1U1DA

Structure of e. coli uridine phosphorylase complexed to 5-(phenylthio)acyclouridine (ptau)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
253
structure length
253
Chain Sequence
b'MSKSDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
molecule tags Transferase
source organism Escherichia coli
publication title Structural basis for inhibition of Escherichia coli uridine phosphorylase by 5-substituted acyclouridines.
pubmed doi rcsb
total genus 86
structure length 253
sequence length 253
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1u1dA00
1V45E 5F7ZA 1SJ9A 3NM5A 1JE0A 1ULAA 5F77A 2AI2A 1RXCA 1T8SA 3P0EA 3NM4A 1YBFA 1JPVA 4GLJA 5CCEA 3KU4A 4GLFA 1JDUA 1RCTE 4GMHA 3INYA 4JWTA 3O6VA 1RXYA 1LX7A 1T8RA 1V2HE 4EB8A 5F7OA 1VHJA 3E0QA 5B7GA 4D8XA 1PR2A 5IU6A 3FAZA 4WKBA 1OU4A 1QE5A 1PKEA 5EFOA 1U1FA 1CB0A 4DAEA 5C80A 4DA8A 2QDKA 2XRFA 2BSXA 3EUFA 1K9SA 4I2VA 4G41A 4JP5A 2I4TA 1RR6A 1Y1TA 1TGVA 4MCIA 1PR1A 4OY3A 1ULBA 1NW4A 4OJTA 4P54A 1U1GA 1T0UA 4L5CA 4TTJA 3QPBA 3DJFA 4OGLA 4QAQA 1LVUA 1JDTA 2OC9A 3OPVA 4QFBA 3PNSA 4D9HA 2A0XA 1VHWA 4R2WA 1NC3A 2B94A 2I8AA 5CYGA 3MMSA 3FB1A 3OOHA 1G2OA 1T8YA 4M7WA 1Y1RA 3PHBE 3PHCA 4QATA 2OC4A 5F73A 2AC7A 4M3NA 4KN5A 4TTAA 4TXLA 1B8OA 2QSUA 3KVRA 1XE3A 2QTGA 1U1CA 2ISCA 3FOWA 5CYFA 5DK6A 1YRYE 1Y1QA 1NC1A 2RJ3A 3F8WA 1V4NA 3BSFA 3FUCA 1Z36A 1A9OA 1PR6A 1U1EA 4YNBA 3KUKA 4TXHA 1LV8A 4R31A 2GUWA 4MCHA 5CXSA 1K27A 4PR3A 1ODLA 1RYZA 1JDZA 4TXJA 3LGSA 4JOSA 2OXFA 1Z39A 1JYSA 1PK7A 1N3IA 1Z33A 4E1VA 1FXUA 4R2XA 4TXNA 3PNPA 1TGYA 1PW7A 4H1TA 2QTTA 4YJKA 3UAWA 4BN0A 1ODJA 1ECPA 3KHSA 1B8NA 1TD1A 4NY1A 3K8OE 2A0WA 5B7NA 4L6IA 1I80A 1A69A 1Z5PA 1OUMA 5K1ZA 3BGSA 1VFNA 4K6OA 3O4VA 4OGKA 3ODGA 4PNPA 3E9RA 1TCUA 5JPCA 1Z5NA 3GGSA 3OCCA 1TCVA 3ONVA 3KVVA 4L0MA 5F7XA 4TTIA 3DF9A 3OZDA 3U40A 3TL6A 4FFSA 4QARA 1OTYA 4G8JA 2H8GA 4LNHA 5EPUA 4F1WA 3FNQA 3DDOA 4DA6A 4DANA 3UAZA 5ETJA 3OF3A 4L5YA 4UC0A 1RXUA 1PR0A 1A9PA 2IQ5A 4WKCA 1SD1A 1PBNA 4GKAA 1M73E 1OTXA 5CXQA 1ODKA 4DARA 5EUBA 3EEIA 5FAKA 5F76A 1RT9A 1Q1GA 3FWPA 3OOEA 1V3QE 2Q7OE 3KVYA 5CCDA 1RXSA 3NM6B 2A8YA 1T8WA 4G89A 1YQUA 4F3KA 1ODIA 3EMVA 4F2PA 1A9TA 4DA7A 4F3CA 4EARA 4D98A 4TYMA 1Z34A 4OF4A 1JDSA 4RJ2A 4U2KA 4YO8A 1OVGA 3E9ZA 1WTAA 1A9QA 5F78A 2HSWA 3OZEA 4WKNA 2AI3A 3MB8A 4L5AA 3DPSA 2HRDA 3EUEA 1SQ6A 1YR3A 4LZWA 1C3XA 3BJEA 3UAVA 2QPLA 1RSZA 3NBQA 3IOMA 4ECEA 1Z38A 4IP0A 3UAYA 2P4SA 2PGAA 1Y1SA 1JDVA 5IFKA 2HWUA 3IEXA 3DP9A 4WKPA 4X24A 1A9SA 1PK9A 1PF7E 4BMXA 4MARA 1ZL2A 5KB3A 3OZBA 4D8VA 1ZOSA 4D8YA 1A9RA 3C74A 1V48A 4LDNA 3GB9A 3D1VA 5I3CA 4DAOA 1Z5OA 5B7QA 3P0FA 1PWYE 4WKOA 4NS1A 4DABA 1SD2A 5B7PA 1Y6RA 3OZCA 4QASA 4TS3A 3K8QA 3UT6A 1Z35A 4M1EA 3T94A 2ON6A 1Y6QA 4DA0A 5F7JA 1CG6A 1RFGE 1U1DA 4TS9A 1V41E 1VMKA 3BL6A 1YQQA 1K3FA 4QEZA 3UAXA 3ENZA 1PR5A 4YMLA 4LKRA 3LBAA 1Z37A 4OEHA 1JE1A 2HN9A 1PR4A 1OV6A 1JP7A 4BMYA 2AI1A 4LNAA 3LA8A 4NSNA 4F2WA 4TXMA 3SCZA 2OECA 4BMZA 2A0YA
chains in the Genus database with same CATH superfamily
2F3UA 2P9TA 4YAUA 4EY6A 2C0QA 4GPEA 4Y1FA 1LBHA 4PCVA 2XRZA 3V5NA 1KKUA 2Q45A 3KK0A 2QMEA 4GW3A 3DZHA 3VISA 4RX1A 1B93A 4BFSA 2IHVA 2G4LA 1Y81A 3EVDA 4LXYA 3GF4A 1YBHA 3GLIA 4E2YA 3DOHA 4KWHA 4Z4IA 2AJ8A 2EFGA 1RVV1 1TVEA 3GVCA 5AUQA 1P39A 3OP4A 3QK7A 4QOFA 5D3MB 4JMPA 5DSZA 4YXWA 1RBZA 3JQGA 1QLJA 5CAEB 3V3KA 3W06A 1JXQA 4JXXA 2H59A 1RRPA 3C3CA 3BH6A 1P9WA 3L7DA 3NGXA 4OQFA 4W5WA 1NJGA 5A6SB 1XDBA 1T8RA 1TF5A 1XRJA 2H92A 3A4VA 3LPCA 4PAWA 4HDCA 4EM6A 5A71A 2OAQ1 2XZOA 4OJYA 3T1NA 2PNJA 3E0QA 3RT9A 1L5RA 1CEQA 1AKRA 4Z9FA 1QYXA 5E9AA 3RRFA 1MMFB 2X2EA 1QVWA 2HMUA 3ORHA 1A76A 1TF2A 4O4LB 3OKCA 3K70C 4F9GA 1KDPA 1XXHE 2Q6KA 3WXBA 4CM8B 3JQ7B 4G84A 1PEDA 2E1PA 4ZEOA 3R9WA 4GICA 4MR7B 3PFNA 3AI2A 1H2RS 2X86A 2FW9A 2NU8B 2HXYA 2JGDB 3E8XA 2A57A 3TLYA 3W2FA 4BMNA 2PRKA 4G8DA 1CQJB 3MHTA 2N1BA 1JBQA 3DE7X 4JFRA 4R9SA 4S12A 3UW1A 3QEBZ 1ZUD1 2JFBA 2JI4A 3FUVA 3GJZA 2GRJA 4UHKA 2HF9A 4MW7A 2ZT8A 3U44A 1TO6A 2IPNA 4BO7A 5K0FA 3QMPA 3PKIA 2C98A 3SKVA 3TQOA 4F5EA 4I4CA 4JZYA 1XMOB 1H6BA 1PUXA 2GF9A 3G5LA 1V8BA 4BNGA 3R3XA 5AM3A 2V9PA 1CQZA 4FDLA 3HY6A 3ADPA 1SXPA 1YAHA 2YRWA 1N2HA 2YIDA 3A27A 3LVBA 5IMBA 2GBLA 3B3GA 3ZYZA 5BQFA 4HBZA 1U7HA 1ZK3A 3IEKA 2VF2A 4TLMB 5K0JA 1CUBA 5DT9A 5AUNB 2YZ2A 4OHMA 3DTVB 2B9EA 2Q1SA 2EP7A 4FKMA 5AKXA 4QAQA 5BSTA 6Q21A 4RIHA 3L43A 2YMLA 1FQJA 3I9LA 4XH9B 4A8JB 4PNEA 4KGVA 4XWKA 4ID9A 1Y33E 2WA1A 2PMCA 3OLXA 2O8FB 1SCQA 1WF6A 3KD2A 5IP5A 1P1CA 3INNA 5JAUA 3WV5A 1T2VA 4C2BA 1HOXA 1MZPA 4JQCA 1TC1A 3PUKA 4PN7A 4C0LA 1G20E 3TSCA 4HQ0A 3W8NA 2Z8YM 2EXXA 2BMWA 3EEBA 1YONA 2XA1A 2QW0X 2PDAA 2A1UA 2XYGA 2OCKA 1M0EA 4A82A 4YLEA 2C7VA 3B9PA 5BT9A 3SZ3A 1RAGA 2Y1DA 4DRZA 5KDDA 4E2ZA 2FRVA 3VDXA 4XB2A 4OJKA 3ZV4A 1HV8A 1VPTA 3BGWA 1A72A 1FRVA 1OZAA 3CY6A 3K05A 3WGTA 1XZLA 2F59A 2EF0A 3KOUA 3WICA 3KZ1E 4HEA1 4NNPA 2FPLA 2RHLA 2XB4A 2B4AA 2YN0A 3IOCA 4DMUB 1VSTA 4MTLA 3SJUA 4TQAA 2WQ6A 4GDFA 4PAQA 5CVEA 5EIOA 2C31A 1JLLA 2KYRA 1FMFA 3KSBC 1GADO 3ILYA 5TR9A 1BTOA 4F46A 1F8XA 1XNHA 2G9UA 3TR5A 4ZDJA 2VYVA 1XL1A 3PQ2A 4L15A 3WGLA 1MO5A 1FUIA 4F3YA 1JB1A 3KXIA 4FI3C 4I4LA 4MITA 4LGYA 1JFTA 4OREX 5HZMA 2JCGA 4FYKA 3WL5A 4A0RA 4OA8A 2XW6A 3WNZA 1VCMA 4GZ5A 5C8DA 4PZCA 1WDKA 3MINB 5CLQA 4C08A 5IDYA 4HWRA 3CVVA 4J49A 1LX6A 2A3NA 3OFKA 4LDRA 4RVCA 2QPAA 2ZU6A 4OLFA 3TSZA 4A2WA 4P98A 4W1RA 4DGQA 4YLGA 4UOQA 2QXUA 3VSBA 1L5SA 1YRHA 1MG0A 3UPTA 4HADA 3KUKA 1OWLA 1RPNA 2L42A 3ANLA 1KP3A 3IMCA 1J8FA 4US0R 4R2HA 3DZGA 4GBMA 2W6JA 2XYVA 1D6NA 1NAIA 4MNTA 2E5LB 5I7UA 4BB6A 3EQ9A 4RD0A 2PJRA 3MMXA 1FNSA 3FZYA 3ESQA 2BGJA 1RYZA 3GUYA 4MW2A 4C7MA 2B8NA 5TT0A 1O6FA 3MHPA 4G0QA 1E1QD 1JR3E 4G4SP 4JDPA 4X8OA 2Q8QA 1ISRA 5GZ3A 2QG4A 4MUGA 2VWQA 1KAEA 1ZXXA 4QZVA 1XXHA 1PQWA 1VG8A 1U9JA 5B1IA 2ODNA 1DL5A 5CA1A 3RS2A 3IH5A 1F2UA 5M34A 2WFAA 2GEDA 1QSGA 5G0SA 1XTQA 1F6BA 2X58A 4B71A 5DM1A 2VDMB 4Z3KA 3AMVA 1YE5A 3GEMA 2VCEA 1V26A 1OBFO 3CBQA 1FFYA 3ZD9A 2P1DA 4FZ3A 2NP6A 1U0OC 2FK8A 3RUAA 4N7BA 3LLUA 5J2UA 3VC7A 4B7ZA 4N7MA 4D56A 2YWEA 2DHQA 1ZUHA 1RHJA 4D4KA 3N2NA 4B4OA 2XMDA 1C9YA 4R1SA 3DNFA 1JU4A 1E6KA 1YR1A 2BJWA 3GIWA 2A5DA 4PG6A 4UDXX 1VIVA 3OA0A 1QOZA 2WVJA 4CKCA 4UVHA 1OWNA 1WUJS 5J23A 3DB2A 5AM5A 1EVJA 5K3EA 3FKJA 4CL3A 4KLNA 4NE7A 3C85A 2QLBA 1DHTA 5IJ9A 4O2LA 7YASA 3NHAA 2E37A 3DXZA 4X7RA 4WUVA 1J6UA 3TCNA 5M7EA 1N7IA 1AG9A 4F72A 1KO8A 3E3MA 2R8EA 1YCDA 3D6AA 2F9MA 1T29A 5FBLB 4FE4A 3GLGB 1P7WA 1TMGE 1G8GA 2RGUA 3KWLA 2P62A 2AZTA 2H17A 4YJ3F 4FWIB 4N9WA 5ER6A 1EGMB 4XD7A 3A04A 2UYQA 3AR4A 2ZRLA 3HJAA 3I9OA 4LTDA 1LU9A 1PS9A 2WWTA 4OIMA 3WQBA 1CEYA 3JZMA 1FYVA 3DULA 3MINA 1M9NA 1YZFA 3U40A 1WXIA 4QDXA 4RVUA 4DIFA 1PZNA 3D7KA 4UBOA 5JJ5A 3AGPA 5BN1A 1G8JA 4MWBA 2I4RA 4TZ6A 5F35A 2RJOA 3K92A 1NXOA 1KAMA 4YY3B 5E1DA 1Y4AE 3FKQA 1E4EA 4HMQA 2BGUA 1E2PA 2QUJA 3PT5A 3TYXA 4F1WA 3B1KA 1O5OA 2FCRA 2ZRFA 3DOJA 4E5SA 1O94D 2A92A 2VBIA 3DNMA 2Y27A 3AC0A 1JKMA 4KOAA 3STYA 5FUBA 3IAM6 1ISHA 3SYNA 4BGIA 1E5LA 2Y1OA 1DU4A 1TI7A 4HX2A 3SIWA 3MGGA 5KWVA 4NATA 1UOPA 4YV7A 1Q2UA 3ZLTA 3G0IA 1O58A 4DV0B 1XKLA 1YB1A 3JQ8A 1A9PA 1ORIA 4JJ7A 1WP4A 1NRWA 1BOFA 2ZKIA 2G88A 3N2YA 4GKKB 3DWGA 2ZWOA 1RWMA 4PBRA 1U90A 2W6ZA 2X9NA 3PVZA 3RF7A 1D2NA 2D54A 5EQFA 4RKYA 1NMEA 1TZKA 4UM8B 1TO1E 3LOQA 2YIMA 3QPDA 3N6XA 3A14A 2UUCB 5LKRA 5G4KB 3CGWA 4OQQA 3ZJYA 3L5OA 3TKLA 5BUSA 2H65A 2VPYA 1Q1EA 1CR6A 2Q7OE 3B82A 3AR7A 2IV3A 4M1TA 4PQFA 2EATA 2W37A 1L4EA 5FI1B 1PQ4A 3VSAA 1S2DA 3RTBA 2B1JA 2L0XA 4D80A 1HFKA 4TMTA 1WMBA 4WK2B 1NN3A 3KKMA 5JE8A 1BKSB 5JATA 3ZGLA 3VTZA 1ZJZA 1UK6A 4M8LA 3RC7A 3QYFA 3LUBA 1Y7TA 4NDZA 1UAGA 1KPHA 4Q3AA 2JAWA 3M1AA 2BGLA 4XYEA 5IW8A 1IFXA 3EX7C 1QJ4A 4GFDA 5GINE 3HBLA 4OFZA 2I80A 4XWWA 4O5AA 5I7SA 1F0PA 1N7HA 1RYBA 2FW0A 1QX4A 4AJ1A 1P91A 1UFKA 2H2AA 1RJEA 3H1AA 4ETNA 1WW3A 4PC2A 4XI9A 4IQFA 2VNSA 3UUEA 2PZMA 1IEVA 3E9ZA 3GA0A 4JYBA 3WLHA 1LSSA 4EEKA 5ICMA 2H4WA 3E1GA 3RNOA 1F2TB 1OBCA 2NTNA 3IP9A 3OZEA 4IG9A 3S40A 4ZI7F 5HQ3B 1RXVA 2D06A 4IRUB 1ZY2A 3LQFA 4L5AA 4MV7A 3VU1A 1DXHA 4OVKA 1CRLA 5ALVA 1JH9A 1HNWB 2HK8A 4HDKB 1G9XA 1GR0A 2WC1A 3D02A 1O97D 1EZ4A 3RVKA 1Q11A 2NYVA 1ZJ6A 1T5IA 5IYZB 2C9YA 1XHLA 1EKXA 1PW5A 4AJLA 5C4IA 5I8PA 1UWLA 3GFQA 3S2UA 5H3HA 3QVUA 3ZGZA 3BN3A 2YWDA 3I45A 4I3HA 3IXLA 1P45A 2HF8A 3WZ2A 3CURA 5B1YA 4UQLA 2GBPA 3EVEA 3S1SA 2P6UA 4EKEA 5IS2A 1XZFA 1OAAA 1C7ZA 1P2SA 2O48X 4ECEA 4CKZA 1IUKA 4B0PA 2X13A 1PT6A 4KO3S 5ALNA 1Z38A 4FN5A 4HDAA 1FSFA 4P4GA 4ZVNA 4HN2A 5D7BA 1RMYA 2FAXA 1E3MA 3VPDA 2C3UA 3OZRA 3P2EA 2O5EA 1ZGZA 3NIDB 1W88A 2GBIA 2NPOA 3A11A 4BNMA 2H7XA 1KDVA 4QWWA 4DCOA 2PX4A 4E15A 3OJFA 5U9CA 1NNEA 1J0XO 4A7PA 1PZFA 4CN9A 2FPIA 4BUJA 3G9TA 1B74A 1YVUA 1WZNA 3TLZA 4CNQA 3HJUA 3C5VA 4TYNA 2OPBA 3BWDD 4Q00A 3TZCA 3GV0A 1R5BA 2WIBA 1G5IA 4PYMA 1VLVA 3I6QA 4G4JA 1JR3D 1TC2A 2W4QA 2QYSA 3JYPA 3AHCA 3O1LA 4QBTA 2B83A 2NU7B 1CC1S 3OIDA 3CJRA 1PFUA 4ANFA 1Q0QA 1CY4A 4Y1RA 3VOBA 3AOEC 4OTZA 4YRGA 2SNIE 4JI0B 5G1OA 4F97A 1N6IA 3O94A 2ATVA 3HU1A 2Y0PA 3W7BA 2F2TA 2X42A 1W2WB 3N2GB 5EI5A 2YRFA 1QIIA 3FD8A 4MVJM 3UOGA 4EVRA 1RQ7A 4RUKA 4JLOA 3UXYA 2Q7XA 2B3TA 1V96A 3QKRB 2G3YA 3UUFA 2VWHA 4OBEA 1DBVO 3KDAA 3OEHD 3C8DA 4J7UA 1OXMA 2RI6A 3DTNA 2ESRA 5EP4A 3AFNA 3Q88A 3SS8A 4HNGA 3AP1A 4EVSA 4G5HA 5B3KA 2XUGA 3FZQA 5A3RA 1EVQA 4PHCA 5C5IA 3AILA 2NSJA 4P83A 2PKWA 4TTQA 4MUNA 3KHKA 2NO9A 4AYWA 4U6NA 4GXTA 5CYOA 2VJKA 5E2IA 7MHTA 5DH9A 4M6WA 3N8IA 2OORC 3P4UA 5HKAA 4RNDB 4PN3A 1GL6A 1VHTA 3NXSA 4DWVA 1QG4A 5DNCA 1HT0A 1QRRA 4DIKA 2X1VA 2Z2KA 5KU7A 4TN5A 1XKQA 1JJVA 4QUJA 3KLOA 3TLJA 2GPWA 5C34B 4TWZA 5IYZA 1K7FB 1WZUA 4YRBA 1TOAA 2PK3A 1BDIA 4P34A 3L49A 3QE9Y 1XMSA 4A0HA 2TSYB 1KO1A 3M33A 4IW3B 4BGVA 3KQKA 1P8AA 2HMAA 1WMDA 2ZQYA 4RK1A 4CEIB 1OSNA 2C29D 3Q7EA 2VJPA 3Q9UA 4HFMA 5A3SA 4DGSA 3U4MA 3HFRA 4NV3A 3ECCA 5C1BA 1QQAA 3WGKA 3ED5A 3QKRA 1DWPA 1E1NA 3CNBA 2WSLA 3O4IA 1MGOA 2AHOA 3DZIA 3MTQA 1D2RA 3QNWA 4RE6A 3PGXA 1OYWA 5IVIA 2EU8A 4YMLA 4WXEA 1C9JA 4U9UA 2HXSA 3HWSA 1RBYA 5KTNA 1T0IA 4QD3A 1E2LA 2ZUWA 1FQOA 2PKXA 1XALA 2QL7A 3OX1A 2X0DA 3HKEB 2EZUA 5J2TF 4LRXA 4C0SA 1EFUA 1EE1A 1ZM4A 2BVNA 5C8YB 1HMPA 3F9IA 4AIRA 5DJ5A 5CA1F 1RMTA 3DZFA 4ZAFA 1E96A 4ASUA 2A30A 3NDJA 4D4LA 3WL8A 2RI1A 4FVTA 5KJEA 2E7ZA 3U3DA 2BR5A 1PR4A 3MWDB 2VPXA 2HK7A 3ENVA 2WHRA 3LT1A 5CITA 4OXXA 1Z8FA 3T5PA 1ONNA 1H8HA 1Y6FA 2G0NA 4RIEA 1WV1A 2FSSA 2UZIR 4MWSA 4D5GA 4MDFA 1OH7A 4H1VA 3VUFA 4IJVA 4DQ0A 4UNPA 5LLTA 5F1PA 5EEGA 1M2HA 4K8RB 2WF9A 1BW9A 3AETA 4FP9A 3UCFA 4BQOA 1J99A 1JMKC 1BE8A 1Q1AA 1YK0A 2AB0A 2FZEA 1BG6A 4OUDA 4J16C 4QBHA 4NH0A 5KREA 1ZHOA 4US2R 1VRCA 3NHRA 2VDQB 3WHKA 3K9BA 3G2HA 3I2GA 1DIOB 2CCKA 2NVUB 4DLKA 4EPVA 4BNIA 1P1RA 5KWEA 1QZZA 3AEYA 3EZ2A 2AIRA 4BJ1A 4PHGA 2XTAA 4D9CA 3JATA 1OPRA 1JEEA 3CLSD 3ZS9A 4ZO6A 4G5QA 4CGYA 2DOKA 2NNWB 4OK5A 1TW3A 1LLUA 1VCHA 1SELA 2OHFA 3L46A 4WK0B 4BLTA 1Q0LA 2BKXA 4EW6A 3PQCA 3NRJA 3A06A 3SSOA 2DECA 4U7GA 1ZI8A 1XB2A 3THWA 3OQOA 2IGTA 3UF0A 3NEJA 4FOLA 4GLJA 4RHFA 4NBTA 2BTOA 2HY7A 1C8LA 1KYYA 1NBME 1YKFA 2GD2A 4AWBA 2YJ6A 5FF9A 5L53A 5BOSA 1VI6A 3RIGA 4RGVA 4F11A 1W581 3DAPA 2GT1A 1FMCA 5EHXA 1O0BA 2H1OA 2HTEA 3M81A 2RHTA 3WAKA 3RS8A 4JIGA 2GEFA 2R1ZA 2VK1A 2XAUA 4XA8A 2WG0A 5I01A 4GZ3A 1EHCA 3RTEA 4HAUA 2H0RA 1QNFA 2FG6C 4KI0A 1GN8A 2WM2A 2CE2X 2QDKA 3U5ZB 3WDKA 4N6GA 5IJ0A 3EUAA 4PVDA 4EUFA 4EVQA 2FOXA 3JPWA 4G41A 4TS4A 4C7JA 3IS3A 3VA7A 4BXOB 3V8QA 2PUGA 2DWCA 3AKCA 1RR6A 2QYTA 1J2YA 1TGVA 1J0DA 3R24A 1XEXA 2D4AA 3QIAA 5KU1A 3TG2A 1BE6A 3L2OB 4BS9A 4L8GA 2WTBA 3H1BA 2OHXA 2M6LA 5JOQA 1NKSA 5KQSA 4B6RA 3RE1A 5JVDB 4N12A 2VSNA 4Y2GA 5EJ9A 4AY2A 4L6CA 1VL6A 2WYIA 1FNNA 4UTRA 4MJXA 4XB1A 3SHOA 2QV0A 2WE8A 1K89A 1QB7A 2E4UA 3G82C 4KVGA 3T7AA 1G6KA 3E05A 5AW1A 5I9SA 4ARZA 1PGPA 3AFOA 4OQZA 3UW3A 4BB0A 1Y7HA 4IXDA 4N8DA 5TY0A 1VZ3A 2XB2A 4Q4JB 4JJ4A 4P5DA 1CUVA 4KLCA 5IAJA 5LQJA 2QLTA 4HAWA 2NYAA 2NUAA 5ITWA 2OKCA 4YJ2A 3K6SA 1FU4A 5J4KA 1JL3A 1KBQA 2ZRPA 1T9GR 4V24A 3RJTA 3V1NA 1E92A 3DXYA 5IVPA 4PC3A 3IJPA 3OO1A 1YQWA 3RQIA 3VTKA 3HZHA 4DIDA 2IVZA 3K1AA 4DJJA 2FTKE 5BYBA 2IU3A 2RAFA 3GMSA 4G9GA 4Q19A 2VSYA 1JB9A 3MVEA 1W47A 3FPSA 4UVDA 5JI2E 1AO0A 3A2KA 1BOOA 1RRGA 4RABA 4U7DA 2I0FA 2QLMA 3U4QB 3HUUA 1E9RA 4OFWA 1Y5LA 3N59A 4DNOA 4IO0A 3CEMA 5C9ZA 2CDNA 3I2HA 4F4JA 5I51A 1ZD8A 3SEQA 3N86A 3WLSA 2W8BB 3GC6A 3S0JA 5SY6A 5JI3E 1Y1RA 1WCXA 3PHBE 1NI4B 2ZR7A 1U0FA 1VJ0A 3HDGA 3WOVA 1NRXA 4JJIA 2XDWA 4A1FA 1UDCA 4KXWA 3QQPA 3B89A 4R1OA 1FPMA 2CNWA 4JC8A 4BWYA 3VOTA 1UQTA 8ATCA 3TQQA 4DSNA 4GQBA 2JDIA 5A0FA 2C9ZA 3GR6A 5FOTA 3GGCA 2QSUA 3NMUF 3N0RA 4BEWA 1C2YA 5BQPA 4GGPA 1IY0A 3K9CA 4ODIA 1QIHA 1SUSA 1EFVB 2GDJA 6REQB 3W3AH 4JEIA 1E60A 1JI3A 1QWOA 3HADA 1UPTA 4PIPA 3W8DA 3E4CA 4RIGA 3V80A 3HL4A 1C0PA 4CF6A 3GZNA 4R01A 3QEMA 5IDXA 1W6UA 3A7EA 4KWIA 4CCSA 1PWZA 1X7YB 3FFTA 3FYTA 3LXMA 4IVRA 2R25B 3WIBA 1Q0TA 1R6AA 4H08A 4EJMA 1Z08A 4TOIA 3FUCA 3BL8A 4JJGA 1Z2AA 3QKSA 2NO0A 1HLPA 5HIJA 1KY2A 4ZVSA 2JVJA 1P4HA 1JDBC 1EP1B 1P81A 1U1EA 1UZUA 4KDCA 2Q7DA 5JUWA 1Y7PA 3LQ2A 2ZT7A 4HGRA 5JFTA 3HB9A 2REQB 3B38A 3W77A 1N5LA 4YFYA 3ZHRA 3KJIA 3RUDA 3OETA 1FBNA 3MWEA 2QMYA 2R6GA 1JHVA 4WI1A 3UKJA 5CXSA 1GYQA 4IQ0A 4CTMA 3ZWQA 3JY6A 5IJZA 3UUWA 1H3EA 4Q37A 1J9ZA 1U2PA 4JOSA 2ZPTX 4R8VA 1DMRA 1PSWA 2H9IA 4UHJA 3H5TA 1LC3A 4ZOQI 1GUDA 2HWYA 3SYRA 3WQSB 1KP2A 3GJRA 4UAGA 5IT0A 3CVUA 4HYQA 1FRNA 3COSA 3KZNA 5G53C 1PTJA 2GK6A 2NT3A 4MI3A 2CL7X 4A4DA 4EAQA 2O54A 1YB4A 2HRCA 4UM9D 1B7GO 1YHYA 2Q6VA 2ZIEA 2IYNA 3DO8A 3U4QA 1Q7EA 2CJXA 4XD7D 2R1TA 1TA4A 3CKLA 2X2PA 3GUUA 1F48A 3H0EA 4KIGA 1W4ZA 1FYDA 4N03A 3BJIC 5IKEA 3JTMA 4X90A 3V4PB 6YASA 5F2NA 4JROA 4R51A 4NOLA 4BFWA 1G41A 2YY6A 3MTAA 4PLFA 5FV4A 4KAJA 2HRZA 3I6BA 2C84A 1XJ5A 1GAWA 1Q6YA 4J0KA 4J6EA 1Q19A 4U63A 3DMPA 2PMDA 2JASA 2F64A 2P8JA 2ZPUA 1SB8A 3ADOA 4K6OA 6GPBA 1OLSB 4FYIA 1USUA 2VO1A 3KR2A 4X1KB 3G17A 4BQEA 1FP4A 3ODGA 2WIDA 1FW8A 2D6FA 1UXJA 4RSRA 1SUIA 1JIKA 1OHHA 1QO0A 2J67A 5JS2A 3QVSA 1Z5GA 2WT4A 2D8MA 5CJPA 5FA8A 4DM7A 4UDYX 3O92A 2O8CA 4OD0A 1BWSA 3VVCA 3BRQA 1TYDE 4KFRA 2FWPA 3QNUA 4G2TA 4GO1A 4P3YA 4TKZA 1WW8A 2IOQA 2ZVJA 3IQFA 4TTIA 4Y3UA 4AP9A 3KZCA 4KMOA 1SAYA 4XPIA 1AB6A 3AKYA 5EXSA 1PLJA 4Y2SA 2DSTA 2AOVA 4OP3A 4BVBA 4F85A 4S3MA 4KO4S 2X41A 1LKZA 1JTVA 3IPRA 3LYUA 4PG4A 4UUPA 4ZT2A 2G09A 2VHXA 5JASA 2PUVA 4Y2JA 1YS6A 5CIYA 1XZPA 1NI3A 2B99A 5B58T 4RD1A 5IJXA 2LKDA 1PN3A 5AR1A 3SXPA 3HC7A 3BK1A 5JR3A 1RHUA 4ZOCA 5BNZA 2VP5A 1M72A 4YT4A 3PDIA 1AQNA 1ZFNA 1ST2A 1IOVA 1MEEA 3CW9A 2UXCB 3WADA 1XU9A 4QFDA 1EPUA 1T5SA 5H8WA 2Y68A 2O2XA 3KO8A 4BNHA 4FGJA 4HQOA 4M37A 1WBBA 3OZUA 4RF3A 2PV0A 5JIBA 1O9GA 4E88A 4L16A 2PANA 5LOVF 3KQLA 4KFTA 1D4OA 1EUDB 1NDHA 4YJDA 2OYCA 1OBOA 3UK6A 1NIJA 3H11A 1M2NA 3HBFA 2FN3A 3KOZA 4W5QA 4JLUA 1D04A 4LA4A 4CT0A 1E1RD 5BR1A 1OV4A 2OQIA 4QYMA 2X2OA 1BXGA 5H3LA 3PUVA 1AB5A 1N92A 2X77A 3H75A 3VDMA 1DC5A 5EKDA 2JKZA 4JLSA 4QLAA 4WPGA 2OBLA 4ZT3A 1ZITA 2UVPB 1M8FA 1J22A 1V7QA 2XNHA 2ACVA 3A25A 3QPVA 4QGHA 1SVMA 4ARAA 5FPSA 5K3SA 1JQLB 3DZCA 1P60A 1O5TA 3H8SA 1AHNA 3GA5A 2IKQA 3LLCA 4CMBA 4CUJA 3FCUB 4R5MA 4N82A 4DG9A 1ECCA 2BJVA 2AMVA 5LFAA 3EPHA 4DYHA 4F92B 3T3DA 5KJ6A 2QU8A 3BB1A 1DSSG 2PXHA 5KDLA 5BW6B 2GPJA 3HNOA 3INGA 3UT0A 3X1XA 1G8AA 1ZLYA 2C2HA 2RH5A 4MRVA 3ZEAA 4DCPA 3BHMA 3GJ3A 3EPRA 4IQ4A 4BP3A 3QKTA 5CVTA 4DMMA 5LR6A 1I3CA 3E22A 2DR3A 1OVGA 3KAPA 2FF5A 4XQEA 1A9XB 4L9WA 3EB9A 1Z56C 1L4LA 1NA5A 3PZRA 4D4HA 5JC8A 5GADl 3SJAA 5TF4A 1NW3A 2XLCA 1FFEA 1KO5A 2MOKA 3HYLA 3L0CA 1U3GA 4F8EA 5BSVA 1EBFA 1FEZA 1J33A 1QOPB 3D0KA 3ABOB 3SZUA 3VU9B 4Z4EA 5DV9A 1E94E 1KI6A 3MSCA 4IGIA 2HCRA 5AYVA 3ZDEA 3PHIA 4XX0B 3ND5A 4CKBB 4DCJA 2BN4A 3M4NA 2BFCA 3DE5X 1O9HA 4KYIB 4LE1A 5BN3A 1W35A 2YC4C 3CG0A 3W2IA 3TDKA 1APBA 2X4IA 3DV9A 1F1BA 1U8UA 3MA0A 3OZAA 4RF4A 5FNVB 4D3ZA 1OB5A 3ZIDA 2IYZA 4YRJA 1LTKA 2AKYA 2I78A 3R0VA 4EPWA 2OV1A 2DFNA 2VATA 1MIOA 4TX1A 5FJJA 1I3MA 4CQMD 4MV3A 4TTRA 2JZOA 3A1TA 1SQ5A 2HRBA 4RJIA 1MV8A 2Q4BA 3C16C 2GXSA 3W5UA 2DYKA 1T2AA 4Y0NA 1WO8A 4BVLA 1ZC4A 4M36A 1NDQA 1LPAB 2RH8A 5ERXA 1G5FA 3KYJB 2B2NA 1W52X 5FWYA 4W5OA 2Q0SA 2QTRA 3DPUA 3RANA 4Q9LA 1UKEA 1Y3CE 2L2QA 4MAAA 5AW3A 1TIKA 3TW8B 5DX0A 3HKEA 1R8YA 2UUBB 2PSJA 3KEGA 1OZHA 3PWSA 3OZBA 1A8QA 3QG5A 4BJ3A 3BCSA 1ZOSA 3W79A 4O4HB 3AFMA 4EHHA 1N32B 2BL4A 4M6WB 3QFFA 1OIXA 3AF1A 1MEOA 2FZKA 3AU9A 4YAEA 1ZM9A 5F1OA 4DUGA 1UT5A 1XD2A 1U63A 2AS0A 2QL6A 1SC3A 1UJCA 1PFKA 3AF3A 5AJYA 5DN9A 3W9SA 2RK4A 3HVJA 1T2CA 4D81A 4ECAA 1Y8CA 1U02A 2IPLA 2RGGA 3QYPA 3F6YA 4HAIA 3L6BA 4OATA 4RYDA 3TBFA 5KCMA 1V8OA 1V6AA 1K4YA 2Z4TA 1GRCA 3BD7A 7REQB 5EJ8A 1NPYA 1P2FA 4G5XA 2XD9A 1DO2A 5HEKA 3OT1A 6REQA 3DHEA 4PLWA 3OE7A 4NZMA 4Z7JA 3OC0A 4DSAA 3CBGA 2ZSKA 3HYRA 1RI3A 2C00A 4C87A 1WX1A 3QXCA 3H9BA 3MJRA 1E1LA 4UPVA 3H5OA 2IITA 2Q2VA 1Q7BA 1WPQA 2AK2A 1X1BA 2HMWA 3ZCVA 5D1HA 3UK1A 4QM7A 3UT6A 2GZDA 3RUFA 4QQRA 4UVIA 3UJPA 3PX7A 2FNAA 3QENA 3DTVA 4RW0A 1OFVA 2OHVA 4UTVA 4HNUA 3SN6A 2J3LA 2VA9A 5J47A 4M9XA 4Y2YA 1JZTA 5GJWC 5SZIA 3ICPA 3OF2A 1YFKA 4E70A 2CMKA 1C9MA 2F1IA 5EWLA 3RO7A 1BCRB 3TWOA 2ONKA 1XD8A 3BEOA 1XFDA 2YYAA 3MGCA 4FZRA 4JB3A 5EE0A 4KXXA 1I1NA 3L8EA 4TS9A 3SGLA 3OQ6A 1EB8A 3F4BA 3FDIA 2IYRA 3E82A 3DV0B 4QVGA 2YVKA 1GFSA 1EWQA 5EQDA 3M5CA 4ZT6A 2BHTA 1CIVA 3ELBA 4RK6A 1EXVA 13PKA 5EJMA 4HGQA 5NULA 2Y1GA 3DZJA 4WCFB 2OAEA 5AVWA 5ALFA 4PAGA 5K8VA 3OQ1A 3UXMA 4WA7A 4MMXB 4R71A 4B17A 3BT7A 4ML3A 1F0KA 1LS6A 2G63A 1NF2A 1WQ3A 2OWDA 1ADBA 4IYJA 1QC5B 3BE6A 4GYKA 4MLCA 1N2CB 4PW0A 4TS1A 1GKLA 3FMGA 3NAMA 3O83A 4Z4GA 2AX3A 4QU0A 5KYVA 2AE1A 2O2HA 2XUQA 4RANA 3V4OA 4BZXA 4YDQA 2ZZNA 1RYHA 2JHGA 2HN9A 1JS1X 2BKEA 4L3VA 4QU8A 3S44A 5K4GA 4X6XA 1TZ2A 3SSMA 4PLCA 5T67A 2FPWA 2H08A 2YMMA 5C5CA 3GEPA 2WF7A 3UCEA 1AGPA 4X45A 5DM70 1XVUA 2JA1A 1J20A 2QX4A 5I7HA 4IZOA 3MMNA 3IQZA 1NE7A 1QZUA 3THWB 1JG7A 1F2VA 4GL2A 4QSMA 3EEYA 2P69A 3D2AA 3GT3A 3QOFA 2X0NA 1UZAA 3F7TA 4FBGA 1EHYA 1CNEA 1SR8A 3EZ7A 5CGZA 2L82A 2GFHA 1ARZA 2YN2A 3OIWA 5BSHA 1NYQA 3K53A 4FFRA 4JBWA 2WIFA 2ZYTX 2ZM5A 1DAEA 4KQGA 5AI5A 4F4CA 3HEBA 5HM6A 4P80A 1F8UA 1BKYA 3MUOA 1GTZA 2KPOA 3VDRA 5JXJA 3UM9A 1EUZA 3KQQA 3MYRA 4L73A 3U4HA 3WZLA 1HTTA 1JRLA 3K35A 4M0KA 4RY9A 1NBIA 3VNQA 1IY2A 3A1VA 4FYVA 4YR7A 3ZJUA 3JZAA 2XMSA 1ULAA 2ZJ8A 2ZS7A 3IBCA 3EVCA 4PIVA 4BEBA 5F77A 2FDRA 1QDEA 4BVAA 5BORA 4FK8A 3ETGA 3LSTA 4FD3A 5KOHB 4IBOA 2PPLA 2VF7A 4PO3X 1AUVA 3HGQA 4NCXA 5CCEA 2BWJA 1XQVA 3OU7A 3L82B 4HTFA 2CBZA 1IMOA 2PWAA 4AWXA 2WWYA 2C92A 1FFHA 1SXHA 2W2NA 4K86A 3A3PA 1G21B 5FRDA 3EODA 1E0AA 4J1TC 4PV7A 4HQRA 4HRVA 1NZDA 1VSUA 1Q3TA 5CT4A 2NADA 1E62A 2QGNA 5GONA 1AKTA 4DF3A 4XQGA 3AI7A 5LNK6 2JC3A 3T3MB 2HFJA 5JNTA 4NFSA 3GRFA 1C3VA 3Q1LA 3SHVA 2B2XA 2QMHA 4IH4A 4Z53A 1KEWA 4G4IA 3TLMA 4X8HA 4W7IA 3V2HA 4ZVKA 3HCPA 1P61B 3G9ZA 2X0JA 2LNDA 1DJQA 1E3WA 4FCTA 4DSOA 3AF0A 3SVZA 4EA7A 1LI7A 1X80A 1GEEA 5JVDA 4MW6A 4BL5A 3T1TA 4HQLA 3LZDA 3RHZA 1SXGA 2NSLA 1D4AA 2HUPA 3LRPA 4UREA 3OF5A 1PVVA 1VIMA 4WBSA 3RK4A 4NAVA 5KYYA 4P3KA 2PUFA 1CFJA 4HB0A 1DVRA 1P4JA 1HBJA 3N7TA 3VR4H 2BEJA 4K9NA 1Z16A 4OJTA 4QRIA 3ZU4A 1CXZA 2EDAA 2PLRA 4D9IA 3GPIA 3S2YA 3EVGA 1S2IA 1DT5A 1BD4A 2V5AA 3D7SA 3EZXA 4IUDS 4Y1GA 4F6CA 3QPBA 4IH1A 4PE5B 1XZIA 3F8TA 4Z86A 1AHPA 1FBTA 5JD4A 4UVGA 1T6YA 3WK7A 4LYJA 4BWFB 1OE0A 4D02A 4CTNA 2PWZA 4PX2A 2PMFA 2RIRA 2JFOA 1JEQB 4NESA 2CHVA 2J30A 2JKYA 1NU6A 4B75A 4BTLA 4B3GA 4EMSA 4WXRA 3ROTA 4BLQA 2OC9A 3WHPA 1I7PA 1NONA 1VBNA 4KXNA 4ZARA 3L7JA 1C30B 3TM5A 3A36A 1QYWA 3ML1A 2BY4A 4M1ZA 5AP9A 1DTEA 1CJTC 4PQYA 1I1HA 1MR3F 1RXWA 2ZAOA 1FTYA 1WVGA 3OG9A 3HGTA 4GBED 1EWVA 1J9GA 3JQFC 1GT91 1NC3A 1R0WA 4Q4LA 1EFPA 4FKZA 5EP1A 5JSYA 1EDDA 1JDNA 2I8AA 3DFUA 2GHQA 4HGNA 3R7LA 4EL5A 3AL0C 4LJAA 4LRYA 1E6WA 2C59A 3AR9A 3E22B 3TRHA 2P90A 3E2MA 5A4KA 1O03A 3RS4A 2AR0A 1Q77A 3I6IA 4TKUA 1PJAA 1YTLA 1W44A 1U2EA 1UJMA 2MMGA 3GLGA 1G2OA 2VHVA 4L5BA 1EZ1A 1ZC3A 4CV1A 4C0QC 2R6AA 3UYLA 1EX1A 4Y2HA 1ZK1A 3C6BA 1CRQA 1E64A 4NI5A 4P35A 1VJCA 4WZAA 5EPOA 2WJJA 4QUBA 3N28A 2ERXA 1ZJWA 3G5MA 3K4HA 1YZ3A 1X0VA 3NEPX 3FROA 4NIMA 2H3HA 3DEHA 5AUPB 4JUDX 3QX8A 3L7NA 4MV0A 4WV3A 2UVPA 5AVRA 5JW6A 5GONF 3MWGA 1TE2A 1THMA 2XYHA 2IS4A 3K0FA 1AZTA 4RSGA 4L4UA 1C0LA 1L5QA 2C5GA 4RKRA 1P5HA 4BVJA 3T7IA 3MWKA 5C51B 1N78A 4E6PA 5IXJA 1QRTA 1XE3A 2C78A 3GCDA 3BGVA 2FPGB 4B5LA 3KIPA 4IDDA 1CY2A 1VL0A 3C3YA 2XMGA 3F7OA 3FNIA 4LF6B 3ZCRA 2CUNA 2GK7A 5AJTA 5DGHA 4D9KA 2JB9A 3ORRA 1N33B 1U5AA 3A6HA 2HA0A 1NJ1A 1Z0DA 2XTMA 3NFRA 3SK0A 1ZD4A 1GVHA 1XVLA 4MS4A 1M5TA 3GP3A 4U7PB 1QQ6A 3CLTD 1P6UA 4UFPA 3EG5A 1FJ2A 2QIOA 3DKPA 1UFVA 1UPCA 3L7AA 2HV8A 4EG7A 5IF9A 1LDNA 2H1RA 3P45A 1A5TA 1G7RA 2P3OA 3AUUA 3BULA 3KKKA 3IA7A 2NU9B 1VL8A 4QTYA 3BIWA 4H7EA 3NBFA 4MGEA 3D0OA 1GU1A 3NHMA 1P5RA 3IAUA 4I1YA 4OYHA 1Y7LA 1GUZA 5BXQC 3OX4A 3T95A 4HRAA 5DGCA 3BM5A 2MWMA 1AMUA 4ZEMA 5DO9A 4CU2A 5EJFA 4B44A 4V0KA 3MUNA 4AY3A 4B3CA 2Q5FA 1XR3A 2VVTA 1U2GC 4NFYA 4DSUA 4MUXA 1JSXA 1V4VA 621PA 3D8UA 3C7KA 1M10A 2HPVA 4IGAA 5A4AA 4CBVA 2CHFA 4JKOA 5CB6A 1CNFA 4G86A 5JD3A 1EU1A 1JLHA 3TD9A 4I4TB 3KRTA 1Y3FE 4AW9A 2QTTA 1UKYA 4DRXA 2QUIA 4N5LA 1NLUA 1U0GA 1OLUA 4RM2A 5G0UA 3VR0A 4AX4A 1QFYA 4J2HA 2K6GA 4KQCA 1JHZA 4EW3A 4JJ6A 4Q4DA 2F43B 1ECPA 1XTZA 1WZCA 1WCIA 4G0VA 1YFLA 5KQLA 3U17A 2I33A 2ROQA 3Q0IA 4LYEA 4NP6A 2XWJI 1B8NA 1CUZA 4XVHA 2G71A 2R5FA 1O8BA 2G83A 2P5YA 4IJ6A 1EVKA 5CPBA 3TQFA 3KOXA 1O0SA 2VYQA 2YFHA 4DOMA 1BFKA 2V96A 2YN4A 4YK7A 4KZPA 2WG1A 3NH9A 1M67A 4OB8A 1NWHA 3L1IA 4RQTA 4FZJA 3BGSA 4YXFA 3I28A 1LBSA 4IO1A 1MTOA 3SWWA 1CEEA 5AJVB 5A0TA 3WLQA 4MW0A 1P2TA 2VHWA 2Q1XA 3K0CC 1GWNA 4HOYA 3BSWA 1OF1A 2IHBA 3VKGA 3EPPA 3GLFA 3LCUA 3PDIB 3B70A 3G1UA 1K0FA 2BLLA 1HEIA 2X6RA 3IE2A 3QM1A 2A4MA 1VG9B 1UIRA 2I7DA 5FTWA 4MUIA 3KD3A 4MP3A 2ZI6A 3AP3A 3DF9A 4G63A 5E7IA 3RYFA 2J5KA 5TLSA 4XIFA 3TL6A 3VMMA 2FSFA 4RD2A 4BQSA 4O4IF 5JXHA 3SDZA 4BP1A 4F4HA 2E9SA 4XLLA 3EQ8A 1T5OA 2O2JA 1VECA 3ZR4B 3JWIA 1PJLA 1Z6GA 1Z0IA 1TMKA 2G40A 3DL0A 3ZWYA 3JQRA 4XGNA 1IK4A 1CFZA 1PDOA 2O2GA 2OUIA 4G5RA 1LK7A 2XCLA 3KKQA 3KBBA 1TAQA 2PT9A 2ZJYA 3LL7A 4ZCRA 1RQLA 4L5YA 3L7CA 1XFAA 5JMTA 1HR0B 3LCVB 3LX6A 2FWIA 3C8ZA 3CNHA 1KI4A 4BNFA 4PYLA 4FEYA 1TUBA 2G1JA 2PL1A 4IIJB 2P0EA 4BX3A 5LDGA 1TCCA 4EPRA 5C1PA 4HAZA 2CV2A 5DBOA 3AZOA 4R8RA 1QCYA 4ENPA 2DHRA 3X1DA 1M73E 1PK8A 4ZQBA 5EMJA 4NPAA 3G2OA 1XGKA 4K9PA 4JI7B 3IV7A 4OXNA 1AS2A 2BEUA 1XMXA 3D6NB 4X71A 3TPZA 3I61A 5BPHA 1WMEA 2I6UA 1NVWQ 1GGNA 1ZHFA 3T0FA 3QQ5A 3MUFA 1NQOA 4AX8A 5KNCD 4R69A 1GZHB 4UTZA 5DOZA 4Z7NB 3CIOA 2AF4C 3ULKA 1XJCA 1W4LA 3FCAA 4IGKA 4F0JA 4CR8A 4UBKA 5JCXA 1A1SA 3WRXA 3JS5A 4HYEA 1JEDA 3T7DA 3G8CA 5J5CA 2MSNA 3TZBA 1G8HA 3IOEA 4NFLA 3ZGXA 1S89A 1T0HB 2OP0A 3PR3A 1IOWA 4I55B 4QDUA 5F21A 5FA6A 5MN5A 4I1PA 1NN1A 1G8FA 4M2LA 4AMUA 3T9DA 4AZVA 3VC3A 3ZI4A 1WZ2A 2OGWA 3KJZA 1RWQA 3N87A 1JWBB 1A9TA 1BWQA 1DV1A 1FXSA 3HCDA 3PHJA 3RIXA 3UT5B 3WNVA 1KEPA 2GYVA 4WY8A 5LNK1 3LT2A 4P4TA 3KSRA 3MCUA 3WYGA 3OJOA 3EIEA 2CFSA 2FWMX 3R8XA 1HE5A 2CFRA 2Z3VA 4WZBE 4WADA 1LPSA 2Q2WA 2QTHA 4CQMA 4EB6A 2FG7C 1K7SN 1E1YA 3HNRA 1EFDN 2EYQA 3JD2A 3KL4A 4WLEA 1XRLA 2V0GA 5BQOA 1UMBB 4WKNA 3HN2A 5B4VA 3ZWOA 3RROA 4UTPA 1P2VA 4QRDA 2WIKA 2VJNA 2X7HA 3DBHA 1F06A 3IUSA 3NT4A 2NWQA 3N53A 4NECA 3SF0A 4BVFA 4LY0A 5DNUA 3A58B 1DQZA 3ER8A 5EJIA 4ND6A 3F49S 2HO5A 1DBRA 5DBEX 2ZE7A 5KHAA 4AO8A 3OJXA 2G1AA 1YR3A 4KNVA 1GZ6A 4QDJA 3I9KA 5ITSA 4AP6A 3UHFA 4L02A 2Z4RA 4S05A 1TADA 4ER0A 4LGCA 5DXAA 2MSKA 2UVDA 2IH2A 2HA4A 3L41A 5J2TA 3SOZA 1P74A 1G5HA 4R1PA 3CG4A 4BMSA 1BVHA 4DV6B 3GFPA 1TUBB 3SC2B 5EN4A 1IUOA 5LJLA 3LYAA 1GG2A 1R2QA 2OCYC 5FA5A 5LQRA 5JU6A 1ZEJA 3TSOA 1KGDA 1RM3A 5ALGA 1O3YA 2E4ZA 2AMJA 1EXWA 2PQMA 3SQXA 1I4DD 1T9ZA 1W25A 4V0SA 2CZCA 1SKBA 2ZZKA 3TD2A 2QQEA 4NBRA 2YJ3A 1JNXX 4WKPA 1JEJA 3PL5A 4ZQEA 2UYCA 4HDRB 4X24A 3VSCA 4BEJA 4KKXB 4FB5A 1QXSA 1Z88A 1JZSA 2CNKA 4MARA 4GWLA 4NZNA 4DG5A 2BLNA 3AM5A 1LLDA 3K16A 1NIPA 1GNLA 1SB9A 2PAAA 3GLQA 3KTAB 2OCGA 2DLCX 2H85A 1MAUA 1FDVA 1ZIXA 2QHXA 1P6XA 4D25A 1YQDA 2GM3A 3WYCA 1ZGGA 2WV9A 3C3BA 2OQVA 4A8TA 1G3IA 4ZCPA 3T9BA 1W4BA 1N6KA 5AW2A 1XL0A 2IEZA 1IUNA 2Z30A 4D74A 1KVRA 4F84A 4S04A 2VTBA 1RC1A 4LOHA 5E3IA 3WWZA 5JZVA 1ZOIA 3M4ZA 4NV0A 1Z6TA 1M6VB 4BFUA 5DNYB 1X7GA 2V7BA 4MIEA 4R7TA 3HCEA 3I9V1 3M3DA 3N07A 5L7WA 4QASA 3SZMA 4CQMB 1RQNA 1UBUS 1N7JA 2W90A 1AXGA 2BFPA 3HP1A 3K8QA 3RU7A 1R5JA 4EWLA 3PL1A 4MQFB 1IEQA 3N2LA 3G7NA 1T91A 4FGUA 3JAKA 2BDUA 2BJHA 3PHHA 2R97A 4P8RA 4WH0A 4EY4A 2BKUA 4OM7A 1QP4A 3F73A 2JIBA 1KSJA 3KQOA 3F98A 1UC9A 4AS3A 5KOIA 3I72A 3P9YA 2RH9B 4K3VA 4DV3B 4PGAA 1X7HA 1M1YB 4HGPA 3LXUX 2DCUA 4JJKA 4DMRA 5DMHA 1YQQA 1FVFA 9MHTA 3A9RA 4YRAA 2PBZA 3MOSA 4MMZB 4AKEA 2WEKA 1DWUA 4Y1EA 2W42A 2OV4A 2FGJA 4F96A 1M33A 3A3OA 2LKCA 4E21A 2BRUA 1DRKA 4QA9A 4IIXA 1TU3A 2ZVQX 3EVAA 4BLWA 1FSPA 1J7KA 2YQ4A 1CB7A 1V3TA 3EQ7A 3JYLA 4LK2A 1HQYE 3PUJA 1NI5A 3SE7A 3TOCA 3AVXA 3ZVLA 3RR2A 4LKRA 4FSDA 3OBBA 3D4IA 1P9RA 3CX7A 4B6EA 1ICEA 2XTZA 2EX0A 1OLUB 4QC2A 1SVSA 3ZHZA 2BTQB 3NANA 1KH3A 1U8TA 4BAZA 2OOKA 4NG4A 4PQRA 3RDPA 3ELWA 3TVYA 2QGZA 2P5TB 3ZHUA 3DFMA 1E77A 1XG5A 3AZQA 5FEUA 4X94A 3FX2A 1NUPA 2VCHA 1L4HA 4KX5A 3BIOA 4PSKA 5REQA 4QXAA 3L93A 4ADSG 4GC5A 1WVMA 4B6JA 2AT1A 3E9CA 1RI5A 3I6ZA 2NO1A 4HEA6 2AOXA 2IYSA 5HKLA 3KT8A 4JYAB 4D4MA 3GZTB 4XR9A 3PRYA 2P2LA 3DW3X 3O4HA 3V1LA 1GY8A 4DDUA 1Q22A 4Q3DA 4X84A 3WIDA 4JH0A 2CXNA 1BNCA 4MS3A 4OU5A 3SC2A 2H18A 1KF0A 3TM4A 4IG4A 5LDDC 5MGNA 5DX8A 4C0WA 3BD8A 5LL6P 1DRUA 1KEEB 1NFQA 3VPSA 2J0QA 2I3ZA 1OLXA 5DCUA 3U3XA 3KP1A 4UQOA 2C1EA 3FWYA 4EMTA 4HQKA 2JFQA 2GCOA 1P4AA 1BO6A 1Q1QA 3O5AA 4RPLA 3R7NA 4PG5A 4F6RA 3IQEA 1XI2A 4LV6A 1RWVA 2XQJA 10MHA 1VP9A 5EWJB 2AZDA 2QRLA 2O8EA 2PUDA 2OQRA 2A0UA 3PR2B 4OHKA 1DCKA 3CVJA 3G1WA 3KZMA 2EW1A 4HVAA 4QTUB 1DKQA 3SHFA 3V8RA 4WBNA 2HSGA 1CF4A 4O0MA 1HUQA 2X8BA 5L3SA 3CSDA 3VYWA 3T5BA 2GAOA 1Z3IX 4U2FA 3V4SA 3KFVA 1ZOOA 5L4NA 3LF1A 4FILA 1KIFA 1HL3A 1Z22A 1D09A 1ZOPA 3P1JA 4X6LA 4CTOA 4WJLA 1GM5A 1JDUA 4FEAA 2QLNA 1EK0A 1XMJA 1X7XA 1E0DA 2JD0A 4RK0A 5A7HA 1KDZA 4D79A 5JSUA 4EHIA 1ACJA 1DO8A 1LQUA 2G9ZA 3MJFA 1XRRA 5IN5A 1PX0A 1DELA 5KTRA 2R6JA 1E5DA 1XPOA 2PXXA 3TZ6A 3LIPA 1UBKS 3AJAA 4X95A 4UMDA 2F43A 2WUFA 2PZEA 1NF8A 2DLNA 4W8HA 1FXWA 3KL2A 4RZXA 2OLJA 3TFQA 3LHSA 4H7IA 3HU5A 3S1AB 3ACDA 2GEBA 1O8CA 1VJRA 4IIEA 3LDHA 1JQ5A 3MSXA 3AF6A 2QM7A 2PE5A 1S6YA 3CRMA 3NTQA 5C81A 1GPUA 3QA3E 2J5XA 4KV7A 3AVPA 1SVIA 4RQUA 4LF5B 2CC2A 3TOSA 2D62A 4QVIA 2Q3LA 1D1SA 2B5VA 2QNIA 4IX1A 4MICA 4P22A 3RNLA 2W2VA 3GWZA 1JQKA 4FGKA 4TV8B 3RRMA 2I4TA 5AI0A 4ZO8A 3QOXA 1H65A 1KR2A 1INLA 2Q3BA 1JUDA 2XKBA 2G4VA 3WL3A 3WK4A 4EYSA 5KMGA 3D6TB 4TZTA 2WKQA 3GDHA 5DTRA 3R7BA 3I8XA 2H2WA 1UBCA 2F1KA 4XTCS 5J43A 3LWDA 4RZQA 2F90A 3V7UA 1N1GA 2ZWIA 3ONNA 5BQ5A 5IC6A 1NJFA 1PRYA 3IHLA 3WWPA 4TTJA 1L5LA 4EEXA 4OHWA 4ONEA 4PICA 2XJ9A 3OIGA 2FGKA 3TI9A 4YV0A 4CCWA 4DPKA 1W2HA 3NO4A 4GX0A 3TKAA 3KZVA 1K86A 4R81A 1GKIA 1SBIA 1YV9A 1ZM2A 2EFCB 2O20A 2Z6VA 4GQIA 4KMMA 2I1VB 4XYGA 5DWDA 1W96A 1ZS9A 2C3MA 2VP6A 1I30A 4PNHA 3UAOA 4YMIA 1YASA 1MW9X 3IELA 5IZCC 3Q8XB 5T6BA 4WNCA 3E5MA 2OG2A 4XW2A 3C3XA 3EF1A 5CIWA 1X94A 1R0BA 4Q3NA 4RPGA 1R0ZA 1SWWA 3IT2A 4EF4A 1C7QA 1YFZA 4YJGA 2YZMA 4RD4A 4HN4B 4BHTA 1K3UB 5IKXA 1IAVA 1DJLA 2B25A 4GI7A 2ZE8A 4LOKA 2ZRMA 5K3DA 2RGRA 2IQIA 4G1MB 3DEFA 4N0QA 5TMDA 3ROGA 3O8LA 4G0UA 1RCFA 2Q5IA 2CN1A 3MLBA 4I4TA 3SMVA 4YCCA 1PS8A 1QAQA 3NHZA 3VR4A 1S9DA 2CHUA 5MDHA 1KQPA 3ZD6A 1IAQA 4HLUA 2Q8NA 4IMRA 3UJBA 4BZPA 2BFEB 1HMYA 3WDSA 1CPYA 1MB4A 1UBSB 1IJEA 1EFRD 3PUXA 5EP3A 4BNZA 2GMWA 4EFMA 2H9YA 3RWOA 2ZXFA 2OAP1 1M2FA 4O5OA 1PT7A 4PS0A 5CT6A 3HRIA 3VJMA 4F4DA 1DV2A 4WESA 3G23A 3OPYA 1GRRA 4ED9A 4EF6A 5CFRA 3ORQA 5DHAA 2W6QA 1ACLA 1S5PA 3ZXUB 1DEHA 3ZE7A 2QVBA 2VXBA 2EQ5A 4O4JB 4F4IA 1KAOA 4HVTA 2X14A 3GBVA 4LGVA 4DM3A 2EFEB 2DFPA 2JLAA 4FBMA 4RDIA 2V6JA 2DJIA 1C1YA 2Q41A 3PKZA 2P5UA 2ZBPA 5LP6F 4MWOA 3NIWA 1K8RA 1JQJC 3PIDA 2V9ZA 5DIZA 2X8JA 5FNVA 3S3TA 1SMKA 1ZK2A 3ZX4A 1QIJA 2BZGA 3X2EA 1YIDA 1KC1A 1ZN8A 3V4ZA 4BKUA 3F8WA 2V9CA 4Q7LA 4HUJA 3TGPA 1KMQA 3BGDA 3GPLA 4DLNA 1PX2A 2QF7A 2BBOA 2B21A 1RI1A 4GSKA 4OSPA 2IZ7A 4EHBA 3KJGA 3LUHA 5KSZA 1Y6GA 4CODB 4PGMA 4POAA 4RC9A 4D3YA 2RGCA 1HT3A 2W9XA 3A3KA 3G7UA 3OCJA 4GM1A 4YNBA 4CE6A 1LV8A 2ZYVX 4N65A 1O96A 1C0IA 3M6FA 2I62A 4Z99A 3SQNA 2DBQA 2J3IA 2VJDA 3EXEB 4KXQA 5FORA 5BV2P 5HS4A 3L8FA 1M6VA 2XAAA 4F3TA 2GEUA 3PEEA 3BFPA 3J81A 1E9BA 4DR2B 3EZYA 1ZJYA 3UEOA 5EEHA 4LCBA 1I3OA 2A7QA 3BE4A 3LGSA 3JV7A 4EI2A 1YO6A 5AKLA 4J1TA 1Z33A 2O0LA 3GJ6A 2B69A 4DZRA 2C3YA 1BQEA 4YJ3A 5IAGA 5CURA 4EHAA 4ZHQA 1K2VN 5IHXA 1YR8A 2MSWA 1ULHA 1TECE 1D8AA 1QVRA 3IV9A 1UJ4A 3CYFA 4MUEA 4BNDA 3VZDA 1EX6A 3RI3A 3ZDYB 2Y1CA 4RFSB 2VQFB 3KQNA 3CNNA 3V55A 3E15A 1JG6A 1GUAA 3JQFA 4OM8A 3ZKWA 3DUWA 1PU2A 4IOJA 3B7GA 5FULA 2QBYB 4TWIA 4DBZA 4LJ4A 3KKPA 4RL4A 4RTSA 3DT6A 3AUSA 2A9KA 3G5UA 3LX4A 5I4BA 1Z7EA 2BHRA 1NR7A 3G6WA 6ADHA 3DGFC 1QUFA 5H1YA 3CUEF 2FX2A 1M2EA 1Z2EA 2B5OA 4DR3B 4EUKA 1T43A 1GGKA 4ZEVA 2P2SA 5ALHA 1N5RA 1WCYA 4QHSA 5FP0A 2QZSA 3NFYA 4K9OA 4R1QA 4GP6A 1KYWA 3U81A 3DL7A 3EGDA 4IVQA 3I4FA 2X1MA 3OCYA 4XLTA 3R3HA 2GPYA 3FRJA 4P7GA 4PIMA 4PGGA 3I0ZA 3ORSA 4ZFNA 2YYSA 3QV1A 2YCLA 1UR5A 2ODPA 3TRKA 2VHCA 4WDQA 3AEKB 4IJKA 5DXFA 5EHQA 1UDWA 4J6FA 2BFAA 4QNNA 5E7QA 5CK4A 4M87A 4NMLA 5FBZA 4E5DA 5LBIA 1KHTA 3RUIA 1U3DA 1QQ5A 1MENA 2Q2OA 3BAFA 3M82A 5D8DA 2NO4A 2VHQA 3ONVA 1EX7A 4FT2A 4GBGA 3B9BA 4L0MA 5EZYB 5F7XA 2R6ZA 5FO1A 2FPIB 1DG9A 2WU1A 3IMFA 3QEKA 2LV8A 4HDKA 3NASA 3ZYCA 4CR6A 2R6CA 3Q8LA 2OCPA 4I1OA 4XQ0A 2ALJA 4Y9SA 4XUGB 4PYQA 1GUFA 2LRHA 1JHUA 3E3NA 1XPRA 4JNKA 4PFJA 1TO2E 1ZA1A 2IYLD 2LWIA 4MRMA 2B8EA 1T4GA 3FNQA 1YVPA 4F4UA 5F9HA 1KTIA 4YP6A 3KU1A 5HSGA 3NHYA 3UA4A 5ICFA 4FDMA 4E32A 3B53X 3CX3A 3ICOA 4F1JA 5MFPA 3HJRA 4E2XA 1NBEA 2Y0EA 5EG5A 3B2NA 3WP1B 1JBEA 2H5JA 4MV8A 3UJHA 2WWVD 3KAKA 2ZSJA 3AI1A 5B1HA 2B1QA 3FSGD 3VO1A 1Y5IA 5INTA 3GRVA 4H9GA 4O4LF 4CIVA 1R8SA 1KEEA 3BFXA 1ORHA 1BZYA 1SHUX 3S5UA 3O8OB 2QX7A 3TZHA 3CX8A 5F9MA 2QRQA 2PUTA 1VI2A 4F93B 5JLJA 4N8SA 3QKIA 2DBYA 4NZPA 4QYSA 1Y3DE 5HDBB 3TTSA 1V3QE 3W6PA 1RLMA 2A5FA 2QVCA 3ET4A 4ZEXA 4B83A 3OWXA 5FOXA 1K98A 4MEBA 4I14A 3KVYA 3V8MA 4MCJA 4X20A 3JQPA 3UWPA 2VBFA 2VBGA 4B87A 4EDHA 2W6PA 1XEXB 3EXHB 1QH8B 3NM6B 3PVCA 4BYGA 3WLNA 2HSJA 1HYQA 3DO5A 2Z0MA 2P1RA 3AJ9A 2GM5A 3CQ9A 1KXZA 2KE5A 2B36A 3EFEA 3PQ6A 2XUKA 3AY0A 4G89A 4OHCA 1EFKA 1Y8RA 2CDBA 4PSCA 3T4UA 2FMIA 3VR4D 3WGMA 4BLPA 4TVSA 2ADOA 4NMWA 2W2KA 5EWLB 3TZEA 5K0SA 4TZ0A 3KPVA 1NOJA 3MS2A 2NZYA 4UFOA 2VLIA 4TL7A 3WV4A 1T4CB 1AOXA 2CNBA 3V1TC 4EFDA 1OFTA 1J8YF 1W85B 1YL5A 5BW8A 2FPXA 3VNBA 4KE6A 3MW8A 1G4UR 3K0EA 5BPFA 3TECE 1BHO1 3W3AA 2ZCVA 1C3JA 1AKVA 1COZA 3GLVA 3JRXA 3NNNA 4NCIA 4KWTA 2QUBA 4LFCB 4MRNA 4XYLA 1T6BY 2D0IA 2Q3DA 3P0HA 4GD3Q 5E4TA 3NUZA 5K2MA 4FOOA 3BILA 4JY7A 4RVHA 4YWHA 1DAHA 3PIIA 3QOYA 1Y7IA 3LQRA 3IOBA 4MA0A 1XC7A 2VTDA 3C1TA 4NBWA 3DBVO 3HE3A 5LYJA 3T4EA 3UFXA 4FINA 1I33A 2VTVA 4URYR 3BFKA 1HDXA 4K05A 4QJBA 3RS5A 4NU0A 3DMHA 3TB4A 4BBAA 1MJNA 2OAGA 4Q9AA 3JAKB 5BUCA 3FPAA 1XZBA 3FCXA 4Q3OA 3A6LA 1GCOA 1TRHA 2YNMA 1TT7A 2QLJA 2C4KA 4JBYA 4LHYA 1PWHA 1YS4A 3CZQA 4NQRA 4TTTS 5JAMA 1NYLA 2AOUA 3OPXA 4Y9DA 1M54A 3UJ9A 3UAYA 1DADA 3L0PA 3ESCA 4LV8B 1DJPA 1Y1SA 5JZBA 3MJ4A 2R8PA 4MGHA 2F3RA 4XDZA 2R7KA 4K40A 3HHEA 4OP2A 5BP7A 3AGQA 4AY5A 1H9CA 1WJGA 4IV0A 3L01A 3P20A 1HORA 5KPDA 2GM4A 1OR8A 2PPVA 2IW1A 5GGXA 1Y3IA 3RRZA 2PEYA 1RIFA 2C2WA 1NHGA 3HP7A 4RSHA 5KCZA 3O9VA 1QYCA 3B1VA 1EM8B 4LYGA 5HIIA 4PEVA 2AX4A 2CVZA 2OUKA 3ORFA 3HDQA 4LDJA 4X6YA 2M9MA 2IZZA 4R9UC 5I47A 1A97A 4MQFA 1KE2A 2LZ0A 1V48A 1WZIA 1Y4UA 2GGSA 5CLHA 3L05A 1J39A 3TCXB 3NYIA 1OASA 4TWBA 3GDOA 1FF9A 2ORED 2VLBA 2FCAA 1GYRA 5ALKA 2N9UA 2OSVA 1MT3A 2AXPA 2NUPB 2Z3WA 3AERB 1HQDA 3FSJX 4OQ4A 5DYNA 2OFOA 5M5BA 4KR2A 2ZETA 5A02A 4GEKA 4XGRA 3LOPA 4DDTA 1DZ3A 2BRUC 3OLQA 3OTQA 5BOVA 3C4JA 3FKSA 4W1SA 4EAAA 4NTZA 5FWXB 1B14A 1E2KA 2R4TA 3ZLBA 2DWUA 4F5YA 5JS8A 4L4ZA 3VR5H 5A04A 5B7PA 3JW8A 4RS4A 3U49A 4NCHA 4BFLA 4RZIA 1PJBA 4JEHA 4EHFA 2DPGA 1PZHA 3C3AA 3C5WP 4QUAA 5BYJA 4ZTBA 3PNOA 1O94A 4KHZA 4GLBA 5JQGF 1LK0A 3E7WA 1AN0A 4CG0A 3EEOA 1E7RA 3TUJC 1COWD 2XOXA 4I81A 2AQHA 2AR7A 4LOJA 3AVOA 3O8NA 3L6CA 1RQ2A 3LDUA 4PANA 4YVFA 1EGQA 4RL6A 16PKA 2IFTA 2INGX 1CG6A 4J3JA 5KJFA 3EIFA 2C7GA 5IBPA 1QTIA 2PZFA 2WKWA 4X1IA 3OCUA 1LJUA 1LXCA 2Y1WA 3HDJA 5F4ZA 2G6TA 4FOSA 5HFJA 1XJWA 3BIJA 1E2IA 4E31A 1D6MA 5DB4A 1IBRA 5BMVF 3AIOA 3I64A 4CM3A 5FHRA 3ZVMA 3KJFA 1AIPA 3N3BC 2IHKA 1Y1KE 2IHYA 9LDTA 5TV2A 1DTWB 3P5BA 4CL0A 5G02A 5TNXA 1V3UA 5ECYA 4JI5B 3EXAA 3RHTA 1YZLA 4PTYA 3KYBA 4FUTA 4P32A 4YUAA 2OXEA 4TRMA 2PS0A 1L8XA 2EGHA 2ZKLA 4EI8A 1QGOA 3ZCXA 2BF4A 4RVNA 2EBUA 5BNIA 1ND5A 1OWPA 1FDOA 3FDXA 5ISMA 3DZBA 1E6EA 5KSOA 5FO0A 5BURA 3PXGA 4ZXFA 1EWKA 4X1OA 4JBHA 4R6WA 1I36A 3OCXA 2B78A 4M1YA 5AKGA 3WWYA 2AZMA 3QVOA 3UN1A 4BO5A 3IURA 5KUTA 3U9TA 4J2TA 3AR8A 4GBJA 2R7LA 4Q9KA 2C77A 3WTCA 4ENSA 2Y99A 1OGIA 3ER9A 2C7RA 1T3ZA 4V3BA 1M0WA 3EGVA 3PE4A 1US8B 4ND3A 1MT0A 1FRQA 1XCJA 1K6XA 3R7WB 4HDMA 3RSGA 4CTKA 1FZTA 1FTSA 4LRSB 1LRKA 4FNAA 3N8DA 4TXMA 4NYJQ 1GKKA 3L0IB 4MVYA 4QJ3A 3AKZA 4YI5A 3U48A 3ZZUA 1W30A 3LBIA 3TW0A 1VB3A 4F2GA 1SBHA 1N5KA 3K70D 1S1MA 4G0NA 3OKFA 3K6RA 2WT9A 3GLRA 3CF6R 4WBNB 5L3SB 4KN6A 2BDEA 1M7BA 3GEDA 3P2OA 5E7MA 3L18A 4EO9A 1SJ9A 1TPZA 2VF4X 4RWEA 1X1AA 2O6HA 3F78A 1NR5A 3DTVD 1X7ZB 2HJVA 3Q0EA 4PNZA 3DW1X 4BB5A 1N1EA 3NHLA 1ZSYA 3ABZA 4QUHA 5HPYB 5K8IA 1KS2A 1XD9A 4IHAA 5K01A 4YBRA 1ISPA 4MKHA 2PKEA 4O08A 3R7SA 5CHEA 3CV3A 3AIMA 1R0SA 3Q4GA 2GD1O 5KYGA 4AYXA 1EXDA 4CMEA 4CTJA 2AVNA 1YUBA 1ORTA 3AEZA 5HX7A 1OXXK 2X23A 4OHOA 1US8A 4CHTA 1PP4A 2C9BA 1R6TA 2R8YA 4E07A 3KXLA 1H1LA 3IVAA 3OFNA 1V2HE 2G70A 4KCGA 5FADA 3RH0A 5KTSA 2MINA 1KMCA 1V95A 3OJ0A 1JWAB 3L6UA 4MUYA 4RXUA 4QUDA 4LF8B 4OLAA 2PWPA 4DB2A 3QLUC 5B7GA 1OX4B 2IY9A 1VKRA 3QE0A 3RJ5A 4D8XA 4Q3LA 2OYRA 5D5PA 1SVOA 1OU4A 1QE5A 3ZWAA 3GZJA 1LB1B 3U26A 3H9EO 3DOUA 2CF6A 3OHMA 3ZWVA 5EUQB 3B6EA 4UW9A 3DVLA 3K72B 3ZU3A 1G3UA 4MIKA 1I4EB 3VPGA 2P2ZA 5I6DA 1Q0SA 1YA4A 4XYBA 3LC1O 4JP5A 2WICA 4YRFA 5ALLA 3D6JA 3SS7X 3U1TA 3UMVA 1NMSA 3P2KA 5A2QA 1HDYA 3DJYA 5AKHA 3LE8A 3WTBA 4TWAA 2OGZA 1DARA 1SY7A 1C80A 3G02A 4FFVA 5A3VA 4B5KA 5COBA 2RK3A 3OZXA 3PXEA 4KZKA 2CVHA 1X0XA 4LHEA 4F60A 1P0PA 1IL0A 3NOQA 5F1YA 4BCBA 4YRDA 3WRVA 1A7UA 1ZIDA 1T0UA 3A3NA 1JR6A 3AG5A 2WTUA 3NG1A 2BUBA 2RHHA 3O91A 2NTYC 3OIFA 5ITVA 3GLFB 2O8FA 5TS3A 2OO5A 3VGJA 4Q18A 4P2GA 4CR7A 3SM3A 4ZZIA 4B84A 5BUQA 3Q6MA 4J8PA 2DPHA 5ESWA 1J8MF 1UC4B 1JHDA 1I1QB 3A26A 3OOWA 4MQ5A 1IVNA 2LXNA 5EAIA 4U5QA 2HYDA 3IAM1 4MDEA 4NK5A 3NR2A 3R9XA 1UEXC 1RS0A 4GGMX 2PGOA 4QG7A 3EVZA 3OM8A 3DZ8A 1EFVA 3WLEA 1W93A 2SECE 5LYJB 4BFZA 1NP7A 1E1DA 5K7SA 1U2DA 3RVJA 4AKSA 4E14A 3ZGVA 4A0QA 4GOOD 3DVAA 4Q12A 2W5UA 4BC0A 3U7QA 4LRUA 5DI3A 4JEMA 3EWIA 5CEFA 2QQ0A 4HWSA 4OHXA 3G89A 4LJ6A 5EMLA 4Q1DA 3CXRA 3V1MA 4BV8A 1H8ED 1LC0A 2HA2A 2YIJA 3UHJA 5PNTA 3RS7A 1I4OA 3LY5A 2J5RA 1J7JA 3C14C 4WZBA 2RGWA 4YTEA 3V2IA 1SCIA 1TYEB 4BAUA 3W4IA 4BE7B 4B3TB 2PH7A 5EXTA 1AKNA 2XOKD 4NHEA 2C1ZA 3ZQKA 3NV7A 3NHBA 3Q72A 1QQBA 2B4KA 1GU7A 1NKTA 2FYTA 2G4CA 1IN5A 3FPKA 2H7VA 2OC4A 3IKMB 3OIUA 4YC7A 2YW2A 5B12A 1PG5A 4X64B 2NOAA 1CUAA 1JQ3A 1JPNA 3S70A 3FFWA 1OPXA 2XMZA 2ZUVA 2H06A 2WTEA 2VYFA 1E99A 4BPBA 3EJ6A 4KRGA 1B8OA 2YQ5A 4AF6A 3KVRA 2Y0BA 3FNEA 1JAZA 1K88A 4X3CA 5DBFA 4WN3A 1DAKA 2CK3A 3BTOA 2CXQA 1OFIA 3AERA 1KKLA 1ETHA 3WBKA 1K4KA 1K4MA 1YRYE 2AMYA 3QSGA 4KC0A 5CA0F 1RBMA 5EZ5A 2O7RA 2XJ4A 2ZEJA 3IGFA 4HAYA 5KTPA 2HSEA 3ZE2B 5LQNA 3I53A 1JG3A 4A2CA 1O95C 1V4NA 1SKUA 1KYTA 3JCZA 3K30A 5ALQA 3Q2KA 2FPMA 3LF2A 1PJSA 4L6AA 4X44A 5D6NA 2VJCA 1A7AA 2JPDA 3DFZA 3U4IA 5AM4A 3HO1A 4BNNA 2ERYA 4GU5A 5DOVA 4TXHA 4J0DA 5I4IA 3D2CA 3L5KA 1E5TA 1FUKA 1R4MA 1T0BA 5MGBA 2F6RA 4GKJB 1QG2A 4P3OA 2GUWA 2EFDB 1P72A 3H2GA 1Y9ZA 1EVYA 4ZC1A 3RKSA 4L74A 4KVFA 2X1LA 3DBHB 1B3BA 1BWRA 1IYZA 1G6Q1 3VZPA 5ADUS 1BDJA 3ZV6A 1P0QA 3M6VA 3NVKI 2PV7A 4RXTA 1B73A 4NENB 4OX9Y 5CXUA 3FHLA 3DDUA 4M89A 2BSAA 1TLTA 2VOJA 4GOKA 1HK7A 4IDEA 1QVZA 1GL7A 2PL3A 3D8NA 3HVHA 2XQKA 2DBRA 4NCKA 4QICA 2CSXA 1UXHA 4N41A 2IBMA 1GTMA 1S8OA 1Z4MA 2FW1A 1G8PA 4QDZA 4HNAB 2ZAMA 3EAQA 4R2XA 1GQQA 3R5XA 1JQAA 3KDSE 1J42A 2Q1UA 3M70A 1C1XA 3T7SA 1O95A 2ZR9A 3H6GA 3VR2A 4BNLA 2DUJA 3I3OA 1G3MA 4LWZA 2FUG1 4QTZA 4XGQA 4CKYA 3SY8A 2D1YA 4EZEA 1QGYA 3JVVA 1Z4PX 2XKKA 2QRJA 2PX5A 4CEHB 3OC6A 1AKEA 2Q5HA 1FTNA 4C89A 2ZSEA 3EWSA 1KVSA 1KZGB 1Z8DA 5K45A 4I50B 3K0FB 3G9QA 1ZVQA 1CHNA 1UPFA 5I9BA 2PUHA 1FL9A 1SIOA 1DC7A 1LSOA 1GLVA 1P9NA 1A69A 2YV5A 3PNBA 3H7AA 4GOLD 5BMVA 2PLNA 1HE8B 5LZ9A 3EIOA 3DLBA 5FOSA 3H2HA 4Q1FA 3N58A 2XHEA 4G1FA 3Q11A 4QG3A 4Q4CA 4BPRA 4J16A 1FLNA 3CEHA 3DAHA 2WJHA 2WKRA 1RLOA 5EIBD 1NJSA 1PWEA 1Z06A 3H13A 4TM8A 4I46A 2AXNA 5G3ZA 5EKTA 5SY9A 4UXJA 2RI0A 4D3XA 1SCAA 1TCVA 4BQQA 2C95A 2ZVPX 3EZ9A 5D51S 2W2LD 1KYIA 2FV8A 1QKIA 1YZYA 2VJQA 4IDFA 1BXKA 1B42A 1LK5A 1WULS 3ETEA 1X38A 4HX5A 4RY8A 3WBBA 4QARA 1C9DB 3V3TA 2GVZC 3IFSA 4P3PA 3UFBA 4E3ZA 3WB1A 1LZKA 1O57A 1HYHA 1NP3A 1C8KA 1NW6A 1N4DA 2SKCA 2PZBA 2X5KO 3PFWO 4J3FA 3KDPA 5L40A 4YCAA 5E95A 2PGDA 2PTHA 3P19A 4QLOA 1U4OA 5ETJA 1L9KA 1QFXA 4W9MC 4HKTA 4JC0A 1XAGA 5CM2Z 1YQ9A 4FCCA 4OXYA 1RRVA 3OQIA 2BUAA 1G6HA 4FYPA 1CT9A 2O8DA 5K9ZA 2G5PA 2WRZA 2JD2A 1OI2A 4H3SA 1Y42X 3Q12A 4WJZA 5JT1A 5LCXA 4A3SA 2PZ8A 3ANNA 4N9QA 5AICA 2ACWA 3EXHC 2MINB 2VJMB 5JJKA 4KDFA 4EJFA 3QU4A 3OZ7A 1JZQA 1MNAA 4M1OA 1QYRA 3NWOA 4QOIA 2GARA 3FWPA 5TMEA 4BKPA 4R84A 4TYWA 4B7AA 2EW8A 2Q9AA 4F3NA 1WNTA 1Q7CA 5K4AA 1VHLA 3UC5A 3EVBA 1CJKC 3H4TA 5JJCA 1ABBA 3Q8KA 2RGAA 3N74A 1GR1A 3VR3A 4FLFA 3ZCPA 3FHTA 2CV0A 2DTXA 3H2JA 4JVNA 4G5OA 1GPMA 3CX6A 1DIRA 1FX1A 4C05A 2IZ0A 8AT1A 1U3WA 1WBJB 2F1RA 1CLEA 1YR2A 2WP0A 3O84A 4Y2UA 4Z6KA 2WZBA 1NUTA 1JG1A 4F91B 1XDZA 3NRBA 5DGDA 4CLRB 2F48A 4Q3KA 1LLCA 4OFBA 5ECDA 5KVQA 3GG2A 4HC4A 2O5VA 4O3MA 2I2AA 3KSDO 1AJEA 4B35A 1PT9A 4WCFA 1VPWA 4B7CA 4G09A 4U2KA 5K0ZA 1KMHA 3D8HA 3RYCA 4C6HA 1OI4A 2VH5R 1U0JA 5EINA 4Y6SA 2QLFA 4BMOB 1IJKA 5EJ6A 2X5OA 3IE1A 1JTEA 4QLBA 1XN1A 1ESCA 2AJCA 2P4UA 2WFMA 3HS3A 4OHUA 4RTKA 3RARA 1AX9A 2GFQA 4NG5A 2NXNA 3S28A 3CB2A 2FLVA 4WESB 4XE5A 5AXCA 3ROMA 4ALMA 1ZVVA 4LYDA 4WRRA 5COQA 2IH5A 3ZWNA 1KBOA 4I50A 2NPIA 1QZXA 3IMKA 1BX0A 1E3JA 3EGIA 4DN6A 5KOJA 3HI6A 5JLAA 5KC8A 1BKDR 3LGXA 1BCSB 3K0KA 1Z4NA 3L9WA 4TKVB 2WBLC 4L3WA 5E6UB 1ISJA 4XUCA 1KH1A 2FFHA 5JH7B 3TLGA 1QOQB 1YZUA 2QK4A 4Q03A 5FYQA 3T4XA 3AEQB 4L07A 1E2FA 2Q21A 3VTAA 4ZDKA 4NCAA 2GPNA 3PXBA 3HO8A 3WMWA 2C4NA 1AN9A 2IEDA 2HQSA 2NZUG 3BJZA 3F67A 5CVJA 1H5UA 4ESVA 1OXUA 5B3JA 1W5AA 5IWCA 3I8OA 3G8AA 3B85A 3GNSA 3KEMA 5JZ9A 3GP8A 1Z4JA 1JEOA 1SOUA 2E0IA 2HWUA 4HAXA 4XDHA 2WIAA 4CG2A 1K8ZB 2BEWB 3ZW8A 5AW9A 4Y6RA 3QLJA 1LQ2A 2A3RA 1TM7E 1UKBA 2DVMA 2EWWA 3PX3A 3V8VA 2JGFA 4I1UA 1E9DA 1NUAA 1U7PA 1E2MA 1PK9A 1WW2A 4RTNA 1DBWA 2OCAA 1XAJA 1ZL2A 2PSSA 4BNKA 3ZG6A 3NDIA 3TIXB 3K6JA 2J6HA 4XZ3A 4YCDA 5T6MA 4RXMA 1Z47A 2XUPA 1MZVA 4HRYA 4RPIA 1QGED 2WUVA 2I67A 3N76A 5E1OA 4ESEA 5KNCA 5EIBC 5TQ2B 1J0CA 1JXOA 2FSVA 3M6IA 3P2IA 2NLOA 4RVOA 3V33A 5DPMA 4RMNA 3ADKA 3WMGA 1IN6A 1Z4OA 4RKEA 1VFPA 1XWFA 2NU6A 3LPNA 4MAMA 5EXXA 1JDJA 1RXIA 4YT2A 5ICCA 1DDOA 2O3QA 4NS1A 1E3QA 2D5CA 1MB2A 2QZ4A 1EI9A 1MIHA 2IPOA 5TPZD 3F5QA 4TVKA 5KO2A 3T3HA 4LX8A 2FWNA 2ZT5A 5EFZA 1NJ8A 1SK9A 1OBHA 1ZUWA 2GXUA 3JQBC 4GPZA 5D3ZA 5HF9A 3SP1A 3OZCA 5FLKA 3ON5A 5KBYA 2D3TA 4YJ2F 4GT1A 1FS5A 1PJ4A 5ILOA 1KIAA 1L6IA 3F3MA 4MQEA 4OHRA 5JG7A 3VHXA 3WG9A 4N39A 3DMTC 3ADBA 1C7FA 1P0FA 4EHKA 4DV7B 5J4LA 1RHKA 1PNRA 2Y1EA 2VNJA 1VJ5A 1P2GA 2G9NA 3PSAA 2O57A 2ZT6A 4AI6A 4DA0A 1LPOA 2OCXA 1VKZA 1CS0A 1N2XA 2V0CA 3DQZA 1IN4A 2W2LA 3CSUA 2IHTA 4HPJB 1VBKA 4Q02A 1DNPA 2CE7A 3MT0A 1NTOA 2WU4A 1SVKA 5FL7D 4FWTA 2PNFA 1T34A 3IPXA 4UU1A 4TV9A 5A7GA 1JFLA 2XT6A 3EVTA 1L5NA 4JWKA 4N3NA 4XRGA 3O8QB 4ENTA 1U2SA 1SIWA 2AH5A 3DOEA 1R3UA 4DQLA 2YWCA 3BMQA 4B46A 4TLEA 3A2LA 1CQJA 1Y48E 3E1KA 1XTTA 1TAGA 2VRCA 3ZE1B 4NC9A 4BASA 4BOYA 8GPBA 2RK6A 5LA6A 4J9UE 2I29A 4D4GA 2PU5A 1J90A 1JX6A 2JIQA 1H1LB 4Z3OA 2HFKA 2QV7A 3F1LA 4YMTA 2R1TB 2HLPA 1UZLA 2KLBA 1CS4C 1UJ6A 1YACA 2Q3HA 2QN8A 2XQIA 4RACA 1Q0UA 5A3QA 1WB9A 5K09A 1X1EA 1OKKA 3I09A 3TQCA 3ZU2A 1WKBA 1CZOA 1OX4A 1D2CA 2FA9A 1JFSA 1DLIA 1PYGA 2MJLA 2JGAA 5CFZA 3KYCB 5AHKA 5KTYA 1MHTA 2CLDX 1JIJA 1TEHA 3IEIA 5DHPA 1XZEA 2ZSBA 3C3JA 4XIJA 3W7VA 3HNPA 2R66A 1GDHA 3PQ4A 3T8YA 3UTDA 2IP2A 4BNVA 3RVBA 2BGIA 2FJ0A 3MBKA 1K7EB 3B78A 2FHSA 2IELA 3SJBA 2P9FA 3KUXA 3T61A 3IPCA 3Q5GA 2HJWA 4TQGA 1SQSA 1KY4A 5FI0B 3RAPR 3FPEA 4NSNA 5E6RA 2Y1FA 4C2TA 1ORWA 3A4IA 4XQCA 3FM9A 2CXPA 5ES3A 5FQNA 1YS9A</