3VV3A

Crystal structure of deseasin mcp-01 from pseudoalteromonas sp. sm9913
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
329
structure length
329
Chain Sequence
SATNDPRFDDLWGLNNEGQTGGTADADIDAPEAWSISTGSRDVVVGVIDTGVDYSHPDLAANAWVNSGEIAGDGIDNDGNGYIDDVHGINAITDVGDPMDDEGHGTHVSGTIGASGNNGVGVVGVNHDVSIVGCKFLAADGTGSTSGAIKCIDYMVGLKNAGVNLRVLNNSWGGGGFSQALADAITASEQADILFVAAAGNDAVDNDQNPHYPSNYENDNVLSIASTDSRDNMSSFSQWGLTSVDMGAPGSGILSTVPGNSYATYSGTSMATPHVAGAAALVLSVNPDLTTLELKELLMSSGDANAALNGKTVAGTRLNVNQALIDADP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Deseasin MCP-01
publication title Structural Insights into the Collagen-degradation by the Bacterial Collagenolytic Serine Proteases in the Subtilase Family
rcsb
source organism Pseudoalteromonas sp.
total genus 124
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3vv3A00
4J94A 1Y3BE 1KE1A 2W2MA 5AVJA 3CO0S 5JXIA 4NE9A 1YU6A 2DQKA 5SICE 1PFGA 3T41A 1GNVA 1SUDA 4GI3A 3WIUA 3DDZX 2PWAA 3ZXYA 1C9JA 1OYVA 1PTKA 2Z58A 1GNSA 5CW1A 3TECE 4I0WB 1TM5E 3BX1A 2SICE 5AVKA 1Y9ZA 3UNXA 2SNIE 2ID8A 1Y3DE 1OYOA 4WOBA 3HJRA 3ZXXA 1BJRE 2SBTA 1Y3FE 3BGOS 1SUEA 3F7MA 2WUWE 2TECE 5FAXA 1NLUA 3I34X 1SCNE 1T1IA 3LPAA 1AVTA 1BFKA 1Y4AE 5AQEA 2X8JB 4M1ZA 3DE5X 3WHIA 3VTAA 1Y4DE 1SELA 2W2PA 1SIOA 4MZDA 1C3LA 1T1EA 2GKOA 1SCJA 2IXTA 3WIVA 3EE6A 4DZTA 1THMA 1KDVA 2Z57A 1TM7E 2WV7A 5JMOA 1SVNA 4BWGA 2HD4A 1NDQA 1Y3CE 2Z2YA 3DE2X 3L1KA 1SBTA 4YN3A 1IAVA 1NDUA 1SCAA 1AF4A 3I2YX 3I37X 4OV6B 1GA6A 1P7VA 4AKSA 2X8JA 1C9NA 3QFHA 1V6CA 4KPGA 2Z2XA 1EGQA 1GTJ1 1R64A 1KDYA 2ST1A 3F7OA 1UBNA 2Z56A 1P8JA 3DYBA 1SUBA 1SCBA 1WMFA 1SBCA 1Y34E 4DWWA 1TMGE 1MEEA 1DUIA 1YJBA 5ARBA 5JXJA 1TM1E 1C9MA 3LPDA 3AJ9A 3DE6X 1SUAA 3DE3X 4ZARA 3DW1X 3D43A 1P7WA 1ST3A 3CNQS 4CG0A 2DUJA 1IC6A 4HVLA 5JXHA 3DVRX 1XF1A 2ID4A 2QTWB 3DE7X 4H6VA 2WWTA 2ZWPA 1SCDA 4C3VA 1ZVKA 4OMCA 1AK9A 3TI7A 3P5BA 1ZVJA 3A3PA 1ST2A 2Z2ZA 1MPTA 1JEAA 3QMPA 3Q5GA 3QTLA 4WOCA 1YJCA 4CFZA 1T1GA 1DBIA 3GT3A 3VV3A 1WMDA 2W2OA 1GA1A 4H6WA 3LXUX 2XTJA 3TI9A 3H42B 2WUVA 2SECE 4NMXB 3DW3X 2W2QA 1AQNA 3DE0X 3D9QX 1BFUA 3LPCA 1HT3A 4OMDA 1BH6A 2ZRQA 1V5IA 2ZWOA 1SN7A 1TO2E 1SBHA 1WSDA 1KDZA 4Z2AA 5AMXA 1CNMA 3DE4X 1S2NA 3SICE 4C3UA 3OSZA 1GCIA 4DJ5X 1SBIA 3DE1X 1TO1E 1SIBE 1WVMA 1Q5PA 3I30X 2PWBA 1AH2A 3F49S 1EA7A 3SQOA 1TM3E 1WMEA 1YJAA 1TM4E 1S02A 3PTLA 2G4VA 1GTL1 2DP4E 4CFYA 3DWEX 4NE7A 5B1DA 1R0RE 2B6NA 1AU9A 5FBZA 1SH7A 3VHQA 3GCWA 2HPZA 2PRKA 2XRMA 4RYDA 4HX2A 1PEKE 1SPBS 4H6XA 3Q40A 1SUCA 1SUPA 2IY9A 1Y33E 1Y48E 4KG7A 1A2QA 4K8RB 2PKCA 2PMWB 1CSEE 1TECE 2E1PA 5ARDA 1Y1KE 3AFGA 4LVOA 3PRKE 1OT5A 2P4EA 4ZOQI 3AJ8A 3EIFA 3EDYA 2Z30A 3VYVA 1BE8A 1TK2A 4KB5A 5FFNA 1S01A 5K7SA 1VSBA 3VV2A 1R6VA 1SBNE 5JXGA 1SIUA 1LW6E 1GTG1 5B1EA 5ARCA 3GCXA 1BE6A 1PJ8A 1GT91 4JP8A 3A3NA 3BPSA 1AV7A 4FONA 4B5LA 2PYZA 3DVSX 3A3OA 1KE2A 5I9SA 3WQBA 4AKTA 3VSBA 3GT4A 4LVNA 2V8BA 2W2NA 3DVQX 1GA4A 2PQ2A
chains in the Genus database with same CATH superfamily
4GRDA 2FWAA 3JARA 3R3YA 4OXXA 2FMIA 3MYRA 3HSSA 4ZRNA 3RC1A 4N48A 4DIMA 5CDUA 2YS7A 2IPMA 2IYFA 4DIBA 2PR7A 1JEEA 2WA1A 4JKYA 2JC3A 5EJ2A 3R75A 4BN0A 3OJLA 2X0KA 1RDFA 2MSCB 4MULA 2L18A 3S7TA 2DAPA 4MQ5A 1EINA 3T5MA 2IIVA 3QF7A 4GQIA 2QPTA 4XQGA 5K5EA 2ZSDA 5BYJA 3KD3A 4RPHA 3AZOA 4K1XA 1G4HA 4LQLA 1NXWA 1VG1A 3A2MA 4EHIA 1MAHA 2EKPA 1ODCA 1SIWA 5AVQA 5AW0A 3RU7A 4RELA 1QH1A 4M9QA 4B17A 2ANBA 3TQCA 1QKIA 3L04A 2Q5QA 5KYVA 5T4HA 4I1PA 1K6EA 1UC8A 2H06A 2PBFA 5TE9A 4MW6A 2YFHA 1WCXA 5DGIA 1Y7PA 2D8AA 2RGBA 3WTBA 2IT1A 2RSLA 4IBOA 2WLSA 3CWCA 1QH9A 3MERA 4FILA 3ZI7A 1P0IA 1QGUB 4TKMA 4P3YA 4Q6WA 2OHIA 5ILQA 1EX1A 2P5TB 1ANKA 2Z8YM 3WIUA 3ZWYA 4BFXA 5A7FA 1OFVA 2BC9A 2O7QA 3VBEA 3HSYA 1NMQA 2GJKA 1TE2A 3A1FA 4AN0A 2ZP1A 1CP2A 1WS6A 2QE6A 3MS2A 3QXSA 1QRDA 3DLPX 4YRTA 4R1TA 5ALQA 2QQ0A 2E85A 4PINA 3V5NA 5HF6A 2X3FA 5JYBA 3CVYA 3L93A 4IIGA 2HHAA 2IXAA 4PYNA 1LDYA 5KI6A 2ZB4A 4OD0A 1TO6A 1OD6A 3TQSA 4A8PA 1TCAA 1V5EA 2AN4A 4KKXB 3NNNA 4NC9A 1I7QB 2X3UA 3PEYA 4JB0A 3H16A 1T4BA 1F2DA 2HF2A 4AX8A 5FI3A 5D5HA 5E4JA 4CODB 3ZVRA 2BFEA 2FJPA 3DBOB 2ZRGA 3FOCA 3K6SA 4M86A 3I09A 3PX3A 2O8NA 1GZ4A 1Y9ZA 2MOKA 4P7GA 2G1KA 3DLCA 3JD0A 4HGRA 1MAUA 4HRXA 2WG2A 3BORA 5HSGA 4X20A 1OXXK 1YI1A 2Q28A 5A4KA 1RRMA 3UHFA 1R16A 2Q6OA 1QVWA 3FRIA 3R3WA 4KMSA 1ZQ9A 4DSNA 1HE4A 2DFLA 4LZPA 2QT0A 3C6YA 4LE0A 4V3CA 1SU6A 2HJSA 3ZV7A 4FFRA 1U0BB 3B1ZA 1A2BA 2D62A 2O8BB 2VBGA 3RC3A 1R8XA 2WTXA 4LOIA 4PAWA 3CRZA 1PYGA 3G1WA 4M1MA 3DPSA 4PYLA 4UC0A 4DANA 5FOSA 1TZMA 1YQDA 4FR0A 4TYQA 4MYSA 3TRIA 3CXRA 1Z0UA 1H6DA 1Y63A 3SX4A 2L42A 2HHHB 4FFWA 4JLVA 3PA6A 4DJJA 4EA6A 1PSZA 2HWKA 3EIOA 4YJGA 1GPYA 1K63A 4MIEA 1TU0A 5IWAB 4G5YA 3SIPA 2AJTA 1KZ1A 2Q3MA 1C8KA 2EIHA 2WHQA 4MUFA 2B78A 4PXYA 5DP2A 4EHFA 4YDQA 1G19A 1A95A 5KYXA 4RULA 2PWZA 1QHFA 3DZFA 3MLBA 4L02A 4EUEA 1MKYA 1W4ZA 4RZ3A 2O2XA 4M6WB 5AQEA 1E6LA 2PZLA 2EJWA 3NMUF 1HDXA 4JWTA 1G1MA 3MLAA 3G6KA 4M1ZA 3R9IA 2HMTA 4REQA 4F5WA 2RIPA 2ZIGA 1GGMA 4FFPA 2OCLA 4YQYA 5L45A 1A8PA 1DELA 2FPMA 5IKXA 2QYSA 3NJ8A 4F84A 1TZBA 1CG6A 4DIUA 1J90A 4Q7LA 1ZESA 4BE7B 3AR4A 3FTFA 4PLWA 3F46A 3L9WA 3UJ9A 2IHZA 2CLMB 1Z06A 2ZTSA 1YONA 1AN9A 2YY7A 4D8TA 2GM4A 3Q1KA 1HDZA 4HTFB 1CUAA 4JJ7A 2W93A 1I2MA 4P32A 4ENVA 3FAZA 1V1RA 2IXTA 3OHMA 3VKFA 3JSAA 4YCDA 4HBGA 3UGTA 2BR4A 4ND8A 4XGQA 2FRVA 1GZSA 3L46A 3FTDA 1VL8A 1VJCA 1RAEA 3DSRA 5IUNC 1P6XA 2GJ8A 4UBLA 1QHHA 2ZYAA 1RI2A 3KDPA 4MARA 1NDQA 3ZHUA 4MR7B 4GOND 4ENWA 9LDBA 3SS9X 1Y4ZA 1S1MA 2E48A 2QP3A 3S68A 3AIIA 3FPAA 3JYQA 1F2TB 4BZXA 5IKPA 1TKBA 1KP9A 2ZQ5A 5C1PA 3NYRA 1FXSA 1TC2A 3M5CA 4HX9A 5EUCA 3ER6A 3HN7A 3K73O 3LBHA 4R5MA 2Y0DA 1FFSA 1NKSA 3SYRA 3F5SA 5FTWA 3ZS8A 1NDUA 2QN7A 2Y1CA 1AF4A 4IXTA 4PYRA 4KR9A 1GRVA 1RW4A 1E3QA 1RJWA 2FWPA 4HS9A 3QKRB 4LS3A 5DU2A 3VVCA 1KYZA 2B3DA 4CMGA 3DB2A 3NVDA 4G63A 3IEKA 3OX1A 1D03A 4CT5A 3P9SA 4XW2A 4HYYA 5DGHA 5JCZA 5KYYB 2YWCA 4N76A 3TSYA 3WGQA 4CCYB 2JFWA 5CXXA 1QORA 2CJYA 3V2HA 2IKQA 3ZZMA 1DHRA 1G21A 1GTJ1 4HVCA 4BFUA 3AVWA 1U3VA 1YBAA 3E3NA 1LPPA 2GARA 4CW7A 1BD3A 4BIMA 2JW5A 2ST1A 2Q2WA 4A73A 4O33A 2YHSA 1NTRA 4LBWA 4ZAXA 5BVHB 4GPD1 3GRAA 3RARA 2Y0BA 1PWHA 3BMCB 2A5YB 3DBIA 3EA4A 4Q3DA 4BNIA 1R0YA 1MXFA 4UBKA 1P8JA 5GM1A 1SUBA 3LT1A 3OIDA 1NG9A 2Q4TA 5LYJB 4AMUA 3AF3A 5ALNA 5HCUA 4H15A 3OOSA 1L1QA 3EOAI 3RM3A 2G82A 2ZUVA 3RTDA 4DCNA 1A8SA 2DR0A 4RY8A 4WWHA 1R0XA 2PSSA 2CNDA 3O9MA 3PA8A 2X8WA 2V7WA 1DUIA 3T99A 1J24A 1CS0A 1XRMA 3KLOA 3ZE9A 4BX2A 3ASUA 4CZ2A 3R3SA 1D2HA 1NXXA 3EIWA 2WJ3A 1XJQA 1B1CA 3MD9A 4JK3A 3WKCA 1HRDA 3OO0A 5CEEA 3ZJTA 1WUHS 3EIQA 3ADCA 4UEKA 1FLDA 4C0HA 3OHSX 3PUIA 3CXUA 2ORWA 3AJ9A 1KETA 5MF6A 2HN9A 5IF9A 3B48A 5FA5A 1BZYA 1U02A 2QRGA 4DNXA 4LFBB 2XUHA 3GFQA 5C0OE 1R74A 4HB0A 3NJ4A 1XKTA 2I2WA 4X1IB 1TD1A 2FRDA 2RH9B 3C3AA 2WT9A 1EM8A 3H1TA 4FR2A 1GQYA 1ST3A 3K0SA 3SX2A 3BFVA 3OT5A 3HUFA 1TCVA 5G3ZA 1Z0ZA 3GZTB 1CJUC 2H2AA 4DKXA 5A06A 4ZZ0A 1FUEA 2HKIA 4J7XA 1YZLA 2N3ZA 2G72A 3PD7A 3ZEIA 1F7VA 5JS1A 2QUZA 2MSEB 1N2JA 3FJYA 3KXDA 4BRSA 4DCMA 4DXHA 2FFQA 1F14A 4BFTA 3MTEA 2WPNA 2Q0QA 4YREA 1ICIA 1XTVA 4NEGA 4GSYA 3I8OA 4LA4A 5A4DA 3IT3A 3BRCA 4UE6A 4KFCA 1ULUA 3MGAA 1J09A 2RH5A 3E3OA 2X5OA 2AOXA 1Y3HA 2W6JA 1R5JA 4MPPA 1M1NA 4XDZA 5KWEA 2AEJA 1B8NA 4LXUA 5JFOA 3HK2A 2YV4A 3WNDA 16PKA 2PVCA 1J0AA 2OVBA 1VOTA 2W11A 2G0AA 3BH7A 2EBHX 2Z2ZA 3K0FB 3OIUA 4WK6A 5E2IA 3DBVO 1B0UA 2PE5A 3FLAA 2WJHA 1M10A 2QEQA 3GZNB 3MCZA 3E7DA 1JSLA 4YWJA 5IM4F 1OZFA 5K6AA 5CVVA 4RE6A 2E4WA 4AZ0B 3KQYA 3P0RA 3HP1A 3ZQ4A 2I4LA 5T4EA 4YAKA 4UPVA 4N41A 3SBXA 3KQTA 1XRRA 2XSZD 4GWKA 2JFFA 2P90A 3D31A 3JQCA 3D0QA 4O0MA 4OYLA 4V24A 4YDRA 2A0FA 1M6WA 1YRYE 3GT3A 3VMMA 3QLVC 5C2JB 5K3EA 2IYOA 1YVDA 3FKQA 5CVJA 3CX8A 2XAAA 1B4DA 5K03A 1EJ2A 3D5TA 2ZKIA 4XYEA 3IQWA 5CT8A 4Q05A 2RMKA 3QMVA 1B1AA 5H3LA 2J0VA 4EOGA 2NYUA 3AERA 3MSXA 1ZO8A 4I50F 3FZEA 3VDNB 3AVOA 3QVOA 2QL5A 2NTYC 3O26A 1YZNA 1O6BA 3C0KA 3DDUA 1E9AA 2V96A 3DOIA 4I66A 1NR7A 2SECE 3OT1A 1NE2A 1NRWA 2ZYTX 1MBZA 4HVTA 4A2PA 3T5PA 1IZYA 2XYRA 1SZCA 3TPZA 2IYVA 1U2SA 4A27A 4ZHQA 1AQNA 1P33A 4DCTA 5EQDA 1OH7A 1MB4A 2Y2VA 2C59A 3HYCA 3QQPA 1E1CA 2I6FA 1J8QA 5BV7A 1EXDA 3R74A 3QX9A 1HYBA 1UJ5A 2B2XA 2POQX 2OLJA 2YMPA 3L06A 3MWDA 1BH6A 4MSUA 4RF3A 4TYYA 5BORA 2A35A 1DRKA 2EW8A 1W46A 2F4VB 4UM5A 2HV8A 2ODWA 4G07A 3UW1A 2F9FA 3WA6A 1F6DA 1RKXA 4HQNA 3NRCA 4KUGA 2JVIA 2OXFA 1CZLA 4N5DA 1CDDA 1YMUA 1HTBA 1QMGA 3QV1A 2GHRA 3I9JA 1GVHA 1RU3A 4RF4A 3Q3VA 3URMA 3BWYA 4AJPA 1O7JA 2WHYA 1GCIA 3ZX5A 3RRFA 2H3HA 3KZ1E 2FN8A 3ENZA 1T5SA 3FUCA 1K97A 4IFEA 4PF1A 3UUEA 4D1YA 4UDNA 4XVCA 5BW4A 2RHMA 3B53X 4XVQA 1C30A 1DE0A 4JHXA 5EIFA 1K8YB 2JGMA 4XI9A 1LBIA 2BE7A 2BI8A 2ZETA 3PNLA 2FSPA 4CKXA 2QRMA 1RLTA 1MO3A 1C14A 1G42A 1E8DA 4E51A 1S2LA 4M37A 5LZ2A 3ECAA 1J49A 1I3CA 3HADA 3P4UA 4WHMA 3V8QA 3N2KB 4FN5A 1VJ5A 5KTOA 1XO1A 3E1GA 2ZUBA 4PZLA 3SF0A 4PC2A 4E4YA 1PNVA 3SHWA 4HF7A 1GY8A 4P4SB 3AXSA 4DAOA 3GMSA 1UQTA 1XAGA 1M74A 3ZWMA 1KO8A 3K8OE 2C2MA 4IV8A 1T3SA 1QV6A 3LUAA 1WDMA 1WU7A 3FGPA 2H85A 4LZWA 5IT4A 4CFSA 4UTOA 5LJLA 5CNKA 3T9BA 4F12A 2B30A 1IN4A 1KI8A 2ZRPA 3JYLA 1BJTA 4MS3B 3ZIUA 2ZJZA 1AURA 1PDWA 1DBQA 2B6NA 1SUIA 1CULC 2OBXA 3GRZA 4MVJF 1KC1A 3P97A 4ZOBA 2Z2KA 4ZI5A 5BWBA 4CL2A 3FDXA 1EDEA 2HUPA 1B6SA 1TRKA 1R6BX 1JDZA 2JJQA 3KAQA 1BCSB 3JPYA 4HSGA 4I8DA 4MJXA 4QASA 1VSQA 3SFVA 4GE3A 4GP6A 4KXXA 1U90A 2AGVA 3D4PA 2GD1O 1YJ8A 4J7CA 1GFWA 2O6LA 2VP6A 3CISA 2A9PA 3SBEA 4B31A 1SUPA 2OXEA 1DT3A 3TEFA 3PL5A 4GBGA 3ZWAA 4YMUA 4C6HA 3P32A 2AUNA 1XVUA 4XSVA 1W8IA 4UEQA 1Z45A 2X76A 3OBIA 2Q2OA 1ZAKA 2Q6VA 4RL4A 4W9NA 2VBIA 4YHBA 1A2QA 5KSPA 3L8EA 3SXPA 1UEXC 3ZN2A 5JQGB 1TAGA 4I4TA 2PL5A 4C05A 2X3YA 5B4TA 1K06A 2IBMA 2F3SA 4F04A 3LVRE 1Y5NA 2JLAA 1VG8A 1WOMA 2ATXA 3WADA 5LQSA 3KQOA 3MF4A 1SQSA 3JQBC 3AL0C 2ZYHA 4EUKA 1A8UA 4GOJA 4I5GA 1JH9A 5FNVF 1VYVA 1JWLA 2YWRA 2VJOA 4M0LA 1G7TA 2CUNA 2ILVA 3DBHA 1GGNA 5EP1A 1Z5UA 2H1VA 3H75A 4L27A 5TVGA 3RFUA 3VR4D 2WM9B 5DIFA 4TSFD 5IJ9A 1GZUA 1L4EA 1ULBA 1VIDA 5HQ3B 1TK2A 5FYDA 2HPVA 3AF2A 4D0LB 4Z4GA 1T0IA 3LCVB 3IKTA 2WC1A 4WNAB 1RYFA 1YR9A 4K2AA 4YJHB 3H6HA 4DVGA 1CRPA 2FUG6 1ISSA 2BMVA 3TLMA 2OQRA 3VV2A 4U6SA 1P7CA 4J7UA 1DRWA 5B64A 1E9DA 2FJ0A 4BP3A 1RLUA 2QI9C 5DPMA 5G1OA 2J07A 5BSRA 4TZ6A 3CLSD 1JQKA 3OJ0A 2CN1A 3QE0A 2R4UA 3OQ1A 4F4HA 4DUGD 3F3YA 5C53B 4O3MA 3FA2A 4GS5A 2D2VA 3N8GA 1ORWA 2QTNA 1WDTA 2FR1A 1S8OA 1Z0DA 1WM1A 2OG2A 4ASUD 3FYDA 7GPBA 3DOOA 3A3NA 5G0VA 1JU3A 4ZJPA 2XZLA 1PNOA 2MYNA 1SHUX 3BPSA 4RHTA 5E6UB 3VDRA 3ZWDA 4DR7B 4FCTA 1F1BA 3FUUA 3KT0A 2PH7A 4XRGA 3OZWA 4BC1A 5DRTA 3TUJC 1II8A 4GM0A 1KE2A 3GRPA 4ZCSA 3FNFA 3VU9A 4I9NA 1M7HA 1TVEA 1R4NB 3AGPA 1IH8A 1BGXT 1QHXA 2O3JA 4KFUA 4XSHA 1H0KA 3WOVA 1GTVA 4TZTA 4YJ2A 4PXSA 3AYZB 4CLHA 4R2KA 1P1CA 1YOVB 4UVHA 3DVQX 2BGWA 4R7GA 3G2IA 3EXG1 3IA2A 3JZMA 3KKQA 4HQFA 1RZRD 4V3BA 3E5HA 4Q00A 5TRTA 2R4TA 4BLTA 3NNDA 3OP4A 4NVRA 3GJSA 3NC0C 3FETA 1DWUA 4HFNA 4K6CA 4LJ9A 1CJVC 4M1KA 2VAPA 5E0OA 3MS4A 2PY6A 1TAUA 4H27A 1KEZA 3NU1A 4XQ9A 2OB1A 3T5GA 3QLUA 4E3ZA 2V6GA 2GI4A 2X6RA 4JL6A 1O96A 1L7VC 2KJQA 3GAZA 2ZJYA 1RZ3A 1I1HA 4PCAA 4HGPA 1PFGA 3T41A 4ODIA 4IIFA 5ELXA 1LKZA 1EMDA 2O1XA 2GFQA 1HQYE 3FZQA 3TW4A 5KZMB 2BFNA 5CFMA 1KY2A 2ILTA 4NLLA 1QK4A 5CXQA 2OCXA 3N0XA 1KVSA 4ESOA 2VQEB 4DCOA 1GL7A 4B4OA 1CUXA 2H7VA 2C9DA 1C3EA 1NVMB 1Z0FA 1L5GB 4DRXA 4CKZA 1JALA 1Y8CA 5L3SB 1PTJA 4HKTA 2ZBFA 1CBUA 1P2VA 3EVZA 4QLAA 5BSUA 5KSZA 4MRNA 3UWSA 3DHVA 3MS7A 3UVEA 1LSJA 3FH0A 1QVAA 2FOLA 3MLEA 4F93B 3JQ6A 4J76A 3HBLA 5LQKA 4RDHA 2PR2A 3TL2A 3FG9A 4IZOA 1U5BB 4LSGA 1EFHA 3TR6A 4EQ6A 4R9SA 1E1RA 4N5HX 2AEMA 2RONA 5ADVA 3KXPA 3PXUA 3I04A 3RUEA 3ZEAA 4BNJA 1UEIA 2P8JA 4CIWA 2QU8A 4I0WB 2KS6A 1ZUWA 3VYRB 2JAQA 2VP2A 2XUAA 4BB5A 3HR8A 4ERNA 1J20A 5ALRA 3SQWA 3VPHA 1W36C 3UJHA 3BE6A 3GZJA 3WP0A 2YMMA 1Y4SA 3LY5A 1MX3A 2VT3A 1ADGA 1Y37A 2XDAA 1Z4PX 3CLRD 4RCYA 4L9AA 5KYWA 4BNTA 3OQVA 1TEHA 3R2JA 2WJYA 1KU0A 1XZNA 1Y42X 1PGPA 2WWRA 4E5DA 2DWCA 1QFJA 3AZPA 4RA9B 3HJCA 2Y1GA 5JG7A 4D81A 1CQPA 2CZQA 1GHTA 1LUAA 1X86B 2JIMA 4KHZA 4X92A 4KXYA 2NZWA 3MRSA 3O8BA 4DRYA 3CH5A 1RMQA 4BMPB 3OOWA 4CWAA 3NAQA 3K0BA 4C0LA 5DX8A 2AXNA 2G3YA 2VHJA 1KOLA 1SUEA 4XJVA 4YJ3A 3TX6A 3RD5A 1G8PA 5JCJD 2FWIA 3EOBI 2TECE 4H0FA 4TTRA 4DT1B 3LOQA 3T5DA 4DB4A 4LJSA 3U60B 3T9AA 3Q8KA 4EKYA 2PUAA 4DV1B 2A58A 4GYJA 4KQJA 4FCCA 4CF4A 5JBIA 2P41A 4ZTUB 1OZGA 3EBOA 2BFFA 2YZKA 3HM9A 1Q57A 1EVLA 1SCNE 2FOXA 2G6TA 2IHBA 5BRNA 1L5HA 4WKOA 4NAUA 3LIPA 2D59A 3MG9A 2DR3A 4OGFA 4OGWA 5CCDA 3ZWVA 4HDCA 4AWXA 2XKBA 4JJ8A 5CNMA 3B60A 3IVMA 4JI8B 2FQWA 1GCUA 2BEJA 1YIDA 3EF0A 5MN6A 3TGPA 2UVDA 2OVFA 3K4QA 4Y2YA 1RHQA 3GDOA 3FSRA 3ABSB 1RYMA 3MTIA 3UHJA 4OQFA 1Z5ZA 2R6HA 1KR2A 2XF2A 1IM8A 1OGIA 4QGFA 5J2UA 2ZM6B 2Q1SA 3KKZA 1ZH0A 5LR6A 1X1RA 1PGQA 4TVBA 4EVQA 9ABPA 1N77A 2OHOA 3IMEA 3C6BA 4QFDA 3N2EA 2A67A 1JWBB 1PKXA 3EIXA 4HYQA 1J56A 1YR3A 4BCCA 1SOMA 4XARA 1ODSA 2VSOA 3BWDD 3W8RA 1O54A 3M5PA 2WU8A 2L17A 2RHDA 2CT8A 3N59A 4UNNA 1SCJA 1P0MA 2ZKLA 2Z2IA 3D8HA 4JOBA 1NKVA 4OQYA 4X1YA 3ZTWA 3K5WA 4C0SA 3VVBA 1BD4A 3R6WA 2F1JA 5IAAA 1T91A 4NJMB 2AQHA 1NBMA 1Y0BA 3BJMA 1BMDA 3AUTA 5GWXA 5BW8A 1YJXA 3TSZA 5AKZA 1I10A 1JQLB 4YAWA 3RFXA 1HLGA 1YZQA 4MIKA 5CA0B 1ZL0A 2Z2JA 4IKEA 4YAUA 4OP1A 4OKNA 3AP1A 2UZ0A 3QY9A 4EHNA 4L28A 3TNDA 2WQ7A 3FGOA 3NHSA 4LG1A 2IODA 3GRRA 4L8FA 1E6UA 3K70D 1GIAA 3DKRA 3PC7A 2R7AA 1ZKDA 1G21E 2DULA 2QW8A 1NUUA 3QEKA 4UDXX 3RFFA 2CKMA 2D4AA 5TS3A 1KJYA 2EEPA 5JJIA 4GX1A 4LHWA 2HU5A 3EMDA 1WV0A 3H6GA 1GSOA 1W75A 2FSSA 3CCFA 3D7LA 5EIWA 2C7RA 2E3JA 4RHCA 1UQUA 3VVLA 2B1JA 2AMVA 4DLVA 4WH0A 2GXUA 5HOEA 5KTRA 1DAEA 1Y1QA 1ZUNA 2DFTA 2HNKA 5DYNA 4OV6B 2W37A 1WULS 3C1AA 4DCCA 4QUHA 4A2QA 3ZE2B 4UEWA 3LDFA 4MRVA 3I62A 4ZAZA 1NBEA 2B35A 5LKRA 5BQOA 3L18A 3H9UA 4K46A 4WOPA 3FVVA 3E03A 4YCMA 2HBZA 3D6JA 3V1MA 1GTRA 3PPVA 2AVDA 1FL9A 2VCHA 1YVEI 3NHMA 1XG5A 4LDJA 2EWVA 1KDYA 2YTZA 4E5MA 4V0NA 4F0JA 1M2OB 1EK1A 2GCNA 3KSAC 1TJ3A 3HJGA 3MGKA 4K3VA 4YP0A 4HHEA 3TMYA 3G9QA 1IOZA 4TMZA 4XWWA 3SHVA 1T0UA 3WG9A 3I04M 3I3SR 2CYBA 4I5EA 1EVQA 4UNIA 3PE4A 4O2RA 5H3CA 3WKDA 4HWTA 3B7PA 3RYHB 3WLTA 1JPVA 1QPGA 2D5AA 4BCDA 4U9HS 2NVBA 5A62A 4MWCA 4A6DA 4B8WA 4GIBA 5KTPA 1WUYA 1KFBB 3REOA 1V7CA 2ZB3A 2FPSA 4RD6A 1EWQA 3HVIA 3LS2A 4K9LA 4K81B 4XEUA 2O8DB 3R4VA 4WZBA 1EVKA 4AY3A 4AO7A 4HDNB 1KZYC 3GAMA 3QIVA 3RNLA 1F0NA 2B25A 3UOWA 1WHSB 1SPXA 4D9KA 1A0OA 1C9MA 1OBHA 4TS4A 3ROQA 1NLMA 1VPDA 3EZLA 2NO0A 1VE3A 2WSIA 2FOIA 3QW2A 2AFHA 2CUTA 2NXNA 3ND8A 1GILA 1LBTA 1Z28A 1ZGZA 2QLLA 3MGBA 3MUNA 3WGUA 5I5EA 2Q3EA 1G4UR 1GGHA 4KRYA 2J7KA 4YMTA 2G40A 3DA8A 2DHDA 2QN3A 4MUHA 3CF4A 3NTOA 1NYQA 1Q74A 2IY8A 3BB4A 1GQSA 4BO4A 4E2WA 4HUTA 1X0VA 2P69A 3GBVA 1P9RA 2HMUA 1IC6A 3SQLA 1JKFA 2BTQA 2ZRDA 4JFRA 1M66A 2OGSA 2AD5A 2YZNA 2PU5A 1AE1A 3LQ1A 3AV3A 1XZEA 5L40A 1SG0A 3K9CA 5AJHA 3HVHA 3I4FA 2VAVA 2WK1A 3VI4B 2H9AA 3BRSA 1OU0A 1TQ4A 3DMDA 2VJMB 3WLOA 4DLUA 1A76A 1FIUA 5HIIA 5HFAA 1QBGA 2IH4A 2DPHA 1PX2A 3F98A 1W0KA 4O63O 4Y2SA 2JDID 3AUAA 5JRZA 1FNSA 4QODA 1KR5A 1W59A 3WL3A 4ER0A 1FP4A 1FUIA 2WP0A 4MV4A 2BDUA 3GLHE 1ZGJA 5ALPA 1YV9A 2OA0A 5JS2A 3TTSA 2GRAA 1WXEA 5B3JA 2ZUDA 3ENWA 3C7TA 2OKGA 4H3KB 3GCDA 4FMCB 1LA2A 3MT8A 4DDVA 5K2OA 1HDYA 4BLOA 2ZVJA 4Q9KA 2QAGC 4WOCA 3WRXC 4YV7A 4XM0A 1B6GA 3R5SA 3TRHA 4HRVA 1I4OA 2GRUA 1Y8RB 4H3SA 3ULKA 3MWYW 5JH7A 4CF3A 1P0PA 1J8MF 4QBTA 4H7IA 1OTHA 2Y9MB 3CTMA 2UXBB 1AQYA 2BDEA 4FKMA 4UHCA 4G0PA 1NWCA 3LNTA 2ZW9A 4QUBA 5HKKA 4HGZA 2D5IA 4FOTA 2DERA 3PSHA 2CVHA 2IOHA 3I23A 2O52A 2X9LA 1VLQA 2CHFA 3HL0A 4KH1A 1RYNA 1C0PA 4JGIA 4ZVPA 4CGYA 2ZIVB 4GBED 4NMXB 3CN9A 2OYSA 3H3XA 2W2QA 4PLTA 3WZLA 4LRSB 4F2GA 4F8JA 3P0EA 2EG9A 3VU9B 3IULA 1AC5A 3GMDA 4YAGA 3OWHA 3P9QA 4Z86A 4DQKA 3PS9A 4DZRA 1QM5A 2BGLA 2FUKA 4ND6A 3NTQA 3WGGA 1N2CB 1OXMA 2WZQA 2XCOA 3NH9A 1L5KA 4YC7A 3LW8A 3NWPA 5FFFA 5A3QA 5KOJA 3JQ8B 1V45E 3IB6A 3SGLA 4Z2AA 7AT1A 1I4TD 2VJCA 5IVKA 2HMYB 1CNMA 3F97A 3H6KA 1OE0A 4ARUA 4CMAA 3PKJA 1DEOA 4TUYB 4XRRA 5CA1F 2GCPA 3UK0A 1E58A 5TSDA 4LZLA 3WDKA 4HN9A 2ZIFA 3E70C 4KXVA 5CFPA 2B6HA 2V5UA 4S24A 3UTDA 4AYXA 4FYWA 1F9AA 4BFVA 3OHPA 1ILEA 2P27A 5G4KB 4JWKA 3F71A 1I01A 2KYRA 1TM3E 3PFFA 1JBQA 1GPMA 5CRIA 5E7JA 1O87A 1L8AA 2A1UA 3CGGA 1DEKA 3VVMA 1CVLA 3LT0A 5AQ1A 5I7OA 3ELUA 4LCJA 1WABA 1SK8A 1W4LA 1UDRA 2DQSA 1NV9A 2Y68A 2UUOA 2ZJFA 1A9TA 1UT8A 3V7FA 3ACCA 5IWCA 4ZOLB 2QTBA 1RRPA 1V5GA 4I46A 1UDAA 3ZJUA 2ZQYA 3M4XA 1Z18A 4G9GA 4QXPA 5IJXA 3VOTA 1XCPA 4M54A 3JWJA 1CUDA 1TKCA 4V2IA 2WHPB 1DXYA 4Q3EA 2H57A 4YEDA 1KO1A 2FQ1A 1P77A 5TPZD 4DDUA 2G5TA 1QKKA 2JGNA 3THSA 4YCSA 1XLTA 2WFLB 1KIMA 3N8KA 3SR4A 4E5NA 1QX3A 4EGJA 2RGRA 4JDPA 4RYDA 2XUFA 1LDMA 1Z0KA 3ZW7A 1GEEA 4NBKA 5L3QA 5JCOA 4LGMA 4Y1RB 1MPXA 3F2IA 4R84A 1ISFA 5C5DA 1JTEA 3NTUA 4RLQA 3LGAA 1MO2A 3IAS1 3OQIA 1KDTA 3LP6A 3P0JA 2YVLA 3SMVA 3X43A 5JSUA 1UT5A 4X45A 4U2FA 3O95A 1Y33E 4AK9A 3EOZA 4Z4IA 2CL0X 4CEJB 4G4SO 1MRSA 3T3PB 4B3RB 1HE8B 3ZV5A 2F90A 2P67A 2PKCA 2AOUA 2IGTA 2I3BA 2JCYA 1KPIA 1VI6A 2JGJA 3GFOA 3R3ZA 3SSNA 1LPSA 5JASA 3U44B 1I2DA 3ESXA 4U2CA 3TLYA 5KYNA 4C22A 1CRWG 3VC2A 3GMTA 4L3VA 4H6PA 1EHIA 3BD8A 1KMQA 2VPQA 2OHVA 4RSGA 3VHXB 4DLTA 1FJGB 1LCIA 3UXYA 1YASA 3OICA 4J1TA 3ZGXA 4W5TA 2YWEA 4WW0A 5EE5B 2VTBB 1BEUB 2O3RA 3E7PA 1G17A 4ZQCB 2GPBA 1Z6AA 1H0RA 2IYTA 3L9XA 3NBMA 4TOIA 1ZMRA 4NCAA 4ER6A 3H0CA 1BE8A 4UUMA 4UHEA 3WYNA 1RKUA 2XADA 3N3BC 4RKWA 4DWOA 4MYTA 3AESA 4ZO4A 2O5VA 3IQHX 2HLDD 1RLOA 1TF2A 2Q0HA 1QXSA 1JG3A 2CK3A 3FNIA 1QGYA 1IHXA 3KYCB 3WSWA 1F60A 3U4AA 4ZGBA 3WWPA 1N4DA 3DNMA 1GTMA 5JAUA 1VYHA 4M2LA 4FB5A 2GVDC 3ANTA 2UZIR 2VR1A 3B2EA 3K0AA 3PE6A 3PHLA 1M76A 1IIBA 2LPMA 1T9KA 3CRVA 2O2DA 1Z2NX 3KJNA 4O1HA 1DRJA 1VM6A 2PMBA 3VNVA 2DHRA 3WWZA 2DOKA 1NW9B 2M1ZA 1JGTA 1IUPA 1BKSB 1CF4A 3WXMA 2N47A 3JCZA 1PJ8A 4TQ9A 2KW5A 1UR5A 3FWPA 2IXBA 5HKAA 5DM60 1TJPB 3WLHA 3GLTA 7MDHA 2WILA 3VZDA 2H1FA 2H0QA 2HLNA 4NJEA 5A6VA 1SJ9A 3UMFA 4TMWA 2PX0A 4J75A 3EASA 3SEZA 1AGYA 1JQDA 2Q3CA 1XXLA 3KWMA 1DX6A 1IWOA 1E1MA 1ONNA 3NHYA 3MW8A 4G5XA 5EMMA 2V54A 3EYWA 3O47A 4IFTA 1WAMA 4OUKX 3OSUA 5KEIA 4LVNA 4FU0A 5LXTB 3QUSA 2ETXA 3HNRA 5DYTA 2C7OA 3VTKA 5BXYA 5HA5A 2FDCA 3IPRA 1JDPA 2NUBA 3ESAA 3IALA 1BE0A 1PT5A 1U99A 5ECDA 3BHJA 1U7DA 5BW6B 3ZZ1A 3U4IA 4DQXA 3K7EA 2VDOB 4HYEA 5FO0A 3JAMA 3UQYS 1TIPA 4M60A 3ZW9A 1DINA 1V47A 1ZZEA 4AVYA 4OLHA 4MUEA 4QVKA 4DLAA 5A0VA 2DT8A 3VO9A 4YAJA 2ANCA 2I8AA 3CHYA 4C4SA 3L0DA 4TSKA 5FTLA 1G6HA 5FPQA 1UZNA 2CFIA 1JIKA 1TIKA 2GF9A 3D6NB 3O8QB 3P9YA 4RVNA 4BAGA 4BS9A 2JZNA 2IU4A 3QLJA 1UP7A 3ILXA 1R0WA 3BHNA 2CV1A 3ZHTA 3FW1A 2GZRA 3F6BX 1AA9A 5FUXA 5AW9A 4QG3A 3O1JC 4JP5A 3U4GA 4EW3A 1I0ZA 1WXQA 5MN5A 3OMWA 3Q11A 4C7KA 5IDXA 3M81A 1TW2A 2H8GA 2PQ0A 3PR2B 3QBJA 1LU9A 4OHMA 4TV8A 4BKRA 4B71A 3KQWA 1N7IA 4IDHA 2C31A 3TLGA 3O31A 1OFGA 2Q5FA 2G1UA 1OXUA 1H2XA 1ISRA 1AS0A 2ZIZA 1RYEA 3OCXA 5G0WA 4ZAYA 3P20A 3VH1A 4BQIA 1KVUA 3OAAD 2BFPA 1RBMA 3M1IA 4L9SA 2JVJA 1FRZA 1C9JA 2BBOA 2X0IA 2AWNA 5JFTA 3VSDA 4I8IA 2WKPA 1QR6A 2GB4A 4KBGA 3L8MA 3IDAA 1FJ2A 1MO4A 1V96A 2AN9A 3FOWA 2VA8A 3O03A 5CW1A 4BNDB 3DCNA 3TECE 2A0XA 4OMFG 4ZCMA 1AN0A 3IP5A 4MR9B 1O77A 3CEJA 4YAOA 4LMPA 5J9FA 1C7IA 3OTIA 1I3KA 4QAJA 1TT5B 4J3NA 1QF6A 1QE3A 1LQUA 3LYAA 2P3OA 3WB1A 3OF5A 1AUQA 4PFKA 2D1QA 4W99A 5F3DA 3OM0A 4BAUA 5ALFA 5LP6B 4DW8A 2WV9A 5ADWA 3D7MA 3H05A 2PN1A 3AIMA 1KGDA 4NCHA 4OP2A 2XIQA 2R85A 4I3FA 2ZSJA 4BFLA 4MPDA 5EEHA 3SG0A 2XKAA 3OZTA 3UB3A 1H5NA 4MRSA 2R8XA 4JSRA 3WLAA 4WGGA 2VT6A 3M83A 2FPPB 4Q39A 5CK5A 1MGOA 1H6BA 3GBPA 2CZGA 5DX0A 1EJBA 3M5DA 4OREX 4R1MA 4NENB 1ZC3A 4JNKA 1QIHA 2B94A 3FHJA 1JAXA 4N49A 3THYB 4CLXA 1WP9A 2AK2A 3HFSA 3BSFA 5B7PA 1WKCA 2FEAA 2RKWA 3OEED 4M7WA 4R9NA 1CT9A 2Y1OA 4OQLA 1SB8A 1R6TA 1U1FA 3MTJA 4KMOA 2WZCA 4U7PB 5LQRA 1KMCA 1LPOA 4DSAA 4ZMRA 5F9HA 5A6SB 1QGUA 2YY6A 3B3GA 1P0QA 3GVIA 1E3EA 4ZDJA 1DQSA 5EYPB 3PWZA 1XALA 4CNBA 2ZATA 1AKNA 1H2HA 3RS2A 1ZM2A 3IVGA 3ZJ4A 2QNIA 5CJJA 5ETJA 1E7MA 4MW1A 1UT6A 1DQYA 2JCVA 4XOUA 1DEXA 4LRUA 2YBDA 3K71B 4Z4EA 1GKYA 5BSMA 2A78A 2QM7A 3A3YA 2X7JA 2X41A 1DQNA 1LDEA 2WAAA 1EXNA 3FI0A 4UM9B 4LVCA 1C1HA 3MTAA 4KZPA 4P92A 4DG5A 3GNTA 1Q3HA 1HXHA 2QKYA 4L57A 1YIAA 3C48A 4Q15A 2HWYA 3CPJB 2OXCA 4BL5A 5GVRA 1N32B 1XTBA 2IP2A 3N58A 1GR1A 3AHDA 3K2EA 4N7RA 4P34A 4D4KA 4ZMBA 4RMHA 4R1OA 1DX9A 1NBME 1SELA 2QVLA 3U5ZB 3B6JA 4NSNA 3FE2A 4ZVTA 4EY4A 4AJKA 5AYVA 3ISTA 1P9NA 4M9CA 4MZDA 1CR2A 2LZ0A 2X14A 4EY6A 1YH3A 3G7UA 6LDHA 3EIHA 3N7UA 4C4OA 4BLUA 3A6EA 3EIUA 3QWAA 3QUAA 4XIIA 3PEFA 2E4XA 4F92B 5FX2A 4AD8A 3CSSA 2H51A 3VYUB 5H70A 2LBPA 3DD1A 2O8BA 2RGNC 3GNSA 4MW4A 2CXQA 1JQ3A 4FMCF 1T3TA 4KWHA 2WICA 1JZSA 1P5HA 4I99A 2J0SA 5AM5A 1EFRA 4OXQA 4OJMX 2HA6A 3DPUA 1M7BA 2GZAA 2VK8A 5EHNA 4PLHA 3VZCA 3G0HA 3M33A 2R8OA 1XP8A 4GXTA 1I36A 4EG7A 2CFSA 2VL7A 4TZKA 2HD4A 4UJ3A 4HT3B 2ACWA 1MOQA 2QTFA 4ALNA 4XYLA 2PUGA 4QWMA 1M8JA 5C8VA 1WSBA 2OCPA 3ETJA 3RLFA 2CC2A 5MDHA 1P3DA 1Q22A 4JITA 2G04A 1P4JA 4BRZA 5I4BA 1CNEA 1ZICA 2QN8A 4ADSG 2NU6B 4V0KA 1IAVA 2OILA 2Z09A 2C03A 3MAJA 3N87A 4WVLA 1L5RA 4Z8XA 1YUNA 4EKNB 4OATA 1K7SN 1SG6A 4DABA 5HE8A 2O19A 3TRFA 3HM2A 3E9CA 4M6WA 2B92A 5CYPA 3UHPA 1OWNA 1DRVA 3MHPA 2E21A 2RHWA 4B3TB 1PV1A 3F67A 5DNDA 3H0EA 3T5BA 1WMAA 2XKJE 4IDOA 2F9MA 4E11A 3G82C 3JR3A 4LQDA 2HA7A 4W7IA 5CH8A 4H1VA 2ATIA 2ZM5A 1PJ3A 3RFTA 3V4OA 3N8NA 5C8XA 3QI7A 3VJLA 4K8OA 4RPJA 3COPA 3D54D 1U8XX 1NDHA 1O8CA 3LBYA 5KJEA 3N75A 3NBAA 2QVCA 1JG6A 4WZBE 5A1TA 5K99A 1SQ6A 5EN4A 5DCUA 5I47A 3PVSA 1JG2A 3FFTA 4HTFA 2CF5A 1C7ZA 4NK4A 4EPXA 5B7GA 4B7ZA 1SCBA 4Y9RA 2A88A 1QWSA 3O93A 4M7RA 3ABQB 4LHEA 2AFHE 4G0QA 4XYBA 1L8QA 5FBVB 3EGDB 1XEFA 2FWNA 4I4NA 4IIYA 4PS0A 3WGZA 5HRCA 2DGDA 3PD1A 4DR2B 1XJ5A 3FB4A 2RGEA 4U5XA 1FMCA 1QVVA 3TTWA 4P35A 3WDSA 3C3DA 1E66A 1NMEA 4ARIA 4HB2A 2V4MA 4DM3A 2BF4A 4PLZA 1NW7A 3MCVA 5E3IA 3A28A 3WYEA 1LPMA 1AQUA 1BEZA 1C5KA 1VJ1A 2FHPA 1AA6A 4O4IF 2OQVA 2HQBA 4PO8A 4MGKR 4KAAA 4MR7A 4X93A 3VO2A 3U1VA 1U1CA 1JHQA 1VZ3A 4PEVA 3JRNA 4RPKA 4XA8A 5SY6A 4WE3A 1QF7A 3R3VA 2RG1A 1F2TA 1FW6A 4URZR 1AIPA 2COUA 1C3OB 3DW1X 1MW8X 3D43A 1FS5A 2HSJA 2FAXA 3WLEA 4ZOLF 4URXR 3CNQS 1A9YA 1FNDA 1DLIA 1YDWA 1UPTA 2DUJA 2EP8A 2JFOA 2V4ZA 4L15A 4RMGA 4MJ3A 3QKRA 3VH3A 4E2ZA 3DJYA 3CEAA 3STWA 4EHDA 5AT1A 5KYYA 2XNKA 5D51S 4CCYA 1YRBA 4D5EA 8LDHA 1BKYA 3B6MA 3TLJA 3KG2A 4BO3A 1O6ZA 4PSAA 2DHQA 4Z0NA 2G63A 1HZZA 5JC1A 4RV4A 3H9QA 5AM2A 1ID1A 3K9WA 4RS4A 2XXBA 1IPFA 1T6ZA 4HLQB 2P5YA 3O90A 2JIRA 4MHSA 5BVHA 5CJPA 1Y6RA 2GX6A 3H1EA 3BMCA 4C43A 1N6KA 3IT0A 1G7CA 2ERXA 4FFSA 1G7SA 3O1LA 4CMBA 2VZ8A 1EX9A 2VFAA 4AP9A 1P80A 3N1UA 3TZEA 5LYJA 3W3AD 3IEXA 3L05A 4R51A 3NASA 1G55A 5K0JA 5KMGB 4FKZA 5CB8A 4ZV7A 3H87A 3DONA 1K7EB 5CB6A 3UT5B 1J2JA 3IR5A 1QAMA 2A92A 4M53A 1Z63A 2CWDA 4I19A 2EGUA 3UMRA 2DM6A 2CHUA 3EUEA 2PGOA 4MCHA 4D9BA 2GN4A 1SOVA 3PFHA 4OQQA 5FPYA 4EEXA 4IUCS 1QZ3A 4MITA 1NU6A 4MAFA 4BGIA 2VRCA 2A0KA 4G36A 3N2ZB 2FN3A 4UBIA 1CUJA 5A02A 1CYEA 3GFFA 2QTRA 2H5JA 3IUPA 1NJ2A 1Z83A 4MVJH 4NKRA 4DJDC 1PEYA 2P9GA 1RWPA 4F4FA 3TI9A 2Q9AA 4X1IA 4IGAA 1N2OA 2JGFA 3HWRA 1PZMA 2CV2A 2JJ8A 2RI6A 3MSCA 4I8XA 3BL5A 3E58A 4QU5A 1E96A 4D46A 1GTZA 4DQ0A 2XZTA 3QUCA 4HLUC 4CL3A 1NVWQ 2WJJA 4UHDA 1OROA 4H4DA 3BKXA 1MVNA 4ENRA 2G5CA 3K16A 1FP7A 4PZAA 3BM5A 3IP7A 5T8KA 2HU2A 1X92A 3L4BA 3PZBA 3VPXA 2BJWA 3X2EA 4RMNA 1W36D 1OY1A 2Q8PA 2ZAGA 4NJOA 3NW9A 4D9NA 2D54A 3AVXA 2OXTA 3KS9A 4LF6B 4HQ6A 1P74A 4S1TA 1MQ9A 4WLEA 1KDZA 4B33A 3AK4A 2P1RA 2VK4A 2PZJA 1RCFA 1GG5A 4V1CB 3PP8A 4Z0HO 1XNHA 3QENA 3K0FA 3TCNA 4KVGA 2O5RA 3UZUA 1QHNA 3GZNA 3JVUA 4GI5A 5EP2A 3DE1X 2OZLB 4KO2S 4PR3A 4TRJA 4Y0NA 3ETNA 3D7SA 1SIBE 2G83A 3KEOA 1XGKA 1QQ7A 2YMQA 2A9KA 3JQ9A 2OV1A 3MT9A 4J4HA 1JZTA 1RYBA 2DT5A 2Q29A 4GOOD 4UXHA 5COQA 4EMBA 5HOQA 2VVTA 3SSMA 1J00A 3M6FA 3BBPA 3ZWBA 2UUCB 1I3MA 3ITKA 3UIEA 4QBIA 3QSYA 4EPTA 3PDUA 2FMTA 2XKKA 2CW5A 4L5CA 1ZMOA 1JDTA 4KN9S 4FLMA 5J4YA 5GADl 5HTOA 1IU9A 1N0VC 2ZSIA 4KV9A 4WESB 5EXEA 5C81A 2G06A 3HJTA 3OQNA 4KO3S 2C5GA 2ECPA 3RFCA 2OCAA 3CCCA 1V1MB 4MQ6A 3UOGA 5KC9A 4HVAA 3LY9A 3DR5A 2OLKA 2HRDA 3IHWA 5AOBA 3WYBA 1GPH1 5I9LA 5FPHA 3NFYA 4CV1A 1UXOA 4CL0A 1M0TA 4RNDB 4LIPD 5I7UA 3KSZO 3R24A 3M4ZA 1YB6A 2XWBF 2G0TA 1RAIA 4IOMA 1WDLA 4LV5B 4QLOA 5FBZA 4BV9A 4HG2A 1JA1A 1A7UA 1FUYB 3F5DA 3ZJ5A 4BQOA 2XMRA 2AN5A 1ZIDA 5JVDB 4Z7JA 4OHRA 2P4QA 2XTZA 2YJ6A 1LFDB 2ZAOA 4A0RA 3WGTA 2ZRNA 1GZDA 2RGCA 1N3YA 1VL6A 1E59A 1GAWA 4CMCA 3C7KA 1QCYA 1RC1A 4JLOA 2XOKD 6Q21A 4KG7A 2GNPA 3EQ6A 2AC7A 3B20A 3O2SB 4OQMA 3OU2A 2RGUA 4NBTA 5E1BA 3PEVA 1UFQA 1W2HA 2ISQA 3V42A 4FS8A 1XQYA 3WMRA 1A98A 2PGJA 3R0IA 4C1BA 4E5YA 2Y1KA 4L22A 3R4CA 5CDGA 3Q9UA 1YACA 3OZDA 3R8FA 1P3Y1 2JLRA 4G86A 1PFWA 3IVAA 4KPYA 1D7OA 1Z7GA 3VPAA 3LV8A 3IAFA 2XVXA 2VA9A 1B0PA 1OQAA 3N2KA 3HU5A 4FYKA 4G8CA 4I55B 1W1WA 2WM3A 3L5KA 1KERA 3UW3A 4P4SA 3NUGA 4JODA 4EF4A 1QIGA 3A4YA 1E1QA 1XI2A 3D4LA 3MCAA 3RI3A 1YS2X 4LOHA 4NYMQ 4PN7A 4UPEA 4UTNA 1P5RA 1MJ5A 1SKYE 5ELMA 3W6ZA 2QMZA 9LDTA 4FDMA 4GOXA 4JY7A 4IMIB 4I3HA 3WNZA 5CH5A 3BK2A 1YS6A 4MS3A 4LOLA 3T3GA 4B83A 1A8HA 3R44A 1VHWA 3MMPA 3D1VA 3FSEA 3GEHA 4J0CA 3DEYX 1HLPA 1UP6A 1APBA 4RHYA 4W5JA 1GWNA 5T4FA 5AIBA 2H9IA 3DDWA 3SHTA 1Q0TA 2GBGA 1BCSA 2HO4A 3LRTA 3D0KA 3JQAB 4FD3A 3MGGA 1YAHA 2O20A 1E2QA 3MBOA 1VL2A 3KPUA 3HHEA 4YRDA 1V8FA 3OKPA 2BOVA 5REQB 1ZD8A 4PO9A 4O2AB 5LD2C 3IX7A 2G5GX 1J99A 2QN9A 4AJHA 3KYBA 5CK4A 1ZHOA 4XX1A 2W7TA 2WSLA 3B9QA 4FONA 1IBKB 4HWPA 3AVTA 3TW8B 3AMVA 4Q3OA 3ROXA 3A3OA 4AF8A 1X1QA 1ZUIA 1HBJA 5FV7A 3F90A 3T38A 3FVRA 3WAKA 1NHGA 2NTJA 2NW6A 2GYUA 5JQGA 1G5FA 1M2KA 1VJRA 3UG7A 2GWHA 1X74A 2F8TA 4NG4A 4N65A 5LQAA 1ZJ4A 3VR6D 1UMKA 2VWHA 3QXCA 5SZJA 2O5EA 4DE5A 3P9KA 1CQZA 1KI4A 2FK8A 1U4SA 2V8BA 1WBDA 1RLMA 4NCXA 3ZDAA 5HIAA 2H4YA 5KWVA 1P5FA 1RPJA 2H65A 4YUWA 5BURA 3NDRA 4G9BA 4JT2A 2BELA 2HV9A 4TKUB 2O4UX 4L8YA 5HQ3A 4JUFA 2ZUTA 3QXHA 4W9RA 2GH1A 4XDGA 1NSYA 3O3OB 5GP1A 4AXBA 4RSMA 5JAQA 4C2AA 1T1SA 1B6TA 4N12A 4B3HA 4KWTA 4WNAA 4YJHA 1WUIS 1T2VA 3K4HA 4LDZA 2P9CA 1MIOB 5ALIA 5L4SA 1JJFA 3HCEA 1U2DA 2JJ2A 4NBSA 3N2GB 2ODPA 3AEQB 5CW2A 1PSWA 2IW1A 2AW5A 2FLKA 1X39A 4HBZA 2QRPA 3B6KA 4J1SA 3R3XA 1USIA 2C4UA 1XZCA 3B8EA 4RZIA 1H4VB 2VHTA 4DJFC 1QFMA 3DAGA 3U80A 3TGLA 4LE1A 3IOBA 1WLSA 5IBRA 3CF2A 1G8JA 2GUWA 3GJ5A 4FEAA 4AY2A 3B5JA 4E4RA 3GRCA 3NHAA 4PCUA 1KK0A 1WXWA 1PJRA 3DAYA 1C2TA 3PHBE 1T9ZA 5K51A 2FCRA 5D2CA 2QZPA 2XV1A 3UN1A 5KOHB 3Q0EA 5E6UA 2QSZA 2E4UA 2PK3A 3BTUA 5I51A 4JBHA 4MRPA 1RIIA 5CIQA 5FPKA 3CF6R 3OCYA 1ZD4A 2AE1A 3KPYA 3QWFA 3RVQA 5J5AA 3KJEA 4KLAA 3NONA 3FJ1A 5I9IA 4A6PA 3TIGA 1S7CA 3PWTA 1TKAA 1R4NA 3O7MA 1JXOA 3LX8A 3W06A 4P3XA 5JCXA 4DUYB 3GXBA 3KIPA 3QPBA 3WLSA 2JIOA 1K8XB 1Z34A 3ETLA 1TM5E 3A1EA 5IABA 5DGDA 2AJLI 3OLYA 4G8BA 5BW5A 1AHHA 1YOVA 2QTMA 5FLXA 1BVUA 2FP4B 1PR5A 4EHJA 1I14A 1T8RA 1ORRA 2QUIA 3R6GA 4RHFA 4EFDA 2GPAA 3HYTA 2BEKA 4NCKA 4JUBA 1V37A 4Q9DA 1L7DA 5AM1A 1RVV1 1Z22A 4HZIA 2CLOB 2ZWIA 4UAVA 2IYWA 5ALJA 1TX4B 1RQ2A 1YKGA 4OK6A 4EYSA 3WJAA 3SIXA 1LJUA 2LCQA 4K28A 2E2WA 2FVYA 5F5XA 1K8QA 2VH2A 5JJCA 1KF0A 5KX5B 1J8VA 1NBHA 1BE1A 3EVFA 4U7TB 1YJ5A 1BJRE 1N4AA 3G2HA 4EO7A 2WUFA 4JJ4A 3TK1A 3JYHA 3LG2A 4KPUB 4MWBA 4HWOA 4RFLA 1BC5A 1UAYA 3L79A 2IPLA 4MYHA 3PF9A 4W1PA 5FJIA 4K6OA 4IX9A 4QDJA 3C97A 4E70A 5BR7A 3N5KA 4O4JF 2RD2A 4TLAA 2R68A 1ZRNA 1ICEA 4JJIA 4Z1MA 1WF6A 1EPUA 4HEA1 2RGDA 1USKA 2PNFA 1YE3A 1ZRMA 1M8KA 1NURA 5F2NA 5CM9C 1P7YA 1KI9A 1NC1A 2FPOA 3L01A 1IIRA 1XMJA 2FMKA 2UDPA 4DUPA 4R8RA 4PAQA 4L1KA 7MHTA 3V8BA 1AZTA 5FWNA 3QVTA 5AW7A 3QQ5A 2FRDC 4G5HA 4ILEA 3I3OA 4PWZA 4TMYA 3EGXB 4ZVUA 1G9TA 1U5BA 2MIIA 3G5UA 4BBPA 1QP8A 5DI3B 3VGJA 2O1EA 4TRRA 5AKHA 3WWYA 4OFXA 2DE0X 1S2MA 2Y1EA 2YVUA 3VPBA 3GFRA 4CG2A 3SFZA 3ZHZA 4ARZB 1AKQA 3HSKA 6AT1A 1FXWF 2N1BA 1JIVA 4JI0B 5EHXA 2QJFA 1Y1LA 2VF2A 1WCIB 3AI2A 2J5BA 1COZA 2AOTB 3MJCA 2C83A 4MGZR 1YQUA 1BU8A 1YZFA 3JQPA 4DLKA 1KSJA 5B55A 2PVSA 1I2BA 3K94A 4C76A 1SIOA 1JHRA 2ZBPA 3O4FA 1RAHA 2G8LA 2ZYRA 3EB9A 4MH0R 2I8CA 3FPKA 4L5BA 4RA9A 1PS9A 1Y1SA 4PM4A 3U48A 4D3FA 4RJTA 3ESCA 4ZYXA 5JDIC 4WKBA 3BCSA 4JAVC 5K6AC 3OLQA 4DZTA 1L1EA 4RU1A 4MVJG 2JG3A 2NPOA 2HXYA 2Y2UA 5DKFA 5ICFA 3VNSA 3DNPA 1V4VA 3CLTC 4HH1A 1H6CA 4TMTA 4E5KA 5DSTA 2PBRA 1J5EB 5IT5A 2ZI5A 4LF8B 2QB5A 1N3IA 3IVXA 1BG6A 4CMKA 5DSXA 1E9RA 2OE2A 2AI3A 2G9UA 3PBKA 3BWBA 1E2DA 4NZPA 4NH0A 4DT1A 4ACAA 4ZYTA 5BVGB 2CCGA 4ETNA 4RZSA 1SQGA 1WCV1 4W4TA 1LRJA 3OFVA 3SJ7A 4DY6A 4M55A 4AP5A 4Y18A 4C7JA 4EMSA 4QWWA 4KV7A 3PI7A 2SKDA 2DQZA 1RAFA 3B7WA 2GT1A 1HF3A 2GGSA 2PL3A 2R60A 3HRIA 1GU1A 3ZGOA 1H1LB 2R5NA 3QVXA 5IDYA 1I3NA 1NUSA 1L0BA 3AHCA 1ETHA 4D6PA 1X94A 2I66A 3BRWD 1P7VA 3WXBA 4UVIA 4B45A 4YCCA 3HDYA 5B3AA 2ZJAA 4IIEA 2C94A 4W63A 2Q1XA 1NP6A 1O03A 1JN0A 4IW3B 4IDEA 1F8YA 1MFPA 2K87A 1SU8A 4BFWA 2JPDA 5M5BA 1R8YA 1I9GA 1G2IA 1NW6A 1IUOA 1YTLA 3VC1A 4DSOA 1L5YA 4KQ6A 4H17A 3TJRA 4C4TA 1JAIA 3JTEA 5EMNA 1DKRA 1Z35A 3NHPA 1Q92A 4Z5XA 2UKDA 1UPCA 1FNNA 2XCSB 2FFHA 2OV3A 5DM4A 3OM1A 1L7BA 2X1MA 3WGKA 1W4BA 2LUOA 3P2MA 3K0HA 4UD2A 4EGFA 1MO6A 3CZ4A 1CUVA 4W5WA 5C18A 1FJHA 1E9FA 2Q5HA 1EH5A 3ZBUA 2X9GA 4NJMA 4GH5A 4QYWA 2P0EA 5BV1A 4XPZA 1F48A 2PRZA 4K6KA 1I4LD 1KZ7B 3EPPA 3PSAA 4M36A 2KLHA 5KQSA 3KAJA 4WK4B 5EZQA 2GO1A 1FZQA 5ARBA 1Z6GA 1ABEA 5ALSA 4OO3A 2J3JA 2ZJ0A 5CA0A 3HCAA 5C31A 1PZXA 2FMXA 3FYTA 1AQIA 4OAPA 1W4AA 4E14A 5L8VA 1YBHA 3D7NA 3DE6X 2BBSA 1LB1B 2VCYA 3BZBA 1A96A 4IHKA 5BN5B 3W7BA 1L5ZA 3I64A 3BFJA 4NMWA 5HTKA 1HEIA 2FN7A 4IWNA 3LVBA 3QV2A 4M1EA 1QU2A 1ZNZA 4FBLA 4ZTZB 3FBGA 3QWHA 4G4JA 4M1SA 5I9MA 1X2BA 1X7WB 1NVTA 1FB5A 1Y5IA 3HZHA 3NEAA 2EGGA 1WL8A 1OHHD 3AZQA 4I1RA 1A5TA 1V25A 1LLCA 3OZAA 2GEBA 2ZEJA 4I7EA 2OXRA 4EG3A 1V95A 2OV4A 3QG1A 3S2ZA 1NQUA 4ZTBA 3VZSA 3L6RA 1WPQA 1RAAA 2EATA 4P1ZA 3ICOA 4JUDX 4ZAFA 2FR8A 2B98A 5KQLA 1QHGA 2COEA 2R5WA 2FVXA 3W4KA 2V7PA 2ZWPA 1P4GA 3G13A 5IG2A 5B57C 3QU4A 3RVLA 3I72A 3EEOA 5BMVB 1AKEA 4C3VA 3PB3A 3OIFA 1M2OA 2VS1A 1PLKA 4OMCA 4ZQBA 5BQPA 1N2GA 1EWKA 2PDAA 3G1UA 1O1YA 3T0IA 3AUSA 4W9NC 2WIKA 4DEVA 3KP1A 3LQ2A 3E3LA 4YB8A 4UASA 3GEGA 3M4NA 3S8MA 4TTVA 2WOOA 1ZH2A 1YK1A 4MI6A 4HH0A 3RYFB 5KSWB 3RYHA 2O2EA 1U0LA 1E9EA 4P2GA 3OH8A 1Q44A 3DZJA 2WDPA 1T9GR 3NGXA 3OT4A 3H5OA 3ORYA 1ZCJA 4V1CI 1G5QA 4DUZB 1L5QA 2QM3A 2XYVA 2VDWB 4V0MA 3NEYA 3PFKA 3TL3A 121PA 2O8DA 3N53A 1L5WA 3T9DA 4BVHA 5K8UA 4HDNA 4MDYA 3VV3A 1MC1A 1AHNA 3O1IC 4JJAA 1WHSA 1B8UA 1E9SA 3G88A 1N6HA 1JZQA 1Z12A 1GA1A 3NT4A 1LLUA 3PUWA 4ZA2A 3ELYA 5EJIA 3TRKA 4PG4A 2O3QA 2IZ0A 4H6WA 4I55F 1OXTA 4DQUA 5D3QA 5HUHA 2I7DA 4JQCA 3MEQA 1SO8A 1ISJA 5F4BA 4BO7A 1RQRA 2GXSA 2IU6A 5EZ6B 3TQHA 4P08A 1JJBA 4Z0TA 4CLRB 3IO5A 3IQEA 1FMLA 4Q9AA 2A8YA 4Y2VA 2BKUA 3DE0X 3BE4A 3CNBA 4ID3A 3OE7D 2JJ1D 4GX2A 3IDZA 2JGLA 4NFSA 4NK5A 3FGZA 1N1EA 4G9EA 4KQXA 1VRVA 1XEAA 2WINI 3RE1A 4EHLA 4ZJZA 3JVDA 5KJFA 1G38A 5LUBA 1EFDN 4K5QA 5CFRA 4FHDA 3GGPA 2H18A 3D1JA 3PQFA 4MLZA 1O95C 3UANA 2VJMA 1D1SA 4DMHA 3IS3A 5IJ0B 5KNLA 4IHQA 3P0HA 1YF3A 5J2TA 3R3UA 3DWIA 4A03A 1ULTA 5HG0A 2JGIA 1GFIA 4G0OA 5FEMA 1D2RA 2FA9A 2V7GA 3FTPA 3GT0A 4ONEA 2R8ZA 2J31A 3OG9A 3M9XA 1FSSA 4AJ2A 4WKGA 2ODNA 3NHJA 3CY6A 1OAAA 3OC6A 3ZGZA 5EIOA 4JH0A 3SICE 1UOOA 2JARA 1ISPA 2LGJA 3OSZA 4LQCA 3R0VA 5DWQA 2FKNA 3QEBZ 3Q3JB 3KTFA 4KQIA 4F7DA 3HACA 4B6RA 4EZEA 1IG0A 3OX4A 1ZZGA 5JAPA 1Z75A 3R0XA 1MX9A 1I1OA 5AOCA 1OX4B 1Z74A 1GFSA 4I9UA 4IDPA 1Y8RA 4GQAA 5CD1A 4C07A 2IGBA 4YT8A 3I6QA 1EA7A 4ZKEA 3OQMA 2FX5A 4XD7A 3SX0A 1AB6A 1QFXA 3ADPA 4XTRA 2Q9CA 5FADA 3ZD6A 1HC7A 3LW7A 2J9YB 1A5BB 4CLOB 4KHPB 1J4AA 3SQDA 1ZWLA 1S02A 1MQAA 2BGRA 4MW2A 2A9VA 3OVMA 1QSGA 3ABIA 3TSWA 3VR4H 1P18A 2KQUA 2OCDA 2YASA 3EFHA 3ELDA 3H4VA 3QLUC 4JBLA 1EEXB 2PZFA 4PQRA 1O58A 2QORA 2V45A 4J9VA 3TTUA 5JISA 1USUA 1DJOA 1TFRA 3HJBA 4M38A 1TZJA 3G2JA 2OXIA 1R7RA 4YV2A 1YKSA 4LY3A 3GJ8A 2INGX 5COAA 5HZHA 4H3VA 1QU3A 3KLBA 3RTBA 1WETA 1CVIA 5F64A 3HV2A 4UAUA 1ETUA 2O4CA 3UK1A 2HPZA 4HK4A 3TKYA 4WAUA 4BJ3A 2B1IA 1GPUA 1PEKE 3PFBA 4JEMA 3ONWA 1F8UA 1M2NA 5DT2A 5IK2A 5A5EA 4Q1CA 3EXG2 2XAUA 3BTOA 1H2WA 1N2CA 4GRIA 4FDLA 3PFWO 3K32A 4H6XA 1ZITA 5JNWA 4IIHA 5JUWA 4EHBA 1QVZA 3JQ8A 4AJIA 1U2PA 3I9KA 3A1UA 4L8LA 1S5PA 2IY9A 4W1QA 4JS0A 1OIXA 2FEXA 3WY9A 2REQB 3D4IA 3O94A 4CUKA 3T4PA 4EY5A 4F71A 5C5CA 4QYIB 5C3MA 2QE7D 4HUJA 2QL7A 4U7GA 1DC3A 2QP9X 4HEJA 3HCFA 3G0DA 4ZPJA 3CWZA 4TUYA 3WWCA 1Y98A 2PZAA 3ZUPA 3WQQA 2X1LA 3KUUA 1XTIA 2WWFA 3DZ8A 4IO0A 5BQ5A 5KU1A 5U9CA 3SEAA 1R6AA 1Y1KE 2ZREA 3QG5A 3BCRA 4BLRA 2P3QA 4TV9F 1O4WA 4X54A 3AFGA 4X90A 5F5LA 5CXUA 3PRKE 3ZE6A 4A8JC 1CCWA 1K6JA 3AI7A 3ZWQA 3DGFC 3NAMA 1FP2A 2NT3A 5LWQA 1EUQA 1WWKA 2H1LA 5G4KA 4KO1S 2FZCA 3IH5A 1A9ZA 3AYXB 1F6WA 1CKEA 3NKFA 3BMQB 3BWEA 4JLJA 3KQVA 2RAUA 4R31A 4WECA 3A4MA 1C1XB 1HDEA 2ZITA 2IL1A 4FDVA 4AC9A 4QYXA 1QGDA 5J58A 3IAM6 3NR2A 3EAQA 4ENTA 4ZOLA 4EHHA 1F8FA 1B15A 3KK0A 1LI4A 1W0CA 4TTJA 4YMGA 3IODA 3J81A 5K7SA 3LWBA 4O2BB 2F1KA 1Z6ZA 3VH4A 1XJWA 2WU3A 2WHPA 2X23A 1RRGA 1T4CB 2REBA 2AIRA 3JWGA 1RR6A 3U5TA 1ML4A 3I53A 1LV8A 3DKVA 3P96A 4Y8VA 2H1OA 1U1GA 1E3IA 1Z13A 2VQFB 2WFLA 3G68A 1FQJA 2O59A 1R37A 3K92A 4GHWA 1MVLA 3L1VA 1LNQA 3NTXA 4QU0A 4GXNA 1PGNA 4G1BA 3Q15C 4Y1RA 1RMYA 5ARCA 3RVBA 1YK0A 1Y6JA 3A9CA 1VKNA 2P2LA 1BE6A 5B6JA 2HSWA 4JSYA 1NVXQ 2QZZA 5HFJA 5JLAA 1GRCA 1W0JD 5BSKA 1PR6A 2FFJA 1NULA 4MUGA 4DV2B 3I52A 2QY6A 4IAOA 4PCLA 4DHEA 4NNPA 4RHXA 3DVSX 4Y1FA 3F8TA 3T3OA 4CEJA 4H77A 5HFNA 3HCNA 2R6CA 4GKBA 2DJ5A 2EX0A 2YXNA 4EA7A 2IE0A 4BXOB 1PHRA 3H2GA 3KQNA 3OZXA 5K6RA 3U44A 1U0JA 2RGWA 4IINA 4HNSA 2I4MA 3KSRA 5K2MA 1ODTC 4IQFA 3O2JA 4OAOA 2TRSB 3VHXA 5HX7A 4TROA 2HEGA 4PANA 2WR8A 2AXEA 4JLWA 2VTBA 8GPBA 1Q3TA 4YMVA 4F06A 1L5MA 4R01A 1KYXA 2PLRA 3EODA 3GVCA 1EP9A 2AD1A 3OWOA 4F5ZA 1O9HA 3CO0S 2D0OB 5BSHA 1QK3A 1D8TA 1DAHA 2ZDGA 2BKVA 3R0JA 3AF1A 2DQKA 1RHMA 3KYCA 5DM1A 1NT2A 1VDMA 1ZMTA 3A05A 1VP9A 3RVRA 2V0CA 3WX0A 4C21A 1MB9A 1A27A 1UJBA 2QRUA 1E2KA 1AGXA 5IAGA 4YXWA 1IULA 3BREA 1GNVA 4CR7A 3G2NA 1OC4A 2OSBA 2PKQO 3ZHXA 1ZN8A 5C37A 2G25A 3HV0A 3MQ4A 2EG5A 3ZDEA 4AUKA 2P2GA 3K6KA 4E46A 4EJ6A 5BSEA 3AHEA 3H84A 1VBFA 2B2CA 1T5IA 4DIOA 4EG6A 3IVRA 3R6TA 4HH4A 5EP4A 1JMKC 3RF7A 3VKVA 5K0TA 1UODA 2X0JA 4OA5A 2H1CA 2YQZA 1AB5A 1JH8A 1NXPA 2YHAA 1U3GA 4BVAA 3AR3A 3DDZX 1EYZA 1Q14A 1U2RA 5C4IA 3FWKA 1MB2A 4AMYA 2IEIA 3CGWA 5D5PA 3V8MA 4Z4HA 1NQVA 4OHVA 1PTKA 4ZYZA 3PXBA 1XK7A 4B3JA 1UJ2A 3WLKX 2OV8A 3JY6A 4FQ5A 2BFBB 2HH9A 2W2LA 2ISCA 1BDMA 3NAGA 5ADUS 2EDAA 1U3FA 2FZWA 2MR6A 2PXCA 4IM7A 3QHQA 4O29A 4RD4A 4EGQA 2PKEA 3VHLB 4B4DA 4AKIA 3LDUA 5LXTA 1FFXB 1NF8A 1Z82A 3Q7RA 3NB0A 1P29A 2C2BA 5FL7A 5K09A 3NM4A 5GOTA 1Z15A 1H2EA 1SXIA 1VJDA 1VYUA 2R6AA 4GYYA 4GZ3A 5BNFA 1M5UA 1P4HA 2WIBA 3LKBA 2Z04A 4B4VA 3NI2A 3LGXA 2XUJA 4NFLA 2JI4A 2XNDD 2WBLC 3G2PA 2V1UA 2FPXA 2IA5A 4AS3A 1KOFA 3CVXA 1J8FA 5C8YB 5AW1A 2PGNA 2R6GA 1QAOA 3FDFA 4NBUA 1TEVA 3Q9LA 1FFEA 1KAGA 1YIOA 2WFAA 1V7PC 3QE3A 4FZ5A 1CR4A 5DULA 4HMOA 4UHHA 3KFVA 2ID7A 1Y3FE 1S7GA 3O8QA 3UJPA 3D6FA 4QUDA 5DW0A 5HJ2A 4OHWA 3TVYA 2K7ZA 3PQ6A 4MUKA 1WG8A 4YX9A 5HF9A 3FZYA 5GAJA 4NU6A 2EVWX 3L77A 4XUCA 3JRXA 3D6MA 2C54A 2KBEA 2F48A 1KAHA 4E7PA 1GZ7A 1M54A 1UUFA 1T8YA 2A84A 2WUWE 4RK6A 1G9XA 4XWAA 4YRQA 2VDJA 3V8PA 5A5DA 2WZDA 1MJNA 3AILA 5BRAA 1QP0A 2CNBA 1E4OA 1Q1AA 2R96A 4EGSA 4KQMA 3NKVA 5CEFA 1NLUA 3PI6A 1H85A 2VATA 2BHNA 2X40A 2N9UA 3M6XA 4OIMA 4XB6B 3LHKA 1GKKA 2DKNA 2QX6A 4WUTA 3NDBB 2AXQA 1IN8A 1CYDA 2F9LA 3SJUA 3BL6A 4Q7JB 3K0KA 1RTKA 2FWBA 3HUEA 3NIWA 3LDAA 3HP7A 4KGVA 5CUQA 3LSYA 5HF5A 4FCVA 3D2CA 2AZMA 4BNYA 3M1AA 2BKXA 2HDHA 2CLSA 5CTJA 5FOXA 4ZO8A 3M8KA 3TE7A 4BNDA 1K4MA 1B14A 1EWVA 4MR9A 2XYGA 3JZIA 1IQ0A 5JZOA 3CBGA 2GPYA 3COSA 1UDXA 5K4AA 4Z99A 2J3HA 1TT5A 4FWTA 4KREA 3K70B 3TJMA 4J1NA 3ZQKA 2XZPA 5TR9A 4AUNA 4PHTA 3CT4A 4RDXA 4J90A 5HS4A 5LP6A 3EPKA 2HUNA 1ML3A 3P2YA 4EB3A 1Y4UA 4XIGS 1C3LA 4HNGA 4KYTA 1C0KA 3W9SA 2BHTA 3ZGLA 4QOHA 5JARA 3B3JA 3QBVA 2FPPA 5K3AA 1OKKD 1XWIA 4MW9A 1MT0A 4P80A 4QDKA 4M9RA 3ZC3A 4NENA 4QTTB 4QELA 4KACA 4F7WA 2AHRA 1LRLA 2AV6A 2JI6A 2D1RA 1NIJA 4HGYA 2GRJA 5EZSA 3THYA 2BMJA 3MIZA 5DX1A 5EVCA 2GAFA 3M3PA 1E3JA 4JB3A 5CMLA 4XUDA 1MEOA 3JALB 5BY2A 4DV6B 4EJSC 1K75A 3WYAA 3C4JA 3LC2O 5A6SA 1PX0A 3QVJA 1VHJA 2CVPA 2FG7C 2RGAA 3NDPA 4GFDA 5EYPA 5AVSA 1FUKA 1EVZA 3P19A 2DRIA 1U9YA 4YGXB 1R3DA 3ABZA 1A5AB 4D41A 2JFQA 1IBLB 4I08A 1ZUHA 3JTMA 4PPFA 4RXUA 3PIIA 3VZRA 2D5BA 3EZGA 4V0SA 3RVJA 4ZEMA 1XKQA 5ED4A 4JT8A 3JYOA 2Q5CA 4ZCQA 5LU8A 1F17A 2CNOA 2FSGA 5BPHA 1Z5VA 5A0TA 1MXHA 2RI1A 1UINA 3U17A 1KPGA 2FUNB 3U3JA 4UU7A 3U6BA 2M6KA 1OJ7A 3RQSA 4JQOA 2PD4A 3PUVA 2B5OA 2P2CA 4WSOA 2P7HA 3CKYA 1AUXA 2QLTA 1U28A 3SN6A 1XZGA 5E1DA 5IARA 5J4LA 4G1UC 3LUDA 2BBWA 1XEWY 1ACJA 3JAKB 1IPHA 4MQMA 4WOJA 3HYLA 4HXEB 3E5NA 3F7OA 4QYTA 4CN8A 1D6JA 4NMLA 3N05A 3E2PA 1RD4A 5LMNB 1RM3A 2OBMA 5A2GA 1B3BA 1MAAA 3KE8A 3MZ0A 1L7MA 3SSOA 4DYDA 4OGGA 3SLKA 3MNFA 3T7RA 3N2YA 3SJBA 1E9BA 3A6KA 3A9SA 4TT8A 2VDLB 2JIDA 1CQJB 2I87A 3QWBA 4JOCA 4YI3A 4JFAA 2QNRA 2Q9UA 3SM9A 5IU6A 1I8TA 3JWPA 4MV5A 4W6QA 3T3EA 4J6FA 4IG9A 2Q7XA 1U3CA 2WM8A 3GCGA 2WD7B 4FW8A 3T7DA 2PX4A 2W6IA 4FZRA 4OPMA 1TU3A 2JBHA 3DV2A 4KXMA 4XKJA 2C3MA 1MDBA 3ETCA 3IOCA 2G17A 1DX4A 4O8ZA 2WQZA 4Q82A 2ZZNA 3FY4A 1FDVA 3K5PA 3PDIB 4QUKA 1U04A 2C2KA 2PS3A 1UZLA 3QH4A 1DFGA 4PR0A 1YS1X 5EZYB 2ZGVA 3PQ5A 1U31A 4XWTA 3HN6A 1VPVA 2OO7A 3I4LA 3IB3A 2NU6A 1SULA 3PYMA 1DAGA 1PT6A 1SZJG 1XLTC 3CURA 1PQUA 1XZKA 4GMXA 1NMYA 1VCOA 3WS7A 5B12A 1TLLA 3HPRA 3AG6A 3WIBA 2LKCA 1D4OA 2Y92A 4A0QA 3STHA 3WP1B 1XMSA 3CH7A 5JCOC 3PGJA 2BKEA 4R40A 1UKCA 1L8XA 4LAFA 2ZDHA 3GPLA 2XXAB 2JGDB 3MWGA 3PQ3A 1ESMA 1WTCA 5CITA 3W5DA 3GJXC 3Q98A 3IDSA 4GDFA 3R5TA 1N6NA 5JSZB 1R0KA 2GKSA 3SLRA 1ZVKA 1HR0B 1UL1X 4HADA 3ECCA 4O02B 4R3UC 5AK3A 5E95A 1N6OA 1V9CA 2GJ9A 1YVUA 2GEDA 2WABA 3EZYA 3MAAC 4CMEA 4EZBA 1CEEA 3K5HA 1MV8A 1XDSA 4G1VA 1XPRA 1N5OX 1YC5A 3OZBA 4K3UA 1TVMA 4YIKA 5EE1A 3G17A 1UQRA 3HB4X 3EGDA 4RTJA 3DEAA 1MT3A 3D8NA 3KOZA 2A5GA 4ES6A 4O59O 4IIVA 1EGMB 4YFYA 1DKQA 1E2FA 1VXOA 2QG4A 4J1TC 5AXBA 4S04A 2OG1A 1UKAA 1E8MA 5ALGA 4RAQA 2ZJ1A 1QHEA 2VHCA 4BX3A 3PNVA 2EQBA 1NVFA 3TTXA 3BXFA 3HE3A 5DEOA 3WL7A 1VI5A 4JJEA 1CY2A 1XDDA 3KX2A 2E4ZA 1ZK2A 4OQPA 3W8EA 4EUNA 4D8WA 5LQUA 3JQEA 3S44A 3CEMA 1I6MA 3Q2IA 3Q7QA 3DLHA 4OP3A 1SR8A 1B0AA 2QNBA 5G53C 4AZWA 3DULA 5B2FA 1H2AS 1PLLA 2OV6A 2WUVA 3JQGB 1MC4A 1C3OA 1Q21A 2QG9A 1UBSB 2TMGA 5EFOA 1K08A 2EKZA 1EDZA 2PMDA 4CXMA 2DWOA 4UBNA 3LUPA 3E8MA 4EFMA 2DTEA 2R47A 1WUKS 3KAKA 3NP9A 4O2BF 1CHNA 2H2FA 2YZ7A 4DV3B 4D42A 4DKJA 2ORIA 4OMDA 4IHJB 4LDRA 2ZWMA 4EP1A 3E9DA 4G56A 4JVMA 2PZBA 2E37A 4LC1A 5TMPA 2I65A 5LMUB 3SZOA 1IOVA 5AJZA 4AYTA 1KAOA 3OOHA 2RHLA 3OUZA 4MWZA 3OCWA 4E33A 3EDRA 2VDNB 1HUQA 1PJ2A 3RVDA 2D4HA 2H5EA 3LTEA 2PUCA 3M6AA 4A5SA 2BFAA 3GGDA 1FTSA 3KHKA 4U0JA 4BTEA 4EG8A 4ZCLA 1C9KA 3DUWA 4D8XA 3DOEA 1QTIA 4A1OA 4DYHA 4X6LA 2XRZA 2WUDA 3ICEA 1DKNA 1NLZA 4QECA 4YAEA 4JXXA 2CLKB 2YHUA 4HX5A 1LS1A 3JZAA 3FOAA 3S2SA 2NAFA 1J1IA 1XLWA 3KELA 1E3TA 2HF9A 2W22A 4FFBB 3UKDA 4WT7A 4KLCA 3GLKA 4FK8A 1GRQA 5KMGA 1M3SA 2RBKA 4JX8A 1XTPA 3KETA 3UT5A 1Z36A 1VA4A 3G0GA 3KTDA 3L7CA 2A0WA 1CQIB 2Z98A 3BWMA 4D02A 5AJXA 5TJ9A 3DCYA 3TQIA 1LK0A 4OQEA 2QN1A 3ND9A 1JWAB 2C7QA 1QNFA 4FFDA 4MKRA 1YQXA 3CPEA 2OB2A 1T9HA 4FT4A 3FOEC 2IHNA 3V48A 2JD2A 4OU4A 4EEZA 4DQDA 4NYJQ 3O4JA 3RH0A 4R3NA 3TOVA 521PA 4E30A 2WAXA 4RD2A 1Z4NA 2VNJA 4LZAA 4US2R 1XT6A 1KZ4A 4TL6A 3BGWA 2BZSA 4QVGA 1P5JA 2NVUB 1IBRA 1G18A 4RC9A 5I9TA 2DCMA 1E63A 3D7RA 3CX6A 2ZBUA 5TGDA 1Z3IX 5IM5A 5AKGA 1Z6QA 3ZWXA 1YU9A 2XCRB 1I33A 2OORA 3LBIA 4IIJB 4LX0A 4OQ4A 1D4ZA 3WZ2A 4CKBB 4FE3A 1XDWA 2AB0A 4GEKA 4V2UA 4J1QA 4E2FA 4ZDIA 3FFWA 4FI3F 2PGXA 5DYYA 1S3IA 3ZZNA 3VR2D 3GR6A 1ADJA 3QOWA 4PSKA 3LL4A 4E22A 2ZIXB 5EJ6A 3AVUA 2KE5A 2W6JD 3AM5A 4QRIA 1B3RA 5F9MA 5KVAA 2N0SA 2P9EA 2GZHA 4ZU6X 5ELLA 4L5AA 4WZZA 1W88B 3KB6A 3O0DA 4BEWA 4V1CA 3DZCA 3IMCA 4RDCA 3UMYA 2B2NA 2VUHB 3GA7A 4ZEVA 2EU8A 3A8TA 3ZYZA 3I73A 2GNOA 5ILGA 2FSHA 2AJCA 2DX7A 1TECE 2E1PA 4BGVA 2MWMA 4D26A 2OZLA 1PSDA 1I4EB 2POCA 5EJAA 2I8LA 1W48A 3BS4A 5KINB 3CLTD 3EEFA 4LJKA 2I22A 3IQIX 1MN6A 2GHQA 2I54A 2YOHA 3DAHA 4NQZA 4OXKA 4I3GA 2JIZA 4OHBA 1X7YB 1Z7WA 4NARA 2LR0A 2J6HA 3B7GA 4LX8A 3S1AB 2O7SA 2VSFA 1N2ZA 2YYAA 1JLKA 4M1QA 4RY9A 3FIJA 5EMHA 4MVXA 4CG1A 2H1WA 5BWLA 3K1JA 3MJ4A 5EKTA 4D9FA 1WD5A 2XDWA 5E7QA 3ZIAD 1OR8A 4WESA 3ZWKA 4AZ3B 5BQ3A 1PQ4A 3T1TA 2WNSA 3WHLA 4J2TA 4REOA 4IMJB 4TS9A 4U4AA 3IIMA 4EW6A 4F6RB 1V1MA 2QK4A 4DLPA 1NJFA 4EO9A 2Q1YA 3SKVA 2GA9A 2DLCX 2FEWB 3RT9A 3HBNA 3LHIA 3AEYA 4JOQA 3D6AA 4CI9A 4N3NA 4HAIA 1XXHB 3TIVA 1G291 4B81A 5DI9A 4HLNA 1ZVMA 3U3ZA 1M0EA 1SEVA 4J91A 2I3GA 2FQQA 2IIPA 3RHTA 4C7VA 4DIKA 1SWWA 3K31A 3G9UA 1I0LA 3IRUA 4P38A 1NPDA 4PYIA 3ZWOA 3P9ZA 3RUIA 5ADHA 5JVDA 1TAHA 4F9TA 5JC8A 3A31A 5HIKA 1Z2DA 4JP8A 5T5QA 4YCAA 3DDOA 2C1EA 2Q3HA 4PQEA 1HT0A 1OU4A 1X8KA 1VPTA 3T54A 3ZPXA 4Q4HB 1AV7A 2H8KA 3E8SA 4ZAGA 1QQTA 1K0FA 2EIXA 2OCGA 2CUZA 2OUIA 5A5GA 3GLGB 3LYLA 3GDHA 4TXNA 3ZJYA 4DLLA 2HK9A 2X22A 1XVAA 1NHWA 2FQYA 2R84A 4FFLA 3A6DA 4MWTA 1QYXA 4MRAA 1PNTA 4E88A 1K6MA 1PVOA 3OY2A 3ZWWA 2ZZKA 4KQHA 2UVQA