4B7UA

Plasmodium falciparum l-lactate dehydrogenase complexed with bicine
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
316
structure length
316
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE DEHYDROGENASE
publication title The Crystal Structure of Plasmodium Falciparum L- Lactate Dehydrogenase in Complex with a Novel Bicine Ligand
rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 118
structure length 316
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2012-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b7uA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4b7uA02
4UUOA 2X7HA 3L4SO 4TSKA 3O4RA 5TC4A 4Q3AA 2ZTUA 2GD1O 4BO7A 4E5NA 4MIEA 3GN2A 4EEXA 1XYGA 1E0DA 3AK4A 3QJ5A 4RPJA 3JQAB 4LISA 4NFHA 4HP8A 1DIGA 3C85A 3NDRA 3Q3CA 2FPPA 3LLVA 4UVGA 1BW9B 2O2SA 5A5EA 1JQBA 1Z74A 4TKLA 1P33A 1TEHA 5BNFA 5I9LA 1A9ZA 1GUZA 2GN6A 5CPBA 4CLRA 5EMHA 5I9NA 1IPFA 4BO2A 5CDYA 3VTZA 4PG6A 4NNJA 4W4TA 2EG9A 4LCEA 3FPLA 3ZWAA 1QYCA 3PIIA 3PP8A 1NX6A 2Y1CA 4BO0A 1PX0A 4NPCA 1HETA 1XCBA 2TMDA 5KKAA 2JFFA 3RUHA 4MO2A 1GY8A 2XF8A 4ZD6A 5DF1A 1PEDA 2X9VA 4FB5A 1NPTO 3ZI0A 1NTOA 3D3EA 3EW7A 1GCOA 4URFA 1VI2A 4PLPA 3GDOA 3B1JA 2QZZA 3WR5A 3VPXA 4LSWA 3U9LA 4RO0A 3AI2A 3GPIA 2HMWA 2VHXA 4FOSA 3EMKA 3FNEA 3PK0A 5KKCA 4G5HA 5FYDA 2PV7A 5IZ4A 3DAPA 1GZ4A 4WLUA 4BKRA 4XYLA 4B7XA 1QKIA 1YJ8A 4JN6B 2NLOA 2PWZA 3F5SA 3M1AA 1I2BA 3DOJA 3Q1LA 1JLLA 1V6AA 3AU8A 3INRA 3OJOA 1OC2A 4ND3A 3UCFA 1NYTA 4E2ZA 1UP7A 2GUGA 3GVXA 3HFGA 3U49A 3O03A 1QYDA 2FPIA 1CDOA 4CQLA 4Q3CA 2D3TA 2C2XA 1K6IA 2JAHA 2IEBA 2B69A 1I2CA 1ONPA 2Y1FA 3DR3A 3UVEA 4ONEA 1E7QA 3PFWO 2Y0EA 4BMNA 5C37A 3SLGA 1K5HA 1OOEA 3LC1O 4D0RA 5IDQA 2VTDA 1MC4A 2HLPA 2PY6A 1U9JA 2EHDA 3ANLA 2J3JA 5T64A 1UJMA 4Y9DA 3UF0A 2DUWA 2B4TO 2FY8A 1DOHA 1VM6A 4TRRA 3BMCA 5C5IA 3S2FA 4DPLA 1H2BA 2PK3A 5CG1A 2DPGA 3WQQA 3WWZA 4ITUA 3GDGA 3QQPA 1LJ8A 1T2EA 1Y1PA 1ZBQA 2P9CA 2VWGA 4E4YA 4JCOA 2NVUA 3LVFO 3GT0A 5L51A 4FJ1A 4IIUA 2X0JA 2D8AA 4UREA 1E3WB 1HDRA 4RV9A 1EFLA 1PJ2A 3PRJA 3F6YA 3JCZA 2ZJ0A 4Q9NA 2R6JA 3K30A 2YV1A 3ETGA 4M86A 2BFPA 3GLQA 3WQSB 4R5MA 1UZNA 1ZK2A 3V1YA 4WPGA 3QVXA 2HJRA 4DIOA 4WCFA 4MKXA 4W82A 1H6BA 1L7DA 1MX3A 3PWZA 3K6JA 3FTPA 4AL4A 2CMDA 3RQSA 3C24A 1ISGA 3IS3A 4UUMA 5TJHA 1EDOA 1IZ0A 1EVJA 2O7QA 2X6TA 4IS3A 1V0JA 3V5NA 1VLLA 3WMXA 3KOUA 1DC4A 1DIRA 1R4NB 1BDMA 1LC3A 2NVBA 4BO8A 5JMWA 3SXPA 3EVNA 1DC5A 2VT2A 4XJSA 1T26A 3EZYA 3RCBA 4PLTA 1T24A 1U5AA 2A92A 3DAFA 3KYDA 2DT5A 5JAZA 5A9TA 2ZJ1A 4PLFA 3MTJA 4D42A 1KVSA 1ZEJA 1B3RA 1Y7TA 1ZKMA 3HDJA 2DTXA 3LK7A 4YACA 3G1TA 5EQDA 4AJPA 4CPDA 3PJFA 1G6KA 5JDCA 2PNFA 4OJNA 3DOCA 1UZLA 5JE8A 1EEHA 2I5PO 3F5QA 3I23A 3JD1A 4MP8A 4W7IA 2QYSA 3SVTA 3ZWMA 3HFSA 4XDZA 1BSVA 2J3KA 1IPEA 2AEJA 1NPYA 4K1LA 1E1MA 1YQGA 3GFGA 3WLFA 3HSKA 1PJCA 4DQUA 1X1EA 2DBQA 5COBA 1BXGB 5KWEA 8ADHA 4MVJA 5L45A 2NUAA 4IS2A 3OQ1A 3LSYA 4XA8A 4YPOA 4R3WA 3ZU2A 4RPHA 3PHGA 1ZO8A 4CQMB 3H9EO 2QHXA 4D45A 5BSGA 1WAMA 3CMMA 2FR1A 3WIEA 1LTHR 3IDSA 1QYXA 1UR5A 3PDUA 4CLDA 4OGWA 1EK5A 4PLVA 2B36A 4CMIA 1MUUA 4WECA 1Y9AA 1DRWA 3V1UA 2YZ7A 2WD7B 1E6WA 3H2ZA 4OO3A 3ZNPA 4CLEA 4P4NA 1WP4A 1E3SA 2A4KA 3BHJA 1P1RA 3Q9NA 4FOOA 1PR3A 4F6LA 2V6BA 4HFMA 3ONEA 4HWKA 3A06A 2VRCA 4M87A 4MVJI 4NQZA 1BVUA 5EN4A 4Z0HO 4RVDA 4DL9A 2Q4EA 4WE3A 2GERA 4OIMA 5A9SB 1Y9EA 4N5NA 4XQCA 1HZZA 3ICCA 1WZIA 5JAQA 1CWUA 1PJ4A 5DDIP 4LCJA 2B35A 2XAAA 1ORRA 2C82A 5THKA 3U4CA 2ZYDA 4D7AA 3M1LA 3QE3A 3BTVA 3A14A 3ONFA 2IYPA 3NRCA 2PH5A 4ZRNA 1R6DA 1DIAA 4DLLA 4QFDA 2O3TA 3QY9A 3PQEA 1B15A 3OICA 2W2KA 2J6IA 5C7LO 3NTRA 4XWYA 4W9NA 3O9ZA 1HE4A 2RBEA 3DWFA 1JWBB 4YYZA 1P1JA 3GDFA 2B5WA 1ARZA 3RKRA 3G79A 1LSJA 3KSDO 1Y5RA 5LDHA 1IE3A 2G0TA 1ISJA 5A05A 3PHLA 1DJQA 1E1KA 1HDXA 4BKUA 5G0SA 5ADHA 3GG2A 4ID9A 2ZB4A 1QORA 5BNTA 1PL7A 5A4DA 4KMSA 4E13A 4F45A 4WK6A 4CV1A 2EKLA 4AJ1A 3FPCA 3DBVO 3DZBA 3V8BA 2HMUA 2P91A 1KVQA 3BIOA 2AG8A 4ZJUA 3DZHA 3SJ7A 4P22A 4NG5A 4CMCA 1HDOA 1KEUA 1LDGA 1U3UA 3D5TA 3L0DA 4Z0PA 4YT8A 1YXMA 3LT0A 3X2EA 4XYMA 1LQUA 1H6CA 1H5QA 1UP4A 1F12A 1V3TA 2FOIA 1F8FA 3DZIA 1LLCA 3JYOA 5DCWA 4BKOA 3KXDA 1BWSA 1BVRA 2VUTA 1JVSA 1ZJZA 2X5OA 3ROMA 2Q99A 1QYVA 3GA0A 4DQVA 1E5LA 1O95A 1S7CA 5TT0A 3DC2A 4RF3A 4J1NA 3E48A 3BAZA 1FDWA 2DBZA 1BXZA 2WYVA 3IJRA 3E5RA 1IOLA 1SB8A 1B16A 2VYVA 4M89A 1EQUA 1P1IA 4L8VA 2FR8A 3G49A 4TWRA 3B70A 3IKVA 3WOHA 3E1KA 2HQ1A 5BNIA 3RSHA 5ITVA 4J1TA 1HEUA 1D4FA 3NJ4A 2Q4BA 4J90A 3KTDA 1YL6A 4YJFA 4OMUA 2C5AA 1QMGA 3VPHA 4E5MA 3I3OA 1KIFA 3BTUA 4KDEA 2VHWA 1FK8A 1T2AA 4NBTA 5G0WA 3FN4A 4WCFC 4ALIA 1UXKA 1CRWG 1XDWA 4ND2A 1O9BA 1YKFA 4IIVA 1I0ZA 3NEPX 5CDSA 3GZNA 3OETA 4QTZA 3ZZNA 3I4CA 4NU6A 3DEYX 3S2GA 2C29D 4OHUA 4DREA 5JYEA 3HB4X 2HRBA 3GR6A 3WQRA 3ZN2A 1TA4A 2P9EA 4D41A 1GDHA 3GEGA 1A7AA 4YTEA 4B7CA 1AXEA 3A28A 4HFRA 4GX5A 5F5LA 5IXYA 2AMFA 2XXJA 3O38A 4LGVA 3DBHB 3RUCA 2XXBA 3VVCA 6ADHA 1U7TA 4L9RA 1JKIA 1AHHA 1YE3A 4I5GA 3ZCXA 4RL6A 2DPHA 3AOGA 3F9IA 1Y8QA 2YY7A 5HA5A 3W4JA 2NQTA 1JU9A 2VZ8A 2WYUA 3AFNA 5JDCC 9LDBA 5IDWA 1SCUA 1PZHA 2VHVA 4WLEA 4D44A 1X0VA 1OC4A 3KV3O 4RVFA 3LC7O 5GZ3A 2FHSA 4Y8VA 2IDZA 2IE0A 4FFLA 1GZ6A 2I6TA 4BO6A 2DVMA 4BNUA 3GVHA 4GH5A 1XELA 3H9QA 2C7GA 4B4VA 4ALNA 4EW6A 2WD7A 3VAZA 4LVUA 5B4TA 1O0SA 4F3YA 1WMBA 5DCYA 2X9GA 2VWPA 3NDIA 2E48A 1O6ZA 3GMSA 1YB5A 3INGA 2X4GA 4D3SA 1YONA 3MEQA 3QV1A 1H9BA 2H5LA 1PJLA 4NZ9A 4ALKA 2P68A 4YJGA 1FJHA 1JVBA 1DIHA 1I3KA 3ICPA 4PZDA 5U1PA 3ASVA 1R15A 3WG9A 3DHEA 1T2FA 2GN8A 3FBTA 1GYQA 1BMDA 4TKMA 5IDYA 4K6CA 4PG5A 1BHSA 2NM0A 1YBVA 3V2UA 1ZSVA 3H5AA 4D79A 4CM6A 5KJ1A 2O3JA 3CMCO 1AGNA 2PLAA 1PWZA 4GVXA 4PVDA 2ZQZA 4E21A 1GTMA 3TRIA 3NAQA 2O3SA 1H94A 4B79A 3JSAA 2HAEA 2ZB7A 3MJTA 4CLRB 1RM5A 1C1XB 2NADA 4TROA 4AJNA 2AW5A 3VHRA 4CMAA 5JAMA 3I9OA 1T1SA 3QVOA 4W9NC 1TXGA 3IKTA 4MP6A 3W8FA 4L0QA 2O3QA 4J9UE 1ZK0A 4QSMA 3IJPA 2PZMA 3M2PA 2ZCVA 5AYVA 2IZ0A 3U62A 5HRUA 3QVWA 4WKGA 2J8ZA 3GEMA 2FP4A 3QP9A 3AY3A 2I3GA 4XQGA 4I9NA 5FI5A 1DDOA 4AJEA 5T57A 2I65A 1ZSNA 3VPSA 3QWAA 5ITWA 4PZCA 1HDGO 5FFFA 4DWVA 5L7TA 1PIWA 3E8XA 2OBYA 2X5JO 4YBZA 1YRLA 1I01A 2WD8A 4KWIA 5F5NA 4R69A 3VZPA 4NJMA 1V3UA 2R2GA 3OJ0A 2I67A 3W6ZA 3WX0A 5KIAA 4UAGA 4OXNA 5IF3A 1QV6A 1DPGA 1BG6A 1ID1A 1PR9A 5COQA 3FR7A 2O23A 1DRVA 1VKNA 3GF4A 3HB5X 4YQZA 5KCZA 4YT2A 5BR7A 3NJ8A 4PLWA 1NVTA 1XWFA 5GMOA 4RZIA 5ER6A 4J7UA 4CM9A 1YBAA 4CQLB 3OH8A 2C5EA 4WLFA 2ZIZA 1W0CA 3STHA 2C0CA 5KJCA 1T25A 1AUPA 3I5MA 2NSDA 3KEOA 3L4BA 4I5FA 4O0LA 4XEHA 3RC2A 3PJEA 4CMEA 1YO6A 3JQAD 3RBXA 2RH4A 4L4RA 1LDBA 1X13A 4CMBA 3WGGA 1FDUA 2GZ3A 4RF2A 4BHTA 3RC7A 4ND1A 1A5ZA 2QYTA 4OXKA 2NTJA 4NMHA 4DMLA 4II3A 2ZB3A 4E31A 2FZWA 1YS4A 1NQAO 2GZ1A 1N7GA 3QA9A 4YRBA 2P9GA 3D3WA 3PGJA 5LDGA 5DCUA 5L4NA 3TZ6A 4NK5A 2NVUB 4J3FA 2PZLA 5K6AA 3P2YA 1XIVA 2VRCD 4YCAA 3TZHA 4ZGWA 4E12A 3DBHA 1XHLA 3Q9UA 5K9ZA 3E82A 3ASUA 2OFPA 3FI9A 3PQFA 4XDYA 1RYDA 4PLZA 1GFSA 2YQ4A 5A1TA 1W73A 1GAEO 2DTEA 2GSDA 3OQBA 4Y6SA 4WCFB 5L53A 2DAPA 1HDZA 1S6YA 3CTMA 1LRJA 3HADA 1JKFA 3L6DA 1EBFA 3JD2A 2QZ9A 3K5PA 4GX0A 4I5EA 1ZJYA 3ABIA 4WEQA 1U3WA 4R5HA 4WLOA 1NFRA 4GWKA 1ZMTA 3ZHZA 3TWOA 4Q3NA 2X58A 4BNVA 3FD8A 1TB4A 4BVAA 1KYQA 1ENPA 3LQFA 1QYWA 4PVCA 3VH3A 4A27A 4H15A 1R0KA 3KYDB 3R3JA 3LT1A 1EFKA 3GVPA 4R9SA 1YB1A 3A1NA 4IJUA 4FW8A 2QRKA 4R01A 3RFVA 1QLHA 2I3AA 2IRWA 3NGLA 1MFZA 1DFIA 2LDBA 4FFRA 2ZTVA 1F0YA 3LYLA 1N1EA 3GNTA 3GNQA 3RUDA 4Q3EA 2OHXA 1M66A 1GUFA 1Y6JA 3K2EA 3AU9A 5G2OA 1OBFO 2E82A 4BB5A 5DNAA 4PG4A 4ZHSA 5DN9A 3H5RA 4NFYA 3TL2A 1G0OA 2WEKA 4AJ2A 1R4MA 4FD3A 4ZVVA 4CM8B 4BKQA 4DPKA 1ADFA 1T4BA 2VUUA 3MJEA 5JDIA 3AOEC 3OBBA 2O7SA 4BGIA 1WPQA 1PJTA 1X14A 3F3SA 3JV7A 4J49A 3TZQA 3BA1A 2FZEA 2X0RA 4PIVA 3TQHA 1M6HA 2PD3A 1NXQA 3ANMA 4JJIA 1GZ3A 4XYEA 2BFMA 4ZQBA 3C1TA 1CIVA 4IQGA 4M8SA 4CMIB 4YDRA 3I52A 1C1XA 4JJGA 5HWSA 3UFXA 2FPGA 3PEFA 4PG7A 1HT0A 2C07A 3M2TA 5DBFA 4R4JA 3WGOA 1GPDG 3CEAA 2GYYA 3A9WA 4KUHA 5JFOA 2EEZA 4HXYA 4EITA 1Y5MA 4HNHA 4ILKA 4FC6A 2PFGA 4UVDA 2D5AA 1Y81A 5EERA 2V6MA 2LDXA 1YL5A 1PGOA 1DSSG 1XR3A 1KY4A 2EKPA 5ES3A 4BOYA 1NP3A 4R68A 4JJFA 5L95A 1KC3A 4LVCA 4E5YA 2JD1A 5LC1A 4YB8A 1B8PA 5JCJA 1CF2O 1HYEA 2HMTA 4DUPA 2W2KB 4O63O 2GO1A 4S1VA 2OOSA 2PD6A 5AXDA 1QLJA 3EK2A 2Y0DA 3ZWXA 4IUYA 1N5DA 2PGJA 3WGQA 3SEFA 2FR0A 1MA0A 1T4DA 3SX2A 2EWMA 4U7WA 1Z75A 2BMAA 1U28A 4C4OA 4WOJA 3RJ5A 5KOIA 4O59O 2VHYA 2YJZA 2C59A 4MVJM 2D5CA 2B5VA 3DAGA 1J5PA 1O89A 2Z5LA 2IXBA 2B83A 4ZICA 2JCXA 3ANNA 3OJEA 1D3AA 4N5LA 5CEJA 2PGDA 3ZW8A 4Z3KA 5L3ZA 5U9CA 2WYWA 3IUPA 4BNXA 3TDKA 4EBFA 1D8AA 4MOWA 1NHWA 4NDNE 4CQMD 3C7AA 1PQUA 3GY0A 3HJAA 3ZWVA 1E5QA 1SOVA 4MVJF 3HZZA 2BELA 4E0BA 5GZ1A 3IMFA 3H9JA 1RWBA 3WGHA 1B3BA 3F1LA 5A03A 4RJTA 5I7SA 2ZQYA 4I5DA 3WYEA 3L4BC 1RM0A 4CMEC 4PRLA 4WASA 4R1UA 3OJLA 1PQPA 2AE2A 4R1SA 3WYBA 2QX7A 2WE7A 1Q0QA 3ZNOA 1KERA 2ZCUA 3AM3A 1HDCA 4CV0A 2PKQO 3TL3A 2CF5A 4GGOA 4KTTE 2B0JA 1E3IA 2ZK7A 1B7GO 3IP1A 1GU7A 3I9LA 4J2OA 3C1OA 4PLHA 4YVFA 2X5KO 1DRUA 2P2SA 3RU9A 3LT2A 1X0XA 2Y68A 1ENYA 5T67A 3RASA 1ENOA 4JP3A 3RUAA 2O4CA 1ZXLA 2JAPA 2JCYA 3GN1A 4YJFB 3ZW9A 2J5KA 1H2HA 3OM9A 5EINA 5K6AC 3F47A 2BGKA 2CFCA 4A03A 5JY6A 2SCUA 1ISFA 5HBRA 4AVYA 1JAXA 1MXFA 3NV9A 3KO8A 3JQCA 4RZHA 5A9RA 4OQYA 3D64A 1N9GA 1KC1A 4CR6A 1XQ1A 2Q1SA 3QWBA 2B4RO 1B0AA 3VDRA 3G1UA 3GZNB 5JLAA 1BGVA 3ZWCA 4YT5A 4J16A 3BXXA 4R41A 4AICA 4K9DA 3BYZA 5TX7A 3ADPA 1YDEA 2P5UA 4RORA 3H2SA 4TMFA 4CV3A 1E1LA 1GV0A 2RHCA 1HKUA 1A4UA 1Z82A 4HY3A 3QRWA 2EW2A 2EP7A 2HU2A 4BV9A 3EDMA 1PZEA 2CSUA 3TJRA 2C54A 3DBLA 5T8KA 4R51A 3WNQA 4B7UA 1Y8QB 2PKRA 1R0LA 4IDEA 4PRKA 2CVQA 4E2WA 3WJ7A 4FGWA 4I08A 1ZH8A 5KJ6A 4OQZA 4CM8A 3AW9A 1U4SA 5J23A 1P1FA 4L4XA 2IZ1A 5DBIA 3RIHA 1MV8A 5TSDA 3W8DA 3ZDFA 4CMHA 4FJ0A 5FI3A 4HADA 1MG0A 2DLDA 3I9JA 4U6SA 1NR7A 3DZJA 2NV6A 1Y8RA 2VRBA 4U8GA 1BDBA 3LT4A 5F1PA 1ZIDA 4B4OA 5JDIC 3T7EA 3P7MA 3M6IA 2EXXA 4E30A 3GPDG 4CM9D 4R9RA 4CUKA 5KVCA 5BQFA 4IY1A 1VSVA 3B20A 3AUAA 4RLHA 3KETA 2ZATA 4KUEA 2P4HX 4YJGB 5BT9A 4ALLA 2NACA 3AUSA 1HSZA 3UN1A 4E2XA 4KP7A 2ILTA 3O26A 4DRYA 3F4BA 4F6CA 5ER9A 1P0CA 1E3EA 1QSGA 1O94A 1ZUD1 3OIFA 4ND5A 4QO7A 2HKIA 5DBGA 4BNZA 3E9MA 4HNGA 2GCGA 5KNLA 3D0OA 5B4VA 2PD4A 4GKBA 1KBZA 3WXBA 2AEMA 4ZQGA 5KTKA 3MCVA 2JFHA 3R6DA 1NPDA 4YAEA 4QX6A 3DHYA 1P0FA 4CL8A 2OGUA 2D4AA 1ML3A 2JJYA 3OECA 5EIOA 1WXDA 5ILGA 1U7HA 4EUHA 2AQHA 1E7WA 2VWHA 1OI7A 2UUPA 2PTGA 3AI1A 3G17A 4UUPA 4DLAA 1HDYA 3WTBA 1ISIA 3DBRB 5IXSA 2VQ3A 2H63A 4IJVA 1B14A 1DFHA 2E37A 2QG4A 3OMLA 2ZB8A 4TRMA 1WLYA 3HQ4O 3W4KA 1MXHA 4XQEA 5CPFA 2HMVA 1NFQA 4Z9XA 4PFJA 4RDIA 1I8TA 2CDBA 2CDCA 4BNNA 3T4XA 3ORFA 2VCYA 1RKXA 1PGNA 1VE9A 1CQJA 3C7DB 4CM1A 4LN1A 3PJDA 4M49A 4FC7A 4D43A 1LDMA 1KVUA 2Y1DA 2GZ2A 3DONA 3I6IA 4YAKA 4GMGA 3E9NA 1E7SA 2VHZA 1EUDA 1WNTA 1M75A 2IYOA 4NJMB 4D0SA 4DVJA 3EVTA 2PZKA 2Y66A 4IM7A 4WLVA 2FN7A 1YJQA 1SBYA 3DMYA 4C7JA 4H16A 4J0FA 5BSHA 1U3TA 4YQYA 1F14A 4OAQA 1UXHA 1J49A 3QHAA 4OKNA 1VJ0A 2WWRA 3T4EA 2VYNA 1SAYA 4E5PA 3RUFA 2OMEA 3JQ7A 1I24A 2F1KA 4IPTA 5I7EA 1DXYA 4IMPA 2FRDA 3HDHA 2YV3A 4TZKA 1LNQA 4XGNA 1KOLA 2QRLA 4CR7A 1LDEA 4X54A 1JWAB 2WM3A 2OZPA 7ADHA 1UP6A 4GGPA 1LQTA 5A3VA 2RCYA 4N54A 1Z73A 2GPTA 3HDYA 3QVTA 3PJGA 4RCVA 4DLBA 1VC2A 2H9IA 3S1LA 3GUYA 4UULA 4GQAA 1N2SA 4BO5A 3F1KA 4RLSA 1LEHA 4ZA2A 1K0UA 3ZV5A 2YFHA 3OFSA 3UCXA 1TT5B 5EJ2A 5FEUA 1RM4A 3D3WB 1NHGA 5JXWA 2J5QA 3RC9A 2HUNA 1I32A 3VPGA 2B37A 3AM4A 5AXCA 3EY4A 1JTVA 4PLGA 4L76A 4MVJP 1Z45A 1QP8A 1ULUA 5DT9A 1UAGA 2H1SA 1GEEA 4FPXA 3PWKA 4XR9A 1JN0A 1LC0A 2Z1MA 4GVLA 1EDZA 2NU6A 4QT0A 3RFXA 1Z6ZA 3IAHA 1I2ZA 1U3VA 4JXKA 3AY7A 4CM5A 2GR9A 4BNKA 2JHGA 3CXRA 5IN5A 3PFFA 4CM4A 4L73A 2O50A 3MOIA 3JYQA 3EHEA 1A4IA 3EUWA 3S2EA 4R1TA 1HE2A 3H65A 3R1IA 2YHIA 2QQ5A 5U4QA 2D1YA 4B8ZA 2DFVA 4FQ8A 4MKZA 4RF4A 4XIYA 2R00A 1UXJA 5T8KC 3DFZA 3L9WA 3H9UA 4NHEA 3MJCA 4TVOA 4BNHA 2O2YA 2YUTA 1E3JA 4WOKA 2RHRA 3UAGA 2I76A 3WJAA 3A4VA 1XEAA 1K6XA 1V8BA 2DC1A 4ZQEA 3VH2A 3OA0A 4BNMA 2ZTLA 3VOSA 4BUCA 1H9AA 4A26A 3VVBA 2WTBA 1H6DA 4DA9A 4DYVA 5I7FA 4JROA 3ITDA 2G76A 3PPIA 1GL3A 2Q1TA 2V65A 3GG9A 4JP2A 5IN4A 4BB6A 3U0BA 3U4HA 2Q2VA 2V6FA 4J0EA 1E1NA 4YRDA 4A5OA 4IGFA 3UHAA 3KB6A 1BTOA 1N92A 2HCTA 5KJEA 4YAIA 4YA6A 4R3NA 3ETEA 1FDTA 3GRPA 5EPOA 1R4MB 4DIBA 3U4DA 3F46A 2OP0A 2DTDA 1XU7A 3ONDA 5I7VA 1ISMA 1DLJA 3H7AA 4JBGA 4NBUA 3V1TC 2DU8A 1Q2XA 2ZYGA 4AJJA 5ICSA 1KEWA 4II2A 3WS7A 4I9HA 4O1MA 4YR9A 3ZV3A 1PWXA 3NTOA 3OIGA 3VZQA 1SZJG 3K8ZA 5TGDA 1M6WA 3CINA 1EK6A 3GK3A 4ZRMA 1DLIA 3KLPX 4J6FA 3JQGB 3CH6A 1MP0A 1GCUA 3RI3A 5JC1A 4EJ6A 3DBRA 4NH4A 2NNLD 4Y6RA 4JBIA 4GBJA 1EE2A 1N7HA 2W8ZA 4CUJA 1DB3A 2OBNA 5IG2A 4UVHA 3CSDA 5JW6A 2NU7A 2RIRA 3NT2A 3WICA 3L9XA 1Q7GA 2C2YA 1XLTA 3WIDA 1DAPA 4FFMA 5ENDA 3JQBA 4J2HA 2YQ5A 4Z6KA 5JAIA 4RPGA 4GWGA 4MPDA 3SBOA 1X7GA 3BZUA 1C14A 3FCOA 4IDGA 1RJWA 4PLYA 4E3ZA 3ZU5A 1XGKA 3WGIA 4DC1A 4G65A 1PU2A 4QQRA 3LC2O 4RF5A 1WZEA 4ALJA 5JC8A 1PGPA 1UAYA 3WLEA 3BMNA 4GMFA 1GD1O 1I36A 4YAJA 3S2IA 1M76A 3K2BA 5B4UA 3DTTA 3PWSA 1IUKA 1VL6A 4XRGA 1ONOA 3CPSA 5HTOA 3DL2A 4AG3A 2NU9A 2Y05A 4LK3A 4OL9A 3ZH2A 3JQEA 4IDBA 1G0NA 5HS6A 4EYEA 2G17A 1HXHA 2AG5A 4EUEA 2YHUA 1PL8A 1Q7CA 1C1DA 1ONNA 1EQ2A 3I6QA 4J1SA 3PHIA 5A02A 4GSKA 4W99A 3NDJA 4MVJD 1XU9A 1X15A 1LSOA 2JHFA 1P77A 2W90A 1QRRA 5C7OO 3U3XA 1L7EA 1K6JA 1X7DA 1ZFNA 5DOZA 1KS9A 1XSEA 1YQXA 4BNWA 3AY6A 3F4LA 4E32A 4AJ4A 1D1SA 1GR0A 1DEHA 2CUKA 2DQ4A 1QV7A 1TT5A 3UUWA 4EEZA 1E7MA 4BNJA 2PZJA 1IL0A 2X9NA 2E4AA 1YQDA 4CL3A 1R66A 1ADGA 1GV1A 1YWGO 2EJWA 5TRTA 5IAAA 5KJFA 1W4ZA 1D1TA 4Z9YA 3SC6A 4PCVA 4RVSA 1M67A 4IGEA 3RKUA 1MFPA 3FR8A 1PJ3A 1SO8A 5AXAA 5IZCA 3MJ4A 4FFNA 3MTGA 4XGIA 3RROA 1TVEA 5G0VA 3ZWWA 3EAGA 4PG8A 2G82A 1FMCA 4UEJA 4J91A 4UUNA 5GZ6A 4L4SA 5H81A 4JQCA 3QWHA 1IB6A 1UDAA 4IXWA 4U0JA 3X2FA 2P5YA 2PKQP 4MVJH 2EGGA 1UUFA 3PLRA 4LW8A 2POQX 4RVHA 5AVOA 3D7LA 4U5QA 4S3MA 3W1VA 4BMSA 2CZCA 2GN9A 4GPD1 3S8MA 1PSDA 3K9QO 1PJQA 3OA2A 3ENKA 1Z7BA 5TS3A 1PGQA 3DMTA 4JIGA 3VKVA 1PTJA 1WDLA 2J5RA 4EZBA 4QECA 4XYBA 1N9GB 1Q7BA 3VPFA 1P74A 2B4QA 5ILOA 3H4VA 2DBRA 4QFCA 4HBGA 3UCEA 3GMDA 4JLWA 2NTVA 4H7PA 2Y67A 5IDXA 1U2GA 3KUXA 1P44A 3ZWNA 1PGJA 1I5RA 3DOOA 8LDHA 1U2DA 1XQ6A 5TF4A 4A10A 2CF6A 2OO5A 1JW9B 2ZKLA 2UV8A 3C7CB 3QWIA 5EESA 5BSFA 5IJZA 2R00C 5L4SA 4Q39A 3GOHA 3D5QA 3JYPA 3OF2A 5TNXA 1ZXBA 5CAEA 3IOYA 2GRAA 4RQTA 1SPXA 4R16A 5I9MA 4E5KA 1ZMOA 4XYGA 3K31A 3DBLB 4DBZA 3BMOA 4HV4A 1MC5A 4WUVA 2Y93A 4Y98A 3KEQA 3TF5A 2EGHA 3ZGYA 1QXSA 1CYDA 3DZGA 3B1FA 4D3DA 1B8VA 2BI8A 3PYMA 5T6BA 4CMJA 1AN9A 4FFPA 3QWFA 2WSBA 3E6AA 3VZRA 1RYEA 4O6VA 4A2CA 4MIYA 1HF3A 4NJOA 1UDBA 1LU9A 3HN2A 1C0LA 2BI7A 5JO0A 3H8VA 3S55A 5L7YA 1GYPA 3WTCA 1CQIA 1NAHA 2TMGA 3UGKA 1XG5A 6LDHA 2VYVD 4TRJA 2CNBA 3MZ0A 4PGFA 3PYLA 3OSUA 3WSVA 1ADCA 1Y8RB 3OHSX 1NWCA 4CODB 1LSUA 1NAIA 3JQGA 1VL8A 5JO9A 4AJOA 2HO5A 4I9UA 3HWRA 1U8FO 2VYND 1AHIA 3WNVA 3RBZA 1JAYA 3R0IA 3ZNNA 1MLDA 2UDPA 4A7PA 2X22A 3N58A 1KY5A 5T5QA 4U0KA 1ZCJA 3KSZO 1MB4A 1R16A 1IHYA 1KVRA 4IBOA 2X1HA 4R1NA 4CR8A 4XJTA 4CM3A 3C3XA 3ZHBA 4QO8A 1HZJA 3AJRA 3I9NA 4DTIA 5DP1A 4Z9FA 1CJCA 3ZV6A 1WMAA 3KHUA 3O8QB 4XZ3A 1PZFA 3WGTA 3PGXA 4KWHA 3FBGA 1YBMA 4RDHA 1Q1NA 1IHXA 1IZ9A 3DB2A 4LMRA 5CHEA 4ZN6A 4LRSB 4RQUA 4B4UA 2WMDA 3E18A 3AUUA 5JPIA 1VRWA 3FF4A 4EGFA 3JQ6A 3WMWA 3JYNA 1P45A 3HE3A 4Y6PA 3L07A 3JQFA 1EZ4A 2Q46A 3P5SA 5CDTA 3RBVA 3JQBC 3I9KA 4XRRA 3PQDA 4CLOB 5B1YA 1OMOA 3GC6A 3DTYA 4YJHA 3OJFA 3MJVA 5AXBA 1HLPA 3TOXA 2Y1OA 4AJIA 3ZWBA 3ITKA 4BGEA 2VOJA 1I3LA 2Z95A 4U6QA 2GNAA 3BTSA 2YW9A 3VH4A 3WBBA 3GFBA 2OXIA 1DHRA 1FDVA 1EVZA 2BKAA 5CG2A 5JS6A 3E5MA 1LUAA 5G0TA 4NBVA 3GHYA 1YVEI 3OIDA 3V2HA 4E2YA 4BNIA 5BSEA 1KETA 1UH5A 2HSDA 1NR1A 1P1HA 3BMQA 3H3JA 2XPCA 3WSWA 2G5CA 1B26A 2AHRA 5GY7A 4EJ0A 3CIFA 2Z1NA 4F46A 1TT7A 3RD5A 5L40A 4J43A 1PJBA 2O4UX 3LDHA 4IJKA 3P2OA 2JCVA 1GADO 4BO4A 4RPKA 3PXXA 1A9YA 3SLKA 1XA0A 1ZW1A 3ENNA 2WJPA 4FDAA 4A73A 5KVVA 2VWQA 1E3LA 3IQDB 4J4TA 3ROKA 4K28A 4QXMA 4OM8A 1LLUA 1K89A 1KEPA 3WYCA 1C0KA 1T1RA 1ZK3A 3B1KA 1LRKA 3RU7A 2CY0A 2EIHA 1IY8A 2C20A 1AXGA 5KVQA 3ZV4A 2H6EA 1I10A 1E77A 2W98A 2PGLA 4M54A 1PZGA 5DZSA 3GQVA 4WEOA 4WNCA 3I4FA 3JQ7B 5JCXA 2HDHA 3ZWPA 3V2GA 1ISHA 3G3EA 4GX2A 1E7RA 1YL7A 5IZCC 2W2LA 3C8MA 4ZQFA 2D59A 1VJ1A 1A27A 3DXFA 4IMRA 5A04A 3TZKA 1PS8A 4HUJA 4MVJE 5TT1A 3HG7A 1DJNA 5JYDA 4OOFA 4IXTA 5AOVA 1SMKA 4B3HA 1G1AA 3ZU3A 2F00A 1VSUA 2Y1EA 3VC7A 3ZWYA 2Q1UA 3K92A 3QIVA 2YFQA 4DIFA 3H6KA 4Z3DA 3DMTC 5L9AA 3PTZA 2WE8A 3FWZA 1OAAA 2PA3A 3ULKA 4GL4A 4RVGA 3DO5A 1ZK4A 4MIOA 2PH3A 3KYBA 2D0IA 4RGBA 3WGYA 5A5FA 2VZ0A 2I9PA 4GLLA 1IULA 5HS4A 2E49A 4HKTA 5G4KA 3DFUA 2CVZA 1EUCA 2JFGA 5CFZA 4M1QA 1ZEMA 3JQ8A 2A35A 1C0PA 1A71A 3NKLA 1QG6A 2I99A 5A06A 1GPJA 4BNLA 3GUCA 2DBVO 4BNGA 3RVDA 4J9VA 4CM4B 5G0UA 3P19A 2OORA 3WB9A 3GEDA 1SOWA 1DC3A 2W4QA 3JYLA 1T2DA 4WNIA 5LCXA 3JD3A 2G1UA 2YHIB 1NQTA 3MWEB 3PZBA 4XCVA 3TZCA 3AI3A 4N7RA 1U5CA 2Q49A 3IL2A 4EJMA 5HM8A 5FF9A 1HE3A 4B3IA 5THQA 2VUSA 2NU8A 4JBHA 5JY1A 3L6OO 2OUIA 3QLJA 4FCCA 1PL6A 1QR6A 4NFSA 3JQAA 3AM5A 2O3RA 3KLMX 3UICA 4YEDA 1NNUA 1E6EA 2AQ8A 3CUKA 3VZSA 4YJDA 1DHTA 4OSPA 1BW9A 3BHIA 3GAZA 3HDQA 4ZU3A 4IZHA 4TQGA 1NQ5A 4KDFA 3N7UA 3TFOA 1DFGA 3NUGA 4RVUA 3H3FA 2BHLA 2HK9A 3OP4A 1ULSA 2FWMX 3L6EA 3MWDB 2IODA 3NYWA 4NU5A 5MGBA 3O8QA 5DOVA 4IDDA 1CERA 4TVBA 2BGMA 1YH3A 2Q2QA 4B4WA 1BRMA 3B6ZA 3GRKA 1LDNA 2VN8A 4GX1A 4XR4A 4NBRA 4CLHA 3C1AA 4GI2A 4KZPA 2YYYA 1RM3A 4M55A 2OP1A 2YV2A 4W6ZA 4P4GA 2QIOA 4JNKA 3GVIA 4CLOA 1PS9A 4AJKA 4ND4A 4IZIA 1FXSA 3NX4A 3KBOA 1TLTA 1B8UA 4BNYA 3HHPA 3PHHA 5B12A 5G4LA 5JBIA 4FR5A 5EQFA 4K26A 3NGXA 3EC7A 4UEKA 4J4HA 4XB2A 3OQ6A 4KTVE 3UKOA 1ENZA 2QW8A 2VNSA 4FGSA 3JD0A 5L4LA 3JQFC 2Y99A 1EE9A 1HWYA 3KVOA 3KZVA 1J4AA 1FDSA 4BGUA 1R12A 2FSVA 1LLDA 3T7CA 4W7HA 1CETA 1TI7A 2GDZA 2A9FA 3TPCA 2EF1A 1H93A 3RJ9A 3CKYA 3UOGA 2HRZA 1N1GA 1CEQA 3LZ6A 5H83A 3VH1A 3GAFA 4B8WA 4CJXA 2DKNA 2GGSA 4J1QA 1JA9A 1K3TA 4L74A 4DQXA 2Q3EA 1R37A 3HN7A 2NVWA 3AUTA 5CDGA 5F1KA 2BRUA 1C3VA 3IUSA 2J3HA 3CZRA 5CP8A 5C7IO 3EZLA 4IJWA 3CE6A 1YB4A 1U1IA 1LXCA 1ZSYA 3LU1A 3BMNB 3ST7A 3KYCB 4FFOA 4XX0A 4GSLA 5DULA 5ICMA 4O5OA 3Q2IA 5MDHA 3RFTA 3RUIA 3K73O 2DM6A 3ON5A 1W6UA 2UVDA 4QUKA 4K6FA 1HL3A 2ZYAA 2JD0A 3I1JA 4PN3A 4N5MA 4OXYA 1C0IA 4FS3A 1RPNA 4Y67A 3RAJA 1WWKA 4NBWA 1E3WA 1C1DB 2GLXA 2BD0A 3COSA 4UVIA 4JX8A 4ALMA 2NWQA 3TSCA 1OZAA 2HK8A 5K0ZA 1P1KA 1DIBA 4I1IA 1Q0LA 1JKJA 5ENVA 2GN4A 1M2WA 4NR0A 4Q3DA 2BFOA 1MGOA 2AA3A 1WVGA 2VOEA 1LI4A 5TJ9A 3JQDA 3SJUA 4HFNA 2Q50A 2IXAA 4XGKA 3VKUA 1R0SA 4WGGA 2O48X 4GAEA 1NVMB 3MOGA 4NIMA 2EJVA 3PZRA 3QW2A 5A3JA 4FIZA 4DGSA 1LDYA 2CD9A 1R4NA 3Q11A 1GQYA 3U4IA 4DBVO 2BF7A 1IYZA 4OSOA 2EP5A 4KQWA 4KOAA 2NTNA 3ZHYA 1SNYA 4MINA 1LBEA 4Z0TA 1ZZEA 1F06A 3K96A 4GKVA 3OEYA 4AFNA 4WLNA 4N18A 1GYRA 3JD4A 2Y0CA 1MG5A 2JD2A 1SC6A 5CEEA 1EVYA 3IIEA 1UZMA 4E33A 3QVSA 3WBFA 2PR2A 2BLLA 4CMGA 3UW3A 4OKIA 1GQQA 2V6GA 3U5TA 4BQPA 5CEFA 1VL0A 2AXQA 1EMDA 5JCJD 3KM0A 3WWYA 4MVJG 4B3JA 3FRJA 4P8RA 3G0OA 2X86A 3WDSA 2JKVA 4BIIA 5TQVA 3ROPA 2ET6A 1U8XX 4HFJA 4MDHA 4E6PA 1NBOA 1ZK1A 3JQ9A 4IINA 1BXGA 5JMPA 1PJSA 3GZ4A 3AWDA 2X0NA 4BGVA 3L77A 1J6UA 1UXIA 4CQMA 1NM5A 1WDMA 4FSHA 1KEVA 1E7YA 4YWJA 4DC0A 1ZNQO 2A94A 2YDYA 2HMSA 4YXFA 1YOVB 4UVEA 3TN7A 1KVTA 1HTBA 4TRNA 3WFJA 1BXKA 3NT5A 2XOXA 3Q6IA 3BMOB 3RC1A 2EV9A 4ROSA 3PIDA 4BO3A 4J7XA 3SC4A 4JGBA 4L75A 2Q1WA 3ZU4A 5I8WA 5A9SA 3AOEA 1W8DA 4BO1A 4A0SA 3ADOA 1DO8A 2RAFA 2DFDA 4HX5A 2EKQA 1DBVO 1B2LA 5L7WA 1H0KA 1NFFA 1P3DA 2I66A 1HRDA 3TNLA 4DXHA 4AJLA 1YGYA 4QEDA 2BGLA 5H82A 1NQOA 4EDFA 3CZMA 2EERA 1GEGA 3FWNA 3FHLA 4BMVA 5F3RA 3TFQA 1L1FA 4ESOA 4G2NA 4EUFA 1ADBA 1NVGA 2X0IA 3FNGA 3VDQA 3MJSA 5F1OA 3PI7A 4ZQHA 1K2WA 3DZKA 5EL0A 5C3MA 1VPDA 1P9LA 1GUYA 4AJHA 4DMMA 3DQPA 2W2LD 2D2IA 3GHHA 5DP2A 3ZHXA 2E6UX 2AE1A 3PVZA 2QRJA 1YDWA 4JK3A 3PLNA 1Q0HA 3IP3A 1I3NA 4XB1A 4D46A 1OFGA 1PQWA 4XD2A 3GGGA 4WJZA 4BQRA 5B37A 2V7PA 3TOZA 4C7KA 1X7HA 2UUOA 4KUGA 1P31A 3PHJA 3LF1A 4LSMA 4IDAA 1I30A 3R3SA 4FJ2A 2AQKA 3DHNA 2VNAA 4BNTA 1SB9A 3E03A 3KSUA 2P4QA 1U4OA 3H9GA 4BL5A 2AQIA 1LRLA 5TLSA 3DDNA 3W6UA 4J4BA 2Q2WA 3KYCA 1O8CA 1SEPA 2GASA 2IEDA 3H5NA 1I33A 2O3UA 1SEVA 1X1TA 4KQXA 4D3FA 3JTMA 4YJHB 2OL4A 5JNLA 4IDCA 1V35A 2C7VA 1E6UA 4MJLA 4IDFA 4OH1A 1EUZA 4R54A 3U09A 3HNPA 3OEWA 4DYDA 4INAA 3ZNQA 4CMKA 1I3MA 1VJTA 4P4LA 3BMQB 2AEFA 4NK4A 3W8EA 2CDAA 3FSRA 9LDTA 1H6AA 1EBUA 3D1LA 4CLXA 7MDHA 4YT4A 2Y1GA 2X23A 1N8KA 1DC6A 1V3VA 4CUZA 4UEOA 3UXYA 3ZWOA 1WDKA 4BKPA 1GQ2A 3UH1A 4FN4A 1JDJA 1DAOA 3RUEA 5JSFA 1LX6A 3I9MA 3E9QA 2HK7A 4GLOA 2FMUA 3I83A 4NI5A 4YAGA 5I8ZA 2RH8A 3IC5A 3QSGA 1T2CA 3GGOA 3LLSA 3BHMA 3D4NA 2BFAA 3FNFA 1F8GA 1UXGA 3FTNA 4OYRA 4WCDA 4XIJA 3ROQA 3EYWA 5AQ1A 4I8XA 4Q3BA 5TIIA 1HE5A 2YDXA 2UYYA 3Q0EA 4FBGA 2IZZA 1NWHA 3BMCB 1F17A 2JL1A 1UDCA 1Z7EA 4CV2A 1VKOA 1HLDA 2VZ9A 4XKJA 1HYGA 4OOEA 3NT4A 4XQ9A 3BTOA 3ETDA 3Q2KA 1EVIA 3GGPA 4TZTA 4P38A 3RWBA 1HSOA 3GH3A 3EGOA 5KVSA 5CDUA 1NASA 2VTEA 3PDJA 4IQ8A 3WFIA 1HYHA 3DZFA 4PLCA 4G81A 1V9LA 4MKRA 4LRTB 1PS0A 2WDZA 4BO9A 1XKQA 3GVCA 1FF9A 2VT3A 3WGZA 2BH9A 3LF2A 1A72A 2Q45A 1LSSA 4RPLA 4PZEA 4EI2A 3D4PA 1LLQA 3FNHA 3NTQA 1J0XO 4YRAA 3D4OA 4LMPA 4BV8A 2GF2A 1YOVA 3W4IA 5IFLA 3JQ9C 3PYXA 5COAA 2DUUA 3KRTA 4H3VA 1A7KA 5G4KB 2NQ8A 1LA2A 4DPMA 4IQ0A 1D7OA 3AFMA 2ZTMA 2FSSA 4CM7A 3N74A 1AE1A 2UAGA 3JQ8B 1WW8A 1ZVMA 1E92A 3HUDA 2EW8A 1O5IA 2X8LA 3INTA 5FWNA 2J3IA 2CVOA 3GNSA 5F21A 4J7CA 4BS9A 3VTFA 4MP3A 4BNFA 2HJSA
chains in the Genus database with same CATH superfamily
1NJ8A 1Q3KA 5DIZA 5AK6A 2I6SA 1IHDA 2VF5X 2X7HA 3L4SO 3VPDA 1THTA 1I4WA 1FMTA 4JJAA 1OF1A 1N6KA 4JLVA 4WJKB 5CLHA 1PEYA 4RNDB 2XQVA 2JBHA 4Q3AA 5TC4A 2BGWA 3PUZA 5MN4A 4JYMA 2GD1O 2DFKB 4TT8A 5BW4A 4EEXA 5AVTA 4GRAA 2ZUVA 1OQAA 2A4MA 1AC5A 3QJ5A 4RPJA 2A0UA 4Y1FA 1IN4A 1PFQA 1Y33E 1NF2A 5IBRA 2BMVA 1TVCA 1Y7PA 5I4CA 3IVMA 3NEAA 3VXKA 4HQ6A 3NDRA 2ECKA 5FUMA 3B60A 3LLVA 1GNSA 1BW9B 4FYJA 5A5EA 3T7RA 1S96A 2QVBA 1M5UA 3PWTA 2L19A 4DB2A 2YMLA 1P33A 3KPJA 1A9ZA 1PDWA 2GN6A 1J00A 1QE0A 4I6EA 4QYWA 1EFVA 4FWTA 2O9JA 4LDQA 2VP9A 2WWGA 2ZWMA 3I01A 4B6RA 2BMFA 3FOAA 1SKAA 3E3MA 3HU1A 2XDWA 3VI4B 4EWLA 4GF5A 1RE1A 4PG6A 5EIBD 1YZKA 1XD2B 4C14A 5FX2A 3ZZ0A 4IYJA 1FTQA 1YQQA 2VEOA 3T7KA 4DDHA 4CFYA 2QRNA 4N49A 2TMDA 1PLLA 1C3OB 1K7EB 4TLEA 5AJVB 5HQ3A 5KKAA 4BCBA 2JFFA 3AHFA 4RPIA 1B6TA 1BQEA 1RTTA 1E0JA 1XVVA 3GDHA 1XZFA 2WOOA 1ORIA 1X9GA 2JJ2D 2X9VA 4NCIA 2BR4A 1E2EA 4FB5A 1NPTO 3ZI0A 3EW7A 4JLKA 1GCOA 1FA9A 4LXIA 4ED9A 3DFFA 3I2GA 5GM2A 1QAMA 1VCMA 2J4FA 1UEIA 3CJQA 1ORDA 4EFDA 1FX0B 2TMYA 3OQVA 2IY8A 2BFBA 2JAQA 4RO0A 1EHCA 3GPIA 4OB6A 4MH0R 5TPZD 3U3MA 5LDDC 3U61B 3EMKA 3O3NB 4J07A 2EQBA 4GP6A 1JIQA 2C9CA 4XI9A 4AS3A 2Q5FA 4XYLA 5IVPA 2P41A 4Y1GA 3QKRA 1RFLA 2DHCA 1YJ8A 4E1AA 4FYWA 2DPYA 2H9AA 2R65A 4PQGA 5FV4A 3F5SA 2VEDA 4NMWA 5J4YA 2GBLC 1JLLA 2CLLB 4NBKA 2H0AA 1OC2A 4LC1A 4MYDA 3TCNA 1G21E 3SYLA 1PUJA 3ZXSA 1ZJ4A 3OE1A 2GUGA 3FHCB 3GVXA 3KHSA 4A1OA 3BQ9A 1NNEA 2G9VA 1YBHA 2D3TA 1E6KA 1PRYA 4BEBA 2JAHA 2IEBA 5FV7A 5KNDD 4X84A 1I2CA 3SVZA 1KQNA 2BEUB 1JTEA 4ZKEA 1E7QA 1DP4A 4RLFA 1S4QA 4Z9AA 1Z0UA 1H3NA 1N5IA 4HK4A 4OUKX 2PX0A 2W6ZA 1K5HA 1OOEA 3F5MA 3SLGA 2OAP1 1ZJWA 1MC4A 2WJ6A 3FROA 3RHFA 1N78A 4FFSA 2BFFA 2JI7A 2FVYA 3HO8A 3H8SA 5AJYA 5T64A 3V6LA 2ACVA 1O58A 1GGMA 2PEYA 4I8IA 2QL9A 4TRRA 1DEAA 3TNFA 5B7QA 1T8WA 1BE6A 3BMCA 3S2FA 3UGJA 1OLOA 1V9CA 4IL5A 5I51A 2DPGA 3U0VA 3WQQA 3R7AA 4ITUA 1W4BA 1T2EA 1INLA 1M33A 4R2WA 4JCOA 3T0IA 3A6HA 5D5HA 1L7VC 1NXWA 3N07A 3LK6A 4O4LF 7AT1A 4Z7QB 2HYDA 3TJZA 4PBRA 1XCMA 1T1EA 1T9ZA 2FVXA 4YP6A 3AEUB 4DQ0A 5TMPA 4Y2UA 5IX8A 3FCEA 4TS9A 1SPBS 3OAAA 3FKJA 4XLZA 1DDIA 2BMEA 2JLRA 4WPGA 1IAVA 3HKBA 1CUVA 3LOUA 3QVXA 4WCFA 4MKXA 3DDHA 2VK1A 1YQEA 3EGXB 3LY9A 4KBGA 3DKPA 2CXSA 3K6JA 1QFXA 4YHBA 4ZI7B 1VXRA 4P7BA 2PXCA 1F5SA 3MN1A 1OU4A 3C3PA 3MAJA 3SJCA 4NICA 4E4RA 2XA2A 3C24A 1L5RA 1UWKA 3IS3A 3NVDA 5TJHA 4BJ5A 2P30A 5C51B 3R7SA 2ZDQA 3WHKA 1HFKA 3FKSA 4B71A 4IS3A 4F4JA 3L40A 4HVTA 1EFPA 1QDUA 1E2DA 3KKNA 3QF4A 4KE7A 5CXSA 4BJ6A 3VNBA 2GZAA 1XMQB 1FSPA 1MEJA 5HBGA 1IHPA 1KDTA 4AZ3B 4F4UA 4YMWA 4D99A 5J9FA 2P3QA 4HEJA 2GVDC 5LNK6 2YYZA 3RCBA 2QKYA 1T24A 1L4HA 3KYDA 3F98A 1SVWA 3LUPA 3LQKA 2Q4TA 5JAZA 1UDWA 1XZNA 1MX5A 2CXPA 1HEYA 1ZEJA 3QY0A 3HDJA 3WWEA 3MQ4A 1DARA 2JI4A 1KMMA 1G6KA 3DOCA 2JH8A 2B1QA 4XTCS 2UXBB 1EINA 2PM8A 4HYTA 1U3DA 3FMVA 3F5QA 4WBNB 4W7IA 4C5AA 3QG5A 1RYNA 3SVTA 4X92A 4RIFA 3HFSA 3FYDA 2ZUCA 1IPEA 2Q7DA 3BS4A 1NPYA 3O93A 4X6XA 2VQEB 1F7VA 4O3FA 2ERYA 1GT6A 2P4EA 5IFKA 2XUHA 3JR3A 4IR7A 1T4CB 3SFZA 1B4DA 4WERA 1X1EA 1VE1A 3BSYA 1NJ1A 3JZAA 8ADHA 1P61B 5DK6A 3M6VA 4IS2A 3EFHA 3LSYA 3R8XA 2QRUA 1P91A 5ELMA 1ZO8A 3B53X 4A2QA 5ED4A 4BBJA 3X1WA 4BRSA 4MYCA 4EFKA 5GM1A 5BSGA 2CL7X 2HOQA 5JV5A 1OWMA 5LQSA 3BILA 3GAAA 4G23A 2OYRA 4BVBA 3IDSA 1QYXA 1USKA 3Q7PA 2EJUA 4H0NA 1NP7A 1XCJA 1CJTC 1ZMBA 1MUUA 2AFHA 3PR1A 3BORA 4DT1B 2WD7B 3RS0A 3VNVA 3TOCA 2OXEA 4L16A 4LJYA 3DV9A 1WP4A 2JK0A 4ENPA 2J7KA 2A4KA 2AG0A 2WAYA 3CEMA 3D6NB 4DJJA 2RFLA 1T34A 3ONEA 4IIBA 3SSMA 4HMQA 5FUXA 3OEEA 4OUDB 4UW9A 4YRTA 4YREA 3LH5A 4RVDA 2R7AA 4RNCA 1ZA2A 2GRUA 2OY0A 3NR2A 2C8VA 5FOUA 4ZYVA 2FUNB 4XQCA 4N5NA 3ICCA 3EOAI 3FMGA 3IMKA 3OHMA 1DZIA 1UMDB 2VQSA 4IFIA 1CC1S 4JQYA 2UXCB 3P52A 1B23P 3GLFA 2YWDA 4MIKA 4BXOA 1U02A 3DE5X 3ONFA 4Q4JB 2QN1A 2X8BA 3ZZTA 4C4AA 1GAXA 4N0QA 3QPBA 4YP7A 1R6DA 1DIAA 4AYXA 4DLLA 1E9BA 2ASVA 3K0SA 2XR1A 2O3TA 2PUWA 2X0KA 3DE0X 1OFUA 3PQEA 3OICA 5J1TB 3OLQA 3TXAA 3RSGA 4EB6A 3BBLA 4I36A 1HE4A 1GSHA 2QK4A 4QM6A 1FP2A 3PEEA 3PNKA 3ND7A 5ALMA 2GEFA 2WNHA 5LDHA 1KGSA 1IE3A 3EXIB 5J5CA 4K9PA 1FEZA 4OJMX 4X45A 1PD0A 1XZIA 3OM1A 5KHOC 5LR6A 5ALSA 5A05A 1HUQA 2CUZA 2CB0A 1HDXA 4MQMA 3T06B 4N8EA 5K4HA 1XQWA 1JEEA 4XGQA 5KTMA 1E2LA 2DF8A 1P4GA 2IYQA 2J3EA 1PL7A 5BNTA 4WBNF 4KHPB 4ER3A 5H59A 5B3JC 4GWLA 5JD6A 2OV4A 1HFEL 1XXHE 2JGAA 4TMZA 5HQJA 5K3AA 4C2TA 4HDQB 5KTPA 4AF8A 3DZBA 1AURA 3HN6A 1KXZA 3HCCA 1EX1A 2AG8A 4YV1A 3SJ7A 3HSSA 4BNDB 1GXSB 2BR3A 4H6VA 1FLDA 1AG9A 3ILYA 4P22A 1J9GA 3SQNA 2XD4A 1RHJA 3SZOA 3DVRX 4DOMA 1H6CA 3FWPA 2R6CA 2FOIA 2OLKA 2BJWA 3ETJA 4AM8A 1WB6A 4E5DA 5CNIA 4RDCA 5JZ9A 3HTXA 3KXDA 1BWSA 2R8YA 4TTVA 1BVRA 2X15A 4ZVLA 5HDQA 3ZU6A 3CSUA 2R3SA 3JVIA 4DCOA 5C5EA 4UQOA 1SIBE 5AJUA 1TUEA 4JY7A 4OAOA 2XAUA 3ABOB 4N8DA 5CT6A 4PIPA 5DX8A 4K9MA 4XPIB 3ZIDA 1JEQB 2G9RA 2JZCA 2Z5GA 4H0FA 1M6VA 1CR0A 4YECA 3PC3A 1NVUQ 1UFQA 2YS7A 1BXZA 4FR2A 1SB8A 3K35A 3KTAA 1FJ2A 4J76A 3UYKA 1OR8A 2FR8A 3G49A 2QLBA 3NLLA 3TBKA 3B70A 1IEVA 3KZXA 4FNAA 2HQ1A 1QCDA 1WD7A 3THXA 1KRXA 4ZCQA 1EGQA 3N2LA 1EH5A 5JS7A 5K99A 1NBMA 4WK4B 4F38A 1IXRC 4OMUA 3TW6A 3RVPA 3NHLA 1JR2A 5AUOB 2H7YA 3CLUC 4OHXA 2E4YA 4JC4A 5KYUB 1G38A 1GPMA 1EIWA 2C5AA 4E5MA 1I6KA 1ZD2P 3SNKA 2V7WA 2Z6VA 2VHWA 4UNPA 4Z3OA 1NMEA 3N6RA 2OD9A 4G5RA 4BQQA 5C1BA 4NBTA 3EPKA 1Z2AA 2F9MA 2PGIA 3FOBA 5BSVA 5G0WA 2ZYTX 2GFQA 1K97A 1UXKA 1JBEA 1JT9A 1XDWA 2E4WA 2RC6A 1U8EA 1XRJA 2HX1A 3BXGA 2P4SA 4IIVA 2FMXA 4KXFB 4MUGA 1HY3A 2R8XA 5DPMA 1X7WB 1YACA 3P71T 4JMPA 3TQSA 3H2IA 3I4CA 3NO4A 1MVOA 4Q9HA 4NU6A 4ASUD 5AM2A 2UZ4A 4CEIA 2TYSB 2B0CA 4M1WA 5JYEA 3UJ7A 3HB4X 4Y9SA 4MGYR 2JIRA 3GR6A 4RC9A 3WQRA 2P9EA 1SN7A 3S28A 4C4XA 4EUNA 1XL0A 1HDEA 4G9BA 5E9QA 5EIHA 3H1AA 2WDPA 3A28A 4TV9B 5G40A 2AOVA 3W77A 2ZWVA 5F5LA 3M6LA 2XXJA 3O38A 3MYYA 4NF2A 3MMSA 1Y4SA 1ZGHA 3N2NA 2XXBA 1C9MA 3CLRC 1JKIA 1AHHA 2QVCA 4I5GA 3KKOA 2IW1A 3AOGA 3P94A 2YUIA 3W4JA 4MITA 4TS3A 4TLMB 2WKRA 2C04A 2CXTA 2VZ8A 1AY0A 2KB0A 3LC0A 5G3ZA 5AOCA 3OCYA 5JDCC 4PV7A 5IDWA 3OD5A 3ICOA 4M9SA 3LBNA 3R9WA 1Z0IA 2HIMA 3IJEB 1OC4A 3F6PA 4FYYA 4RVFA 2QTMA 1T5BA 4J0GA 3FTQA 3FF1A 4JR1A 5KYTA 4DZZA 1A95A 4PM4A 4EO4A 2IDZA 3CUUA 3L1IA 4FFLA 5NULA 1GZ6A 3KWJA 4BNUA 2DVMA 5K8IA 4G0WA 4GH5A 1XELA 4ER7A 4B4VA 1KAGA 4Y2SA 2HREA 3D8SA 1W47A 4AZ0A 3OZRA 3A2MA 5DGXA 2ILVA 5ALZA 5LP6B 4JGIA 4F3YA 2B6NA 3HXKA 4JENA 4FEAA 1G9XA 1WMBA 2QP4A 4KDCA 4WTOA 3M6AA 2GEVA 1KQOA 2WMOB 2FQXA 3HKDB 4GR4A 5DNVA 4D3SA 3K9BA 2Z2JA 1YRHA 5A7GA 1H9BA 3B7GA 5LMNB 2O8FB 3OPYI 5AUQA 2AX3A 2W2NA 2P68A 1L5GB 5JS1A 2AOWA 4Q34A 1B8NA 1U63A 1YGPA 3EAFA 4MHSA 3BH7A 3ICPA 4GG1A 2GCIA 4PZDA 2ZYVX 3ASVA 2I8LA 1I2AA 3Q7RA 1STOA 3BH6A 2C5BA 3DHEA 4AUKA 3G68A 5LVAA 4H7KA 1URPA 1GYQA 4KE9A 2O57A 1JDBC 3EPPA 1M1YA 4J3NA 2QAGB 5IF9A 4TKMA 3U7HB 2W6QA 2DPXA 2G0AA 4KJXA 3G23A 4KR0A 4RMGA 2UUCB 1EM8A 2BFDA 2VP0A 5K0LA 2XITA 5IANA 3AINA 2HI0A 1HZZC 2YY6A 4JODA 4KLRA 3T9CA 3LFUA 3MHTA 4M0EA 2CN1A 4QUIA 4CM6A 1AGNA 1Q44A 1PWZA 1UQRA 3ODGA 1KYTA 5AIAA 4BLRA 1JEAA 1M1XB 2G5GX 1N2CE 1GTMA 1RVDA 1VJ5A 2ZQZA 3ETCA 3FGZA 4YK7A 5AQEA 1N9KA 3UT5A 2O3SA 1H94A 4U7FA 3NOOA 1Z56C 4B5KA 1BVHA 2AR9A 3F6RA 4WKCA 2NADA 4B87A 5EIXA 1L4NA 4AJNA 3ZDBA 4DSTA 3LRPA 5AI8A 3TI9A 4KN5A 5BVHB 5HGXA 5JAMA 1ZC3A 1TXGA 3B1YA 5K3EA 5M2QA 3IKTA 1Z88A 3W8FA 2F7SA 2J07A 4KKVA 4L0QA 4C22A 2YV5A 4J9UE 1YRWA 3VUEA 3RVQA 3HUFA 3SZGA 1FIUA 5EI5A 2IZ0A 2PT5A 3EXHA 3HB0A 5DHAA 5FADA 5SY4A 3U62A 4DFDA 1RJGA 2VHCA 2YXDA 4HRVA 1JQ3A 3QP9A 1O6FA 4MXDA 1NRJB 1YSCA 3JALA 3UJBA 3VAYA 3WE7A 3HS3A 1E96A 1T0JB 2WTMA 1UINA 3D31A 4MQEA 1ZXXA 2RHBA 4MVYA 2R7LA 4PGGA 4X1KB 1BJTA 1QZZA 2V9CA 2ORIA 3CNBA 1ESZA 3QWAA 2X13A 4PZCA 1OZHA 2GN2A 3C39A 1ZQ1A 1VKRA 3V6MA 3BICA 3Q3GE 3E8XA 3ZHRA 3SFTA 1IZ7A 2CKDA 4CF7A 1EHYA 2Q9UA 2X5JO 3B38A 5KDLA 2VPZA 2WD8A 1H8HA 4ITRC 3ASYA 1A2QA 3ZS8A 3SZLA 2QZ4A 2WFLA 1IN7A 4WFQA 1F1BA 2GCPA 2R2GA 4OQXA 2YHSA 3QMMA 4QQKA 5F4ZA 2X8JA 4WINA 2RKBA 4KCGA 5KIAA 1XZGA 1SHLA 5LP6F 4EIWA 4OXNA 2GZDA 2Y4OA 4LRWA 1JPNA 3H9BA 1BG6A 3O8OA 3LGXA 4CYMA 3PB3A 6CHYA 1I6MA 1DRVA 1VKNA 2PG3A 5EMLA 1ZRNA 1O95C 4JQOA 3EYAA 3NJ8A 3GFFA 1OA1A 1EHIA 1ZISA 4WW0A 3SLRA 5LJLA 4CM9A 1W5BA 2J0QA 4XM2A 5IM4A 5KYYB 4AP6A 3NHWA 1W0CA 5CYGA 3L4BA 4XEHA 2FMIA 1P4RA 3K8OE 4H7DA 3PJEA 2I6QA 3W5JA 4CMEA 3QA3E 3OG9A 4BUJA 3IAAA 4L4RA 1LDBA 2GM5A 3LUDA 1FDUA 4RF2A 5E6UB 3RPEA 3TB6A 1M1NB 4DILA 5SZKB 1AZLA 2OHJA 4XB6B 5CFMA 1GN9A 2QYTA 5B3AA 5CDGA 4LBYA 1U80A 3H5LA 5K0CA 2JAWA 2J4DA 2W58A 4II3A 4UBKA 1M9NA 2FZWA 1FYXA 2GD6A 1YS4A 3KKEA 1FUKA 5K3FA 1CRZA 1N7GA 2DH5A 3QA9A 4Y6QA 1REQA 4QT4A 3UXHA 1H2AS 3I3SR 3PGJA 1CJBA 4D74A 5A4MS 3TZ6A 4E15A 4K03A 4RWZA 1D6JA 4MHTA 4J3FA 2PZLA 5L3SB 5DXAA 3RRNA 3TQQA 4LOIA 1XIVA 3M33A 3I64A 4DLYA 1N57A 4R71A 1FFYA 1FQKA 2VRCD 3E5NA 3LBAA 2YXPX 3AEQA 4M1MA 3DBHA 3NYIA 4YCAA 3TZHA 4DRZA 4E12A 2XADA 3OPXA 4XDYA 2HEIA 1VCOA 2DY1A 3AGPA 1WHSB 4FZJA 1EJBA 2HSGA 4MGIR 4YJ3B 3FDJA 2JIPA 1GAEO 2WSSA 1L5MA 4Y6SA 1Y1SA 3T5BA 1M0TA 2DAPA 3QX7A 1S6YA 1ZZGA 3LI2A 1AQNA 3CTMA 3O8BA 4ETWA 1UJ4A 1X86B 1EVQA 2ETVA 2CV2A 2GN0A 3L6DA 1NVVR 2ZG6A 3R6LA 4YMSA 3RYTC 2SECE 1FNMA 2GBCA 4DR2B 4GX0A 1YMVA 1ZJYA 2BGJA 2QUJA 2X2FA 3ABIA 1EGHA 2BIFA 1V1MA 3QK7A 1JFVA 4WLOA 1J2JA 4C1NA 2Q0XA 3R3XA 4C04A 5FFNA 3P2KA 4FMDF 4Q3NA 4X6UA 3KQHA 4NHOA 2FLKA 1WZCA 1X7XB 4NQRA 5LBUA 2BKLA 2LCFA 3OI7A 4LYDA 1R0KA 3ROEA 3ORHA 3ZY3A 1G8AA 1SUPA 1N0IA 1U6JA 2B3DA 2GZRA 2YOHA 3GVPA 2XMGA 3LT1A 4IIXA 5INTA 3A11A 1G20B 1KHTA 1TLFA 3CUYA 4FW8A 2QRKA 1AA9A 4HYEA 4R01A 5EKXA 1QLHA 3RFVA 3RS7A 4DLPA 5CBPB 2SNIE 3HA3A 4DCJA 1RRVA 4PGAA 3QVGA 5CX1B 3TM5A 2VDLB 2P6PA 4OI0A 3Q40A 1T5TA 1F0YA 3GNTA 4OTZA 4K9LA 4Q3EA 4X3PA 3VTKA 4F1KA 3V33A 3FFBA 4FOTA 2WVHA 3OC6A 1P9RA 2IOFK 2HU7A 3HMQA 3O47A 2XNCA 4IHJF 4ROTA 3AKDA 5J5AA 5IT9A 3FNIA 2IYTA 1IWBB 4AU1A 3BT7A 3ILSA 3GP5A 4ZHSA 4RTJA 3SY8A 2DY0A 1L4EA 3ICEA 3LYHA 4M1EA 3BRCA 3IQFA 3TL2A 3WOVA 4JI2B 4X90A 2NUAB 4CM8B 4BKQA 1QGOA 2VUUA 5FBRB 5JDIA 4RZUA 1PJTA 1SBNE 3JV7A 4BTEA 1Q57A 1OZFA 1KP2A 1PZXA 3BA1A 3RF7A 1F51E 3EH2A 5D6OA 2SICE 4IIJB 1L8LA 1DKRA 1RT9A 2V6JA 2WFZA 4JJIA 4NU8X 4A8HA 5JH7F 1GZ3A 1PFYA 4XYEA 4ZQBA 2REOA 1CIVA 5HUHA 4CMIB 4F3CA 4URUR 3I52A 3TMKA 1G17A 1C1XA 3A6FA 3IB3A 4JJGA 4F04A 4PG7A 2QUZA 1HT0A 2C07A 3M2TA 2PSJA 1VHJA 4RMHA 5SV2A 3CEAA 4D4KA 5IU6A 2REQA 5HIKA 4JBNA 5A4JA 3EXEA 3CF0A 5D3MA 4D0NA 1HNWB 3WNZA 5L3QA 3ZDCA 4HNHA 4DTCA 3PLAE 1FUEA 2ODPA 4R9VA 2P2DA 4DG8A 2IU3A 2IVZA 4C6HA 4MQ5A 3DMGA 2H92A 4FDMA 2R86A 1YL5A 3T7DA 5I7UA 3OCXA 4RE6A 4K6KA 4ESVA 3LIIA 1NP3A 2QTVB 3FUVA 1QVRA 4R68A 4V38A 4M36A 4DUGD 2C1XA 2LW7A 5DWQA 4E5YA 4ARCA 3UV3A 4R1MA 3OO1A 5BV2P 5HKBA 4D2IA 1I94B 2QV0A 5JCJA 1L5SA 2IUUA 2D1RA 2YZNA 5FB3A 2HMTA 4PW0A 3T1NA 2I34A 1HNNA 3KU1A 3K32A 2FKAA 1E4YA 1U0OC 1YKGA 1JNYA 2GO1A 2H31A 4S1VA 5K4AA 5CVTA 3GUZA 4WZZA 1K98A 4HAYA 1KTIA 3EK2A 1B73A 5C31A 4H59A 3CBQA 2AC7A 2CXHA 3IP9A 4KXUA 2OHVA 4OL0A 4E3WA 4Q7QA 4CF5A 3SEFA 3ETNA 1M74A 1C0EA 3SX2A 3VU8A 3LNTA 4U7WA 2RHLA 3ZLVA 3UB2A 3S99A 1KKLA 3L06A 4WOJA 3T34A 2W6ID 1PVVA 4AMBA 1T0IA 3N86A 3FYUC 4BB0A 4Q4DA 2IYEA 2VHYA 1GPKA 4RV4A 3RNOA 2XE8A 1XZBA 1WB9A 5CM2Z 1DKUA 2D5CA 4HLUA 4K8RB 1NZJA 1UBGA 3UK6A 2ZCJA 1VJCA 3O94A 5IYZA 5BQXA 5ICEA 2ZIGA 5BSTA 1MCZA 1QKJA 5CEJA 2PGDA 4JMLA 3ZE1B 5U9CA 1DWOA 3OHPA 4OHFA 4BNXA 5DM1A 4E5SA 2W0SA 1PQUA 2B30A 2PH7A 3DUWA 3LXXA 5DYYA 3UMFA 4X64B 5HKOA 1E5QA 5F9HA 1SH7A 1SOVA 2ZI4A 1SXJC 4MVJF 4N40A 4M53A 1Z2CA 2C4WA 3ZGNA 2P2ZA 3PV0A 1F1JA 5AJWA 2WIJA 3TQFA 3UQYS 3T52A 4D98A 5A03A 2OFWA 1CQJB 4B44A 1IY2A 3L41A 2ZQYA 4I5DA 3VHXA 5AW4A 3SZRA 4C0AC 3UPUA 1SUDA 4B6FA 4X62B 4WASA 5LBTA 2CV1A 1XZ8A 3RTBA 5LM3A 4JKIA 1EUDB 3DNMA 4HI0E 1NBHA 1NVBA 2QX7A 4R1SA 3WYBA 2CLDX 2WE7A 1Q0QA 4XJXA 1RCFA 3HYTA 2GJ8A 1SXGA 4H3KB 4MYSA 4LFBB 4WWHA 1KERA 2VG8A 1AIPA 2Y27A 3DO6A 2ZCUA 3AM3A 4PF1A 3QEMA 2A1UA 2PKQO 3BK7A 2Q07A 4KGDA 2BDUA 4MA4A 1E3IA 2GPBA 1B7GO 3TL3A 3I9LA 2Q8QA 1QH1B 4LSGA 1X0XA 2Y68A 2HK6A 2B34A 1U3GA 4JI6B 4DUYB 2IPAB 2YJ3A 3RUAA 1L5FA 4KAJA 4W1RA 1Q19A 1U90A 2BC9A 5EINA 3AEKA 5EZ6B 2BCEA 3OE4A 2BGKA 4F6RA 1EUQA 1JMYA 3GGDA 4A03A 2G25A 4E4TA 4NOLA 3UTDA 4Q1EA 2FLWA 5E3IA 1EB8A 3KO8A 4AWAA 2BUCA 4RZHA 5J4KA 1W48A 5CLGA 2IBTA 3AONB 3D64A 1N9GA 3CKKA 3H97A 3OCZA 1Z13A 3RVSA 1GRVA 3WLTA 4HDMB 2F3RA 3HBFA 3VDRA 3OJWA 3G1UA 1W85B 1RS0A 2MYPA 2QI9F 4YT5A 5M34A 2C9OA 2IUEA 4MKIA 3A0UA 3Q7IA 1M1UA 1U0LA 2B1JA 2H2WA 1X7YB 3QXHA 4HB3A 1KH2A 4RORA 3H2SA 4TMFA 4QAJA 1E1LA 2JLUA 1GV0A 1QOZA 2RGUA 3WXMA 1A4UA 2MSKA 2XIQA 2ZJ8A 1Z82A 2X77A 2Z2IA 4HY3A 4IIYA 4PC1A 2OAGA 5G1PA 2EP7A 2HU2A 3N8HA 3OPMA 3EDMA 1PZEA 1TM7E 4QOEA 4AY3A 1HFJA 3UM9A 1XYVA 2XZOA 3GLIE 4X3CA 3Q88A 5CA1F 3CISA 4HJXA 2FEPA 3A1DA 3D1VA 3T3IA 1R0LA 1QAQA 3WJ7A 3C5VA 1ORHA 2J9RA 4JLNA 4KGXA 2PUFA 1S5PA 1WY7A 4Q93A 2IHNA 3WJ2A 4HH3C 3FKQA 3JY6A 3VNRA 4BMDA 1SUWA 2W70A 5IC5A 3T1YB 3M6WA 3PI6A 1P1FA 1Z4PX 3JWIA 3LBFA 4DN6A 2NXCA 4OQMA 4QOJA 3TAUA 3I2HA 3ZDFA 4BYGA 3EHDA 3AERA 1N33B 2FA9A 4P7JA 5EIFA 3CNOA 4DLXA 3CM0A 5FI3A 2FQQA 1E2BA 4HADA 1MG0A 3M1IA 3NNDA 5IASA 2DLDA 3I9JA 2JGIA 1NR7A 3GGCA 5CXXA 5C4GB 1AXRA 4MLCA 3F78A 1P0MA 1RQ2A 5TY0A 1KE2A 3RT7A 3JVDA 4HXFB 4U8GA 5IXJA 2PKXA 3LT4A 4B4OA 1ZIDA 4KPEC 3T9AA 1ZIYA 3OU7A 4Y6LA 2W6OA 4AMVA 1A8UA 5TF0A 3M6IA 3W06A 4C07A 4E30A 3R0JA 1J8MF 2JA1A 1K06A 1SK9A 4YRRA 4CUKA 4MMZB 5KVCA 3CURA 4IY1A 4RLHA 3B20A 1BMTA 3AUAA 4ZEOA 2YIDA 2R5WA 4ALLA 2JZOA 2WSIA 5BT9A 1K5DA 1YVUA 2XDQA 1X2EA 1PNRA 5AVVA 4E2XA 3SYMA 1WHTB 3T5AA 3REFA 3ZLTA 5KDOA 3O26A 2XQJA 2VSXA 3ILVA 1JF8A 2HHLA 5ER9A 1E3EA 1ZUD1 1LTQA 4KFTA 1OIXA 3P2MA 1JI0A 5DBEX 5DBGA 1ZUIA 1U2ZA 1PVDA 2GB4A 4WVLA 2GCGA 3V46A 5F23A 3D0OA 3SHTA 3LBYA 2PD4A 4GKBA 5B4VA 3SYNA 3ZX4A 4KXWA 3QXGA 1JHVA 4M7WA 2XDAA 4KAAA 3TQRA 1ZUWA 4O4HB 3CN7A 3MCVA 4YAEA 1FLNA 3IDZA 4ARVA 2D00A 1P0FA 4JYAB 2JFWA 3PVCA 4CL8A 3KQKA 1WBBA 3PXGA 3DDUA 3E9YA 1WETA 1K1EA 1GTZA 1JJFA 1WXDA 1ZVKA 2VTVA 3A3OA 2FEXA 4GICA 2OILA 4O2RA 4S1NA 5ILGA 5DTRA 3TD9A 2C4VA 1GCAA 3AKEA 3K1ZA 4NFLA 3SCZA 1OAOA 2PTGA 3G17A 1IG3A 4UUPA 4DLAA 3WTBA 2Q5QA 3QBDA 5K8CA 3CVXA 3ROZA 2F9LA 3EF0A 5BP7A 4LYAA 3GUUA 4CKCB 4BMOB 5IXSA 1UJNA 1MABB 2ZIAA 4DJFC 3U17A 1DV1A 3K1JA 2R5NA 1TGYA 1WLYA 4BLTA 5LB2A 1IJFA 5EKDA 2OHIA 1PFWA 2ZUFA 2B98A 1CVIA 3B89A 4FOPA 5JZVA 2OC9A 4LS3A 4UTNA 2NU7B 1MAHA 4YN3A 2DG2A 1NGSA 3F74A 1GAQA 1LF5A 1L5VA 2HA3A 4PFJA 4UU7A 1E2MA 1TU3A 2CDCA 4EY7A 4BNNA 4KAFA 1QK4A 4G4IA 3TNJA 1JEDA 4CGZA 2PYIA 4NS4A 4QOIA 3ZJTA 1XCPA 4FINA 2C92A 3OZCA 1U1EA 4D43A 1LDMA 2Y1DA 3DONA 5FBQB 3JRWA 2VHZA 2NX2A 3PUYA 3QU7A 2ZZKA 5A5GA 5LOVB 3QEJA 1HX7A 1SXQA 3GT7A 4ZOQI 1IQUA 2AZ4A 1Y1QA 2WG1A 1NI3A 4H3SA 4NJMB 1Z6QA 3QBTA 3PRHA 4FXPA 2B20A 4HNAA 1YCGA 3U2QA 2FN7A 4RTRA 5D2CA 2XB6A 1OGJA 3FDFA 4H16A 4Z99A 5TS2A 5BSHA 3BDAA 1U3TA 2VDWA 2XB4A 1F5NA 4JVMA 5DIFA 4C7OB 3QHAA 4OKNA 2WWRA 2AYZA 4C0LA 2YVUA 2XT6A 4G0YA 4ZOCA 1ZUNB 2V97A 2AFRA 2VYNA 5ITZB 1SD5A 3NTLA 1ZM2A 4DW8A 4EW2A 1Y4ZA 1I24A 4Y2QA 4KXVA 4O5AA 2A59A 2UYHA 1TVKB 2YV3A 2Q6LA 4J29A 3CUWA 1MIHA 2WM3A 1UBHS 2OZPA 7ADHA 1CPYA 1QM5A 1UP6A 2Q5LA 1ESNA 2DUMA 1LQTA 2OFXA 1ZN9A 2XE4A 3AHIA 3PIRA 4LE0A 3B51X 3FFAA 5A3VA 3ODPA 4MHOA 2ZBPA 3N2KA 4PINA 4A23A 4DLBA 1VC2A 3AILA 2H9IA 3OUUA 3GUYA 1NBAA 3L18A 4UULA 4XD7A 3HDTA 1TLLA 5CM8B 4GQAA 1N2SA 4F5WA 1T9HA 3F1KA 4QNMA 4NULA 4RXUA 4W8HA 4ZA2A 2YFHA 4K6GA 1HOXA 4I1OA 3UCXA 2DYKA 4CIBA 2JNWA 3E1GA 4N0EA 1T9AA 4O4HF 3KG2A 1RM4A 3D3WB 1PSZA 4KW7A 2OXCA 4ZI3A 2BGGA 1DCMA 1SJ9A 5KTSA 2VJMB 10MHA 2TMKA 2PT9A 3OD1A 3PE4A 5I3CA 1U2RA 2OV6A 4YRGA 3CGGA 3N70A 5DT9A 3U26A 4AQDA 4EF5A 2XBMA 4P3KA 3BREA 2H1SA 3OWXA 2FMHA 1EZ1A 3H18A 2VP6A 4KQHA 2XZLA 1KJNA 2ZUBA 4GVLA 4CKEB 3AESB 2ATCA 1BE1A 1GL7A 4HQNA 1UADA 5A6SB 2E4UA 2NU6A 4FFVA 1XF9A 3IVRA 4J16C 4MJ3A 1X8XA 1YRBA 4QICA 1X6VA 4UM5A 5AM5A 1NXPA 3H87A 3WKAA 4BNKA 1CF9A 2YN0A 3HRHA 2PUEA 3PFFA 1TRHA 4GOXA 4GI1A 3MOIA 3JYQA 3ZD7A 1A76A 2ODBA 3DPIA 3Q7EA 1BWPA 1HE2A 3HC7A 4I2NA 2ZSIA 1R0YA 4OY3A 1EVEA 2DFVA 4FQ8A 1NJFA 4RF4A 4UXJA 3IR7A 4CFZA 4D5GA 2IV2X 5JSQA 5T8KC 2DQZA 3CNHA 4GMKA 1NVVQ 3H9UA 5HF9A 4PR3A 2IA5A 2PJRA 1PTKA 4TXLA 3MJCA 1AKEA 1PFVA 5FBKA 1E3JA 2X9LA 5DNDA 1QWSA 3NHBA 2JGKA 4F72A 2I76A 4PXSA 3RGGA 4UFNA 3GD5A 2P9JA 3V4ZA 3SJAA 2C2OA 1XEAA 1Z7WA 1K6XA 3NDPA 1MJNA 1W88B 2E4ZA 3HBAA 3OA0A 4GXNA 2F17A 4BNMA 1HTWA 3F6BX 3M9LA 2P2YA 3MYRA 3KSBC 2IZ6A 2FUG6 4UBIA 4E94A 2HHJA 5AJHA 5ILQA 2ZKIA 3OESA 3P0EA 4DYVA 3ITDA 1QVWA 1Z0DA 2RONA 5ITSA 5EP4A 3WDLA 4G0VA 2YASA 1GL3A 1KZ7B 3GG9A 4TXMA 3B2NA 4JL5A 1RHMA 1IATA 4BB6A 3U0BA 3HYRA 2Q2VA 4YRDA 4J0EA 1MJGM 4KNWA 4QBGB 1VGQA 3AHGA 1JEYA 1V7PC 3RC8A 3C3BA 2MIIA 1C9NA 4ARZB 4H7HA 1APBA 1LBSA 2ZBVA 4KQ2A 1CZKA 3CLTD 3F5DA 4MSUA 2J4CA 5KJEA 4YAIA 1J5EB 1BX1A 1FVFA 1FMFA 3CLSD 1W4LA 2FZVA 2UZ1A 1E64A 1R4MB 3A3YA 3JS5A 3MCUA 3TTWA 1QP7A 5FCDA 3U4DA 2F4VB 1LZKA 1FFXA 1JQAA 4C2UA 3ONDA 3NP7A 3V1TC 2E85A 4JBGA 2GCNA 4HQRA 3UHFA 1OH8A 2DU8A 1Q2XA 2AN3A 4AO6A 4AJJA 3HVUA 5ICSA 1MIOB 1E9AA 2N0SA 5FO0A 3AKCA 5JCOC 3KL4A 2Q21A 1VG1A 1ZOIA 4I9HA 2ZVDA 3OLWA 3QOWA 4YR9A 1DNPA 3ZV3A 4ZICA 1PWXA 3NTOA 3VZQA 4G1VA 2C7PA 3UJHA 2FPWA 1G7TA 3M5PA 3GW8A 3WZMA 4ZRMA 2QXTA 4QTUB 2BJHA 1BEEA 3DEAA 4ZK6A 3RI3A 1GCUA 3C5WP 3EAQA 3M6MD 2NNWB 1C9KA 1HT3A 2RGAA 3PFKA 1VBFA 1YKSA 2NNLD 2W6JD 4RA9B 1SBZA 4FFBB 2D13A 1N7HA 2MDTA 2W8ZA 1DX4A 2KWIA 5EWMB 4POOA 4B3MB 3FPBA 1B42A 3KUKA 4ZCMA 1W76A 1U9IC 2C2YA 2GWRA 4UBLA 4BFYA 5AW1A 3ZDDA 3KLOA 3VR3D 2C5LA 3Q8WA 4IV8A 4YRFA 1E66A 2VNJA 4UFPA 4Z6KA 5AW2A 3SBOA 5KYXB 4EMUA 3KJIA 4NOMA 3ZZ1A 4ZHQB 1D2MA 1NSYA 5HP4A 4D1YA 3F8SA 3FZEA 5AHOA 3RIEA 1XGKA 2BLNA 5C1IA 3WGIA 2Q6VA 1WX1A 1I0LA 5AM3A 1WZEA 3BERA 4ALJA 1UAYA 5BR1A 1JB1A 3L0CA 1WPGA 1E32A 1F4PA 4PO1A 1GD1O 1I36A 2GPWA 2XD9A 4IRXA 4OP2A 3S2IA 3K2BA 3NM4A 1TVMA 5B4UA 2Z9DA 4EHDA 4MV9A 4D9BA 2VQ6A 1Z0FA 1K8ZB 3EARA 3VSAA 5DYIA 4MV0A 2XW6A 3FAKA 4AG3A 2NU9A 3JVUA 1WABA 2GNPA 3T4UA 4GZ6A 4S2EA 5ARCA 1G0NA 5TEVA 3ANSA 4EYEA 2G17A 5LKRA 5E6RB 5HIIA 5A4FS 1NN3A 2YHUA 3RV4A 1MO3A 1EDEA 1XDDA 1YS6A 4OM7A 1Q7CA 2VZLA 1ONNA 2GO7A 1EQ2A 2PAAA 4PNPA 5KBYA 4ENQA 3RABA 4TOIA 4LQCA 2Z2KA 4MVJD 4H4CA 4N48A 1Q84A 2JHFA 2W90A 2GAIA 1KGDA 3NB0A 3EG9A 3U3XA 2ZBFA 3NVAA 1L7EA 4BN5A 8OHMA 1P62B 1X7DA 3UPTA 4BNWA 4AJ4A 1D1SA 1DEHA 4M1KA 3WK5A 2JFYA 5JG7A 3HGMA 3PQCA 4Y0NA 5ERXA 4HDCA 1BZYA 2FRDC 2LBPA 2VNHA 4HUQA 4I1UA 3TQOA 3UUWA 1RZRD 3SF0A 2GM4A 4TQAA 5FA6A 5LXTF 4IILA 1IL0A 1ZCFA 1HYBA 2E4AA 5KJFA 5TRTA 2G8LA 2EJWA 5IAAA 1W4ZA 3P9SA 3H9CA 4ZT2A 3CCFA 2JH9A 5K3CA 2VTBB 5J47A 1XVLA 4J8PA 5EIBC 4JXXA 2PS0A 2OK8A 1V7CA 4WADA 2PIDA 1DG9A 2Q3HA 2ID7A 3I1YA 1ZG3A 3K09C 5JPDA 2JLXA 4QUGA 3ZWWA 2G82A 3E3NA 4J91A 4UEJA 5GZ6A 5HK8A 1Q77A 3S44A 1ZVVA 1IB6A 1T9BA 3C48A 4LKRA 4FEGA 1EG7A 5FLKA 2FZLA 2HWYA 2ZAGA 4IXWA 2IP4A 4W63A 4AXXA 1OH7A 4MVJH 4CGYA 2YKGA 1G21B 2YZMA 3OZVA 3REOA 1O94D 4RVHA 5AVOA 3D7LA 1ITZA 1RWVA 3KSAC 4S3MA 1EFRA 1NN1A 2VPPA 4FLEA 4GPD1 3S8MA 4B73A 3H4TA 1NIJA 2ANCA 4N39A 1Z7BA 4EQ6B 3HGTA 4H7EA 3DMTA 2ONYA 4PZUA 3VKVA 1X1CA 2M6SA 4D9JA 2I80A 5J40A 3AR4A 3OQMA 3JWJA 2QVZX 3TUIC 4D57A 2GCOB 4IDNA 4ZHQF 2J5RA 3WP0A 4F2WA 4XYBA 3AC0A 1Q7BA 5AM4A 3VPFA 1J90A