4KDCA

Crystal structure of ubig
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
224
structure length
217
Chain Sequence
EIAKFEAVASRWWDLEGEFKPLHRINPLRLGYIAERAGGLFGKKVLDVGCGGGILAESMAREGATVTGLDMGFEPLQVAKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHVPDPQSVVRACAQLVKPGGDVFFSTLNRNGKSWLMAVVGAEYILRMVPKFIKPAELLGWVDQTSLKERHITGLHYNPITNTFKLGPGVDVNYMLHTQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3-demethylubiquinone-9 3-methyltransferase
publication title Structural and biochemical studies reveal UbiG/Coq3 as a class of novel membrane-binding proteins.
pubmed doi rcsb
source organism Escherichia coli
total genus 70
structure length 217
sequence length 224
ec nomenclature ec 2.1.1.222: 2-polyprenyl-6-hydroxyphenol methylase.
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4kdcA00
2IFTA 3HCBA 5HIMA 3DXYA 2PXCA 1RJFA 1WG8A 3ELWA 1P1BA 2ZSUA 3BGDA 4E2ZA 2OPBA 3EVAA 2ZIEA 3DTNA 3I58A 4DA4A 3EVGA 3G2MA 3ELYA 2AOVA 5CVEA 3SXJA 1RJGA 2H11A 2QYOA 3MCZA 5GIOE 5FQNA 3R9XB 1NV8A 3LPMA 5LQAA 4RV9A 3G7UA 3NDIA 4H0NA 3OFJA 4V0QA 4AUKA 1WS6A 1R6AA 3FYDA 3P2KA 3EEYA 1JR4A 2R6ZA 3P9KA 1D2CA 1X1DA 2ONYA 1JQ3A 3L8DA 4PYOA 4X41A 1HMYA 1RJDA 3C6KA 2JHPA 3CBGA 3TRKA 1KYWA 4AZWA 3IEIA 3OU2A 2AOXA 2YQZA 1KIAA 3C3PA 1KR5A 1P1CA 1QAOA 2ZBRA 2HNKA 3FUXA 4QVGA 4A6EA 4YUYA 3OFKA 3LSTA 2PLWA 1AQIA 2P3OA 1VE3A 4EVIA 2XYVA 4RTKA 1JQDA 1M6EX 3DMGA 3G2QA 3JWIA 5FHRA 3FUTA 3LBFA 1NBIA 4M38A 3CCFA 4PONA 3KR9A 3P97A 4QDKA 3BXOA 3GRRA 2OKCA 1F38A 5EOVA 2G70A 3M6XA 3PX3A 3HCAA 3DR5A 2ONZA 3OE4A 2HWKA 4F85A 1DCTA 3BUSA 3FTDA 5DWQA 2F8LA 4HSGA 5EEGA 4M36A 3NVKI 5E1OA 1EIZA 3CKKA 2FRXA 2VP3A 4FR0A 1VIDA 3MTEA 1X1AA 3EMBA 4FT2A 5BXYA 3TKAA 3KU1A 3PFHA 5DSXA 3SR4A 1MHTA 5HFJA 2B2CA 3MB5A 1WXXA 4UOEA 5EKXA 2QE6A 4LECA 1SUIA 4PIPA 5GM1A 3SM3A 4RTOA 4GC9A 2VZ9A 3FTCA 1EG2A 5DTQA 2IH5A 3FPEA 2CKDA 2IH2A 1KPHA 3EVFA 4ER5A 4ER7A 5EMKA 2P35A 3TPZA 3FRIA 3OU7A 2PT9A 4MQ4A 1N2XA 3TMAA 4PYNA 3RW9A 2EG5A 5DM1A 1I1NA 3HCCA 4RSRA 2GAFA 4KIFA 4FZVA 3MERA 2QY6A 1EQAA 3DLCA 3Q87B 1I9GA 5CVVA 5E1BA 1L3CA 4HTFA 5DLYA 4AZVA 2IBSA 4CXMA 2PX8A 4P7FA 2PSSA 3IV6A 2YXEA 4IV0A 4PCAA 1WZNA 1X1CA 4PGHA 3UZUA 5EIWA 3VC2A 3ER8A 1ZGAA 4EK9A 3X0DA 1MJFA 2LD4A 1BOOA 1L9KA 2OB1A 4EKGA 1NBHA 5FULA 5DM2A 2K4MA 2GLUA 4L7VA 1UIRA 2EX4A 1XDZA 3BWMA 2PJDA 5EPEA 4HTFB 4FSDA 1VP3A 2ZIFA 3EVEA 2ZW9A 3MGGA 4QPNA 5HEKA 5K03A 2ZVJA 1YUBA 4CKCA 5LSAA 3UA4A 3HEMA 5DT2A 3F4KA 3UA3A 4YV2A 5LR6A 1SVUA 3ID6C 2GA9A 1VPTA 2P8JA 3B5IA 3FRHA 3SSNA 2NYUA 2IIPA 3R24A 5K09A 3TM4A 3P9CA 2XBMA 3HCFA 1BKYA 2HR1A 3HA3A 3BKWA 2R3SA 3HA5A 3B3FA 3KPJA 3H2BA 3KPUA 4Z2YA 5C9ZA 3CC8A 3ER9A 2XYQA 1EJ0A 1O54A 3UJ7A 2NXNA 4OBXA 2PXXA 4RTRA 5F2KA 4E2YA 1PRYA 3CJQA 3CVOA 5G02A 3HM2A 1JSXA 5K05A 1UWVA 1QAQA 2N47A 3RODA 2EJTA 3T7SA 3FTEA 2VDVE 3UJDA 4RYLA 2O0LA 3LDUA 3QV2A 1RI3A 1G8AA 3CJTA 5E2AA 3EGVA 1BC5A 2NXJA 3BKXA 1D2HA 4MHTA 2GB4A 3EVDA 5T64A 3KKZA 3UJ8A 2OO3A 4OA5A 3FUWA 1QZZA 5LQNA 3M33A 1RI4A 1YZ3A 1RI5A 4QTTB 1NW8A 4XUEA 5DX1A 3GRUA 3REOA 5BP7A 4DZRA 3TOSA 3HP7A 3DULA 1G55A 1N7IA 2ZBQA 3M70A 3GRVA 3T7TA 2IPXA 4E2WA 1G8SA 2HMYB 4DMGA 3G89A 2FYTA 3SX0A 1KXZA 2C7PA 2B9EA 3KQWA 3EPPA 3O31A 2KW5A 2BR5A 5EHIA 4X63A 1R18A 2FK8A 3KR2A 1SQFA 1JTFA 4CKBA 5ICGA 4PWYA 2JHAA 5FUBA 4A6DA 1V39A 3LCCA 4X60A 10MHA 4QTUB 4EKIA 4F86A 3KPWA 3PLAE 3R6TA 3V97A 3MHTA 5D1NA 3U81A 4IKPA 4V0RA 2YR0A 2QRVA 4GF5A 3GDHA 2OXTA 1YFLA 1YB2A 4C08A 4BP3A 1NKVA 1JTEA 2PGXA 3NWBA 4GBED 5LQRA 1KP9A 2JH8A 3I53A 1PJZA 4PYLA 2YX1A 1KPIA 4CWAA 2BZGA 2P7IA 2Z6QA 3KQYA 3LX6A 3PB3A 5E9QA 5FQOA 3DH0A 1G60A 3PT9A 2AS0A 2NP7A 3AXSA 5K0BA 2AOWA 5EG5A 5IH3A 5DX0A 2ZBPA 1QAMA 2ZCJA 4M7RA 4EMSA 2QRVB 3HVIA 2VDUE 5DPMA 3RIEA 2ERCA 4RTNA 3K0BA 4P7GA 3P8ZA 3EGEA 1KHHA 2Y1XA 3HVJA 3BT7A 3BZBA 2B25A 3LKDA 1KYZA 1L1EA 4M37A 4PYJA 5KQSA 3CGGA 3FPGA 4QVKA 3ELDA 1XDSA 3FTFA 2ADMA 4GEKA 2JG3A 5EGSA 3THRA 3CJRA 3HVHA 2NP6A 8MHTA 3C6MA 4C04A 5DTMA 2AN5A 5HILA 2Z6AA 2IP2A 3B7PA 4POOA 5JR3A 5KQRA 4DKJA 2PWYA 4GUAA 3AXTA 3GRYA 2QM3A 4OA8A 4QPPA 5K01A 5LQJA 4KIGA 2FK7A 2ZULA 3BGIA 4HG2A 4HGYA 4P58A 5EMJA 1IY9A 4QQKA 2YUIA 4MIKA 5U4XA 4KW7A 4E2XA 2ORED 4PNEA 4CTKA 1N7JA 4OQEA 4DF3A 3NDJA 2JH9A 1ORIA 1XXLA 2I62A 5DRYA 5K0EA 3UFBA 4E31A 4F84A 3IYLW 3ELUA 4R8RA 3UJAA 4BP1A 3OU6A 2C7QA 1DL5A 3G8BA 3LKZA 4OX9Y 1ORHA 3UJ9A 4DQ0A 3O7WA 4KDRA 3GNLA 3MAGA 4NECA 3I5UA 1ZKDA 2P1DA 3HCEA 3LCUA 1FPQA 4WXHA 3PTAA 1TW3A 4AZTA 4Y30A 1B42A 3BGVA 3GJYA 4LWPA 4QQNA 5ERGB 5HOQA 1L3BA 4AZSA 3VC1A 4RTMA 2AVDA 3M6UA 3P2EA 4JXJA 2ZZKA 4RVFA 2EFJA 3TQSA 1JG3A 1F3LA 2C7RA 1NW7A 1Q0SA 3E7PA 4PCLA 4RTQA 3UBTA 4FGZA 3UJBA 1JQEA 4RTLA 5ICEA 4XUDA 4R6WA 3SSOA 5FA5A 4XCXA 3G8AA 3GIWA 3OZRA 1XCLA 2DPMA 3R3HA 4RX1A 4KRGA 4RTJA 3VYWA 4YV1A 5EZSA 5EKUA 3G88A 3EEOA 1XTPA 4OQDA 1NV9A 2BM9A 4DM3A 5IKMA 2P40A 5ICCA 1X19A 2B78A 5EIFA 4YUWA 2JJQA 2O06A 2E5WA 3E8SA 2PV0A 3PVCA 5GIPE 4C05A 1ZQ9A 3MCTA 5CUQA 1VP9A 4ATNA 5HIKA 5K0FA 4CTJA 2V74B 1XJ5A 5GINE 4DCGA 5EQJB 2PX2A 1ZHFA 2PXAA 3LL7A 4YMHA 2V7EA 5GM2A 1SG9A 3KQVA 5EVJA 3FPFA 2HV9A 4GC5A 3HTXA 3I9FA 1XVAA 1O9HA 1ZGJA 2PX4A 2WK1A 1RI2A 1O9GA 3DOUA 3P2IA 1AQJA 2ZFUA 3UJCA 3S68A 2WA2A 5GP1A 3GCZA 4E30A 3ANXA 4CKEA 1HNNA 3A25A 2BM8A 3A7EA 3BWCA 4LG1A 4HC4A 3SGLA 4C06A 2ZLBA 2CMHA 4PYIA 5E9WA 7MHTA 3FYCA 5DXJA 3B89A 3KPYA 4GQBA 2H00A 5CVUA 3KQSA 2ZTHA 1QANA 4DCMA 4ER6A 4R05A 3P9NA 2IBTA 3C3YA 3LDFA 3LHDA 2ZWAA 3A27A 5FCDA 1Q0TA 2BH2A 3LECA 5FADA 1Z3CA 2YXDA 5M5BA 5K8VA 2YVLA 3D2LA 4PYMA 4RVHA 4RVGA 4U7TB 4E33A 2AR0A 1IM8A 3FUUA 4FSXA 1INLA 2WA1A 5E8JA 2H1RA 5EMMA 5LQKA 1SUSA 3NVMB 2C7OA 2P7HA 2XYRA 1RI1A 3ERCA 2ESRA 3NW9A 3KQQA 2NXCA 2IDJA 3KR1A 2O05A 2CWWA 1H1DA 1NT2A 3KQTA 5E2BA 3TM5A 1YFJA 3NJRA 2BR4A 3IHTA 1WXWA 3DMHA 2UYQA 2OYRA 4HGZA 4R8SA 2FHPA 5D1HA 1R8XA 4LWOA 4YMGA 3GXOA 4E32A 3R0QA 4C07A 2P3QA 4MTLA 2UZ4A 4AX8A 3GU3A 5KVAA 5CCBA 3OPNA 1XCJA 2VDWA 1I4WA 3JWHA 3KPVA 3E23A 3OZSA 1NE2A 4HRAA 1P91A 3UWPA 4EQZA 2G8NA 5BW4A 3AJDA 4RWZA 4MWZA 2ZWVA 5HZMA 5JUWA 3E05A 2Z6UA 3HA7A 5DX8A 3G5TA 4X61A 4Y2HA 1Y8CA 2IDKA 2PKWA 1FJXA 4ER0A 2CL5A 5ICFA 3T7RA 2G71A 3QOXA 4FT4A 4GOMD 4KDCA 5C1IA 3I64A 5E1MA 4B17A 2ZZMA 3PS9A 4X1OA 9MHTA 4O29A 1YZHA 3V8VA 3SVZA 2AVNA 2O07A 2OY0A 4PYKA 4G56A 5K0GA 3FZGA 4QDJA 3HCDA 2NNWB 1UFKA 2GH1A 1QYRA 4FP9A 3SSMA 1JSZA 3UJ6A 4RTPA 3KQOA 2PX5A 1VLMA 5EMLA 5MHTA 3EVCA 3THSA 5EC8A 4XUCA 5DTRA 2Y1WA 5E8RA 3G2OA 2FCAA 2YTZA 2GPYA 5FHQA 1L3IA 3B3JA 1EAMA 4RVDA 3JWGA 4PYQA 3GGDA 2PT6A 3ME5A 4HH4A 3KR0A 5KS2A 1T43A 3M4XA 3OZTA 2UYOA 4KVZA 2AZTA 3TR6A 5KYGA 1R8YA 1DUSA 2VS1A 1RJEA 2UYHA 2OB2A 3QOWA 2PBFA 1JG1A 5EEHA 1KPGA 5FA8A 5HIIA 2ZIGA 1FBNA 2I7CA 1U2ZA 4BLWA 2P41A 3EMDA 1EJ6A 2I9KA 3DXZA 4PINA 2AOTA 4YUXA 5CIYA 1SKMA 3P71T 1X1BA 5T67A 3FPJA 2HTEA 3M6WA 1VL5A 3DUWA 3DXXA 5CM2Z 5E9JA 3B3GA 4GOND 4R6XA 4P7JA 5BW5A 2PY6A 5CVDA 1AV6A 3KHKA 3MQ2A 4P7KA 5K0NA 3TFWA 1OR8A 5DRTA 5FTWA 1R00A 5F2OA 2OBFA 3DMFA 3LBYA 4BLUA 3A7DA 1VBFA 2BR3A 3FUVA 3GO4A 3GRZA 1VQ1A 4ISCA 2AOTB 4IV8A 2PWPA 3FPHA 2ZZNA 2DULA 4GOLD 4C03A 4BLVA 3O4FA 5HIJA 1G6Q1 3T0IA 3LGAA 2AOUA 4E70A 2O57A 3MTIA 2AN3A 2GS9A 2FPOA 3LCVB 5GWXA 2UYCA 2XVMA 4U7PB 1JG2A 1P39A 1TW2A 2P3LA 5CVJA 5DM4A 3LDGA 5T6BA 1G38A 3M6VA 3VSEA 2G72A 5P8WA 3EVBA 3BWBA 3G5LA 3HNRA 5EHGA 1SQGA 2IH4A 3KQMA 5K0LA 4OBWA 3G2PA 4PGGA 3C0KA 5FWDA 3NMUF 2AOUB 2AN4A 3GWZA 2XVAA 1M6YA 3AY0A 1FP1D 1IXKA 2CMGA 5DXAA 5E1DA 4C4AA 1ZG3A 3AWIA 5EZQA 3OE5A 2NXEA 3EGIA 5CD1A 3NWEA 3P9IA 3TLJA 3A4TA 2YXLA 3TKYA 1YF3A 3KQPA 5B1SA 4YV0A 4IWNA 5FWAA 4ER3A 5GOZA 5F2NA 1AF7A 3DLIA 4YUVA 1R74A 2PVCA 1JG4A 1NW5A 4K6MA 2OZVA 3NTVA 5LQUA 2G1PA 4RTSA 5C0OE 1WY7A 2I6GA 4BY9E 5DM0A 2Q41A 3SMQA 2EJUA 3JWJA 1NW3A 3WSTA 3PX2A 5K0JA 1D2GA 4KWCA 4YUZA 4ZTBA 5H02A 3DP7A 1TPYA 1FP2A 2B3TA 4GOOD 3BWYA 5DSTA 2JHCA 1XDUA 2A14A 2IGTA 3EVZA 4FS8A 4PIMA 5CCXA 1M0EA 3ORHA 3K6RA 5LQCA 1NW6A 3Q7EA 3HVKA 3A26A 5K0CA 3OCJA 1BHJA 3PFGA 4WVLA
chains in the Genus database with same CATH superfamily
3AIKA 4FZ5A 4LHVA 4BIIA 1LPPA 1ZA1A 2C58A 2H06A 2WBLC 4IYJA 3OLVA 1TRKA 1Y1LA 2IXFA 5FTJA 5HYVA 4DDKA 3L4EA 2VHZA 3LE8A 3ZE8A 1VG1A 1U3TA 1ND6A 1NSTA 3QA9A 1PJAA 3LHFA 2HC9A 4J16C 4V0ME 1AT1A 3I6MA 5D3QA 3FOCA 4OGWA 2A5GA 4A91A 3MCZA 2FWPA 1S2GA 4HBZA 3U56A 1N0UA 2Y4NA 3LLCA 4E5SA 4LDQA 3WL7A 4YEDA 3D7LA 1AS3A 2X4GA 3RIYA 1JEQA 1XMSA 1QSGA 2E4XA 1PO7A 1MV5A 2R96A 4MMYB 1QH8B 3P2KA 5JNTA 1I2DA 4KQKA 2NU6A 2F1KA 1JQ3A 3BMQA 3QKSB 1N8KA 1KAHA 1PFVA 3DKKA 3TQFA 1XUOA 1XPOA 2X9LA 1ZCZA 1XN4A 3AKCA 4RTSA 3SDSA 1Q7TA 3CINA 4NK5A 4NRDA 5C1PA 1PWZA 2J07A 2XT6A 4IZHA 3LP8A 2O5RA 3I6YA 1XA4A 3C3MA 4JKIA 4ZVRA 4BKMA 4KMMA 2GHTA 3WB2A 1M6EX 2J9YB 2VRNA 1IH8A 4NDNE 4KR6A 2ASEA 4MKIA 3QKWA 1UPUA 2C7GA 3HKCB 2QXUA 4WKCA 4LSGA 2VYCA 1HFJA 1HYHA 3OD5A 3TZKA 5JBIA 2Q5IA 4K9DA 3ITEA 4KTTE 3ORQA 2RI1A 3FTDA 1HL7A 3KXLA 3CR7A 4MGIR 2Q9AA 3MCAA 1K8QA 1TMGE 1JKIA 3FMPB 1Y3HA 3DHYA 4JBGA 3UJNA 1KVTA 1X1AA 1CJBA 4OHZA 1EB8A 1T29A 1TTQB 3GVIA 1IWBB 2L42A 3QBEA 1USUA 4GZ3A 4WV3A 1VSVA 2EDAA 2XCLA 4I1OA 4CHGA 4DJFC 5MN4A 1UMDB 1W85B 4KQIA 1OAKA 1PUIA 1W88A 3PGA1 4YXWA 3N74A 2VHXA 5EY5B 5TT0A 2D3WA 1I2ZA 3U1VA 4NHEA 3SC2A 4DIFA 4N6GA 2BGWA 1B6TA 4MQFB 1MGPA 2XUDA 1EVLA 1TGYA 5A4KA 3PJGA 1N2XA 1E9RA 1UKYA 1XV5A 1YIAA 2IHJA 3BORA 3FG9A 4FGSA 4KLZA 5IANA 2WQ6A 4O3MA 4MRVA 3AEUA 3JQDA 1K7YA 1KMHB 2ZAYA 1ECGA 2D5IA 3AY3A 3O90A 1ZD3A 3WLIA 4C21A 5BR1A 1L3CA 5IUKC 3DFUA 2GF2A 2PSSA 4TLDA 3IV6A 4FMDB 2ZJ2A 4BUJA 5DTJA 1X1CA 2YV5A 2XWPA 3GJ3A 1G41A 2RGNA 2Q1WA 3HLTA 3X1DA 4B4OA 3IAM6 1M2GA 3AR3A 1OU4A 2J59A 1F2TB 1T9AA 4KWIA 4L7VA 1ZX1A 4RM3A 1HGXA 1A95A 1PG0A 1V8DA 1TK3A 3E27A 2B5WA 3ZHTA 4F8EA 1YUBA 3IQDB 4QM6A 1XMXA 1P9NA 3GVCA 3BSSA 3PFCA 2W6JD 3P9CA 2ZIZA 2XDYA 3HCFA 2NSJA 1C80A 1MMFB 2QN8A 4X45A 3KPUA 4IM7A 2JBAA 3ZEIA 1EVEA 4OI0A 4L0MA 1JE0A 3GDWA 2YL2A 5GPBA 3SKYA 1EVQA 2OG1A 2YV1A 4AMYA 1PUJA 4B3MB 5SZHB 2H1VA 3TMKA 2GM5A 4CG1A 3AEQA 3FTEA 1ENYA 2OO7A 4R71A 1NYRA 1CZNA 1VJGA 4HQ0A 1PX0A 2R7KA 4XAQA 1PG5A 2WYWA 2WAOA 3M5CA 5THQA 3SZGA 4JYZA 1QM5A 4J2OA 4ZGGA 4RU1A 1OXVA 3UHJA 1FZQA 2REOA 2ONCA 4YMTA 1M2OA 2IZ7A 4KBGA 4QC2A 4EGSA 1DTSA 3KFVA 3MTBA 2BFEB 3AG5A 1MRNA 5A04A 3M8KA 3A4MA 3RHTA 1S9HA 4MRMB 5DCYA 3R6LA 2XVYA 4ZVPA 5A1TA 5BMOA 2A0FA 3SJUA 4TZ0A 2O23A 2OP1A 1XSEA 3RWOA 5HK9A 1UWCA 3L4JA 5HRUA 4Q3EA 2ZPUA 1VDZA 2GPSA 1P4SA 3NKFA 2C7PA 3IB6A 3A6PC 4NWIA 5BWOA 5ALOA 3ZG6A 3PF9A 4EGAA 4FGUA 2B35A 4BN0A 4FMBB 4CKBA 2GASA 4EZIA 1JAZA 4TL6A 5KYUB 10MHA 4QTUB 1CQXA 2DY1A 3JWPA 4CT5A 1K75A 4A2WA 4WDQA 3D02A 3U81A 4AJ2A 2DUUA 3WIBA 4INPA 3GDHA 3GLFA 5ANRB 1PZGA 3OQMA 3FPBA 5KYTA 3NAQA 1EX6A 4LJSA 1DC5A 4X85A 3L77A 1OC2A 4TWIA 4ZOAA 5FV7A 1AXEA 5G53C 5DBHX 3K9BA 4RLHA 2AS0A 2HUNA 4JLPA 3AUUA 2G07A 4O1MA 4LXXA 2GZ1A 2QD3A 8ADHA 4JT8A 5EHZA 1LFAA 4BB0A 4E07A 3FA2A 2EATA 2A1IA 2ZWOA 4R2XA 2IXEA 2OXFA 4ZO4A 1VSQA 1GPUA 1DINA 5DLDA 1K3FA 3O4JA 3U4HA 1E66A 4TS4A 4MULA 2CLOB 4YRDA 1FOEB 3QE4A 4ZRNA 4MB0A 3L7AA 3RVBA 1G5PA 2QLJA 4N7RA 3QX9A 5K99A 1EDOA 1DP4A 1YDGA 1WL8A 2A92A 4B48A 4B6EA 2AN5A 5CEFA 3ZV7A 2HSWA 2OGTA 5JR3A 1SQ6A 2OD2A 4LZWA 4HT3B 3RAGA 3RAEC 2VF8A 2ZULA 3GA7A 5JTUA 4KYIB 5EMJA 3PNBA 2YV4A 3WQBA 2QB5A 2XXBA 3B85A 3EAQA 3RK1A 1DG1G 3F74A 4NAUA 1TC1A 1VE7A 3HKDA 2MINA 3T38A 3T7AA 1DMSA 1IPEA 2AKYA 2WIBA 4E31A 2RHCA 2WIJA 5JLJA 5TMDA 4R8RA 1E5VA 3NCHA 3UJAA 3Q72A 2HBYA 1L7EA 3PDUA 1OBVA 3WNZA 5LQMA 3AP3A 1AZTA 1IY8A 2F59A 2XNKA 4X54A 1ZI8A 4EZEA 4A5SA 2BCEA 1HDCA 3E1KA 3QHPA 3W8RA 5DN6D 1GGHA 1M0TA 2F9MA 3CW9A 4BNZA 5ICMA 2WVGA 5J2UF 1B42A 3GJYA 3IL2A 3VOSA 5TC4A 2C5SA 3AHHA 3IP7A 5EJMA 1YFZA 2ZVQX 2I76A 5FI3A 4U2FA 3R3UA 2VP9A 3UT5A 3CF0A 2PCJA 1O97D 2PXHA 5K4HA 2C7RA 4IICA 1WDTA 4D4IA 2GCOA 2PX0A 3CNLA 4W5NA 2FFBA 1F8YA 3FF1A 4HPXB 821PA 2VK2A 2A59A 3W1EA 1C9DB 3VYWA 3U0BA 3WWOA 4EYOA 3A6FA 1F0PA 1TCVA 3EZYA 1C1DA 1SQ5A 4GSYA 4H18A 1GUAA 3RRXA 3OQVA 2ZZMA 5FFMA 3N0TA 4MYTA 1GDDA 4M22A 4IDHA 4TM8A 5MFZA 1ZQ9A 5CUQA 4V03A 4EHNA 4WIAA 4ZN6A 4X7PA 1Z2NX 1OJLA 1I2MA 3RHZA 1R16A 5KKCA 1E20A 1ZI6A 2DXIA 4Z0NA 5C5CA 4AKGA 4X65B 1PL8A 4NFHA 5E0KB 5LVAA 2P6NA 4QVIA 1ULTA 2HV9A 1D2MA 4GC5A 5H0IA 1N9ZA 1NL3A 4YP9A 3L6CA 4XM1A 1PN3A 2WK1A 4FN4A 3KKLA 4K26A 1PGPA 1TRHA 3IJEB 4EJ2A 3AFOA 4GGPA 4ILEA 3EEFA 4FJ0A 1J1IA 2Z4RA 4E2ZA 5FWYA 5CA0F 1GA4A 3M3PA 4PYIA 2P4EA 3VYRB 1SM4A 4KG7A 3U61B 3T5GA 2H3EA 4Y2TA 3G2IA 3GGSA 3BH6A 1QLHA 1XMIA 3GUYA 3JQAD 4HNVA 2ZRCA 2P68A 4L16A 4XJTA 4IDQA 3VR3D 2PGNA 3FZNA 4E03A 4YCCA 4C6TA 4ZPJA 3I6BA 3KXDA 3CUVA 3LECA 4RVCA 5FADA 4F2PA 1FB5A 2YFHA 2POQX 3A6ZA 1R64A 4DLZA 3COZA 1IN7A 4J0EA 1DBQA 4N0PA 1T2VA 2AJBA 2BM1A 2BFCB 3UOWA 2GETA 3DAFA 2PSDA 3C24A 1F9EA 3ND6A 3QG5A 1Z8FA 3RUHA 4A2CA 4BNHA 1FNBA 1Y81A 4YROA 2PGJA 3O1HB 4WEQA 5EP4A 1GPH1 3T95A 4JI3B 3WICA 4RH0A 3ZNNA 4C0JA 4DIBA 3FZQA 1U0RA 2K7ZA 2JAXA 3BGOS 1VYTA 4FCCA 3GFTA 3MWEB 4JIGA 4HNTA 4F9GA 1YI0A 3TSAA 2UYQA 521PA 3QY0A 4DY6A 3HWRA 3T5AA 1RBQA 2FKNA 2VJAA 4HAWA 4HWSA 1JEAA 1GFWA 4UHCA 3DBOB 2RH8A 4A27A 2IPNA 4XLZA 3AFIA 5CCBA 1VL0A 4UOQA 3VX3A 1PS8A 4YRSA 4PHFA 2PD4A 3C48A 2ZRNA 3W2GA 1BXZA 4DFDA 4UE6A 2ZE6A 2J41A 4YRZA 1IHOA 5I9IA 1EUYA 4KLRA 3D6VA 2ZB3A 3IVAA 3KJEA 1DKMA 2O2CA 3JAWB 4R54A 3EDOA 2XB8A 1WXGA 4B4WA 4ARSA 2YWXA 1YA8A 3D2CA 4MB6A 2ANCA 4N5HX 2O50A 4TUYB 3IMFA 4V0OA 4BUZA 4ZCMA 2O8BB 2C2ZA 4I6GA 5F21A 4YAUA 4H4DA 1I2AA 2AFRA 4NOLA 2P30A 3OECA 5C8YA 4BGUA 1QFYA 3CZPA 1L7VC 3I1YA 1L8AA 4HWPA 2R00C 3NHSA 4BV8A 1X14A 4B2PA 3F7MA 2CK3A 1U94A 1UQRA 5IN5A 3TZEA 5K3OA 3I45A 4G1EB 4FLFA 3TVTA 3EODA 1I7NA 3SZUA 1RKBA 1AUOA 4I8IA 1CETA 2YHSA 1PEKE 2PUCA 4RTPA 1P3Y1 3HU5A 4QJIA 2HW8A 4MNTA 1AN0A 3IVRA 3BFPA 3B2QA 4K6CA 3GLQA 1EVKA 3VR2D 3QYAA 4N49A 4E13A 3WIDA 4DRXA 3OTOB 2CV0A 4IXMA 1SZPA 2WFMA 4ML3A 3PE4A 4K86A 1P9RA 1VSBA 4C0AC 3DZFA 1UT6A 5KEIA 1FLVA 4RZUA 3DDSA 1XQ1A 1KVRA 3B3JA 4CTNA 1XU9A 3P0JA 2HV8A 3H11B 3U44A 4IIHA 3ISVA 3H8JA 1IPHA 4CEHA 1ZIDA 4J4HA 2H18A 3LUPA 5CBPA 1Y4ZA 5IH7A 2Z5VA 3KD3A 3Q8LA 3N6XA 3GLHE 2V7UA 4R8VA 5AESA 5REQA 4CMIA 3WA6A 4FGWA 2H57A 2DF8A 3LWNA 3BF7A 4BFCA 2EEPA 3PFWO 3VU1A 3NTUA 3NC1C 5IW8A 5LBUA 5FPYA 4U7DA 3AR8A 2GFIA 5D85A 4PSKA 3LOPA 4CW7A 5LD2B 3MMXA 3OMWA 2JLQA 4JC0A 4A1OA 5TF0A 1AV6A 2DUJA 4JBWA 1Z5UA 1MQ8B 3TFWA 1ANKA 5B6JA 2FE1A 3Q8MA 4HQ6A 3ZHZA 4B6SA 4WKOA 3TSZA 2W4QA 3F78A 4ZKDA 4P0TA 3H84A 1N6OA 4QXQA 3A28A 4GLFA 3ILXA 3HPRA 1CSEE 5IT4A 1XWWA 2XF8A 3IIIA 1YOVA 4MGEA 4P3XA 2O57A 2VC2B 1C9EA 3DTVB 2ZTMA 1WU8A 2IK8A 3COJA 4QZVA 1AUXA 2XVMA 4KC0A 4U7PB 5TVGA 4BQSA 4GYKA 3U09A 4FYMA 1BEUB 3EFOB 4M60A 3RUPA 3CVWA 3TIGA 1DEOA 4JXXA 4DZZA 1YBFA 1TOAA 3KQMA 2Y9PB 2FEXA 5F3DA 1JKMA 5KAPA 2HA7A 5K4AA 1N6KA 2AKEA 3H1AA 3GWZA 3DE4X 5FTMA 1RRPA 4BS9A 1E6UA 1W4LA 4DR1B 4KSCA 3H5NA 5L3QB 1NLZA 1EX7A 3ABZA 5IYZF 3SIRA 4BTEA 5G1NA 4LSMA 3WADA 2Y93A 1B0AA 2VKQA 4CQMD 3U9SA 3DONA 3QEOA 1BS2A 4F12A 1VL6A 2GO1A 4YAGA 2X1HA 3HBLA 3COVA 5KOJB 4PY2A 2I6GA 2OCYC 1WEKA 1HBJA 1H22A 3V7NA 3VH3A 3HB7A 4XEUA 4AYWA 1A3CA 3E7WA 4CV0A 3U4QA 1RAGA 3M6IA 1SOUA 2R6CA 4PGMA 4LGCA 1HORA 2FW0A 3H9JA 5CLGA 4IDCA 5EAIA 1Y5IA 4ZZ1A 2DRIA 3C8MA 3FD8A 1JU9A 1QIIA 3AUSA 2GD6A 3CBQA 2A14A 3TAXA 4BPRA 5EA2A 1GD1O 5B7NA 1NR1A 3F6BX 1D4OA 4Q7JB 4DIKA 1OYYA 1AGXA 3TN7A 4TT3A 4W5OA 1VE1A 3DF9A 4AURA 1QGAA 3WO1A 1WMAA 2J3EA 1FRZA 1SKQA 5CW2A 2VHYA 1N5RA 4KQ1A 4LDJA 3QEKA 4B31A 1U2GC 5AM2A 5JCJD 4X1YB 5JDIA 1I8TA 4NCAA 1SEPA 4EYEA 1DJNA 1U7OA 4HDCA 4RY2A 3P26A 4MQUA 4NPCA 3RKUA 1NQUA 3PGVA 4Y7DA 4IIJA 4YP6A 1V8OA 1KWKA 2WPDA 3CKYA 4HRYA 2ZRJA 3REFA 1JPNA 5GONF 1MAVA 3GH3A 3RABA 1E2EA 4WXEA 5BW6B 1YB5A 3F8SA 3K6SB 1YA6A 2MYNA 2I8CA 2XKAA 2I03A 3FAKA 4CL8A 1EK1A 2EHDA 2YV2A 4YREA 4A16A 1F6BA 3OOHA 2ZWPA 4PTZA 4N7BA 4F56A 1SXGA 3L4KA 4B3DA 4BMXA 5BMVF 1E0AA 5LLDA 2KX7A 2P2DA 1II8B 1PJLA 1MJGA 2DCMA 2HNKA 2YICA 4A6EA 1OYOA 2LP4Y 3KC2A 3HY3A 1SVLA 2CDCA 2QR2A 2PDAA 3JRWA 4YA6A 1VE3A 3O8BA 4HUJA 4EVQA 1YR6A 1JQDA 1YMUA 5BN5B 4ZAFA 2UDPA 1NBIA 3ORSA 1OD6A 1T3HA 3A1UA 3ADDA 3GRRA 3FCAA 4XQCA 4XCQA 3M6XA 4A3SA 1W581 3DS8A 2D1RA 4IFIA 4B2LA 3EDMA 2ACEA 3AKYA 1FFWA 3RS7A 4BNIA 2B7CA 1R1DA 4O1HA 4NXMB 2QJRA 4JR2A 2YBEA 3BYZA 3OJXA 5D3MA 4Z3KA 5C3MA 2H1WA 2C9BA 3JU3A 5IJ0B 2RKOA 1PJ3A 4Z9BA 3VH1A 1YRYE 4DJAA 1W5AA 4FT2A 4X92A 3AM5A 3JZIA 3PFHA 1N3YA 2WF7A 3NM4A 1JDBB 1G5RA 4DLUA 4GPIB 1IMOA 1HNWB 1E1MA 4UOEA 4Z4EA 4JYMA 1Z0IA 3A9CA 2FPPA 1E7RA 3OWOA 3UMVA 1V7PC 2VZ9A 2PTHA 1EM8B 1TCUA 1DC6A 1ZRSA 5LQSA 4JWTA 1GV0A 5JATA 5LOVB 3K5PA 4D44A 1UXOA 4OMFG 2QRMA 2WJHA 2C1ZA 2GZAA 3OU7A 3QJ5A 4JA0A 2BOVA 3FXAA 4PEVA 3W34A 4J2TA 3BILA 4II7A 5THXA 5IDXA 3IPCA 1I9GA 3ISJA 1LJLA 2GFQA 5FL3A 2EF0A 5KTPA 5G3ZA 3A70A 1JEDA 1DJQA 2QVCA 4Z3OA 3ZWPA 4G0QA 2ENWA 1WZNA 2J5KA 4RNCA 5WRFA 3R7SA 1R0XA 3LFTA 2AQKA 1KDRA 2Y2VA 1J99A 1M2WA 4WY5A 3DB2A 4I4NA 4ZCLA 1Y5MA 1ZGAA 1TNDA 2F7SA 3A3YA 2FOIA 3G68A 2PEYA 2XMRA 1OWOA 3D3WB 3FSGA 3TSWA 4AQ7A 3N2LA 2B1RA 2BI4A 3OIYA 3PJEA 4JGIA 2AEJA 4JP5A 3HXMA 5JRZA 1M3SA 2VSXA 3KLBA 1QZ3A 5EPEA 3DQQA 2DHEA 1PG2A 3OM0A 4R81A 3UFXB 1QYVA 1O97C 1T34A 3F7OA 3KCNA 1XZFA 2BMDA 2JHFA 5CAEB 3F4KA 3TCXB 2ATVA 3RYTC 5LR6A 4ETIA 1KDOA 1SXJE 3E4CA 3AF2A 5IVDA 2FFRA 4EFNA 3NHWA 3SR3A 4CFSA 1N92A 4GSKA 3UG6A 5HTOA 1GL9B 1XDGA 1F4PA 3H13A 3N6VA 5H1YA 2I55A 2PKQP 2WIFA 3AI1A 3DC2A 4IS2A 1G7CA 1H23A 1MQSA 3KYDB 5SZJA 4PZ9A 3WKCA 5CXQA 3OZGA 1RE0A 2BTEA 5JDCC 1NIPA 3BL5A 4OV6B 4M9ZA 5FDFA 4CM3A 2CLLB 1NYQA 1YBVA 4AROA 1DBIA 3NDPA 4LCEA 3W5IA 1BG6A 2QTHA 1XAHA 1U7DA 3T7SA 2IXTA 3K0HA 1MAHA 4LW8A 2PA0A 3LDUA 1Q0PA 2W00A 1YTUA 2NQ8A 1RKUA 2EWMA 3IALA 4QNRA 1QMPA 5FUXA 2IHYA 4HGQA 4TQAA 2W90A 2VPZA 3V4ZA 1G21A 2GYUA 4K6FA 4OA5A 4RVOA 4C6HA 1IZ0A 2DX7A 1Q17A 1U3GA 2ZWIA 4D8YA 3KVVA 3UBTA 5EJ7A 1N8NA 1T24A 2ZRFA 3IA7A 4LY9A 1QOZA 4UNSA 3PNYA 1QRDA 2WIDA 1K7FB 3HNOA 3KLPX 4JITA 5DGCA 4HUTA 1S0UA 4R3WA 1H1LB 4A6XA 1G8SA 5I8WA 4B3GA 1JA9A 2FJ0A 4YCDA 3G89A 4CKWB 2K87A 3I83A 3IE1A 1GPAA 1ML4A 2B9EA 2IA5A 1KI8A 1X7HA 2VJBA 2WF9A 3CX3A 2BR5A 3S2UA 4E7PA 1DS6A 4RJIA 5AQEA 3LKVA 4RVUA 4JI0B 5JS1A 2B4AA 5JZOA 1U5AA 3DDZX 4I08A 2O9JA 3LLUA 3VGPA 1E1RD 3DWGA 1L6RA 3FSJX 3NI2A 5DHPA 4TVKA 4B9AA 4IG9A 5TSDA 3PLAE 1PDOA 3I2IA 4IHJF 3ZU2A 1QHFA 3SZOA 3CEJA 5ALJA 1ZR4A 1SUDA 2P78A 2VOJA 2Q50A 3EIWA 3A31A 3JATA 2F55A 5AKGA 3I42A 1KF0A 1IU9A 1NXOA 1UQUA 4N0QA 1QLJA 1TQHA 1PL6A 3LX6A 5E9QA 2OZLA 3JSAA 3MFQA 5L9AA 5IH3A 3S2YA 4D9BA 5DX0A 5FBQB 1XQYA 3FFWA 4LYDA 3EIEA 3OQHA 4URUR 1W49A 5CX4A 4M7RA 4WBNA 3FYHA 4GEGA 4F7DA 1I80A 1EXNA 2GOYA 4UTRA 4RFVA 4CZ2A 2W4MA 2PU7A 4FNMA 1XKQA 3P52A 3I3OA 2ORVA 4QVKA 3FTFA 2JCVA 1CRPA 5CG2A 3U40A 1ODJA 1G20A 1LI4A 1IQ0A 4G41A 2W2PA 1JKFA 1H2ZA 1IOVA 1XAJA 4KCGA 1IEWA 2IVFA 1WZEA 3H9CA 5BPFA 3INGA 3KZOA 2AQ8A 1GCOA 3N2EA 2CMFA 3DVAB 1T5SA 1YASA 6Q21A 1AKMA 2QM3A 1KOLA 4EI7A 5KTNA 5LQJA 3OF5A 1SCBA 4JJZA 1OX6A 1Q12A 4JUIA 1RD4A 3DL4A 3EC1A 3ZU5A 3F2VA 3PYLA 1NQ5A 2FPRA 1L9XA 4MIKA 4R51A 4BASA 2XUJA 1COWD 4PAGA 2J4FA 4CG2A 4L4RA 4LC9A 1W2GA 1BIFA 2I62A 4YMUA 3JQFC 4BXOB 4U39A 1LTHR 2C5HA 4B8WA 5AVUA 4C7XA 4EW3A 5JJCA 2JFWA 1P9WA 3BPSA 1G9SA 3HU3A 5DHRA 2XRYA 5FNVB 1QIKA 3GNLA 5B4TA 5AVYA 4IGFA 1LK0A 2ZIVB 4Y2UA 5ALHA 3UYKA 3VR6H 2GEDA 4MVJM 4W5RA 4HDRA 1XQ6A 2FEMA 4FPXA 3VNSA 3OJCA 3LZDA 3PPIA 2R7LA 1VTKA 2K2QB 4IIEA 2BGUA 4AZSA 3VC1A 1EHIA 3QWFA 2QRGA 1P5ZB 4IJ6A 4WZZA 2PZKA 4Q16A 3OIFA 4NF2A 4B0PA 2IW1A 3GFSA 2WJJA 3AP2A 4RPKA 1S96A 2W0MA 5LZ4A 2QJWA 1SHLA 1KTVA 4KRGA 4MI9A 3KIPA 5IAEA 2BJHA 1ATIA 4TKUB 3G88A 4O2BF 3QE0A 4UZEA 3HB1A 1SPBS 2H31A 4LK2A 2G36A 3DOFA 1WCV1 1OVGA 2B78A 5GIPE 1X74A 5H3HA 2CDRA 1E6CA 1GILA 4X6YA 1NOJA 4FI3C 4ZMBA 3W1VA 4CKXA 1E8MA 2YWGA 3KVYA 4B45A 2Q2QA 3GJXC 3NV7A 4DCGA 5HKOA 1JB1A 1I3NA 1Z4JA 3W3AA 4UMFA 2O3QA 4JU9A 1XRSB 2C77A 4GWGA 2WYOA 3E3NA 3KQVA 3R2JA 2HK9A 1C30B 1CUZA 4MIYA 5FOXA 2PX4A 1R2QA 2PUEA 3EGXA 1O9GA 5C3UA 2WA2A 1UXHA 2CL7X 2JLAA 1M9NA 3HYNA 4O4HA 4CF6A 2TMDA 3A6GA 1R8SA 1WAMA 3O2NA 3EXFB 7YASA 3X1JA 1IBCA 4ASUA 3LP5A 2AG1A 3IUPA 4QDUA 4RGBA 3UK0A 4HX5A 4LJLA 2IEGA 5I7OA 1Q11A 3K20A 4RIGA 2WJZB 4R05A 1PWHA 3EHDA 1J1UA 3DTVD 3LDFA 4DJJA 4CLXA 4MCAA 2QTCA 4RJJA 1A8SA 2RFLA 2O2EA 3EOAI 4RHXA 4DCSA 3L4SO 5K0TA 1S2NA 2ZJ3A 4PAQA 1T1RA 2AR0A 2CXQA 3GAAA 1S9DA 2WA1A 2YQ5A 4OHBA 3V8RA 3K1AA 4II2A 3L7YA 1EP2B 3HU2A 4KVAA 3V2GA 1RI1A 3DCIA 3PLNA 4LE0A 4YO8A 3FI0A 1FP6A 5G0TA 2O05A 2W6MA 5M29A 2O8EB 1U04A 1EHCA 1MFZA 2Z58A 1E2UA 4LEIA 5HKBA 2BR4A 1TEHA 2OCGA 2I67A 5EWLA 3KAPA 3UY4A 4OBEA 1X15A 1Y1QA 5EXPA 3ESBA 4GRDA 3BB4A 1DWQA 1XHFA 2D7JA 2RHMA 2YJ6A 4KUEA 2H4HA 2NVUA 3AF4A 3WLFA 3CHYA 1GFIA 2GJ4A 3AI2A 2VKTA 3C4JA 4AX8A 1KSFX 4BFUA 4A8JB 3NLLA 2AMVA 4FGJA 4BTVA 3NT2A 3N0XA 2X6RA 1DEKA 3GFOA 1NE2A 4M9QA 4GDFA 3BHIA 2W2MA 1CUDA 1KEUA 3S27A 3AUAA 1UBRS 2OCPA 2ZSIA 3GXBA 3L6OO 3RSLA 4DA6A 5BUQA 4OGGA 5JUWA 1UBCA 1ZGZA 2P65A 3QXCA 4R1MA 1SU6A 4RF3A 3W2IA 4U7GA 2LRHA 4JWKA 4OFXA 1QUFA 1KYQA 4N5NA 3KRTA 4X5OA 2G71A 3DWEX 1YULA 1YWGO 3C3CA 4Z9AA 5CIQA 1IRIA 2QZ9A 4AKEA 4S1TA 4B3CA 1RQLA 1GZ3A 1Z4KA 2FH5B 2PFSA 2XKJE 4FDUA 5K0GA 3KTAA 4S3MA 3BXXA 4FP9A 4AK9A 2GN0A 4BWVA 4NJMB 1X1EA 1X7XA 1QWOA 2O5VA 4UNNA 5JC8A 4DB4A 5EMLA 1L4UA 3FTPA 1P5JA 1L5MA 4DHWA 4BFZA 5CG1A 2JEOA 3AF5A 2GBPA 3TS1A 4RH1A 2VH5R 3KOMA 3DE2X 2FWAA 2FZLA 2J6CA 3REGA 3KJNA 5JRDS 3ZNPA 5A4DA 4I4CA 1GZUA 1L3IA 3UMMA 4LZOA 2OORC 2Y0DA 2QLMA 5F52A 2CHEA 2E49A 1HE8B 3I8XA 1RXUA 1CUAA 2JCXA 1NJFA 1Y7TA 5D5PA 1B8VA 1DUSA 1BW9B 1SKBA 4L4SA 4R1LA 5I7AA 1E98A 4HMQA 3RROA 4ECEA 2UUAB 2M9MA 3VISA 3HJUA 3LHSA 1FXUA 2FUG6 2QP9X 2P77A 1R6XA 2FWJA 2X1MA 2AFHA 2F8TA 2FZCA 5T67A 3RS9A 3UK1A 3NFYA 4F4CA 2QVYX 5BYJA 1F7UA 3R41A 4ZRDA 4BBZA 3ZK8A 5I7UA 3K70B 4GX5A 1I7LA 3I09A 3ZWOA 5BVGA 3OZXA 4MB2A 3RF7A 1S2DA 3FOZA 1RZRD 4M7PA 2EYUA 2IODA 3H18A 3R5TA 2N46A 3JQQA 4XWGA 3AHJA 3D81A 3WHPA 2BEKA 3PL5A 4WNIA 2ZJ8A 4ENUA 2BZSA 2GPTA 3V5NA 4FEAA 2G9RA 1ZJWA 1PNRA 4UBIA 3SHTA 3NTOA 2HXSA 2XA9A 3LIIA 5HIJA 3THXA 3KM0A 3EIQA 2XNDA 3GLUA 1ZH2A 2AN3A 1WCIA 3MMZA 2GS9A 4JVOA 2BL4A 2Z8YM 4NKRA 5IMSA 1UBMS 1G5IA 1Q7BA 2AC7A 2R84A 1P39A 4HFRA 3IAUA 3WFZA 4KE6A 1AZWA 721PA 1RIIA 2VJOA 3VSEA 1KVUA 4M89A 5JMOA 1T10A 1B6SA 3CCBA 3G2PA 2WUVA 2O59A 5LA6F 2RJ3A 1GCUA 2XT0A 3NNDA 3Q0IA 3R8CA 2VQ3A 1N2EA 1FUUA 4G24A 4YI5A 3RYFA 1CCWA 3ZVRA 2OCIA 4EG8A 1C1HA 2CHQA 5CXXA 1T8WA 5FTLA 5EZQA 3TTVA 4AT1A 4MOWA 1XPRA 1FMTA 3JY6A 1U2DA 1BA2A 2QDKA 4FIZA 4YHBA 3VTKA 1MG5A 3H4TA 4C4PA 3ZU4A 2JFQA 4O0MA 4G5GA 1UK7A 4DDUA 2OCDA 2B8WA 5IXJA 3RG8A 3DZHA 2QE7A 2C4WA 2D59A 3F6SA 3G2JA 1PD1A 1G98A 2I2CA 4ED9A 1RYNA 2JBAB 1Y1KE 2BBOA 2BI7A 4B7UA 2ZQZA 1R5BA 3K6JA 3PX2A 1T2UA 1DIRA 1CT9A 4I9HA 3O8RA 2CNDA 3D7MA 5H3CA 4BX8A 3SFTA 1K89A 2Q4DA 2XJ4A 3SIWA 1VA4A 1R6TA 1XYVA 1NMYA 2GD2A 2X15A 1Z6TA 3CZ5A 1N1DA 1NRXA 3AEQB 2FN3A 2IGTA 5CGQB 4G01B 3RNOA 1IY1A 3R1IA 4WKGA 4OG2A 3K6RA 2OA0A 2W6IA 3ZY3A 2X6TA 3VU3A 3Q7EA 3HVKA 3GLTA 3A26A 4JP8A 2RCYA 5AJTA 2LBPA 2YBDA 1ZY2A 3MWDB 4ND2A 5EUCA 1ULZA 3HCRA 4BJ1A 1M2OB 3L06A 4I1PA 1QGDA 4L27A 4QOJA 3JQEA 1YZQA 5AKZA 5K3SA 4EO4A 3AVPA 3SS7X 1ETUA 3FNIA 1GLVA 1VPLA 3P9QA 3SXJA 4IWXA 4LJYA 3C74A 2WNHA 2UKDA 3WC4A 1Q1QA 1JQLB 3DUFA 1Y3DE 2C4TA 4WRRA 3GT3A 4XD7D 5NULA 2JFFA 3S99A 3BTUA 2C3UA 3JQRA 4CU2A 3F3YA 1U9IC 1NNUA 1UT8A 2XOKA 5F33A 4TSRA 5T41A 2R6ZA 4IAOA 1KARA 2X7JA 4WT7A 1D2CA 5EP1A 3L8DA 1KQGA 4K0RA 2XW6A 1RJDA 4OJKA 4CKBB 5F12A 3OEHD 2P0YA 4ZOLF 2KYRA 3EYAA 5SICE 2M6LA 3EQ8A 1XNQB 1ZHOA 2C96A 2VT3A 2WTXA 2XQKA 3OU2A 3A4LA 4UHJA 4LY6A 3BFJA 3C5WP 5EWJB 4C4RA 2Z8ZA 2AI1A 4N40A 1ODCA 3JWIA 4YRIA 3TZ6A 1YHYA 2HLHA 4M38A 2FSSA 2HRRA 4JXZA 4ND6A 1U8UA 4BQNA 3NRBA 1R9NA 1P77A 6REQA 5DKFA 2J31A 2QVBA 4BQOA 2BKUA 1XNGA 3HCAA 3U3OA 4S04A 3UPUA 1WB9A 1XTSA 1DHTA 1BXGA 3OE4A 1RLIA 2CGEA 3HACA 5CLQA 4EB6A 4LK3A 4ZYZA 1XZDA 4JKYA 4AJJA 1ZN9A 2JJ2A 2Z9BA 1T1JA 4AMVA 4UBJA 1RLUA 3TKAA 2BW0A 2GN1A 2GKSA 1H5UA 4PRZA 2PNFA 1HE4A 3A14A 3ISTA 2CZQA 4KRYA 3SYNA 1Y6GA 1JLKA 5GAJA 1WXXA 1XRQA 5EKXA 4KOEC 3UICA 5BRJA 2M32A 3U9TA 5AW4A 4M1TA 4DR6B 4UZFA 1LLFA 3FPEA 4B71A 2SCUB 3EVFA 3WKDA 1H8ED 1K2WA 3CEHA 4WOJA 2RCNA 4W5HA 2QBYA 4KR7A 2WVHA 1OFUX 2R6FA 4FW8A 1FFHA 1ZEJA 1NBAA 2OOSA 3JQ8A 4YT5A 3TOCA 5L3SA 4JC8A 1V47A 3GH1A 3WGOA 3EZFA 3KXIA 1SZJG 4Q5IA 4AMBA 1NNI1 3QSYA 1NT4A 3CH7A 4A9AA 3PICA 1M66A 1Y1TA 2WF8A 3MJRA 3TVYA 5D3ZA 1U28C 1MORA 3HKDB 3GJZA 3UWSA 1F7VA 2X0IA 1T5BA 1FMJA 4QDZA 4E09A 3V8MA 4L5BA 5AJWA 4DM7A 3F1LA 3T7EA 3WYEA 2SKCA 1EWKA 1XDZA 1ZM9A 2J46A 3BA6A 3LT2A 4C0XA 1VP3A 4QQFA 5AWFC 4DMCA 1Z2EA 1KEWA 2VF2A 1ZVMA 2VTVA 5LSAA 2E4WA 2DB3A 1WBJB 1TQ8A 5LZ5A 3PG5A 1VCNA 3UANA 3MXOA 1EZ1A 4JJKA 4HNGA 1ETHA 2IF2A 3SG0A 4GFDA 1BKYA 3AZQA 5FAKA 1XVVA 4GI1A 4R5MA 3J81k 4CLHA 3CC8A 3RHSA 5I3CA 1GAQA 1UC8A 2C9OA 1O54A 3EY9A 4OBXA 2CVOA 5B1DA 4PR0A 1FQKA 1CZHA 2B6NA 3SJBA 1C1DB 4HLUC 1TAGA 2N47A 5EL0A 1U3UA 1T5TA 5LZ7A 2VDVE 4LOAA 3UO8B 3FVTA 3QV2A 1B8NA 1JAXA 1AVTA 1GGEA 3K09C 3GC6A 3L1IA 3W5SA 1NVEA 3EVDA 4LMAA 4QARA 5J2TF 1DAEA 5TEWA 3U5TA 4DQLA 4CJXA 3EGDA 1B00A 2HF7A 2XMQA 2VDJA 3GCGA 3BB3A 5LD2C 3ECAA 1OXTA 1NUTA 1M8GA 2O3SA 1LK5A 1QZZA 2PAFA 2PYIA 4RA9B 3TEFA 5LQNA 3VHLB 3U7HB 4XUEA 3FZYA 2VP2A 4G5YA 1LLDA 1C0KA 2IOFA 3CZ4A 1ODSA 3PUZA 1LGYA 1FNNA 4QELA 1D9XA 1EB9A 2X1VA 3FDZA 4DMGA 3U19A 3IKLA 3DBVO 1XJ0A 4IKOA 2YIDA 3SBEA 1U7ZA 3O31A 3KYIB 5B30A 2OSVA 1ZU4A 2RB4A 1BMTA 1QFJA 2AJ8A 3E9DA 4X63A 2V96A 2OV3A 3MCWA 4MA5A 4XX1A 4WLFA 3MD9A 1FW8A 2ZDQA 3C2QA 1E5DA 3WLSA 5TJ9A 3D4PA 1SOAA 1YVPA 2Z1MA 1JBKA 3I23A 5EPUA 2Z9CA 4L51A 5D1NA 3VKFA 3MHTA 3L6DA 1OLUB 1HEIA 4HSEA 4WN9A 1L4YA 1MDBA 4C08A 4DQUA 2JS7A 1KIFA 5LQRA 1DC8A 4OP2A 1B2LA 1PJZA 4XWYA 3GP8A 1E3QA 2YOFA 3RSHA 3KHTA 2GBCA 3NBZC 4I3HA 2VQSA 3ASVA 3DVQX 4BVLA 3NASA 1N25A 5JYCA 2AOWA 3E58A 4NARA 3EMKA 2N1BA 1VYVA 3NG1A 2EL9A 3FYSA 4Y2VA 2IOYA 4RUKA 3HVIA 3IAM1 1N3LA 4KJZA 4FC6A 4PF1A 1EXDA 2AQIA 1VMIA 2ZRMA 3PC8C 4EEXA 4PC6A 4L8GA 2LCQA 1ZJZA 4OHMA 4EPYA 4NABA 4M55A 1LC3A 4IVQA 4M37A 4Q3BA 1GTG1 1RQ7A 2JI9A 4KO3S 5H16A 2Z2JA 4KQ6A 5EGSA 2OWDA 2OD7A 3ZBPA 2J4CA 3KKQA 2HH9A 4XGKA 4QAQA 3ICWA 1UBUS 2UZ3A 5DFAA 2ID4A 2R5FA 5BN4B 4G5XA 2D2XA 1LBQA 1QFXA 3NEJA 4DQKA 2PWYA 4GUAA 5AVQA 4H2DA 4MRSA 1FP7A 4LZJA 4MUHA 4B2YA 2OBMA 2OFWA 5DGXA 1QHGA 1NPTO 4XDYA 1IY9A 2ZXFA 4KR9A 1WW3A 3F67A 4QQKA 3RRZA 3UVEA 5C8YB 5J43A 3HABA 4CTKA 2UYHA 4RVNA 5L95A 1Z4QA 1JJVA 4X7RA 1KDYA 1QWSA 1T5OA 1OB5A 3B1KA 2IP4A 2AJTA 4W9RA 4PYRA 1T35A 1X3LA 2D5CA 2D54A 2H7CA 3N3AC 1PLLA 3KKOA 4BGEA 5JVDA 5K6TA 1ZWLA 3IAS1 3OZUA 2JCBA 3D3NA 2HIAA 4JEUA 1Y0BA 1Z82A 2O48X 4LWPA 5KDDA 3WLNA 5ADUS 5HZKA 3RYCA 1VB5A 1USIA 2AG6A 4GMDA 1RC0A 2IIQA 3NBKA 1P1KA 4RKRA 4RVFA 1Z7EA 3B60A 1C14A 2VXYA 2D06A 4A6PA 2B98A 3BXPA 4ALLA 3U44B 1V95A 1R0BA 4MGKR 1QYDA 2CL6X 3TO5A 2C3PA 3UV3A 2EGHA 3U7RA 3OFNA 4GPTA 2WICA 3WTCA 2A78A 1Z6AA 1K8XB 4JI2B 2IVZA 1JIKA 1FNDA 1Y8AA 3ADPA 4RE6A 1UKVY 2O06A 3PVCA 4RKQA 3URKA 4DCPA 1ACLA 2X19A 4G4SO 4ZQHA 3VKGA 3ZD7A 1CNEA 1OPXA 1NUSA 3ZDDA 1T8PA 1EDZA 4CKZA 1XMQB 1VJCA 3ONNA 5EIEA 3HB9A 3PGLA 5FBWB 3LG2A 5A5EA 2Q3EA 3QVTA 3JQ9A 1CEQA 2CZGA 3HDGA 4GGMX 2ZR9A 3PR3A 4GX0A 5ISMA 4CEJA 1AH2A 2FETA 2B9VA 1JDBC 1H65A 2V0CA 2ZT7A 3NH9A 1YXMA 1ZI9A 2R86A 2HRZA 3A05A 4XJSA 4L5CA 4TX1A 2QTVA 3WGLA 4AG6A 1R6DA 1AURA 3I9FA 4H6XA 4ENTA 3K70D 1VJTA 1MIOA 4KYUA 4C1BA 4ARIA 1X8LA 2WZBA 1DBVO 2FAXA 1A72A 3OC6A 4YXWD 2YASA 4CKEA 3PITA 3QTTA 3SK0A 4UM9B 1Q6ZA 3B89A 4BOYA 4EUHA 3F97A 1L7RA 3O4VA 2ZREA 5CB4F 3A3NA 3CLVA 3Q7QA 2Q5QA 1JXOA 3NTLA 3P1JA 3TZQA 1ZOPA 2YN2A 4UKDA 2PQ0A 4JQOA 4QUKA 1XDBA 5L7YA 1I4EB 2ZU0C 3TLAA 2JFZA 1JDZA 4AU1A 4BVJA 4E33A 1V11B 2PL1A 3SD7A 4ZHQF 2Q9CA 1FQOA 2QUKA 3PEVA 1JHPA 3G6KA 4ESVA 5BUSA 3KQQA 1NVFA 3PDIA 1R3UA 1PVOA 4MKXA 1J2YA 4A92A 2JKZA 3A3PA 5EP2A 2PUJA 2X5KO 5KX5F 5HJ5A 1WXWA 3H9UA 4DUZB 4BLTA 5D1HA 2VYQA 3B48A 1KH3A 4GX1A 3P2JA 3EF1A 1CUBA 3W5HA 4UULA 1E3TA 5JSZB 5FBRB 2BGKA 4H6PA 4Y6OA 2IF0A 3F47A 4EUFA 3CTMA 1QNLA 3KPVA 2VVTA 4J6FA 4M1MA 3WBKA 1P7YA 5SYMA 3PXAA 3UXMA 2WABA 4YQZA 3AEXA 4MWZA 3KQUA 1VGQA 1T9BA 3AVXA 2PRKA 4KXLA 1R50A 4PN3A 2UZAA 4GYYA 2Z6UA 5KYXA 2AUTA 2CXHA 2OSBA 4NV3A 4UTOA 2L19A 4XFKA 4MI3A 1PR0A 1C7QA 1E9CA 4LYFA 4DMKA 5AI0A 4UPDA 2BFBB 3ZNQA 4NPAA 5DOVA 1Z08A 5FKJA 5B2FA 1E59A 1B23P 2RC5A 1W44A 3UAYA 4G1UC 1G3MA 1KKMA 4IIJB 9MHTA 2TMGA 1BVRA 3GLHA 3IQZA 1T2CA 3K1JA 4JP1A 5C8DA 1IB6A 4J91A 5TR9A 3L5KA 5D7BA 1LX6A 2AHRA 3BN3A 4JJ6A 3OEED 3HCDA 2NNWB 2GH1A 3TZCA 4Y6RA 5FYQA 2QXTA 3MGAA 4CMCA 1IZZA 1AKWA 2DSTA 3RJTA 4M8NE 2B3DA 4EHKA 1YQUA 3SIXA 2BFAA 2MT9A 4QUDA 5DE3A 3RFFA 4L6IA 4M36A 2FGKA 2HA3A 4OP1A 4I5FA 1JQBA 1JNYA 4R68A 2GCIA 2X0EA 4X91A 1DG9A 1KBZA 1UK6A 5JROA 4IGKA 2VHJA 1KMQA 1VCMA 1SZDA 4EG4A 3SQMA 1YOBA 1E8DA 3CR8A 2XNJA 3ZQJA 1Z7YA 2GEUA 2CLSA 1T43A 3EF0A 2NU7B 2JVJA 4EA7A 3F73A 3Q2OA 1R8YA 3ROFA 4ZOCA 1NVBA 3D2BA 1KPGA 5KNBA 2OCKA 4BU0A 3RS2A 4WNAA 3LT5A 5EHNA 1BJTA 1F6DA 1YGPA 4L4UA 4O4IF 4QDTA 3DXZA 4UVIA 5JIBA 4YUXA 1XTQA 5CIYA 2HFJA 4J76A 4PG4A 1YE3A 5D3MB 1I94B 1VL5A 5E9JA 1ZMOA 1GSAA 2PO5A 1U4SA 5EESA 4P7JA 1KFBB 1NXQA 1I0IA 1QVVA 1S1MA 1T8SA 2BWJA 3LUAA 3EEBA 2WLSA 2FR8A 1EP1B 1OR8A 3E3AA 2R6R1 4LQDA 3VV3A 3D6HA 2P9EA 5A3VA 2JW5A 3KLOA 2WV9A 1UWKA 4DT1A 1YQQA 4ND5A 3A7DA 2ZAOA 4FI3F 5E6RA 5LZ9A 4HGRA 1XU7A 3QF7A 1CEYA 1ZHHA 1GPDG 1WSAA 2NT3A 3K72B 2OQRA 5BO5A 4YJ2A 1ZJJA 2OWEA 1XELA 3DMNA 2MWMA 3LWZA 3IQHX 2NADA 2ZUDA 5CURA 3PQ6A 2XRZA 1ZRNA 4MDEA 4OXQA 1LDNA 4NYJQ 2NVBA 2WWHA 2QRUA 2XE7A 3MBIA 2WP8J 3VU8A 4IEEA 4KQXA 2CNWA 4TKLA 1TM2A 3C8ZA 4HEA1 4PZ0A 2JLUA 3IQXA 3NMUF 2OQ2A 4ZWNA 3X1WA 1XXHE 2XVAA 4D79A 5C80A 1N77A 2P4HX 4EEKA 3OOSA 1G1AA 3UV7A 2J09A 2I4IA 4UNIA 4PGAA 2Q5LA 4OHVA 2WDPA 5L7WA 2ZB2A 3VZBA 1X1TA 3EQ2A 5CD1A 3KHSA 4FMDF 4IMRA 4W5WA 3MJ4A 3ASUA 1JPJA 2FZVA 4LZAA 3THOA 1B43A 4AG3A 1DWOA 3WLMA 5KMGA 2QTMA 2HK8A 4IWNA 5GOZA 3A4NA 4XD2A 4BO7A 1QQ5A 4D3ZA 1Z6GA 4PPYA 1XB2A 2JZNA 1ZW6A 4BO6A 1NFRA 3H4VA 3TW6A 2ROQA 3RRFA 1BA3A 4TWRA 3WLPA 3IXLA 2VRBA 1BVYF 3CLHA 5JAQA 1A8IA 1Y8QA 3DQPA 3UWDA 3WSTA 2YYZA 3DMDA 4PIVA 3RUDA 3PHBE 1PQ4A 1CUUA 4UHHA 5TPZA 3C1AA 2FZ4A 4NOMA 3H7IA 1FDUA 1I3LA 2YFQA 3GK3A 4KBFA 4I1SA 5DYWA 4JV5B 3GAMA 1XZLA 1ZINA 2ZBVA 5HIAA 2W4IA 1F51E 3TQHA 3DPSA 4AKTA 4G89A 3SEFA 1I5EA 4RD2A 1MNAA 1HLFA 3R3YA 4GZ6A 1ZXBA 4KL8S 4MVJF 2QBYB 1A1VA 1Q3KA 2HLPA 1ZUIA 2X2EA 3K5WA 4A73A 4RDHA 3SX4A 1UBTS 5SY9A 1WXIA 2G5PA 4X66B 4U0JA 4XR9A 5BWCA 4JLSA 4V0NA 2IYFA 3OT4A 3IELA 3K92A 3NETA 1KEEA 4H15A 4I5EA 2L18A 3KJHA 3O75A 5UKDA 1BN6A 1FYFA 3KT6A 4NBKA 4DLBA 4FGLA 4AJ1A 1YZLA 3B7GA 1NPDA 1ORRA 5CDHA 1EE2A 4KDEA 5D00A 2QPAA 4JT4A 4DW8A 3I9NA 3OIUA 1G8PA 3GCWA 2O1XA 4F5WA 1P3JA 2X8JA 4DR2B 4B8ZA 4BNDA 3TSCA 3Q41A 4U8HA 2CYBA 4KXXA 4BJHB 5JS7A 1IUOA 1PJBA 2E4VA 2AG8A 3JATB 4M1WA 4UEWA 2ZE8A 3L1VA 3L7MA 3D0QA 3B6ZA 3O95A 3PUIA 4L22A 4Q47A 3K9GA 3P97A 3CUKA 4QDKA 3O47A 4D4KA 3T15A 4IIXA 4DIDA 2GVDC 3QBTA 1AGRA 2OZLB 1Y4DE 1VKOA 4JMPA 1RFLA 4RLFA 4ZEOA 3JAMA 1V41E 2C95A 3AF1A 4BZQA 2BAGA 4C0KA 1XWFA 2JIDA 2F3RA 5DVZA 5BQ3A 4WBNB 3JYQA 1Z25A 4FLMA 1L1QA 3ICVA 3FJ1A 3QJYA 2O3TA 3VBEA 2AQHA 3N8KA 3OO0A 5AI5A 3RBXA 1Z4NA 4MS1A 1IQPA 2J87A 3X2FA 4OOEA 2JIQA 4RENA 2QX8A 5LNK6 1G20B 4A8JC 2HDHA 4NQRA 4BATA 5IJWA 1Z7BA 2ZEJA 3MAAC 5HVNA 1B0UA 3FRIA 4EYKA 3JR3A 1OV6A 3BDVA 3PC6A 4JT9A 5JNVA 1XRMA 3IEUA 4XLTA 1SXJA 3ROMA 1R8QA 2FPWA 4G84A 3VR5A 5CLFA 4B3IA 5CYOA 3R3WA 2GCNA 2Z5GA 2A9OA 1EQAA 3Q87B 4YJGB 5EWMB 3SBDA 1Z47A 2UAGA 4HTFA 3D8RA 5D86A 4AZVA 2IBSA 3RIMA 1P7VA 4ONEA 1P4HA 4NCXA 3IUQA 3P5BA 2PAAA 4A82A 5KREA 1JPUA 2PBLA 3WO0A 2EDCA 4D4LA 4CU5A 1PK9A 3KEQA 3MYRA 4ZXPA 5JMWA 1SC6A 2Q6OA 4CL2A 4BKUA 4J8PA 2PX3A 2A5JA 2QN7A 1JIXA 1GG9A 2CN1A 3V8EA 2K5UA 1SVNA 3RFXA 1CJCA 5J4YA 2WWVD 3DZJA 4EARA 1UIMA 4EO7A 1GCGA 3C41J 2IHVA 1XZEA 3IGFA 3BZWA 3DV2A 1MA0A 1M2HA 1ICIA 2NZWA 1MPXA 2WIKA 5JALA 2R3SA 2PR7A 4O59O 2HCJB 1CLUA 1JLRA 2XYQA 3Q2IA 2C83A 4OKSA 3RC1A 3CLKA 5GADl 2IWRA 1L7PA 1O77A 2PXXA 5F2KA 1QCYA 2H48A 2RAUA 2VNJA 4TS9A 4TTAA 2ZS7A 4ZK2A 4B7AA 1HRDA 3OHMA 3GT7A 3W0LB 4ZQFA 4NDAA 5AUNB 2O2JA 4HXGA 1RI3A 1XE3A 2GN4A 3WWZA 5AIBA 1F2UA 2QMEA 3L79A 5JJ5A 2HSDA 4ZVTA 1D2HA 4MHTA 1LDEA 4Q9NA 5C4IA 2V65A 4ZI3A 2QIOA 4XYLA 2RH5A 3K70C 1WSBA 4AJIA 2BELA 4XWTA 2W0SA 4IDDA 1AKVA 3WBFA 1Q2UA 1HEYA 1RKVA 1RLTA 1MAWA 3HP7A 4OHXA 3JZAA 5DCWA 3H99A 4FFNA 1ECCA 2J3IA 3EGXB 1L4NA 1FYDA 4EDHA 4S1NA 3AG6A 5EUBA 2AG5A 4P92A 1H2WA 1X1QA 4ETWA 4JS0A 2C97A 4IIVA 2WG0A 1PJCA 4DQVA 2PJUA 4TLAA 2ZM6B 3NNSA 3NGXA 3PENA 1Z6PA 4FE3A 4FEGA 1SQFA 4P93A 4V24A 4Z0HO 2EWWA 5ICGA 3ZVNA 1WKCA 1L6IA 4MV4A 1TM3E 4TS3A 3GW8A 1VHTA 1HQDA 4L28A 5CT9A 3PEFA 3QBJA 2GAJA 4KGXA 4QL3A 4UM9D 1SWWA 3VSDA 2PVSA 1B74A 4MVJI 2YR0A 4EMTA 1K8RA 3F7NA 4Z2AA 5LZ2A 2Y6VA 5A9SB 1UDCA 2UZ1A 5KHOC 1CUXA 1W9HA 1E4YA 1UOOA 2G5TA 2HRQA 3QVKA 1UC4B 4BIMA 4EFDA 2FUCA 2RGNC 2YFYA 2C9MA 1JSCA 1RTTA 2Q29A 2WNIA 1G5FA 2B8JA 2BZGA 3K1AB 3IERA 3O1JC 5DP1A 5DP2A 3WIOA 1ZVJA 3KU4A 3PT9A 4NOJA 1I7PA 1RMYA 4YT2A 1YMVA 3HZHA 3ZCVA 3X44A 1ZEMA 2FB9A 2A0KA 3QYFA 4FHCA 4CMHA 3ZDEA 4BNTA 1ISIA 2ERCA 3MS7A 4LNAA 4CG3A 1FUIA 1R37A 3A58B 1OSNA 4F4HA 5J58A 3CRQA 1KAMA 4LMRA 3KOYA 4YALA 2MYPA 3HVJA 3NAZA 4R40A 1ODLA 1KRHA 1P4GA 3HV0A 5JAMA 2DPHA 1SGWA 4Q4JA 4TMYA 5ALIA 1WQ1R 3ZLBA 1DO8A 1GN8A 5FA6A 4DUYB 2JIMA 1MTOA 1ZNXA 4YRQA 3MJFA 2A8YA 5L3RA 1A2OA 1AUVA 1HQKA 2NNLD 4G23A 4HX9A 4DJ5X 2XUFA 4G4IA 5BN3A 4M1OA 5AT1A 3SYLA 3G0GA 2ZRDA 3W4JA 4ZV7A 3VJRA 4HVCA 3PNPA 2C7BA 3PUVA 5ENDA 1DAFA 4RWEA 4EATA 5JW6A 3DDUA 3IT1A 2XI4A 3SHFA 2MSLA 5LYJA 1IN8A 1D4FA 4NNJA 2ANBA 3B6IA 1SCUA 1ORIA 2TS1A 1XXLA 4MXDA 2X7XA 3R8FA 1OZ0A 3ZXIA 3WP0A 2MSNA 4HEQA 4BMOB 1KFKB 1U0LA 2C7QA 1EEXB 3KDAA 2VBCA 1C7IA 1TFRA 1V2GA 2GBGA 3EHEA 3SNHA 1AHHA 2WTUA 2JIOA 4DLPA 1A0OA 4FW9A 1N2HA 4TL8A 1Z5GA 2P90A 2QQ0A 2WPDD 3RRJA 4DC9A 4U3JA 1MQAA 1ZXXA 1X7XB 4LY0A 1VGRA 1P2UA 3FDXA 4RZ2A 1F14A 1JBEA 4ZVLA 3RYHA 5F9HA 2UXBB 3SJAA 3RE1A 3FLBA 1NMXA 1E4EA 1SXQA 2D8MA 1R0SA 3Q98A 4PCUA 5BSWA 4DMRA 1I13A 1WNTA 5AI8A 2GWRA 3UJBA 4RHTA 3LQ2A 3SSOA 5EJFA 5DM60 2ZJ0A 5ICEA 5KQMA 4AY5A 1ADGA 1UP4A 3HJBA 3E70C 3VJLA 4D92A 1YU6A 1VLQA 1ZMTA 2DLNA 2Q8NA 1NYLA 3N7UA 3IO3A 5EKUA 1CR0A 5LB4A 4GECA 4L9SA 5A06A 4OY3A 2X4IA 1QQ7A 4QOFA 2QA5A 1QDLB 4NCBA 1WWKA 3HXTA 2WHRA 3TH5A 4MGHA 3K9HA 2V1UA 1TIBA 2R8YA 2H29A 1ENPA 2AFHB 4JT2A 2IUYA 4NBNA 2IS6A 2GEJA 3C7CB 4N3BA 4ATNA 2MSCB 1O96A 5BVGB 4RV5A 2W48A 3LL7A 1O8CA 4FOTA 1DB3A 2QGZA 4JOCA 4QXAA 5EVJA 2V7QA 4WK2B 4DQDA 1A9QA 1MX3A 5KNDA 3EOBI 5L7TA 4MUKA 2IW3A 4FC7A 3BD7A 2JJ1D 3NHFA 4RDXA 1AQJA 3BIJA 3RLFA 1S1CA 3WQRA 4K6GA 4PO8A 1UINA 3V7YA 2JL1A 1TVCA 3RREA 3THXB 2AZMA 2C57A 3BFVA 3F5SA 3G02A 4HC4A 1OH8A 5JEDA 1GEGA 1WCIB 2CMKA 1EQ2A 1GZHB 1U90A 1NVMB 1ODFA 2EFYA 4XA8A 4ZT4A 1DGQA 4JZKA 4GD3Q 4KH1A 2ILTA 1P7WA 5D7NA 5KCZA 1U80A 2N75A 3E0QA 2D7DA 1M0WA 2OZKA 1WM1A 3AZPA 1H2AS 5K3FB 2Y05A 3C14C 3CO0S 3ILHA 1CFJA 1SUBA 4Q05A 4NX2A 1E1CA 3DGFC 4PLWA 4CGZA 1VHWA 2BDEA 2IYTA 2ZUSA 5CJ2A 1LUAA 4Q1FA 3NVMB 4ZI5A 4AF8A 5ALVA 2EZ8A 5BSUA 3PXCX 3K1YA 2BMWA 2FDXA 1NZJA 2TMYA 3FSGD 3HGMA 5TGDA 5C31A 3TFOA 1J25A 2PMDA 3H04A 1DJOA 4TV8A 2Z83A 3P5SA 4PZDA 3SHQA 4WGFA 3RSQA 4CLRA 3EOZA 3CEAA 1T4CB 1N6IA 2PRJA 1PR3A 1E9EA 1CY1A 2HBRA 2VTKA 1S7GA 3CN7A 3GLRA 2GPNA 3O03A 4MKGA 4NE7A 5B1IA 1KJYA 4XPIB 3RQSA 5C8ZA 4LWOA 3TIFA 3HXKA 3WGKA 2G9VA 2EOAA 1NVGA 3G2KA 1Z56C 1ZFNA 1SN7A 1U65A 2IKQA 5EMNA 1HE2A 2BGNA 4OXRA 2P6MA 3EZ7A 3IMKA 3RC2A 4L95C 3X1XA 1WHTA 1ULAA 1G4AE 4HH1A 2OCAA 4P4SA 2P6RA 2O54A 1FXWA 1QFZA 2E48A 1PK7A 3WNBA 3ZBUA 2BJVA 1MW8X 3QXHA 4RQTA 2BEVA 2AG0A 1ZA2A 1XVIA 1JHRA 2HWYA 3KWJA 1EDBA 1TQDA 4GQIA 2XUPA 1A9ZA 3VJKA 1EFTA 2F67A 2I2XB 3K1ZA 3LYLA 1HFWA 3E5NA 3STXA 4BEJA 1C81A 2JARA 1E2GA 4EJMA 4X1OA 4O29A 5JWRA 1XZAA 1YZHA 2M6RA 3PLRA 3HS3A 4KZKA 1TK2A 5HQ3A 4G56A 1ZITA 2FPIA 3PZBA 1RNLA 3HXPA 5EJ8A 1T0PA 5TPWB 4UU0A 4NSNA 1YJ5A 3JD3A 1T0IA 2ZBEA 4Y6SA 5CTJA 4M8IA 2KM1A 2R66A 1IJBA 3V3KA 4YRLA 2EZUA 3ZGNA 1E3SA 2O7NA 1IONA 4J3FA 3GARA 4AD8A 1EGMB 1FDSA 1NIJA 1V6CA 4PRLA 3ZU6A 1IDN1 4U2BA 4C5AA 3H5IA 1AF4A 3NWOA 1FFXA 3FX2A 5BSKA 1JW9B 3FCCA 2HJVA 2CLFB 3H17A 3C1TA 3GGDA 3CKLA 4KPUA 4CMIB 4YQFA 1UEXC 2W93A 2VRWA 3QBVA 2LDBA 1PSZA 4K5QA 1ZD8A 3P9XA 1VG0B 4KV7A 4N01A 5AJUA 1C8LA 2AB0A 3GYGA 3TRIA 1YRBA 4Z54A 2VFAA 3QOWA 5E3JA 1PV2A 5IMBA 4ZZ3A 3U3MA 4IIGA 1TI7A 2PV7A 1QO7A 4K40A 4TYPA 4W82A 1K7XB 2HHCA 3QPCA 4C14A 2E4YA 1BXGB 2M6SA 2ISSD 4WCFB 3ESDA 4ZVQA 1E9FA 1SKMA 1XA3A 4EB6B 3D5EA 4DA8A 5IKEA 1RWWA 1Y9AA 2Q5OA 3DUWA 2BBWA 4P4NA 5DDIP 5TJHA 1DIOB 3KZKA 3TJZA 2I7VA 3HR8A 5JAHA 3M3DA 5CVDA 1W4ZA 3A4VA 1PT5A 4C4TA 3JALA 3MQ2A 4GVPA 2IIVA 4NFSA 3NKLA 3U62A 3QWAA 1QX3A 4U8GA 3A10A 1UBSB 5EGNA 2YVQA 4K9SA 3TOVA 1JE1A 4IJWA 3CUWA 2PWPA 1K7SN 2ZZNA 2DULA 4GOLD 1XMOB 3DEJA 1E60A 1BE6A 2AOUA 1MAUA 3TJRA 1OOEA 2P9TA 1M8PA 1NVUQ 1OI3A 1X94A 2AW5A 3CQ9A 1YO6A 3DYVA 2VZ8A 3JCZA 3ZHVA 3WZLA 4DLTA 3Q9SA 1ESCA 2P3LA 3DFFA 1RMQA 3FETA 2AF3C 1SQSA 3K0FB 4KQFA 4BB5A 2WTBA 1OF1A 2R6DA 3HJTA 5P8WA 4LC1A 4JI8B 4OH1A 3HNRA 5LU8A 3K8YA 5GJWC 3FOWA 2AX4A 3QTBA 5I9MA 4G37A 3OZCA 3PP8A 3M1AA 3R75A 5KSYA 1Z9BA 3LM8A 4UD6A 5CM9C 2WHPA 2YWFA 1QLWA 3ZWXA 3TBHA 1HNXB 3O9VA 4JU8A 2WC1A 5F51A 3ICQB 1T6BY 4HN2A 4YCNA 2NAFA 3M5DA 1E2MA 2OBYA 3MD0A 3OUTA 1N7HA 4MS3A 1X7GA 1ZOOA 4YJHB 4GYWA 1OTHA 1VYUA 4Z49A 3TLJA 5AVSA 4LXYA 3C3DA 4WESB 4E11A 1C8KA 3QHAA 5D2CA 1ZJ5A 2ZAIA 4PXSA 4LDNA 4CQLB 1MC1A 1Z39A 5BYAA 2HQ1A 1U8EA 1WY7A 2IYYA 1NN1A 1DFGA 1GU0A 1EFRA 2P9BA 2QUBA 2W37A 3GWGA 3H2HA 4P53A 3MTGA 4U02A 1ECLA 3H5TA 3HKBB 1P5FA 4KWCA 1ZMBA 2WHQA 5GJVC 3I2JA 4Q6BA 3ZZNA 3C3JA 5AW0A 3A4YA 4C7OB 4PIMA 2VT2A 1C8BA 4JVMA 4R69A 2H63A 1K4KA 4I7EA 4I9FA 2BTOA 2WZCA 1N2GA 2EJBA 5IK2A 1UQTA 1I6MA 5J9FA 3OT5A 5AKIA 1JFFB 1NATA 3EVAA 1AKYA 3I58A 4II3A 4DV1B 1K3TA 1EWYA 1L4KA 4EQ6A 4HGPA 1KOGA 2FUG1 4NBRA 3ELYA 2AOVA 5BSEA 2M98A 1CX9B 1JP7A 4H7EA 2R68A 2IS2A 1ZICA 4MEJA 4MV9A 3W3AD 4YN3A 5LQAA 3FDZB 2YY7A 2J7KA 4GGOA 4X6UA 1WS6A 1RJ9B 4LJ9A 2H2IA 5AO9A 5KNCA 3GZJA 1L5HB 2VTBA 4FFSA 4L85A 1QH9A 2CC2A 2BD0A 1Z0ZA 2OCLA 2ZBDA 4I3GA 3P0IA 4X71A 3IS3A 4TYNA 1UUFA 1AQLA 4TQGA 1WPQA 1Q1BA 2P9JA 2O8FB 1QAOA 3IXQA 4GDMA 4JEIA 4GKAA 4YUYA 3ETDA 2ZJFA 1WHSA 1ZN7A 4ASUD 4FFBB 3WGTA 3CRVA 2ZS8A 5HK8A 4EVIA 1GXSA 3G2QA 4EPWA 2PE5A 3W3ZB 2G1UA 4G8JA 4Y9SA 1XVUA 3D6JA 5EOVA 2OKCA 3C5HA 2CF5A 2QDXA 1F0NA 4ND7A 4I6JA 1RCTE 3DYBA 3ULKA 3TOZA 4D56A 5C5EA 2D62A 4X7MA 1DCTA 1F9AA 2AMFA 1XEWY 1WE2A 4BN4A 4I14A 4YMLA 2EXXA 2F3TA 3A0RB 3INYA 4HYEA 1VIDA 5DI3A 3BWEA 3ZTYA 4QGSA 1E7WA 3L8MA 2CDNA 4PLHA 4EENA 2W2KB 3CGWA 3G0CA 7AT1A 3A2LA 3IDSA 2EFGA 2VATA 4HB2A 1HWYA 3KUKA 4KQCA 3MB5A 1ZGHA 1M0SA 1EINA 1U2PA 4LECA 1L5FA 2BUAA 3GUCA 3MELA 3WMEA 1KJQA 4AIIA 2DHCA 4QM7A 3IURA 4R41A 2QZ4A 4ICIA 5ECDA 1PJRA 3RC9A 1F48A 1IBRA 2QV7A 4GKVA 3ZDYB 3IEXA 2PMEA 2ODEA 1EUZA 3PGMA 4MO2A 3RPEA 3OE7D 1MX9A 1UBNA 4H7KA 4MQ4A 4BVKA 4M1QA 3AL0C 4RK6A 3BTSA 4EG7A 2V5VA 1KIMA 3GEMA 1ZL2A 4WH0A 3OFSA 3WWCA 1AGYA 1SH7A 1TZCA 2FN7A 2HF8A 5ILQA 4ARUA 1EG7A 5F1OA 2WF6A 1RYHA 2C88A 3U80A 2ZTLA 1L7QA 1MLDA 5JDIC 3DLTA 3UH0A 3MJDA 2PFGA 2BUCA 1PUXA 2WDZA 2YXPX 3VU0A 4FNGA 9ABPA 1SC1A 3E4DA 1MJFA 5TQVA 4WOBA 4F91B 1BOOA 4QGAA 2K4MA 1S2OA 1LK7A 5JVDB 4KWHA 2HFKA 2ZIFA 1KR2A 1M1YB 1W73A 1P8AA 2FDRA 1PFQA 3KAQA 4BLRA 4TLMB 4FINA 3BIFA 4AVYA 1B8OA 4Z53A 2P6UA 2P8JA 2H16A 2AYYA 3E1GA 4JYPA 4KMOA 2Q27A 2IIPA 2YYSA 4HN4B 3ZGVA 4UOZA 2RKWA 1NU8A 1I4DD 3IAHA 4G5QA 1K97A 5FNVF 4WEOA 3AVVA 1GUYA 3K31A 1QGZA 2HT6A 5GZ6A 1EJ0A 3GQBA 3K4QA 3RS5A 4YRGA 5KOIA 4MWBA 4OHOA 4BUCA 1UDBA 2H65A 4QYSA 1J2RA 2ZBFA 1EZZA 2FXVA 3HHEA 3IBTA 3BE6A 3KTFA 5GV7A 3VGJA 2XWBF 5K05A 3EFBA 4O4LA 1GFZA 2CFOA 3OKAA 2WSIA 4OEHA 5LC1A 2PLFA 4NJEA 3GLIA 3VAAA 2MHCA 4QYMA 5TEVA 2FJUA 1ZISA 4O2LA 4UASA 4AULA 1AV7A 3W4KA 4D42A 4Z4QA 3QLEA 3WQQA 4WKBA 2QZPA 4CIBA 4DKJA 4G5FA 3LQQA 4CEJB 4U9HS 1IN4A 3H65A 1V8PA 3I5XA 1RZUA 5A62A 1F2DA 1UP7A 1E2KA 2PM8A 3F9CA 2EF1A 1G55A 1FYVA 3U7GA 1MIOB 3T7TA 3L9XA 3EE6A 3QKRA 2CW5A 1Q15A 4Y18A 3OQPA 4DC0A 4G5RA 5LFAA 5TQJA 2D1FA 4MYUA 3TSYA 4KJXA 2I54A 1YRAA 4G0UA 5J5AA 2KPOA 3JVDA 1NXVA 5IABA 4ZCQA 4DABA 5B64A 2ZUEA 1IZ9A 1TVKA 1XPJA 2BF4A 2C5AA 2D2IA 1SFRA 2BY4A 1X77A 4LRUA 4ZVUA 1FFBA 1X1RA 4X60A 3N28A 1PBNA 3LJKA 4MWSA 4UHKA 3KB8A 5BSMA 3UIEA 2B20A 3VA7A 2XNDD 1CUJA 3RD5A 3UOAB 5C5DA 2QJOA 1GZVA 1M2NA 1QGOA 3NU1A 4XM2A 1F8UA 2Q1XA 3ONVA 4EGQA 1RWOA 1KP2A 4NCNA 2PGXA 3NWBA 1QHEA 1XVTA 4YRPA 4EABA 2YX1A 3QPAA 4CM1A 1S3SA 1RC8A 3ZU3A 1OGIA 2IV2X 2VT7A 4B46A 3TTUA 3PDIB 2AZXA 2QUJA 3HFRA 5KQGA 2R6JA 3GA5A 1C3JA 3HJRA 4PPGA 3MUOA 2CVHA 1PD0A 5IAOA 1OLXB 2YFKA 1PR5A 5CDFE 1UAGA 5IBCA 2PGDA 1YAJA 2O3UA 3SEZA 1J49A 1ZMRA 4IOMA 3SZMA 1A4XA 4RGYA 2ECQA 2P2CA 3F6CA 3HVUA 3GEGA 3IBCA 3PUKA 3Q7IA 4PC2A 3EJ6A 3NBYC 4R8LA 5CFLA 3MPOA 1AN9A 2HJ9A 3ELDA 1CDZA 3KUXA 4KQMA 2HJSA 4YAOA 4UDYX 5ALTA 4WVFA 4ZCTA 5ADWA 1DTWA 3B6KA 8MHTA 1W4CA 2A58A 4TV9F 1ZU5A 4LF5B 3FJOA 2F3PA 2Z2IA 2R2AA 1BH2A 5EJEA 3DT6A 1W6RA 1ZM3A 1NGSA 2OGWA 3A9WA 1MHPA 1OIVA 2NZYA