3VV3A

Crystal structure of deseasin mcp-01 from pseudoalteromonas sp. sm9913
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
329
structure length
329
Chain Sequence
SATNDPRFDDLWGLNNEGQTGGTADADIDAPEAWSISTGSRDVVVGVIDTGVDYSHPDLAANAWVNSGEIAGDGIDNDGNGYIDDVHGINAITDVGDPMDDEGHGTHVSGTIGASGNNGVGVVGVNHDVSIVGCKFLAADGTGSTSGAIKCIDYMVGLKNAGVNLRVLNNSWGGGGFSQALADAITASEQADILFVAAAGNDAVDNDQNPHYPSNYENDNVLSIASTDSRDNMSSFSQWGLTSVDMGAPGSGILSTVPGNSYATYSGTSMATPHVAGAAALVLSVNPDLTTLELKELLMSSGDANAALNGKTVAGTRLNVNQALIDADP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Collagen-degradation by the Bacterial Collagenolytic Serine Proteases in the Subtilase Family
rcsb
source organism Pseudoalteromonas sp.
molecule tags Hydrolase
molecule keywords Deseasin MCP-01
total genus 124
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3vv3A00
2DUJA 5JXHA 1JEAA 2WWTA 4OMCA 1Y4AE 1ZVKA 2X8JA 3DE7X 3GT4A 4RYDA 5CW1A 5FBZA 3WHIA 3AJ9A 2PWBA 2WUWE 3DE4X 1SBHA 3PRKE 1OYOA 1OT5A 4KPGA 3EE6A 1UBNA 3DE5X 3DVSX 2W2MA 4ZOQI 1SCJA 1V6CA 3A3OA 1SUBA 1DBIA 1GCIA 3UNXA 4CFYA 4Z2AA 2SBTA 3Q40A 3VYVA 2W2NA 1Q5PA 5AMXA 1SUAA 1BJRE 2HD4A 1TM4E 4H6XA 2PKCA 1AVTA 1AV7A 1V5IA 4K8RB 1WVMA 2ZRQA 4M1ZA 1SIBE 1AQNA 1BE6A 1Y9ZA 4KB5A 3DWEX 2G4VA 5JXIA 2V8BA 3AFGA 1NDUA 1YJBA 1Y1KE 1T1EA 1TECE 4ZARA 1A2QA 3VTAA 1SPBS 1MPTA 2IY9A 3DVRX 2PWAA 1CSEE 3I37X 1NLUA 5AVJA 3WQBA 1R6VA 3DE2X 4C3VA 1SUDA 1AF4A 3D43A 3BPSA 3PTLA 1GT91 4NE9A 1MEEA 1BH6A 1LW6E 5AQEA 4CFZA 1Y33E 5SICE 1SH7A 3I34X 1SUPA 2Z56A 3AJ8A 2SNIE 3F7MA 1Y4DE 1BFUA 4CG0A 4BWGA 5ARCA 1PJ8A 1BFKA 1YJCA 2ID4A 4AKTA 1GTL1 1KE1A 4DJ5X 3QMPA 1TM7E 3SQOA 1GA4A 1S02A 1Y48E 1ST2A 1GTG1 3DYBA 3VHQA 3DE3X 1P7VA 1TO2E 3TI9A 1ZVJA 2PMWB 1SUCA 1T1GA 1TM1E 2B6NA 1C3LA 3I2YX 3ZXYA 2DQKA 4DWWA 1SVNA 2Z30A 1KDVA 1SCAA 4JP8A 4J94A 1SIOA 5FFNA 2W2PA 4B5LA 4H6VA 2SICE 1CNMA 1SCBA 4LVOA 1TM5E 1AK9A 1SCNE 1WMFA 1VSBA 3LPDA 5FAXA 3SICE 4C3UA 1Y3CE 5B1EA 3F49S 4H6WA 4YN3A 3DVQX 2ID8A 5JMOA 1SBNE 4HX2A 1XF1A 2GKOA 2ST1A 5I9SA 4DZTA 3WIVA 3A3NA 3HJRA 3DE6X 3DW3X 5ARBA 3LXUX 4I0WB 1PFGA 4NE7A 3D9QX 4KG7A 1R64A 3ZXXA 1EA7A 1R0RE 1GA1A 1GNVA 1BE8A 3GT3A 1THMA 3DW1X 3BX1A 2PRKA 2DP4E 3GCXA 1PEKE 1C9JA 1NDQA 1EGQA 3DE1X 3TI7A 4OV6B 3EDYA 1SBTA 1P7WA 2Z2XA 1Y3BE 2Z2YA 3QTLA 3P5BA 4MZDA 2SECE 1IAVA 2TECE 4AKSA 1GTJ1 1SBIA 5JXJA 3L1KA 1P8JA 1Y3DE 1DUIA 1GA6A 2PQ2A 2QTWB 1ST3A 1TMGE 4GI3A 4OMDA 3DDZX 4WOBA 1KDZA 1SIUA 2Z57A 1YU6A 1T1IA 1TK2A 2XRMA 3A3PA 2ZWOA 1S01A 3BGOS 3CO0S 3T41A 2XTJA 1KDYA 1S2NA 1SN7A 2X8JB 3LPAA 1WMEA 3QFHA 1SUEA 1Y34E 2Z2ZA 1WSDA 1KE2A 2PYZA 2WUVA 1Y3FE 1TO1E 1AH2A 3CNQS 2WV7A 1TM3E 5K7SA 5B1DA 1SELA 4HVLA 1HT3A 1AU9A 1IC6A 2W2OA 3VSBA 3H42B 1WMDA 3WIUA 4NMXB 4WOCA 2HPZA 3I30X 2P4EA 3LPCA 3EIFA 3DE0X 5AVKA 2W2QA 4FONA 3GCWA 2E1PA 1PTKA 3TECE 3OSZA 5ARDA 2Z58A 1SCDA 1OYVA 1SBCA 3VV3A 3Q5GA 1GNSA 4LVNA 2IXTA 1C9NA 2ZWPA 1C9MA 5JXGA 1YJAA 3F7OA 3VV2A
chains in the Genus database with same CATH superfamily
1E7YA 3LV8A 2CMGA 2AMYA 1LPSA 1YDEA 1BS9A 3MIIA 4HLUA 2QGNA 3GBVA 3N8NA 3MRTA 3F6BX 4MEBA 4WPGA 1XKXA 3RGGA 3D3JA 2OO7A 1RAIA 1S9DA 4BJHB 1V1MA 2JGEA 4QRIA 5HZKA 4FHCA 5MHTA 4EKNB 4K81B 2F3RA 2W11A 5JANA 3SLRA 1WF6A 1NULA 1QYXA 1V8DA 3L0SA 4DCTA 5CCEA 5HKOA 4Y0NA 1J7JA 3VVCA 1WHTA 3QJ5A 1T3HA 1ZMRA 1V25A 1VCOA 3L4SO 3DWEX 3AY7A 3E7FA 3KDSE 1S89A 4RAOA 3U56A 2ZU0C 1BC5A 3MUNA 1T6XA 2AI2A 4A8JA 1QIHA 2R85A 3Q9UA 1OUMA 1N1DA 1E1QD 4XZ3A 3O1LA 4GNRA 1W59A 2Q5IA 3KXDA 3QELA 5EUMA 1Z6PA 2PLNA 2NSHA 3NIDB 1JPVA 2Z6VA 3BRQA 3NETA 3GFOA 3TFWA 3ZEIA 1GUAA 1JQBA 3IVAA 1R5BA 4HUJA 4KIJA 1L1FA 3ZVNA 3GXOA 4KVZA 1BAPA 1P7YA 1U04A 5C8ZA 1I01A 1KBZA 1QX3A 2WNIA 3GT0A 5THQA 4D81A 5BN3A 1H0HA 3FSRA 1VPWA 3WYDA 4RPCA 2B83A 3K1TA 2Q7DA 4HWOA 3JD3A 2XAUA 5A1TA 1DHTA 1DQPA 1GPLA 3FYCA 4Y2SA 1N3YA 3CX3A 1ICIA 3TMAA 2V6JA 3NHPA 1YU9A 4W63A 2R7MA 2AHOA 2E4XA 2WT4A 1QRAA 3IERA 3CPHA 3NEJA 4X62B 1H66A 1SY7A 3OI7A 4EI8A 3M2PA 1G8YA 2OFWA 3EUAA 1JU3A 3B1YA 5AVZA 2XNSA 3MYRA 4LWQA 2QL7A 3RIGA 1E64A 1PEDA 2O52A 3NHFA 3ZQ6A 5KNBH 4CNBA 5K6AA 2E5WA 3WNCA 1SCNE 1T10A 2ZRBA 2H1RA 2AZMA 5EP3A 1BN6A 2XB8A 2H8GA 2HHJA 1IY0A 5KC9A 5CAEB 1KZGB 5F2KA 3RUHA 1CB0A 3VDNB 5CA0A 1EFDN 2RB5A 3EG5A 4G5RA 4V3CA 4C5BA 4LUCA 3UAXA 1QLWA 3L8CA 1L7VC 1T29A 3CLHA 1U1FA 4QDJA 2JZCA 3L41A 4TVKA 1XZQA 3R5JA 4DADA 2VXBA 4Q4AB 3WLKX 1K7YA 3ITNA 1R64A 1S8FA 2F8LA 2ATEA 1EBBA 2Y99A 2X0RA 4TZ0A 4H7DA 1SU6A 3OWXA 5CFPA 2C84A 4EVIA 2HXYA 4NU5A 1KY2A 3R7BA 2QV7A 3H11B 3LD9A 2GCOA 1ZNWA 2E89A 1DQYA 1U2PA 4AD8A 4DV3B 4XJSA 3L5OA 2P9CA 4PLCA 4R2HA 4JWKA 4XKJA 1Z17A 3WV4A 3PNLA 1O5IA 2JRLA 4UZSA 4ARSA 1AMNA 2AL7A 4MUJA 4ZT5A 1C4XA 1P81A 4EI7A 5EWLA 4L9SA 2R48A 3OCCA 1Q44A 1WHSB 4WZBE 3VDMA 4DV1B 1C1DA 3IEUA 3QE2A 1UDXA 3IOBA 4XW2A 1GRNA 2FZLA 4PO1A 4PXYA 4HYQA 5IC5A 2DR2A 1VP3A 4F8YA 1Q1EA 3MWEA 3I73A 4NWIA 1TKBA 3A04A 3CVOA 1BVUA 3LPCA 1EK1A 2BGNA 2H1FA 3GEPA 3LBAA 1K3UB 5C8YB 3MQ4A 4D82A 4D4GA 4PYKA 2JEZA 1UT6A 3AHGA 1DX9A 1E3MA 1JJFA 2ZIGA 4LRXA 2B30A 4G9EA 3IC5A 2POCA 3GAMA 3K8ZA 2B98A 3S1AB 5IF9A 5JXGA 4QD3A 3RVNA 3I53A 1KU0A 5LP1A 2JC3A 1I7QB 3JQAB 3ML1A 1AS2A 5HBRA 3IVRA 4RZ3A 5HXAA 1SKAA 1UZMA 3KJXA 3V2HA 5C80A 3M82A 1DBIA 1DCFA 1BMTA 1NU8A 2CLIB 2OK7A 4I50A 4J8PA 1K89A 4BVAA 3IOYA 5BV1A 1L3BA 3VPAA 1BOFA 2CNKA 2K87A 2R84A 3K09C 1P6QA 2N46A 1IRIA 1JAYA 3OURA 1UH5A 4MUGA 3UHPA 3ZZ0A 3Q7PA 3D8BA 4M46A 4ZV9A 2RGUA 3NMUF 1BEUB 1TIPA 2FWPA 1G3QA 2C9OA 4NZZA 2PRSA 3FSJX 4K26A 3UIEA 1U7DA 4F96A 3LUJA 4DY6A 3PQ2A 2AZTA 3QYPA 1ZIYA 4ZANA 3OJLA 4DDMA 4QPCA 4YV7A 3IAM6 3PC2A 2FWJA 3QKRB 2CC2A 5MF6A 2BUBA 4AICA 2DHRA 2Z83A 4ML3A 3TEFA 4ER6A 1OILA 2A5LA 2JFQA 2K2WA 4NCJA 3R4CA 3BIFA 1XPOA 2BFNA 3OBIA 3RLFA 1KE1A 3UVEA 2IQ5A 2AN1A 2YY6A 1YR1A 3OE4A 4JHLA 4KDEA 2BSXA 1MX5A 3FJ1A 3DV0A 3JQCA 4YFVA 5HE9A 1KQNA 5E1DA 4EEXA 5L4NA 2Q5CA 3WDSA 5I3CA 1QH9A 1GIAA 3FPAA 2OR3A 3GA7A 3QVWA 1NP7A 2JVKA 4HDRB 1GUFA 2O3RA 3OWOA 4DRXB 3IQGX 4HDNA 2E21A 2QI9F 3FWZA 4E3ZA 1P0MA 4ZOAA 4C4TA 2DJ5A 1LPMA 3E9YA 4WFJA 5JPCA 3I8XA 4PYLA 3R4VA 1V2HE 1TEXA 4GX1A 4JQCA 3G79A 3MN1A 4FD3A 4LF4B 1E18A 1NYRA 1ORVA 3F4KA 3LUHA 4ND1A 3UMMA 5E0OA 5GOTA 4NBWA 3F3SA 5C31A 4F21A 2AOXA 3KKEA 1J9GA 3ICVA 3QELB 1IMJA 2IIBA 4WHMA 2IQIA 3JZMA 4HFNA 4GOMD 2P5UA 1DBSA 3EQZA 4KITB 5K01A 3ZVKA 1FVOA 4A1OA 4UDNA 2QN2A 3RWMB 1FDIA 1ZR2A 3NHZA 2ZYAA 2FFHA 4JI1B 4O4IA 4O5AA 4EOGA 1Q12A 4WOBA 1PP4A 1ZRHA 3GP5A 3A3PA 4NEQA 4OBBA 4QBTA 2PUBA 1QIDA 1GFIA 1GVHA 1RBYA 2B1JA 2QLBA 3GCZA 4KQ2A 4M55A 4PAMA 1IJBA 2PH7A 4IIXA 3A7DA 1P1CA 4POOA 1UFVA 2IYRA 5CH8A 1B6SA 1ZIOA 1W1UA 2PLFA 3DAHA 3OWHA 2GDJA 3ZHVA 1E9RA 3W0LB 1ADFA 4G0YA 3U44B 1B14A 2L82A 3IX7A 3PP8A 4HUTA 2DUWA 2KBEA 3CE6A 3VV3A 4YO7A 5DM0A 8ADHA 3F4LA 5EQFA 4BTLA 4EG0A 2W4QA 4L8LA 1C9EA 3C4QA 1OLOA 4Q4JB 5DGIA 1IY8A 4M38A 4W9NA 5JBNA 2A7QA 1CDZA 2P3LA 3AVOA 1KEVA 3CR8A 1DC7A 4G84A 3F98A 4MCHA 2DY0A 5LWHA 9GPBA 1G8FA 3CWQA 3DVSX 5KJFA 3AR9A 5KKCA 1SD1A 1MJFA 1VHJA 5I51A 2GCOB 4E4TA 2XKAA 4F4HA 2D13A 5HRCA 3WC4A 4PVDA 1WEHA 1Z75A 1EP1B 3GEIA 1I9GA 1X15A 2BTQA 4E5UA 1PFYA 2WAYA 5LP6F 2IHYA 1DXYA 2V8BA 4JK3A 3VR2A 4EY3A 1RC0A 4N0PA 3ENZA 1A72A 5JBQA 1GTSA 3QK7A 3VOBA 3Q98A 2BKVA 2G4CA 1SQSA 2BFDB 4B3FX 4EDHA 3BHJA 3GLFA 2V7BA 5TEVA 4ABTA 3BPSA 2BE7A 3MOGA 4GDFA 4PN3A 1IFXA 4YA6A 3UPTA 1Q1GA 2MU1A 5JVDF 5ICMA 4G2NA 3AJ8A 2B4AA 4TTQA 2EBWA 2HA2A 2P79A 3AR2A 4Y8VA 1SXQA 3V55A 2HUPA 1Y9AA 4RZUA 5EHNA 2JI4A 2C96A 2F4VB 2FPSA 1JU4A 1KPGA 3T94A 5DNVA 1EVIA 4IJ6A 4EL5A 1W88A 3OE7A 3U6BA 2UZ4A 3SR4A 3V7NA 3MT9A 2OBXA 3NHJA 2QTHA 1FEZA 2AG8A 3X0DA 2XAAA 5DZSA 2A9QA 4UMVA 4M7PA 1WEKA 1AXEA 3HRIA 2XA9A 4KDFA 2WNSA 3TINA 1X74A 3GUCA 4O59O 4FBMA 3FVRA 2GXSA 2VLBA 4OVKA 5F64A 5IKPA 1ZJ6A 3K94A 1SOWA 1R3DA 2ET6A 1RIFA 4P38A 1RXUA 4ZT2A 2EYQA 1Z4NA 1Y5LA 3ZCXA 4QA9A 5EJ8A 3QE9Y 3LC7O 3NIWA 3VU3A 4OHXA 1W4CA 5AJTA 4LJSA 1KJIA 2KJQA 4LTMA 2PXCA 4MWDA 3VKWA 4OCZA 1LSOA 2BEWB 4RWEA 2AOTA 5AUQA 3S70A 4C7OB 2RGRA 2ASEA 1K8QA 2XUGA 1KOLA 3OHSX 3AINA 2XY4A 3QKRA 1FX1A 3FNHA 1XQ1A 2VTKA 4X7BA 2QEQA 3FW1A 4OHBA 4WJZA 3QF4A 4FLMA 4FSXA 2XLCA 1DC3A 3FD8A 3PPXA 3EQ6A 5LXTF 2WJJA 5DI3B 2ZVQX 1C9YA 1YU6A 3A6HA 4EFKA 2O2IA 2O3QA 4IXNA 5HDBB 5CFNA 4YAUA 4EHKA 4G5XA 5F4ZA 3U7HB 1KY4A 5CB8A 5ALNA 2WQ7A 3PEYA 2GR9A 4DCMA 5D3KA 1A7UA 1NF8A 4RXMA 3RE1A 5IAKA 2OV8A 4B2PA 2WJVA 3CS3A 4M8NE 1AS0A 1FDUA 2AKEA 4WOCA 3AUAA 2PZAA 3SC3A 3CW9A 3DE0X 1RS0A 2HT6A 2VATA 5A7HA 2VHTA 2FQWA 3I4CA 4U7JA 3PUVA 2O8EB 4URFA 1L2TA 1H65A 3KV1A 2NSJA 5LJLA 1E2EA 4PINA 1NSTA 3HP1A 3QG1A 4EJSB 1SVLA 1KAHA 3FH0A 3SF8B 4L5BA 3MPUA 1EESA 1RQ2A 3FSGD 4WNAA 2WUWE 5D5QA 1XWWA 3AL0C 3OLQA 3OU6A 4M87A 3HB1A 1A2OA 3UBTA 4C5CA 1A9ZA 3W6UA 4GOXA 2AR9A 2PXAA 2X8WA 2AFHB 3DM5A 4QAJA 1AO3A 1SHUX 1M75A 1WCV1 3EDQA 2XW6A 3KFLA 1CJSA 2FYTA 4FFWA 2FFQA 2CJWB 2OK8A 4U7DA 4OXQA 3TG8A 3IP3A 2VPZA 3BB4A 4EY8A 1ADJA 3H2YA 3QSYA 3HC7A 3KTAA 2HXGA 2XV1A 1ULBA 4AJNA 1IJFA 1C81A 4E4RA 2F3PA 2IY9A 4LEIA 1LK5A 4Q01A 5IHPA 3N2EA 3CUEF 2FVXA 3RRMA 3TCXB 4EECA 2ADOA 4OHPA 2Y2VA 3B85A 3IA7A 4FTWA 3N2IA 2XUOA 5CXUA 2Q1UA 3G82C 2EZ4A 4HXGA 4NYMQ 2EX1A 5FBRB 1T1RA 1Y8RA 2VFAA 1YJCA 4G25A 3OPQA 1ZVQA 3NBMA 3KPWA 2H2DA 2PGXA 3C7AA 4FR0A 3F47A 1ZUWA 4JP5A 4LYYA 4RZIA 5CM9C 1KYZA 3LOUA 4YCAA 1O03A 2BTEA 1I5EA 1M6VA 2DQYA 3DS8A 2CE7A 1R6AA 1JF8A 4NY1A 4DJEC 3W78A 4GX5A 4F9TA 1X92A 3VU1A 1NBMA 4BU0A 2I1QA 3DPSA 2OHFA 3GXBA 3LHIA 3G9TA 1BXZA 1F6BA 4B8ZA 3DWIA 4PC6A 1KSJA 4QTZA 1CPYA 3H75A 4EJMA 2YJ5A 4ROTA 3GPLA 2G40A 2C1ZA 4RF2A 2DE0X 2QX7A 4TV8B 4F71A 1P18A 3SXUA 4RXUA 2COUA 1UEXC 4LNAA 3U7QB 1QGUB 4N39A 2O4CA 3AVTA 1ZH4A 1FJXA 4ZI7F 3M3HA 3QVXA 5KPDA 1GYQA 3I42A 3VPCA 2BFEA 4AJLA 3DDNA 1BEEA 5I48A 4Q7QA 3A26A 4OIFA 1JYSA 1P1RA 2QL9A 3BMQB 4OXIA 1HH4A 5E3HA 2VAMA 4F56A 2H00A 3TNJA 4GP6A 5KYNA 4M1MA 2CZGA 1A4UA 4ZVTA 1FYDA 1USVA 1X86B 2Z2YA 4B34A 5KTYA 5ER9A 5AQ1A 3GWGA 1FRZA 4MRAA 3OZUA 3QG5A 4LRYA 2J32A 5H5JA 1KDZA 2XRMA 4DSNA 5A9SA 2QXTA 4MPDA 4M9CA 4BNDA 2XH8A 4X91A 4AKHA 1VSUA 4C0SA 2ERYA 3ZDFA 3TAXA 2PYDA 2E1RA 2OHGA 2ZEJA 1NWCA 1RU3A 1VE5A 4M8SA 4TTAA 5ENVA 5CITA 4Y6PA 2CLLB 1LRKA 4WZBB 4R0MA 1I9CA 3NWBA 4MGEA 5LDDC 3A0UA 4C6TB 1H2FA 2OCGA 3HRHA 3N2NA 3ILHA 3MHPA 2PJZA 3R6DA 2IYUA 3IUBA 4DR2B 1P1JA 1PAUA 1WS6A 1XTRA 3MJTA 2OCDA 3PWZA 5IWAB 3ZDBA 3FMFA 5CIYA 1L4UA 1M10A 2E9SA 1W1WA 2W2XA 4NAVA 5LOVA 4PC3A 3RUEA 1ECLA 3PWTA 2J3LA 1X39A 3KL4A 3ZJTA 3VHLB 4CM9A 5EIBC 1C7ZA 2A67A 1QUFA 2ZUDA 1EVQA 2N3ZA 4JVSB 2GK3A 1JI3A 1YASA 2Q46A 2YV2A 4GWLA 4LJ9A 5AUNB 1HSOA 5AVVA 1OXTA 5ICEA 4U02A 2G5GX 3DOUA 3AZPA 2LCIA 5CDFA 2B5VA 3ZHSA 4EJ2A 1KOGA 5K3CA 3V4FA 3VC2A 3IL2A 2PYIA 3ZG6A 1Y9ZA 5BN4A 1X8LA 1A97A 4M76B 1XAGA 7REQA 3V33A 4K1XA 4I1IA 5EIEA 5JAOA 2XYPA 1GARA 3FMIA 4YBRA 3E5NA 3GVHA 1EBUA 3PF8A 4F7DA 1RXWA 1LSJA 1B2LA 4N6GA 3S7ZA 5JQWA 3VM6A 1XQ9A 3KSZO 5HX7A 3NRBA 1FTYA 3HGTA 1RM5A 4TOIA 3LLSA 1JEJA 2SKDA 4KK4A 4ZYLA 3HUEA 3R0JA 2HEGA 3C6ZA 1XX6A 1XTBA 3RDPA 2I03A 3OA0A 2H11A 2KLBA 2DMRA 1NIJA 1G16A 1VSQA 1LVUA 3CJRA 3W5AA 3TUJC 4UVIA 5GV7A 1A98A 1OTHA 2NW6A 4PPFA 2ZTSA 1ZOIA 2VRBA 3C3WA 3K2BA 5JVDA 2ZBUA 3PCRB 3QMMA 4RY9A 1VG8A 2H85A 3ZQUA 4WBNF 2QOEA 5IXJA 2WF5A 4B4WA 5CM2Z 3HPQA 4UTNA 4J94A 3SDBA 1N3BA 2IE0A 2QUZA 4M99A 2EFHB 4G89A 3OX2A 1HNWB 4XM1A 4BJ3A 5INTA 4AK9A 4CCYB 3T3OA 2XCTB 4OKSA 3LPDA 4G1CA 1WUIS 4HS9A 2WKSA 4FN4A 3V8NA 1NWHA 2JFGA 2DJIA 5T4FA 3WK4A 5ED4A 4LRWA 2Q3FA 5A6SA 3OPVA 5I9LA 3FVTA 2ZZKA 3I4FA 2YC2C 1KKMA 3NHBA 3LQ2A 4GM4A 4ZV4A 4DV4B 4DBLE 3BQNB 2CNWD 4G4IA 1H3EA 3AOEA 2XDAA 3FMGA 3IOMA 4HQKA 3CHYA 3MIZA 5IBQA 4J3JA 4U0JA 4E3WA 2G06A 3JWPA 1BE8A 4UNSA 4LXXA 4CR6A 2G88A 2VYQA 1N1GA 2WW8A 1ZM2A 4KLNA 5CMLA 2O2JA 3FCAA 1XZKA 3R41A 4IQ4A 3IAHA 3MLEA 2P78A 2VP4A 4LDNA 4H0CA 1HR0B 3G59A 1KGSA 1Y8RB 2HMTA 3L7MA 5D3QA 3IP1A 5HHTA 2Q4BA 4KQJA 4HVCA 2OSVA 3WLEA 4I3HA 4OHRA 1G17A 2YWHA 3KOUA 2I78A 4MYUA 1KI2A 4TYMA 1W7AA 2RJ3A 5DBHX 5KYXB 1X1AA 1KJQA 1EA5A 3OLCX 4QUKA 5DI9A 3ZWXA 3HKCB 1CRLA 4K6OA 5LXTA 4K9KA 3U26A 3WB0A 3L6CA 5AK5A 1Z2NX 1KI6B 1VRWA 3GLQA 3MUOA 2A3NA 3KUCA 2B37A 2WWFA 4ARAA 3KKMA 2YY5A 1EP3B 1YRHA 4L72A 4QICA 5K3FB 1FZQA 1ZGBA 1XJ5A 2V03A 3Q2OA 4N0DA 3TLMA 2O2YA 4MA5A 3M2TA 3C5EA 1Y1PA 3PQ3A 1U0LA 3ZK8A 4A8JC 4AJKA 2DWQA 4RF4A 2GBGA 5A03A 1CUBA 1UC8A 1V9CA 2MJLA 4QYIB 4C2AA 2BLLA 4KACA 3ZGZA 4AO6A 1K98A 1XVLA 2BFBB 2Z5FA 3FZYA 5KYVA 3ZLBA 3L0YA 4X1IA 1LD3A 1N2XA 1QO0A 1ISGA 3ZDZB 1U0EA 4DPMA 4BQOA 3T9FA 5F23A 1WSBA 1Z34A 2O0MA 2R8ZA 3BK1A 3EEFA 2WPNA 1NPYA 4I3GA 1JFVA 4HGNA 4W9MC 1Y4UA 4MVJG 2A30A 1PNOA 4YP1A 3JPWA 1W5AA 3QU7A 1QIJA 4DJDC 5GJVC 2ZUSA 5DLDA 1KA9H 1DQSA 2OGSA 3CH5A 4QO8A 4RVCA 4XGQA 3KQSA 2OY0A 2C7BA 1CUUA 4XPIB 5FYDA 4TMWA 3DOOA 3FY4A 4JVNA 2NP7A 4LQ4A 4BO2A 5J63A 3PSAA 2ZU6A 5H1YA 5JYBA 2RGWA 4Y0VA 2TMKA 3BWDD 4A2PA 3AB8A 3D31A 1JHOA 3IKJA 1GTL1 3UCXA 1UZLA 2Y1WA 1YFZA 1K6IA 1YK0A 2W6JD 3L0ZA 3TGWA 5KKNB 1D1PA 1NONA 3RBXA 1QCYA 1DTSA 2FN7A 2G3YA 1J5EB 3M5PA 1E2IA 1T8WA 2J0EA 3QPVA 1XLVA 4MP3A 4JELA 1DI0A 1KDVA 2HGZA 4ZAGA 2PUDA 2OQ2A 5BT8A 3Q3IA 1X1QA 4FBGA 1L1QA 1YKSA 3NNDA 3SQNA 4C87A 5LYJF 1DWPA 1BG6A 5B30A 1F0PA 1P7ZA 3JQBA 4UZEA 5LMNB 2VOEA 4HYTA 3V2IA 4UEWA 1E2GA 4A16A 1ZGGA 2V0CA 5EHIA 2R11A 4YN3A 3H84A 1KFEB 1WPGA 3QW4B 4KW7A 3UY4A 4DWVA 1UKAA 2AQIA 1CUIA 2WE7A 4RNCA 2CUKA 2E7ZA 1E4OA 4URZR 2JLSA 5IWCA 2JW5A 1V5WA 1TF5A 3TKYA 3NALA 4FZJA 2PHZA 3ZIUA 2DQ4A 5CB4A 5H59A 3H6HA 1VA4A 1KQFA 3KTDA 4CMCA 4LHZA 4TTVA 4AS2A 1C8VB 1ZJZA 4X6XA 5AFSA 1YHZA 4WLOA 3AFIA 1GTJ1 4LWZA 4BC1A 4EW3A 4EZEA 2D54A 2BWJA 3FM9A 4PHHA 1F0KA 2CNBA 2MT9A 2P2NA 4K9RA 4PNZA 4R8RA 3FOEC 4QGSA 4PRLA 3B1KA 2IUTA 2OQIA 4QGHA 1HDGO 5K5EA 4D26A 1G8AA 1WPXA 4FIZA 4D9GA 5B36A 4BV8A 4LYDA 5JQGB 1EB8A 1PR2A 1WXHA 2YZMA 5KSZA 5CEJA 4PS0A 5DTMA 3K0KA 1CHDA 1F3LA 2EZTA 2I2CA 3C5VA 2F9MA 3JX9A 4MRVA 4NJEA 4RAQA 2D7DA 3WFIA 1FLAA 4BV2A 4G63A 1FUKA 3GJ5A 4HH3C 1EX1A 3ESAA 4D4IA 2R96A 3NNNA 1NBAA 2C2MA 4L75A 2WABA 1DFHA 5HWSA 4KX5A 5E0KB 3NFRA 5B2FA 3N87A 3CB2A 1NVTA 2O50A 2ZSKA 3R5SA 1R6BX 3AR3A 2YDYA 3JALB 1R7RA 4BZQA 5KQPA 4UBLA 3VZRA 3DO6A 4CKBA 1MMFB 4BNKA 1H2YA 3A2LA 1SA0B 2IEGA 3T9EA 4J1TA 2EATA 4B44A 4R3WA 1YIOA 2DULA 3D6VA 3I1JA 2QZZA 3H9QA 4G2TA 4P32A 3I0MA 2O7NA 3JQEA 5KEIA 4M1YA 4MSUA 5G02A 5LCXA 1AK2A 2HF8A 2XMCA 1QHSA 3PXBA 1X8JA 4KMRA 2JJ8A 1NYTA 4KXQA 1TIKA 1XO1A 2C54A 4REQB 5HBGA 3VMFA 5CDUA 3GP8A 1I0LA 3R9XB 1YSCA 3X43A 3ZY4A 2V9CA 3ID6C 5FUYA 4UHCA 5SYMA 1YMQA 3RARA 5AM2A 2XMPA 3HKCA 2N1BA 3KJGA 1X6VA 3HWSA 5EJ9A 4FE4A 1PSDA 3P9RA 2XMDA 4QPDA 2WQ6A 1VZ2A 2O8DB 4J2OA 2LBPA 5LQSA 2YIVX 1RC1A 1MU0A 3CT4A 5C5EA 3R2JA 4PAQA 1XDBA 5KZMB 4N76A 1T0HB 3LK7A 2ZWMA 4F4UA 1ECPA 1YR6A 1G6KA 4CKZA 3RR2A 5DCUA 2VCEA 3LUPA 3NO4A 2XWQA 3WMRA 1Y48E 3B82A 1J8QA 4DMUB 4AX4A 4P4GA 1ABBA 3NT5A 2OFOA 3AOGA 2OM2A 1MJ5A 2CFOA 3PA8A 2JGMA 4L28A 2D62A 2EGHA 2FOIA 3EWAA 4Q3CA 2INGX 3TOCA 1RXSA 4YJ3B 3JZIA 3K4PA 4ETWA 2IODA 3LY7A 4X1IB 1NM5A 2GN4A 4EY5A 2XA1A 1GN8A 4B7CA 1K3FA 1YGPA 2R1VA 4NBLA 4Q9KA 3CCFA 3T54A 2W6JA 1K88A 5D84A 3ZQ4A 5KJCA 1KO1A 4YMGA 4YRFA 3CVUA 2ODQA 3ANMA 4H6WA 1O87A 4QUIA 3IILA 4GD3Q 3GGSA 3BCSA 2O14A 2ZB7A 4AMBA 3FLEA 4RTSA 3JWGA 4E4YA 2PH5A 2F90A 1QK3A 2OGUA 1RTKA 2VJOA 3JQRA 4GPEA 3DNPA 4LZOA 5DBFA 3CEHA 3K6SA 2IA5A 1KARA 3UHFA 4Q7MB 1E6EA 1HMPA 1R50A 2QRNA 3DH0A 2Q3LA 3GI1A 3BX1A 5EMKA 5JDCC 1OBVA 3CVYA 3LY8A 1KP9A 4YIHA 1J9ZA 4BEJA 3BERA 5EKDA 1XVUA 2XYQA 3U4GA 5I3ZA 1KRWA 3ICPA 3IEXA 1NVVQ 1CQWA 4TV8A 1SC6A 4H1TA 2HRRA 3MILA 1TK2A 4ZTBA 4FCWA 4C4ZA 3RQIA 2HQRA 1DRWA 3WTBA 5C32A 1PJLA 1FB5A 2OYSA 4UMFA 2IZ1A 3OH8A 4G97A 2Q41A 3AU8A 4XX0B 3K9BA 1SOVA 2ZSIA 4EEKA 3QNUA 3Q0TA 4MGKR 4HEJA 2ZYDA 4GKAA 1O08A 3DFMA 1ISJA 1JX6A 1POXA 2HH9A 4DQKA 5BMOA 3KYDA 4WZAB 4PLTA 3ECAA 3L8HA 1CJCA 4F2PA 2II6A 2BDTA 2QNIA 3PQEA 4P2GA 4RY0A 1QORA 4BPBA 3GDHA 2PAAA 4HBGA 1EVYA 3C16C 2VTBB 3FGZA 5BW8A 1WDLA 4YUXA 1Y3IA 5CXQA 2J9XB 2PX0A 3K5WA 3SBXA 3ICEA 2XMSA 4M7OA 1B6RA 3LT4A 3LPLA 4O5OA 5JD5A 4J0GA 6ADHA 3L7JA 1GZSA 1YD7A 2EL9A 1Z37A 1YWGO 3ED1A 1XDGA 3QOYA 1HLFA 1ML4A 4K0KB 3NORA 1LBSA 1H2EA 2NNWB 2PSFA 3MAGA 4HAWA 4HX9A 4JENA 1MQSA 2AG0A 4C6TA 2QW8A 3O3CA 1HYHA 3O84A 1QVAA 3G2KA 2IZOA 1T9ZA 1M1UA 1G0NA 4YBZA 1FUYB 3U60B 1D5CA 3W9YA 4M1EA 3BZWA 4UDXX 4MVJE 3NHRA 3RKRA 4S1OA 3TIVA 4KBYA 1IPHA 2OHIA 2PN1A 2REQA 2XCLA 3DV9A 1L6IA 4IEIA 2CDBA 1U0TA 3RHFA 4D4LA 2H2HA 2JI9A 2VDOB 3O4RA 4GMXA 3AP3A 3FPKA 3HFSA 4YJFB 4GWKA 5AI5A 5KO2A 1RRCA 5K0JA 5JZSA 3BEOA 2XVMA 4R1QA 4WXYB 4ZP1A 4MWGA 3QF7A 1CKEA 2NG1A 3AQIA 4DG5A 5EJ4A 2XT6A 2YFHA 4IW3B 3TR0A 3OC6A 3OIDA 5ERGB 1X1SA 1N32B 4UHHA 5L8VA 5AKKA 2UYQA 4WNYA 5CCDA 4PY2A 1IOLA 2OG2A 1S8AA 3WV5A 4BVKA 4E08A 5MGNA 1U7WA 5BN4B 4HL6A 3I92A 2W71A 3ZHUA 2C0QA 4ITRC 3CV3A 3RYCA 4KQIA 3ZK7A 1Y3HA 1Z2PX 4KJXA 1H6DA 4MA0A 3VFDA 4OB6A 3ZKAA 4FVTA 2PJUA 4DCGA 2YVLA 4PQFA 2CXOA 4MH0R 3K32A 3DUFA 4IMPA 5B2EA 3NPMA 4IDGA 3L0OA 3PPWA 1PJ3A 2ZPTX 4J4HA 4B87A 4K3VA 5IS2A 3N0TA 3VBEA 1XLUA 4R54A 3M8KA 4LSWA 4F4FA 1LJ8A 4GXRA 5H9WA 1U3WA 2BHSA 1ZH2A 4N01A 3UW3A 5KX5A 1MOPA 3SQDA 4DMLA 5JG7A 4K6MA 4IR7A 1UMBB 3OLZA 3LXUX 4L51A 3DVLA 3NYQA 4HQRA 1ZK3A 4NPCA 2IIPA 1D8TA 2WB4A 4Z7QB 3TLXA 5ENZA 1X19A 3R75A 4DZTA 1GGJA 4FDAA 2J7PA 3NG1A 3MLAA 4TKUB 2GBIA 4UOEA 1SBTA 3CXUA 2FMFA 1PS0A 3DKIA 1LB1B 3BTUA 3QU9A 3SJBA 4AF8A 3PYXA 4WAUA 1DS6A 1MLDA 2Y1EA 3CJTA 1H8EA 3L1KA 1HXHA 2JHFA 1DUIA 1EI9A 3SQMA 5AO9A 1IEXA 4AG6A 2J46A 3RANA 4PTLA 4KAFA 1AKEA 4RZQA 1KPHA 2LCFA 1XEWY 3AVXA 5MGBA 2P9YA 1M1NB 3HKEB 4LN1A 1ESMA 4L85A 4MW6A 1Y34E 4R51A 2WYIA 4FQ7A 2AS0A 3EIUA 4O8ZA 2FPWA 1ESEA 4HVLA 3WHPA 2QM0A 4EMUA 3R6WA 3CZ4A 5G4KA 1ID1A 1NI3A 1R0WA 3A6LA 3UOGA 2Q3MA 2PL9A 1NN1A 3SHVA 2JLAA 3N0XA 4LDQA 5JZBA 5DGCA 2QZ9A 2WICA 1NKSA 1IULA 1L4KA 1MW9X 1YNSA 2C2KA 1YGYA 4LVNA 4BO0A 3PA6A 2H3HA 4HEA1 2WRZA 1YS6A 2WFAA 4N6OA 5E4FA 3HCEA 4ZZ3A 4ON9A 3HUFA 4WN9B 1MKYA 1P17A 4NCAA 5F1OA 4QAQA 1G5RA 3G6KA 1HE1C 3PZRA 2SBTA 1A0OA 1V4BA 1SQ6A 3AXTA 3MJCA 2NPFA 4C4OA 2OG1A 4BV9A 2CNNA 2YZKA 2LR0A 1ZESA 1O4WA 1OI7A 2PZFA 2XKJE 1AVTA 3CZAA 3LVBA 4MQEB 4M88A 5JARA 1K8XB 1F2VA 4GMDA 4RABA 1OXBB 1BKDR 1V0JA 1CUZA 5DKFA 3UB4A 2RHRA 3HYNA 3UAOA 1AZTA 1IZ9A 2XCIA 2OHXA 4CV1A 1Z5GA 2C0PA 2WPDA 3NONA 3WGTA 4A91A 3IVMA 5TC4A 4N03A 1WB4A 1JALA 1C7FA 1MO2A 3I6BA 6PFKA 2FLWA 2WSYB 3B52X 3LUAA 2Q2VA 1EUQA 5LNK6 3WSWA 1YL6A 4TUYF 5HGXA 1FYFA 1B7GO 2NT4A 3V5NA 5B5SA 4JV5B 3DHYA 3P52A 4F5DA 5K4GA 1BYIA 1N2HA 1YBFA 3CA8A 2IZ0A 1BFUA 2H1WA 3THRA 3C3AA 4ZPXA 2XXJA 4B6OA 1V95A 1Z0UA 2W00A 1CZUA 1X7GA 1ZD1A 3BXHA 3NJ4A 4IMRA 4FKMA 5EZ6B 2PNFA 3NX4A 1BXGA 2YFYA 3ELWA 3IQEA 5CM8B 2XUDA 1CUWA 1VYTA 5CIQA 5AT1A 3K72B 5ITZA 1FTGA 5M29A 2J7KA 4RTKA 4CLOB 3Q9SA 2C00A 2F67A 4XVHA 2CMDA 1FW8A 3IAFA 3QUAA 5DNDA 1KEUA 4FE3A 3SQLA 4O25A 4AZTA 4J07A 3ZU3A 3U44A 3I6IA 5AP9A 2ZJ2A 4DMRA 4ESHA 3H2HA 4YJGA 2NO0A 1RXEA 3OLYA 2C59A 3DAPA 4JFRA 3WA6A 2HDOA 3O9ZA 4OB8A 3FFXA 3IDZA 1J00A 4KXXA 4BP3A 1RXYA 4JVOA 3C70A 2Q0XA 3D54D 3RS0A 1ZW1A 2GZAA 5DM4A 121PA 3QLUC 5FBHA 1KYYA 4E5SA 1C3JA 4Z7OB 4M1WA 2H4WA 4ND7A 3SIRA 2VP2A 2JD1A 4MKXA 4OMFG 3Q8KA 2VHCA 3U1BA 3WGNA 2PV0A 3HWX1 2WSSA 3RWOA 1L4MA 3TX6A 1IZ7A 4LOLA 2FETA 2J45A 4QUDA 4EFNA 3HKBB 3L8ZA 1OWOA 3GL9A 3IE0A 4HFRA 1USUA 5TLSA 4BX8A 3TBHA 3PNQA 5K0GA 3U4QA 3N0VA 4MJLA 2GD1O 4LQLA 3LIPA 2FWAA 3DCNA 3RSQA 4NVRA 4NBKA 1GPBA 3TSZA 4FMDB 2C8JA 2ZTHA 2HIMA 3L7DA 4UDYX 2BMFA 1OYYA 4EMSA 4YXWD 4U2CA 5ALMA 3BDVA 2W2OA 2Y71A 1ZY2A 4DLZA 4D8TA 4Z3KA 1XNRB 2DY1A 1BTOA 3NBYC 5IH3A 1LFDB 2QRVB 3W8NA 1TUBB 1P8AA 3O4GA 3ESXA 2IC5A 2R8BA 2C2GA 3KHSA 3MTGA 1IBKB 2F00A 2L2QA 3FOFC 3U1VA 3LBHA 1YZTA 2EW1A 3E9QA 3OTQA 4A6EA 2MSWA 2R1UA 5JECA 5KOJB 4ARUA 1RPZA 10MHA 5DJ5A 1R74A 3AERA 1VL8A 2O0HA 4UM5A 3RNLA 3A1UA 2XPCA 3ESBA 4MVJD 1X7ZA 2C7VA 4OA8A 4R81A 2QZ4A 1VRVA 2QR3A 3C3YA 4PYIA 1K08A 3W4KA 1YVRA 3BL5A 2A1UB 2HSEA 3HABA 5CYFA 2G82A 5EJIA 4BO8A 4NLLA 2NNLD 3KR9A 1NUTA 4OO3A 1P9WA 4WDQA 3LDGA 4BMXA 4OJMX 3WFJA 2HJSA 2OZLA 2IPMA 2X5JO 4PHFA 3FHOA 5BSEA 2XOEA 1ORRA 3HU5A 1RACA 1IM2A 1LI4A 4JGIA 9MHTA 4J0HA 2TRSB 3CUSA 1KJZA 1OGIA 4U2BA 4FJ2A 4OUKX 1C2TA 4ZCPA 3TSCA 1M6EX 1T5HX 3GEBA 3VTAA 4JOBA 5H83A 4JLDA 1Z6XA 1A8UA 2Q4EA 3R8CA 3ZU2A 2BN4A 3BTSA 4KUEA 2O3TA 2Q1XA 4PZDA 1GT91 5HP4A 4NCIA 5G4KB 3TEJA 1W2GA 3PNBA 1C41A 3DLCA 1DDGA 2EW2A 1W94A 1GR0A 3OQIA 1NJ1A 1NXQA 3KOWA 4QATA 3CB4A 2O7VA 3OG9A 2VO1A 1VDMA 4UE3S 3T8YA 4H7EA 4BO4A 5KTRA 4GDMA 2IZ6A 1GSOA 2AC7A 2GN6A 2IKSA 2V4UA 1DVRA 5A3VA 1FYEA 1MCZA 2EGGA 4REMA 1D2AA 2PKWA 2W8BA 3G5MA 5I7OA 4F6RB 2A58A 5K03A 2V7XA 1CFZA 4JOQA 5BWOA 4B3GA 4FYPA 1PQPA 3N76A 2O48X 5IJ9A 3L8MA 5EZYB 4WCFB 1XEFA 1LTHR 2B9VA 1YI8A 3SWWA 3TE6A 5DOVA 1ZMXA 2BMVA 1D6SA 2VK1A 4JYCA 2O8DA 1D4ZA 3CUWA 4I9UA 4B3XA 5COQA 4N3NA 3NHUA 1R5OA 3NB0A 2BM8A 3OQNA 2Z0MA 1GGKA 4FFOA 5F98A 4OU5A 1RBZA 3E23A 1IB0A 2X14A 2LDBA 3I45A 2MINB 1JG2A 5HOQA 4E32A 3OCYA 2WTMA 1JIIA 1CUFA 1O9HA 2UKDA 3JD0A 4I1RA 4MGYR 1X7WB 4Y6OA 1JR3D 4MMZB 4YJ3A 1IHUA 3EMVA 4LKRA 4PM4A 1KSGA 3OFVA 2XVYA 3U3ZA 3WB2A 5FOTA 4KXNA 4DL9A 4TWAA 1NVWQ 3BD6A 4JP1A 1MGPA 3UJHA 1G60A 3TL6A 3Q3JB 3ND9A 3SC2B 3KD3A 2Y6UA 4TL6A 3AIOA 2VK4A 5CX4A 1YTUA 1H6CA 4DIFA 2V4MA 1JVNA 3GGOA 2X0NA 4R8SA 4B6GA 4CV2A 1E7WA 2ZT7A 4DQVA 2WILA 3HEBA 1LPBB 3JVDA 4ZVNA 4WBSA 4QNRA 2JJ1A 5T57A 2GJSA 4P5PA 3LX4A 3UM9A 4YQZA 5J1TB 1MAUA 4RJKA 1II9A 1BU5A 2APJA 4YJ2A 3FAKA 3AR5A 1MR3F 1A2KC 2AG1A 2NVOA 2IZ5A 2ZB2A 4MYCA 2YMQA 3V9AA 4HT3B 3IQXA 2R5WA 5IZCA 5FOWA 3O8LA 5F3WB 1CF4A 3LCMA 1OBHA 2BHNA 3CTMA 3CLRD 2YN0A 3OQVA 1I14A 5FUWA 5C1DA 3PUYA 5EIBD 5C8XA 4Z0PA 1OAKA 4IUBS 1MG5A 4CUZA 4WZAE 1F5SA 3UW1A 5B4TA 1BDHA 4DN6A 3QUQA 3ANTA 1SU7A 1AHIA 3V4PB 3GQVA 4PGFA 3JR3A 4ED9A 4QBGB 1XYGA 2WR8A 1FX0A 2HMVA 1E63A 1C8KA 2ZIUB 1UJ6A 2W2NA 4U9UA 1U9CA 5BWBA 4ZCLA 3EY4A 4XCXA 1W6RA 4X3CA 1FFXA 1XUOA 1EFPA 1GLNA 1XZFA 2O2CA 1BDBA 3OE1A 4TXNA 3RWBA 3VKFA 3WSTA 4AZ3A 4EPRA 4LZNA 2JGRA 4MVYA 1JFSA 4DMFA 2ECPA 4UUBA 3W3ZB 2IU6A 3L92A 3F6CA 3PICA 4NU6A 4NABA 4WK4B 4TTRA 4MHTA 1NVMB 2DECA 4UJ5A 1E4YA 4W1SA 1C7IA 4YPFA 1Z2AA 2LGJA 2AN3A 3ABRB 4N5HX 1XN4A 3FE2A 4U9IS 3T06B 2CUNA 3PVSA 2I3BA 4HNTA 1EK6A 2C77A 3HDYA 2QM8A 3COVA 3RTDA 5FV7A 3ELUA 3LMKA 3KLPX 3DJYA 3TCNA 2PY6A 4G07A 1AX9A 2J4FA 4AKTA 1UPXA 2BC9A 1QIKA 2DQZA 2IEBA 2Z5LA 1U7TA 4X00A 3SQOA 2WVJA 3RYHA 1PW7A 4J9VA 3VXKA 1JHDA 1WMAA 3KLOA 3VBCA 1ULSA 4JYBA 1MRNA 3LPMA 2E0IA 4MB0A 4XH9B 3R6GA 2J87A 4I3FA 1NBIA 4Z86A 2QJRA 2ZUVA 4YMSA 3HKDA 4TQUS 2W42A 1BX3A 4C07A 1USKA 4FP9A 3EW7A 4YJFA 3WLAA 2QRPA 5CEFA 2GYYA 5ITVA 3ZI7A 4XQGA 3KB8A 4B85A 3AP2A 1G6HA 3G5LA 2GGSA 1MO4A 1P0CA 2Q3EA 3CCCA 4OM8A 1VLLA 4ETMA 1SXPA 1XVTA 1QF6A 2VJLA 5JMOA 4TLMB 5EEGA 3LX5A 3P20A 4BASA 3ADKA 1L1RA 3WXMA 3ZDAA 3G8BA 1K2VN 4UU7A 1A96A 3LF1A 2YOFA 5LDGA 5ADWA 2I99A 3JAMA 2VT3A 4QUGA 5CA1A 3RU7A 3UYLA 3R7SA 4US2R 4PU0A 2IBMA 1T8UA 2ZBEA 1XTQA 1GNQA 2IOQA 2V7UA 1KBOA 3IHWA 2P6PA 1F06A 1JSXA 2AN9A 2ZBDA 3MMXA 4KAJA 3ENWA 2ORVA 4YJDA 4GI5A 4GX2A 4IQFA 4IIJB 4Y2VA 4OMDA 3O8CA 3HP7A 5JLJA 4D56A 3W1EA 2VJYA 4WESB 4E15A 4H7FA 1IVYA 2I4OA 1BWRA 3E18A 2H54A 1R4NA 3CEAA 1UMBA 4EYEA 1FXUA 3MELA 2Y1CA 1B73A 5FB3A 4MQFA 3F3YA 2XVXA 1KQGA 3OHPA 4JJGA 4JOSA 4CE6A 1T9AA 2ZJ5A 1R1DA 1RYYA 3CPEA 1RYDA 1Z4QA 5F52A 3K70C 1EWQA 3CNLA 2J3QA 3SM3A 5EMHA 1HGXA 4JY7A 3ZZNA 3K70B 2JH8A 1DJMA 1XZCA 1MAWA 2ICAA 4MRSA 1ZI6A 3L7BA 1Z13A 4QJ5A 1K7FB 3UUWA 1P2BA 2D0DA 3K30A 1GZ5A 2I87A 1L5MA 4LHXA 5A3JA 1PO7A 7MHTA 1H22A 2D00A 3PL1A 1AGXA 4BNIA 3U16A 1UBNA 3GLHB 4J91A 1W96A 1ZS9A 4K6KA 3JAKA 5CT5A 2GN2A 4ZOQI 4HG2A 1JDSA 1KKUA 1ZMOA 2FG6C 4OQZA 1Q0QA 4P3NA 5MN6A 5CGZA 4WN3A 3GELA 3F2VA 2OV2A 5F12A 1GL3A 4LZZA 1WE2A 5BMVF 4I1VA 1YB5A 3HGQA 1CULC 3ES9A 4IHJF 4L4SA 1O95D 4MW5A 4B4KA 3W8FA 3E4DA 1FDRA 2ZSDA 1MAVA 4H1HA 1F1BA 1L5HA 1M83A 1Z29A 1NBHA 1PV1A 2VPPA 3P19A 3WLOA 2LXNA 2ZJ6A 1V6SA 5I9IA 1YZNA 3PG5A 4GSLA 4NE9A 4OHUA 3P2MA 3AF1A 1RWXA 5FTKA 1SG6A 2P9BA 4A0GA 3OOEA 1GUDA 2VH1A 4F5WA 2VTVA 2WT8A 5EWMB 4MPJA 3ROGA 2JDIA 1XCBA 3SLKA 2OZEA 5ECDA 1PD1A 4UTPA 4B3TB 1Q17A 1EFLA 1MNQA 1TU4A 3P32A 2NQ8A 1P6UA 3COYA 4YRZA 2VLIA 1CF9A 1LLCA 1U3DA 1R4AA 3C8MA 4L8WB 2I34A 4WQMA 4AXBA 3OMXA 2FNAA 5M7EA 4QTYA 1QYRA 5C46F 4KQXA 3QM1A 3BS4A 2ORED 4HR7A 2FCAA 4A1FA 2VCYA 4BO6A 3PFCA 1G98A 2DT8A 4OEHA 2Z6QA 4BVFA 3EWNA 3IQFA 5IW8A 1JE0A 2VF7A 3ABIA 3CMMA 2EZ9A 3EC1A 3LLCA 3T3DA 2BFPA 3EGDB 1NE2A 4OUDB 3A58B 1WMFA 3PIIA 3FPGA 5FNVF 3N7UA 3K9CA 3NFYA 3AUXA 2NYUA 2K7ZA 5DCLA 4MA4A 4RV4A 3JQFA 4UVHA 4JP3A 1C1XA 3O7WA 4JJ6A 2TYSB 5IDVA 3ZLUA 4ZI3A 2XZDA 1RWNA 4OHKA 3OT5A 1EEXB 4G8JA 3BWEA 1T8RA 4MI6A 4XTRA 2EBFX 2LPMA 1E32A 4RH3A 4O4IF 4MCAA 1J23A 3VOAA 2G0NA 4EQ6A 4JQOA 3JSXA 4X9XA 5B53A 1BA2A 2ON6A 2OXEA 4QYIA 4QLBA 3QXHA 5FI0B 1HT0A 2BRUA 3RVJA 1N4DA 4CLOA 3ZYZA 1EVZA 3EN0A 1P1FA 3EZ6A 3L9WA 4YMVA 1VHTA 4M9ZA 2XZOA 3JQ6A 4WOJA 5DNUA 2RIPA 1R88A 3A9CA 1GPKA 3KALA 4D45A 5YASA 3HV2A 3OSUA 4IJ5A 1HDYA 1SXJD 4FC7A 4U7TB 3WOVA 1GHTA 2O2HA 1NQTA 2XUJA 1DARA 4UXHA 5EXPA 4YX9A 1NMZA 2PKRA 1RWPA 4X60A 2F1KA 4J16A 2XZLA 2JGKA 4G23A 5DBOA 3HKDB 3Q6MA 4ZCIA 1NU6A 1LDBA 1IHPA 4X45A 4DIBA 4W6ZA 1NQAO 2FY8A 2ZRHA 3DD5A 2FW0A 2O4UX 1HZJA 1IOWA 1V8OA 2VHYA 2GZHA 3MWDB 2V74B 3ZV7A 4YV0A 3ZVMA 1IWPB 5H9VA 1FP7A 4LGCA 4TM7A 1GAJA 1XKQA 2QVCA 1NT4A 3U2QA 3ZNQA 5C3MA 1SCDA 3GLFE 4NV3A 2NO4A 4RV5A 1NW8A 3KDPA 2Q99A 4Y1FA 2FDCA 2GFQA 4BLVA 2XODA 4IZ6A 3ZWKA 2Z6UA 5JD4A 2GO7A 1G5FA 1XOIA 2PGAA 2AXEA 2CHVA 3CWZA 4JROA 3ROQA 1QH8B 5I7UA 1Z0SA 1ZP6A 4GO1A 1RKQA 4JKYA 3ZHYA 2XRZA 3K0CA 4ZCTA 3QU4A 1N6LA 1C1YA 1W85B 1NSYA 3I8OA 1VFNA 3WWCA 3EK2A 4Q4HA 5T4BA 3O4VA 4R84A 3U3KA 3LBYA 4L4YA 4N7BA 3RW9A 1LBQA 1N0VC 2X9GA 3BRWA 3A9SA 1JHVA 1YQTA 3MTAA 2YHBA 3AFGA 3B51X 4CYMA 3DAGA 1T4CA 5CVCA 1COWA 2WY2D 1VDZA 4DNPA 3HSYA 3R0VA 5GONF 4U5XA 1X70A 2IYWA 1O2DA 2QAGC 2R79A 3HYSA 3ZBPA 4EFDA 1P39A 4UBKA 5FI5A 3GJ7A 3TXXA 4L7VA 2BI8A 3BH6A 4NR0A 3IBGA 4AS3A 3IRUA 5LZ9A 3DA8A 3SC4A 1TD9A 2SNIE 1JR4A 2IK8A 1YBHA 1E79A 1TAGA 1MOSA 2W83A 2PSJA 4OBWA 4TWZA 4EIWA 2WJZB 4B40A 1RCTE 4YVFA 3VVBA 4PSDA 1DX4A 4KQWA 1BW9A 3GRUA 4J1SA 4WCFC 5IF3A 2CXRA 4WNCA 1VXOA 1VE7A 2IJGX 3LC1O 4GICA 5SY6A 2EZUA 4X8LA 4QUAA 4R9RA 1I7DA 4ZVKA 1WXDA 5CHEA 3W8DA 3IODA 4HDMB 2X3YA 1VJTA 5FCDA 2J09A 3UK2A 3KKLA 1LS6A 3EIWA 2GTHA 3H2GA 4Y2TA 4P86A 4RWZA 3TK1A 1M8FA 1TXGA 1EXVA 5FAXA 4B3RB 4HXEB 1EH5A 2Z98A 1E1CB 5B1EA 1AHHA 1KO4A 5AW7A 3ZCQA 1Z6TA 4MINA 3D5TA 3LNCA 4FU0A 2RGBA 2XX3A 2ST1A 4Y67A 5JSUA 5KWEA 1JH8A 2YNMD 3QKSB 4GLOA 4J0EA 5HQ3B 2QPOA 5C4MA 1OX6A 3E3AA 1MH9A 1NDHA 2CHEA 2J4DA 2JARA 2WZCA 4LQDA 4O2BB 5LZ8A 5IJ9B 4OJNA 4BLPA 2KWIA 1W2HA 4M2LA 2JD2A 4JKOA 3JQ7A 4LRSB 3LRTA 3VSAA 2BM9A 1E0JA 3ITEA 4XGIA 3RT1A 1ZVMA 5HVNA 3DF7A 5ELMA 2VAWA 2W2KA 4HLNA 4M6WA 3H3FA 3T41A 4ZKDA 2VNIA 3R3UA 3EXIA 1A4IA 4I55B 2XMRA 2IPOA 4HQLA 1NW7A 1U2ZA 2H4ZA 4KBGA 1KJ8A 5IAJA 3T9AA 2HHHB 2GZ1A 4U7GA 5U1PA 1LNZA 1TMKA 1B6TA 2E49A 1TM3E 3F97A 5AVOA 1MH1A 2QMYA 4BP1A 4LDZA 3SEFA 3UWMA 5JSQA 3H17A 3ZD9A 2GB4A 1F2TB 4HGYA 3DCYA 3KWLA 2PM8A 1ZD9A 2JFFA 3W6PA 2NZ8A 1TPZA 3AXSA 2OO5C 3KOMA 3QU5A 4FYHA 3GJSA 4C6HA 5B4VA 2V0GA 1DDIA 1GNSA 1Z15A 3DXZA 4PZPA 5FP0A 5J5CA 2XE8A 4RZXA 1RRMA 3ILXA 1CIVA 4C0LA 5D3MB 1P4SA 1EK5A 1Y4AE 4FDTA 4R1NA 4YO8A 3OCJA 3OZCA 4ZWNA 1DC6A 3DBHA 4Y2GA 2F55A 1VG9B 1OHHA 4FYJA 5JS8A 3HXPA 3GEHA 3LWNA 3WBFA 4GI2A 1LLFA 2A5FA 2OYCA 3RKUA 3C1OA 1UXKA 4A03A 5JO0A 3TFOA 1C4KA 2R1VB 4TWJA 4BS9A 2PG3A 1SEVA 5IG2A 3V8MA 2FW1A 1D04A 5DISB 5I4BA 4Q4DA 1E9BA 3BIJA 3WGKA 3WI7A 1JSLA 1Z5OA 1FPQA 3AFNA 3PHGA 3DFIA 1O0SA 3KZ1E 5AM0A 4YAKA 4HRAA 2W70A 3R7NA 3SYRA 4NENB 1ZA2A 4D41A 2C7RA 3ISVA 1NLUA 3IA2A 4U7HA 2RC6A 4QDXA 4DR6B 2CHGA 5C9ZA 3UPUA 4DYDA 1N9GB 4UHEA 3RJMA 2EG5A 1QNFA 1YCHA 4IHJA 1V7ZA 5LBTA 1XPRA 3OUTA 2CFIA 5BSUA 1E3EA 3BOSA 2P3OA 1MA0A 4Q19A 3I0ZA 3QYFA 1JHUA 3Q3VA 2AD5A 2GNAA 2FHPA 1CLUA 2MR5A 2Y1KA 3A4TA 4R9NA 3C8ZA 1JDPA 4YUWA 1UIMA 1UPUA 3IH5A 4LMBA 1YA8A 5CH3A 4ZOEA 5E6SA 1UBSB 3LL7A 1QE3A 3VGJA 4QNMA 3BE5A 1OLSA 5F77A 2IU0A 4RGQA 1IG0A 1E8DA 3AKZA 4AWAA 1P2TA 2GPJA 4I55F 1E9CA 2GCNA 5CGQB 4Q9JA 3OEWA 5GQSA 2GAOA 4EJ0A 1L4FA 2CV2A 3SICE 1GCOA 2VZ0A 4KRFA 1EFVA 4CEHA 4MDFA 1GSIA 1M5RA 1MX9A 4KXFB 1NJ8A 2I62A 3R3JA 2P62A 1VGQA 3LK6A 4ARVA 4J49A 5FWNA 4QGAA 3U7JA 4U6SA 4CETA 2D2FA 4Z2YA 3E03A 1M8JA 2BFFA 3MK31 1MF7A 3HJFA 2JI7A 2E37A 4MKHA 4DIMA 2P2YA 1F14A 5T4HA 2ZYGA 1PJ4A 4CTMA 5KWIA 1UBLS 3MT7A 5HJ2A 1TTHA 1L3IA 1DOAA 2OE2A 1NNLA 1TRHA 1XP8A 2ZETA 3QVGB 2PMCA 3TJZA 3AM1A 1FP2A 4LXHA 1AQNA 3BN3A 3EASA 3PPVA 2AUTA 4K28A 4UVEA 3W77A 4A7PA 3G2QA 2QY9A 4DVJA 1VGVA 4BMNA 2ZPAA 1S01A 2VDVE 4BO9A 4EGAA 1HC7A 5EA2A 4D02A 5B7NA 4R2WA 5JS1A 3NW9A 4ZK2A 5K2MA 2P11A 2R6HA 2WUVA 2Z08A 2I67A 3PJGA 2JEOA 4IQ0A 4JI7B 3DPUA 1Q15A 2NTEA 1DXQA 4XB2A 3ZIAD 4MYRA 5LOVF 3B78A 2BFOA 3WICA 5K3OA 2QUIA 4RY8A 2FUKA 4NMMA 1V16A 3UTCA 3RIYA 2AA3A 1AURA 2PX2A 4KQKA 5A1JA 5JSZA 2HPAA 5ES3A 2IXTA 5DT2A 4BNXA 2WUFA 5HKKA 4HWPA 5L7TA 1YZKA 1K4YA 2ILTA 1R9MA 1YRBA 3KVVA 3RYCB 1OU0A 4B3CA 1LH0A 4R7ZA 4E21A 3RUCA 4LOJA 1PG5A 4RHCA 4EKGA 1QV9A 4ND5A 3D4PA 4FHEA 4GZMA 4K7JA 3HXTA 4HS4A 4QQRA 1UQTA 3OM1A 3B12A 1Z8FA 3D2CA 1E0DA 3G02A 1NBWB 2BAGA 2IVZA 1E0KA 1C29B 2DF8A 1QB8A 3RRBA 5T8KC 5KDDA 5ESRA 2PD4A 1RPJA 2IXEA 4R68A 2I6TA 5JNRA 1EKXA 1XPJA 1F9EA 2BDEA 2YFQA 2ZTLA 4QEKA 2E3JA 5LZ2A 2FX3A 3ICOA 3OQHA 2FSHA 4OD0A 2YCBA 2Y92A 3OZXA 3TDMA 4MYHA 1UXGA 3TTYA 4CLDA 5TPWB 4DHWA 4N8SA 1TTTA 1J2YA 5IYZA 1U2DC 1HYQA 1WO8A 1N6KA 4IRXA 3UQYS 2RHLA 2ZM5A 2GAJA 1VJDA 3GJ3A 4ZREA 4KZKA 2RHMA 2WHPB 3SHWA 5HW0A 2Q49A 3S2SA 3NUGA 3JAKB 2ZWIA 3KQUA 4TKUA 1A5AB 2XE7A 4G0OA 3DMNA 2Z56A 5HFJA 5LKRA 4NSNA 2NUTA 5E2BA 2Z3VA 5EYPB 4AMYA 3HB5X 1V1RA 1A76A 3WK9A 3AH8A 3Q7QA 2OP0A 4B35A 1NVDA 1W75A 4QU5A 3TQCA 5KOHB 2P9GA 5K3EA 4GBGA 1L5HB 2QAIA 2BI4A 3S40A 2P2LA 1Y7PA 4Q9NA 2HCRA 4F0JA 1J6UA 3HN7A 4HATA 5IJZA 3QX3A 2BE9A 5B57C 3I2HA 3LL4A 4A26A 3TQHA 1SKYB 3HQ4O 4P81A 3BIOA 3ILYA 3IMKA 4DM4A 1KH2A 2P0AA 4MVXA 1YS9A 3A05A 1W0KA 4DR1B 1XMVA 2XSZA 3HXQA 1EVKA 3OPNA 4FLEA 1JQ5A 2VJPA 3N8GA 3CLTC 4QXOA 1GQYA 3MOIA 1BRTA 4JC0A 4US1R 5LIRA 4OJYA 1MFPA 2H2GA 3JCZA 3RT7A 3COSA 3LI2A 4WN9A 3RHTA 2YNMC 5ALXA 1EE9A 4G26A 3PRYA 1RIIA 1RPTA 4IOKA 5EMJA 2WJ4A 2Z1NA 1DJQA 1WCYA 3OZDA 4BNHA 2E87A 3GGPA 3FCCA 1M6WA 3PWSA 5T3UA 4D80A 4O8CA 4Q3OA 2RHWA 1SBIA 3QU2A 4MS4B 4RFLA 1CQJB 1NM5C 2VYVA 4I4LA 5TXGA 4B74A 2PSDA 2H52A 3N8HA 4YT5A 2PMKA 5ALSA 3PJRA 5L7WA 2Q8QA 3CSDA 3O4IA 3PFWO 4DCNA 1UZNA 4G09A 1RLMA 1WMEA 1IPEA 1L5ZA 2FFAA 4YJ3F 3V4LA 2B25A 2VPXA 3FG9A 2QTFA 3WWEA 1SIWA 2FZWA 1UOPA 5E6SB 1K8ZB 2H8KA 2IV2X 1MENA 2RSLA 3C7DB 4CKYA 1ZH6A 2ZZMA 2W22A 2GZ3A 1UK9A 2ZITA 1U2GC 2V6FA 3FJOA 3LPNA 4YFYA 2JBHA 3CEPB 4KOEC 4BCBA 1K0FA 3VJKA 3IDFA 1NF2A 3PFHA 4IRUB 4X8HA 3UN1A 4FOPA 3BJMA 1HDOA 4B76A 4ZQFA 3FX2A 4MX8A 4DR5B 3G88A 2EWWA 3QE3A 3GP3A 5EMMA 1C9MA 3X1MA 1YJXA 2VR1A 3P2EA 3LM8A 2ZI4A 4H1VA 4RD4A 1DUVG 5LL6P 3UAGA 4PQEA 1N2SA 4URVR 3TW8B 2QN1A 5F1YA 4NDNE 4EUEA 1I10A 1M6HA 1YV9A 3KXLA 5I4IA 3AIKA 4YRMA 5FHRA 1SUBA 1OSNA 1TDJA 1F6DA 1I3LA 2Q0QA 1NPTO 2XOXA 2Z1DA 3GUYA 3PHLA 3FUWA 4IDAA 2IEIA 4OYRA 4Q24A 4DJTA 1O6BA 4P4LA 3MUFA 4N7JA 1P2SA 4IX9A 3U62A 1RHUA 1AV7A 1A2BA 5KQMA 4AULA 4I1PA 3HA3A 2C98A 2VOJA 3Q88A 1FS4A 1ETHA 2FRDA 2PX3A 3AI7A 4IIEA 4TGLA 1UWCA 1XMSA 3G0GA 1EFCA 4UE2A 5FNVB 4BKQA 4OQEA 1IN4A 4BEWA 1SKMA 3RRXA 4LV5B 3N59A 3SJUA 4LYFA 2PWAA 3KM0A 4D43A 1XR3A 4H6PA 1P4HA 1UT8A 3TGPA 4WDRA 2Z43A 1TQ8A 1XZEA 2GNPA 4H0FA 2A35A 2OGTA 3A32A 4PHCA 5DYTA 1U7PA 1XC7A 4O4HA 4DRYA 4TS1A 3W1WA 3SVLA 3F7MA 2WWIA 5DLEA 3RABA 1NMEA 2A0FA 1U8YA 1U9ZA 2VDUE 4P3OA 3H8JA 4R9UC 3W7AA 4IVQA 3WMEA 5REQB 2KQUA 4H2DA 2PCJA 2HSZA 4EKEA 1TTQB 4TQAA 2IDMA 2XF2A 4I4NA 3KKPA 2GJ4A 4FCCA 1LBTA 1ZD8A 3CRW1 2ATCA 4TS4A 3DYBA 1ND5A 3QEKA 3ZW8A 1T24A 1ZSVA 4QDZA 2BV3A 3DLHA 4YONB 4HHEA 4GXTA 3MD9A 3VZBA 5WRFA 3DDOA 1EJ6A 1FCJA 3KJNA 5ED0A 4DMMA 3B1XA 4LX8A 3PGA1 3IE2A 4EUHA 1JIJA 2JCYA 4LAFA 1ZM7A 2PVCA 1U5CA 1UL1X 4O02B 3HJNA 1P5JA 3U13A 2EG9A 4O0MA 4R9SA 3ZVLA 2O2GA 3SE0A 1V8PA 2G5PA 3F6EX 2H4JA 3W4JA 2NXWA 1C3EA 4WA7A 5KSYA 1VIYA 3T9BA 3TPZA 1UK8A 4MWTA 1IE3A 1H2HA 1JPUA 1EM6A 1X7ZB 3C8UA 4HDKA 4AQYB 3EOZA 4KXLA 2O0LA 4J0QA 1PGJA 4RMHA 4WD3A 3ZKWB 5BNFA 4DT1B 3CG0A 3AESB 4F91B 3P7MA 2V65A 2A1UA 2C4VA 1ZK0A 1KWGA 4NXMB 1RAGA 3NRCA 3MW8A 2O9JA 3FMOB 3KLNA 3C6XA 2TECE 2M32A 4MR8B 4KHZA 2ZW9A 4KPFC 3IT3A 2PMEA 3RS8A 5JIBA 3IEPA 5D00A 2H1HA 3B53X 4JMLA 2UXCB 1E3WB 2BMJA 3KXPA 4FJ1A 4R8KA 3L4BC 1U02A 3RREA 4EW6A 1QS0A 3K20A 1LA2A 1WZCA 1JDVA 3CPJB 5JAZA 3GR6A 4TV9F 3QKSA 1Y3FE 4WSOA 3VC1A 3H2KA 2AZXA 4WINA 4CG3A 1G2PA 1WUTA 4NS4A 4KX3A 4XGKA 4ARCA 2X7HA 1HE8B 3I62A 3SBOA 3VZCA 4OGKA 5LZ5A 4RHUA 1DO2A 5DT9A 2OZKA 3SYTA 5A5FA 1UWVA 1W5EA 2VQDA 1U2EA 3DB2A 4S2EA 4UAGA 5AVKA 1Z56C 2RARA 1IUPA 1YOBA 3PNMA 5H70A 1XU7A 2X0KA 2YWXA 3NATA 3I39X 1GUBA 1A8PA 1HZZC 1NPDA 3SDSA 3ZXIA 7AT1A 4GT1A 2NO5A 2WJPA 1IZ0A 3WKEA 5LMUB 4B6QA 3AKCA 5CT8A 1EQ2A 1CHNA 2MSKA 2ZDQA 3GLGE 1JH9A 3NTUA 4QT0A 2Q2OA 5J2TA 3E15A 3MGAA 4WCFA 1RJEA 5KI6A 5ESDA 2NAFA 4ZMSA 2ROQA 5IFLA 2ODNA 1DRKA 9ABPA 1FQKA 3KQLA 1F2TA 3NEAA 1ONNA 2P1DA 1QC5B 1HDZA 1NI5A 3BBLA 5EJ5A 1QCCA 4DA9A 2VIIA 3DWGA 1G18A 3GFQA 3OZTA 3Q7EA 5FPHA 1T34A 2JJ2D 4TVOA 1B8OA 1OPRA 5EOVA 2QVZX 2JCVA 4OY3A 3Q72A 5A5DA 4EW1A 5JPDA 1N7GA 2C42A 3F9RA 1EDBA 3D3EA 1ABEA 1I4LD 3E5HA 3VA7A 4QEZA 4WXMA 4ZDKA 1OI3A 5AXBA 1ILEA 3V1KA 1RNLA 2QLLA 2F3TA 3BHMA 2H57A 1K92A 1ESZA 1JLRA 1S2DA 1XZPA 5A06A 1C5KA 4LX0A 4C4PA 1OGYA 3P9PA 3L4BA 2D06A 1GG5A 1E3QA 2XITA 4HP8A 4QU8A 3TXYA 2QUAA 3WGVA 2ZUEA 4IDNA 4QARA 1SQ5A 4ZV7A 3T34A 2WAMA 3TH5A 1MV8A 2O05A 4DKXA 2C3UA 5DX0A 1PF7E 3E05A 2HFKA 3W5JA 1T9KA 2QTBA 4D9KA 1S96A 1F4LA 4TX1A 1F7UA 1AKYA 3E35A 1F4VA 3AI3A 1P1HA 2AG5A 2CKMA 2FEXA 3A14A 5EERA 5IKMA 1SIOA 3JQPA 3EG9B 5A0TA 3T7CA 5CD1A 5JI2E 1G4HA 2GKGA 1SCBA 5DTJA 1ISPA 1ZGCA 2EP8A 1BA3A 4HO1X 3WADA 2GAFA 3IIMA 4NFYA 3WHLA 4PXSA 4HFMA 3QEBZ 1AMUA 1BMQA 4JSTA 4XFKA 2QQGA 5KSPA 3RROA 3GCDA 2G76A 3L07A 3WAJA 5DLQC 1X1CA 1B2RA 5H82A 3TLYA 1REQA 1UFRA 2IYVA 4Y30A 1N25A 2QU8A 3RS2A 1YS1X 1CYEA 1JDBC 3RBAA 2FZVA 4KQGA 5BSRA 2PRKA 3OPYA 5LA6F 2A5DA 1M7HA 3QQ5A 1R37A 2V1UA 3B38A 3BK2A 1C0KA 1HQKA 4FYVA 5JYDA 4DLPA 4YAGA 2Q45A 1CRPA 3M9LA 1VZ3A 4TYNA 4JDUA 2WHRA 2GVNA 5LD2C 3PXUA 1V3TA 5FHQA 3S2GA 1RRVA 3CFYA 4DCJA 1YZFA 2RG7A 3C98A 5FPYA 3T7KA 2VC2B 1L5WA 1KIAA 1PL7A 1SVSA 2A9VA 3D59A 2N1MA 2VJDA 3EW9A 2BY4A 1KE2A 3ROPA 2BRUC 4NL4H 2PTHA 2JIZD 1E1KA 1W4AA 2BFFB 1LWNA 5CNMA 1OLXB 2YZGA 1GYRA 3NT4A 3V97A 3MFYA 3NWEA 3NS7A 2HO5A 3CRRA 1RM3A 1CRQA 2O2XA 3KK0A 1R66A 3GA5A 3K0SA 5F73A 4K9OA 4U39A 1SUSA 1D2CA 3IHKA 4FJ0A 4YJHA 3BWYA 4XIYA 5FUVA 4N5IX 4Y3UA 4HB4A 4Y9DA 4ZU6X 3EB9A 3U9LA 3RRFA 2FZCA 2BJHA 2QD5A 3LCRA 3NEPX 1KP2A 4R05A 1QYDA 2NV6A 2PKQO 3LVQE 3PQ4A 3ZE8A 4PQYA 5JQGA 1QRUA 2QP4A 4XA8A 3PRKE 3KJQA 2HF7A 2IHZA 4OAPA 2B35A 4R1OA 2HL6A 3OKCA 4UNQA 2QD3A 5ETJA 4BNUA 1E7SA 5J47A 4ZI7B 4LZLA 2IXDA 3TEMA 2XQVA 3A27A 2XMBA 3I01A 5TPZD 1BJRE 4H27A 5JC8A 2ZQZA 4WK2B 2ZBFA 4EBBA 5JNWA 5DTQA 4JU8A 4DIUA 1XF9A 1R0BA 4Q48A 3D8RA 1RHQA 1ECCA 3FKSA 3OUUA 4HYYA 1UDWA 1DL5A 4RX1A 3V8EA 4E2YA 1M8GA 5BXYA 1XALA 1NXTA 2IHJA 5HM8A 5JYEA 3OM8A 3NXKA 2PUAA 1FLVA 1WX1A 2EJBA 5AVJA 3CLKA 1KK1A 2QRGA 4ZZIA 4I5DA 1G8MA 4ZVOA 4KIUA 3S5UA 2FK8A 4OTZA 3HN6A 1SHKA 1HK7A 2GQ0A 3TE7A 5BQ3A 1Z7BA 3OP1A 4NJOA 4U6NA 3T5TA 5HJ5A 1MJGM 1Q14A 4WEQA 3PDUA 3H9BA 3I2JA 4DAOA 2CMKA 2ZI3A 1RWOA 2B7BA 4EY4A 2CD7A 4KWEA 4IDOA 4B6PA 1KRXA 1ECJA 4YCLA 2IHUA 3PPIA 3PT9A 5AWFC 3PV0A 4P58A 5A5VA 1Y7HA 3RVKA 1L4GA 2WYVA 4DLAA 2YIJA 2QE7D 1C3XA 1NZDA 2DWUA 4RK6A 3ZWQA 2PTGA 1LNQA 2FV8A 2DBQA 2PA3A 4JUCA 1KYVA 1WOMA 3OD5A 3UHAA 3N2KB 4CCSA 2XZTA 5I9NA 2CLCX 2I6FA 2FN4A 1Y4ZA 5ALIA 5C7YA 4L08A 3LOQA 4R1TA 4S1VA 2XUZA 5EJ2A 4OAOA 2BSAA 4DIOA 5JNLA 5EYPA 4ZZ2A 3HVHA 3T0IA 4C1BA 1O94D 4DR3B 3R5KA 3ZHRA 1WU8A 3ZNPA 3C2QA 3HADA 3PWKA 5JNUA 1GCAA 1J0XO 1I51A 1U0GA 2ZRNA 3A4LA 1FXWA 1X13A 5DBEX 5L4LA 1MW8X 2FR0A 2DUUA 3FLAA 1GD1O 3DNFA 2WJ3A 3KYCA 4EK9A 3GCXA 5BSGA 2BBTA 2HA0A 4TT3A 4RD2A 3JYPA 5E7JA 3W6ZA 1WUYA 2JBWA 4EYQA 5T4EA 3UAZA 2BEUA 2PX6A 1J5PA 2ATVA 2WSBA 1P4RA 5BV7A 2W58A 2Z9DA 3EXFB 3H1BA 3LHKA 2WSSD 2GWRA 1NBME 2Z57A 1PFQA 3FNRA 1Y42X 4MVJI 2P67A 3DQQA 3O4HA 5EP4A 3KOYA 3JRWA 4CG1A 4D3SA 3QEMA 4D9EA 1Z5WA 4NG4A 5FADA 4JI0B 4DYVA 2XOKD 2L42A 3I76A 1EVLA 4LZWA 1N92A 3ANXA 4X95A 3WP1B 1OX4A 2JRCA 1I6LA 1O1YA 4W5HA 3TQQA 3E1KA 1WXXA 3LFTA 3G2HA 1WBBA 2QT9A 5GOZA 3JARA 5DXFA 3TVYA 4EJSC 2LW7A 4C7KA 3LSYA 3O83A 5ALGA 5KYWA 2ZCUA 2OWEA 1I4OA 4JBIA 3REGA 2ZIAA 1S1MA 1TQ6A 5LQRA 1Q84A 1IDN1 1VRCA 4KZPA 1FMTA 2BH2A 1CS0B 3NPAA 4PWYA 5EQTA 2XE4A 4CM9D 3IP6A 3VNUA 2IZ7A 2HY7A 4IHAA 3ZQJA 3R3SA 2QROA 1ZL0A 3CBGA 2F17A 1XLWA 1GRQA 4RU1A 4AURA 2QTVA 2I9PA 3PDCA 4UKDA 1BKYA 1A8HA 1BROA 2QB5A 2R8RA 1DIRA 3EGDA 1N6RA 4QASA 5EI5A 4DMKA 1X9HA 1B8VA 5K51A 5BSHA 4WX2B 3EJWA 3N0RA 4ZI5A 4E7PA 1PSZA 1U8EA 1BQ4A 3L4EA 5DX8A 3PBKA 5DF1A 3M1IA 3W5DA 1YCDA 1TYAE 3L8EA 2C78A 3D7MA 5KB3A 3HCCA 4H7PA 2OCLA 4WY8A 1JMVA 4WGFA 3CWCA 3I64A 3ZGXA 1WB9A 2W4MA 1Y6QA 4MARA 2FLVA 2IEAA 4JU9A 4ROSA 1IBRA 3K5PA 1LW6E 5C7OO 2FPPB 2GXUA 4LE0A 1CZNA 5DIFA 3USZA 2HNBA 2AYXA 2QL5A 1EP2B 4Q6BA 4RIEA 4FXOA 4GPAA 3CUUA 4BN5A 4YJHB 4EPWA 2OV6A 2QYTA 3D8HA 3OICA 5F1KA 1KZ1A 4AUNA 3KQMA 1E9DA 2BGGA 2ZJ1A 5FBLB 3TRHA 1FA9A 3CVXA 5EPOA 5JLAA 2X77A 3BTOA 5J40A 4L22A 2R7KA 2X1MA 4RQBA 4AROA 2OEPA 2XJ4A 4R6XA 1NX6A 2QYSA 5SY9A 1SVNA 1X7YA 1VLMA 1SC4A 1XMQB 1OFVA 2C9ZA 4MMXB 1YQWA 5A6VA 4O1MA 3DEIA 5NLLA 4F8EA 2FUCA 1KMIY 4RXTA 4XPZA 3CLVA 5I8WA 2GERA 4RACA 2EP7A 4G0QA 4EFMA 2ZYIA 4BQPA 1OAOA 1WB5A 2A1IA 2GN9A 1CUXA 2PBLA 2PT5A 3LXXA 2ZJBA 1BWSA 3UMRA 5L9AA 4RFSB 2R9VA 2I1WA 1FMJA 3JVVA 4NE7A 2NOAA 5KVQA 3B60A 2V96A 1FK8A 4KG7A 4JC8A 2QRLA 2QG9A 1U8CB 4GBMA 4PSAA 5KNCA 1P1BA 3I61A 4RFVA 1T36A 1C9JA 1L9XA 2VJNA 1OFUA 4O4LB 2QRMA 1I3MA 2JIRA 1E98A 5G2OA 3TIGA 3WB9A 4RHYA 1EXDA 3BE6A 3R09A 4WUVA 3OZ7A 4U5QA 2P40A 1AN9A 4M1QA 4ZO8A 4D97A 2EIHA 3QJGA 4ITUA 4Q3EA 2YVAA 4BDSA 3PDIA 4GWGA 3MGBA 3BRSA 5DYNA 3V4VB 5JUWA 1RWVA 3PC8C 3CGGA 3TMKA 4C14A 2OB1A 1HY3A 2B0CA 4YP0A 4D6YA 1DC5A 2J3JA 3K8YA 1JYFA 3LCCA 4RO0A 2P41A 4NBRA 2AEMA 3TSYA 3IT1A 1Y9JA 3GBSA 1HT1E 4Q9AA 3ZYCA 5TMDA 1U99A 3OTWA 5EP1A 4V3BA 3N2LA 4KFSA 5BSFA 1ZD5A 3EQ7A 1Q77A 1Y1RA 1KU6A 5M04A 5GIOE 1EMDA 2BEVA 3IT2A 2IFTA 4FDVA 4JHXA 4L15A 4N54A 5KTSA 5JNTA 3SAJA 3QENA 4IWYA 3EGEA 3KO8A 3HA2A 3WL3A 3PC3A 1SCUA 5TJ9A 3GHYA 1DBPA 3FHTA 1FTNA 1MO5A 3N8DA 5AH0A 3AUKA 1SOMA 3Q0EA 1TZBA 2D1YA 2OAP1 3RHZA 3T1NA 1EK0A 3LX6A 4IPTA 4Z2AA 4G4SO 2PT6A 4RL6A 4W99A 1SHLA 4BFUA 4BZZA 4C0BA 3R6TA 4MHOA 2AF4C 3KU1A 4DSZA 2KPOA 1DMSA 3I72A 3GD7A 3ZXUB 1Q50A 2XCQA 2A78A 2X76A 3KZMA 4GR5A 3Q7TA 5TVKA 4EQZA 2C9YA 1FOEB 4RSHA 1GPAA 4EG4A 4G4SP 5HQ3A 4C7JA 3PGLA 1FYVA 1GOTA 2F1JA 3TZEA 3GNTA 4GBJA 4OI0A 2FP4A 4XR9A 5BW6B 5HA5A 3SHQA 2J9ZB 2HYIC 1OZFA 4YRPA 1FTWA 3DEJA 1PFVA 1YJQA 4BMVA 4GKKB 1XMJA 2CXTA 4CHTA 3CZRA 3EODA 3HN2A 2VP5A 4E14A 2VCHA 4V38A 1E9SA 1Y1TA 2H2AA 1BFKA 2Z3WA 5JS7A 2GVZC 2B3TA 1DU4A 2FI1A 4BZWA 1EG2A 1TM7E 4DA4A 4ZVVA 2Q1TA 3A36A 1I5OA 2VKTA 4RKYA 5EFOA 2J9FB 2HBQA 3P9QA 3GDGA 4AB1A 3M7IA 4O4LF 4UXJA 4RK4A 3UFBA 2AH5A 3CURA 3EQ9A 4L07A 2AXNA 4QUJA 3R76A 1FP4B 2WIAA 4C08A 4P4SB 1KO8A 1SCAA 1WPQA 3D64A 4BV3A 2ZR0A 2EFCB 1V39A 1E1DA 4YDSA 1KVTA 2CK3A 1UOOA 1RJDA 1M2FA 1SMKA 2VSFA 2HQSA 2YHUA 3MPOA 1J33A 1H2ZA 4QWMA 3QOWA 3L01A 3PS9A 5EFZA 5EINA 3AY6A 1UMKA 3X1JA 4JFAA 4LMPA 3OFNA 3JXEA 3L1UA 2JAXA 4IS3A 3VSDA 1G1AA 5J3JA 3LLUA 1VKHA 4KYIB 1QQ7A 13PKA 3O8DA 3L84A 5F21A 2ACEA 4W8HA 3RSLA 3S8EA 2F8SA 5AW3A 1K06A 2WFLB 4LXYA 3L6BA 1FNSA 3TQOA 2WUDA 3JVUA 3HRKA 4XYGA 3GH3A 1UAGA 3HPRA 1VJRA 2NU7A 2HV9A 3HSSA 4HH4A 4MZDA 5L95A 3MNFA 3FIJA 4MVJF 4MOWA 2PGOA 1WCWA 2P2SA 1IAQA 5SZKB 4EY6A 1IH8A 1YDWA 2CXPA 4G0XA 4OMUA 4KPEC 3L4KA 3LUCA 1Q2UA 2ZE6A 4MUYA 1H6BA 2FF5A 2PV7A 3QVSA 4HQ6A 1T2AA 4CMGA 3PUHA 2RGYA 5BOVA 3WWYA 3PFBA 2J0UA 1FUEA 1REQB 2FMIA 1H4TA 1FU4A 3E2MA 4RQAA 3DZDA 1WCIA 4WVLA 2Z5VA 3DMPA 2DTXA 4QRHA 1WOYA 4IYRA 4L4XA 4RD0A 3TOVA 3TKLA 4A6XA 3TMYA 1TC2A 5AJZA 2ZB4A 5EMNA 5JCXA 1NR7A 4FHZA 1LBHA 1D5WA 2PPLA 4TMTA 5BP7A 1P91A 1S4QA 1RAFA 1TQDA 3SOPA 3PJDA 1RVV1 4JLAA 4NAUA 4YCMA 2A5GA 4JQYA 2IYNA 4D92A 3E58A 4P7GA 2H2IA 1VXRA 3AKDA 1YVPA 3OESA 5HKKD 1G5HA 2GBLA 2Y68A 4YQEA 1R10A 2ZRLA 2BEJA 3D0OA 4UFNA 5TX7A 4GYKA 1SQGA 4BKRA 4TKVA 3HBJA 3BSSA 1OLSB 4RZHA 2WWVD 5JZOA 1DAKA 2P4UA 1GPJA 3SCZA 3Q87B 4IV8A 4C4RA 3OIGA 1BQ3A 2HHLA 4AJHA 3EOAI 4CQMB 3NHYA 4G1MB 1TW2A 4GR4A 4X20A 5ALHA 2QQ5A 4GLBA 2QTMA 4DV2B 4FINA 3BGDA 4LCEA 3JS5A 1UXHA 4MEJA 3S55A 4NZMA 5KOJA 4L57A 5GINE 4Q9HA 1L4HA 5J2UF 5IASA 4IVNA 2Z8YM 3IBFA 2I7TA 1O95A 1QAQA 2HX1A 3IPLA 4WBXC 3E3OA 2GJ9A 5L51A 2O5EA 5DU2A 4X61A 4HQFA 1CJUC 1V8BA 4J16C 3PDHA 1J0DA 4PYQA 4DJJA 1ES9A 3QVJA 5EJGA 7ABPA 4Q66C 4YMWA 3GU3A 5L7YA 4YV2A 1Q95A 1K7CA 1JPNA 2EERA 3NP9A 4N3BA 3ZY2A 3INNA 3MTQA 2AFIE 4UNRA 4ZGBA 1SGWA 3GPDG 4Q16A 1MTZA 1DCKA 2VWGA 3RU2A 3TF5A 3NRJA 4Y6QA 3IUJA 4MUBA 2G70A 3QWIA 1VJCA 3GUZA 3R23A 4DR7B 1N3IA 4OI4A 1ZWKA 2O59A 4RTLA 2D1TA 2I6GA