4B7UA

Plasmodium falciparum l-lactate dehydrogenase complexed with bicine
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
316
structure length
316
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-LACTATE DEHYDROGENASE
publication title The Crystal Structure of Plasmodium Falciparum L- Lactate Dehydrogenase in Complex with a Novel Bicine Ligand
rcsb
source organism Plasmodium falciparum
total genus 118
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b7uA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4b7uA02
1RYEA 3O8QB 3MWDB 5L7TA 3AOGA 4GVXA 3NX4A 5JDIA 4CV1A 4KDFA 4CR6A 1U5AA 4MP8A 1NVMB 4OL9A 2ZCUA 3DB2A 1U8XX 3CXRA 4CUJA 1UR5A 4AJOA 4BHTA 4IGFA 1IHYA 2GN9A 1Q0QA 2EW2A 1MB4A 3D4OA 5FEUA 3VKUA 1LDEA 5ENVA 5A9SB 3DDNA 3U49A 2Y1EA 2PTGA 3I9JA 3RD5A 3CUKA 4WPGA 4Q3DA 1SB8A 1TA4A 4HFMA 4N54A 4PG7A 1KETA 1LRJA 2ZCVA 1W73A 4E5PA 1LDGA 2P5UA 3HWRA 1RPNA 1HT0A 3OFSA 1N9GA 3PPIA 4P8RA 3GA0A 4XR9A 3MJ4A 1NNUA 1E7WA 1AHIA 1GR0A 3KETA 5TLSA 3MOIA 2W90A 2G17A 1JWAB 1DSSG 3FWZA 4W99A 2CD9A 5F3RA 3AOEA 3HNPA 1EQUA 1PGQA 3JQFA 3VH3A 3ZWNA 1JKJA 3COSA 3OH8A 3EMKA 1P31A 2B5WA 5TF4A 3RWBA 1NHWA 4RGBA 1WAMA 2E37A 2J8ZA 3C1OA 4KDEA 3ZNPA 4EUEA 2RBEA 3P7MA 3FRJA 4KUGA 5H83A 3ZWMA 2Q2QA 2QRJA 4OMUA 3IJRA 3LT4A 4YJGA 2WYUA 4XZ3A 3I4CA 4Y98A 1V3TA 3RUCA 3F4LA 4FBGA 2UV8A 4IDCA 3WGTA 4XB1A 3ZWOA 2PNFA 4D42A 3ETEA 3KHUA 2CDCA 5IAAA 4E32A 2P5YA 2R2GA 1P1JA 5G4LA 4NDNE 2VT2A 1E5QA 4UVGA 3LK7A 3QRWA 1DO8A 4BKOA 3MJVA 4XRGA 3JD4A 1GQ2A 1DAOA 1X1EA 4KWIA 1Y1PA 1FXSA 4AFNA 3SVTA 4DMMA 1GY8A 4ITUA 3FWNA 1NX6A 2B4TO 5IXSA 4BNNA 4QO8A 1FDUA 4FC7A 3RC2A 4D79A 1TI7A 3OETA 5L4SA 4YAIA 5F5NA 2CUKA 2WE7A 3GLQA 3L6EA 3ASVA 3BTOA 5F5LA 2GNAA 2D2IA 4IMPA 1P44A 1H0KA 1FMCA 1Y6JA 3I9MA 1L1FA 1EVYA 4I5EA 4YQYA 2O4UX 1H6CA 3K73O 1T2AA 1ZKMA 1IY8A 3LC2O 3KEOA 1OOEA 2G1UA 3OM9A 1YB1A 4PLYA 3WLEA 1ZNQO 3ZWVA 1PWXA 1NQ5A 3H2SA 4PVCA 4Z3DA 1G0OA 2E6UX 4DLBA 4CM9A 3I5MA 1E7RA 5FFFA 1NYTA 4OO3A 2PH3A 4WK6A 1YOVA 3VDRA 1QLHA 2XOXA 3H8VA 3RFVA 1HDXA 3JQDA 5H81A 4NU5A 5JMWA 2VYVD 1MX3A 2IDZA 3PHLA 4BO2A 5DOVA 2ZIZA 3CIFA 1VRWA 3QQPA 3Q2KA 4BNTA 4ZQGA 1AN9A 1G1AA 1UXGA 2A4KA 2DAPA 3GVPA 2WD7B 1YONA 4JJFA 4B4VA 4BQPA 2BMAA 1GADO 1W4ZA 5EQDA 5T64A 1OC2A 5ENDA 2EGHA 2NU7A 4OKIA 2X6TA 3GEDA 4QO7A 1U3VA 4IIUA 2O3QA 1Y8RA 1FJHA 3BTVA 1SAYA 4OXYA 3RBXA 4CMKA 4P4LA 4R3NA 3VVBA 5AYVA 2PKRA 3QVXA 3ZU3A 3B1FA 4QT0A 2WM3A 2FR1A 3EYWA 3GGOA 4FD3A 3ZHZA 4ALIA 1YKFA 6LDHA 3NV9A 3W4IA 3PYMA 1M67A 2DKNA 3BMCA 2V6GA 4JCOA 2NVUA 4CV0A 4UVDA 4NZ9A 3INRA 3UUWA 3IP1A 1HYEA 2OXIA 4BKPA 1PS9A 4RL6A 4DBVO 1GYQA 4E5MA 1NASA 1PJ2A 5KTKA 3KYDA 1ZMOA 1HSOA 4ALMA 3R1IA 2H63A 1QYVA 3G1UA 5JY1A 3HB5X 3WSWA 1QRRA 3LC1O 1V6AA 3KLPX 4J0EA 5EL0A 4DQXA 3TOZA 1MXHA 3JQ8B 3CMMA 2EP5A 3U09A 2DQ4A 3GVCA 2DU8A 5L7YA 3ONFA 1PL6A 2Q1TA 1NFFA 1PJCA 4OHUA 5F1OA 5ILGA 3JYLA 1R15A 4D3DA 2D0IA 2VWQA 2BI7A 4EGFA 3LSYA 1O9BA 4QEDA 3P5SA 1ZFNA 2TMDA 3UICA 3O03A 2CMDA 1C0IA 1JVSA 1ZH8A 2Y67A 3QP9A 3CH6A 1XWFA 3KSZO 4NI5A 3DMTA 4FS3A 3PZBA 3UAGA 1NP3A 3NAQA 3DXFA 3E03A 4XJTA 4BNVA 4GQAA 3WDSA 5IG2A 3K31A 4K9DA 4II3A 1SC6A 2A9FA 5DN9A 5F1KA 4J16A 1F0YA 4TKMA 2FWMX 3DHYA 2XAAA 4CLRB 1JKIA 4GI2A 2HMWA 4U0KA 5DBGA 4RORA 5JCXA 1WDKA 2B4RO 2RHRA 3WIEA 3KLMX 3IL2A 1KOLA 3TQHA 2BRUA 2ZB3A 2GD1O 4OSOA 4R1SA 2DM6A 3FCOA 1HYGA 4JBHA 2D5CA 4BNYA 1DBVO 5COAA 1GYPA 4FB5A 5TX7A 2NQTA 5AOVA 3PWSA 1T1RA 3JQBC 1ONOA 1NWHA 1EDOA 2O23A 2ZQYA 2O3TA 1HYHA 3KOUA 4MP6A 5A02A 4ZVVA 1IOLA 1M2WA 5A3VA 4Y6RA 4CMIA 1Y5MA 1O89A 1MGOA 2JCVA 2UDPA 1ZK3A 5L9AA 1LLUA 5I9LA 4I5GA 1NM5A 2JD2A 3QE3A 1R0LA 4Z9YA 1U8FO 1E6WA 4CMEA 5BQFA 4CJXA 3R6DA 2VWGA 1FF9A 1OMOA 4DL9A 1XG5A 4DLLA 3PIIA 4LSMA 2G0TA 3GNSA 1N9GB 2EIHA 3Q0EA 4KTVE 2WE8A 3VTFA 3WQSB 2CSUA 2DC1A 3E5RA 5K6AA 1ENOA 4GX0A 1LDYA 4ZQHA 1H6BA 1I2ZA 1LQTA 2VWPA 5B1YA 2JFGA 4CMAA 1RM0A 4AJPA 4LISA 4TKLA 4BNWA 1ISFA 4B3IA 4QSMA 3BYZA 5JYDA 3QLJA 1BRMA 5KVCA 4YT4A 1GAEO 1DDOA 3WFIA 1WPQA 4UVHA 1XQ1A 5L95A 1C0LA 4UVIA 2FZEA 5JDCC 1XIVA 1U3WA 4MKZA 1DIGA 4IJVA 4YJGB 2ZK7A 1ZEMA 4GH5A 4FDAA 4WLOA 3U4CA 1VKOA 4PVDA 1AUPA 2IZZA 1QP8A 4D3SA 2Z1NA 1DC5A 2NWQA 1T26A 5DBIA 5TT1A 2POQX 2IXAA 2I3AA 3KM0A 5CDUA 4DTIA 1WZEA 3R3JA 5TIIA 2G5CA 4HUJA 2ZB4A 3Q1LA 2R6JA 4CLDA 3GG2A 3F5SA 2OGUA 4BO0A 1UXKA 3H3FA 2O3SA 2W2LD 4I5FA 2NTJA 2H1SA 4S1VA 3UW3A 1ML3A 2ZTLA 1PJBA 5C7OO 2I9PA 4WJZA 1P74A 3L6DA 1I0ZA 4CQMD 1DC4A 3H9GA 3CZMA 3PTZA 1DC3A 2O7QA 4IXTA 3GDOA 2VQ3A 5BNIA 2AQKA 1Q0HA 1SCUA 3OEWA 2JCXA 5BT9A 1OZAA 3ZNOA 4J9UE 3GF4A 5DOZA 5IZ4A 2CDBA 1EUCA 4CUZA 2RHCA 3VPHA 1P1RA 4BS9A 2E48A 3MJEA 1ENPA 2DTEA 4PLVA 3WXBA 4RO0A 1E7QA 3PI7A 4DUPA 4O59O 3ANLA 2J5RA 4MO2A 1A71A 1EZ4A 1PL7A 3OIFA 4INAA 3I3OA 1PJ3A 1SMKA 3KYBA 3KYCA 2WEKA 4QTZA 2ZTVA 3AY3A 2BGMA 3E1KA 2IE0A 2ZYDA 1E92A 3QHAA 1YOVB 1MXFA 4XA8A 2OORA 4F3YA 3GG9A 4RPGA 5HBRA 5A9RA 3U62A 4B4OA 3HFGA 1V9LA 2OBNA 4Q3CA 1PTJA 1W0CA 1LXCA 3DZHA 4E31A 1BMDA 3STHA 3AY7A 2PD3A 3C1TA 5HA5A 2QYSA 1DPGA 2GERA 2PGLA 3ZGYA 3I9OA 3PP8A 3L77A 3DZKA 4M1QA 3HUDA 4E2XA 5AQ1A 1CF2O 2FY8A 1QYCA 2YYYA 4CMCA 1C0PA 1EBFA 4RVHA 3S2EA 1GEGA 4WKGA 5DCUA 4RCVA 4WGGA 4Z0HO 5DF1A 1Y9EA 1Y8RB 9LDBA 2YUTA 2HMUA 4A5OA 3MEQA 4Z9FA 3GGGA 3GZ4A 3NDJA 3NGLA 3PHHA 5KKCA 3GFBA 3K30A 4HFNA 2VOJA 4YJHA 5A3JA 3SJ7A 2AQHA 1WZIA 4BGVA 4P4NA 4B8WA 2XPCA 3E9NA 3D64A 4PZEA 4LSWA 3ZV4A 4AVYA 3WLFA 2EKLA 1K89A 4O1MA 3QIVA 5TJHA 3D4PA 3SC4A 1I3LA 1QYXA 3TZKA 4DVJA 2NVUB 2R00A 4B7XA 1DAPA 3DOOA 3PHJA 2PA3A 3NTQA 3D1LA 4MDHA 3WB9A 3WNQA 3RJ9A 5DCWA 3KYDB 4R5HA 3GUYA 2B35A 3H5AA 4PLWA 2X5KO 4OXNA 4GPD1 3V1TC 3V5NA 1J5PA 1HDOA 2HRZA 4NBTA 4DPMA 1YBMA 3EY4A 3AFNA 1X15A 1WMAA 3PWZA 4YACA 3NJ8A 3CSDA 4YAKA 1H93A 4F46A 3H65A 3VOSA 1KEUA 3LF2A 2I67A 2VYVA 3LLSA 4Q3NA 7ADHA 3I1JA 2GYYA 1U2DA 1PWZA 1SNYA 2ZJ0A 4J9VA 4PGFA 3Q3CA 4CMGA 4CM1A 4NBWA 4IUYA 5C3MA 2H9IA 4IDAA 4R1TA 1H9BA 5A5EA 1YBAA 2PGDA 3MJSA 2DTDA 5CDTA 1VJTA 2YY7A 3BMOB 5T8KA 1LRKA 5KJ6A 3QWBA 1C1DA 2Y1CA 3DHNA 4JP3A 1I2CA 3DBVO 3GMDA 5TT0A 8ADHA 1HF3A 2E82A 3PQDA 4WLUA 3HDHA 2WSBA 4BMNA 4R41A 3GDGA 3JTMA 2X0JA 4QQRA 3ADPA 1HZZA 1NQOA 4XYLA 1MUUA 1CETA 4YJFA 1E3JA 4EBFA 1GUFA 4L74A 4FN4A 2RAFA 3ST7A 1D8AA 2UUOA 4DRYA 1CWUA 1GPDG 4YAGA 3B70A 2VRCA 5T57A 1LLQA 3I83A 1T2CA 4PLHA 4ROSA 4R1UA 3W6UA 3ZN2A 5KNLA 4OQYA 3KSDO 4NG5A 4ND3A 1EUZA 1SZJG 1IPEA 4URFA 3KB6A 5U9CA 3F6YA 3ROPA 4DPLA 3JQCA 3RUAA 2DUWA 4B79A 4IXWA 2B0JA 3JQAD 4XRRA 3OQ6A 4CMIB 4IPTA 3WJ7A 2VT3A 4YAJA 4GBJA 4GVLA 1HKUA 2PD4A 3I23A 3T4XA 4AJHA 4HXYA 2P68A 5C7LO 4ZD6A 3WS7A 1VJ0A 4XB2A 3LZ6A 1E6UA 1GZ3A 3FN4A 4E2WA 4II2A 3F46A 5AVOA 2IZ1A 2Y0DA 2VTEA 1M66A 4DWVA 1XCBA 2HKIA 4FOSA 4JGBA 1DJNA 3KXDA 4E13A 3OF2A 4IQGA 3N74A 3DMYA 4CLXA 4LRTB 3LT0A 2NTNA 1A27A 1ZXLA 4GLOA 4ND2A 4YT2A 5IZCC 1LDMA 1X14A 4GAEA 1BWSA 3B20A 3NUGA 3EC7A 2F1KA 3IDSA 4L4XA 4E21A 1Z7BA 3PDUA 1U2GA 3DC2A 4IQ0A 3C85A 3GRPA 4IZHA 2VHZA 4HADA 4YDRA 4CODB 2IYPA 3RAJA 2GASA 5CP8A 5G4KA 4XYGA 3JYOA 4GWKA 1KY4A 4IQ8A 1VC2A 3WGGA 2O2SA 4CV3A 1D1TA 5DDIP 4IDFA 4QECA 3DOCA 3RUFA 1N1EA 5A03A 1R37A 1V35A 1N7HA 3SEFA 1DFGA 4DQVA 1LU9A 2B69A 4H16A 1ZMTA 4XIYA 4AJNA 4H3VA 1PJSA 2NACA 4P22A 4I9NA 3C1AA 3NT4A 3K2EA 4A10A 4J4BA 3ZZNA 2QW8A 1BVRA 4OAQA 2B4QA 5GZ1A 4A03A 2FZWA 3VPSA 4TROA 4XYMA 2JKVA 1DHRA 3B1KA 1F8GA 1YWGO 3PWKA 1K6XA 5K9ZA 2Q46A 4WECA 1P1KA 3PYXA 3PLRA 1EFKA 4O63O 3WGZA 1IULA 2HUNA 3RC7A 3D5TA 3QWHA 5JNLA 2HAEA 2Y99A 1T4DA 3NDRA 1FK8A 5DP1A 2PH5A 3NDIA 4IDBA 1LDBA 1UXIA 3BZUA 3S2GA 4WASA 2X9NA 3ZWBA 4XX0A 4I1IA 1EQ2A 3UCEA 3HQ4O 1UDAA 5THKA 3KYCB 2NQ8A 4DREA 2ZTUA 3IC5A 1DC6A 1P45A 1U3TA 1BDBA 1IUKA 1GDHA 2X7HA 3HJAA 3IP3A 5JYEA 1CERA 1D4FA 3AM5A 3GHYA 1IE3A 1PL8A 4MVJH 4A7PA 4BNLA 4L73A 2C54A 1IPFA 5I7SA 1KVQA 3E48A 4XYEA 2Y66A 4E5NA 1PZGA 1PQWA 4RDHA 3RU7A 5DCYA 1A4UA 2HSDA 5KVVA 5ER6A 3WGOA 4PLCA 4BMSA 1BVUA 1P9LA 3NKLA 3E6AA 4WLVA 5JFOA 1RJWA 3FNEA 3JD0A 4IJKA 4MJLA 4YTEA 5ITWA 3WYCA 4YT5A 1A9YA 3PYLA 4D3FA 1B2LA 2HMVA 4J7CA 1U5CA 3ICPA 4IMRA 4I9HA 5ES3A 4WCFB 3K96A 4PLZA 4J4HA 4A73A 4LK3A 2GDZA 2YDXA 4CL8A 1R0SA 4UEOA 3OA0A 4FCCA 4N5LA 4OSPA 4Y8VA 4ZQBA 1NPDA 3JQ9A 3AY6A 4IBOA 3DO5A 3INTA 3GPDG 3ZWWA 3A14A 1WWKA 1PQPA 4EW6A 1A7AA 5FI3A 2XF8A 4CLOA 1GCUA 1UZMA 1U7HA 2NTVA 2BI8A 2AHRA 4FSHA 4J2OA 1DIHA 1NVGA 1Y8QB 5FYDA 2JCYA 2ZJ1A 4R01A 2IXBA 4CR8A 1JW9B 1ZK4A 2DBZA 1LUAA 3TZHA 1EVJA 3DHEA 2X1HA 3QVTA 1EBUA 4LN1A 3RU9A 1O94A 3KO8A 3W8EA 2I65A 1LEHA 2DBQA 1LQUA 1NXQA 3JQ6A 4OJNA 3WJAA 3DFUA 3FI9A 4E6PA 1YDEA 1XHLA 2PK3A 3MTGA 4Q3BA 5JE8A 4ESOA 4XKJA 4RVSA 3OICA 3TRIA 2V6FA 2VUUA 4QFCA 3GVXA 3VH1A 3JD1A 3LQFA 1XYGA 1ARZA 2PZLA 1JQBA 4D44A 2VWHA 1XLTA 4DIFA 2CVOA 2AE2A 2Q4BA 4U7WA 3E9MA 1YDWA 1WP4A 2PZKA 2IEDA 1CRWG 1GEEA 3KEQA 2X5JO 4XWYA 3VVCA 1A4IA 1JLLA 3BA1A 4E30A 1I01A 4RPKA 1HTBA 2HK8A 5G0TA 1VSVA 1LNQA 4IJUA 4BB6A 4AJ1A 2PZJA 1C1XA 1I3NA 3PLNA 3RUEA 2RIRA 4LCJA 1WNTA 3I9NA 2GUGA 2Q1UA 5DT9A 4HX5A 5CEEA 2C20A 2O3UA 1UP7A 5J23A 4AG3A 1A7KA 1W8DA 4AJEA 3FTNA 4YJFB 1XGKA 2X0IA 3GZNA 1UP4A 2FOIA 1H94A 2BELA 3F4BA 4J3FA 3ITDA 4XDYA 1HDRA 5B37A 4J4TA 3AUUA 3ONEA 1H5QA 4LRSB 1LC0A 1B8PA 2AA3A 3U4HA 4CV2A 1CEQA 4O5OA 5I8ZA 3OJLA 1DRVA 4J91A 2PY6A 3GFGA 2RH4A 3JQ7A 1ZJZA 3TZQA 1NHGA 4KTTE 4NBVA 4UEKA 4OGWA 1U1IA 4ZA2A 4D46A 2HDHA 3FPCA 4JJIA 3TNLA 4CM8A 3ANNA 4BIIA 2Q1SA 3P2OA 4L4SA 4JX8A 3E5MA 2CDAA 2NUAA 3L4BA 4MOWA 5KOIA 3AJRA 1YL6A 4XJSA 1JKFA 5G0SA 3PDJA 1GZ4A 1ZK2A 2WYWA 4Y9DA 3WFJA 4FGWA 1R0KA 2GO1A 3ITKA 2DBVO 4HV4A 3GUCA 2VYNA 1E3WA 2GPTA 1ISGA 3QW2A 4YYZA 4JNKA 5I9MA 2QG4A 4AICA 1LBEA 2VHVA 4M86A 1JU9A 1EK6A 2YQ5A 1B15A 2Q3EA 5G0WA 4XD2A 3FHLA 1BXGA 2JL1A 5KJ1A 3DTTA 2QZ9A 3GH3A 2O7SA 5G4KB 2VZ0A 2CY0A 3F9IA 1PS0A 1Z73A 5ER9A 1GFSA 3L4SO 3GNTA 3JCZA 4R69A 2UAGA 1PZHA 2DPGA 3OIGA 3QA9A 4JK3A 3WOHA 2A92A 5MGBA 1JTVA 3OHSX 1Q7CA 4MIYA 4NPCA 2WD8A 5CDSA 3IJPA 5EPOA 1ZEJA 4GGOA 4XDZA 4UUPA 4DQUA 1V3VA 2V6MA 3GK3A 4BKUA 4JJGA 1H6AA 1LI4A 1ISIA 3RKRA 4ND1A 3W8DA 1KERA 2X9VA 3SC6A 2EEZA 5L40A 3L0DA 3ETGA 1ULUA 1BDMA 4RLHA 1SOVA 1HXHA 2Q50A 1NQAO 3KUXA 5CPFA 2FSSA 3M1LA 4F6LA 2HQ1A 4ZHSA 4R9SA 3HG7A 4E5KA 2YJZA 4J1TA 5JW6A 1YQDA 4KUHA 1O8CA 3F5QA 3UGKA 4D41A 3N58A 5B4UA 4KQXA 1GU7A 4R54A 5LC1A 5JCJD 3VZQA 5IZCA 4UUNA 5L45A 5EJ2A 2YHIA 2OUIA 1ONNA 2YFQA 4DIOA 1HWYA 5K0ZA 1J49A 4GMGA 1X13A 3BMNA 5CFZA 2OP1A 1MFPA 2VRBA 1ORRA 1EK5A 1AE1A 1U28A 4W9NC 3HDYA 1HE5A 3TSCA 4DIBA 3GVIA 4JXKA 4XEHA 1PU2A 3S1LA 1PJTA 4Y67A 1NQTA 2QZZA 1SEVA 3ZWPA 5BSEA 4AL4A 1MFZA 2CZCA 1XA0A 3RFXA 3N7UA 5JO0A 4DA9A 4GGPA 2B37A 1FDVA 4QUKA 3ADOA 1Q2XA 4BGEA 1E7SA 3BAZA 4BNGA 2J3HA 2NU8A 3WG9A 4A27A 4XGNA 4K6FA 5JLAA 1T25A 3DWFA 2FN7A 3PZRA 4EEXA 3LLVA 5LDGA 4BO6A 3OECA 1YBVA 2YFHA 3RC9A 5KWEA 2QX7A 4RF5A 1C3VA 2VUSA 3EGOA 2YZ7A 5KJFA 3IMFA 3OQBA 4U8GA 4OH1A 2HU2A 1KS9A 4ZN6A 3EK2A 5JXWA 2VNAA 3ZV5A 2EWMA 3DBLA 3GEGA 3NRCA 4MVJA 3I4FA 4L4RA 4XQEA 3IS3A 4GL4A 2FSVA 1E1NA 2AG8A 1JDJA 3ZWCA 3TL3A 3EW7A 3H6KA 3AK4A 1I24A 4CLEA 3OP4A 3SBOA 3ZHBA 4CLOB 4O6VA 1EMDA 3D0OA 2JJYA 1KIFA 4J1QA 3F3SA 1HDGO 4ZRMA 4J7XA 1PGNA 5H82A 1TVEA 2I76A 3PGJA 4NHEA 3T7CA 3FBGA 4EJ0A 2CF6A 3ON5A 3A1NA 4DBZA 1N1GA 5AXAA 2ZYAA 3O26A 4CQLA 5JDIC 1N2SA 1G6KA 3B6ZA 4WUVA 1VJ1A 3ZHXA 1TT5A 4BKQA 4A26A 4I8XA 2C82A 2OFPA 3WSVA 4HNGA 2VHWA 1LJ8A 1V3UA 3AI3A 3LU1A 4NNJA 3IKTA 4ZICA 3HB4X 4DPKA 3ZV3A 1LC3A 4R1NA 5JPIA 5IDYA 3D3WA 3BHIA 3HZZA 3JQGA 2I99A 1M76A 2AQ8A 1NBOA 2QQ5A 1I33A 1T2DA 1PIWA 2BFPA 2FR0A 3VDQA 1HE3A 5TQVA 3FNFA 1LSJA 4ZU3A 1C1XB 1Z82A 2V7PA 4BNMA 1GYRA 2AQIA 9LDTA 2A35A 4K28A 4ALLA 2OO5A 3DONA 2PZMA 1MG5A 3BMQA 3GOHA 2FPIA 3MWEB 4CLHA 4CMBA 5C7IO 1P0FA 2IODA 1U9JA 3GZNB 1RM5A 4O0LA 1DOHA 4BO4A 1UP6A 3AOEC 2OP0A 4RQUA 1R4NA 4PLTA 4OKNA 1LDNA 1SOWA 1DIBA 1PSDA 1EVZA 3HHPA 4BGUA 4FFMA 4HFRA 1VM6A 2ZATA 4MIEA 5IDWA 1DFHA 1UDCA 3WWYA 1KVRA 3TL2A 3SLKA 3BHJA 4GSLA 3FSRA 3GRKA 4OXKA 3CPSA 3JQ7B 3WTCA 3FD8A 4DC1A 3OMLA 3IIEA 2X4GA 1GL3A 5JS6A 5LCXA 3DEYX 3L07A 5F21A 3CKYA 5EN4A 4EJ6A 5JY6A 3VPXA 1F17A 2VUTA 4RPLA 3Q9NA 4QFDA 3M2PA 4FFLA 2UVDA 4AJIA 4UREA 4JBIA 4CM8B 1DIAA 5IJZA 1E3EA 4C7KA 2GSDA 3MJTA 4RV9A 3ZI0A 4BB5A 1PZFA 2AMFA 4IIVA 1WXDA 3HSKA 1J6UA 3QWFA 4YRBA 1DHTA 2OL4A 4NR0A 2EERA 2FRDA 4RJTA 5T5QA 4YPOA 2V6BA 3R0IA 1E3WB 3GN2A 5C5IA 2E4AA 2HLPA 3NT2A 1YL7A 3H9QA 3D3EA 4JN6B 2D3TA 2EG9A 3BMCB 3ZHYA 3D5QA 2GR9A 4BNXA 4JBGA 4W7HA 3C7CB 2X8LA 3GY0A 2OHXA 2HK9A 5KKAA 1TXGA 1BXGB 2Q49A 1QSGA 1YS4A 2J3IA 4J7UA 3NTOA 3GN1A 4BL5A 4CM9D 3RROA 3LT1A 4KQWA 3Q11A 3RBZA 1LRLA 1XELA 1GTMA 1D3AA 2BKAA 4LVCA 4AJ4A 2DTXA 1OFGA 1Z75A 2EV9A 3C7DB 4J0FA 3M2TA 4D43A 4RPJA 3PVZA 1PX0A 4FR5A 2NNLD 3PJGA 2BD0A 1ONPA 1GQQA 4NJMA 1Y7TA 2D5AA 4UAGA 2YV2A 3OQ1A 3FBTA 1X0VA 4TVOA 3MZ0A 3IKVA 1AXEA 5L53A 3PQFA 4D0SA 1DFIA 4YEDA 3UCXA 5HS4A 2IZ0A 8LDHA 4GWGA 4IY1A 5BSFA 1MC5A 3RC1A 1K5HA 3ABIA 1CDOA 2PV7A 2WDZA 2VHYA 2IRWA 1I36A 1JAXA 2VN8A 5T67A 5LDHA 1Y81A 4EDFA 3C24A 3UOGA 3WGQA 2FHSA 4NK5A 1ZZEA 4BV8A 4HFJA 4M54A 5L51A 1F14A 4EUFA 4XIJA 5KVSA 3I6QA 3I9LA 3AM4A 4YWJA 3BTSA 4FGSA 3OJEA 3HFSA 2ZB7A 4BO8A 4M55A 1HDZA 4GKVA 4YXFA 3L9XA 1UDBA 2YHIB 1W6UA 5DBFA 2C2XA 1ZBQA 3AU9A 4BNZA 2HO5A 3BMNB 1CYDA 4TZTA 1NPTO 2RCYA 4R5MA 1ISHA 5COQA 3VPGA 3DBHA 3OEYA 4U0JA 3G79A 3V1YA 3BHMA 1KBZA 1TEHA 4U6QA 4EUHA 1IL0A 4BV9A 1VLLA 3WBBA 3UHAA 3DBRA 1Y5RA 5KJEA 5B4VA 5G0UA 1NTOA 2WJPA 5A04A 1RM4A 1T1SA 4CM5A 3WMXA 4EI2A 4HY3A 1HDYA 3RSHA 1QORA 2JFHA 4AJKA 2D1YA 1ENYA 3DAGA 5IN5A 3RUIA 3WQQA 2DPHA 4IJWA 4QXMA 4OYRA 2H5LA 1VPDA 1HE4A 3EZYA 1V0JA 3QY9A 1VL6A 4PZDA 3ZDFA 3W1VA 4N18A 1HE2A 4PLFA 3INGA 2HCTA 4MVJP 3U5TA 4C7JA 5HM8A 1YVEI 1B0AA 2EXXA 4RF4A 3FR8A 4YAEA 2ZTMA 2EF1A 1BXZA 4E2YA 3E9QA 1LLDA 3HDQA 3DL2A 3QVSA 4WE3A 4XQ9A 4KMSA 4NU6A 4R16A 1B8VA 4L0QA 4E4YA 1ZSNA 3JV7A 1WDMA 3DBLB 1KVUA 3PQEA 3DMTC 3DTYA 4X54A 5EIOA 2PKQP 3C8MA 3E18A 3C3XA 4LGVA 4R51A 1TLTA 4BMVA 2BF7A 3VZSA 3PRJA 2FPPA 4YVFA 4RZIA 4JQCA 3VZPA 1LX6A 1XR3A 2XXJA 2GLXA 5JAMA 4C4OA 3HDJA 4ZRNA 2GN6A 4W82A 5TNXA 4NBRA 3DAFA 4BNKA 1DRUA 3JQBA 2OOSA 1H2BA 4I5DA 4BNJA 3ANMA 1BGVA 5JC1A 5G2OA 5TSDA 3NEPX 4NIMA 2DBRA 1AGNA 4P4GA 3C7AA 3JQEA 1P33A 5MDHA 3CE6A 5JO9A 4CQLB 1R12A 3TN7A 1BTOA 1P1IA 3FTPA 3K5PA 3TZCA 4NFYA 5A05A 2CVQA 1AHHA 1GUZA 2J3KA 1QG6A 2AEJA 4RQTA 2E49A 1IB6A 2JD1A 4R4JA 5GY7A 1KY5A 3GVHA 4G2NA 1BG6A 2Y68A 4IS2A 1Z74A 1EEHA 2ZB8A 3ONDA 3GT0A 4E33A 3GGPA 3Q9UA 1H2HA 4HKTA 1N92A 4TRNA 3WIDA 3D3WB 1DXYA 2Y0EA 3K92A 4FPXA 2NADA 3RUDA 1I3KA 4MVJE 3ZWAA 2EKPA 4CMEC 1XEAA 5GZ3A 3U4IA 4CMJA 1TT7A 1B3RA 3H5NA 4WLFA 3UXYA 3GQVA 1S6YA 3TWOA 1YL5A 5EMHA 4YQZA 4DLAA 1E7YA 2VHXA 5B12A 2X58A 4BKRA 5JSFA 2BFMA 1I3MA 1PQUA 2YW9A 4Y6PA 4Q39A 5K6AC 1NVTA 3UF0A 3U9LA 2WWRA 3AUTA 3BMQB 4EITA 5I7VA 2LDXA 5AXCA 5JDCA 4PFJA 2X22A 3WGIA 1MLDA 3QJ5A 4Y6SA 1EE2A 2Q2WA 1KYQA 1YB5A 1IHXA 2P9GA 4L76A 3AI1A 2P4HX 1HRDA 3RJ5A 3HN7A 2B5VA 4CL3A 3NGXA 5A5FA 1E1KA 1TB4A 1VL0A 3A06A 3V2UA 3KRTA 1U3UA 5I7FA 4BO7A 1B8UA 2YQ4A 3QVOA 3GNQA 4F45A 3UCFA 3DZGA 1BW9A 4MINA 3IOYA 4UUOA 2YHUA 4KZPA 1A5ZA 4IGEA 3LF1A 4LCEA 4Q3EA 2VCYA 2B83A 1H9AA 2NM0A 1T4BA 3GEMA 2GN8A 3PIDA 2W2LA 2Z95A 3JSAA 1C14A 4CUKA 1PR3A 4LVUA 4M8SA 2CF5A 2HK7A 4YT8A 4YJHB 4CQMA 5BNTA 1R4MA 2BGLA 1FDTA 4TMFA 2PD6A 1N5DA 3OJFA 1YB4A 4CM4A 2WTBA 2QIOA 1NAIA 3CMCO 4NQZA 4CM3A 4RLSA 4PRKA 4WCDA 3QV1A 4D0RA 4EJMA 1Q7BA 2O2YA 4FOOA 4Z0PA 4IZIA 4M87A 3FR7A 4MP3A 4XQGA 3F1KA 2VTDA 5KIAA 1D7OA 4ALJA 4LW8A 1YRLA 4GLLA 3PGXA 5GMOA 2X5OA 4GX5A 1HLPA 1NPYA 1ZSVA 2HRBA 2OZPA 1HEUA 2AEFA 3I52A 4GSKA 2EP7A 2BLLA 5DZSA 3L6OO 4DMLA 4NJMB 1YQXA 4FJ2A 5FI5A 3VTZA 1QYWA 1M6WA 4PG4A 5I9NA 3TFQA 2Q1WA 3LC7O 3VAZA 3K8ZA 1B16A 3UH1A 3VZRA 1QYDA 4U6SA 1KC3A 5ILOA 1O0SA 1U4SA 3FNGA 5FF9A 4CPDA 3TFOA 4IDDA 1C1DB 1HDCA 1R66A 4IINA 1I32A 3GR6A 4BNHA 2EJWA 3H9EO 3HN2A 4FW8A 3H2ZA 1YO6A 1GD1O 4BOYA 1KEWA 3ROMA 2DVMA 2I3GA 1RWBA 2JAHA 2Y05A 3PK0A 1DJQA 3PFWO 3Q6IA 4PCVA 4WCFC 5JAZA 1T24A 2HJSA 4YB8A 5FWNA 3K9QO 2P91A 4QX6A 3G0OA 1PZEA 4UUMA 4JP2A 3ZNQA 1NFRA 1E3IA 2FMUA 1UJMA 1XKQA 5IN4A 2OMEA 1VE9A 3KV3O 4NBUA 1WW8A 2ZYGA 4WOKA 1A72A 2NSDA 4FFNA 3DBHB 4UEJA 5U4QA 4M89A 5HS6A 1T2EA 4N7RA 1E1LA 2R00C 3GC6A 2HMTA 2BH9A 3WX0A 3F47A 1XU9A 1SPXA 3DBRB 3S2FA 4CR7A 7MDHA 1BXKA 1N7GA 2WMDA 4RVGA 4PG8A 2EHDA 5A1TA 3ICCA 5THQA 3ZU5A 4KUEA 3RKUA 1ISJA 1VI2A 4E2ZA 1F12A 3PJEA 1I5RA 5L4NA 1CJCA 2ZKLA 1K0UA 3MCVA 3IUPA 5DP2A 1P1FA 3OJ0A 4JLWA 4MVJI 1QV7A 3VH2A 3WYEA 1PJLA 4IDGA 3ZU2A 1JN0A 1QR6A 2GZ3A 1P3DA 3DZFA 1VSUA 4D45A 1XQ6A 4FIZA 3H9UA 1S7CA 1XU7A 1BSVA 1DLJA 2YV3A 2BFAA 2D59A 1SBYA 4RF2A 4LMRA 1HLDA 1BHSA 2UUPA 3ETDA 4LMPA 1YJQA 5T8KC 3U3XA 3BTUA 4M49A 3WMWA 3E82A 3W4KA 1X7DA 3AU8A 4WLEA 1PEDA 2FR8A 2UYYA 3X2FA 3TJRA 2G76A 4IS3A 5IXYA 3QWAA 4W7IA 4Z0TA 5I8WA 4TRJA 3P19A 3BXXA 1I8TA 2VRCD 3ZV6A 2CFCA 1ADFA 5L4LA 1ZCJA 4MVJF 1H6DA 3K6JA 3T4EA 1VKNA 2XXBA 2DFVA 2NVBA 1FDSA 4YCAA 4UVEA 2VOEA 4DYVA 1KEVA 4L75A 4N5NA 1O6ZA 5KJCA 4J2HA 5L7WA 3JQAA 3AI2A 4B4UA 1A9ZA 4BNUA 3ZCXA 1U4OA 1PGPA 3CINA 3V8BA 5B4TA 4XGKA 4E0BA 4TRRA 3CEAA 1ZK1A 4RF3A 3VHRA 4MPDA 2Q2VA 4XGIA 5G0VA 1LA2A 2X9GA 4ND4A 4GX2A 1YH3A 5ADHA 3H9JA 2Z1MA 1P77A 3O9ZA 4R68A 4BQRA 1GUYA 1GPJA 2QYTA 3EUWA 3ENNA 3H5RA 1UXHA 4J49A 2W2KA 3BMOA 4MKRA 1RYDA 4XR4A 5JMPA 1WMBA 5JAIA 5CG1A 2OBYA 4PZCA 3AM3A 4EEZA 3DOJA 4ALNA 1QMGA 3MJCA 1GQYA 2FPGA 4WNIA 2EKQA 4HNHA 3EAGA 1QXSA 1IYZA 3Q2IA 3RVDA 3FNHA 3EVTA 5T6BA 4TZKA 3UKOA 5COBA 4PLGA 4B7UA 1QLJA 2HJRA 3F1LA 4GMFA 5AXBA 2TMGA 4IM7A 4A2CA 2Z5LA 4YBZA 3OA2A 5GZ6A 4ZQFA 5IFLA 1HETA 5TJ9A 2J3JA 2GF2A 3RUHA 4Q3AA 4BNIA 3HADA 4AJLA 1BW9B 2J6IA 3G1TA 3ZW8A 3WGHA 1PJQA 2DLDA 4JIGA 4TSKA 4RDIA 1B26A 4ZQEA 4L9RA 2JAPA 4XCVA 5L3ZA 1ADGA 5ITVA 2C59A 3W6ZA 1LSUA 1XSEA 1K2WA 3LYLA 1ZVMA 1YJ8A 3AUSA 4WOJA 3UFXA 5HTOA 4CQMB 2C5AA 1V8BA 1NR7A 4DC0A 1R4MB 2Y1OA 4R9RA 3IAHA 5F1PA 4WEOA 1R16A 2Y93A 1GZ6A 1UAYA 5I7EA 4R3WA 4PRLA 2ET6A 1ADBA 1K6IA 1B3BA 1P0CA 4CM4B 3JD3A 1PR9A 1QKIA 4HWKA 5DNAA 3W8FA 4FFPA 4MVJG 3RFTA 3CTMA 1EDZA 4E5YA 5CG2A 2I66A 3PHIA 2H6EA 1I30A 1GV0A 1ULSA 3MTJA 2X23A 3TZ6A 4G65A 4OOFA 5TS3A 4CM7A 3M6IA 3TF5A 1KVSA 2Q99A 1AXGA 4MIOA 4MVJM 3WQRA 1Y9AA 2VZ8A 4J6FA 4B7CA 3DR3A 4BUCA 3G17A 2PKQO 1UXJA 1Q0LA 2VNSA 1ZXBA 1NWCA 3OJOA 5KCZA 1ISMA 3PJDA 1UUFA 5EESA 4GX1A 4K26A 4NMHA 1X0XA 1M75A 3UVEA 3WBFA 4J90A 4ND5A 2VZ9A 3HE3A 4CMHA 4P38A 1FDWA 3PHGA 1UZNA 3KBOA 3S55A 3WWZA 1HL3A 2AG5A 2LDBA 1CQIA 3I6IA 4DXHA 5ICMA 2Q4EA 3D7LA 1ZIDA 4YR9A 1DIRA 3ZWXA 2WYVA 2NU6A 1E1MA 3WGYA 1EUDA 2AE1A 1R6DA 3DZIA 1F06A 1ZO8A 2GCGA 1X7GA 4W4TA 2JFFA 3V1UA 1OC4A 2BFOA 2GGSA 1M6HA 3K2BA 3WYBA 4TQGA 2Y0CA 3KTDA 3L9WA 3O4RA 3G49A 2PFGA 1B14A 4K6CA 1JVBA 4PN3A 2W4QA 4NFHA 3AW9A 4NJOA 3G3EA 3VH4A 4BO1A 4WLNA 2P4QA 3JQFC 2I5PO 4J43A 3O38A 3JQ9C 1DEHA 1YQGA 1T2FA 3PEFA 4J1SA 1HSZA 5BSHA 5EERA 3VKVA 1Z7EA 5BR7A 4TWRA 3EDMA 5TGDA 4MKXA 1RKXA 4KWHA 3V2HA 3ZWYA 4K1LA 3O8QA 3DFZA 1MP0A 3U0BA 5TC4A 2X0RA 3E8XA 4ALKA 2Y1FA 2X86A 4B3HA 2NLOA 3QVWA 4RVFA 2PLAA 5KVQA 5A9SA 5A4DA 4AJ2A 3LDHA 4Q9NA 1KEPA 1UZLA 1O5IA 4JROA 1B7GO 1Q7GA 2C0CA 2CNBA 4RVDA 3U4DA 2GRAA 1PS8A 3JYPA 2V65A 3OSUA 4GKBA 4BO5A 3FPLA 1NAHA 2I6TA 4PG6A 1ZJYA 3H3JA 1QV6A 2NVWA 3IQDB 1LLCA 4H15A 1E5LA 1MV8A 4RPHA 1Q1NA 4WCFA 4FFOA 4ONEA 3ASUA 4XYBA 3GMSA 1GV1A 2D4AA 4OQZA 1SO8A 3ROKA 4BNFA 5JAQA 3ROQA 1WLYA 1NFQA 5CEFA 3GDFA 2JD0A 5HWSA 1G0NA 1L7EA 1EFLA 4L8VA 1YE3A 5A9TA 1MG0A 1D1SA 4HP8A 1HZJA 4FQ8A 4WEQA 1IZ0A 1YXMA 2J5QA 1VL8A 3OIDA 2AW5A 2Y1GA 2YV1A 1X7HA 4Z3KA 3FF4A 4WNCA 4G81A 2RH8A 3LVFO 1Y8QA 2FP4A 3M1AA 2Q45A 3AFMA 5CDYA 4FC6A 4OM8A 1LSSA 4PG5A 4HBGA 1OI7A 5U1PA 2NV6A 3H4VA 5IDQA 1MA0A 1ENZA 4NK4A 3KSUA 3SX2A 2CVZA 2JHGA 4KP7A 3JQAB 3RASA 4EZBA 5CPBA 4UULA 1X1TA 2P9CA 3SJUA 1UAGA 4S3MA 4BGIA 3ZW9A 1K3TA 2PWZA 3JYNA 3AWDA 3TOXA 3D4NA 2C7GA 4G5HA 5CDGA 1PGJA 3L4BC 2IEBA 3WICA 5JC8A 2Y1DA 3ZH2A 2VYND 2C7VA 1NR1A 4KOAA 1PJ4A 3S8MA 3ZNNA 2ZQZA 5CEJA 4U5QA 4ILKA 2W2KB 3OBBA 4YJDA 3RIHA 1UH5A 4TVBA 3WTBA 5BSGA 5EQFA 3PXXA 3H7AA 3VC7A 3NYWA 2GZ2A 2DT5A 1U7TA 1CQJA 1KVTA 3NTRA 1E3LA 1L7DA 1I2BA 3QSGA 5DULA 1MC4A 4ZJUA 1SEPA 1RM3A 4EYEA 3IUSA 3T7EA 2HMSA 1DRWA 4FJ0A 1C0KA 1Z6ZA 3EVNA 1ZK0A 1LSOA 3BIOA 1JAYA 4I9UA 2O3JA 2SCUA 2J5KA 3EZLA 4Z9XA 4B8ZA 4BO9A 2F00A 1JWBB 3A28A 3A4VA 4TRMA 4H7PA 5TRTA 1J0XO 3S2IA 4OOEA 1GCOA 4NH4A 2YDYA 3TDKA 2IYOA 1E0DA 2BGKA 1DB3A 2DUUA 3DQPA 4FJ1A 2P2SA 4ZGWA 5IF3A 2W8ZA 4RZHA 2C2YA 5JBIA 1KC1A 1P1HA 3CZRA 4B4WA 2WD7A 4D7AA 1N8KA 1YGYA 4YA6A 3P2YA 3NJ4A 2GN4A 1E3SA 3DZJA 2G82A 3RQSA 4E12A 2QRLA 4W6ZA 3JD2A 3GAZA 1ZW1A 5AXDA 2PR2A 2QRKA 1DLIA 2NU9A 4E3ZA 3RI3A 3SLGA 4NFSA 3X2EA 1CIVA 1K6JA 3NT5A 5C37A 1WVGA 5ICSA 2C29D 4FFRA 2C07A 4PLPA 5BNFA 5JCJA 1E7MA 2QHXA 1OAAA 1XDWA 4W9NA 5CAEA 3QWIA 1ADCA 3UN1A 4CM6A 2O4CA 5CHEA 2O50A 4YRDA 3GPIA 3EHEA 3TPCA 3RBVA 4DGSA 3AUAA 3DAPA 1EE9A 2P9EA 4I08A 3MOGA 1TT5B 3LT2A 1E6EA 3ORFA 3JYQA 4OIMA 4RVUA 1Z45A 4A0SA 3JQ8A 1F8FA 1SB9A 3GAFA 4ID9A 4F6CA 3RCBA 1JA9A 3PFFA 5A06A 3B1JA 2X0NA 3ULKA 2EW8A 4N5MA 3JQGB 1O95A 3R3SA 4XQCA 3GHHA 3SXPA 1LTHR 5IDXA 1OBFO 4Z6KA 1I10A 1ID1A 2PGJA 2D8AA 4B3JA 3KZVA 6ADHA 1EVIA 4BO3A 1ZUD1 4DYDA 3WNVA 2A94A 4AJJA 2ILTA 2EGGA 2EJVA 3A9WA 4YRAA 4MVJD 3ZU4A 1E77A 2C5EA 2JHFA 1WDLA 2AEMA 1PGOA 3ENKA 2AXQA 1J4AA 2O3RA 1ZSYA 4J1NA 4CLRA 1IZ9A 3V2GA 2DFDA 4IDEA 1R4NB 3PJFA 4PIVA 4BVAA 2BHLA 3WR5A 3I9KA 3VPFA 3KVOA 2GZ1A 2B36A 3W4JA 2W98A 2O48X 3DZBA 5EINA 5HRUA
chains in the Genus database with same CATH superfamily
1RYEA 4CT0A 3KZNA 3O8QB 1B41A 3LL4A 2ECOA 3UA3A 3PVSA 4YRQA 4HYEA 3U26A 4KDFA 1E8MA 3CPHA 3COJA 2ZCUA 3A9RA 1U8XX 3V34A 2RC5A 4CUJA 3A6LA 4MYDA 1EP9A 2EW2A 2GF9A 1M2OA 3WL5A 4YV2A 1QKKA 1LDEA 4MNTA 4QATA 2RGNA 2VXOA 1CG6A 1FE8A 4G0MA 5KYUB 1X7WB 3I9JA 2I4OA 3NU1A 2GAFA 5LKRA 1UFVA 2OHVA 1YNSA 3KFLA 3KWMA 4WPGA 1Z0FA 1T3LA 3FDZB 1JEDA 3GROA 3MILA 1SH7A 4UNQA 5JQGB 1SVOA 4QNMA 3GMTA 3U7FB 4LOKA 1LRJA 5EIBC 1W73A 4C88A 5B7GA 2P5UA 5CIWA 3HWRA 1KBOA 5GVRA 2J9FA 4TLDA 1ZPDA 3OFSA 4PGMA 4UNSA 1GXSA 3GA0A 4Y2SA 2ASEA 5I45A 3VPCA 1QE3A 1XQWA 1E7WA 1FFGA 2XOKA 2VSYA 5ICCA 1GR0A 4LPSA 4FM9A 2I22A 3GWGA 3W9SA 1XWWA 4BC0A 2I1LA 1JWAB 3HK2A 4E07A 1A98A 1KMNA 1JPUA 4GMXA 1FXWA 4N3GA 1MV5A 1ZG3A 3JQFA 1E9DA 4URYR 1XZIA 5C0OE 4Z7QB 1TM4E 4FHZA 4HK4A 4U7JA 4CE6A 3WMGA 2BM1A 1JHVA 3QKSB 3RWBA 1IY9A 1CW2B 1GA1A 3OP1A 1WAMA 2E37A 2J8ZA 2OO5C 1J42A 2VK1A 4EUEA 1C3OB 1X8KA 2OZLB 3IDAA 4DT1B 6GPBA 1JFFB 2Q2QA 3DC7A 3IJRA 4YJGA 4Z7NB 3AKZA 1KRXA 3Q3VA 1RP7A 1T2NA 1E6MA 2HBQA 2HWXA 1V3TA 4G5OA 1QGED 4CU2A 4ZCMA 1SN7A 2UV8A 1RE0A 4MAMA 5CRIA 3RE1A 2GHQA 5CT8A 2AG0A 2G5PA 2IVZA 4GMKA 3R9IA 4DLSA 3FY4A 1M8FA 4K6OA 3KHUA 3F8WA 3HKDA 2RKOA 3O4VA 1YHNA 3EQ7A 5CT4A 5D5PA 1KDZA 4E32A 4A0FA 3K0AB 4ZHQB 1QPZA 2EFYA 1AX9A 3G13A 3IRVA 4NDNE 3K8QA 4KGZA 2OV8A 1TIPA 2VP0A 3IRUA 4HX2A 3IUMA 4QPJC 4I3HA 4BKOA 4YCCA 3RSCA 3M6MD 5IYZA 5BY2A 3MJVA 4XRGA 5H3LA 5LB4A 1VTKA 3OJXA 1DAOA 3I2HA 2WABA 4HQFA 2ZSJA 4KWIA 3ZXXA 2QF7A 1Y1PA 1OYWA 3SVTA 5BN5B 2NZXA 3MUOA 1GY8A 2GWHA 3CISA 3TINA 5IXSA 4U3JB 1FDUA 4FC7A 2B99A 2INGX 4JB3A 4WN9A 4D79A 3HLTA 1QMPA 1TYCA 3PNMA 3ZKWA 5FUVA 1RQPA 4S05A 1Z4PX 1LQ2A 3BTOA 5F5LA 2AKYA 3SYTA 2YWGA 4HO1X 1TFUA 2IP2A 4MITA 3WO1A 4KEAA 4UKDA 1ZD5A 2B5OA 2QUBA 4II7A 4IIHA 1EVYA 2XUDA 2HJ9A 3BK7A 1H3NA 1R6VA 2HA3A 4U2EA 1UBSB 5HMMA 4TZ6A 3U3MA 1IY8A 1BC5A 1CUJA 2WJIA 3KEOA 1M2GA 3G1WA 4PLYA 4FU0A 1XZGA 1Z7YA 4MRNA 1PFWA 1AMNA 2A1UB 2CYAA 4Q15A 1M34B 4QUBA 3TIFA 1FS4A 2BONA 3I5MA 5K4GA 1L8OA 1GNRA 3ONVA 5FFFA 1W76A 4UPEA 4WK6A 1Z4JA 1XTIA 2XOXA 5JMWA 1HDXA 3JQDA 2WWWA 1EXMA 1KGDA 1Y3CE 4J0JA 4NU5A 5H81A 3TSZA 3UAOA 4BMZA 2IDZA 4S1PA 4EX6A 1Z22A 4KG7A 3J81k 2EQ5A 3VMFA 1R7RA 5K6RA 4NDAA 2IHZA 5DOVA 5BNWA 1WPRA 3N9IA 1ODCA 3HDTA 1KY2A 2LBPA 3R77A 4B45A 3NALA 2P4EA 1DINA 1OA0A 3W8NA 2P6OA 5EI5A 2QX4A 3DE1X 1SU4A 2Z2KA 3Q2KA 4XUEA 5I4CA 1AN9A 1G1AA 1MB3A 3NQ41 1XTQA 3EH2A 3NP7A 4JJFA 4BQPA 1KORA 2GPJA 5DYGA 5HKLA 4O2AB 1YS2X 3EFOB 5EQDA 1YFJA 4HQOA 5ENDA 2EGHA 1OXUA 1IEQA 1V8DA 2BR3A 4XGQA 4BAUA 4O4IF 3T1TA 2VP3A 3B12A 2G0NA 4R9VA 3LHDA 2D1QA 4PANA 2V4MA 4ENPA 1S9HA 2BIFA 2Q6TA 2J85A 5SZIA 4G4IA 4HAWA 2K6GA 1K92A 5LMCA 1RHRA 1TE2A 3B1FA 4OATA 2FR1A 3THSA 3A4TA 4FD3A 3VSBA 3X1YA 1OU4A 3ZHZA 3BB4A 3RR2A 3AXSA 1LI5A 2ZLBA 1UODA 3RS0A 3S70A 1AS3A 2VAMA 2FPPB 1E2NA 1JQKA 3A70A 3NV9A 2E5FA 1TQHA 4PGHA 5BUSA 1O96A 2VP9A 3GB9A 1GPYA 4MCHA 1GRRA 5E6RA 5IK2D 2YXEA 1THTA 3T6KA 1UCFA 1IU9A 1IBKB 2JH3A 3IP1A 4JS0A 5CNIA 1Z06A 1JAIA 2JFQA 4RL6A 4DBVO 4E5MA 4MUKA 2QSUA 1XVUA 1WV1A 3O4JA 2BZSA 5KTKA 1GLGA 2AWNA 3I0NA 4NYIQ 2H63A 1QYVA 2ILVA 1JMYA 1QB7A 3HB5X 4FYPA 5JY1A 1YT5A 3LC1O 2FQXA 3EPKA 2FSFA 1V6AA 1DC8A 2NZUG 3N5CA 2NNWB 3DDZX 3AYZB 3FGZA 4ZWNA 4WFKA 3LUFA 1V45E 4GO1A 4BTEA 4LDZA 4PCUA 5LDDC 1Y6FA 1S01A 4ZV7A 1MT3A 3DJYA 3ONFA 4XFKA 3RSQA 5GOZA 1K8QA 3UTCA 5CDGA 5K8TA 1W36C 4UU0A 3TDMA 2QY9A 2WQZA 1U02A 3LDUA 5F1OA 3K9FC 5ALRA 1R15A 4BAZA 5CDFA 4BWGA 4WINA 3B89A 1T5SA 4D3DA 1I13A 3S44A 2OSBA 5BSKA 1JRLA 1C4WA 1FQWA 4KU4A 1O58A 1O9BA 3RANA 4ZGGA 4V0SA 5IM4A 3IAAA 2P9FA 3UICA 1SU8A 5JR3A 1T3GA 3O03A 1L4BA 1ZH8A 4PQYA 4EYGA 1VBFA 3PFBA 1HEIA 3OQHA 3B3QA 2VDVE 1XWFA 1XZDA 3KSZO 4I7EA 4M99A 3V32A 5FUXA 2AXPA 2ADMA 5FOXA 1RWPA 3DXFA 3E03A 4JOQA 1ST2A 3AV3A 4II3A 5DN9A 4JQYA 2CV1A 3OHPA 5F1KA 2IELA 1VHDA 4IIJF 5AW7A 3AETB 4HC4A 5I4IA 1NZJA 2F8LA 5LOVB 3TSOA 1KMQA 2VXCA 2QD3A 3DWGA 1FQOA 1S2MA 1J0AA 5JD5A 2R1VA 4UEQA 1KPGA 1RHKA 2RHRA 1A2OA 1TMKA 5D86A 2BRUA 1ATZA 2ZB3A 1T4MA 3V7YA 5A7HA 2HXSA 3QOFA 2IYLD 2Z4RA 5DHFA 3HVRA 2GBLC 1HYGA 5JD4A 1EFVB 3GU3A 1APBA 1QGOA 1VXOA 4BNYA 4WKOA 3ABSB 3IHKA 2FUNB 3KKQA 3EDYA 1W93A 2F1JA 4XTCS 3S81A 1G5PA 1HNWB 4PSUA 1FY2A 1I6KA 5A3RA 3BXPA 4FYVA 1TDJA 2CNOA 3PWSA 4HF7A 5KOHA 4MAFA 1C9KA 2C3UA 1EDOA 3DS8A 2O3TA 2X8WA 1M2OB 1NXPA 3GLHB 2YX1A 3KOUA 4QRDA 2RK4A 1SULA 2JIZA 3OOYA 4NH0A 4G26A 3PXAA 1VA5A 3LYAA 3ZK9A 4IOMA 2O2DA 1W85B 2JCVA 5EUBA 1T91A 1ZK3A 2ZSKA 4M9CA 3CPJB 4HWPA 4R2LA 1PR6A 1UBGA 1V96A 1U0GA 1R0LA 2PSFA 1E6WA 1D1QA 3E58A 3DDWA 3FE2A 3RTBA 3RS7A 2DKOA 2BKLA 5JSKA 5FV4A 4RTNA 1SG6A 1QS0A 4CMEA 2OBMA 1IQRA 1FF9A 2GTHA 2MSEB 2Z3VA 4PR3A 3IOEA 1KJQA 4DL9A 4AK9A 1XG5A 3D2AA 5LQJA 4DLLA 4LSMA 1A8HA 2J9FB 3FPHA 5TPWA 3RVKA 4LBWA 3VTFA 3WQSB 4RH3A 4Y2XA 2FUCA 4M9SA 1N3LA 2E0IA 5AHKA 3RVJA 3FLAA 2EFHB 4GX0A 1NJ6A 2AX3A 1LQTA 4BZWA 3BZWA 3LSTA 4X3OA 4DV1B 2CSXA 1PW5A 1V1MB 1DQNA 1INLA 1L7OA 1U0TA 4KBYA 4UNRA 4BNWA 4ZCLA 3AR2A 5ALVA 4GOOD 4GPIB 1BRMA 2C3PA 5F98A 1DDOA 4HEJA 1T0UA 3WFIA 1ZX1A 4KPEC 5L95A 1XQ1A 4EY4A 2V4ZA 1CVIA 1C0LA 1G4AE 1SBNE 2AN3A 3KJGA 1XIVA 4JWKA 3NIWA 4JOCA 4ZVMA 5TARA 4IJVA 3TNJA 3TXAA 1JEQA 2PMKA 4YJGB 2DX7A 2ZIEA 4B9EA 4GH5A 1OHHA 2Y0PA 1R4ZA 3HSSA 2DMRA 4LZZA 3QYAA 5EZYF 2Q7OE 2DP4E 4OQQA 1SFRA 3BT7A 2GX6A 1C8BA 4MUGA 3PPVA 1R74A 2NWQA 3H75A 5IXJA 1YHZA 3HKDB 2ZU0C 3VC1A 3A3OA 3AX6A 2IXAA 2I3AA 4LXGA 1BH2A 13PKA 5C5EA 1MC1A 5FLYA 1OH5A 3O83A 3AINA 3AHIA 2G5CA 2H16A 5IYZB 5IKPA 5EIEA 3WLKX 5FWYA 4BO0A 1YD7A 2ZUEA 3SFZA 3ESDA 3H3FA 4LXYA 2M1ZA 3AHGA 4IMIB 3OZXA 4QXPA 4NCKA 3GWZA 3N70A 1ML3A 1PI3A 5C7OO 2BEVB 2I9PA 3I5AA 4CQMD 2PH7A 3A04A 5AW6A 5IJ9A 5J1SB 3E9RA 3H9GA 1GPBA 1PT9A 3WB2A 1EXWA 5AIBA 4JQOA 1CDEA 1XJWA 2XYGA 4D9EA 2GZSA 3KFXA 3ZKWB 3IVMA 1DKLA 3KLBA 1PL0A 3BJIC 1OZAA 1UQTA 2GKGA 4X1KA 2LD4A 4COOA 5IZ4A 3KV1A 5LNK6 1JLRA 2PSJA 3UM9A 2E48A 3MJEA 4YGXB 1DRKA 2BCGY 4X8OA 3PI7A 4URWR 4O59O 1XZJA 3DJFA 2J5RA 2WTUA 4OX9B 4AKHA 4DJAA 1QZZA 5EJMA 1ETHA 3FCSB 1O8BA 1TTHA 1XQ9A 3KYCA 4LUCA 2V7UA 1A8QA 3MELA 3B8HA 3I8OA 3MGBA 1W0JA 1HYQA 2E5WA 2C5FA 2IE0A 2ZYDA 2IGTA 3QHAA 3CLHA 4NRDA 3DUWA 1NVAA 3HBMA 4QEZA 3WWCA 3T54A 4BTLA 1Q1BA 2OORA 2FPXA 3GG9A 4HTFA 3HYNA 2HZ7A 3LGXA 3U62A 1HNXB 1T4CA 4MWZA 4MS3A 3HFGA 3ROXA 3QBVA 5J59A 4CG0A 2Z98A 4BEBA 1DNPA 3WL8A 4E14A 4X1IA 3MD9A 1MABA 5CA0A 1PTJA 1R50A 1U3GA 1W0CA 1XLVA 2WYIA 3D2CA 3KTFA 4E31A 3TGLA 2W6OA 3VPAA 2PD3A 4H6PA 4OI4A 5HA5A 1QLWA 3GJ5A 5KWSA 3O3CA 2BZ1A 4B0OA 2PGLA 1YNOA 3I9OA 3PP8A 4NCIA 3GCZA 3DZKA 4HX9A 4DV7B 5CCDA 4XM1A 4ZIRA 1CF2O 1J99A 3GAMA 3S5UA 4OQPA 3KJFA 3RU2A 3RVSA 5DCUA 2YQZA 3NTUA 2EJCA 4WGGA 4WZAA 5DF1A 3H8JA 4Z0HO 4C6HA 4DKJA 1Y9EA 2GB4A 4A7PA 4DLKA 3FRHA 1MTZA 3ORHA 4JLSA 4BE7B 2HMUA 4A5OA 1DCTA 1CJMA 3G2QA 3MEQA 5AKIA 2QUHA 3W5HA 1LCIA 4IYJA 3PHHA 3I2YX 3GFBA 1EFHA 4MCIA 3JZAA 1OH6A 2QSYA 1T1GA 5FL3A 3R74A 1QX3A 1VJDA 2BE7A 3AKYA 4DRXB 1DI0A 4IVNA 4K3UA 4LRQA 3D64A 3KNZA 4PZEA 2OBFA 4AVYA 4ZI7A 3WLFA 3I5XA 1XTTA 1K89A 3HZOA 4NQRA 4O1MA 2QAIA 5CMLA 4Y2YA 5E6RB 1PRYA 3D4PA 3SC4A 4REOA 2R00A 2ERXA 1ZJJA 3NAZA 4HNAB 4P4UA 4RTQA 3OQNA 4B7XA 4AU1A 2I3DA 3DOOA 3E3NA 3NTQA 2YYSA 2CLSA 4FDTA 4KLCA 2GFHA 4MDHA 3BSSA 1GZHB 1EINA 4OBEA 3RJ9A 1I7NA 2CNLA 4WESA 5DCWA 3HACA 3G5TA 4G24A 1GWNA 3A25A 2CNNA 3HVJA 4LE1A 1FZTA 1ABEA 3VR4A 1VLZA 2B35A 4PLWA 4X9XA 4XIIA 3S27A 3VAYA 3W5BA 2Y2UA 4P58A 4ZJYA 3V1TC 4DPMA 4V2UA 4N47A 3ZWQA 3ILYA 1YBMA 3EY4A 4G1CA 3AFNA 1NNLA 4DCGA 1OB2A 3JTEA 3IQHX 3CSDA 3HA3A 4YAKA 3F74A 3NP9A 4A0QA 1SC1A 1SVSA 1T5OA 2GYUA 3D1VA 5DXAA 3VOSA 3LF2A 4F46A 2I67A 3VBEA 1II8B 2XKJE 3L4EA 4Q3NA 7ADHA 2ODWA 2GYYA 4KXNA 1U2DA 2QLLA 1PWZA 4OHPA 3FDJA 4J9VA 4PGFA 3ZC3A 5JIBA 4N0MA 2WR8A 3EISA 3I6YA 3PQCA 5LR6A 1NVVR 1J7JA 5H0IA 4R1TA 4WIAA 1VL1A 5BSRA 3M8KA 2VJAA 3WLNA 3U13A 1VJTA 3BMOB 4U8HA 2BSQA 3FUCA 5T8KA 1E58A 4YRIA 1LRKA 1G7RA 1XMSA 1C1DA 2B6NA 4RH0A 1JDUA 1ESEA 5AKHA 3T4PA 5AVUA 4DR2B 2GBFA 4O5AA 1EGVB 5TT0A 1TL7C 3FZYA 4MPRA 2E82A 1SZPA 2P2NA 3FZQA 3PQDA 4HVAA 5AD1A 2PTHA 1CY1A 1LNZA 2HSGA 2CLMB 1R10A 3NHMA 4MUAA 3GDGA 5AJZA 3D54D 1P81A 1QVRA 4QQRA 4BLVA 4G1EB 3AF6A 5SY4A 3LS2A 1H2WA 2R1VB 2ONKA 2XUPA 4XYLA 1M7GA 1TW3A 1MUUA 1PEKE 1PG0A 2WJ6A 3DFFA 4EBFA 1EA7A 4DA7A 1M2FA 1GUFA 1SXJD 2PRIA 2YIJA 4CI9A 2RAFA 2VPIA 3FWPA 4S04A 3JAWA 3TW4A 2NUTA 2Z5FA 4JLNA 3ENZA 1WZUA 3DKRA 1IZYA 3PQ2A 1GPDG 1O1YA 4YAGA 1DAGA 1YRYE 2Z58A 4PLHA 2J0VA 1T2CA 2ZDQA 4OQYA 3QPBA 4ZPJA 5TDHA 5E1DA 3WZMA 4NG5A 5KOHB 1GKLA 1WKVA 3M6FA 1X39A 2ONCA 3KB6A 5EHGA 2V7QA 3QJGA 3F6YA 5FPKA 1YQUA 5L6MB 2V6JA 3NO4A 4V0MA 1TZ2A 1XP5A 4PBTA 4B6JA 3JQAD 5KTTA 4WXRA 1NKTA 3NFRA 2H92A 2NO6A 2ZE6A 1XTUA 3DULA 4IPTA 4MQ6A 4PAQA 1E2PA 4KDCA 4GBJA 4D5GA 3ICOA 1HKUA 5BYKA 4AJHA 4HXYA 1O87A 2D2VA 4ZD6A 3WS7A 3GNLA 2FJUA 2UUBB 4W8OA 2DQZA 3QXXA 1E63A 1E6UA 2VPPA 5D51S 1QS0B 3RIEA 3T3GA 3B6KA 4EUNA 5BV1A 5BRJA 2IZ1A 4FMCF 1QZUA 3B36A 5E9AA 5IAKA 1TYEB 4PYRA 4DNOA 2HKIA 3FPSA 4CTJA 2QVCA 5TPWB 5D2CA 4D8YA 4E13A 2BUCA 1OIXA 3KS9A 2IPMA 3OF2A 2OILA 2CLIB 3ER9A 2WUWE 3DMYA 4DXDA 4CLXA 1MX1A 4KO3S 1ML4A 3JZDA 1N78A 2F1RA 5TGTA 2Q8PA 3CSUA 4YT2A 1LDMA 2F64A 2GFQA 5MHTA 2A9KA 2D5BA 3MCTA 2Y4NA 1BWSA 2ZRAA 3NUGA 5HF9A 4KFCA 1A5AB 3DUFA 1J5EB 2QWXA 4LZPA 1U2GA 2IPLA 3DC2A 4IQ0A 3C85A 5C4MA 4RS4A 3ZCPA 5EKTA 5CP8A 4FONA 3N2NA 4PZLA 4AMGA 5G4KA 1KH2A 4GZ5A 3JYOA 3Q7IA 4YRRA 1DUSA 1GA4A 2YWCA 3LA8A 3R6TA 4IQ8A 1VC2A 4WXHA 4H1VA 1JV2B 1JEQB 5KPDA 3MWLA 4Q47A 5DDIP 3TVDA 3LUPA 1K97A 1GZ7A 1SBQA 1V35A 4MUMA 3M6WA 4RCYA 1S8NA 4UM7A 3Q7QA 4XIYA 3S40A 1CQIB 3BPSA 4GBMA 1KJNA 3AVXA 4AJNA 3K0SA 4H3VA 1G3IA 4CLDA 4I9NA 1IXZA 2B20A 1KSGA 1ESMA 1O77A 5KYYA 1EUDB 3K2EA 1SVUA 1VHLA 5FWYB 3FRIA 1GDTA 1L5OA 4MJ3A 2QW8A 3EGXA 3SR3A 3R4VA 3M6UA 4WI1A 3KB2A 3VPSA 1AM4D 3CEPB 2AL7A 2MYPA 4PQGA 5A4FS 5FPYA 1YWGO 3U6BA 1VGQA 2X4IA 3HGTA 4LY6A 4TWZA 3N53A 4U2FA 5FPTA 4DMHA 3TLMA 1SUIA 1WKBA 2EX0A 1P1KA 2GYVA 2A9QA 3H1GA 1CRLA 3NM5A 3PLRA 4GZMA 3E84A 2GNOA 4IJ5A 1VKZA 5EQJB 3WGZA 3CX7A 3OZUA 2R84A 4QGBA 4J75A 1OPXA 3SF8A 4W8HA 5KNBA 4X1KB 2YXLA 4HRYA 1NZDA 3QWHA 3ET5A 1REQA 4Q0MA 5C52B 3VUEA 5A3SA 2CLOB 5AJHA 1BS2A 1FEZA 1W2GA 1Z29A 4RD6A 2RAUA 1N6IA 3NDIA 4IDBA 4X71A 4GM0A 5ARDA 3ZWBA 3UMSA 3UT6A 3ZCRA 1QC5A 4XX0A 2J4DA 1TK3A 2UXDB 1WP9A 2ZTSA 3FLMA 4EPYA 3KFVA 1UDAA 2C9CA 3KYCB 4EHNA 1XCGB 2NQ8A 4CKBA 4D4JA 1OV6A 3HFRA 4DREA 2ZTUA 3IC5A 2X7HA 1P45A 2HA6A 3SYLA 1GDHA 4EO4A 3GEEA 4MUYA 3HC7A 1C8LA 1FP2A 1IE3A 1WOYA 2QENA 4MVJH 5GGXA 1W25A 1OFUX 4BNLA 2Q2NA 2HO4A 1G8JA 4ETMA 4HTFB 3NTLA 5JEDA 3PUWA 1T4CB 2JFXA 4FT2A 3B60A 1FPMA 4MS3B 4RDHA 1N5RA 1W52X 2PO7A 4GYJA 5J5AA 3RU7A 4E7PA 1A4UA 1WE2A 2HSDA 4X1IB 4F4IA 1I5OA 1MABB 5CA0B 1Q50A 3BXEA 3GJQA 4PLCA 4BMSA 4EHIA 1P9LA 3ZLUA 2RAVA 3UHJA 4WLVA 4PC1A 4DADA 2JG3A 1PR1A 2IX9A 3JD0A 4O3FA 4YTEA 4RCZA 2J1LA 2QSZA 3CUYA 2F1OA 4TX1A 3AKDA 5LXTF 1MVLA 4TM7A 3PYLA 2QTZA 4ZIRB 2XQJA 3EA0A 1WHTA 3Q3JB 4LJAA 3TRJA 4J7CA 4X8LA 4PAWA 5DN6A 3FVVA 4IMRA 4IRUB 4U2CA 4WZAB 1RAIA 1RQLA 4WCFB 3C3KA 3VYVA 1CR0A 2P2ZA 2V55B 2BHSA 2YBDA 4QOIA 4Z9AA 4CHGA 4A73A 4DILA 5CD1A 1S2IA 1I9CA 2GDZA 4YP7A 2YDXA 3BICA 4CL8A 1H85A 4UEOA 3OA0A 3PENA 2DBYA 2B1QA 4Y8VA 1G291 1JJ7A 2KB0A 2GRJA 4B74A 4QPDA 4YCNA 3JWJA 3RKSA 1Z4KA 2LCQA 4ZI7B 1XD9A 4LI3X 1BCSB 3ZWWA 1UT5A 2O1EA 5KDLA 1STOA 3AQIA 3NTXA 2BBOA 2C4UA 4UHJA 1IQPA 4O8CA 4AWAA 2BH2A 3FNIA 1JB9A 2AHRA 4YMUA 2FDCA 2ONYA 3ZXSA 3PT5A 2F8MA 3OTWA 4CR8A 1ZK4A 2C42A 4D9MA 1EBBA 1RRFA 1EVJA 1VE7A 4OU4A 3DHEA 3TOVA 1Z17A 3QVTA 4JA2A 4JVSB 4Q6WA 3F5DA 3STWA 1O94A 3KO8A 2IQIA 1A0OA 4DLNA 1OVGA 1NXQA 3LP6A 4E6PA 1T13A 2JKYA 3D0QA 3DFUA 1Z16A 3EGVA 4MUBA 3MTGA 4Q3BA 5DRTA 3P5BA 3TE6A 2H5IA 1PR4A 4BVFA 1XVIA 3RB8A 4RD1A 4GFDA 4B40A 1XNRB 1CT9A 2WKPA 3OICA 2B8WA 2VUUA 4RVSA 2B7BA 4QFCA 5D7NA 3TRIA 3JD1A 3VH1A 3A6GA 4TVKA 4C2UA 2PZLA 3STXA 1WUIS 2G67A 3R41A 2R7NA 3GJ8A 4FYYA 4HPJB 2II6A 5LA6A 3QLUC 4JX9A 1OX4A 1USUA 1XKLA 4PPFA 4ARAA 1RR6A 5B3LA 3UV3A 1DKRA 1DMSA 1E5XA 1P7PA 4ZGBA 1P0MA 4CF4A 1W4LA 1II0A 2OCPA 1I4OA 2J33A 2PX8A 4YXWA 4F4HA 3GLRA 2LCFA 3VVCA 3I8XA 1A4IA 3BA1A 3I30X 1NKVA 1I01A 2ZRCA 3LFTA 3EX7C 1YR6A 4YK7A 4F92B 5KSYA 3KSRA 2XADA 3RVOA 4AJ1A 3BDAA 5I9TA 3RUEA 5D85A 3G9ZA 4EJSC 4LCJA 1RBMA 1WNTA 5AW1A 2GUGA 1BX0A 4TTTS 1NQWA 4HX5A 1G21E 1GN9A 2C20A 2O3UA 1Z8NA 4OIFA 3ZS9A 1VZ3A 4MWOA 4AG3A 2BBSA 2QL9A 5BW4A 2X0IA 2I7TA 5CA1A 1RWMA 5FUYA 1BX1A 2BELA 2Y71A 4QVIA 3IAEA 4UM9D 3MRTA 2G36A 4ZCRA 1E1RD 2XT0A 1VPWA 3JAWB 2RKBA 4DG8A 1Z7WA 1LF0A 2FUKA 1PZMA 2ZE5A 1PAUA 2CBGA 4J4TA 2FOXA 3G2JA 3K09C 3ONEA 1A7UA 4EB6A 2AR9A 3OSZA 2AA3A 3SWWA 4CV2A 1CEQA 4P7FA 1I1NA 3TI9A 3OJLA 4IZOA 1TF5A 3P45A 2VHCA 4TKZA 3ZDRA 3GFGA 1U1FA 2NXCA 2V5VA 2P6RA 3LWNA 4ABTA 3EF0A 3IFSA 2HNAA 1AHPA 2Q5EA 1LVGA 4TSFD 1NVEA 1TTQB 1U1IA 4B0PA 2ZRMA 1EE1A 3KYJB 4YDHB 3TSYA 5LU8A 4WNAA 2OXEA 4RKYA 1NI4A 1P9NA 3PDCA 3AJRA 3HP1A 3G7UA 1XJ0A 3VJKA 5A5GA 3PDJA 4W5NA 3AF4A 5ALMA 5GV7A 4AKTA 4IR7A 4TTRA 3TZBA 3II6X 3G0CA 4UDXX 4R8VA 3ZVRA 1KZ9A 3GUCA 1E3WA 4IWXA 1ISGA 3HXKA 3QW2A 3BRWA 3V6MA 3HM2A 1JEYA 3HI6A 2QG4A 4GWLA 4QLBA 1X3SA 4JU8A 2VHVA 3BXOA 3EG5A 4KQEA 1C1HA 1EK6A 4MI6A 5KAMA 3ZOZA 2LRHA 1YCGA 4UOQA 3C6QA 5FQOA 3BCSA 3LX4A 3DUFB 4XD2A 2IHKA 3MUEA 3DEZA 3D6VA 4J94A 4MCJA 4BMOB 2GAOA 2CNWA 2IPNA 4D1YA 5DIFA 1HY3A 5G4KB 3NBYC 3BBLA 3C6YA 3GLUA 3N07A 2NGRA 4D26A 1Z73A 3DLHA 2JLCA 2XRZA 3L4SO 1EM6A 1MAHA 1JA1A 2G0AA 3GNTA 3OQPA 2AMVA 4KLAA 4MKIA 4NU0A 5ES4B 3RARA 5KMGB 2ZT6A 4GRAA 4YV0A 4JK3A 2HT6A 4CF3A 2A92A 3W5CA 3B3AA 2WICA 5AM2A 3T1QA 2VK8A 1XJQA 3MM4A 3AQ4A 4G85A 4GR5A 2HCJB 1VGRA 1ZEJA 4EQZA 1SURA 1JSXA 2UYGA 4JJGA 3UJPA 1LI4A 1NMZA 2IYYA 1TCCA 3DFMA 4L9AA 3W8DA 1W1UA 4GKAA 5KYYB 3OWOA 4JUDX 4X61A 2WTNA 1Y3DE 1TO6A 4R9UC 1KPHA 1QOZA 4S1OA 3UNXA 4YN3A 1DG3A 2WJZB 3S1AA 1YZFA 3H6GA 4DM3A 1SOVA 1HXHA 3CLRD 2NUPA 2FSSA 2M6RA 3HP7A 1VBKA 4F6LA 1L4FA 2FH5B 3R8FA 5LZ7A 3HG7A 3TQTA 5JATA 2P1RA 3FFWA 4HB4A 2EARA 1YQDA 4D41A 4PQFA 4MA4A 1Z0DA 2P90A 1JHRA 1L1QA 1UBLS 4R54A 5LC1A 3VZQA 4GOMD 4G4SO 5K3OA 1XA4A 2HJVA 4PC6A 1DGQA 2HF9A 1OWPA 3K35A 3VYTB 5CFZA 1QC5B 1X13A 4XX0B 3KE9A 4ENWA 2VRBA 4BVKA 1EK5A 3KJIA 1AE1A 1WZCA 4HLNA 3F9RA 5FULA 4PHHA 4I2NA 3STUA 2WHPA 3TSCA 1F0KA 4DIBA 5GTDA 3A4NA 1PU2A 3BWXA 1UM8A 1HH4A 1RBYA 4Y67A 2IP4A 4TYNA 4P36A 3V4RA 2ORYA 4LHVA 1ZRNA 1SEVA 3B53X 4PC2A 1U8AA 4JLMA 1IIBA 1CNFA 1HBJA 1XA0A 4AS3A 7GPBA 2XUHA 1CU1A 4L5YA 1EYZA 2QVLA 3WGKA 4L02A 1CV2A 1NP6A 2D0OB 4GOLD 4ZEOA 5AQEA 1SUAA 4BGEA 3BAZA 2QRVA 3I9V1 3H2JA 1EZ1A 1JYSA 2J3HA 3RS9A 3VR3A 5MN4A 3KQNA 1O95D 3CN7A 3GT7A 1MPXA 2X40A 3DWFA 3I4LA 3GFSA 3RO7A 4ICIA 2W8BA 4XXHA 3LLVA 1E0AA 1HFEL 2PX5A 1WHTB 2WJWA 5C8ZA 4I66A 4I9GA 3SJZA 2HDWA 4AN0A 1X7ZA 3RC9A 1WX1A 3BC1A 3EGOA 2D2FA 1LPOA 2HQBA 3IMFA 3OQBA 5ERGB 3OY7A 4GBED 1JFLA 1AKVA 1KK3A 1OBHA 2H85A 3OZEA 4OLJA 5JXWA 2EF0A 5JZ9A 3ZV5A 4DABA 5IM5A 3DBLA 3C41J 2GOYA 3LCJA 1EDBA 2PLWA 4XQEA 2OHIA 2FWIA 2GK7A 1OW3B 1E9EA 2YHBA 1KZ6A 3IS3A 1XQYA 3F7OA 1ZY2A 1YSCA 2PX0A 3CRVA 3LBYA 5IF9A 3NC0C 1IEVA 1KHTA 3OPNA 5IBQA 1PFYA 1SD2A 1Z7GA 3JQPA 1OI3A 2AW3A 2B7CA 1VLQA 3CY6A 4FZ5A 2Q3JA 3SSOA 5JNVA 3T1YB 4CLEA 3OP4A 3ZHBA 1WU8A 2ODTX 1ILEA 1EMDA 2DH5A 2JJYA 3ROGA 5LNK1 1GQSA 2R44A 5CFMA 2OUKA 2PL9A 4ZT5A 2C03A 3BWDD 3S5JA 4LDPA 1LWNA 3RNLA 4ZANA 1Z0UA 4PN7A 3HU2A 3X0DA 2DECA 4P5DA 1FRVA 5K45A 1NQUA 3FBGA 2IYAA 3AFOA 1KAQA 2CF6A 1WULS 1RU3A 1Z37A 3GARA 2WT9A 2XZOA 2ZYAA 2IYZA 4UU8A 1N2SA 1G6KA 1P8JA 2K2QB 3T3IA 4KYTA 2PJDA 3B6IA 3LVQE 2C82A 1E32A 2R6R1 5HW0A 4H7EA 5FBHA 1I9GA 1TX4B 5JRDS 5LWQA 3WSVA 1RACA 4XVQA 4C30A 4KB5A 3VGJA 1V3UA 2EKBA 3LU1A 5LA6B 3A4LA 2FPSA 1OX4B 2ATXA 4IHAA 3UHOA 4ZICA 1L7PA 1L5ZA 4DPKA 1LC3A 5CT5A 4R1NA 5JPIA 2JFNA 4BLOA 2O8EB 2QJWA 4KX5A 2W2NA 1M76A 2AQ8A 5IJ0B 4RW0A 2JGDA 1T2DA 5DIZA 1BU8A 2BFPA 4G86A 3GEBA 2V96A 4FZVA 4KRYA 4P34A 1KO8A 1E99A 1XI2A 3FNFA 2JIDA 3LOUA 5DCLA 3W6OA 4EMBA 1P72A 2C0QA 5DE3A 3MMSA 3NHJA 4P92A 2AYYA 1GYRA 1FSFA 2A35A 2DJ5A 1ZI9A 2C84A 4RVOA 4K28A 4ENQA 3KCQA 3DONA 2X76A 3QXCA 2PZMA 1QF9A 1E3QA 3GOHA 4LRWA 5D00A 1IZ7A 1KDVA 5CA1B 1SJ9A 5HR5A 3ICEA 2FLVA 4O0LA 1QVZA 1T3HA 3P8ZA 3FHJA 2ZS8A 4BO4A 4EG8A 1MEJA 5ALWA 1SQ5A 1Z5NA 1KK2A 1E4EA 4OKNA 3E0XA 1EFRD 1NJGA 1SOWA 2RGBA 2L18A 2ISSD 4EB6B 1OAKA 4N1AA 1RCTE 4HFRA 1VM6A 4RAQA 3C0KA 4KQCA 1XE3A 4RTSA 3VR5A 2CLHB 1KYYA 1ZIOA 2YC2C 1XN4A 2LKCA 3P97A 3G2NA 5H16A 3IILA 5U4XA 3V9AA 1FUYB 3GRKA 1DC7A 3CPSA 2X4GA 1OIVA 2DULA 2FG6C 3Q7EA 3ZKAA 1G5IA 3Q87B 2G9ZA 3UUFA 5JY6A 2GS9A 2JAWA 5I4BA 4N8EA 1UKAA 5IAEA 3OMWA 2UVDA 3KVRA 3UFBA 4AJIA 2FSHA 4JBIA 4WNAB 1DIAA 5EE0A 2H17A 5TVKA 4DJDC 3E9EA 3L0ZA 1UC8A 1OE0A 3ZI0A 1NI4B 4CFYA 1TAUA 5FPHA 1Z35A 1L7BA 3NIBA 1RW4A 4I6GA 3HB7A 4YONB 2HCRA 5FAKA 1H1LB 2VNHA 3PNOA 1D04A 2AMFA 4H27A 4IIVA 4MH0R 2XNDD 3VC2A 4EKEA 3DEIA 4KGXA 2HPVA 4B6EA 3AESA 1XCLA 1I14A 4YPOA 3R0IA 1E3WB 1TO2E 5L3RA 2E4AA 2W00A 3F49S 3WLIA 3ZCTA 4W5TA 3HBJA 3H9QA 1JEYB 4FI3F 1UFRA 3EGWA 3UAVA 1XZ8A 3CB2A 4EJSA 5C1OA 2DWUA 2F43A 4CDMA 1T5LA 1VIVA 2QG9A 3DAOA 3Q4GA 1Z5OA 3DDSA 4QDKA 3OQOA 3M9XA 2O7NA 2X0KA 1JAHA 2HK9A 3OPQA 4FYIA 3V48A 1U1GA 2CXRA 1KY3A 3GT4A 1BWRA 1TGYA 3I45A 3TMYA 4U2KA 5K8VA 2EEPA 1YS4A 1CJBA 2J3IA 5HFJA 1NQXA 1E1CB 3P9YA 4KQWA 1J1IA 4OXRA 1E8DA 1M8JA 1GTMA 1D3AA 1EP1B 1U90A 3KXPA 4UBLA 3BXHA 1Z75A 2AX4A 2EV9A 3ETJA 1QJ4A 1YS1X 2IHTA 3ZHCA 3T1HB 3HJUA 3RRXA 2AFHE 1PX0A 3DHWC 4HYQA 3FWHA 3F4KA 4E7OA 1JHOA 4MDEA 2IS1A 2BD0A 4TOIA 1GQQA 2O0LA 2ZIXA 4HEA1 1UOOA 4YRLA 4ENSA 1WZ2A 4MWGA 4UAGA 2AC4A 2VSQA 3EIOA 3NHAA 1FMTA 1CLUA 1LW6E 1AXEA 3MZ0A 1UMBA 2V8BA 1DFIA 4KQJA 2UZ1A 2Q9CA 3A31A 3D3QA 2HYDA 2ZJ2A 2H4ZA 4IYRA 4IY1A 4EYOA 3S1AB 1K5HA 3ABIA 1UMCA 5EE5B 4QWMA 2NUPB 2SKCA 4G84A 1CS0A 1Y81A 2VHJA 1QP7A 5CUQA 3WGQA 4ETIA 1VB3A 2EL9A 3G0DA 4BV8A 4OJYA 1AY0A 3OKCA 2C5GA 1AKWA 3PBKA 1ZD1A 2NSJA 3C5WP 4UUBA 4IHJA 1G59A 1FSPA 2AN9A 3OOSA 4XIJA 2WOJA 2OFXA 1QNLA 1PKXA 2WSSA 3IAS1 5KYXA 4NEGA 3KTAB 3BILA 3BTSA 2H8KA 3HFSA 2ZB7A 4EELA 2R85A 3EA4A 3FWYA 3L9XA 4HXFB 1V26A 1W6UA 2ZWOA 4HDCA 4LYEA 4Y2JA 3P4UA 3H1BA 2C2XA 2NUBA 1ZBQA 2A9RA 1NL3A 4LY9A 1P7VA 3AU9A 1L5LA 4BNZA 2HPHA 3E7FA 1J25A 3GFOA 3N3AC 4R5MA 4ME6A 5FOWA 3EBPA 3SHOA 3U3KA 3DBHA 2JJ1D 3G79A 2WHPB 5FLEX 3V1YA 4K0KB 1TEHA 4E2FA 5JAHA 1VLLA 3EEIA 3OE7A 1Q1QA 4FNGA 4FOLA 3UHAA 3DBRA 4DQKA 4UMDA 5B4VA 1A9RA 1QE5A 4X62B 1NTOA 3W3AD 2GLTA 4Q1DA 4DAEA 2CL0X 2IW3A 1H8HA 2O0MA 4PHGA 1TZKA 3BIXA 3ZE7A 2ODQA 1AQ6A 3DW3X 1IK4A 1JAZA 2R97A 5TB5A 3TZEA 1EEXB 1QORA 2JFHA 4F12A 5LBUA 4DJJA 4K7JA 4H77A 3RUIA 3V4PB 2DPHA 2QI9C 2QRVB 4F21A 2GH1A 3SNHA 3JVDA 5K0BA 3F0TA 2FGJA 1TUEA 3QY9A 2BHNA 2PUDA 5E9WA 1F2DA 1VL6A 2W8BB 1OXTA 2ZR8A 4GXNA 4PZDA 2PUAA 3D7NA 2HREA 4XUCA 4MVJP 1PR0A 4TV9B 3Q7PA 4JV5B 1JQAA 2EXXA 1FRNA 1KP9A 2AK3A 1X7ZB 3FR8A 3MT7A 4UD2A 1GPH1 5ESDA 5HE8A 3T35A 1PVVA 4FN5A 4B87A 1BXZA 3QVSA 3DL2A 2C3YA 5ELXA 4XQ9A 3BAFA 3NAGA 1XT6A 2CCGA 3LVRE 4GOND 1ST3A 4R71A 1NJ5A 1WV0A 2ODNA 1JZSA 1B8VA 3QI7A 1Y4DE 2WF8A 3ITEA 1HYBA 4L22A 1U04A 3TLGA 2CL7X 5JHHB 3DBLB 5MFZA 2HPZA 1V5GA 2DKFA 4IMJB 3V6LA 5P8WA 3CT6A 3G8AA 5EIOA 3L84A 5JWOA 5KSWB 1ZVQA 4TYQA 4DR4B 4G5XA 2R8XA 2WKSA 4J16C 5DTIA 5F7OA 2J7KA 1P4SA 2EZ8A 2UXCB 4PCLA 2OYRA 3X1DA