 5T5QA 3L2OB 4E08A 3TMYA 1BCRA 2FX3A 5EFZA 3NHMA 3IKLA 5E0KB 5CIYA 3WNQA 5KNCD 4JHLA 4ZQCB 5EGNA 1ULAA 2NZ8A 5LQKA 2I67A 2B8EA 2X1LA 4G56A 5FA6A 3TZLA 1AKRA 4YB8A 3UMSA 1ZKDA 2IITA 2N42A 2RC6A 1QXSA 4DLYA 2G71A 2YIMA 2NQTA 4BUJA 1CSEE 1N5LA 1VHTA 2A57A 3GLUA 4J0IA 4QIHA 2J9XB 4K6OA 4YJFA 4BBPA 4C76A 2V7XA 4AJ1A 3GRRA 3W3AH 1CP2A 1NW3A 1Q17A 1C1XA 2E7ZA 3AG6A 4HB4A 2ORIA 4HWTA 3JVUA 1U0GA 1VYHA 1HDEA 3C4JA 3L7BA 4ARBA 3DDOA 1ZSYA 4DSZA 5KTYA 3ZDXB 1I7QB 4EF6A 4OCZA 3KVOA 4BFLA 4QAQA 1QGUB 4I1SA 1B8NA 3PLNA 3TUJC 3NBMA 1JBQA 1ZQ9A 1ONNA 2QEQA 4FC7A 3C8ZA 1BXGB 4MW0A 2DKFA 2ZTSA 5G40A 5I7SA 1EIWA 5AT1A 2CK3D 1YMQA 2IYYA 2IPNA 2ZU6A 1J1ZA 2G28A 4MWTA 4R98A 3W6UA 5AQ1A 2JL1A 2QE6A 4JBNA 4G0XA 4OQXA 4XQ9A 4UEKA 2H08A 4OXXA 2ZIXA 1XNHA 2JJQA 1WHSB 1II0A 4AK9A 4BQFA 3H42B 2ZUWA 2HBZA 4RJKA 1TJ4A 1WS6A 2G4VA 2WSSA 4BO3A 3VO9A 4RHXA 1XPJA 5CA0A 3KSDO 1EVLA 1RQRA 2YRXA 1ZGBA 3HFGA 2C7VA 4KQFA 2J9YB 3ML1A 2FN3A 3GX1A 4HZIA 5JUWA 4P2GA 3L9WA 4RKFA 1NN5A 1ZM3A 3H7IA 4Z99A 4ECEA 2CBGA 4D3ZA 3HWSA 5JJCA 4NBRA 2JIZA 4YRFA 2WWGA 3N58A 3PEFA 4WFIA 2KS6A 5BSHA 4DV3B 4K9LA 2ZYHA 2GEJA 4XSVA 3I1JA 3FWZA 5DMHA 5KQRA 3PPXA 2RD2A 2O2CA 4TVKA 3RF6A 3WXBA 1PFQA 3IUEA 4O8CA 1VHLA 4ZCLA 3E1KA 3WLNA 5I01A 1YULA 5JBIA 3PNOA 2HIAA 3DDZX 1D09A 4R8SA 4X90A 1IBCA 1SCQA 3C3PA 3LRXA 4E2ZA 3EBLA 5A9SA 4KNYA 3ELUA 5A5EA 1EXMA 2FQYA 3RNOA 3ZDQA 3H8WA 4JI4B 5K6AA 1MU0A 4Q03A 4V0NA 1H2WA 5TRTA 2VBCA 2PVSA 4RVGA 4WZAB 3QX8A 1ZRHA 1G64A 1VL8A 1I0LA 5BN5A 2QR2A 4HDSB 2Q6VA 1OAAA 4HUQB 2HNAA 3ESYA 1C30B 1P9WA 3MT9A 421PA 4E46A 3RLFA 5KTSA 2JLBA 3TQRA 4LZAA 3C3CA 5BWOA 3UATA 4EX7A 4DQUA 1XU9A 3PJFA 4CF4A 3KFVA 4U8HA 3RS3A 2X8JB 3MGCA 4GMXA 4LISA 4ZO8A 3TTWA 1NULA 3EYAA 2ZRCA 4MDYA 4NOKA 4RHEA 1ACJA 1BFDA 2GCIA 2ZVQX 4KNWA 3C2QA 4LSMA 4TKVA 4YRQA 3AJRA 4KRFA 4DUGA 2UV8A 3LC0A 1WTCA 3FYCA 4G36A 4QVGA 3LW8A 3WR5A 3QFSA 4HADA 4KO2S 3KZVA 1NSYA 2BF7A 1BQ4A 5CT8A 2Z9BA 4YRDA 2I34A 3QKTA 2VDNB 4TQUS 4YMGA 1BQ3A 5FBHA 4UUBA 3WZ2A 4CQMD 5CDHA 3ZZNA 1HWYA 2XCUA 3H8SA 3HU1A 3NFYA 2HK6A 1P8AA 2X8AA 3E9EA 1KVTA 2V58A 4HTFA 2JVIA 1HDGO 2Y1KA 5EWMB 3DMHA 4HF7A 1XC7A 3PTZA 5E9WA 1CVLA 3C70A 3NH6A 2E87A 1MTZA 3L41A 1RZRA 2B1QA 2P62A 2JBHA 1ZUHA 2OPBA 3QVTA 4J91A 1VJRA 2FOXA 3NC0C 4NPAA 4GSLA 4WXPA 4ZODA 3WMFA 1N0UA 5F51A 3KWJA 3ADDA 3MS2A 4Q4HB 4WUTA 1ORDA 4KN9S 5BXYA 1LPBB 2G7ZA 3A6DA 3A1WA 3FVRA 3EDCA 4FN4A 2QAGA 4BEWA 3KS9A 2AFIB 3PV0A 2XEXA 5EMNA 3A1NA 4F85A 1NPDA 1LQ2A 1HT2E 1IB0A 2RGCA 1RM4A 3HXTA 4DRXA 3ASZA 2HEGA 4NFLA 1SWWA 3ONNA 4P7GA 5KQSA 4KDRA 5B6PA 5K3FA 2GKGA 4IPTA 1H8HA 5EHIA 1MOQA 5E0OA 5SV2A 1SCIA 2G7MC 1KEPA 3DMYA 3R8CA 4EW2A 3K70C 5EVCA 4W5NA 2QD2A 3GNQA 4KIGA 4R68A 3I42A 1RT9A 1QPZA 1EFRA 5IXYA 3ZW8A 1KI8A 2VZ9A 1PGJA 1IEQA 1N9GB 1SHJA 3GRCA 4Y2XA 1WMSA 1L5WA 2OZVA 3BM5A 3FRJA 4RE6A 5EMLA 5K3AA 2QOEA 3DP9A 4U0JA 1NXPA 3MTQA 1TGVA 3KOYA 4K26A 3QWBA 5AUQA 2QMHA 1NX6A 1HNNA 3Q8LA 4RKYA 1G21A 2CLFB 4FXPA 1N0WA 2MSWA 2C3UA 3GFQA 3ENVA 2UXBB 4BFTA 1RZRD 5CRIA 3TE6A 4UE6A 4XXHA 3E61A 3EXHA 2C7BA 4FCVA 4WECA 1ND5A 4LCEA 2QSZA 5J5AA 2QUAA 4EBFA 1F1JA 1GR0A 1CDEA 3ZS8A 2E4VA 3ZJ4A 3GEPA 3PNSA 2CDNA 2GI4A 3PHBE 1Q1BA 2F48A 4TWJA 2HCRA 2ARKA 3DC7A 3JQ9C 3U4MA 1G4HA 5TX7A 5AW8A 3UAOA 3E03A 1WO8A 3KYIB 4D6YA 4JITA 4JL8A 5EL0A 1XNJA 3PDIA 4WOJA 1E3EA 2FPIB 3P9IA 4MWGA 4X24A 4YJHA 2WLSA 3WP1B 1YA6A 1JR2A 1H8HD 4REOA 2GBIA 2NUAB 1N0IA 2J3MA 3M2TA 3DE1X 4QKQA 4XB1A 1VE5A 1Z63A 3X1XA 2IIQA 2OZLA 2ZR0A 1I5RA 3T6KA 1EFRD 5J2UB 4MPPA 2WNIA 5ADWA 5LP6F 3KHUA 4P31A 4D3FA 4M0LA 1QHHA 3EGDB 5ENZA 4D56A 1UZAA 2GPTA 4KAXA 3TQTA 2MSLA 1KFBB 3ZCTA 4JJFA 4ZN6A 3O4FA 1BXKA 2ODBA 1H2HA 2B34A 1HL7A 2EKBA 4CEHB 1ZD3A 1P0QA 1JP7A 1F8FA 5JD5A 3I32A 4E31A 1PJ8A 3B7GA 5ADHA 3B5IA 2KQUA 1Q21A 1P45A 1VM6A 1D2CA 1RXIA 4GI1A 5HPYB 2GH1A 1Q7BA 3D8SA 1HQKA 1TQ6A 2SHKA 2O8VA 3PUJA 3FKQA 1S2LA 2FW6A 1E2MA 4H27A 3WNVA 3S8MA 2HHJA 1Z2PX 3KJNA 1H2EA 1DLIA 2CF5A 3G59A 2FPGA 3CQ9A 3HEMA 2EP5A 4KE7A 5GMOA 3VR5D 4QGSA 3U4QA 3K92A 4OBWA 3CBQA 5H5JA 1S02A 2JCYA 3VJRA 4ZK6A 4MUXA 3DYVA 2WUVA 3ZQ4A 4AI6A 3TPCA 3LY7A 5HIKA 2ZSEA 2AZDA 1LD3A 1UZNA 5CX1A 2R6CA 1DO2A 4AVYA 1RADA 3AZPA 4O59O 3U44A 1BVYF 3BE5A 4MV3A 3A2MA 4ND4A 4EHHA 3MUEA 3M3DA 3I9OA 3SJZA 5TMEA 3OIGA 3AUFA 4C0AC 5BYAA 2EW8A 5K8JB 4OGWA 4CPDA 2LV8A 4M8NE 2OD9A 2V7WA 2JZNA 2WBLC 2BISA 4LHXA 1VXRA 3H9GA 4HYQA 3T1OA 2NPIA 3UEOA 1M2KA 3DFIA 3IVCA 5ALJA 5J59A 4V1CB 3EOAI 4JL5A 1E1MA 1Y3AA 4EI8A 1JHMA 3DCJA 3F7TA 3GJYA 3A10A 4B3DA 3U5TA 1L5NA 2O8EA 4UCFA 1EX1A 4MARA 2W2VA 2O3UA 5COAA 4PNEA 1OTHA 1JE1A 2BFCA 4M9ZA 2B0JA 4MKIA 5DZSA 4AF8A 4E6PA 2XADA 4AKGA 2EIHA 3AFGA 1DADA 4OJTA 2HM7A 5A7HA 3KT8A 2J7PD 3CW9A 1YJXA 3V4ZA 4B7UA 2I91A 5H7XA 4HNQA 4DLKA 4DJFC 2JGDA 3UFBA 3CM0A 3KKZA 4AN4A 2OGUA 3HC7A 1P6QA 4QFMA 4J16C 3SC2A 3JQBC 3ROZA 1EESA 3O9ZA 2ACVA 1CUGA 2ZRKA 4U9HS 2GZ1A 5BVGA 4C7JA 4B0PA 2PU7A 4KPFC 4TUYF 1J1IA 2PIDA 4MK4A 4GW3A 4O2AB 4FZVA 5H02A 2BFDB 3VGJA 1PBTA 3WMRA 1Y1RA 1NBAA 3H75A 3COYA 4GPTA 3JX9A 2BFOA 4X3PA 2A1UA 4N6OA 4PYIA 3NWJA 3RDPA 1LY1A 2FFJA 1GOTA 1ZOPA 1BX0A 2GEFA 4KGDA 4IXDA 1PZEA 4ZOLA 2FQXA 2GN9A 4OHRA 4EJSB 4ENQA 1RWKA 2IOFA 1DZ3A 1M1YE 1T3GA 5CB8A 1VPWA 3EEQA 4PGAA 1C8KA 2X9GA 1K4YA 2LCFA 1MJGA 3DMDA 5HKAA 3QVMA 2W2TA 2XUKA 2WHXA 4EEKA 1Z0IA 3NAGA 3CZQA 1HF3A 1VSTA 1Z7EA 4LHEA 3CY6A 4XRGA 3BS4A 3IXLA 5KJ6A 2O2ZA 3QEKA 3ZHQA 2AXEA 1ZOLA 1JEYB 4DGSA 1JEDA 5T3YA 1VBKA 1LVHA 1NTRA 1PFYA 1A7UA 2Q45A 4UDYX 5E3JA 5A7GA 4XKJA 4OFBA 4L2IA 2GSDA 2RH9B 5A6SA 1WXQA 2ZT6A 1N5RA 3IUSA 4FK8A 5DNUA 3WDKA 4R2HA 3N6XA 2EJBA 2ETVA 4PBSA 4EFLA 5AW2A 4A2WA 4A16A 4M9QA 4OXIA 4KITB 1AQNA 5A3SA 3GLGA 1MFPA 5LP1A 4P84A 1CZKA 3FCCA 4XIJA 4BX9A 3F4BA 2DPYA 1IYZA 1PR4A 1WVGA 3QMPA 4IAOA 1ORRA 2NTVA 3G68A 3FPSA 4RGBA 1VKJA 4DIDA 3LVRE 3O8NA 3ZHSA 1F4VA 1DX9A 1SXJC 2W6ZA 4FSHA 4WBNF 3AR2A 4MV6A 2PX3A 3BMOB 4R0VA 2PPLA 4BQQA 2XEDA 1EFVA 4EO7A 3OIDA 1P80A 1E3JA 1IOZA 1JIJA 1JMYA 4IRUB 5ER9A 3T3EA 1Z4QA 1JLKA 1QUEA 2DRIA 3ROKA 1JB1A 4HDNB 2B4KA 4KGZA 3AONB 4C0SA 4TS4A 1XQVA 2VAVA 1S7GA 2JC3A 3N9IA 2ZB3A 3ORSA 4QU9A 4YCAA 4YBZA 5H82A 3UGQA 2I0FA 2JBAA 3EEOA 1JMVA 2P6RA 1X7YB 4ED9A 2BFNA 1R74A 2OXCA 3H2YA 4BZQA 5JWOA 2L69A 2TMKA 3G89A 3QLVA 4KQ9A 4ZCPA 2HC9A 1V7PC 3RRBA 4G2NA 4P3KA 1JQKA 2WYIA 4U5QA 2XGOA 2FW8A 2UZAA 1SY7A 2HSGA 5IJXA 3U7EB 5EXPA 2Q41A 2GZDA 3BDAA 4J8PA 5EXTA 1JZTA 1SOVA 4NF2A 4TV8A 3O9MA 5EP1A 4DXAA 1E1CB 3F2VA 3UT5B 1IBMB 2OCKA 3G2KA 4LTNA 1HDCA 3ZH2A 4XOUA 2JCGA 4ND8A 5EPOA 3WGOA 5AOBA 3ZD8A 5DTEA 3ICEA 4CL8A 1TT5A 3LU1A 5HF8A 1CLUA 1NZDA 3FX2A 4KWTA 4JD5A 3TLXA 2BGMA 4P35A 3ZVLA 1Y4SA 5L4LA 1YFJA 2XUZA 2MJLA 5EUQB 1B0UA 1YVDA 1NM5A 2GO7A 3OQ1A 5HZGA 3WISA 1PL8A 1VSBA 3PIRA 3IA2A 3Q6MA 4BCCA 3V3TA 2XVZA 1A3CA 4B7ZA 2BELA 2GEKA 2PX5A 1PWXA 2XYQA 6Q21A 4K5QA 2IXDA 4M1WA 3V7FA 1K3UB 2D00A 2M6KA 3FKSA 3IJRA 5DSTA 3Q8KA 1YO6A 4FP9A 1KMMA 4GVLA 4LOJA 4Y2YA 1PHRA 1SOUA 3LHKA 4IDDA 2O0HA 5C1OA 1K8YB 1L7AA 3PFIA 3RAFC 4NU6A 5NLLA 2M32A 1LPNA 4FBLA 2Z2IA 1TIBA 3HWWA 1ZDMA 1PEKE 1JEEA 1E2EA 4ASUA 1T36A 3B1JA 1R9GA 2CZQA 4NKRA 1Y6FA 5J1SB 1I01A 1PSDA 4TKZA 1B3RA 5SZJA 3WQSB 1KIFA 2QN1A 1PLLA 4IO1A 5TQVA 1V9CA 2JLXA 3QK7A 4MRRA 1JXQA 3WS7A 5ECDA 3OD1A 1A9XA 3QXJA 2F8TA 3CRVA 1OC4A 4EG7A 6ABPA 3DXYA 2A8YA 3QTLA 2VT3A 4JLKA 1NDUA 5ALTA 5DT2A 4NONA 5EXSA 3WFJA 2XMPA 3DOIA 2P77A 2NP6A 3RTAA 5JANA 3BFKA 4KSBA 3R9XB 2HPZA 1DJNA 3T9AA 2F64A 3KC2A 4LC1A