3VV3A

Crystal structure of deseasin mcp-01 from pseudoalteromonas sp. sm9913
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
329
structure length
329
Chain Sequence
SATNDPRFDDLWGLNNEGQTGGTADADIDAPEAWSISTGSRDVVVGVIDTGVDYSHPDLAANAWVNSGEIAGDGIDNDGNGYIDDVHGINAITDVGDPMDDEGHGTHVSGTIGASGNNGVGVVGVNHDVSIVGCKFLAADGTGSTSGAIKCIDYMVGLKNAGVNLRVLNNSWGGGGFSQALADAITASEQADILFVAAAGNDAVDNDQNPHYPSNYENDNVLSIASTDSRDNMSSFSQWGLTSVDMGAPGSGILSTVPGNSYATYSGTSMATPHVAGAAALVLSVNPDLTTLELKELLMSSGDANAALNGKTVAGTRLNVNQALIDADP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Deseasin MCP-01
publication title Structural Insights into the Collagen-degradation by the Bacterial Collagenolytic Serine Proteases in the Subtilase Family
rcsb
source organism Pseudoalteromonas sp.
molecule tags Hydrolase
total genus 124
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3vv3A00
1SCAA 3GT3A 2Z56A 3D43A 3T41A 3UNXA 4GI3A 4CG0A 1TM5E 2Z2YA 1MPTA 2ID8A 1WSDA 3WHIA 1EA7A 3Q40A 1TM3E 1C3LA 2PKCA 1Y48E 1SIOA 1YJAA 4I0WB 1P7WA 1SH7A 3TI9A 1C9MA 5ARCA 5JMOA 3WIUA 1Y4AE 1OYOA 2W2NA 3LPCA 3CO0S 2PWBA 3AJ9A 1SCNE 2P4EA 4WOCA 1PEKE 1UBNA 5AQEA 2ID4A 3QTLA 4YN3A 2ZWPA 1SCBA 3BPSA 2HPZA 2Z30A 5FBZA 3DVQX 3ZXYA 1SUAA 5FAXA 4JP8A 4DZTA 3AJ8A 3VV2A 1P8JA 1GNVA 3DVRX 1AF4A 3I2YX 1BJRE 4BWGA 1R64A 1V6CA 5ARBA 1TM7E 4CFYA 5SICE 1AK9A 4DWWA 2Z58A 4FONA 2WWTA 3QFHA 1Y3CE 1GA4A 3L1KA 1XF1A 3ZXXA 4HX2A 2IY9A 3HJRA 1SPBS 2XRMA 4Z2AA 2WV7A 1ST3A 3TECE 3VV3A 4OV6B 1GA1A 1PTKA 3LPDA 1AV7A 1T1EA 1WMEA 5AMXA 2W2OA 1PFGA 1V5IA 4NE9A 4KPGA 2IXTA 1SBCA 3EDYA 2PMWB 4LVOA 1KE2A 5JXJA 3SQOA 1SBTA 2TECE 3BX1A 1OYVA 2DUJA 1DUIA 1SIUA 2Z57A 1C9NA 1THMA 1CSEE 5CW1A 1HT3A 5ARDA 1T1GA 3SICE 1IC6A 3F49S 1R0RE 5AVKA 3DWEX 2GKOA 2W2QA 1AVTA 4LVNA 1ST2A 2ST1A 4AKSA 1T1IA 2PYZA 1SIBE 1MEEA 1PJ8A 1GTJ1 1YU6A 1SUDA 3D9QX 3F7OA 2SECE 3EE6A 2W2MA 2HD4A 5I9SA 4HVLA 3GCWA 1BFKA 2PRKA 1WVMA 5JXGA 1GA6A 1TO1E 4OMDA 1SUPA 2PQ2A 1S02A 4C3VA 3DDZX 1NDUA 3DE5X 3DW1X 1Y1KE 3DE0X 4K8RB 1SUCA 1GTG1 2DQKA 1SELA 1AH2A 3GCXA 1NDQA 4J94A 3DYBA 1SBIA 2X8JB 1KE1A 1AU9A 3A3PA 4NMXB 2W2PA 1BE8A 1LW6E 1NLUA 1WMDA 5JXHA 1Y34E 3PRKE 1SBNE 3F7MA 1Q5PA 2DP4E 5AVJA 2XTJA 2WUVA 1BFUA 3P5BA 3VHQA 1Y3BE 2WUWE 3H42B 3CNQS 2SBTA 1ZVJA 2QTWB 3OSZA 2E1PA 3DE1X 1VSBA 1A2QA 1DBIA 1WMFA 4CFZA 1IAVA 2V8BA 1TK2A 1SUBA 1C9JA 3DE3X 3VSBA 1S2NA 4KG7A 4H6VA 1SCDA 3DW3X 3BGOS 2SICE 1EGQA 4ZOQI 2ZWOA 1Y3DE 3PTLA 1JEAA 1OT5A 2X8JA 3LPAA 3I37X 3GT4A 2SNIE 1YJCA 1Y3FE 1TM4E 3QMPA 1TO2E 4ZARA 4AKTA 3DE7X 1SBHA 3A3OA 3DE6X 4H6WA 5K7SA 1SN7A 1TECE 3WIVA 3LXUX 2G4VA 3I34X 2PWAA 3DE4X 1AQNA 1BH6A 4M1ZA 3Q5GA 1KDVA 1P7VA 1SVNA 3VYVA 2ZRQA 5B1DA 1TM1E 1CNMA 1GNSA 1S01A 4OMCA 1KDYA 4RYDA 1TMGE 1GTL1 3DVSX 2B6NA 1Y4DE 1GT91 1R6VA 4H6XA 4WOBA 4DJ5X 1BE6A 1Y33E 3VTAA 4MZDA 3AFGA 1Y9ZA 3I30X 4NE7A 1SCJA 1YJBA 4B5LA 5JXIA 2Z2XA 2Z2ZA 1SUEA 4KB5A 3WQBA 1GCIA 3DE2X 1ZVKA 5FFNA 3TI7A 1KDZA 3A3NA 4C3UA 3EIFA 5B1EA
chains in the Genus database with same CATH superfamily
4GU5A 2QTMA 3WGJA 1C8LA 3JD2A 1B0AA 3H75A 3QE0A 1SK9A 3T41A 2P3SA 4KR6A 3O82A 4QJBA 1HDZA 1Z38A 4YONB 2JIQA 3KU1A 2G36A 5CPBA 1G66A 2NAFA 1K7EB 3ZD8A 3SC2B 5G0TA 1J90A 3ES9A 2XE4A 1HZZA 2DPYA 5FPPA 5KS2A 1MC4A 1KMQA 3AY7A 1XPRA 3MERA 4BPBA 2HUPA 4X44A 1JZQA 5EFZA 1CF2O 4TV9B 1RWQA 3EZLA 2CUZA 7ADHA 4PC3A 3D0OA 4EVSA 5MFZA 2DJIA 3WFIA 3TW6A 2C7VA 5LNK1 4LK2A 1NR1A 3ETNA 1T3HA 3AEUA 1QRAA 3NETA 3NJ8A 1H0RA 2H07A 2V7BA 2W58A 1Y8RA 3GUZA 2WYIA 4PSAA 1WB9A 1USKA 1I1QB 2R00A 3AF3A 4IHJF 1ODLA 2FPPB 5CIWA 2Q1XA 4JWTA 1YFZA 4ALMA 2GETA 2D3TA 1QUFA 3DXYA 3EVBA 5KOYA 2MSWA 3O84A 1NJGA 1SFRA 5MDHA 2AYYA 3LBHA 4MW0A 3Q72A 1P9WA 4OPMA 4YBRA 4B6JA 3DV9A 4RJLA 4BMCA 1D0SA 1OYOA 3KJFA 1Y7LA 1H9AA 1TYDE 1PVDA 3ZZ1A 4WWHA 4JVNA 1X8JA 2BGNA 4FHEA 5CFLA 2HMSA 4UJ3A 5JD4A 1QKIA 4II3A 2ZXEA 3FVRA 3GA0A 1UXKA 1G63A 2FOXA 4QULA 2VWQA 1KA9H 1WDMA 2O0LA 4E15A 2IYLD 1KOFA 1AOXA 3GRFA 1QP0A 1F2TA 4QDTA 1VI6A 2X7HA 1K4YA 2CHVA 3RJZA 1BXRA 1NFQA 1YB6A 4IOKA 3OC6A 1PG5A 4TVOA 1MZVA 2ODAA 3ADOA 2PS9A 4Q4JB 1OIVA 1NA5A 3VOSA 2V54A 3G0HA 3PT5A 4MVJI 3NYIA 3AIMA 1TGVA 4K2AA 3CZRA 5I4KA 4KU4A 4NHEA 1VKRA 3P5SA 4WLEA 3IIKA 4MZXA 5E4YA 1JEJA 2HRRA 2J9FA 1MABB 3WJ2A 3DA8A 1KAOA 1P91A 5CXSA 3GDFA 5AKIA 1W9HA 4CV2A 2FGKA 3DBRA 1V7PC 2QD4A 2O50A 3MTQA 4UVEA 4KPFC 3V9AA 2BGGA 3OLXA 1CUHA 5D3ZA 4FHGA 1DL5A 2VDNB 4MWDA 3EC1A 1GG5A 3CRRA 5FYQA 3VKHA 1LS1A 2G1UA 4WXHA 5MGBA 1S6YA 3GZNB 1DV1A 2LV8A 2XCUA 1S7GA 4AECA 4DC0A 3CRW1 3ETEA 5JZSA 2EZTA 5FXMA 4GMXA 4X7MA 4C4XA 2Z4SA 1BWSA 1SB9A 2EU8A 1KZ4A 2FFJA 4MITA 1ZLYA 3RS3A 2VWPA 2Y8EA 1U28A 4LYJA 4UUPA 2C7OA 2IS6A 5EIEA 1NTRA 1ZR2A 3VU0A 4FONA 2I67A 5D6OA 3THWB 3HRIA 4K8OA 1U1CA 1FX1A 2VSNA 2ZS7A 5JAHA 4EVQA 1GLNA 3DVAB 4ECAA 1XR3A 5EMLA 4XUEA 3ZE6A 2WSYB 3KUXA 1JKFA 4PG5A 3P26A 3U44A 4RTPA 3AK4A 2GHQA 5K1ZA 3WVNA 1IZ0A 4IXMA 1WTCA 3N5KA 2R1VB 4GI2A 4PWZA 2HHHB 2E5LB 1G8HA 1MJGM 2H65A 4EKDA 1YZKA 1QH1B 3L07A 3LP5A 4KUEA 4IDOA 5T5QA 5BT9A 3W8EA 4ZEVA 4G2TA 2VPPA 4MPPA 4XM1A 2R6AA 4G4SP 5D2CA 4KN6A 2P9ZA 2O52A 4G9GA 2D4HA 1BCRA 4YUYA 5DM70 3K0KA 4J9UE 5IMBA 2VJYA 3KPYA 1JTEA 1E5TA 4MW6A 1NQOA 1DKRA 1WHTB 2HTFA 3GMSA 4RVHA 1JMYA 2FR8C 4TKZA 1O1YA 1Z2AA 4W5TA 4BKMA 2IHVA 4BLQA 4FK8A 4OJKA 5DHRA 1PYDA 2HHJA 3F5QA 5C5CA 1CB7A 1CZUA 1GNPA 3OEHD 1CUGA 1L3CA 1RLOA 4MQFA 5K05A 1EX9A 4IX1A 1RZUA 2CL7X 3LT1A 1JBEA 1P44A 3FCOA 4NYJQ 3T3EA 1ZH6A 4KMMA 1DIOB 2RKBA 3FE2A 3UMBA 4F2WA 2PT5A 2GYWA 3AF0A 1N8SA 1QO7A 3K8ZA 4A0SA 4BZZA 1ZIPA 4Z3OA 4KPGA 1XHEA 4GFDA 5GGXA 1WQ1R 5C1OA 1JUDA 1GAXA 1SBCA 3UMSA 3ZW8A 1J0EA 1S2LA 3IPAA 4RK6A 3GEIA 3DQZA 2ETXA 2PMWB 4GX0A 2JJMA 4ZALA 4DXHA 3WLLA 2O0KA 3EVNA 4D0GA 3M34A 1B8VA 2V3VA 2ZAMA 1C0EA 5D00A 4QBHA 3TE7A 4K81B 5BSEA 1W46A 2HZBA 4J0HA 3QLUA 4Y1RA 3N0VA 3SR0A 4YY3B 5BN5B 2VHEA 3GRYA 3R0XA 4UAVA 4YV7A 2ODWA 3KKQA 4GNRA 2IY8A 5BR8B 2VUHB 2DLCX 1WIWA 3TEJA 3AERB 4DT1B 3TG8A 2P69A 3KQMA 4CN8A 5B12A 3KAQA 2Z2KA 3EHEA 1PWZA 5FH9A 1IN6A 2Q8NA 1HQKA 1V6AA 2A4MA 5TGDA 3MCTA 5EE1A 2P67A 3WLSA 1JPVA 5ETJA 3ZV6A 1NLYA 4IIJB 1NVXQ 4AYWA 4TN5A 1U80A 1ZG3A 2IU6A 5FADA 1VL6A 4B76A 4HLNA 1FVOA 1MVOA 3BD7A 1Z5OA 1EFPB 3FWZA 5AYVA 4MUKA 4BVKA 5C51B 1KTVA 3GJYA 3NHKA 3VJKA 2CMDA 2PBFA 2QNRA 4O4JA 3V8QA 4E5NA 2I0FA 3SHFA 2XF2A 1MEEA 2QIPA 4XFKA 3V4VB 1IB0A 2NX2A 2Q7XA 5L45A 3QWAA 1DTSA 4ZO9A 1NTOA 2OXTA 1O89A 3S40A 3ZCVA 5LD2C 1LDYA 3OEEA 5CU7A 2V5UA 1NN3A 1TE2A 2PBLA 3PA8A 4BZWA 2FQWA 5G41A 5IU6A 2GH1A 4CEIA 3GP5A 5JS1A 5DM1A 1PJ8A 1V7ZA 1E3WA 1IAQA 2J3HA 3LWDA 2ET6A 3NTOA 4XPIA 3RS2A 4AUEA 3FCAA 3TVTA 2J3DA 3Q2IA 2MINA 1ZRMA 1AUOA 2EJTA 2JZNA 3BXOA 2BMWA 3CRQA 1CUBA 3IOEA 3KVNA 3M2PA 2Q3BA 2Y1OA 4BFCA 4HVAA 1Z4KA 3BBLA 3NDPA 1C3JA 4CLEA 4Q9KA 1K7XB 1HDGO 3S1SA 5J2UB 1EVEA 3HCRA 1WVMA 4LXIA 3NHAA 4C05A 1Y81A 1B0UA 1KK1A 1OXSC 1R6UA 2G63A 2LUOA 2A1TR 2TMDA 1UK6A 2WD8A 1JQJC 2R1TA 3MJSA 4P7BA 4WFIA 3RVBA 4JWKA 3HXOA 3M3HA 4DJAA 4J76A 4JLUA 3C74A 2P2SA 1NZJA 2OQRA 1VPEA 2WJWA 4LS3A 1OAKA 4UE2A 3P71T 3I04A 1IUOA 1HY3A 1R6AA 1V1MB 1X0XA 2PKYX 3E70C 4IS2A 1W1UA 2W2XA 5JV5A 5M29A 1BOOA 1Z82A 1D09A 3C43A 4RIHA 3GVCA 2YASA 2VT6A 5HA5A 4D41A 4D80A 2WFLA 4KEAA 5D1HA 2VPZA 3RGWS 5CFMA 4HYQA 4QC2A 3B9BA 5E1DA 3TCXB 4BV3A 1UAAA 2ZJAA 4GH5A 1SBIA 3FMIA 4JU8A 4B0OA 4YCCA 4DR7B 4KREA 1OH6A 4RV9A 1W73A 3SC6A 3QEOA 2LDXA 4PU0A 1H0HA 4EGFA 1G6OA 2PFGA 4DQDA 3WXMA 2QD2A 2O8CA 6NULA 3F46A 3OZDA 4PS0A 1V26A 4CMHA 3JZIA 4DR3B 2G08A 2W6JD 3MOIA 4LTDA 5ELXA 1DTWA 2FN9A 2UVPB 4QHTA 1WU8A 2OGSA 3I8SA 2WKSA 4IIFA 2N9UA 4KFRA 2Q5JA 4D6XA 4IL5A 2NUAB 2I6XA 1EFCA 3OX3A 1Z75A 3K4PA 1TA4A 1XXHA 4HFJA 1FRZA 2MSDB 4MW4A 3PRKE 4EGQA 1M6YA 2QN7A 4S1WA 4CMIB 3J7TA 1PT5A 3NVAA 2CLKB 1K86A 3ZD9A 2DP4E 1Z7WA 2BBWA 3JQAB 2BFBA 2FZKA 3A7DA 5J63A 2C5AA 1PZEA 3UMFA 4FLMA 3ZGOA 1VCHA 3OCXA 1PKXA 5B55A 4BNLA 3O4GA 1SC4A 1N5OX 3FCYA 3LQ4A 5JEEA 2WNIA 2ZQZA 4JXXA 2CLSA 3EW7A 2PUEA 4CM8A 1BKSB 1EVZA 5M7EA 1THZA 1M2KA 1XVLA 3C85A 4JYCA 4Q03A 3DPIA 4BMPB 2HCJB 5A0FA 3K16A 5KPDA 2VTEA 5KUTA 1TQ6A 1DXYA 1OLOA 1SU4A 4NU5A 4BUJA 3OSZA 1GUZA 2ATCA 4KOAA 4N5IX 4PLVA 5REQB 2P41A 2NXCA 2MR6A 3OM8A 3CUTA 1BMFD 1RHKA 3LCRA 3W5HA 3FPBA 4NG5A 1U7ZA 4DQLA 4OLBA 4CF3A 1QHHB 3ITDA 5I4BA 4NXMB 1FYDA 4DARA 4UCFA 5CJJA 5LP6C 2PKRA 3BMCA 4CFZA 4OAPA 1FUIA 4ZV7A 1CJKC 2AEEA 5CFNA 3BE6A 5E7IA 4GX5A 5IK2D 2Y1GA 1KZHA 2M1XA 1LK0A 4X71A 1Q1QA 1U2RA 2JDIA 3MINA 2J4DA 1SXHA 4UDYX 1TUBB 2XTZA 1SD1A 3IXQA 4XX0A 5IAEA 5CCDA 4YMLA 4L8LA 2JLYA 1F17A 2YS7A 3ILSA 4I19A 1WXXA 2B37A 3R09A 2ZZNA 3SKXA 3RYCB 3TRIA 4TUYB 2I2XB 3JTEA 4EEXA 4CG1A 5HILA 4GWGA 1L6RA 2QRGA 4RL6A 5HIAA 2I66A 1NW8A 4TVSA 2OB1A 1DEXA 4AWXA 5JARA 2CNBA 3M6VA 4KQXA 3ERCA 3PJGA 3THYB 2WJAA 1BA2A 1I30A 2Q3HA 2I1LA 4U7HA 1X9IA 3BERA 3DQPA 5FL3A 4BO8A 4DRXB 5I7WA 3A4TA 3SJZA 5ALKA 1XZNA 1RTKA 2ZULA 3ND6A 4MVJH 4MKIA 5I7VA 4PAWA 2AOXA 2AN3A 5IC6A 1SM4A 1NC3A 2OV8A 3ESCA 3EGXA 5AR1A 5GVRA 2IRWA 4BQEA 5IJWA 3ECSA 4HB3A 2LDBA 1FXUA 3SC3A 3X2EA 5KHOC 1MHPA 3FPSA 1E60A 1NDHA 3DP9A 3D6NB 3KC2A 3N2LA 1EFVA 3PFIA 2JKYA 1WPRA 2D7JA 3CUKA 3OM1A 3RQSA 5EPUA 3UYLA 1TKAA 1FBNA 2CVZA 3DQQA 3V8NA 1YDGA 2YXDA 4II2A 4DCVA 2WAOA 2GBIA 3DTNA 3TK1A 4ID3A 3JR3A 4D45A 2BH2A 2NXNA 3OCCA 4DV7B 5DNEA 1I2CA 1X7WB 3FA2A 2I4OA 1BGVA 2PXCA 4K6MA 5L4LA 3JX9A 3A3OA 1IN4A 3CWZA 2O23A 2IQ5A 4WLOA 4YS6A 3TTXA 3P2KA 1FW8A 3GR6A 2RONA 4PAMA 1Q16A 1JJFA 2P68A 3EUEA 5K6AC 3F6BX 3QQPA 1R74A 2XWJI 3A6HA 3KTOA 2WDZA 4BU1A 2WR8A 4OXKA 2DR3A 4EHJA 1P4JA 2G0NA 5HWSA 4BVLA 1N33B 4V1CI 5KTMA 4H08A 1SKAA 1GPLA 1T1JA 2G4VA 3GV0A 5JJ5A 1GOTA 5GOTA 1QPBA 3BJMA 3A1EA 2WINI 4BQNA 1JBKA 1I7LA 1C41A 3PYXA 1J22A 3H8JA 1VP9A 5C7YA 1J4AA 2JI8A 3EMDA 3L6RA 3LQ2A 4FSHA 4KUGA 3OEYA 4EY6A 1C1YA 1E3TA 3RU7A 3UAVA 1USWA 1Z0KA 2UU9B 3SEQA 2OY0A 4EMBA 2ZM6B 2Y71A 3WXBA 1WPQA 3PFNA 2JLAA 1RADA 3OPQA 4PLTA 1AHHA 2CC2A 4MV3A 2J5BA 5BW4A 5CG2A 4XWWA 3E05A 2J4FA 4L4XA 4Q3OA 4V0SA 2D5CA 4NQRA 4DQVA 3ZDDA 2H85A 2ZTVA 3HJUA 4ZI7B 4BGDA 2IOHA 3A27A 5IKPA 2EZ8A 2HJ9A 4E2XA 4AMGA 3RS7A 5KOHA 1MJ5A 2EIXA 4CR7A 2C7RA 5AJXA 3UFXA 5K03A 5FPYA 4G01B 4ARZB 4IJ5A 2FP3A 4UTZA 3SDSA 5IJ0A 1GAJA 1PR2A 5FOUA 3TM4A 4H4EA 3AG5A 1V3TA 3VR6H 4ETWA 2DHEA 1ZOLA 4E2YA 5JAIA 5KQRA 2JLVA 2B8WA 4DLWA 2AOTA 4QELA 5LVAA 1HDCA 2RHMA 2NZXA 2EBHX 3SJCA 1YK0A 2RHGB 1EXVA 2QN3A 3Q9NA 3VJLA 3I30X 3D7KA 5FNVF 4F97A 2XXAA 3TLGA 1H2ZA 2PXAA 2HNBA 5DTEA 2DHRA 1UADA 1UXHA 2H52A 3TQSA 3VO1A 1H1DA 2B34A 3NORA 3DXFA 1MD9A 5ISMA 1NBHA 1XXLA 3BCSA 3NIBA 3TTSA 1PT7A 2V3CC 5IRCD 5H9VA 5LIPA 1B14A 2O2JA 8OHMA 3ODGA 3RT1A 1IWPB 3P97A 5EZQA 1OWOA 1YFKA 3NAGA 5AVYA 4JV5B 4RCYA 1XAHA 5IDYA 1GFZA 1SA0A 1AQJA 4P7FA 3O0DA 4YUAA 3R4CA 1KY3A 4HDNB 4EYOA 3K0BA 1GPDG 4HWKA 5JCZA 1PJLA 3SFZA 5JYBA 4QREA 5BUQA 2ZBUA 1U02A 5KX5F 1R5JA 2UUOA 3IO5A 3PSAA 4ZWNA 5CP8A 3UNXA 2CXPA 2YNMC 4UBOA 1F5NA 3IKVA 3KPUA 2F3QA 4EI2A 3CW9A 3KWJA 3AUAA 4WFQA 4A0FA 3Q5EA 4EL0A 4C0JA 2GXUA 1EQ2A 2OCLA 1MPTA 3V8VA 1NY5A 4KNVA 4EPWA 2VTVA 4REQA 5F4BA 3WAJA 2M6LA 1ZD3A 2XUKA 4MCHA 3E3AA 3E58A 3KEFA 4UAJA 1DBSA 4AYTA 1XNQB 2JFXA 5GZ3A 4WBNA 1M2GA 1ONPA 4JJGA 2PR7A 5LMUB 1V2GA 1KP3A 1DC8A 1TVEA 1OWLA 2BGWA 3H1EA 2YC2C 1K7FB 2DRIA 2JH9A 4HTFA 5GZ6A 2H48A 2HEIA 2GBPA 1XTJA 4D3DA 3M83A 3OHMA 1EUYA 1QP4A 4IIVA 1ZIDA 3R3HA 4RQTA 1TVKB 1KEUA 3RYIB 1JFVA 2XWSA 1JDBC 1WEHA 3BTSA 3L7DA 2W2NA 3IJPA 3VR5D 3KXDA 1MAWA 4UPVA 3BMNB 9ABPA 3G88A 3Q0IA 2W6ID 2CDRA 3C3EA 1P7ZA 3CLSC 1LBEA 3H1GA 5AJTA 3B5JA 2YWCA 4HKTA 4HN9A 1K9VF 4UZEA 4WOCA 4HOYA 1VI5A 4EFLA 1E5XA 3EGVA 4W1SA 1KJWA 4ARAA 3KQNA 4CM5A 2G80A 4I4CA 1H6CA 2O2DA 4BMDA 4RTLA 2QX4A 2AI2A 3IIEA 3Q8KA 2QRHA 3GCDA 1DEKA 2BRUA 2WE7A 2WHYA 5K0LA 2W2KA 1XZQA 1YDEA 2JJ1D 1Y3HA 1MKYA 2IELA 1D8TA 2C4MA 4DZTA 1IN5A 3TVDA 1KO7A 4E5YA 2JFBA 3PFHA 4MJ7A 4EW3A 4NPCA 2WP0A 3DBIA 4NV0A 5I9BA 4BBJA 1EK1A 1P8JA 1IJKA 2A88A 4DWJA 3R24A 1YRLA 3AEUB 3S2YA 5DBOA 3ZHSA 2WQZA 4DREA 1UFOA 1Y8RB 3AVQA 3O9VA 2XE6A 4A8JC 4LZOA 1EDZA 5JNTA 2RKOA 1QUEA 5U4XA 3O8OA 2DJ5A 3PV0A 4BWGA 1HL7A 3FOCA 1X7ZB 2OKCA 2WU3A 3AKDA 4Y6LA 1G42A 1N1EA 1RHRA 2I34A 5DGXA 1TM7E 1GGNA 1UKBA 5A3RA 2IODA 1Q3TA 4YMUA 4CLHA 3N58A 1PZGA 4R2KA 4U6SA 4MHTA 1G41A 1X1RA 5BN4A 2Z58A 2Y1XA 4M2LA 5KVQA 5AI5A 1Y3CE 4H4CA 2B30A 3SJAA 1PQPA 3D0QA 1LW7A 3BXXA 3EGIA 1SOUA 3MN1A 4UD2A 1M2OA 2B5VA 2ECFA 1BHQ1 2QL9A 3PDUA 4C0HA 2O8BA 4MV8A 1F2TB 1Z37A 1ZXLA 4G4GA 3ZHBA 1U0BB 1JXMA 1BXRB 1VL8A 4GX2A 4HWSA 3D8SA 4K9MA 2Z0MA 3HBMA 4B40A 1LX7A 2DECA 1BN7A 3IAM6 3LA8A 4G3XA 5C0OE 3KR0A 3A25A 1NBMD 5HNKA 2NSHA 1G59A 1V2HE 1H4VB 4O1HA 3MUOA 4QGHA 4J0FA 2J9FB 2VQ6A 1IONA 3TLYA 1G0OA 3EPJA 3RJ5A 4HAUA 3DBRB 3EYWA 2FAXA 1IHXA 2GN9A 4GICA 2ZRPA 1EUQA 4LBVA 3CB4A 2M6SA 4F5WA 2WV9A 3HNOA 2WJ6A 3B3AA 2GEKA 1YUBA 3LPDA 2YHSA 1AURA 2FOIA 3V4FA 2AZ4A 4OX9Y 4PHTA 2FSHA 3INGA 4ZU3A 1B1CA 3S55A 4AO7A 3DOEA 5BVHA 1W2HA 4EGAA 1NF9A 3TGLA 3CKKA 3NDIA 3F6SA 4BJ3A 1QS0A 1XLUA 2OD9A 1XE3A 1PX0A 2MHCA 2YV1A 3NRBA 2J3IA 4A6EA 3ZOKA 3CRNA 3I9JA 3MUEA 2FSVC 4M76B 2QTVA 2OT3B 1J7JA 2BFEA 3HVKA 5CA1F 1XPOA 3E84A 1OB2A 1HQDA 1XMJA 3SQOA 3U44B 6ADHA 3BAZA 1KEEA 1S2MA 5B36A 3G9QA 3ROFA 3BJEA 3ADCA 1J56A 1OYVA 1W2WB 2NN3C 3ISJA 4LYDA 4NK4A 1SIUA 1GG9A 1YS6A 3M70A 5FL7A 2IH4A 3MT0A 1C9NA 2CFRA 4MMXB 3WLPA 2PJRA 2QI9F 1T8YA 3R5HA 3EVCA 1CY4A 2J3LA 2H7VA 3O4IA 4FFWA 4C3OB 1OY1A 3GLFE 1XKLA 4QQRA 4N76A 4AJKA 4EYSA 1QTNA 1BCRB 1KI1A 1Y1LA 1MG5A 2H4XA 3JQEA 5AHWA 5FB3A 3NX4A 5FA5A 1FFSA 2JLRA 5D5PA 5AVKA 4BKUA 1BGXT 4B4VA 1VPVA 2FPIA 2VTKA 3CNOA 3MJ4A 2W2TA 3MMSA 3U7HB 4QM7A 1E98A 5KQGA 1UMCA 5IZCA 1GFIA 2VPYA 3VYSB 3VVBA 4ZXPA 1C3VA 4JJ6A 5J2TA 3DMYA 4MQFB 2V65A 2PY6A 3AZPA 3OURA 4RF3A 3ZXSA 4DLUA 1BH2A 3HSYA 5DCWA 5JIBA 1J2TA 3E35A 2F43A 5I51A 1Y6RA 4ZIRA 5KNLA 3VNAA 3SS9X 2PLWA 3AXTA 4W5JA 3DFKA 1YB1A 2YRFA 2PSFA 3DD1A 4ZHSA 5IKMA 4KI7A 1ULSA 2CNDA 3OCWA 4KN8A 5DNUA 2NU6A 2NACA 2QR2A 3GG9A 3KCQA 4HQKA 3H1FA 3HDHA 3ETGA 3OF2A 4QUIA 2ZI4A 1Z6XA 4IEEA 4RD3A 2WOOA 1TQ8A 2NNWB 1CZNA 1Z3CA 4QYWA 3W8FA 2Z8XA 3DT6A 5CDUA 4MQ6A 3HWX1 2XB8A 5FJJA 4R7GA 4BNGA 3ZVMA 3NGMA 4M1KA 1U2GA 4QYXA 4Y1RB 2RSLA 1TCUA 3AI2A 1VLLA 1DQPA 3V6LA 3VSDA 3RVPA 2QZSA 3T5BA 2Q0XA 1H05A 4PCLA 2VQDA 4TWJA 1P18A 1TRKA 3RRNA 1XFAA 5BYKA 5C1PA 1EJ6A 1M83A 2O4UX 3BCHA 1H65A 2ZSDA 2HMAA 1AB5A 3I83A 3L6CA 1J8QA 2GTIA 3G2PA 4PPFA 2ARKA 5JSKA 3UW3A 4CYMA 4R6WA 5C3MA 4ZOBA 3LGSA 2HSEA 4MO2A 4RD6A 3VSEA 4MEAA 5BMVF 1PWYE 3KJEA 4ANFA 3G9UA 1U1FA 1NDUA 1CIVA 3FPEA 4PRLA 3IR7A 4G5HA 1RFGE 2C78A 2G0TA 1BYIA 1GTMA 7ABPA 2ZG6A 2RAVA 5JCPA 2X13A 5GWXA 5EUMA 4AUNA 2AEFA 2HDNB 1UFKA 3ABQB 4KQJA 4QRHA 2W4QA 1RCUA 3GFRA 4O4JB 3G0GA 4A8PA 3WRWA 5KTKA 4MVJE 4Y30A 4Q05A 2FV8A 1EDDA 1E66A 2JAXA 2CE7A 5J58A 3JD0A 13PKA 2G4LA 4B83A 5DHTA 1CQZA 2YDYA 4G0QA 3T99A 5ITZA 5JATA 1LXCA 1AHPA 3LLUA 1E2GA 2PH7A 2PMKA 1EK0A 1FSGA 2VA8A 3IDFA 2GJ8A 2VRNA 4C07A 4CEIB 3BDIA 5TLSA 2ERCA 4EJ0A 3WOVA 1E3WB 1QIGA 5COBA 4PFSA 4XPIB 1A7AA 4GE0A 1ZOPA 3VNBA 3NR2A 1XZCA 4DRZA 3F9RA 4OK6A 1QB7A 2MINB 5LZ4A 3R3ZA 2I6SA 3FXAA 2PMCA 5JXHA 5B4VA 2HLHA 2P9EA 4D5EA 5J4LA 4DV2B 4WCFC 3FN4A 4LY6A 5AKZA 3W04A 3VKUA 1TKBA 3JQ8B 1XRQA 3DCIA 2J4CA 2QXUA 1GLVA 1XQ6A 4P35A 3RTAA 1Y80A 1L8AA 2AC2A 3DOHA 2DBQA 3L2OB 3C7TA 4YP7A 3GLIE 1ZGJA 2RC5A 2UV8A 5I5GA 4DMKA 2WHXA 4K9OA 2QYSA 3P32A 4YROA 1AUQA 1L4BA 2GAOA 4L7QA 5F5XA 1XX6A 1T2CA 4D3FA 5DN9A 4JGBA 4DS3A 4LJSA 3FNGA 3KKZA 2FFRA 4PPQA 4YCMA 3MGGA 1RJWA 2Y4OA 4EB6A 1SG0A 2IYQA 4OSOA 1W6UA 4PN3A 3DLHA 2WFLB 4JVLA 4EF4A 1AA6A 1GUFA 2C00A 4WW0A 1Z2DA 4G0WA 2IHZA 5CH3A 3RPEA 3WK4A 4MPRA 4KOEC 2FW1A 2XUAA 3R40A 1QCDA 1Y8ZA 1ZD5A 3JY6A 3IHKA 3RYHA 1NVDA 1G21A 5KDOA 3CT4A 3JQAD 4UULA 4M4SA 2XNKA 3B2EA 2RAFA 3WWPA 1KFCB 5TJHA 3A28A 1DTWB 5J1SB 4PICA 5I7UA 3QEBZ 3Q15C 2XSZD 4B34A 1E9RA 3I5AA 1NE7A 4W82A 4C76A 4HDAA 4YO8A 3DE3X 1JP7A 3LKZA 4G84A 1PSDA 4GF5A 4HS9A 5JS2A 1IY2A 2ZW9A 3ZJ5A 1H4SA 4FPXA 4F4JA 4ND6A 5A05A 2VK1A 5IH7A 1XXHB 2J0QA 4A10A 2ORVA 2WTNA 4E0BA 3IR6A 4YRIA 1Z0DA 2HMTA 1V45E 5AESA 3MS4A 4P92A 2YV5A 3VFDA 4CGYA 1SCDA 2BFBB 4BGVA 4NOJA 4WNYA 4C7XA 4AJ9A 2DGDA 1UOQA 2RHBA 2FP4A 3HU3A 1H2AS 1P17A 3TJZA 3TEFA 2AXNA 2FMIA 3F74A 4KDEA 2YHAA 3TOCA 2FCRA 4A0RA 4CM8B 4FKBA 2YWBA 4DIMA 1OTYA 5FOVA 4CL2A 1AN0A 2B21A 2L2QA 2NXJA 3QV1A 1U2ZA 3IEPA 4JLVA 2RGCA 2WIGA 4ZDWA 5JNLA 3IMCA 4JH0A 2QJRA 3BHNA 5FRDA 5THQA 1FJHA 3RRBA 4DQ0A 2HV8A 3FG9A 1GU0A 1XLVA 3JZDA 1WKBA 1V41E 3I64A 3A1FA 5JBNA 1ONSA 1W85A 1QGAA 4WTOA 2FRVA 1WY7A 4BJ6A 1FVFA 3H0EA 2SNIE 5BV0A 2HCBA 1FRNA 2H7CA 4CR6A 5LKRA 4YIHA 1GZ3A 3BMCB 3GX1A 1J49A 5JCJA 1W0KA 3WFZA 4A36A 3R74A 3HCAA 1GCUA 4P32A 1SJ9A 1R4MA 3DPSA 4ASUD 4B85A 1F3OA 1RP1A 1GN8A 1NONA 2W98A 5IBCA 3MINB 3KVVA 4GOXA 4RVNA 5GV8A 4XX0B 4HDKA 2B0JA 3O8NA 4UEWA 2YJ5A 4D02A 2CF5A 2V7GA 2ZUUA 3REFA 4P80A 3LQ1A 4EKGA 1GUAA 3P9XA 4AKTA 4P2GA 4MQ5A 1K3TA 4OHWA 2HF7A 3AHCA 1H3FA 2YIDA 3UUGA 3MNFA 2EP7A 3ICEA 2FJ0A 2V9CA 1LVGA 2W2LA 3GJQA 1DKOA 2OECA 3EXAA 3I8OA 3OJOA 3P4XA 3QOWA 8ABPA 2QQ5A 3WV4A 4AP9A 2GWHA 2C98A 2Y0CA 4CIDA 1QPGA 4RY8A 1FY2A 3FNEA 5KNCD 4LY0A 4QOEA 1X1CA 1Z2PX 1XTUA 2VQSA 3LUJA 3D8NA 5BT8A 1V16A 1QAOA 4QOHA 2UZ3A 3INYA 5KTRA 1GQFA 1QZXA 3PFWO 3KV1A 3HA7A 3KALA 4J0QA 4N0DA 5EZYA 1KZ6A 1L4YA 3VYVA 5JY6A 1FDWA 1TM1E 2Q3JA 3SZUA 4HEJA 1Z4PX 2GVNA 4NIMA 1I5EA 2IPOA 2XYGA 3EGXB 5JQGB 3ER9A 3COPA 2NO6A 4MICA 2VAVA 2YJ4A 1M8FA 1UBCA 1EFVB 2W6NA 4LRWA 5CDYA 3IKLA 2PN1A 5WRFA 3KXKA 3DZJA 1EDEA 1SXQA 2FG7C 4XOUA 2AQIA 3KUKA 4F8EA 2MCFA 4M0UA 3GA7A 3N75A 1WXQA 4YEDA 1Y4DE 3K35A 3IDQA 3MMNA 1IVYA 2HA4A 3DEAA 1U8EA 3OX2A 4HB0A 3GHYA 3OI7A 4DWVA 4JUIA 3QMMA 4KRFA 3F8SA 4TQUS 2D2XA 4L28A 5IHPA 4WFJA 4X1IA 4L4YA 1BRMA 2PS0A 4X90A 4C08A 4Y7CA 3C6XA 1QO0A 3F6CA 3PHBE 1E2FA 2VIIA 3IFSA 3OIWA 5K01A 2X2OA 3CF6R 2XVAA 3D64A 4EFMA 3AUSA 1LD3A 2C5GA 2R2GA 2W0SA 3DL4A 4CZ2A 3NLLA 3WNDA 2JA2A 4MWGA 4ED9A 2R11A 5C3UA 4XWOA 3CTPA 1XRRA 1UMBA 2REXB 3IVCA 3OFND 4B6GA 1NC1A 3RRZA 4CLRB 1YI1A 2H63A 3KZVA 2GKSA 4QVGA 5COAA 1XDSA 3UV7A 4C87A 4RK7A 4RJTA 4GMKA 4QHSA 2L82A 4HNRA 1XRPA 3BZUA 4UHCA 3X3HA 1FFXB 1JQEA 1N0UA 3TRDA 7AT1A 3ZZUA 2KE5A 1FXWF 2VJNA 3A3NA 3N6XA 4Q9JA 1AD2A 3Q11A 1KFBB 4CV1A 5KO2A 4MUNA 2BF7A 3EIEA 1U2TA 1PZXA 3OWOA 2R97A 2RGYA 4KR9A 2ZUVA 1MC1A 1VBMA 4HVCA 7REQB 2ZUSA 1MTOA 2VJBA 2QTHA 5IDWA 2WHPB 2X2FA 3LX6A 3ZUPA 5H4HA 1VM6A 4R1SA 5B64A 4UU1A 3CRVA 1XCMA 3ZHCA 5KOHB 1QRTA 4NCBA 2Y68A 3UFXB 4MUIA 3EQ6A 4GI3A 3ANLA 4TSFA 2CE2X 1XTSA 1KZ9A 2BBTA 2BFFA 2PD4A 3BWCA 5IJ0B 3OX4A 1OKKD 3NU1A 1M34E 4KDCA 4ETIA 3E2IA 3IEMA 3L49A 3BGVA 2RGXA 9ATCA 1EP1B 4IIJF 2AOTB 4GOJA 4U2KA 1P62B 2VJOA 4U2FA 2I2AA 5MN4A 1K0UA 1L4FA 1O5OA 2P0YA 3OO1A 2OFPA 2SKDA 2WWGA 1GKUB 4XZ3A 4IS3A 3TLGB 1HZJA 1WXFA 1YVPA 4MP3A 5FOQA 4IV8A 2Q5QA 4FDAA 1YJAA 3G2MA 1Z0SA 2F3PA 4JUBA 4DNXA 3DVLA 5LQMA 2DXIA 3DULA 4KX3A 3CINA 2ZE5A 2K87A 1QTQA 2FUNB 4LHZA 3KNZA 3HLKA 1FLNA 3AR8A 1QHXA 4H0FA 1MQSA 2BEJA 5DYNA 5DCUA 1L7OA 4HXGA 2EW2A 3RSSA 2YXPX 1HKHA 1ZD2P 3QW4B 2IV2X 4WADA 1O57A 4PR3A 1DRWA 1TUEA 4QBFA 4QGFA 4EJMA 1OHHD 4YJ3A 1SA0B 2IIBA 2Y6VA 4R1OA 4F1JA 1MB2A 1W36B 4ND1A 4RFVA 3IERA 1P6UA 3K1AA 4O08A 3IUJA 3M81A 1JIUA 3AETB 2YV3A 1K2VN 2VK2A 3WNVA 2QBYA 3ZG6A 2BGLA 3N59A 4JVOA 3GRVA 2JAQA 3VNQA 5C46F 1DGQA 3UMMA 1T2UA 3I2GA 4XPZA 5BRNA 4D1YA 1EG7A 3LO5A 4EJFA 1WBJB 5EUQB 1RCFA 2VXOA 2Q4DA 3QFFA 3QPVA 3R3SA 4MKHA 2HXSA 4MQBA 2D8AA 4NOMA 5ALJA 3N0RA 2H0AA 5F33A 4LOIA 2J08A 5J2UF 1PD0A 4LEIA 3E9NA 2J59A 1USVA 4RAQA 1OGYA 5AFSA 5JPIA 2OZLA 2YBDA 5M34A 1VKOA 3HDVA 4N12A 4WOKA 4AK9A 4RBNA 3T9BA 4Z6KA 1O95D 2F55A 1E8DA 3U40A 1H22A 5CFQA 4UEOA 1UKCA 5FTKA 1UJBA 4H27A 4WBNB 4AZ3A 1WCWA 4EI8A 4DCCA 1MZPA 2EJVA 4ZDIA 5TF4A 4HQ6A 2HJVA 2QJTA 1QP7A 3PXUA 4HTFB 1KEWA 2CNOA 2X1VA 2ZK7A 4J03A 4ZVKA 3HZRA 5DX1A 3RYFA 4OQ4A 2IP2A 4BCCA 1GFWA 3BKWA 4DG8A 1AQIA 3K9NA 1XDZA 1BX1A 1Y9DA 4V38A 4XQ9A 3SOZA 2QMHA 2Q3LA 1R4AA 3IUSA 4TS9A 1H66A 4UCWA 5CX1A 4TLMB 3D3WA 5EUCA 4PPNA 4WQMA 3ITEA 1Y82A 5CH8A 4CCYA 3PHCA 3PRHA 2PWZA 3LX4A 4LYYA 5F9MA 2G5PA 4N41A 2IZ1A 1LKZA 3BHJA 4WHMA 1I2DA 1F60A 1QQTA 3OQ6A 1YRHA 4COKA 4EF5A 4OA5A 4G85A 4QDXA 4UHFA 4DSTA 1P6XA 1E7RA 3SYKA 5KMGA 1MO3A 2YRWA 1T8TA 1QYWA 4UW9A 4M9XA 2HWXA 5DNWA 1KWGA 3M6IA 2ALJA 1BX3A 2W2KB 3Q7RA 3KT6A 10MHA 1ZVQA 2A5GA 2I7XA 2PWPA 3C48A 4QM6A 3IT2A 2ZYGA 1AKEA 3T7DA 4H3HB 4EFNA 1QGUA 4ZVQA 1C3OA 1RU3A 3JPWA 3A9RA 4XCQA 1C1HA 4OU4A 4ZVPA 1Z56C 4JI8B 1G64A 2I29A 1U1IA 2QV7A 5F12A 5FA8A 4X66B 2WUGA 2P2NA 1IBSA 1UMKA 3V8BA 4HDSA 2VTBA 4O02B 2BM8A 1MCZA 3NNSA 3O8OB 4W5HA 4HVTA 3GJTA 1JZSA 3F8TA 5DNCA 5HZGA 1GYPA 1JT9A 1NUSA 1T13A 2EYQA 2NU8A 3TSZA 4W5WA 2H4FA 2AL7A 3DZGA 3UXMA 4HEQA 1V5IA 3ZNOA 3TMKA 2IHKA 3LF1A 4PXAA 5IP5A 2P5SA 2QG6A 2Q41A 5BN4B 2H2IA 3DFFA 4MVJP 3H3XA 1GZ7A 1HFKA 1WEKA 3Q98A 3UAOA 2B9VA 4BKRA 2JJ2D 2QS9A 4CETA 2POQX 4HH0A 2OC9A 1SKQA 5KSYA 4FYJA 1JPNA 5T3UA 3VMMA 1M2OB 3OF3A 4XLTA 1NX6A 1Z5NA 1LFDB 1ZCZA 2IDMA 3KOZA 3WLOA 2INGX 2PJDA 3K0AA 3EA0A 3NTRA 1V6SA 2PBRA 2PZAA 3AR4A 3L79A 1D0IA 4ITRC 2GS9A 4KRYA 4Q01A 3VSCA 3DXZA 2IY7A 4ZT5A 3ZIAA 4ACBA 4WN9B 4HNSA 4C04A 3BL8A 5C9ZA 3VPHA 1UINA 4XSVA 2PUBA 4HB4A 3WGYA 4C7KA 2QZPA 1CIPA 2BYTA 1QCCA 1ZC4A 3I53A 1IC6A 4E6EA 1FU7A 1MAVA 2PBZA 4DNQA 5I7EA 3HJFA 5A3SA 2CEAA 3F78A 1GO2A 3MS7A 3K05A 1EJ2A 3W4IA 5BWMA 1Q0TA 3KJXA 1SQFA 3CURA 2V7EA 4MUHA 3VXKA 5IF9A 3MAAC 4IJKA 4LYAA 3VHXA 2REBA 2A67A 1N0VC 1C1DA 4PYQA 5D86A 3HVRA 4OHVA 5ITVA 1QF9A 3RC8A 3G5AA 2CLHB 5ES4B 2NSLA 4Y2PA 3VNSA 1L0BA 3HXKA 3X44A 4YMTA 5BVHB 5JG7A 1I24A 4LJKA 4Y2VA 1YASA 4MS1A 3KXIA 3V8MA 2IVZA 4UTXA 1QS0B 1PR3A 2X58A 3FDXA 3IQHX 3Q2KA 3MB5A 2IIQA 1XPJA 3U3KA 3G02A 2D6FA 2IYNA 2JBAA 4TQAA 4CXMA 1UBFA 4L02A 2QTVB 2X0IA 2Y9MB 5LZ5A 2BFEB 5SYMA 4KSYA 2O6LA 2F67A 2O5VA 1KEEB 1GTJ1 2XGOA 2P77A 3H9JA 2HWWA 4UAGA 4I4TA 3GUCA 1MXHA 1PDWA 1SRQA 1SUDA 3D9QX 2V0GA 2L42A 1X70A 1UKAA 4J7AA 3KQOA 3WSVA 2NW6A 2ZUEA 1CUYA 3AR9A 4Y18A 4DW8A 3ZK7A 3O7MA 3V1NA 5C1DA 1WLSA 3A1CA 3A1SA 3BSWA 3RSCA 2FSSA 4WXYB 3ZDCA 3M1AA 2XNDA 1J8YF 2GYUA 1KVRA 4XCVA 1TO1E 3BXEA 1XGKA 1PI3A 3GFBA 3S7ZA 4ZOEA 4C7BA 4CKBA 2FPIB 2VF4X 3UC5A 3S2EA 4MDEA 6REQA 2Q8PA 1CC1S 4JJFA 3T0IA 2GTHA 3DDZX 1UMCB 2A9VA 1WSBA 2WC1A 2LKCA 4QUGA 3DNPA 4WERA 5A4KA 3FRJA 3HB1A 4RPHA 5J2TB 5D7BA 1CEQA 2HV9A 1TK9A 4ENQA 1OAOC 3CCBA 3E9DA 3WB2A 4UXIA 5DNVA 4LZPA 4D4KA 2F43B 1M1YA 4ZIRB 2Y92A 4IW3B 5G4LA 4QU9A 2X86A 4L1KA 5KKAA 5DPMA 3U2QA 4DYDA 5BSGA 3WWOA 4GPIB 1LI4A 5EJ7A 3S8MA 4DLAA 1T9GS 1Z6GA 1JU9A 1L4MA 1Z74A 1ZI9A 2NU6B 1G17A 2AH5A 1YA4A 1P77A 2XCIA 3O9ZA 4YXFA 4ZEMA 3A3PA 4M1EA 3K9GA 2PG3A 3EARA 4B7XA 1G6Q1 4JAVC 2QMYA 1B23P 1LW6E 2WJ3A 1LLCA 2QE6A 4RD0A 3ONEA 4LISA 3H5LA 4LYGA 4MK4A 4O2LA 4NC9A 2DPHA 4PBRA 2BM1A 2XUPA 3L0IB 3GBPA 1IL0A 2OVBA 3PD0A 3RRJA 4JR2A 4PO1A 2IK8A 5CD1A 5JD3A 3OZSA 4MRVA 3F5SA 4YGXB 1KY4A 4E1BA 1ISJA 1AXGA 1HXHA 4KMRA 5IJ9B 3MG9A 4E31A 3F7MA 1NLMA 4KMOA 3WNCA 4QFCA 4R69A 5FWXB 2H6EA 3BTVA 3E5HA 3GPDG 4R68A 4ZQFA 1T0JB 3VI3B 1L7MA 4G5YA 3VDNB 1OCEA 4WLNA 3TSAA 3NIGB 1H4QA 1QE0A 4EP1A 1C14A 3VGJA 2XR1A 2WUVA 3OEED 1NXTA 3F0TA 2Y1FA 4YMIA 4HXYA 4Q37A 3EZGA 3ENKA 3ZCTA 3V1TC 4RD4A 3ZD6A 5SY9A 1MMFB 4Q1EA 1IB6A 3HN6A 1XWWA 4DUGA 4AMBA 1NMYA 2QKYA 1GGHA 3DE1X 1VSBA 4OJQA 4TQGA 4RW0A 5ITZB 3R0VA 1PU2A 521PA 5KQPA 4GKVA 2EEZA 4OQYA 1IRXA 1EE2A 5HKKA 5P21A 4US2R 3VH2A 2VOEA 3GI1A 5J5CA 4ZYYA 2VJQA 1DBPA 2JEYA 1PFKA 2ANBA 1HETA 3HGMA 4GKAA 3ZV5A 1JLHA 1KMHA 3D2AA 4G26A 4ECEA 1CDZA 1NNLA 4IIXA 3WKAA 4PRYA 3P9CA 3BEOA 3WGTA 1CZKA 1UK7A 2WYOA 2ZGVA 3TBKA 4PTLA 4U2GA 5BOSA 4KN9S 2NZVG 2HH9A 4QA9A 3UKOA 2RBKA 2EWMA 4RWEA 5LQKA 3FRIA 5I9IA 5CDTA 2I4MA 5JALA 1R66A 1QYIA 3A4LA 1M2FA 3EBPA 3FZYA 1JI0A 2FMXA 4K86A 1M7BA 3V2HA 3R7BA 5EPOA 2ZJOA 2GM4A 2EOAA 3ZNNA 4MRPA 4BLTA 1DJLA 1LI5A 1UK8A 2TMGA 4PYNA 4RHXA 5DOZA 1GCOA 2XPCA 1KIMA 1T10A 3MJRA 3RDPA 1GL3A 4HGPA 2DBRA 3OFJA 1P31A 1DIRA 1X74A 2OC4A 2PGOA 5AKGA 1MUUA 2O7RA 3T5GA 2WWRA 4KP7A 2Q0QA 5JO9A 3I5XA 4QU8A 4DLKA 1AKMA 2GEJA 5A4MS 1I4LD 2N75A 1E2EA 4KXLA 2X5JO 1LX6A 2PX4A 3EFHA 4N3AA 4TOIA 3NANA 3PXGA 2GZ2A 3MMXA 4GRAA 4X6UA 4NCAA 3RYHB 3ZWMA 1G21B 1N3BA 4YCSA 2OV1A 1IUNA 1EBFA 3JQGA 3MWKA 3PWKA 4YAKA 4YRMA 1C1XA 2IKSA 1RPAA 1TC1A 3NHZA 2QTAA 1YJCA 5F21A 5C80A 4Z54A 4IXTA 4QTXA 3BD8A 1A76A 5CEJA 3DZBA 5F5NA 4EOGA 4P22A 4QE3A 2Y67A 4ALJA 4ZT7A 3PQ3A 1A82A 5K2MA 2A5LA 2FYTA 2VCYA 3JXEA 1TO2E 4BO3A 2HB6A 5EKTA 3HJGA 1S9DA 5KSPA 1IG0A 3B6KA 3CR3C 3FLMA 4R5HA 2VDUE 2GN6A 1J70A 1VXOA 5HRAA 2SKEA 2ZI5A 4HD8A 3RT7A 2VDKB 1MT3A 2HN9A 2FP4B 3DCNA 5L6LB 1U04A 4KXUA 2VP3A 2JEOA 3S1LA 3M6LA 3UOGA 4AG6A 4C1BA 3V4RA 4PG7A 2QQEA 2IOYA 3D8TA 1EVQA 4GP7A 5ALHA 8ATCA 5JPCA 5HTOA 3L8MA 3P2YA 1JEQA 3L0OA 2DWPA 2D13A 3DM9B 2C8JA 2JDID 3KYJB 3NPMA 1GT6A 2I2DA 2MMGA 1GQRA 2GZDA 4DDMA 1W85B 1N5MA 4FYKA 2H57A 3IP8A 3MSCA 1TZMA 5DCLA 1G3MA 2Q62A 1CR0A 4Y2TA 1N7JA 4LOHA 3BH7A 2MSKA 3AZOA 4ICIA 2HMYB 4O59O 1OTXA 3G1WA 2O20A 2C4UA 3ZBPA 3G17A 1IVSA 3FGOA 4P5EA 1WSAA 3ZYCA 3PNOA 5GQSA 1FU8A 3O1HB 3KYDA 1KEZA 2IOFA 4HDKB 3LFTA 2FPSA 3WADA 5TRTA 5CDFE 2X0JA 3P94A 3SPXA 2X8LA 5JAPA 1R15A 3KLMX 2H1HA 3G5TA 2HYIC 3ZE2B 1LBSA 3FYDA 4DJ5X 1BE6A 1WUTA 3AESA 1TJ5A 3D1JA 3N0WA 4F4HA 4BFSA 4QO8A 2D2EA 2Z09A 3VDMA 1GNTA 1JEEA 1RM3A 2XYQA 2I3AA 3CSDA 2IWRA 5KJEA 4E30A 4N6GA 5HRCA 1DO0A 1Q1NA 4W9RA 4BDSA 4H18A 3C4JA 3WK8A 1H5QA 4QIHA 5FOXA 4AB1A 1JPJA 4HB2A 4Q7EA 4NESA 1P1BA 1W76A 4NE7A 4IF6A 2GERA 3UUFA 3BCRA 4JUAA 5CLLA 5F51A 5NLLA 1JSZA 4L6IA 1V16B 2BKEA 3B7PA 4IIGA 4B5LA 4ZVUA 4B84A 3GDGA 3CVJA 4L8YA 1WW8A 3TJRA 1C8KA 1G98A 4KXVA 5EZYB 3SSOA 4LBZA 3IJRA 1ZESA 4IVQA 4CMJA 2C20A 2A5DA 2ZJ2A 3ICCA 3PSHA 5JZMA 1Z15A 1ZVKA 2C61A 2W6QA 3R44A 1G291 4KQ6A 5FFNA 1U2QA 3MPOA 1AQUA 1UPUA 4FSDA 3SJUA 4INAA 1OU4A 4UNNA 1I0LA 2FMHA 2GFIA 3C97A 4J3NA 4AFNA 1ZCBA 5FI0B 5IT4A 3VJMA 4KR2A 3EYAA 4P4NA 2FCAA 4LRYA 4RHFA 2VH2A 4NARA 4QAJA 3VPSA 4KTVE 3D4IA 3QHQA 4WL0A 5CD9A 5T3YA 1BWQA 1X1BA 2HSWA 5FHRA 2DERA 1RTTA 4R8SA 3GBVA 4MGKR 2AZMA 4KQMA 2RG7A 3GDOA 2QL7A 4BO1A 1OFTA 3EOBI 1D2EA 5JSHA 2WK1A 4FFRA 4PNPA 3R4VA 5TPZA 1QQBA 2BGJA 4OXNA 1Z18A 2I4LA 3QG5A 3DDUA 2OXRA 2CMHA 3O3NB 2QLMA 4X1IB 5TV2A 5F2NA 2ZRBA 3OIDA 5HXAA 1RBZA 1U4OA 3PHJA 1RXUA 2QX8A 2GCOA 2NO0A 4MQUA 2NU9A 4N0QA 2WHEA 1CT9A 4GNKA 1PVVA 2IOFK 4QQKA 1FLAA 3ANTA 3OIGA 4WD3A 5CLQA 1QHYA 2QI9C 2HDHA 2RG1A 3SM3A 1A1SA 2BFAA 2L69A 4I0WB 1UMBB 3GGPA 2V6IA 1MOQA 2YUTA 3ORHA 3W90A 5KYWB 1CQPA 1YDWA 2W83A 3ESQA 4H1WA 5JUWA 3DCJA 5EKSA 4N9QA 5A5EA 4FC6A 1UKZA 4H7PA 3PXAA 3PVCA 2O05A 3A0UA 2BBOA 2I76A 3FSRA 4AJ2A 3RB8A 4DCPA 5J23A 1UJ5A 5FULA 4RULA 5DGTA 1L7VC 4DIBA 2E4UA 3JV7A 1P5FA 3QRWA 3U4DA 1E94E 2YIMA 3EJWA 3D4BA 3NHFA 5FR2A 3AHJA 3NHLA 4A03A 1A8PA 2PLRA 4JQSA 2X9GA 5DLEA 1SCNE 2P4EA 3BK2A 1A8HA 3QXGA 5D85A 1H2XA 3DZCA 2ZSBA 1P0IA 2JGJA 5DW0A 2ZCJA 1FXSA 2ID4A 4Q5IA 3SU8A 3EXEA 4EB3A 2VUSA 4D3SA 2BFFB 3W7BA 2AB0A 3DXXA 2XHEA 4BRZA 5EHGA 1O5IA 1UXJA 5BN3A 4IJVA 3D8HA 4B8ZA 1WZUA 1S5PA 2V6BA 5CLGA 3H86A 4CU5A 4RF4A 2H0RA 4O4LF 2YOFA 3AJ8A 1ZW1A 4MLCA 1YONA 3ZGYA 3I61A 5CCXA 3EULA 3FYUA 1M7GA 3CLVA 1XEAA 4ER7A 1NVUQ 4NAHA 4ND3A 1XZEA 4XIFA 1W36D 3U4MA 1ORDA 4P38A 3GFGA 3MTAA 1KHTA 1O03A 3VUEA 3VSAA 1SKYB 2CVHA 2HQOA 3T3HA 1HFEL 1ZNXA 4BEBA 3FCSB 4FFLA 4IIDA 2AFIE 3WC4A 2Q6VA 2Y2VA 2XT6A 3ONNA 4D8XA 3V32A 1QHGA 1JX6A 3M33A 1U6JA 1V6CA 4JDUA 4LSWA 1G2IA 2F9MA 4A6DA 2WG0A 4CMCA 3V7YA 4I9UA 2EF1A 4NZ9A 5DM0A 5A04A 3IT1A 2VAWA 3H13A 3IA2A 4H2DA 1QHSA 2HJSA 2ICAA 4YJ3B 3KZCA 2DE0X 5DIFA 1C50A 1N7HA 1OXVA 3T9FA 1OW3B 3K1AB 4QUEA 3THRA 3TLMA 4BWYA 3ICPA 4R7TA 4Q4CA 2ZRMA 1TGYA 2K7FA 2OGTA 4CIXA 2QBYB 1CEYA 3L4EA 4J75A 4K6GA 4J4HA 1HEIA 4IKOA 5ELMA 1MO2A 1DKQA 4MKRA 5B3LA 3QMWA 2NT4A 3AJDA 4N7BA 2VEOA 4GOLD 1JYFA 3LWNA 4AJNA 1LTQA 5HIMA 5K0CA 2PXXA 3GFOA 1OLSA 2WM3A 2JVJA 3BWMA 3F6RA 2IY9A 1YRYE 1N5LA 1UL1X 1Y6QA 4HFRA 4Q47A 5F2KA 3ZIUA 1N8TA 2JAWA 4MUAA 5MF6A 2FWJA 1HNWB 2RMKA 2YNMA 2OZLB 4BN0A 1LF5A 3AQ4A 3PGKA 3AVVA 2POCA 2OKGA 3QI7A 1TYCA 4L3VA 1ORRA 2IZZA 3MJCA 3QPAA 3SFVA 2NM0A 1RWWA 3VV3A 4FKZA 3A2KA 2XUDA 4U9IS 4FYWA 1ABFA 3B5EA 3IXMA 5FWAA 1UIRA 1F0YA 1U4SA 4AZ3B 4M38A 4QDZA 1Q20A 1XZIA 4IFBA 3D2CA 3T1TA 1E3LA 3OF5A 1J20A 2REOA 1YSCA 2EGHA 2X8BA 3PDJA 4EF6A 1C4KA 3RYFB 3K0CC 2Q3CA 2LCQA 3KQWA 1EHIA 4U6QA 1WL8A 3HI4A 1S8FA 3KUCA 3NDJA 1EP9A 3OKPA 4RANA 3M6MD 4BMZA 3QKTA 2P7HA 1O77A 1QVZA 3QVJA 1E61A 2R8BA 3D3WB 2XMBA 3MGKA 4CCYB 1QTRA 4RDXA 1M7HA 3HCWA 1IIBA 4TKVA 2BSAA 1N57A 5KSOA 3FMOB 2PCLA 3N3BC 1VKZA 4RMJA 3KD3A 4F6LA 3I04M 2MU1A 4TXNA 5KMGB 2I91A 5KJFA 1LI7A 3L05A 4PS1A 3CLRD 3DTVA 5FJIA 1JHZA 3CX7A 4BEVA 4UAUA 4PW0A 4JP5A 2P5TB 1IU9A 2O8NA 1D5CA 2P9CA 3JQBA 2ZT8A 1X8LA 2ZITA 4HQNA 3RR2A 2XYVA 1QJCA 3UPDA 1QU3A 1JVNA 1QGUB 3L01A 3OMWA 1C3OB 3FR8A 5KSWB 4HP8A 3TUIC 1F6WA 1T15A 2COKA 1GQ2A 3AUKA 4EW2A 2GD1O 2PKXA 1N5RA 3DEFA 2BONA 3EEIA 4YBZA 3FF1A 3HXPA 4DC1A 3RJTA 1POXA 1P2TA 2VTBB 3EZFA 2RBEA 5CTAA 3PP8A 2OTCA 2X1MA 1E3JA 4ILEA 4RIIA 4TYMA 3WGHA 1SGWA 2C88A 2KB0A 4A8JA 1GSAA 1PG2A 3ASUA 1CE8A 1SD5A 4BB6A 3L7CA 5I47A 1CU1A 3HWSA 4DG5A 4G4JA 1TUGA 1VA4A 2NU8B 3O8CA 3K9WA 1DS6A 3FKSA 4YJ2F 4YVFA 3VDRA 2ST1A 2FB9A 3LXXA 1VKNA 4LJLA 5LNK6 3KKPA 1SOVA 4P0PB 1E1KA 1P33A 4LTNA 4CKXA 4B3GA 3BIXA 4BASA 5IAAA 3FCCA 5JSYA 5AIBA 3WTCA 2JAUA 2QM8A 3ER8A 4BU0A 1RRPA 5CFZA 4DKXA 1CEXA 2B1GA 4YT5A 5ALXA 4NYJR 3KEQA 2W90A 1MH9A 2A59A 2ZR0A 4LF9B 2VUTA 3WG9A 2JK0A 4D0NA 2C29D 4CIYA 2CHGA 2WSSD 4HLQB 3WRYC 3K0AB 2X14A 3DFIA 1MB4A 3IURA 2NNLD 1F14A 2HYDA 3F7OA 4PEVA 3U3ZA 3U49A 3AZQA 3ZZMA 2XMGA 4MVWA 1FSZA 2K2QB 3WLQA 4CMKA 3UPTA 4RKQA 1KDRA 1URPA 2OSVA 4LAFA 5CEEA 4KBGA 3PYLA 3BXFA 2IHJA 2DQYA 1ENYA 1KI2A 2QGNA 3FGPA 3FIUA 1A9OA 1VYVA 3ZDXB 1SQGA 2I5PO 4D92A 4QYSA 1GA6A 2OESA 1BAPA 1EZ4A 3MD0A 4YWJA 4FOOA 1RWXA 4M9QA 2O3JA 3JR7A 1H1LA 2XUQA 1NV8A 3PGVA 3QE9Y 1E3MA 2H1IA 4C3VA 4EY4A 1JIVA 4GMFA 4LHWA 3T4PA 2ABWA 3VHXB 1I3NA 1C1DB 4CQMA 1M1NA 2CZQA 4XLLA 4R8RA 5AM2A 2BCJQ 2JASA 2DQKA 1JPUA 1SELA 2M98A 3OTGA 2XW6A 3JARA 4J2HA 4UVIA 1XRNA 3OETA 3U1TA 4MS1B 1UF9A 1QU2A 2RGRA 3IE2A 5FL7D 1B16A 4RADA 3GUVA 3FJ1A 5FBRB 3BRQA 1J7KA 4PIMA 3PE4A 4WECA 1HM5A 3DYBA 1CY7A 3SNHA 2JBAB 2CL0X 3F5MA 3L06A 4IOJA 5EUBA 5U4QA 3TAHA 4ESEA 1XD2A 1HOTA 1QZZA 2FUKA 5I3ZA 5IDQA 2PGNA 4N0EA 4W4TA 4E2FA 1QSGA 4B8YA 3D7MA 3QVKA 4YAEA 1JHRA 1NXSA 4AN1A 4DPLA 2ESRA 3I12A 3ECAA 3ISVA 3JVVA 1R0KA 1WV1A 4F1KA 4DV1B 1WMDA 3H2YA 4YRGA 4JZKA 3N53A 1GG8A 3FGNA 3H0KA 3OT5A 4WCDA 1EHCA 2HSDA 4MGIR 4C6SA 5AJZA 1ZI8A 3ZJTA 3SOPA 1SBNE 4TX1A 3RAFC 2VRCA 3TDNA 1CETA 4QHYA 1KU0A 3RVSA 4CKBB 1T2NA 3TEMA 4GD3Q 4MB2A 6REQB 1C0IA 1B2RA 1J2YA 5AW6A 3QU5A 3F98A 4DABA 4DM4A 1VLVA 4FIDA 4GM1A 4LQCA 2GD6A 4RH1A 2FSGA 1RQNA 3OY2A 2MSCB 4US0R 5IKOA 4EO7A 4DLXA 3N8HA 1JEYA 4DBVO 4IQ4A 1R5OA 1H9BA 4BO5A 3PJFA 4WPGA 2EFYA 3LT2A 4OOFA 1E7WA 1M1YB 2XH8A 3DMHA 3PJEA 3X1KA 1F7VA 3HY3A 1VHDA 4X6XA 1TMKA 3GFFA 3GJ8A 3H6GA 2AG5A 3L92A 4M1OA 5TVKA 4EBFA 3LLMA 3SFTA 1O4VA 4TT3A 5AUOB 1LJLA 2Z83A 5HFJA 1PUIA 5F7XA 2R86A 3CEAA 3OEWA 3PCTA 1XTPA 4XVRA 1SKUA 4MOWA 5IULC 2WFAA 3WDLA 3JALA 5H68A 4BPRA 1IAVA 1QC5A 1R6TA 3ABZA 4I5EA 4A1OA 4CT0A 3OOSA 1XP8A 1DMSA 5T8KA 4F2DA 2JCXA 3BFKA 2HW8A 4H1VA 2J87A 2FUEA 2J48A 5JHGB 1WKVA 4F2PA 1KKLA 1SBQA 1O9HA 2DFTA 2V7PA 2IX9A 5T41A 2C9DA 4GWLA 4NJEA 5T6BA 4L2IA 2QNIA 1L5OA 1TXGA 4CRWB 5TIIA 3CBQA 2B2NA 4I4LA 4Y67A 1JYSA 3DBHA 4X3PA 1NVEA 2CHEA 1ABBA 5IBRA 3NAMA 1P2DA 3BGOS 5DMXA 1HPLA 4RY0A 1K3UB 4XGNA 4ZYUA 1GZ5A 3CNLA 5IM4F 4BNYA 4I1PA 3IAS1 4HNHA 1PQWA 4BUCA 1VPLA 3MJDA 4IPTA 1Z2OX 5CDSA 1FS4A 1DEAA 1Q95A 2F1IA 4BGUA 4WK6A 3RSOA 4GYJA 2W93A 4QBKA 4ZYXA 2JIPA 1R5NA 3ZY4A 1T2DA 5LQUA 3BB4A 3GQVA 3CX6A 4M1QA 1FNCA 1QKKA 1GITA 1XAGA 3KAKA 4IDGA 3LVFO 4NI5A 1WUIS 4OB8A 1ESDA 5DLQC 5EJFA 4BNTA 5F9HA 5HX7A 5AT1A 4DDVA 4NDNE 3QPUA 5FPTA 5HFAA 3PQ7A 5KHLB 4BGIA 4DMHA 5BSKA 4K0KB 3B2QA 3I37X 1JSXA 1OC4A 1W44A 2OMKA 1M33A 1TZJA 1ETUA 2YZGA 4HUJA 4IEIA 4DMFA 5BORA 5J47A 3HXMA 4MJLA 3L5OA 4WASA 5DEOA 4K1XA 1RQRA 4H3KB 2O7VA 2NAPA 1I9GA 1SWVA 4M0DA 4P3NA 4TLCA 1MV5A 1VE5A 1WZNA 2ZLBA 3I9FA 1F9AA 3L9WA 3LXRA 4UM7A 4NMHA 4FVTA 3NFRA 1IXZA 4C4SA 5TMDA 3L1UA 4KLAA 2A1TS 4B6FA 3KX2A 3MMZA 3TOXA 4DIOA 5EJ4A 4WKGA 1W94A 4ZARA 4CL3A 5BOSB 2VXYA 5HFNA 2O2GA 2RH5A 2VYFA 1PJ2A 4K9QA 4ZN6A 3HUTA 4FCWA 4OP2A 3F8WA 1FDRA 3CH7A 1VPWA 5ED4A 4JBWA 4EGCB 2Q7DA 3VKFA 2ZIFA 3Q3JB 7YASA 4C0AC 4NBRA 4CTOA 5I7HA 5IPFA 1GVHA 1GZVA 2DHQA 3B3QA 1G20B 4NZYA 3CLTD 5E0KB 3UF0A 4BNXA 1CS0A 2PSJA 2IPLA 3RF7A 3AP2A 3B12A 4PQRA 4EITA 2PD6A 2ZUTA 3IUMA 3V4PB 2GDZA 4HQRA 5K8JB 5AM0A 3HJAA 3S1AA 2R8OA 1VMEA 2VJDA 5KZMB 1R8SA 1AQNA 2NO7A 2W8ZA 2GZHA 1V35A 4M1ZA 2C97A 4J2TA 4UFOA 2NV0A 4URVR 3N8GA 2FXVA 3D1VA 3JAKA 3OP1A 4G0XA 4XASA 1FYVA 1JJIA 3PGXA 4RWZA 2P9JA 1QG0A 1SZDA 2WTUA 4I50A 1GNSA 2P4HX 1YCFA 1YHNA 3BB1A 3EXIA 4DC9A 2W8BA 4P3KA 1DFHA 4PHCA 2VNHA 1CUSA 4ZU6X 5GJCA 1N2EA 1J0XO 4KYIB 5BR1A 2OK8A 2GF2A 1M54A 3JQGB 3UJ9A 3EG5A 3OTOB 1C1XB 2QW0X 2WJHA 2H54A 3AB8A 1JFRA 1NNSA 3PE3A 1NYLA 2XBLA 3U48A 3WGZA 1G7TA 3C3XA 1GTL1 1ZJ4A 4YUWA 4R1QA 1NASA 1NUUA 1NF3A 2FDRA 2LTAA 4OXQA 4PZ0A 2OFOA 4UVGA 1AXEA 1PHPA 3GD5A 4B2LA 2OCKA 4TTTS 3AU8A 3NHSA 5AQ1A 2GZMA 3EDQA 2XD9A 3P9ZA 4XARA 4GL2A 2Q4BA 3DL0A 1WJGA 4IV0A 5ED0A 2CK3A 3WDKA 5I01A 4DB2A 1L3BA 3ABIA 2WHRA 4B3DA 1IY1A 1I6MA 2OLKA 1YS9A 1SHTX 2PVCA 1SXPA 1A2KC 1HYQA 3HQ4O 3JW8A 3TKYA 4E33A 3KAPA 5ALFA 2VDWB 4JVSB 3SD7A 5JCJD 5FOSA 3C3DA 1W0KD 2OBMA 3S2GA 1JEQB 4X95A 4LFCB 3TTYA 1NW7A 3HKCA 3WIDA 1TAQA 2WT9A 2DYKA 2V96A 1Z7BA 4DN6A 4QPZA 3E53A 5EIBD 1VLZA 3Q9UA 4DV3B 1ULZA 1KDPA 3EIFA 5F52A 4UBJA 2VATA 2W2LD 4AZSA 3ZE8A 4KPUA 1KBQA 2C9CA 2OUIA 1NMZA 1OAAA 4E2WA 3FNHA 3KYDB 4YH1A 2GD0A 1J99A 2ZB7A 6PFKA 1SEPA 1G20E 5EJGA 3G0BA 4JI5B 4B3MB 2VDRB 4HWOA 1QQ5A 3VQTA 2F8TA 1KYWA 1RPJA 3RU3A 1Y4SA 1TM5E 2JI4A 3AESB 4IHAA 4KIFA 5E1MA 3TNJA 1V0JA 4LJ8A 4K9PA 4R9UC 4AS3A 4FD2A 1VG1A 1T36A 4WXPA 4KWHA 4XR4A 5A03A 2DFKB 1N6NA 3BJZA 3MXTA 5ICSA 1CUVA 2RGDA 4UDNA 1N4AA 4QOIA 4EMTA 3C8MA 3M1IA 1E6EA 4ZZ2A 2VT3A 5F1PA 2UZAA 1VECA 5FTWA 3U7GA 2I2CA 3E9EA 2BTEA 3H6KA 4A0QA 5JROA 1ORTA 2GFQA 1UZUA 3EDMA 2QYHA 1EQUA 1OXMA 3L18A 3LIPA 3LUDA 3QITA 121PA 3NTQA 4GP9A 4TV8F 3TMYA 5JNWA 1RLIA 1ZD1A 1PR6A 1D4ZA 4PQFA 3LG2A 1U3DA 3DV0A 1T5DX 2N1MA 2F64A 2VYND 1EMDA 1FNSA 4IP0A 3WGVA 3ZDEA 2HI0A 3L6EA 3QBTA 4MKFA 4F84A 4B3XA 3I6IA 5DP1A 1IXSB 1VBNA 2GF0A 4L5JA 1DRUA 4W1QA 3JATA 5BXQC 2PWBA 1BOFA 1H6AA 3RVOA 3IQDB 4UHHA 1QO0D 2XKAA 4FR2A 2EKZA 3X1DA 4XW2A 2C2GA 3GLUA 4F3TA 4OIFA 4MV6A 3GN2A 3GRUA 4KFTA 4QLBA 1MGOA 2NQ2C 1SURA 3A6EA 3MRXA 2ZB8A 4IZIA 3MYYA 5KTYA 2VP9A 1PUJA 1MFPA 2G67A 3GAFA 1TI7A 5B6PA 1M6VA 3UK2A 1CDEA 4NHOA 1A9ZA 2VDJA 1V8FA 2DWOA 3R0ZA 1LVUA 2BUCA 2GA8A 2GK7A 3NM5A 3GH1A 2B82A 4NZMA 1YZQA 1G8PA 1UEJA 4UJ5A 4CLDA 4RMNA 2GCOB 3EZNA 5ECGC 2P9QA 3R3JA 1EXNA 4HX5A 1UM9A 2NU9B 4EHBA 4NWIA 5LYJF 1SBZA 1DRVA 4BWVA 4LCJA 3U3XA 3VAYA 4E5UA 2Z3WA 2VNAA 5HR5A 2PQ6A 3ENZA 3MCWA 2HPVA 4OK3A 1HE2A 3UAGA 2J46A 3WGUA 1D6NA 5BPHA 3I09A 2WAMA 4QXPA 5KWJA 1N3LA 4TSFD 4A9AA 3EY9A 2GRAA 2EFJA 2CLMB 1E1MA 2PZLA 1T5LA 1NKTA 2V3WA 2WPNA 3CEPB 4QODA 2ORED 2QROA 3V8PA 3QKSA 5EJIA 1ZGBA 4OGGA 2J5QA 3FSGA 3CHYA 1F2UA 1R0YA 4MRSA 1KL7A 1ZK4A 1GQQA 4BLWA 2GF9A 3OUTA 1P4HA 1OWMA 1RAAA 2CFCA 2JFGA 4J7UA 2VI5A 3TR6A 3EXEB 5ADVA 4EENA 5BN3B 4IJ6A 1K7CA 4N49A 3FIJA 1FNBA 1EWTA 4HNUA 4HH4A 1RQ7A 1U7UA 1W96A 4EPYA 4WBXC 3WK9A 2YWHA 1Y5LA 1TJYA 3P8ZA 4LQDA 2A78A 1NQUA 2Q6LA 4L8FA 3T1VA 1TF2A 1T25A 1CZLA 3FYUB 2JZOA 3OTWA 1WABA 2DR2A 2XA2A 1PYOA 4BQIA 2P79A 1K63A 1ND5A 1YRWA 2DQZA 2R6HA 2ZE7A 4J0GA 4LWQA 4OD0A 5G0SA 3LH5A 1I51A 1SUSA 2ZJZA 4QGGA 5B6JA 3GJRA 4ZK6A 4MDYA 3G0DA 3ZJUA 3I5YA 2HTEA 3DKKA 2CLIB 1J6UA 2A92A 1UXIA 3R76A 4N48A 2VHVA 2ASEA 2JIDA 4YDQA 2Y0PA 3BGWA 5FUXA 4BX3A 1XQ1A 1DFGA 2VEDA 2QRNA 4PZCA 4AU1A 2QTNA 4AWBA 4RX1A 1WPGA 2UAGA 3EPHA 1Q0RA 2EG5A 1IYZA 2Q9AA 2YJGA 4JBGA 4UOQA 2J5XA 4Y9UA 3TQOA 1AZSC 4MA5A 2A3RA 2CNWD 2X7XA 3LHKA 3ONDA 4JIMA 3Q3CA 5EVCA 4CM1A 4CM9D 5KU7A 4Z4IA 1I4OA 4Q1DA 3SGLA 3VVCA 3H99A 2GAAA 2PX6A 5BNFA 4G8DA 4Q93A 2RB5A 1NRIA 3NH6A 3V8EA 4HYYA 3VI4B 2A9KA 4KMSA 1OLSB 1UMDA 2TECE 3Q3HA 2Y1WA 1MA0A 3SHVA 1BDMA 2GJ4A 4BLSA 4P5PA 4LV6A 5T4EA 3JQ6A 4I9GA 4EGSA 1X7GA 3GF4A 4P3PA 1NQXA 1ISFA 1TQ4A 3FF4A 1QLJA 3O3OB 4Q1FA 3UXYA 5SYAA 1DAPA 1GZ4A 4R84A 5IJAA 2ZYWX 3WGOA 1EIWA 4YUXA 3K3PA 3D1LA 3M7IA 1T1GA 4BS9A 2IVFA 4WIAA 4X7RA 4NMMA 1RBMA 2Z5VA 4D44A 4RPCA 4AKHA 1R9JA 5HVNA 1WUYA 3RBXA 4FE7A 2JF0A 3BWBA 4G8JA 2R1ZA 3Q85A 4FZRA 4RKRA 1OFHA 1G38A 1E0SA 3NUZA 2VPIA 5E3JA 4H1UA 2GBLC 2OHFA 3HB0A 5KREA 5J9FA 4DA9A 5JOQA 4Q3DA 4LVUA 2OWEA 4N5HX 4C0BA 3I4FA 2ODBA 4TLLB 4RDIA 5DWVA 3T3MB 2EKBA 3PXEA 2ZB3A 3W79A 3BSYA 1F1JA 4Q9HA 1V3UA 3P2EA 4L3OA 1QPZA 5TMPA 3E1KA 1O95C 2XGGA 1X2BA 3A2LA 3QJ5A 2YHIA 4RHCA 4TKVB 4P82A 2FSIA 1MAUA 3QWBA 3K4QA 4NCNA 4I5DA 4LBWA 5SZKB 5C4IA 2RI1A 4XWTA 4BBZA 4CM3A 4IUDS 3U1BA 2O19A 4RCVA 2WZCA 3DTVB 4Z3KA 3V1UA 2WTEA 1YC2A 2YYSA 1JF8A 3HHEA 3LT5A 3WL3A 5K09A 3CJQA 5IKEA 4L74A 4JLJA 2R6R1 1RKBA 1VDZA 2FEPA 4IDHA 1VE1A 2BLLA 2HD4A 1ID1A 4ZJYA 4QUKA 1NUPA 3VHRA 3UT0A 4HVLA 5KWEA 1EWQA 1JYEA 1HZZC 3VYRB 2EHJA 2ZRAA 4G4IA 2O06A 2B36A 1L3IA 2WDPA 4A6PA 1M2NA 4PLFA 3A6JA 2XXJA 2PQ2A 1EFUA 1QAMA 3H9GA 3RBZA 4AZ0A 4G0MA 4OH1A 3UMJA 1VP3A 1WXWA 3M1YA 3OE5A 1TLLA 2NO4A 4LPSA 5DWDA 4A8JB 4JB8A 3HC7A 3R75A 1CE8B 1LPSA 4G5XA 1BEUB 1Y1KE 1HG1A 2Z3VA 2R00C 2QVCA 1AH2A 4NX2A 3HVJA 1NRXA 1WPXA 4I55B 4HLDA 4YAIA 2YKGA 1KARA 3K2IA 2WJ4A 1JI3A 4XUCA 3GCXA 2P6UA 3N6VA 3SY8A 3USCS 3FR7A 4B75A 2IEBA 1FZQA 4GGPA 2H29A 2AF3C 4TM7A 2I78A 5FAKA 5C8VA 2HMWA 2ENUA 5IVIA 1KE1A 4Z53A 3NG1A 4IY1A 1Z12A 1ZM3A 5TMBA 2W7TA 2HQRA 2PUHA 4L4RA 3WBKA 1EE9A 2H7XA 4YV2A 2QGZA 4UFNA 1J9ZA 1IBRA 3LUPA 3W2EA 4D9JA 2ZYSA 2FUG1 2GHRA 2Z1DA 1PQYA 1Q0LA 1KAMA 1VKJA 1XTZA 3BS4A 3OA0A 1TD1A 1ZVMA 2J9ZB 2ZEJA 4FYPA 4V0ME 1NVFA 4DZRA 1ZVVA 1YFLA 1EWVA 1DX6A 1USUA 2PZMA 5DGHA 2A9PA 1GAWA 1T34A 2CLLB 1I8TA 2WIBA 1XTTA 3RAJA 3HL0A 4XCXA 2YIJA 2FX5A 1NT2A 4RNCA 2OGUA 4BV2A 1AZLA 5B2EA 1KRWA 1U90A 4R05A 3Q41A 4FYIA 4LA4A 3U9LA 1Q1ZA 1U63A 1NULA 1H1LB 1W4CA 3FAKA 4HGYA 4W99A 3WYFA 4DYHA 2P75A 1FP2A 4Q3LA 4O5OA 1ONBA 1ZBQA 1HE3A 1LFAA 4G5RA 1BFUA 1M1NB 1UFRA 3D3KA 3F9IA 1IZYA 4IQ0A 4K40A 1D7AA 2FKNA 2OZKA 5KTOA 1B8NA 3W3ZB 1CX9B 4K05A 2SBTA 3JARB 4TT8A 1TA0A 3ZV3A 2QTWB 2HA7A 2OP1A 2AMFA 4TQ9A 3GGOA 2OA0A 3WZMA 3C16C 1B0ZA 4CHTA 3I0ZA 4INOA 3T5AA 5JCOA 5JC8A 1KRXA 2R60A 2NO5A 2EAUA 2B4RO 3MIZA 2W22A 4Y2GA 3R7NA 3VU1A 1S9HA 3AI3A 2YN2A 5E6UB 1XD2B 3RT9A 5I7RA 5DBEX 1N3IA 3DC7A 2XNDD 2Y05A 1U28C 3E5RA 2Y2UA 2ECQA 2C3MA 3LC7O 5HKBA 1JLMA 3OQBA 5EE0A 4XTRA 1R6BX 1V4VA 5H7XA 1EP3B 3A1WA 4AP5A 2PV7A 1ZGCA 3DBLA 3G6KA 1ADFA 2AFHA 1LBHA 1VRCA 5JANA 3EPLA 5JWRA 1G2QA 1RR6A 3G5UA 2WU0A 4L4ZA 4P31A 1E7SA 4C5CA 5T7BA 1L1QA 3CO5A 3EXHA 2OHVA 2WJIA 1NF2A 2ZE6A 1VGQA 4R98A 5AKYA 1OJLA 2D5AA 1I3LA 2HRBA 5L7YA 3DW3X 3TQHA 4OI4A 3X2FA 3ZQUA 4E11A 5FI1B 2DBVO 1PR5A 4B7AA 3U5ZB 1XFDA 5JE8A 2BY4A 1LDNA 3PX2A 4LOAA 2M6KA 3VAAA 2G04A 4GPEA 5JMWA 1HLFA 2FW9A 4U7JA 1A04A 3CZPA 1WTAA 3INRA 3HR4A 4ZQHA 1JEYB 4D8YA 2FW8A 2WZDA 4LXUA 3K6SA 4QYIA 2XBMA 4OI1A 4WAUA 2RBGA 1T8SA 2BMEA 2RHTA 1U6KA 1WX1A 3RO7A 4FZJA 4FX2A 2IU4A 2FSUA 3DO6A 1NG1A 2R6CA 2W9XA 1O2DA 1G8JA 4RVUA 4LV8B 4AKEA 3VA7A 4R0VA 1DZ3A 2XNHA 3HXTA 1PR0A 4R6XA 3QOFA 5FTNA 1UKEA 4AURA 4IDDA 4F5EA 5ILOA 4GL4A 2VSQA 4DDWA 5M5BA 2G3YA 1P9OA 1OI7A 3DO8A 4B46A 2VF5X 3JALB 3TCKA 1L5WA 4E51A 2H16A 4JN6B 1RYBA 1YB5A 1INLA 2VHZA 1PTJA 2C5HA 3D6MA 2QLNA 3CUWA 2C9BA 4KGXA 3ZV4A 3OQMA 4BE9A 3KFLA 4WLVA 3THOA 3HCFA 2NYRA 3QMPA 4NJEB 2VN8A 3ZHTA 4L2IB 4B4WA 1RM0A 1POWA 2BHLA 1SCUA 2YV2A 3QLUC 3DBHB 3QW2A 1ECJA 1VE7A 3FVTA 1FFGA 1R0WA 5DU2A 4DUGD 4DLZA 1P60A 2G9VA 5CHEA 1OBFO 3T5MA 1QFSA 4HJXA 4YRRA 1S7CA 2HDOA 2JKZA 4R83A 1TECE 2QD1A 3EIOA 4XA8A 2R7KA 4J7CA 1NVGA 3LCUA 4OHPA 4C6RA 2JGDA 3T1HB 3KDAA 3EZYA 5AKXA 5KYXA 2OHJA 1MN6A 4LJ6A 3RQIA 3BQMB 2X0NA 4MI3A 3EWNA 4YJ3F 3I2IA 1I2ZA 3QVWA 5K6RA 4FU0A 2XKJE 3C45A 4W8HA 1W7AA 3E7WA 4WX2B 2IUTA 3AQIA 3A1TA 1P7VA 3PF9A 2ZBFA 4M36A 1JDTA 1YHZA 4GQAA 5CYFA 2BFNA 5B1DA 5JEDA 4OIMA 2WSMA 1FX0A 4M0CA 4BO7A 1YS7A 1SUWA 4FHZA 3KT0A 5FNVA 3WK5A 1SXJC 5CK4A 3MQ2A 1B8OA 3PHIA 1R3UA 4FLFA 4F96A 4M37A 4ZYZA 4KFUA 1W48A 4KAJA 3FD8A 2WABA 1YKGA 4C29A 2IPNA 1X7YA 2J6HA 2P6PA 4RSGA 2A9RA 3IB3A 3L0ZA 4YCLA 1Y42X 3NVMB 4PXYA 4N0MA 2Q2VA 4B4KA 1BS1A 3QU4A 4Q7LA 5GOZA 3DV2A 1JU4A 2FX2A 1QANA 2XT0A 4BNDA 5B4UA 3IAFA 2B6NA 3LFHA 1J9EA 2NZ8A 2FN7A 3HY6A 3R6GA 3R9XB 2O5EA 4R8LA 2RH8A 1JE1A 1N5DA 2E5FA 5ESWA 3JZFA 3S2UA 2GNPA 1T43A 2JJ8A 3UAXA 1PT8A 3UJ3X 5DHSA 2JHFA 2O1WA 3W3AH 2BMDA 2FPOA 5ALPA 1ESMA 1JT2A 2QE7A 5KX5A 1CS0B 3LOPA 3QWFA 3UJAA 1RXCA 3TTUA 4EB0A 3LJKA 4EUHA 3M3PA 4K03A 3QX7A 1AMOA 2EFEB 3S1AB 2IIVA 2OMEA 4TM8A 1BYUA 4LF6B 4IUCS 2J8ZA 4YR7A 3H8WA 5A3QA 4U3JA 3TLJA 4KNYA 4ZQIA 4ZZ0A 4AY3A 4FHDA 3HADA 1EBUA 1EX6A 2HRCA 3JAKB 4JB2A 4D5GA 1ZICA 2Y0BA 2ONCA 1O94A 4OJNA 4C3ZA 3R3UA 1ZR4A 4LDZA 3BRCA 1B76A 1YK1A 2ZJ4A 4I50B 2C31A 3EXIB 1UM8A 1DKLA 2W8BB 2H17A 1I80A 1VLMA 2Y93A 2MYTA 1DADA 2HA5A 2I54A 3O4JA 2DWCA 2ISQA 2YQZA 1BX0A 5FEMA 3LWZA 1FP6A 1U2EA 1GPBA 3EC2A 4FQ7A 5F73A 4O4HF 1JHPA 1A7UA