4B7UA

Plasmodium falciparum l-lactate dehydrogenase complexed with bicine
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
316
structure length
316
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Plasmodium Falciparum L- Lactate Dehydrogenase in Complex with a Novel Bicine Ligand
rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords L-LACTATE DEHYDROGENASE
total genus 118
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b7uA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4b7uA02
2D5CA 3V1TC 3QVWA 5KTKA 4F6CA 3AOEC 5FFFA 3RKRA 3P2YA 4CMEC 4WLVA 2HK9A 1T4DA 3WSVA 3OA0A 4CM6A 4J90A 1PZGA 2G0TA 3GQVA 2ZJ0A 1C0LA 3DBHB 4XEHA 3GGOA 4GQAA 4YXFA 5CDSA 1GPDG 2VRBA 1MB4A 3JQAA 3GVCA 2ZCVA 4CMIB 5DDIP 1ZZEA 4L76A 1U28A 3E48A 1U3VA 4F45A 5A9SB 1XWFA 4YJFB 2ZYGA 3V1YA 5U1PA 4M87A 2DTXA 4GKBA 3GHHA 5KVCA 3I9MA 1SNYA 2Q4EA 2YFQA 5BNIA 2AG5A 3OP4A 1BW9A 3F1LA 2AQHA 2P4QA 4WOKA 2V65A 2YDYA 1A7AA 1M75A 1YBVA 2GZ3A 3JQAD 5LCXA 4MPDA 1R4NB 4NPCA 3T7CA 1M6WA 1W73A 4YRAA 2NNLD 2PD3A 1U3WA 2EXXA 3LLSA 3KSDO 4GSLA 4QX6A 4RGBA 1KY4A 1O6ZA 1GCUA 1H6BA 3C7DB 4DLBA 4NMHA 4DWVA 4IMPA 1XLTA 3QSGA 3AW9A 5BNTA 4UUMA 2BELA 1HE2A 1DJQA 1JW9B 3L9XA 1EFKA 1T26A 2ZTLA 4DLLA 2VHZA 1RYEA 3X2EA 1YONA 5CDGA 2VYND 1HKUA 3DL2A 3UCEA 5DN9A 3INGA 1F8GA 1PR3A 4E4YA 2PK3A 1GY8A 5IDQA 3NEPX 2FWMX 1M66A 4XYBA 1B26A 1ZCJA 2OOSA 4HNGA 4KOAA 3SX2A 5CEJA 4J3FA 3MJEA 4OL9A 2HJSA 1WPQA 1LJ8A 3RC7A 1C0KA 5H82A 2X8LA 2GNAA 4NFSA 2O48X 1U8FO 3GMSA 3WIEA 1NFFA 4J0FA 2J3KA 1JVBA 3WSWA 1DRUA 3PP8A 2X9NA 1NXQA 3JQ7A 1E92A 3A06A 3DOCA 4W6ZA 1E3WB 2H1SA 1FXSA 4H7PA 3EDMA 4RF4A 1P1HA 5ER6A 1ZEMA 3OJEA 3PQDA 3CPSA 2CVOA 3M2PA 2I3GA 3GAFA 1IZ9A 4GSKA 1IB6A 1HETA 2UDPA 5KKAA 2P9EA 2WD8A 5AXBA 3H9QA 4BO4A 4NJMA 1V3UA 1L7EA 4MVJG 4XIJA 4AJKA 3QE3A 1ULUA 4YT8A 4ZQBA 4AJ4A 4U7WA 5A9TA 4AFNA 1V0JA 3KB6A 4PG6A 1ZO8A 3W8EA 3AI3A 4MVJM 4WLUA 5I9LA 1N8KA 3ETGA 4CODB 3LC7O 5L51A 1NAIA 4BQPA 4WEQA 4EBFA 1DFHA 2D3TA 2PZLA 4DXHA 5A1TA 1W0CA 2VUSA 5TQVA 1GV0A 3GNSA 4Z9YA 3FRJA 3ZV4A 4Q3NA 4L4SA 3KEQA 4E32A 4CMIA 4XCVA 2YDXA 1JWAB 4FOSA 2EGHA 3STHA 3WGHA 2I67A 5HWSA 1E3EA 1LA2A 3B1JA 3TL2A 1EDOA 1UR5A 3JQFC 4JBGA 5F21A 3QA9A 1LSSA 4MVJP 3ZV5A 1SBYA 1CRWG 5JW6A 3L4BC 4D79A 4BIIA 2EW8A 2GLXA 5I9MA 2NADA 3FNHA 4D44A 2G1UA 2YHIB 1ZKMA 2GN9A 1R0KA 1PS8A 2V7PA 3F4LA 4YT5A 5A4DA 3B70A 4DA9A 2W2LA 5A03A 1VL8A 4I9UA 2DU8A 4R1NA 4BMVA 2H63A 4J2OA 2BD0A 2O50A 1YRLA 5FWNA 2VYVA 2XXBA 4CL3A 4CM8A 4R5HA 3RU7A 1E7SA 1I2CA 2DQ4A 4RDHA 1TT5A 3ZWPA 3DHEA 4CM7A 4BNVA 4K6FA 4D7AA 1F06A 2HLPA 4DPKA 4AG3A 4Q3BA 1AN9A 3HDJA 1GADO 4GAEA 5C37A 4MKXA 4IIVA 1NQTA 1VL6A 4FCCA 4CQMB 5CFZA 5EESA 2E49A 3UW3A 1A4IA 3PFWO 1SEVA 4CQLB 2PZMA 3DZHA 1OOEA 2E82A 5ENDA 4BO3A 1E3JA 4HV4A 4JX8A 2PH5A 2AG8A 4ND2A 1P45A 5COBA 3GOHA 3RSHA 3MZ0A 4MDHA 1HE5A 3V2HA 3WQSB 1ISFA 1JN0A 2PA3A 3PWKA 4JGBA 3ZU3A 1GQYA 1E3LA 5EMHA 2CSUA 4YT2A 1FJHA 1EVZA 3H9UA 3HG7A 4EEXA 3BTUA 4YAIA 4PG8A 5G0SA 5U4QA 3E18A 3JQ9C 2GF2A 5DCUA 5TT0A 3DXFA 4UVHA 4BVAA 1X7GA 1ADBA 1VE9A 1WVGA 3DB2A 5F1OA 3VPGA 2QZ9A 1CQIA 1WP4A 1PJCA 1P33A 1ZXLA 2IEDA 4EUEA 2CF6A 1V35A 4N18A 3FBTA 2DBQA 5IZCA 1TT7A 1IYZA 1IULA 3AM4A 1XGKA 4K1LA 4Y67A 1WMAA 3TZHA 4RJTA 4EDFA 3LT1A 3DFZA 5JFOA 5DULA 1O95A 2CMDA 1HSZA 3DFUA 2IZZA 3FTNA 3VPSA 2PGLA 5DOVA 4FIZA 1NM5A 3QQPA 2P9CA 1ZEJA 4UEKA 3JYPA 3QV1A 3WICA 3ZU2A 4RVHA 3JD3A 1QR6A 4ZRMA 4YPOA 1HT0A 1X7DA 4XIYA 5JAIA 3U5TA 1PJ3A 2UAGA 4Y6RA 4DMMA 3PXXA 4JQCA 4XQEA 3MJVA 3FR7A 2G76A 2JJYA 1ZK2A 1GZ6A 2LDBA 3NTRA 4WLFA 3U09A 1Y8RB 1YS4A 3D4OA 4BO1A 3IKTA 3ZWBA 2PGJA 4PVDA 2VQ3A 3GVHA 1NQAO 4R01A 4ID9A 1CJCA 3TF5A 5K6AA 2B36A 3NTQA 4GH5A 4YQYA 4Z6KA 3ZV6A 3TSCA 3G17A 4FGSA 3U4DA 5DOZA 3WMWA 1EUZA 2IXBA 2GSDA 1GUZA 1ZK1A 4OAQA 1GCOA 4J4TA 3TJRA 1Q7GA 2VN8A 3PQEA 1N9GA 3TZCA 1XQ6A 1E0DA 1QRRA 1QG6A 3PZRA 1JVSA 3OIFA 1SZJG 1QP8A 3DQPA 4O6VA 1O5IA 1DAOA 1E1KA 2JHFA 4IZHA 1C0PA 2P4HX 4PG4A 1Q7CA 4BGVA 4FJ1A 1ZUD1 1WDMA 2GZ2A 4OHUA 4NNJA 1KEVA 4Q3EA 5COAA 4H3VA 5TNXA 4E21A 1GYPA 1AHIA 2C20A 1SOVA 3ITKA 3WYEA 4EUFA 2Z95A 3P5SA 1MC4A 4G5HA 5A06A 3SVTA 2GZ1A 2GGSA 3QWAA 4NK5A 1Z82A 4XGKA 3GGPA 4LCJA 2JHGA 3IUSA 1UAYA 3KSUA 4A03A 1V8BA 3ST7A 5T8KA 3VVCA 1ADGA 2BGMA 1MG0A 5DBGA 2GYYA 2ZYAA 1ZW1A 3TZKA 5T67A 3OFSA 4Q3DA 4IZIA 4BNGA 3DBRA 3GGGA 1DIRA 3HFGA 3I4FA 4ALKA 3GFGA 4IS2A 1I0ZA 4GX1A 4K9DA 1LDEA 2NM0A 2UV8A 1ISIA 2DTEA 1U4OA 1LRJA 3ROQA 4G81A 4GGOA 3H9EO 3WIDA 1U7TA 1E7MA 1MV8A 2C82A 3LU1A 3WJ7A 4EUHA 2Q3EA 3FTPA 1TEHA 1Y6JA 1ZJZA 3EZLA 4O0LA 2OBYA 1KS9A 1GZ3A 3MOGA 2IEBA 3OJ0A 2OBNA 2OP1A 4Y8VA 3PJFA 1DHTA 1FDVA 1WZIA 2HU2A 1UUFA 1YO6A 4II3A 3JQFA 2DBVO 3Q11A 4L75A 4PLHA 2QYTA 2UVDA 4IUYA 3K9QO 5JYEA 3ZGYA 4IY1A 5G0UA 3MJSA 1H9AA 2QYSA 3F6YA 3H8VA 1UDBA 3QWFA 3KEOA 1PU2A 2GPTA 3L9WA 3VH4A 4DQXA 4IDDA 4TZKA 1GEGA 2QRJA 4E33A 3EY4A 4WEOA 4AJEA 4HUJA 4ILKA 3AUAA 3DTYA 2BHLA 1FDTA 3NDIA 1R12A 3ASUA 1GV1A 1V9LA 3NDJA 3C85A 1HDCA 2B83A 1Q0QA 2B0JA 4DYDA 3UAGA 1NQOA 4A26A 5ITWA 3ROMA 3U62A 5L4SA 4Z9XA 2WYUA 3RD5A 4CMHA 2HSDA 4NU6A 4PRKA 3RBZA 3LT4A 4XB2A 3U9LA 3KYBA 4B7CA 3KM0A 4QXMA 1MA0A 4LMRA 4PFJA 3DAFA 4DREA 1K5HA 5EJ2A 5JY6A 5KCZA 3PI7A 2WE8A 1QXSA 1B14A 3S2IA 3OIGA 1X1EA 1PGPA 1U9JA 1PJLA 3HSKA 2O3JA 1Y9AA 3W4JA 1I3KA 4QTZA 5LDGA 2P2SA 3BTSA 4RF2A 5FYDA 2JD1A 1YJ8A 3PHHA 1CF2O 4LW8A 4IDGA 5IF3A 1QLHA 2BGKA 3LSYA 4BGIA 4BO6A 1HLPA 2AMFA 4RZIA 5JO0A 1UZLA 4BV8A 3G79A 2HMVA 3WLEA 2Y67A 4YWJA 4FFPA 4ZQGA 2C59A 3B1FA 3ICCA 5A04A 1Z73A 5FEUA 3ANNA 1PIWA 2DBZA 5DCYA 3QP9A 1HE4A 4Y9DA 3TL3A 2UUOA 4GMGA 1EMDA 4CM9D 5KJEA 1Q0HA 1LDGA 1CETA 1GDHA 2E37A 4FBGA 3FCOA 4JP3A 3ZNNA 1DO8A 4WOJA 3AU9A 3VKUA 3KZVA 4MP3A 1LSJA 2WM3A 2OL4A 3JQAB 3OECA 1A27A 1ULSA 3JQ8A 3D64A 2O4CA 4OXYA 3D5TA 4J16A 2EKPA 5EN4A 3PRJA 5JDIC 1LSOA 3QLJA 1C14A 4ZQHA 4KUEA 4HWKA 4RPJA 4XX0A 1OC2A 1LNQA 3CMMA 1KVUA 2FPPA 3GK3A 3PFFA 4FPXA 4Y98A 4PVCA 5A5EA 2X7HA 2WJPA 3CUKA 4ZRNA 3HUDA 3TOZA 3ZWOA 4OO3A 3DEYX 2DC1A 1NVTA 3I83A 3KLMX 2C54A 1JAYA 1H94A 4LK3A 1HDZA 4AL4A 1DPGA 5C7LO 3GG9A 1ZSVA 1F8FA 2O3TA 2J8ZA 2QIOA 4CR8A 3F47A 1CYDA 3ETDA 2HK7A 1B8UA 3ROPA 1J6UA 3KTDA 4D46A 5HTOA 4RVGA 4AJIA 1BXGA 3PGJA 4JCOA 4ZQEA 5THKA 1TVEA 1A9YA 2JL1A 2W4QA 4LVCA 4XQCA 3OA2A 5AXDA 3GHYA 1JLLA 4R41A 1ADFA 4DIOA 4L8VA 5B4TA 4TROA 1HF3A 2J3JA 1PQWA 1QYXA 4XQGA 3DC2A 3NX4A 2YYYA 2VCYA 1F14A 1DRWA 2JAPA 1LUAA 3AK4A 3HQ4O 4OJNA 4ALLA 4CM9A 4NQZA 3AUSA 3BHJA 2FZEA 4QO8A 4B7UA 3VOSA 3NJ8A 3GR6A 3RFTA 1RJWA 4TVOA 5HS6A 1LDMA 4GVLA 3FR8A 3NAQA 4PZEA 1CERA 3GAZA 4BNJA 3M6IA 3RUIA 4FB5A 2JCXA 1ISGA 2YQ4A 3UICA 3AY7A 5KWEA 4Z0HO 1AXEA 4J1SA 5G4LA 4CMCA 1QYWA 4TKLA 5FF9A 2B4QA 1DFIA 2OO5A 4HFMA 2D0IA 4MKZA 3E5RA 3HN7A 3F46A 2EV9A 1NBOA 2XF8A 2X5OA 3L6DA 2JD2A 3PTZA 3SLKA 4BV9A 3KYCB 4TSKA 3TOXA 5I9NA 4OOEA 1JU9A 1OFGA 1XU7A 1Y5RA 4J7XA 1A72A 3VHRA 2AEJA 1J0XO 1U4SA 1GD1O 2HMTA 2P5UA 1HWYA 3JQ6A 5L3ZA 3WXBA 4G2NA 1DIHA 1SC6A 5CDTA 2RIRA 1S7CA 3BHIA 2FN7A 3MJTA 4WCFA 1DHRA 3Q9UA 5CAEA 3ZV3A 2BFMA 1U5CA 3AY6A 3DZGA 4PLZA 3SXPA 4U6QA 1T1RA 4IDAA 5L7WA 1GUYA 3WS7A 2NU6A 1C1XA 2ZCUA 2X0IA 4BO8A 1JKIA 1HE3A 5JDCC 4PRLA 1TXGA 4AJPA 4PLCA 1M67A 2D59A 4XD2A 4BMSA 2NU9A 1R15A 2HMUA 4BNFA 1VPDA 5G4KA 1HSOA 3OJLA 3H9GA 5JC8A 1PZEA 2JAHA 4I5EA 4EJ6A 4RLHA 4JXKA 2DBRA 2BI7A 2ZKLA 3OBBA 4TRJA 2P68A 4QECA 1K3TA 4RPKA 3VH2A 3A14A 1Q0LA 2V6BA 3ZN2A 1HYGA 3LQFA 3ZHZA 3GPIA 1X15A 3K92A 3LT0A 3I1JA 4IDEA 2NQ8A 2VUUA 1BDMA 1HZZA 4LVUA 4J7UA 2NSDA 5EQFA 3UGKA 3RU9A 1XIVA 1YQGA 3WNVA 2EW2A 3I9JA 3VZQA 4CQMD 2C5AA 1N9GB 3DR3A 2J3HA 3MTJA 2IDZA 7ADHA 3PIDA 1BXGB 1M2WA 4CM5A 1B2LA 1P3DA 1DDOA 2H9IA 5C7IO 2Z5LA 1E3IA 5TGDA 2A94A 1N7HA 3RC2A 3NT4A 3HADA 2RHRA 3H5NA 3IOYA 5CP8A 1E77A 5CDYA 3DDNA 3ZZNA 4I5DA 1VLLA 2I9PA 3ZWCA 1M76A 3V2GA 3ZW8A 3H65A 2W90A 1P1RA 3PYXA 3S55A 4NZ9A 3E03A 4BKUA 4IQ0A 4DC0A 1LX6A 2CFCA 2NTVA 4PLVA 2JKVA 2PWZA 4BNTA 4CM4A 5ENVA 2D5AA 2X0NA 1KIFA 2OXIA 3D4NA 2EWMA 2JCYA 4NH4A 3I3OA 2AXQA 4B7XA 5TX7A 1GL3A 5B12A 2HCTA 3GN1A 5L4LA 2X23A 5CEEA 1LRLA 4A2CA 3TZ6A 2NQTA 1WXDA 3DBRB 1EQUA 1GU7A 2Q1UA 4YYZA 2VOJA 3GZNB 3G3EA 2I66A 3QIVA 3DBLB 1PZHA 1HDXA 4OYRA 2Q50A 4GLOA 4MOWA 1K6JA 3DZJA 3MWDB 4XJTA 2DPHA 4IBOA 4GX5A 5T64A 3D3WA 1PGNA 5JMWA 3BTVA 2D2IA 5HRUA 3AI1A 3E8XA 2FR8A 2YHUA 3E9MA 1KC1A 3HB4X 4FQ8A 3S2GA 1XR3A 2XXJA 1EUCA 3VTFA 1D7OA 4GL4A 4YAKA 3PJGA 3C3XA 2D4AA 3UCFA 2O2YA 2HJRA 2D1YA 3ON5A 3C8MA 1BXKA 3ONFA 3L77A 4OXNA 4EI2A 4N5LA 3OJOA 4XR9A 3PJDA 4E12A 1PR9A 4WJZA 4R1UA 3AUUA 3W8FA 4A27A 2VZ9A 4K28A 4ONEA 4CUZA 1XA0A 3W6ZA 4KP7A 3WB9A 4DRYA 4F46A 2HO5A 3OHSX 4YAJA 3H4VA 4AJHA 4BNKA 1JTVA 2NLOA 3ZNPA 3OICA 1GYQA 2Y1FA 1CIVA 2W98A 5CPFA 5T6BA 3PGXA 4TMFA 4CJXA 6ADHA 5IN4A 3AU8A 2QHXA 1VI2A 5JBIA 1J4AA 3TDKA 1MGOA 1Q1NA 4GMFA 4D45A 2WYVA 1VC2A 1E7WA 2RCYA 4GX0A 1PJ2A 4PLWA 5KVQA 4NK4A 5ES3A 4E2WA 1E1NA 1IHXA 2Y99A 4GWKA 3JQBA 5CPBA 3H9JA 4YJDA 2ZB4A 4FFRA 2GD1O 4MVJA 3G1TA 3O8QA 1U7HA 1ZVMA 1EZ4A 1NPYA 1LXCA 3GEDA 4CLRA 4LN1A 1OC4A 3IIEA 1SO8A 3HDQA 3BMNA 1N7GA 2O2SA 4Z3KA 4EGFA 4UVIA 1LI4A 4ALIA 4NJMB 4EW6A 4PLTA 3LF1A 1P44A 1UDCA 4HX5A 4JNKA 3W6UA 3RJ5A 3VH1A 4D3SA 4J91A 3FWNA 3GDGA 4CLRB 1R4MB 3MCVA 5H83A 1DRVA 4K6CA 4DMLA 4I5FA 1LLCA 2Y05A 3H5AA 1PJBA 4O1MA 3K6JA 3QJ5A 1JA9A 5MDHA 4PLFA 3IS3A 1ZK0A 4YJGA 5FI3A 4ZGWA 4RO0A 3H2SA 1A71A 4D3DA 4BMNA 4CV0A 3LF2A 3D1LA 4E0BA 1PL8A 1IL0A 2O7SA 1VL0A 1ZSYA 3RJ9A 4ZICA 2VYVD 2O4UX 1I33A 3ANLA 1NFRA 4BHTA 1NVMB 1W8DA 4F6LA 1YKFA 3H7AA 4IPTA 1T2AA 2P5YA 4ZD6A 5K6AC 2FSVA 2HRBA 3QY9A 4XWYA 3DMTA 3SLGA 2Q2VA 3O26A 3V5NA 2E4AA 1IPFA 1B0AA 3AM3A 1HDGO 1UDAA 4GBJA 4CLXA 2I99A 4W82A 2C2XA 1SOWA 3ZNQA 4IGEA 2Y66A 1Y1PA 2CDBA 3KXDA 2EKQA 4GPD1 2OUIA 3INTA 4XJSA 4IJWA 1T2EA 2BMAA 4ZHSA 2NTNA 4PG5A 1B16A 1K6XA 3MOIA 1O9BA 3C24A 3KV3O 4IS3A 5G0TA 4BNHA 2C5EA 4CM8B 4QEDA 4UUOA 1YVEI 4I9HA 4E5MA 3GDFA 3PHIA 4DIFA 2HAEA 2FRDA 2G5CA 4PLPA 2F1KA 5JDCA 1D4FA 4JIGA 3VZSA 4CMJA 5CEFA 4KWIA 2Y1EA 3RFVA 2DVMA 3JQBC 1XU9A 4M89A 1PX0A 2BH9A 4J6FA 8LDHA 4FC7A 4MP8A 2RAFA 1NYTA 1RKXA 1C1XB 4PCVA 1B3RA 5DCWA 2X9VA 1G0OA 4PZDA 1N1GA 4CLOB 4CUKA 3ETEA 4CMGA 1E6EA 1GZ4A 5L9AA 5JNLA 1E5QA 2TMDA 1G6KA 5KJ6A 5JPIA 3T7EA 2IZ0A 1Y8RA 4N54A 4Q3AA 4WLOA 3IL2A 3GRPA 2ZTMA 2ET6A 5L7YA 2NV6A 1X13A 1PGOA 4UVGA 3S2EA 1EUDA 4AJOA 3SEFA 1BWSA 5FI5A 1UZMA 4E2XA 3AI2A 2YFHA 4LGVA 4MIYA 4FS3A 3E5MA 3NYWA 3UFXA 1HDYA 2C0CA 1WZEA 4AJ1A 1K2WA 1DLJA 1HL3A 1E5LA 3O38A 3W8DA 4O63O 1XEAA 2BFOA 2YV2A 3EVNA 5LDHA 3WGTA 3D3WB 3OEWA 4CLHA 3PDUA 5BT9A 3RUCA 1DC3A 2NVWA 3BHMA 3M1AA 1R0LA 2P91A 2QZZA 3UH1A 1X7HA 1RM5A 4IM7A 4HBGA 1XG5A 5I7VA 2VHXA 2CNBA 3WGQA 3WGZA 1W6UA 2HKIA 3L0DA 1DOHA 2Y0CA 4GI2A 3DZBA 1E6WA 2F00A 4AJNA 4R1TA 3FPCA 3L4SO 3EHEA 5B37A 4R9RA 4XYMA 5F3RA 3NUGA 1O0SA 4YACA 4LRSB 4OQYA 4RF5A 3A28A 1EVIA 5BSHA 2PLAA 4B8WA 3LDHA 5GZ6A 2JFFA 4P22A 3DZFA 3AOEA 3M2TA 1VSVA 5KIAA 5KJCA 1VRWA 5F5NA 2NU8A 1IOLA 1XELA 1I5RA 1YOVB 3JQEA 3FNEA 4XZ3A 4RF3A 3DOJA 1G0NA 4CV2A 4J1QA 2YW9A 3FN4A 2ILTA 1H9BA 3WYBA 2GUGA 3RUDA 5GZ3A 2WD7A 2BFPA 3VC7A 4HFRA 2FZWA 1YOVA 4LISA 1VJTA 3CINA 4P8RA 4EYEA 4CQLA 3DWFA 4FFOA 1U3UA 5ER9A 1IHYA 1XYGA 2GN4A 3RC9A 3KO8A 4W9NA 3ZHBA 1ML3A 1OI7A 3G49A 3DMTC 5AVOA 1O94A 4UREA 1OMOA 3ONEA 3SC4A 5JC1A 3GEGA 4TQGA 5ILGA 1GPJA 2G82A 4NR0A 4B4UA 4XGIA 2B4RO 1DFGA 5L53A 1WAMA 4HXYA 1GEEA 3WWYA 1T4BA 1EQ2A 4IMRA 2RH4A 1MXHA 2ZB8A 4OSOA 4WLEA 4OKIA 3B6ZA 3CIFA 3GUYA 3NTOA 1BW9B 5L45A 1QV6A 1XKQA 3CH6A 4D42A 2PZKA 3HN2A 4EZBA 2IODA 1ORRA 4BKRA 3DONA 1DC4A 3JYLA 3R3JA 2PTGA 3COSA 3PWZA 4P4GA 1YXMA 2XPCA 4R68A 4B3IA 1T2CA 2E48A 3UVEA 4OXKA 4XDZA 3GNQA 4XB1A 3KOUA 1MLDA 4EJMA 3DHNA 1K89A 1P9LA 4X54A 5JCJA 2ZJ1A 3WTCA 1V3VA 2GO1A 3R6DA 1K6IA 4RCVA 1E7RA 1I01A 1H2BA 3KRTA 1R6DA 1HYHA 1WWKA 2ZK7A 4QFDA 4WE3A 5JE8A 4HFNA 5EINA 3BMCA 4CV3A 1Z74A 4GVXA 2Z1NA 3IDSA 1J49A 1UXIA 2HQ1A 4JN6B 1I36A 1D1SA 3C1AA 2BKAA 1W4ZA 4MO2A 1HDOA 3RC1A 3GY0A 3CMCO 5BSFA 3ZWVA 3WFJA 1NPTO 2I76A 1EK6A 3RUFA 2YZ7A 3F5SA 4XKJA 5DF1A 5JO9A 4URFA 5T5QA 1BHSA 1EBFA 2QQ5A 3Q0EA 4NBUA 4A0SA 4AJJA 3HDYA 1DC6A 1QYVA 1EK5A 2I65A 1T24A 3UF0A 5TIIA 3DOOA 3B1KA 4ND3A 5GZ1A 1ISHA 5L40A 4YAEA 4M8SA 1CWUA 1KERA 3CKYA 1B8VA 1WW8A 3UCXA 1SPXA 1FF9A 1RM3A 4XA8A 3GF4A 1AHHA 3H3JA 2CUKA 3ZWMA 4OKNA 1U2GA 1BGVA 1M6HA 4YA6A 1U3TA 2VWQA 2X9GA 1DEHA 2DUUA 3OMLA 1F0YA 5IN5A 3PZBA 2ZATA 1YL7A 4UUPA 3C7CB 5EPOA 4Z0TA 1J5PA 1A4UA 1L7DA 2WYWA 1KY5A 4I9NA 3RROA 4DLAA 3PEFA 2LDXA 2QRLA 1LTHR 4R3WA 3DBHA 2IZ1A 4DBZA 4R51A 3RBVA 4Q39A 3MJ4A 2Q4BA 4MIOA 1GFSA 4E5PA 1T2DA 1Y81A 4KTVE 3WR5A 2RH8A 3PDJA 4WK6A 4PGFA 4ND4A 3GMDA 1DSSG 1LQUA 1KYQA 4W9NC 4IINA 5I8ZA 4YJHA 2CF5A 2ZQZA 3BA1A 3NDRA 3GEMA 1NAHA 4DBVO 3L4BA 4GGPA 1P1FA 3Q6IA 4KDFA 1R4MA 4L9RA 1ZIDA 2J5QA 1LC3A 1LLDA 3N7UA 2C07A 2VRCD 2AQ8A 4U5QA 4FGWA 2YY7A 5MGBA 3D0OA 3OQ1A 4R54A 4NBTA 3AM5A 2DTDA 5DNAA 3WGGA 4FOOA 3UKOA 2G17A 3TQHA 3UN1A 4R5MA 3KHUA 1UXJA 3I9LA 4BNUA 4GWGA 3WYCA 3ZWYA 3BIOA 2PKQO 2DAPA 4I08A 4XGNA 5L4NA 1A9ZA 1R66A 4YDRA 4IJKA 4C4OA 5KOIA 3W4IA 4EITA 4KQXA 2IYOA 4P4NA 5AQ1A 3ZWNA 1V3TA 4PLGA 3QHAA 4YT4A 4J1NA 1Q7BA 4P38A 3JSAA 3FSRA 3HWRA 4KDEA 2QG4A 1R0SA 2AE1A 2R2GA 3ORFA 1TT5B 3NGXA 3NV9A 2AEMA 1Y8QA 4Z9FA 3PPIA 3ZNOA 3RQSA 1SAYA 1DB3A 4DUPA 5HA5A 1XCBA 2FPGA 4W99A 5C3MA 3BAZA 3BMCB 2QX7A 2X58A 1AUPA 4NI5A 4MVJF 4S1VA 3ABIA 4E30A 2BFAA 2VOEA 3G1UA 4R1SA 1EE9A 2DPGA 4MVJD 1VKNA 2POQX 4HADA 1O8CA 3K2EA 4RVDA 2PY6A 3PK0A 4IXWA 3Q9NA 4OM8A 3WOHA 2HRZA 2PV7A 2X0JA 3AUTA 3MEQA 1ZSNA 1ENOA 1FDUA 3TFOA 1JDJA 4WNIA 5DZSA 2B35A 2DM6A 4BUCA 4D0SA 3VDRA 3BXXA 4J43A 1WNTA 4MJLA 1QV7A 1DIAA 4IJUA 4FFLA 5U9CA 1LC0A 3CE6A 4HP8A 1BMDA 4JJIA 4MIEA 1KEUA 4FJ0A 4I1IA 5HBRA 4TRNA 3ANMA 5TRTA 4BB6A 1E3SA 3JCZA 1FDWA 1EVJA 1LLUA 3HHPA 4ALJA 5AXAA 1RYDA 1YQDA 4R16A 2AW5A 4CV1A 1MX3A 2Q45A 1MFPA 5IDXA 3A1NA 1H0KA 1HRDA 2AA3A 1UP4A 7MDHA 5JDIA 4M54A 2WWRA 4B4OA 4MVJE 1DXYA 5ILOA 4R4JA 2A4KA 2ZTVA 1JAXA 5EIOA 3VPFA 4E3ZA 1UJMA 1R37A 3O9ZA 1I8TA 3RASA 5ICMA 1KEWA 3GNTA 1EDZA 5I8WA 3IUPA 4J49A 1C3VA 1DIBA 3JQ9A 1QYDA 3P2OA 4N5NA 4O59O 3JD0A 2PR2A 3KSZO 5G0VA 3WNQA 1GR0A 2EIHA 3K30A 2YV1A 4DYVA 3HE3A 4OOFA 3F9IA 4E31A 3IAHA 1P77A 2IRWA 2VZ0A 4DVJA 3ZCXA 1IPEA 1QSGA 4E5KA 9LDBA 3E9NA 4H16A 3VVBA 4ESOA 1GYRA 4EJ0A 5BSGA 4WCFC 2HMSA 2PH3A 3EC7A 1ZXBA 2C7GA 4IIUA 3LLVA 3ZHXA 2QW8A 3R3SA 3NGLA 3ZWXA 1F12A 1PWZA 1ENYA 1MP0A 4RL6A 4YTEA 2BRUA 5T57A 3UOGA 1B7GO 3K5PA 4FR5A 1EVYA 4BKOA 1T2FA 4BNXA 4PN3A 1XSEA 2NU7A 2EJWA 4YJGB 3T4EA 2PZJA 5TS3A 3GFBA 5IXYA 5ITVA 1U5AA 3AOGA 2AHRA 2UUPA 3RUAA 1I3LA 3LC1O 5EL0A 2P9GA 1BXZA 2Q46A 4A7PA 4LSWA 1RWBA 1Z7EA 4JBIA 1UP7A 2HDHA 1Q2XA 2PGDA 2Y1CA 1L1FA 3V2UA 1I32A 1KVQA 1YDEA 2VWPA 1ZH8A 3U49A 2HUNA 3UHAA 4BS9A 4B79A 2Q2WA 4BB5A 2Q1SA 3D3EA 4BKPA 4NHEA 1YQXA 2NUAA 3G0OA 1T25A 3I23A 2VWHA 3FNFA 8ADHA 4CMEA 3SC6A 4UEOA 2EKLA 3FHLA 4CLEA 4J7CA 3CEAA 4RLSA 1IZ0A 4KQWA 5A3VA 4NBWA 1IE3A 2YUTA 3M1LA 1JWBB 2X22A 4ZVVA 1K0UA 1C1DB 1JKJA 4ROSA 3F3SA 4QSMA 4M1QA 3T4XA 1UXGA 1NR7A 3RFXA 3GH3A 4GX2A 4R3NA 2J3IA 4BO9A 1YBAA 1HDRA 1PGQA 3Q2IA 5JCXA 2WE7A 5I7FA 4WASA 3LVFO 4OIMA 1ENPA 2ZB3A 3PJEA 5F5LA 4BNLA 2WEKA 3OSUA 2Y0DA 3HB5X 1F17A 3PHJA 3GZ4A 2B4TO 4QO7A 4BO2A 4F3YA 3WQQA 3LT2A 2GCGA 4ZN6A 3ADOA 3VZRA 3RWBA 4CL8A 4YB8A 1HYEA 3V1UA 4IDCA 2PNFA 3ITDA 3PIIA 4BNYA 1GAEO 4E5YA 4YVFA 4CLDA 2GR9A 4DTIA 2JFGA 4HY3A 3Q2KA 2OGUA 3ZWAA 2X4GA 3FWZA 1NVGA 5JAQA 3MWEB 3K31A 3PHGA 1VKOA 4BO7A 1YL5A 1BDBA 1UZNA 1NASA 2OMEA 2ZB7A 4YBZA 5BNFA 3L07A 1DBVO 2OORA 1BG6A 3BZUA 4WPGA 5JMPA 2X1HA 3GZNA 4D3FA 2DLDA 2ZIZA 5JYDA 5A5FA 2WDZA 3DBLA 4UVEA 2EERA 2OFPA 5BSEA 5KVVA 4L74A 5A02A 1NX6A 1GTMA 1ARZA 1ONPA 2PD6A 4LCEA 4Y6SA 3NJ4A 1DIGA 5K9ZA 3EUWA 4WECA 2NVUA 4A10A 4P4LA 2NVBA 1ENZA 1D1TA 4TRMA 4YJHB 2VHVA 4KUHA 4GLLA 4RQTA 1KVTA 1XHLA 4IQGA 4BGEA 2DFVA 3LC2O 2B37A 1U8XX 3WJAA 3N58A 3N74A 5A05A 4I5GA 2JFHA 4M49A 3RKUA 3X2FA 1YDWA 3PVZA 4S3MA 1B3BA 1RM4A 4ZA2A 3BMOA 3WG9A 4BL5A 3V8BA 3IKVA 1JKFA 1GQQA 3JD4A 2RHCA 2NWQA 4BO5A 3PWSA 5BQFA 2BGLA 4XRGA 2GASA 3K8ZA 1ZK4A 4HKTA 2DKNA 4UAGA 5JAZA 4B4WA 4J9VA 4R69A 3BTOA 4MINA 1OBFO 2WMDA 3D5QA 2Q99A 3QWHA 2WSBA 3JV7A 5K0ZA 3IMFA 3C1TA 4O5OA 4FW8A 4WLNA 4MVJI 5GMOA 1P0CA 1YL6A 1R16A 2I5PO 4RPHA 3GN2A 1A5ZA 3LZ6A 4I8XA 3B20A 4TKMA 5C5IA 2J5RA 3QWBA 4FDAA 1LLQA 5HM8A 4LRTB 2YHIA 4RVSA 2E6UX 4IGFA 1CEQA 1NP3A 1I3MA 3W4KA 3IQDB 4ALMA 2C2YA 1QKIA 2V6MA 1CDOA 3ENKA 4J2HA 2OZPA 1VJ0A 3UXYA 4WGGA 1I2ZA 1KBZA 2D8AA 4DQUA 4OMUA 2OHXA 2VYNA 4UUNA 5CDUA 2X6TA 1ZFNA 3FI9A 4RV9A 3WFIA 4BOYA 1FK8A 2AEFA 1NNUA 3JYQA 4WKGA 3PQFA 5KKCA 2DT5A 3RAJA 4HFJA 2RBEA 4MVJH 4ND1A 1NHGA 1AXGA 3GC6A 3JD2A 1LEHA 2A35A 2EG9A 1PJTA 3QVOA 1DJNA 4L0QA 3W1VA 3EMKA 4KMSA 1EE2A 2J5KA 2O23A 4WNCA 3EZYA 2Q49A 3I5MA 2W2KB 4C7JA 4DL9A 5AOVA 5BR7A 2PFGA 1B15A 2PKQP 4KWHA 3UUWA 5TF4A 3AJRA 4UULA 4W4TA 1VSUA 3LK7A 3U4HA 2ZQYA 4FFMA 1XDWA 3K96A 3JQGA 4CLOA 1H6CA 1QYCA 3H2ZA 2CVZA 4NU5A 1S6YA 5L95A 1BVRA 1UH5A 3E9QA 4DGSA 1NWCA 4E6PA 4NFHA 5TT1A 3SJ7A 1P1JA 3GA0A 4WUVA 4MP6A 3L6EA 3DZKA 4WCDA 4Z3DA 3OQ6A 1P1KA 3KYDA 1TLTA 4DIBA 3F5QA 1H6AA 1Z6ZA 2A92A 1V6AA 2Y1OA 3I52A 5G2OA 3RIHA 4BNIA 3Q1LA 1UP6A 2EJVA 2XOXA 1ZJYA 4YEDA 3F4BA 3U3XA 3OF2A 3SJUA 2FR1A 2VWGA 3R0IA 4OSPA 3U4CA 4U0JA 1TI7A 1IY8A 1D3AA 1X0XA 1OAAA 3GVIA 4RVFA 1PTJA 1ZNQO 3DZIA 4FC6A 2FP4A 2EP5A 3BYZA 3JQ7B 4CM3A 2R00A 3FBGA 4Q3CA 4M55A 2NVUB 1MFZA 3QVSA 5TC4A 4FD3A 4AJ2A 3FPLA 3KBOA 3BMQA 2BLLA 5IZ4A 1GUFA 2I6TA 4DC1A 1UAGA 3GPDG 5DBFA 2EHDA 4NFYA 2FMUA 4J0EA 4RPLA 2GN6A 4B8ZA 3HDHA 1OZAA 4XYEA 3CZRA 3SBOA 1LDNA 2EP7A 4KZPA 1SEPA 1BRMA 3O4RA 5KJ1A 2X5JO 4C7KA 1ISJA 3BMOB 3DTTA 2O3RA 5KJFA 5F1KA 3AFMA 4PIVA 4Y6PA 5DT9A 3ZU4A 1ZMTA 5TSDA 1BVUA 1NFQA 3OETA 2HMWA 2UYYA 1EBUA 1TB4A 3JQDA 4D43A 5L7TA 4R9SA 3AY3A 5IFLA 1Y5MA 1PS0A 1UXHA 2CDCA 2I3AA 1I3NA 4FN4A 2IYPA 1BTOA 2FSSA 2ZTUA 3INRA 1N5DA 1SB9A 5G4KB 4H15A 4ND5A 3ZH2A 3WBBA 1N1EA 2VT2A 5TLSA 1P31A 4UEJA 3HNPA 2B69A 1ONNA 2GRAA 1VM6A 3NT2A 5JLAA 3I6IA 4K26A 4BNWA 1JQBA 3AFNA 3I6QA 4FSHA 3U0BA 4AICA 4NDNE 4RPGA 2O3SA 3JQ8B 1O89A 3WDSA 1PZFA 5DP1A 5DP2A 1Z75A 3I4CA 4YRBA 4UVDA 2H5LA 2Y1DA 2VNAA 1LDYA 4RORA 1R4NA 3JQCA 3E6AA 3CZMA 2AQKA 4TWRA 4NBVA 3WBFA 1RM0A 4JBHA 4OGWA 1HLDA 1C0IA 3HZZA 3QWIA 1Z7BA 4CMKA 1YB5A 1MG5A 4TVBA 5ICSA 2W2KA 5DBIA 5ADHA 3DBVO 1B8PA 4INAA 1H2HA 1QLJA 2W8ZA 1BSVA 1DC5A 1X0VA 1PEDA 3PLRA 1LBEA 3TPCA 9LDTA 1N92A 4DQVA 2Q2QA 3WMXA 3JQGB 4J1TA 4A73A 2FR0A 3DAGA 4Q9NA 3VPHA 4E5NA 3OQBA 4RVUA 4LMPA 1NQ5A 2PKRA 4E2YA 3PHLA 3WX0A 3GVPA 3ZDFA 1FMCA 3OM9A 4D0RA 5I7SA 4RQUA 1I2BA 3TNLA 5HS4A 2Y1GA 1SMKA 1E6UA 4GKVA 3EW7A 3WTBA 3IP3A 3ULKA 2XAAA 1MUUA 2VHWA 3ZI0A 2Q1TA 1YJQA 1RPNA 4B3JA 1I10A 4KTTE 4M86A 1YB4A 4AJLA 3ZW9A 4BKQA 4DPMA 4YCAA 1PWXA 2V6FA 3TFQA 5AXCA 4N5MA 4BNMA 3CTMA 4CMAA 3QRWA 3H6KA 3ASVA 4JROA 1EFLA 4Z0PA 2DFDA 1NPDA 3KLPX 1E3WA 3DAPA 3H5RA 4IJVA 5IXSA 2JD0A 3Q3CA 2R6JA 4YQZA 3MJCA 5A3JA 1HXHA 3QVXA 1T1SA 2O3UA 1X1TA 2R00C 4TRRA 4CPDA 5LC1A 1PJQA 2BF7A 1NR1A 1D8AA 4CMBA 3GG2A 3EK2A 3K73O 3VDQA 4RDIA 1U2DA 3NRCA 1ID1A 3I9NA 3MTGA 3FNGA 3C7AA 3KYCA 3IJPA 1YBMA 3ROKA 3VTZA 1ONOA 4BNNA 4J4BA 4N7RA 1YGYA 3ENNA 2GERA 1E7YA 3GLQA 1WDKA 3VH3A 3GVXA 1PJSA 4HNHA 2AQIA 1I24A 1P0FA 4QFCA 5JXWA 2AE2A 2VUTA 1E1MA 1LSUA 3JD1A 1PS9A 1SB8A 3OH8A 3KYDB 5TJHA 3OIDA 3IJRA 2ZYDA 4QUKA 5TJ9A 4CM1A 5IG2A 3VZPA 3S2FA 3OJFA 4PZCA 1DAPA 4L4RA 4NBRA 4XQ9A 3TWOA 4FFNA 3HFSA 5CHEA 3KUXA 1AGNA 3WGIA 2QRKA 1P1IA 1A7KA 3KETA 3RUEA 3P19A 5IDYA 5I7EA 3PLNA 4E13A 1H5QA 2PD4A 2H6EA 3CSDA 1H93A 1YWGO 2VTDA 2YJZA 3D4PA 3PYLA 2EEZA 3F1KA 4MKRA 1KEPA 3BMQB 2CD9A 5GY7A 5IAAA 3K2BA 4U0KA 1SCUA 1PQPA 3TN7A 3H3FA 1YH3A 2X5KO 2VZ8A 4IQ8A 4B4VA 5CG2A 1AE1A 4CR6A 3ZU5A 3L6OO 3EVTA 1X14A 1Z45A 4BNZA 3TRIA 1WDLA 2BI8A 3P7MA 3VPXA 2JCVA 1ZBQA 3CXRA 4IDBA 2C29D 2C7VA 3E1KA 3JYOA 5JSFA 4YJFA 1Y8QB 1HEUA 5J23A 2GDZA 4U6SA 1YB1A 2O7QA 3S8MA 5IZCC 1G1AA 1KVSA 1QORA 2EF1A 1ZK3A 3C1OA 2HK8A 3R1IA 3EAGA 5AYVA 4YRDA 3DHYA 2Y93A 4FJ2A 1QMGA 3A9WA 3AWDA 4XR4A 4YAGA 5COQA 2W2LD 2J6IA 5B4UA 4E2ZA 3I9OA 3TZQA 1DLIA 5JS6A 2CVQA 1MC5A 2VTEA 1HZJA 4G65A 4IDFA 4DPLA 3RBXA 2VRCA 1LQTA 4J4HA 4TZTA 4JP2A 5A9SA 3RI3A 5KNLA 3HJAA 3PYMA 3E82A 4JJGA 3EYWA 5IJZA 3NT5A 3EGOA 6LDHA 1ADCA 3GDOA 3I9KA 5THQA 4QQRA 3WWZA 3ZHYA 4A5OA 1PL6A 2B5WA 1C1DA 2X0RA 3LYLA 4JJFA 2FY8A 3IP1A 4QT0A 3ZWWA 2A9FA 3ONDA 2V6GA 4W7IA 3GRKA 3JYNA 1PSDA 2SCUA 1NWHA 2CZCA 4ITUA 5CG1A 3WLFA 3IC5A 4U8GA 3WGYA 4XYGA 4NIMA 3WGOA 2GN8A 4NJOA 4W7HA 1LDBA 2FHSA 4EEZA 3FD8A 5F1PA 4XRRA 4BO0A 5IDWA 4L4XA 2FPIA 4CM4B 1NTOA 2CDAA 4CUJA 2CY0A 1UXKA 3NKLA 1WMBA 1H6DA 3U4IA 1XQ1A 4ALNA 1PJ4A 1FDSA 4BQRA 4CQMA 5KVSA 3OEYA 4CR7A 2NACA 5C7OO 4RZHA 3GUCA 1MXFA 5EQDA 4ZU3A 1HTBA 1PGJA 3RUHA 1KC3A 4YR9A 1Y9EA 1LRKA 1VJ1A 2OP0A 1KETA 1E1LA 2IXAA 4PLYA 2Z1MA 4XDYA 1GQ2A 2VNSA 2YQ5A 5B4VA 2YV3A 3ICPA 4ZQFA 2FOIA 1NHWA 1N2SA 4XYLA 2VT3A 1IUKA 2TMGA 1Y7TA 3A4VA 2IE0A 5H81A 2Y0EA 1KVRA 1WLYA 3QVTA 4BGUA 1EEHA 2Q1WA 4NG5A 4IXTA 3RVDA 4AVYA 3GT0A 4KUGA 5EERA 1CQJA 2WTBA 4JK3A 4JLWA 3D7LA 1I30A 5B1YA 3O8QB 5T8KC 2B5VA 4II2A 3FF4A 2O3QA 4OQZA 2EGGA 4L73A 2Y68A 1ZMOA 5JAMA 1YE3A 3S1LA 1LU9A 4B3HA 3VKVA 3ADPA 4PG7A 4WCFB 3DO5A 4D41A 1ISMA 4J9UE 3VAZA 1PL7A 4LSMA 3RCBA 1KOLA 5A9RA 5JCJD 3QW2A 3O03A 2X86A 3JTMA 1PQUA 1TA4A 3KVOA 3WQRA 5G0WA 3BMNB 2DUWA 1P74A 2VHYA 2WD7B 2NTJA 4ZJUA 4OH1A 3DMYA 1U1IA 1E7QA 5JY1A
chains in the Genus database with same CATH superfamily
4D98A 2D5CA 1YFKA 3RAGA 3V1TC 2WZBA 2CBZA 2YVAA 2I0FA 5FFFA 3RKRA 5BWBA 3IKLA 1J9ZA 5D3MA 3ORHA 1VKJA 4CM6A 4TV8F 2G0TA 2ZVJA 3UENA 5FR1A 3MNFA 2H1LA 4QD3A 2VXYA 1TTTA 5AVTA 4ZAZA 5LJIA 4RXMA 3CUEF 2QL9A 5CDSA 4YXFA 2ZZMA 3LMKA 2C5LA 3JQAA 3L7KA 3GVCA 4QBHA 3WSTA 2XA9A 4CMIB 3ZDAA 3GU3A 5DDIP 1SR8A 1F0NA 1U28A 1ZZEA 3E48A 3OX4A 4ZV4A 2XD9A 1U3VA 1LI5A 1UZAA 1ZM4A 3BQNB 3PFBA 1UKVY 2ZYGA 1WHSA 3GMIA 4YJFB 5U1PA 4YHHB 4M87A 3R3XA 2YH2A 1BZYA 3I9MA 1KKUA 1KZ9A 1SNYA 1XLWA 1IXSB 2F7SA 2Q4EA 2YFQA 3QX9A 4LGYA 1M6VA 1Y4ZA 2DJIA 4FVTA 2C9DA 2QUIA 4NWIA 2QDXA 2D00A 3D8UA 1GPNA 3BZWA 3F1LA 5BYKA 3ICQB 4U63A 1M75A 1YBVA 4BYGA 5ECYA 4KXYA 5CX1B 4X1KB 3T7CA 1M6WA 3FUWA 2DOKA 4HMPA 5CU7A 1MDFA 2QSYA 4KQKA 1PG0A 4I1RA 3ZHVA 1GNTA 3FE2A 4PPYA 2QTZA 1GCUA 4C2UA 5FOTA 3NIGB 3GJXC 2JGRA 4NMHA 4XPIA 5TMEA 4EF4A 4DWVA 2ZYTX 2RAUA 5JI2E 2G36A 3JATA 3AW9A 2FK7A 3E7WA 2P5SA 5IVDA 2UZ1A 1KDYA 5KSWB 1DJQA 3AETA 1NBWB 1QP4A 1N2HA 1AQLA 1CY7A 1EFKA 1T26A 2EQBA 2HU8A 4W5TA 3QOXA 3FPHA 1CQWA 2F8MA 1KOJA 2XECA 2VYND 4N3NA 5CDGA 1K0FA 5JMOA 1Y5LA 3DL2A 3DMDA 1SD1A 4OV6B 5CURA 5DN9A 3D59A 2V58A 4G97A 2PK3A 4OFZA 5JIBA 1W0KD 1M1NA 1X8JA 2C9ZA 4JYAB 2Z1DA 1B26A 1G42A 2OOSA 1Z0JA 1F6WA 4LXTA 1H5NA 2YYSA 3MBIA 1XLVA 3MD9A 1BGXT 1I1QB 1ZJ5A 2YRFA 4WZAB 5DBEX 4MKIA 4FP9A 4AW9A 3IE1A 1LJ8A 4R1MA 2BZ1A 3EWIA 4F1JA 2OCYC 1UM8A 5H82A 1W47A 4NFSA 4Y2RA 1U8FO 3WKEA 3KHTA 3F7MA 4KR7A 3M83A 1C4XA 1PNOA 3MWEA 2J9FB 1MOQA 1NXQA 2O2XA 4GPBA 1E92A 5LJLA 1W36C 2GARA 2R3SA 1MCZA 1C8VB 2YV5A 2ZBRA 4W6ZA 2H1SA 3FI0A 5ER6A 3WB1A 1NSYA 2R48A 2XOKA 3BK1A 3OJEA 4LHVA 4IRXA 4JBNA 2EJTA 3C8HA 2BFFB 2FPKA 2BFEB 1V7QA 4EY8A 1BVHA 1IB6A 1QHHB 4DMCA 1HETA 3KU1A 2AYZA 4MYSA 2P9EA 2JDID 3AL2A 2I7DA 2DHQA 2ZR7A 3D4LA 3NEYA 5L3RA 1XQWA 1F2TB 5FA6A 5AXBA 3RSOA 2WIDA 3OG9A 4G0MA 2FPLA 3D8HA 2BFBB 3WP1B 1XFDA 3QM1A 4LBWA 4RQAA 2HLDA 3HWWA 5GAJA 1NJFA 4Z7NB 3NETA 4EA6A 1RJFA 2A9PA 1P6XA 1QFSA 1XROA 4JJZA 1T91A 3EXHB 5A9TA 4MYCA 4BEWA 5K3AA 5HQ3A 2H5IA 2JEOA 5BOSA 5K8TA 1ZO8A 3TQCA 5F2OA 1Y6RA 5FV4A 2HA6A 5I9LA 2P1DA 3G2HA 4POOA 3ETGA 5HCUA 4MAMA 4MV1A 2Q0HA 5L51A 3S81A 4TZ0A 4BQPA 3BCSA 2OENG 4EQZA 3WZMA 2IUTA 4EQ6A 5A1TA 2VUSA 4MV7A 2XH8A 1MO6A 3MMZA 4JOCA 5TQVA 5BV7A 2C7PA 4LI0A 4MEBA 3ZV4A 4KQIA 3OTQA 4PS0A 3RFCA 2ZULA 2RI6A 3R3ZA 3U2QA 1CY2A 2R8ZA 4CMIA 4J0DA 5EHZA 2WWXA 3DD1A 4FOSA 4YY3B 3NBYC 2PLRA 2I67A 5AH0A 5LZ8A 4MW9A 5HWSA 2KWIA 3ZOKA 5DM70 2PTHA 2LRHA 4RC9A 1DUIA 2UYOA 3B1JA 3TL2A 3W0LB 4CZ2A 1NVAA 4EY4A 1DGQA 2JB9A 2PKYX 1EAMA 3V8NA 3ZV5A 1SBYA 5JW6A 4CIDA 3AVVA 1DBQA 2NAFA 2G1UA 2I1LA 3URKA 3O91A 5IAKA 2ODNA 3GAAA 4TWBA 1BE1A 1NW3A 4ZDKA 1XAIA 1ZG3A 2ZSAA 1VL8A 3TLMA 2GF9A 1GG2A 2W00A 4G09A 4JJEA 3G85A 1UBMS 5I7UA 4FONA 2C92A 2HB6A 3CZQA 1XAGA 2O50A 2G7ZA 3AB7A 3MHTA 4HAVA 2VYVA 2BEUB 3GXBA 2W70A 3U3KA 4KPUB 2JFUA 4CM8A 3RVKA 4WMLA 3E4DA 2E5LB 3U3JA 3H87A 2HDNB 1SC1A 3C5EA 1R8SA 3DZCA 4KRXA 1L4HA 3HXKA 5DTMA 1PYOA 1C3OB 5LP6C 4L5AA 4D7AA 2Y27A 2ORVA 2HLPA 1L5FA 2YHAA 3L6CA 4BLOA 2IYLD 4NV3A 7MHTA 3TVTA 3C3JA 3R6LA 1BX1A 3AR7A 1C4WA 3LY7A 2QNBA 4MR8B 2ZI6A 1NQTA 5K7SA 2GBFA 2GEKA 4QUDA 2CHFA 1HGXA 2OO7A 1U90A 2PL3A 3KE9A 4QBKA 3A4MA 4CKBB 1VMDA 4IVNA 1Z4IA 2VBGA 2YV4A 3EOZA 5LXTA 1OOEA 3N6VA 3QU5A 2E82A 1G5TA 4ZI5A 2QN8A 4Q18A 2V0CA 2X41A 2X77A 4RSHA 2QXTA 3VPAA 1IK6A 4IXMA 2PH5A 1HEYA 4XIGS 2IYZA 4RBNA 4R7GA 4CI9A 3OAAD 3AVPA 4WJKB 3NIDB 3E1GA 4CBVA 2XQGA 2C9YA 1ISFA 2B4AA 2G08A 1UMDB 2YWHA 3PWKA 3ICOA 5CNJA 5EJMA 4BASA 1FRZA 1GQYA 1V96A 1XD2B 3EIEA 2ZBUA 2ZE7A 1EVZA 1IAQA 1K4MA 3VBEA 2AD1A 3LKBA 4PE5B 4D8UA 1DBIA 3GP3A 5JADA 2DUNA 2GVNA 5G0SA 4INZA 4B3CA 3U7HB 3JQ9C 2ZW9A 4TYMA 2QXYA 5TT0A 2Z3WA 3FWYA 4UVHA 1G3IA 1X7GA 3REQB 2R0QC 2BFFA 3DB2A 4A0HA 4X5OA 4DCMA 2VPIA 1IHPA 1WP4A 1DAEA 3HB0A 1T8YA 2DWOA 5FWXA 1V4VA 2IEDA 3PFCA 4EB6B 5BYAA 1GVHA 1JHRA 1GTRA 2VSNA 2DBQA 1JLKA 1TT7A 1NXWA 3U4QA 1J42A 5IEBA 1US8A 9GPBA 4GLJA 5CX4A 4RJTA 3MVEA 1VIYA 3GO4A 3VSBA 5M04A 4O4LF 1TZ2A 5GM1A 2W11A 2XYVA 3ACBA 4DMGA 5BV0A 2ZIVB 5K01A 1TZKA 3C3PA 2ZRDA 3FTNA 2PGLA 3KYIB 4DLWA 2Q6OA 4M6WB 5EWLA 1EK1A 1NM5A 4UEKA 3RJTA 1ZEJA 2CD7A 1GPMA 3T0IA 3U7FB 4FWBA 3SFVA 1IHDA 1F2UA 4HDOB 4EF6A 4MSUA 2NQ2C 2I1VB 5IVIA 1C7RA 4EZIA 3QU9A 5JAIA 3U5TA 1PJ3A 5E3IA 1JHDA 3K9HA 4I8IA 3PXXA 4JQCA 3FR7A 3CR3C 2CXHA 2O2HA 2LIPA 1R9JA 3R44A 4E5SA 1B1CA 4PM4A 4UHKA 3U09A 3L1IA 2Y1WA 4TM8A 5A7FA 1IOVA 3LUBA 3ZGVA 1QAMA 4DA4A 1GLNA 3AESA 4P6VF 1U2QA 3VR0A 1A9QA 4P86A 4YQYA 1KEZA 3CLRC 3U37A 3V46A 3ZV6A 4Z6KA 1JQKA 2JIZD 4N3CA 5AJUA 2CBGA 2SNIE 3NC1C 4L7VA 5INTA 2GSDA 4CKEB 1A8UA 2AMYA 1ZK1A 2PG3A 3F74A 2PAAA 5FUYA 1DO2A 1H9CA 1A2OA 1BHJA 1RJGA 3TJRA 3QI2A 4LYEA 1Q7GA 3IV7A 1XVLA 4DE5A 3EQ2A 1LNZA 2EC5A 2IIQA 2IL1A 5ALFA 3RYFB 4EL5A 3L6UA 1VJCA 1NJ8A 3OCVA 5K0GA 4BCDA 1OXUA 3WK4A 4QKQA 5ICCA 3I01A 4U4AA 1XTIA 3LUCA 4L4ZA 4WBNB 1VMIA 4WY5A 4B73A 5C8YB 4KR0A 4BPRA 1IN5A 1E1KA 1S2IA 2P4HX 2P65A 3EDQA 1Q7CA 1K4YA 3AF0A 4PG4A 3A8TA 4ZWNA 3GT3A 4F9FA 1XRSB 3GYGA 4D5EA 3RHZA 1OY1A 3CUYA 1KEVA 1IQPA 1CIJA 2EAUA 5KNDD 1P7WA 1VHLA 1ZA2A 2HSEA 2QG9A 4H3VA 5TNXA 3IIIA 1AHIA 1BJKA 2ZYWX 4Y7CA 1YA6A 3BL8A 2BMJA 3IAS6 3EMVA 5A6VA 1EDDA 2XIQA 2Z95A 5EKUA 1J24A 1TZCA 1M73E 1MC4A 2C95A 3UV6A 4BNDA 5A06A 5JQGF 2GZ1A 4NK5A 1GOTA 4UHJA 3DXZA 1WKCA 4FBMA 3TK1A 1R0YA 4LCJA 1UAYA 2A3NA 2OORC 4A03A 4IWYA 3ND7A 2XCLA 2XF2A 5T8KA 1ZCFA 1ADGA 3WGUA 2BGMA 4QDTA 4ODIA 5E9QA 4EPXA 1ZLXA 4D9CA 1M34E 1Q1BA 2GYYA 1TU0A 1W5FA 2ZRJA 6GPBA 3MTBA 4BNGA 1ICIA 3DBRA 2X7XA 4TKUB 3ZZ1A 4I55F 1AUOA 5FWYA 3DL4A 4XSGA 3R77A 3BAFA 2IHBA 5CD9A 1LBQA 1XEFA 2AUTA 3PUYA 4FNAA 4MQ4A 3O73A 3K1ZA 1ISIA 2DTEA 4OMFG 3ROQA 3EIHA 4HXGA 2HBZA 4DNOA 3CVUA 5HGJA 1SCJA 3H9EO 1NXOA 4NEQA 1U7TA 1E7MA 4DJFC 1SBTA 1WBDA 5B3AA 4BWFB 3MRXA 3LKDA 3FTPA 4YLEA 4BEBA 4RHYA 4DV5B 1R9MA 2EBHX 4XTCS 1QRDA 2GEDA 3OQJA 1KU0A 1YRAA 2AVDA 4TYYA 1UFKA 2IEBA 3A1EA 1SKUA 2OBNA 2OP1A 4Y8VA 2OYCA 3T7TA 4A8HA 2AN5A 1ITZA 1WZIA 2ZKIA 4LGCA 2ZP1A 5DYTA 1YO6A 5ALXA 4ZJYA 1NW9B 3HBJA 3U40A 4L75A 4WZ6A 4L3OA 2VDUE 1QHSA 2QYTA 2AMJA 1ODSA 2WNHA 1M1UA 3KLNA 4HCJA 1GPBA 3OZ7A 4I2NA 4JQYA 2WYHA 4NLLA 4ZEOA 2ST1A 1JHYA 2ZIFA 3H8VA 3I32A 4JOSA 1L5WA 1UDBA 2AKYA 3KEOA 1PU2A 4P7FA 4RIEA 1CR1A 3CCFA 4IDDA 4PQFA 3V8MA 1ESCA 2W42A 2W6OA 5EZYF 2QRJA 2NUPA 2Z04A 1EXDA 2V1XA 1M83A 3BG5A 4E33A 3KL4A 5HRAA 3QF4A 5CT6A 4QLBA 4WEOA 4ZPXA 3L82B 3WGNA 1KJJA 3AUAA 1HLFA 5JXGA 1T3TA 2YWJA 3RTBA 2V5VA 3A1DA 2B83A 1Q0QA 2MYUA 4DYDA 5JXJA 1Z2PX 2G80A 1BC5A 2HSJA 2ID8A 1RFLA 4K0RA 4MPJA 4BTLA 5ITWA 1AX9A 3ZDCA 2ONYA 2WWWA 3KDSE 2C4HA 3QVLA 3O74A 4GMHA 4Z9XA 2WYUA 3RD5A 2I3DA 1TGYA 4NU6A 3L1UA 3ZQJA 3EIFA 1E9RA 3K0AA 3LT4A 3I0MA 4W9MC 4Z8YA 4B7CA 3KYBA 4FR2A 3PF8A 3KM0A 4TYPA 4YO8A 5LA6B 1XTQA 3KUUA 1VG9B 4Q0MA 2H7VA 5CT9A 1XRMA 5AJHA 1FZTA 4DCCA 4DREA 3J80A 1K5HA 2P2LA 2OBMA 3QYFA 2P1RA 2PCJA 5TR9A 5D3ZA 5JY6A 5FKJA 5HK9A 1B14A 2R6CA 1E0KA 1KDOA 3OIGA 4IHAA 4QGHA 3ZKAA 8AT1A 2VP9A 3DS8A 5BQXA 1NG9A 4D0GA 1W88B 2O3JA 1AKEA 1MT3A 1M5UA 1Y9AA 2SKCA 4FYKA 4HAIA 2C0QA 4QJIA 4QTZA 3RK1A 3W4JA 4B6GA 4OSEA 3N2KA 4U3JA 1UBEA 4YIKA 1EZ1A 2P2SA 3VKFA 5FYDA 3TLYA 3AM1A 1JSXA 1PR0A 3EZGA 1B6TA 4K9QA 5GONF 1DRJA 4ACBA 3UAYA 4HDSB 2P9YA 4IDGA 3O9MA 3Q6NA 2X4DA 1BO6A 3JASB 4EUNA 3OX1A 1FU4A 4BO6A 1FFHA 1UZLA 3ONNA 2OAGA 2HMVA 4BXOB 3LECA 5I9BA 4AXBA 4LDAA 1UPBA 4OYLA 3GJRA 2Q5FA 4RS4A 4ZQGA 5A04A 3OZSA 5FEUA 5DHSA 1PIWA 1J99A 2F1JA 5DCYA 3OZVA 3C5WP 4F85A 4WY8A 1YASA 3DJFA 1U8UA 4BQSA 5KJEA 4K9SA 1APBA 2FG5A 1Q0HA 4NL4H 2C5FA 4WV3A 2E37A 3A4TA 4C0JA 5BSVA 2GWRA 1EUQA 1CNMA 2NUTA 4JP3A 1DAHA 5B3JA 4EDHA 5B58T 1HFKA 1XTVA 1JS1X 5EZSA 3VKUA 3KZVA 4M83A 3T9EA 4MP3A 2OG1A 1VRCA 1CUBA 1E60A 1E8DA 2WM3A 4YRGA 1A27A 3JQ8A 3NBFA 4QL3A 3RVPA 2PGXA 3MJHA 4ZCRA 3D5TA 4PZ9A 2YYAA 2JJ1D 1CRZA 2OWEA 1YE8A 1LSOA 2K7FA 1C14A 3A4YA 2ANCA 4RPJA 4YCJA 1ORVA 1LNQA 1WCIB 2FPGB 2MYNA 1WZUA 1P5FA 2A59A 2FPPA 2WM8A 4FHEA 5TF0A 3RFFA 3VO9A 3PFFA 3CUKA 1KI8A 2GZSA 4UMDA 5AHWA 3C3EA 1I7SB 4JWTA 4G37A 1JQLB 4E07A 2GOYA 3LBIA 3KLMX 5JNTA 1JAYA 2IEIA 1G6OA 1E2UA 1E98A 4B83A 2R47A 1GKUB 1DPGA 3GG9A 4FFVA 2XMDA 4EKDA 1HO3A 2ZYUX 2AGVA 3ZCSA 1F8FA 4RH3A 3IRVA 1CR2A 2OA0A 5KYUB 1FJGB 1UMKA 2HCRA 3SHQA 2G0NA 1KZ6A 1H2FA 1RXVA 3O3OB 1DJLA 5CXXA 4AUKA 3HA2A 2J87A 5LXTF 2ECPA 2JJ1A 2LUOA 3OVMA 5E7QA 2OYRA 1RAFA 3QLVA 3SZRA 1A9YA 1W5SA 1UJ2A 2I4OA 3KAPA 4F21A 2FG7C 2J0UB 5A3RA 1B4DA 4DV4B 4MI3A 2JL1A 1ETUA 2H07A 4XQCA 2QPOA 1JLLA 4DIOA 2BTOA 5B4TA 2G4LA 3QEJA 5D6OA 3AIIA 1PFWA 2OCGA 5EPEA 2VCYA 1YI0A 1USGA 2R68A 4CETA 3BGOS 1FRQA 1DRWA 1T0JB 2JAPA 2P2CA 3AK4A 4OJNA 5FI0B 1I4OA 3W9UA 4F9EA 2SCUB 3AUSA 3WB2A 1NLUA 2FZEA 3WIVA 3G82C 2AVNA 4JVSB 2AOVA 1LDMA 2PKCA 2B7CA 1PSWA 2RGAA 2YVLA 3F6CA 1QG0A 4GVLA 3TNFA 1F38A 5I45A 1R9GA 3SMVA 5FPTA 5EYPA 4B6QA 3GAZA 4BNJA 1ZVQA 3PQ6A 1XPRA 1CF9A 4H1VA 5ALGA 3IPXA 5C1OA 2R1VB 3AY7A 4G0OA 4N7BA 1RQLA 4EY6A 2WI8A 1S3FA 2D0IA 4MKZA 3IHLA 3OJCA 3HN7A 2ZBEA 4Y30A 1NBOA 3B3AA 1YVUA 1KHHA 4BV9A 5I9NA 4F06A 1JU9A 3MGGA 4L8WB 2DUJA 2O8EB 5A0TA 3PSAA 4AD8A 4OX9Y 13PKA 2H18A 1A98A 3BCUA 4WI1A 3RADC 2QG6A 4HUQA 1CZRA 1NZFA 3F78A 4Q21A 4RHTA 4JI4B 1HTWA 4JU9A 4LZJA 1JDBC 1HWYA 4XDGA 3MRVA 3WXBA 4XUGB 5JOQA 3SXUA 1DIHA 3DZDA 3ZCTA 1XEXA 4WXEA 1S7CA 2PUHA 4WCFA 1DHRA 5CAEA 4CFYA 2B30A 1R74A 3ROEA 4C4RA 1DEOA 4ZRDA 5SYNA 4NFLA 2P40A 1Y1RA 3HPRA 3C5VA 4KLRA 3U0VA 1G38A 4KFSA 3OKCA 4NCJA 1ABBA 1W2WB 5FBLB 2Z08A 2B8NA 4FDVA 2ZBVA 2XRMA 4QYWA 3UXHA 1DV2A 3DHVA 5FUVA 2QVBA 3NANA 2F2TA 2GSWA 3RM3A 3UJ7A 4B3FX 3OM8A 3P1JA 3VKWA 2X3UA 1AKRA 1TXGA 3I2IA 4M1ZA 4OVKA 4NPAA 5BR7A 1M67A 3LUHA 3N0WA 4EYKA 2J46A 2BOVA 4MYHA 2V0GA 2H5EA 5JQGB 2ZBPA 5EKTA 5BURA 2YHSA 2WWIA 5CGQB 4D0SA 2I9KA 4I5EA 1S96A 4QDZA 1QPBA 4UJ3A 1GFZA 5IARA 4EJ6A 1G59A 1UOEA 3A70A 4OJQA 4HTFB 1N3IA 1UKYA 3E84A 1Q11A 2BI7A 5BP7A 4LFAB 2V7WA 3GEBA 1PFUA 4KXXA 2GEJA 2GB4A 1XJWA 1E1YA 1G8PA 4S05A 3B7WA 3HA3A 3OIUA 4MUNA 1OV6A 1HYGA 3CVVA 3FRIA 3GPIA 4LKOA 4YP6A 5J4LA 4CWAA 1AZSC 4MDEA 1JSCA 2R5NA 3I1JA 1E5XA 2IV2X 3AKEA 4YASA 2NYUA 1SIUA 2XMZA 4HLCA 3ZXUB 4LF9B 3ILHA 2FN9A 2KE5A 4TT3D 4GP9A 2A9OA 2C98A 4Q9AA 3I9JA 1U6IA 1T8UA 2C5AA 1J2RA 3AR2A 3MTJA 3TW4A 1NZDA 4NXNB 3V6LA 1YA4A 3TAHA 2A5FA 3U7RA 3NUQA 3NNNA 1N6PA 4UUAA 5C7IO 4OAPA 2Z5LA 1E3IA 1QVWA 2GJ9A 2A94A 1N7HA 4WNAB 3RC2A 3HADA 4AX4A 3C4JA 1BS2A 4JC5A 5CDYA 5ECWA 1Q14A 4P3YA 3RPEA 4Q66C 3GCGA 1AB5A 1EWTA 1AMOA 3HU3A 1KJNA 1RPTA 2W90A 3I45A 3N7TA 3TDMA 5GOTA 1THTA 3PYXA 3H1AA 4CF6A 2X9QA 1UDWA 3HZOA 3NS7A 3GJTA 2PX0A 1LX6A 2NTVA 1BCRA 2JKVA 2J3QA 1IQUA 3IQGX 4TXNA 4KK4A 5LB4A 5BYJA 3GEIA 1DKRA 5FO0A 2ZT6A 4HQ6A 3DQZA 3D4NA 5E0KB 4NH4A 2QRUA 3Q41A 2AXQA 4NCKA 4QOGA 4FUQA 5TX7A 4UDOA 3CRVA 5EHNA 5B12A 4HDNA 2QTTA 5EUCA 3RVMA 3T52A 3I39X 1LPOA 3OZRA 4QEZA 4O8ZA 4BLSA 4P32A 4E5DA 2J9GA 4PCUA 4UU0A 4DSOA 1D2RA 4EB3A 2Y76A 3DBRB 5CB6A 4YYZA 3K0CC 2I66A 2Q5HA 1FA9A 1U7PA 3MGBA 2QQFA 2CT8A 1HDXA 1N2XA 1NYLA 2GAOA 2AOXA 2O5VA 2ZIGA 2XUPA 3HTXA 1QVZA 1Q3KA 4Y2TA 5K3SA 2W6ID 3U56A 2AFRA 4OHXA 1ULTA 1YD7A 4KAAA 1QAOA 2FF7A 2IGTA 5LMNB 1J23A 1PR5A 2IDKA 5HUJA 1NI3A 3MWDB 4QSHA 1BHQ1 3OIYA 4GX5A 5FIUA 3D3WA 5T64A 4C6SA 4DM4A 2ZUFA 3I09A 2QM7A 2JANA 5HRUA 3E8XA 2OHFA 1M5TA 3F6BX 4DY6A 2VK4A 1XR3A 2XXJA 2V96A 4NHOA 2COKA 1USWA 1D7OA 5ERGB 3ESZA 4CEJB 2ZWIA 2VNJA 4XPIB 1DELA 4ZOAA 5GGYA 1NJGA 1V1MA 2QI9C 2R6ZA 3R0QA 3S6JA 3UCFA 3SC3A 1QTQA 4OP3A 1MV5A 3ON5A 3KSBC 2ATXA 2XRFA 3L77A 1SU4A 2YWDA 5EI5A 3VPCA 3FYHA 2JGLA 2D1QA 2YICA 3JVVA 3ZI7A 1U2EA 4H4DA 1E99A 4ZP1A 1SBNE 4WJZA 2V3CC 3BDIA 1AVTA 4IIDA 1SVIA 1XEXB 1TQ6A 5A4MS 1XZEA 3RYHB 4FQ7A 1E9CA 3LCCA 4JKIA 4DRYA 1P4HA 3O2SB 4DZRA 4F46A 4X8OA 3EA4A 3OHSX 1UAAA 2C3OA 2VNHA 2WG0A 5AK4A 3KPWA 4AJHA 1B6RA 4BNKA 3OICA 4IKOA 1JFSA 4AKIA 2R85A 2RC5A 3QFSA 3MWJA 2UXCB 1VIAA 2X1VA 5CPFA 5T6BA 4B75A 1PKXA 3QE2A 4Y1EA 4CJXA 3AU8A 3PXGA 6ADHA 1VI2A 2PUGA 3OE7A 5CDFA 4JT9A 1MGOA 3N0XA 1Q1NA 5KCMA 4C9BA 1ZHHA 1YJBA 2DR0A 2RCYA 1DWOA 5JT1A 4ZTBA 4D74A 5KVQA 4JLKA 3S8EA 3KELA 4XLLA 3VU1A 4BFLA 2XVAA 3K70B 1BNCA 2PGAA 1N34B 1D4AA 1P5JA 1E1NA 1BCSB 4E2WA 2Y99A 3TQIA 4MAFA 4KQ9A 3UFBA 2XYHA 3FKSD 4YJDA 3T1HB 4LHWA 4HB2A 4LBVA 2ZB4A 3HH8A 3JAWB 1RHQA 3CCBA 1VCIA 1ZVMA 1JB9A 1EZ4A 3O5AA 1LXCA 4IQ4A 4C08A 4JXXA 1Q74A 1SO8A 2P79A 2BMVA 2QLFA 5ICGA 1CZLA 4Z3KA 3KT0A 3T5AA 1ZJ6A 1UL1X 4YV2A 3LF1A 4R6WA 2AJTA 1S7GA 1UDCA 2IK8A 4UBNA 4HX5A 3QX3A 2PRSA 3WLOA 4QOHA 4IEFB 3VH1A 4E08A 3FWNA 1M8PA 4F84A 2ZSDA 2XQIA 1DVRA 1A5SB 4L07A 5TPZD 3BJEA 2B1QA 1DRVA 3EIUA 4I5FA 1LLCA 3HXQA 2XCSB 4J2TA 1K86A 2KMLA 1AF7A 4AURA 4D3ZA 5GJBA 3P5BA 2RMKA 1USIA 1VHWA 3MT7A 4PLFA 1O95C 3GQBA 3RNOA 5NLLA 3ZY6A 4A6EA 4RO0A 4D3DA 4JYZA 4H27A 3ZUPA 4HR7A 1JDZA 4TLCA 3DMRA 4BMNA 1IBKB 2Y4NA 5FXMA 1RJEA 1TC1A 2QMZA 3H5OA 1RWQA 2BBSA 4B3DA 2CV2A 4HDNB 3PQCA 2R66A 4KE9A 1G4AE 5F7OA 1KMMA 1Q0TA 1W5TA 1RLJA 3LDGA 2W2OA 3ME5A 2JH9A 1I33A 3CJQA 1N2CE 1NFRA 1SQ6A 3LW7A 5C4GB 2JLXA 2P5YA 2IUYA 2LXNA 3P32A 4W5WA 4BMOB 4EX7A 1T29A 1YVPA 3M3PA 2MSDB 2Q6LA 1QZXA 1KO5A 1X7XA 4N4AA 5D7NA 5HMMA 2HRBA 3CG4A 3T9CA 4EZEA 4XWYA 5CIYA 4QVIA 5FBKA 2Q2VA 3Q8MA 1BA2A 1XNHA 1MAVA 2PEYA 1IRIA 1IU9A 1RWXA 2E4AA 3M8KA 3LRXA 1B0AA 4JUIA 4CCWA 1RBYA 2A5LA 3AM3A 1UDAA 1IAVA 1AK1A 1MJGM 1SCAA 2PCLA 3FKJA 4GBJA 4W82A 2C2XA 2PAFA 1GLGA 2GBLA 3K0EA 4B2IA 2Y66A 3AR5A 1D6MA 1BS1A 3K5IA 4OHBA 3KXDA 3HSSA 3QKRA 2H08A 3SGLA 2OUIA 3INTA 3V42A 2GA9A 1FLNA 1GTZA 2WIFA 1T2EA 4M0PA 4WNAA 4B3GA 2JI4A 4HYYA 2O59A 1O9BA 4GI1A 3KV3O 4BNHA 4UUOA 3GJZA 4AS1A 2WPDD 1IB0A 4M1WA 4Q48A 3FYUA 3PHIA 2HAEA 1N7IA 4KLZA 2FRDA 4LYFA 3L49A 5JDCA 4JIGA 4DV1B 2LR0A 1RAHA 2HTEA 4CMJA 4ZEVA 2Y1EA 1FVHA 1GIAA 1OAKA 1XU9A 3OM0A 4OIFA 2V0NA 4CGZA 2XNSA 4FC7A 4WZBB 5KHLB 2RAFA 2WP0A 1JJAA 4R0VA 2N46A 1C1XB 3R8CA 3WRWA 5J2TA 1B3RA 1GKYA 4MUYA 3AZQA 1EUCB 4IZ6A 5K3BA 4GECA 4LQCA 3X1KA 1N1GA 2GBPA 4CN9A 4CEJA 3ETEA 3PNYA 2DHDA 4ARBA 3I37X 3R5TA 5E2IA 5L9AA 1AV6A 4I81A 4BMYA 4BE7B 1EBBA 2CGEA 2Z3VA 4ZVVA 2HREA 4WINA 3SIRA 1M2OA 1DAIA 1S1CA 4RDXA 3O8LA 1GAQA 2I54A 1VLQA 2JF0A 2WW8A 1ZU4A 3PS9A 4G4SO 3QENA 1WMSA 3T5CA 3QSYA 3IQFA 2C57A 3UJ9A 1KR2A 1SVKA 2PFKA 3CH7A 4LGVA 4FS3A 1VDZA 2QY9A 4HMOA 1JG6A 1JPNA 2BEWB 2RGEA 1DLJA 2J0VA 4R1QA 5HUQA 2YCLA 2YV2A 3VNVA 4HVLA 2XB2A 3EVNA 4PYMA 2OLKA 3PDUA 3RUCA 3IDFA 4M9SA 3EGXB 5LU8A 2PUFA 2BH2A 3KAKA 5CT8A 1R0LA 5ELXA 1OFUA 1QC5B 3UH1A 1DAGA 3O4GA 5AW1A 1RM5A 4JI5B 3D8TA 1K4KA 3ZIDA 5SY4A 2CFSA 4HBGA 4K0KB 5GWXA 3NU1A 3AIMA 4OUDB 1F8UA 4ZHQF 1R9NA 3WGQA 3K35A 1W6UA 2HKIA 1P5HA 1DOHA 3ANSA 3F5DA 3OPXA 1E6WA 3QMWA 1FX0A 3GT4A 1CY0A 4MUJA 4R1TA 1YDFA 4ZT5A 1BX0A 4D9MA 4XYMA 5F3RA 3SBXA 4E4RA 1YMVA 3NUGA 1O0SA 1QHYA 1F2TA 4OQYA 4RF5A 1BEUB 2WAYA 3WBJA 1NW7A 2OT3B 4XUDA 5BSHA 1SRQA 2QPAA 4H0CA 1P75A 1QHFA 2BBTA 3PE3A 4DV3B 2K6GA 3DMGA 1RHKA 2JASA 3OPYB 4GP7A 3SIXA 1VSVA 5CW1A 3LL4A 3DOHA 4OJTA 5IKEA 1GGHA 1IOLA 3KFLA 2NU8A 1XN1A 4HLQB 1C80A 4PZAA 3WXMA 4XZ3A 4HEQA 4RF3A 3TQOA 1G0NA 3JQPA 4CV2A 4P4SA 3S2YA 1W7AA 5DKFA 1MABA 4Z4IA 1PWYE 2ILTA 1H9BA 2OZEA 2BGUA 2LCFA 3WWCA 3RUDA 1U9IA 1ZNYA 3CNLA 4NPHA 4RKQA 5AJWA 4BATA 4EIWA 2BMWA 2FZWA 4Z4GA 4D5GA 1EVEA 2I33A 4KIWA 5CFRA 4N76A 5BUCA 2C4VA 2M98A 3NO4A 1U3UA 3ENQA 5EMJA 2R84A 2RARA 3A26A 4KR9A 1WXWA 2ZJ7A 4KSYA 1V45E 4HMQA 2AMVA 4ITVA 1PK7A 4RHFA 4ARAA 3A6GA 3WGVA 2C96A 3KPUA 3ZHBA 1XCMA 2ZJ2A 1JLRA 1ML3A 3PU6A 5M29A 5GJWC 2ZI7A 1AZLA 3P27A 5E4FA 1GPKA 1XVUA 3DMTC 1CC1S 1G8HA 2FYTA 4PYKA 5BPHA 2DXIA 1J33A 3KWFA 2G28A 1G55A 3KR9A 5ABPA 5DMXA 1BA3A 3ONEA 3SC4A 3GEGA 3R6TA 4CT5A 3DMHA 4TXHA 3MS7A 3TRKA 4DJ5X 2RGGA 5I4IA 3BRWD 3EPRA 1UKCA 4X85A 4O4IA 3TQSA 1P19A 2BHTA 1O57A 2QLLA 1R50A 1DFGA 5AM3A 4ARIA 1UIMA 4RW0A 1U9YA 1XMVA 2AB0A 3MS2A 4HXYA 3NHYA 4IMRA 1MXHA 2Q07A 2ZB8A 5K6TA 5IM4A 4WLEA 5E6UB 2GPYA 3GUYA 3NTOA 4XW2A 1D9ZA 5HOEA 4YYEA 1JAIA 1XKQA 3QQ5A 4HQKA 3I92A 1JI0A 4KWTA 2IODA 4W8OA 2FXVA 3EXIB 3IULA 1ORRA 4D8VA 3H2IA 1X74A 1ZRHA 2XUJA 1CDZA 1DX6A 1IY1A 2HA2A 2PTGA 2KX7A 3B9RA 1A82A 3G1WA 2QYOA 2XPCA 2OC9A 1OA1A 3Q3IA 4P5PA 5FRDA 1NI4A 4EVSA 1OZGA 1RXYA 1GITA 2RD2A 3U17A 1U0FA 1FS6A 1U7OA 2FJUA 3AJDA 3KOUA 4UU7A 3DHNA 4X54A 2AR7A 3R6DA 4ZQIA 2XUKA 1NRWA 1SM4A 1V3QE 2B5OA 5DFAA 5M34A 4J6EA 1E7RA 1YR3A 2D8MA 4FLEA 1I01A 1H2BA 4C78A 5ILQA 3KRTA 4KMRA 2PUDA 5LA6A 2YRXA 1Z3IX 2ZK7A 3JVIA 1QHNA 4QFDA 4WE3A 3BGIA 3EULA 4RKYA 5KAPA 1FFSA 3Q98A 4HFNA 1BQEA 1M8KA 2F3SA 4RCYA 4ETNA 4PCAA 2HD4A 3LIPA 1J49A 1NBHA 2MSEB 3JARA 1CYEA 1NT2A 1I36A 2QXUA 1D1SA 1ORHA 2BKAA 3SX0A 3DL7A 4CIAA 3B9QA 1D04A 3NC0C 5B3KA 3GFFA 1OWLA 3T34A 1L4LA 5BSFA 3ZWVA 2XA1A 3MJFA 2XVXA 1A7JA 2AC2A 1EK6A 5ALRA 2IPMA 4DIEA 5EXDA 2YZ7A 2OQVA 3R24A 3E1SA 4ESHA 2QQ5A 5AW3A 3DMNA 4AJJA 1G5IA 3RRMA 4HDSA 4XCQA 2VI5A 3GLHB 4CF3A 2A5YB 5ALTA 1EK5A 3WLIA 3PLAE 1T24A 3UF0A 3L4KA 1YACA 1J0DA 4JQOA 3G88A 1B8NA 3DOOA 3D3NA 3MD0A 3KSAC 3KKKA 2EW1A 4OI1A 3QBEA 1PDWA 3EC2A 1A5BB 1ZM7A 1CWUA 4JYMA 3RS5A 5BRAA 4RANA 4QT4A 2GHQA 4LV5B 2YASA 2XZPA 1N6IA 5A9SB 2CW5A 1UFQA 3ET5A 3V4ZA 2RHHA 1PDOA 4RL4A 3FOZA 4G0UA 1ESZA 2XITA 1MR3F 1BGVA 1U2GA 4YA6A 1U3TA 1PUIA 2X9GA 3P2MA 2ZJ6A 4FLMA 2A14A 5CMLA 2IU0A 3DE6X 3OMLA 1F0YA 3LQ1A 2ZR9A 3HRHA 5KUTA 2ZATA 1KGSA 3M6LA 2DQKA 4DDHA 1BOOA 1RYBA 1DKQA 1NQUA 2UKDA 3VI4B 1L7DA 1J1UA 4I9NA 2CB9A 3R0JA 3PEFA 4F0JA 4Y1FA 4MWCA 1LTHR 3ESAA 3M6VA 4CDGA 2IZ1A 3EZ7A 3RBVA 2NV0A 4Q39A 3IPCA 2Q4BA 5DNUA 2CZGA 1N5RA 1T2DA 2GD2A 3BREA 3M9XA 4JSRA 4D0LB 3WZLA 1VCOA 3PDJA 4WK6A 3O8OB 3TCKA 2R9VA 3TIIA 2NTEA 4L72A 2IPOA 1DSSG 1LQUA 1KYQA 4RVOA 2CLHB 1Y63A 3CISA 3W9SA 1N5LA 4IJMA 2OO5C 1M6NA 1T2NA 1NAHA 2HV9A 2I03A 2R1TA 5ULLA 3SKXA 5H3LA 3P45A 4X8LA 1P1FA 2CJPA 1R4MA 4MKGA 1FMFA 1ZIDA 4JB8A 1LC3A 4AKEA 4CCSA 5JH7F 3N7UA 3VDNB 2VRCD 4M0DA 4LHXA 2EFYA 1R6AA 1GWNA 2J4DA 5JSYA 6REQA 2FG6C 4C7OB 1G7TA 2V3WA 4G5GA 4U5QA 5L3VA 4LYGA 3U1BA 2A58A 1TU4A 3OQ1A 3NTXA 4NBTA 4B9AA 3WK7A 4L8FA 4RFVA 5DHFA 5LBUA 2NNWB 2XVYA 4XXHA 4EYGA 1YHYA 4GXNA 4NMLA 4R5MA 3FMFA 3MCZA 5CIQA 3UN1A 4S35A 5AI0A 1A8HA 4W8HA 5HJ5A 3BIOA 2PKQO 5B55A 2DFTA 4XGNA 4IUDS 5L3QA 1JXMA 1KO8A 3A10A 3OHMA 4OBBA 4QOFA 1O8BA 2GKOA 2QN6A 3JAKB 2MCFA 4PINA 3SOZA 3I0NA 1RU3A 3SPXA 3ED5A 4I4IA 3W4IA 2YOFA 4MS4A 2O2DA 4M1EA 2YWBA 2GXAA 1AZWA 2V97A 3EQ6A 2WHPA 1V3TA 3PX7A 3ZGXA 1TJNA 1FJ2A 1Y33E 3AKDA 3QUSA 4G1UC 5GJVC 1H66A 2N1MA 1R7RA 1LH0A 1Q7BA 2WJIA 1ETHA 1D6JA 3CLVA 1SXJE 4Z2YA 3TJZA 1KTVA 3PDIA 3ZBPA 1ZIPA 4KDEA 5C80A 3AF6A 4WTOA 1S8AA 1TT5B 1THMA 2VAXA 3MLAA 4F1KA 2Z6QA 2GPSA 3ZNOA 2WU1A 1DB3A 4BVEA 5CUQA 5HA5A 3P9KA 2C9MA 1FYFA 1GNPA 2B21A 2QX7A 4BWGA 4MVJF 4I19A 2XEDA 2N3ZA 3NHPA 3ABIA 1ZY2A 4E30A 1XLTC 5IJ0A 1H1TA 5FJJA 3DTVB 5FOVA 5JCPA 3UXEA 1EE9A 3A1FA 1KAOA 1NBAA 4NARA 2VL7A 1O8CA 3K2EA 3BFPA 4R2MA 1M8JA 3QBTA 3ZR4B 1VPLA 1KK2A 2CJYA 1AGPA 2E4VA 2HRZA 2PV7A 3VR3A 2VT7A 5IMBA 4TVSA 3AUTA 2QX6A 1HDIA 1DQSA 2DLNA 1ENOA 3GLIB 2ONKA 3A9VA 1EK0A 2YXEA 4WNIA 2RGBA 3NHKA 4X8MA 2WT9A 1YZFA 2DPMA 3KWMA 2DM6A 2EFDB 4ME6A 5C46F 3TUZC 1QU3A 1NV8A 1OB5A 1ZOOA 4KAXA 5EJEA 3D3QA 3LTEA 3J81k 1Z0ZA 1R8QA 2FGJA 3W2EA 1QIIA 2E9SA 1O96A 3Q0TA 3CE6A 3EH2A 1BMDA 2NYAA 1MKYA 1L7NA 3ZHTA 1FBTA 3CKKA 1JQ3A 1E9DA 3AV3A 3CNQS 3D2LA 4MIEA 3RVNA 2EYQA 2JATA 5HQ3B 3ANMA 1L7VC 4DWWA 1WSAA 1G5PA 1O5TA