1U1DA

Structure of e. coli uridine phosphorylase complexed to 5-(phenylthio)acyclouridine (ptau)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
253
structure length
253
Chain Sequence
MSKSDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uridine phosphorylase
publication title Structural basis for inhibition of Escherichia coli uridine phosphorylase by 5-substituted acyclouridines.
pubmed doi rcsb
source organism Escherichia coli
total genus 86
structure length 253
sequence length 253
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1u1dA00
2Q7OE 1ULBA 1NW4A 4E1VA 1TCVA 3UT6A 4WKCA 1PW7A 1JYSA 4WKNA 1RFGE 3NM4A 2GUWA 4U2KA 4DAEA 1C3XA 4DA7A 1ODJA 3FB1A 2HN9A 1RSZA 2H8GA 4LNAA 4L5CA 1OU4A 1T0UA 2AI2A 4D8XA 1JE0A 1TD1A 1RCTE 2HWUA 3O4VA 1VHWA 1QE5A 1A9SA 1LX7A 3KVRA 1VHJA 3O6VA 5IFKA 2ISCA 1A9QA 2OXFA 4GLJA 1A9RA 5F78A 1U1GA 4R2XA 4MCHA 4TYMA 5F77A 1Q1GA 4P54A 4R2WA 3UAYA 5CXQA 4M3NA 4JP5A 5CYGA 1OTXA 3E9RA 5CCEA 4G89A 3ONVA 5ETJA 4ECEA 1G2OA 4TXMA 4JWTA 5EPUA 1JDSA 1PR0A 1WTAA 1T8YA 3K8OE 5F7ZA 2OC4A 4RJ2A 1A9TA 5F73A 1YBFA 3ENZA 3DF9A 2QSUA 1Z38A 4DA0A 2B94A 4LKRA 1U1DA 5IU6A 4JOSA 1JDZA 3ODGA 1T8SA 2A8YA 4LZWA 5C80A 4D98A 4I2VA 4TTAA 3OZBA 1JDTA 3KUKA 4YO8A 1PR2A 3BGSA 4TXJA 5K1ZA 1ODKA 1Z35A 3NM6B 5B7GA 5KB3A 3C74A 4WKOA 3E0QA 2OC9A 1U1FA 4OF4A 3LBAA 3DDOA 4OGKA 5F7OA 4H1TA 4K6OA 3PNSA 4G8JA 3NBQA 4D8YA 4X24A 1OUMA 2ON6A 2A0XA 4QARA 1RYZA 1PR6A 1FXUA 5I3CA 1OVGA 1A9PA 1Z5NA 4OGLA 4L5AA 1TGVA 3GB9A 4KN5A 3QPBA 1YQUA 1T8RA 4YJKA 1Z33A 2PGAA 3FUCA 3K8QA 4WKPA 1Z39A 3P0EA 4BMXA 1SD2A 1U1CA 3DJFA 4MCIA 4TXNA 1JE1A 1JDUA 3LA8A 4BN0A 3DPSA 4EB8A 4F2WA 1B8NA 1PR4A 4UC0A 5F7XA 3KVYA 3PHCA 2OECA 1ODLA 4LNHA 2AI1A 1RXCA 3DP9A 3F8WA 1OV6A 4QATA 3NM5A 3D1VA 4F3CA 1K27A 2IQ5A 3LGSA 2QDKA 1V4NA 1Z5PA 3UAVA 1A69A 4QASA 1U1EA 2I4TA 1PK7A 4TTIA 3MB8A 4OY3A 3IEXA 1JP7A 1Y1SA 4TTJA 1LV8A 3OF3A 1K3FA 5EUBA 2RJ3A 3OOHA 1CB0A 1NC3A 3EUEA 1ULAA 1VFNA 3UAZA 3MMSA 3BJEA 1PBNA 3KHSA 1Z37A 3FWPA 4GLFA 4QEZA 4NS1A 5B7NA 4NY1A 3PHBE 4R31A 3BL6A 1K9SA 2AI3A 1V48A 3E9ZA 3PNPA 3FAZA 3U40A 2QPLA 3P0FA 1PR1A 1SD1A 4QAQA 1VMKA 1PKEA 3OZCA 5B7QA 2HSWA 1V45E 4BMZA 5FAKA 4FFSA 1PF7E 1I80A 5F76A 4MARA 1RXYA 3EMVA 4OJTA 5JPCA 4L5YA 1ODIA 4G41A 3INYA 2I8AA 4YNBA 1OTYA 5CYFA 5CCDA 3EUFA 4BMYA 1NC1A 4QFBA 1PWYE 3UAWA 5F7JA 4D8VA 4OEHA 4IP0A 1A9OA 5EFOA 1LVUA 2A0WA 4DARA 1TCUA 4YMLA 3OOEA 2BSXA 4TXLA 1ECPA 4M7WA 1V41E 4DABA 4F2PA 3UAXA 3KU4A 3FNQA 2P4SA 4L0MA 1RR6A 1RXSA 4DA6A 3BSFA 1Z5OA 5B7PA 4F1WA 4TS3A 4DAOA 4DA8A 1RT9A 3OZEA 1JDVA 3KVVA 2QTGA 1ZOSA 1Y1QA 1V3QE 1CG6A 3OCCA 1N3IA 4PNPA 1SQ6A 4EARA 3GGSA 1Z34A 4D9HA 1TGYA 1PK9A 1Y1TA 3EEIA 1JPVA 3OPVA 4M1EA 1Z36A 5CXSA 1Y6QA 3SCZA 3TL6A 4TS9A 2HRDA 4GKAA 2A0YA 2QTTA 1YQQA 3FOWA 1RXUA 1ZL2A 4F3KA 1V2HE 1PR5A 3IOMA 4L6IA 3OZDA 4LDNA 1YR3A 5DK6A 3T94A 1B8OA 4GMHA 4DANA 4TXHA 1M73E 1SJ9A 1Y1RA 1YRYE 4WKBA 2AC7A 1XE3A 4PR3A 4NSNA 1T8WA 1Y6RA 2XRFA
chains in the Genus database with same CATH superfamily
4LDPA 1WUIS 4GZ6A 3BGWA 4NFLA 4RVCA 2B1RA 3EJ6A 4JH0A 4XEUA 1Q0TA 3MHTA 2H5EA 3A3OA 1H2WA 1I7LA 1SUFA 1C3OA 1UOPA 4DDHA 3L49A 2OM6A 1IK6A 3ZU3A 3U31A 1V4BA 1H1DA 2LD4A 3ESQA 3V1NA 1GTRA 1ZIDA 3AB7A 1N2CA 4OFXA 721PA 1O6GA 1STOA 3A1CA 3C70A 2HM7A 2R1VB 1UPUA 5ICGA 2CXQA 4ZAVA 3IVCA 4YR7A 1UBNA 1TTTA 2JAQA 2BUBA 3RARA 1O94A 1R16A 3GQBA 5LOVA 1J8YF 3D1JA 1L4HA 1LBTA 1KY2A 2F43B 4Q6BA 4LFCB 1CUFA 1TA9A 4Y0NA 5LWHA 4QT4A 1YAHA 4XGNA 1C0PA 1XQXA 3MOIA 4ZEVA 4CLHA 4LE0A 1C1XB 4X8LA 4HNHA 4JJ7A 4OLHA 3WTBA 1MV8A 3HCEA 4KU4A 2AI2A 3PUZA 2C3UA 5F2KA 1UP4A 3F2VA 1DX4A 3IJ5A 3O91A 4RV9A 1LWNA 2XDWA 5AW5A 5AKYA 3I53A 1XZEA 3R24A 2RHWA 4N0EA 1ZOOA 4DVGA 4N39A 2IPLA 2F1JA 1FE8A 3SBXA 5C0OE 3C3YA 4CM7A 2GRAA 4R3NA 2WSSD 3A36A 2NX2A 2POQX 4WZAB 1NRWA 1Z0IA 2A9QA 3WGKA 5IN5A 3G2NA 4WGGA 3KB6A 4OV6B 3QF4A 4H59A 3ILXA 1U3DA 1H8EA 1WX1A 4GRAA 4WK4B 2J87A 3C3JA 1F48A 3KDPA 4RQBA 1A9QA 2YC2C 4I1PA 2FDCA 2ZITA 1CJMA 2ANCA 2ZS7A 4JLVA 4FOTA 4YJHB 5TQ2A 1P73A 5IKEA 3NHKA 4Y1GA 4UUOA 2P5YA 4CF7A 2V03A 4RO0A 1FIUA 1UBUS 3FMGA 2V7VA 4TLBA 4XIYA 2YKGA 5K8TA 1KNQA 2HRZA 1NXVA 2I0FA 3NBUA 3KLOA 4FLMA 5F12A 2FN4A 2JIQA 5F77A 4YV7A 2VDWA 3H9GA 1R15A 4REMA 3TSAA 1DBRA 5DBGA 3LCCA 5BSTA 4TS1A 1Q6ZA 3IKLA 5LC1A 4INOA 3Q15C 5HE8A 8MHTA 3DDSA 3K05A 3FTPA 2IEBA 2XVAA 2XWQA 1OTXA 2VO1A 4L3OA 1A50B 1EX6A 2W0SA 4B4UA 2JLVA 4YRAA 3ONVA 2XUJA 4OYRA 4RYLA 4JLDA 3SJZA 2JFOA 2B35A 4US2R 3W8DA 2DWQA 3GA0A 2G08A 4J91A 1PG0A 4J4BA 1UDRA 1H66A 1KXJA 1WMFA 3DZBA 5HR5A 3UTCA 2EF0A 3LF2A 1T8YA 1A27A 1B43A 1C3OB 1UFQA 4P4GA 4RA6A 2Y1GA 3JU3A 5TC4A 3PQ8A 3QKIA 5B3AA 1QGZA 2WZBA 1N2CB 3EZLA 1NYQA 2AUMA 4RJKA 1XWIA 2NUBA 1S8NA 1E6EA 2H4HA 1YBFA 3UK0A 1G7SA 1NZDA 1ZRNA 2P5UA 1TZJA 2QRQA 3GRKA 2OFXA 4DE5A 3A9CA 2FKAA 3K9CA 3NEAA 3QV1A 3SE0A 5GZ3A 3GQBB 5CIYA 2ORED 1QP0A 2PZKA 2YMMA 2XYVA 4H18A 1H1LA 2UZIR 1PNVA 2O57A 3WOHA 4JLSA 3SJUA 4CG3A 4W5HA 3FMIA 1EK6A 1U6KA 3PWKA 4JYBA 3VNVA 2JFGA 4FUTA 5A3QA 2FWNA 2WZDA 4C08A 1I2DA 3E5RA 5AP9A 1KRXA 2ZJ8A 1N2HA 2Z2XA 2QG9A 2G28A 1KVTA 1MAHA 1PVVA 1Q50A 3GAMA 4HWKA 2O9JA 3VUFA 3PJRA 4OQPA 4BJ1A 1AA6A 1K5DA 4XSVA 1K3UB 1MO2A 4TXJA 1BYUA 3DSRA 4X85A 5C3MA 1RADA 2B7LA 2YXNA 3N8GA 5K8UA 5FA5A 1R64A 1E1DA 1P1FA 3CUVA 2NU7A 1NW3A 3QF4B 1Z8HA 2P40A 3AFHA 3DZCA 4PGFA 3VR0A 1RTKA 1CJVC 4EHIA 2F1RA 1GZHB 1G6HA 2C8LA 3T52A 4IFIA 4EG0A 4Q16A 2OYRA 3M6UA 3JX9A 1CLUA 5TQ2B 2OC9A 2P41A 3WGJA 4BVBA 1PEKE 1PX2A 4OF4A 3TAXA 3L0OA 5CX1A 2I8LA 1S2DA 3WJAA 4Q48A 1UPTA 2Z58A 1B41A 4MYDA 3RF6A 3VAYA 5JD6A 1M8KA 2CF6A 3F4KA 3GC6A 3IR5A 5G0UA 2VDWB 4G5XA 4Q3CA 4QE3A 3TUJC 4C88A 4H1TA 1UOOA 5JDIA 3PNSA 3TUZC 3VO8A 1GL7A 1C14A 3WIDA 3QTBA 3RG2A 4TV8A 1A2KC 1IOWA 4PAMA 5DYWA 4NG4A 1MT0A 4PANA 2D1SA 3PFGA 2ON6A 1EDZA 2VHZA 4E5NA 1ICIA 2WLSA 4YDQA 4WWHA 3BX1A 4JJFA 4NFSA 4R68A 3VDRA 3L7YA 2Z9CA 1NN5A 1EFCA 1T2VA 2GASA 2P2ZA 1L7BA 3CF6R 3D6TB 4PZ9A 4RPJA 1K66A 2N0SA 4WXHA 4XTCS 5D51S 2IUTA 2PGIA 1GA6A 5HIIA 3LPAA 4FUQA 2X2EA 1JZSA 2YICA 3AG5A 3BM5A 1MFZA 4RA6B 1PKXA 1H6DA 3TRDA 2JLAA 3LOQA 2OQRA 3PFCA 1TI7A 5TQ0A 4IXMA 4YRGA 5BT8A 3LO5A 3BGDA 2XXJA 4I55A 2J3JA 4LISA 1S2OA 2FB9A 3CLTD 3VVLA 1V6SA 2CNWD 1LFDB 4O29A 4OI2A 2J3IA 1D7AA 2DECA 3U49A 1ZUIA 4J7CA 4C76A 2Q5HA 3DXYA 4P3OA 2X0EA 3CVOA 1M0WA 2BKEA 1H1LB 1QC5A 1VG9B 2UXBB 5EIHA 3C3PA 3USES 3P8ZA 4C0AC 1D4OA 1GSHA 2RCYA 5HFNA 1Z39A 2P0EA 3GJRA 2VXBA 1S1CA 2FSSA 2QP9X 4MO9A 1D0VA 1XVTA 1H4TA 1M2GA 3QF7A 4RTMA 4AP5A 3LI2A 4AMUA 5COQA 3CJRA 4UPEA 3WYDA 4CQMA 5CJPA 1Y3CE 1R74A 2PR2A 3TL3A 4E21A 3FOCA 1MW8X 4LCBA 4BN0A 4KXQA 2CW5A 4Y2GA 4PQGA 3OJOA 4KQ9A 1PNOA 1HE4A 2EWWA 3FBWA 4IL5A 4ZOQI 4TWJA 1JPNA 1E6MA 2PYZA 3GJ5A 2NU7B 4DIMA 5HS6A 1ZH8A 4J0FA 4RVFA 2I4MA 3IDZA 3BTUA 2XYQA 4RK6A 3QXSA 2C5SA 3L7CA 1FEZA 3PXEA 5EJMA 4CN9A 3EIWA 4MVXA 1ZN7A 1EGQA 1CJSA 5K3DA 3CSDA 1ZR4A 3Q7PA 3WFZA 3IURA 4KIUA 4C14A 2H29A 3B6ZA 3QXCA 1P9OA 3NM5A 5CX1B 4Z9XA 2XXAA 1Q0UA 1V7PC 3NLLA 1MDBA 1YZYA 1JHYA 1X8XA 3C3AA 2FRVA 2VJDA 4QUAA 3VXKA 4CIVA 5AVJA 1CY7A 4HB0A 1XB2A 4DBLC 1L3BA 3YASA 1Z47A 2VSFA 4U7JA 1HZJA 2PT6A 4RVNA 1F06A 4YXWD 5LBUA 5IDYA 1F8FA 3K9BA 3QFSA 4TV8B 1BMTA 4WXRA 2XE6A 1PGPA 1R4NA 2FRDA 2D0PB 4DDUA 3CSSA 3RUAA 3JW8A 3K15A 4N0DA 3PYLA 1KARA 3TEMA 1IMJA 3KSDO 3PFIA 1TEZA 4QXQA 2HZBA 1GQRA 4PHGA 1HQCA 5EXDA 3S70A 2PTHA 3VAAA 2GZ1A 1T2DA 1JG1A 1SVOA 1KI3A 1VL5A 3DYVA 2WWGA 2X15A 1PQYA 3EZ6A 2P78A 4G01B 1DOHA 4UAVA 3VR5A 4EBBA 2R0QC 3UY4A 4FHZA 3B1ZA 5TQ0B 1JBKA 3KHSA 4M55A 4YEDA 4FDMA 4I55B 3ENVA 1YKFA 4I99A 4KO1S 2P90A 1O1YA 2PXXA 1KP3A 2HIMA 4ZC1A 1XZNA 5EJ4A 1CE8A 2ZYTX 4UOQA 5EHQA 4P6VF 1UKYA 2V45A 4A2PA 2WYIA 1N77A 1QC5B 4LRXA 1QIIA 2ZRLA 3U6KA 3BL6A 3G0CA 3N3AC 4MIEA 2JHPA 4KPGA 2JNWA 1T5TA 4GFDA 4ZOBA 2R5FA 3WGOA 4ITVA 1E3QA 4C06A 3S5UA 5K05A 4RAQA 3TMAA 1KKLA 2AG8A 3E05A 3W3ZB 2ZVPX 2AOTB 1FFWA 3PC2A 1NLZA 2H1WA 3CIFA 1X8JA 1NE2A 3EK2A 3OE7A 4P84A 4QHYA 3WYGA 4RQAA 4CQMB 3ZY3A 3LBNA 3GLTA 3DE4X 3S3TA 5IC4A 4NAUA 5AM5A 3IQFA 3B6KA 2IH5A 5JRDS 5CNIA 3DFZA 1QOZA 2WG2A 2ZCJA 1MJ5A 1VHTA 4LGMA 3T4UA 1RZ3A 4M0KA 4RNDB 4BQQA 1OH8A 1PF7E 1NJ6A 1TMGE 5CGQB 1SXQA 2YFKA 3P0HA 4X90A 3MMPA 1JF8A 2Q2QA 2QM7A 5CT4A 4C4YA 2JDIA 4V03A 1BOOA 1CZHA 1EQAA 2QPAA 3OEEA 2VNAA 1C4KA 4DNPA 2XXAB 1RI1A 3UF0A 1EGMB 3HJGA 4EGQA 1S6YA 1GGMA 3UCEA 4MA5A 4YJGA 3I0NA 2O2GA 1J9GA 1PFYA 3BIFA 5LM3A 4G41A 5LP1A 1XP5A 4ND3A 1WDTA 2GDJA 1GPJA 1YDHA 4E08A 2O7NA 4JR0A 3HB7A 3TLKA 2AEJA 3QLVA 2JGMA 4NZOA 3SNHA 4D56A 4UTOA 4KAFA 4FDVA 4GYWA 3DEFA 2QTFA 3GNQA 4KXYA 5K0TA 2R68A 1GGJA 1R4NB 2D1TA 2OBLA 5JHGB 5D5PA 5KYWA 3HADA 2EFDB 3FGPA 2FK8A 3ITEA 1BMDA 3K0FA 1VB3A 1JT2A 2OZPA 3UK6A 1GZDA 3PFHA 2WU8A 3IP8A 4PCLA 5KNCA 2ZAIA 1DAEA 3K2BA 1FLAA 3LZDA 1CJTC 2WHRA 4ASUA 1P72A 3MCTA 1GCIA 1JA9A 1PJ8A 2G5CA 1CJBA 1X6VA 3D3JA 3FVRA 3Q8XB 4NNPA 4YJ3A 3S7ZA 1NAIA 1CUXA 2E4AA 1SIBE 3BE6A 3GMTA 4J1TA 4RIHA 1MQSA 4IJKA 1QOQB 1P6UA 3BJRA 2MWMA 3FFXA 4X97A 5HQJA 2FUKA 4MEBA 3URKA 1W96A 4KQHA 4M8NE 1Q7EA 4R05A 3G9QA 4ZU1X 4HF7A 1CE8B 3UVEA 2IYVA 4IWNA 4KIFA 4ZMBA 2VDJA 4C05A 3DMGA 1V9SA 2VKTA 3PK0A 2IXTA 3HK2A 3TJMA 4Q18A 3RKSA 1RR6A 3NIDB 5JYCA 4AG5A 3QXGA 5DCUA 1TVEA 3T1OA 5ALEA 3ROPA 4U7HA 3TPZA 3RW9A 4DA8A 3F9CA 4IDGA 1SVSA 1LBEA 2V6JA 4PM4A 2WKQA 4ETNA 2XQJA 3H65A 4QM7A 1O0CA 2QW0X 1KSFX 3DZGA 4FR5A 3CVYA 2I3GA 4IW3B 1N1GA 2IZOA 3EVFA 4QTXA 2N3ZA 3FWHA 1L7EA 4I8IA 4LF7B 1NXTA 5CBKA 4BQOA 3BILA 1LBIA 2Q4OA 4KSCA 2HHAA 4DIDA 1ISFA 1DQZA 4RETA 2XOEA 3WWPA 4R5MA 4N41A 4B4VA 1WV0A 2KYRA 1VTKA 2HU2A 1B14A 1E8MA 1K6MA 4HAXA 3RFFA 1YZ3A 2DCUA 4D9IA 3GFGA 1P2GA 4MMZB 5IG2A 3SR0A 3QWAA 1XDBA 3I2KA 1QG4A 1OJLA 1ZVQA 2JKVA 3C48A 3R5KA 4YJGB 5HM6A 1K9VF 3OZVA 4UUMA 1G41A 4JVMA 3TIVA 2QN1A 2GNAA 2WI8A 2Q50A 1BFKA 3OT4A 5TVKA 2ASVA 1P0CA 1QFJA 3C15C 1C3JA 4PSUA 3M4XA 4RLSA 3DMTA 1NONA 1GRNA 3QFCA 4FR2A 4MWTA 1L0BA 2FSVA 3OWXA 4Y2XA 1YB6A 5AKHA 3SEZA 3ORRA 5GJCA 3K5WA 3ICCA 4BUCA 4JYMA 3SLRA 4GF5A 4G9GA 5KUTA 5KYWB 1IXSB 4GI3A 5BY2A 3K0FB 5IDVA 5C35A 3JQBA 4PTLA 2YNMD 1UBHS 2QVLA 2NP7A 1ZEJA 3BKXA 2EYQA 2C2BA 3MJVA 1T9HA 3AY3A 5KS2A 1KAGA 3O0DA 4F3KA 3IRVA 2IQIA 1JHXA 2RK3A 4QYXA 4ZREA 4OBEA 3KJGA 5AOBA 4N5IX 4YJ3B 1E9RA 2SNIE 3D7RA 1G7CA 1OFIA 1XCMA 3MM4A 1U0EA 4QL3A 4CT5A 3DD1A 3ZZ1A 2HLDD 2WNHA 4DV7B 4PX2A 4YAKA 1NSTA 5LQCA 4L73A 3FH0A 4ZAXA 1CKEA 2QG6A 4TXHA 5HZKA 2O8CA 2PUHA 2WT4A 2Y0PA 2BEKA 2WHQA 3ELUA 1WG8A 5J2TA 4D99A 4HEQA 4R2IA 1VQ1A 5TVGA 3IPXA 1UT5A 2Q4RA 4MVJH 1LDMA 3G6WA 1BDJA 3BEOA 4KE7A 5DEIA 1BU8A 3FOEC 1E94E 1E60A 2XOKD 5BMOA 1QFYA 1CUGA 4LDZA 5JC8A 5JD5A 2EV9A 1DQSA 2WTAA 2O7RA 2ZI3A 3DEJA 4CF6A 2V4ZA 3J81k 2PT5A 1M5UA 3N7AA 1ADJA 5CVJA 3SM9A 4WL0A 4Y2VA 1TCVA 1DKOA 4KFRA 3N0XA 3TIXB 4XWOA 2AZDA 5FADA 1N7IA 1FLVA 1E1RA 3L7AA 4PZDA 3EZ2A 4N40A 3Q4GA 4IVNA 3OSZA 1EHIA 2NWQA 4OLJA 1UPFA 3MJTA 1ZN9A 4FLEA 1PJAA 1W52X 2IYQA 4KYIB 4YVFA 4D42A 4M0MA 2ZULA 5FWDA 3QVLA 1H5QA 2PZLA 3LLCA 4AO6A 3FTDA 1IG0A 1J6UA 4Q1CA 4ROTA 4QXOA 4UUQA 5AM2A 1FRNA 7AT1A 2VTKA 4NBVA 4NCXA 3IFSA 3WRXA 1OZ0A 2ZUCA 1R0LA 2QRPA 4TWBA 4C03A 1HDGO 3GDWA 5BWOA 4DXHA 4ZVKA 1KAEA 5BQXA 4Q37A 2C5EA 1MAUA 5DZSA 3ZQ6A 2VPXA 1NLFA 1MB0A 2R3SA 3CR3C 1NKSA 3BOSA 3OKAA 4D3YA 2QJOA 1QH9A 3KJHA 4DDTA 1Y6GA 1DV1A 2C7BA 3Q85A 1UBSB 2R6ZA 1TA0A 2JGEA 3FDIA 2F3RA 4HDNA 4M9ZA 2JANA 4NWIA 4B4KA 1M8JA 2PMDA 3ZCQA 2JFPA 5LOVB 3PC7A 2NO0A 1ECJA 5C2JB 5KCMA 4CL8A 1BS2A 3DS8A 3CUYA 5ESDA 4F6CA 2O06A 4CN8A 1AH2A 3L92A 4EW3A 1P7ZA 5K2OA 3V4PB 1QE5A 1F60A 4D0RA 2GVZC 1L5RA 1EHYA 4RMIA 3WGMA 4BFLA 5KMGA 4KO3S 1PSDA 3JSXA 3HYSA 4LSGA 4DNOA 1PI3A 1ZMOA 2QE7D 3IKTA 1IHOA 1VECA 2Z5FA 2V97A 3OBBA 3PPIA 3QVWA 1XMOB 2OQ2A 3ESXA 1LS6A 4IGFA 3ESZA 3DM9B 5BSVA 1ABEA 1UXKA 2GPTA 2I99A 2I55A 2A0KA 2X8WA 3G9XA 4YTEA 2G17A 2WSSA 3TB4A 4D41A 4UMVA 3KSAC 3VO9A 3CZ9A 4FFRA 1J8FA 4I8DA 1XD8A 1GA4A 5K51A 3S8MA 3I45A 4NL4H 3UGKA 2J0SA 2IV7A 4KGZA 2NQ8A 1UMDA 2X0JA 3I34X 3KHTA 3LJKA 4A4DA 2ID9A 4A6EA 1I3NA 4AXBA 1QQAA 2O8CB 1R5OA 3ESYA 5J2TB 2AVDA 3ZX5A 2PWYA 4C4AA 3ECAA 3K8YA 2VSYA 4AIIA 2O8BA 1DC7A 4JLAA 1K4MA 1P5HA 2NVOA 2XX3A 4JP1A 4DY6A 3BSSA 4L22A 2H4WA 4XRGA 2ONKA 5DMHA 3AINA 1ZJ5A 2ZJOA 4RDCA 5I9LA 4ECEA 2QAIA 4KK3A 3RHZA 1UPXA 5JBQA 2XIQA 1BFDA 4B5KA 2VPIA 3A6EA 4BQNA 4PN3A 1YVDA 2ZJ1A 3I12A 4HRVA 5A71A 4F9TA 1EXMA 1YVPA 2GF0A 3CG4A 3AQ4A 4RS3A 4Z4CA 3ZLTA 1A82A 3PT5A 4I4LA 2AFIA 3DV2A 2EL7A 1HDEA 1L5GB 4QPCA 4KQIA 3FZNA 4PC2A 1S2NA 5EJ9A 4FQ7A 1KC3A 2EBHX 4BLWA 4IDEA 1XMIA 1XTPA 2X77A 3P26A 4X7RA 4TL8A 1SKUA 1VMEA 1CTQA 2XJ9A 1N9GA 3MGAA 2O14A 4TMTA 3ZXYA 4ALJA 1K4YA 5KEIA 5GGYA 1P62B 2ATIA 3ANLA 5IU6A 3AFIA 4IJWA 3U3OA 1BS1A 1Y9DA 2PV7A 1UJ6A 4R4JA 1T2NA 2Y99A 3RFVA 3Q1LA 1LQ2A 4TSKA 3PNLA 4TX1A 4YS6A 2FPKA 5TE9A 4C29A 4K0KB 1GR1A 5JR3A 2X4IA 4XRRA 5ECWA 4DNFA 3SQLA 1XJ0A 2HXSA 4EA8A 4PZ0A 5FOSA 3MD0A 3HJBA 1COWD 1LF0A 4HDNB 2Y77A 5F3RA 3SZRA 4D3FA 2X6TA 1I7PA 2X7HA 4UCQA 2EBWA 2JFNA 5K1ZA 1R37A 1VL6A 3V3TA 1PJQA 1WVIA 1ZXLA 3D81A 4XYGA 4AFNA 2VQEB 4XUDA 2JJMA 2V8BA 3H2JA 5JU6A 1PFKA 5KMGB 3EMKA 4PZAA 1EBBA 2X3UA 2ZUBA 2ZGVA 4FDLA 3VPCA 3VR4D 2AQHA 2JFBA 1AKVA 2J48A 3BCRA 4V0MA 4IZOA 2GRUA 2EU8A 1IY2A 4ZT5A 4HWOA 5GINE 3MC1A 1KK1A 3AF2A 1J5PA 3PC3A 4HJRA 4IOKA 1OB2A 4RKEA 2OAP1 1NMSA 4G1UC 3VNBA 2VP2A 3VTAA 1ZI9A 3OZRA 4E46A 5F7OA 3MLBA 4GOJA 1UMDB 4ND2A 1XI2A 2KBFA 4DG5A 1RRCA 1A8SA 1N78A 2J7PD 2KPOA 4JN6B 3OOSA 3LLUA 5A06A 4MUHA 1W4AA 2WLTA 4X6UA 2C9DA 2VK1A 3FUVA 4EPTA 1O5OA 3TZCA 5B36A 2FX5A 1U2DC 4D8YA 3W7AA 1Z07A 2WKPA 1HLPA 3R4VA 2QMZA 1ZNYA 5BSKA 2H18A 1HE8B 3WYCA 3L4EA 3WHLA 1KOFA 2CJFA 2MMCA 1OZFA 4MWBA 4YN3A 4QPNA 4I66A 1RYEA 1LEHA 3ZGYA 2RC6A 4JP3A 5B64A 1H2EA 3G1WA 1OFTA 4FNOA 4P2GA 3NPAA 2VPZA 4OP2A 2ZYIA 3FNEA 4Y30A 5IFLA 4BO4A 1Z5NA 2PUAA 1GPMA 1LH0A 3WA6A 1OIXA 4OGLA 5B53A 4EH1A 4XVUA 2C2KA 1N75A 1PR9A 5J1SB 1ODCA 4IINA 2AFIB 3C4VA 3KZOA 5BQ5A 1KMCA 4CCAA 4EAQA 1Q12A 1DFHA 2IVFA 3BMQA 3CLTC 3EXAA 3GWZA 3FUTA 3QPBA 3T7CA 3WDKA 2PWBA 3RGGA 3U60B 2J46A 2ZYVX 4B0OA 2VF2A 3HCWA 1N9GB 4ZPXA 3AEZA 1M6YA 4MUKA 2LDXA 3DE0X 3I1IA 3GDFA 2UZ0A 4ZYUA 3WVNA 4ESOA 4EUFA 1J0BA 2P2DA 2O3UA 3Q5DA 1YNOA 3UUGA 5U4QA 4CLXA 2OYSA 4E70A 4CDGA 5C1OA 2R751 4WK6A 2Z6QA 3P0EA 3T1NA 3TQRA 4JB8A 4MRNA 3G2QA 2E4WA 1CZKA 1Y98A 2CNWA 3PJDA 3WLLA 5CEEA 3KX2A 1T1EA 3HR7A 3PC4A 2XA1A 3Q72A 3RRFA 3QKSA 2I3BA 3A11A 3RODA 3MT9A 1ILEA 2G0TA 2OKCA 1BE6A 4CHTA 3HKEA 1NBIA 3N59A 4TUYA 3GJ3A 3E7XA 3CBQA 2ZJ4A 3DZFA 1SPBS 4HI0E 3CUEF 2AMFA 1GY8A 1PUJA 1KE1A 5IDWA 3GG2A 4BJHB 2XV1A 1ZWLA 2SBTA 3M6IA 1GZ6A 1XF9A 3EIQA 3FYTA 4GMFA 2BCGY 3GGCA 1NYLA 3GFFA 3I58A 5A4JA 5JI3E 4P4LA 4LMRA 2X9NA 1OV6A 2XGMA 2I71A 3HBAA 3GCZA 4AKSA 3JYNA 4F3CA 5KYXA 5EJ5A 4CXMA 1LLUA 3THXA 2I1VB 3BIWA 2NSLA 1OT5A 1VJCA 3DV0A 1K0FA 4LRUA 4EDFA 2YRWA 1NUAA 5ENZA 4YI3A 4GPAA 4N0QA 2P6RA 4HGOA 5K45A 2Q2NA 5CLLA 1JLRA 1OWMA 2AG0A 3UMYA 2NADA 2DXIA 3E9CA 2LNDA 1TQ8A 2C8JA 1DQNA 3K9HA 1TAQA 2WAMA 2C2OA 4RK7A 3HWRA 4IMPA 4A91A 2WJWA 4GEGA 4YXWA 4ZCLA 3GJ4A 5DNCA 1CRQA 1G2IA 5DGHA 3W3AH 5TF0A 3O4RA 3RWBA 1K7SN 2XCQA 1NC3A 2OHOA 4FEAA 3O3OB 1QZUA 4K9SA 2YCLA 2A9JA 5IEBA 1NUQA 2FLVA 2Q45A 1F2TA 2D5IA 4J0GA 1Q7TA 4IIEA 3SJBA 2BZ1A 3BMQB 2MSCB 3ABRB 1TM4E 3GZ4A 4IZIA 4MTCA 3GLRA 5EMJA 4GZLA 4P31A 2G1KA 3T99A 4BVHA 1PK8A 2D2FA 2DC1A 2RH8A 3PGKA 4M1SA 4QRDA 5BOSA 5KDLA 1E1NA 1N7JA 4LOLA 1SCKA 4KUEA 1C9YA 4OI4A 1J07A 1XRSB 3M6LA 4WLNA 5THKA 3JASA 1T36A 3OESA 2PX0A 2JGDA 1TYEB 4F06A 4DSUA 2V7PA 3T8YA 1G60A 1QQ7A 4TTSA 4OTZA 1LDGA 4I5GA 1YGPA 3P19A 3GH1A 4GR9A 5A05A 2ZRNA 2DKFA 4HRXA 3KQNA 1LV7A 2AR9A 3PNVA 2HSJA 2CE7A 3QKSB 3G7UA 4KQEA 4YRPA 4ABYA 4CMBA 4V0KA 1Y3HA 3HKEB 4KSYA 4TUYB 5FV7A 3ZWNA 1XNRB 2BM9A 1IXKA 3WDSA 3GARA 5HVNA 2YHUA 4H1WA 6NULA 5KJ1A 2YR0A 1MRZA 4L8GA 3N76A 3C8UA 5F2NA 8ATCA 1CY0A 2YV1A 1KJ9A 2R86A 2VI5A 2ZJAA 4M60A 5G02A 3TXXA 4ZGBA 4ALIA 2X42A 3D8BA 4K87A 1A72A 3KXLA 4KAXA 4HVTA 4UCFA 4ZCMA 1N1MA 1YVUA 2HA0A 1F4VA 621PA 3U09A 5B1EA 1IAVA 1A4XA 4H60A 5BR1A 3PIIA 5KYXB 5KQMA 1ZUNA 3JQRA 5TS3A 3N0WA 3THXB 2XGJA 3DV0B 1FDRA 1CU1A 2Z5GA 1Q92A 1JFVA 3AHCA 3VKFA 1F12A 3RIGA 1RWNA 1GXSA 1V6CA 3ZH9B 5A4DA 3EFBA 7GPBA 5CYFA 4MTLA 2GARA 1CHNA 1GG8A 5LFAA 5M34A 2AKYA 4IF6A 1VP9A 1W5FA 2BJHA 3A6DA 1QONA 5DI9A 4EB0A 3NTXA 1MHTA 2C0QA 1DX9A 1PWYE 2P91A 4M1YA 2OXEA 1QHYA 2ID4A 1BOFA 4FB5A 3FTFA 1JU4A 1QE0A 4Y7DA 4EI8A 4F2GA 4F3TA 2XTJA 3H5IA 2D54A 4FT2A 5F21A 4LSMA 3DHYA 4R1NA 2NO4A 4G4SO 1LVUA 1DEXA 3E3AA 3QTLA 1RPNA 3U7RA 2JGLA 2Q07A 4OJKA 1FFAA 2I7XA 4JU8A 3U3KA 1F2TB 3MCVA 1Z25A 2GCEA 5KO2A 5KTSA 3I83A 3NCTA 1UK8A 3ROFA 3O8RA 5B30A 1KEPA 2DFNA 1BRMA 1JG3A 3PGLA 2WSBA 1ZVJA 3BJMA 3LFTA 4JOBA 5BWNA 1V41E 4PFQA 2GD0A 2UYQA 5IASA 4QGAA 5BOSB 3AUTA 2QZ4A 3TRFA 1A5BB 1QHHA 1P7VA 2VHUA 3GDOA 3JASB 4CTMA 1T36B 3GLHA 3WAJA 4HYYA 4KWTA 2QNIA 2AMYA 4YK7A 4ZT4A 2JGDB 4DOMA 5I9IA 3DCNA 2OCYC 2XNHA 4W7HA 3ZCXA 4L6AA 4XGRA 5K8CA 1MXHA 3H5NA 1FYXA 2VQFB 2PWZA 3EDCA 1SHLA 2B8WA 2DG2A 2FXVA 4C7XA 4TYNA 1NYTA 4MWOA 4F12A 5GTDA 1FTGA 4UVIA 5KBYA 2D4HA 2PA0A 2OHXA 2G1UA 3UJ3X 2O5EA 2H3HA 4B31A 5I5EA 5CFMA 2QUKA 2VZ8A 4R3UC 5C8YF 5TR9A 3HPQA 4GDMA 2FQWA 4Z9AA 1MIHA 2ORWA 3ISVA 3T9AA 1NPYA 4BE7B 3LK6A 4H1UA 1YRBA 2ZUDA 2FOIA 5C32A 3OLQA 1QK4A 1HK7A 3D4PA 3NHFA 3IQHX 1T5HX 1EFRD 4AY2A 2FHPA 4BTVA 3VZSA 4DF3A 5KHLB 1ZUNB 3BRSA 1MC1A 4CTKA 3A0RB 1G8KA 2JAPA 4HN9A 1X1CA 2QUAA 3LHFA 3IJPA 521PA 3HCBA 3RS3A 3SEAA 4D79A 4DUPA 4M0LA 2Q2WA 1N7HA 1GPH1 2WW8A 1KEUA 1NGSA 3H3JA 4YCLA 1GXSB 2BUAA 3NWEA 1DCFA 1WMAA 3V2GA 4MQ4A 3GJ0A 1CF9A 1YRLA 3EIHA 4M1EA 5AK4A 3TYXA 4GLLA 2A0UA 3GFQA 1R4MA 1Y6QA 1EDBA 2G3YA 3WZMA 1CF2O 1Q0QA 2GJKA 3ILHA 3DVAA 2ZZMA 2YNMC 1IY9A 1ZWKA 3W06A 1WD5A 4GLOA 4M21A 2W58A 1JAIA 1Z6QA 2BFPA 3K1AA 4I08A 2E6KA 3R3YA 3WZLA 4UTRA 1PR5A 1TF7A 1B74A 2PLRA 1X7DA 4Z4HA 3LOPA 2IWHA 3BMXA 3Q1KA 2AIRA 1FFXA 3O1LA 1B6TA 1FSFA 2YNMA 1W9MA 5HMLA 3E6AA 1NQ5A 4Q01A 1UK7A 3TEFA 2XWPA 1IM2A 4D9NA 2GXAA 4I81A 1XNQB 3AONB 4C87A 3OH8A 4I1OA 3PUYA 4BJ5A 4ME6A 4HVCA 1H85A 4L2IA 1MVOA 1QHHB 1YRYE 3T9DA 1P4JA 3TCXB 1NQVA 3GLHB 1NBME 4LY6A 2B78A 2CXSA 4IG9A 1J8DA 1IWOA 4OP3A 1O4WA 1QGED 4OQMA 3MUFA 1A9ZA 3Q9NA 4L85A 2RMKA 4Q9AA 4AU1A 2GO7A 3EN0A 2Q0QA 3LUAA 2BHSA 2GH1A 3A4LA 3RLFA 2RHDA 3LBFA 1BWSA 2IYOA 2H0AA 2GN8A 1ZBDA 2VNIA 3FNBA 3TNFA 4UTPA 2QBYA 1ZONA 3CURA 3LUBA 4L9SA 3RQIA 3IHWA 3UT6A 2ZSDA 3WQBA 3BIXA 1XAIA 5FHRA 1L4EA 3AO0B 1JKXA 4C07A 3DB1A 1GKKA 4IX1A 3SP1A 3Q3HA 5JPDA 3AL0C 3CV3A 2XD4A 2A5JA 2X4DA 1P75A 3IB6A 4FNMA 4RZ2A 3EVZA 4HNQA 3TLZA 4KPYA 1RI5A 2P69A 1XZAA 1ZCFA 3HA3A 1K7XB 3AERA 3JWEA 1OHHD 4HTFA 4UASA 3F90A 3RAJA 4LWZA 3ZUPA 2M1ZA 1IBKB 4PAOA 4LJ7A 4AICA 1VKNA 1TYBE 4DADA 4EF5A 4JLJA 1UBEA 4KQ6A 3NVDA 2GK6A 3EGDA 2YYAA 3KZ1E 5CEJA 5KWEA 2QAJA 1XOIA 3GNTA 3PCTA 5FCDA 2IW3A 4D8XA 2NZ2A 4KFUA 3FPEA 2DLCX 2P68A 5HJ7A 4EMSA 5BW5A 1RCTE 1J0CA 2F1OA 2QTLA 2HA5A 4JYCA 4HEA1 3GRFA 4URVR 4L75A 2A9FA 1JR3E 3OETA 4EUNA 2HPHA 1R4MB 2PX6A 1J8VA 3A1FA 4L9AA 1CEQA 4Z7QB 2V8OA 3NOOA 3DVAB 2LCFA 3H5LA 4QXAA 2NU8A 1VHLA 3ZDAA 5HQTA 5TQVA 3RYCA 1J99A 1MEOA 1WY5A 1YD7A 3PC8A 3IBSA 5HPYB 2WJ3A 4ZJYA 2GSWA 3K1AB 1MGPA 5AKJA 4FGKA 5K4AA 3JD0A 3TQQA 2QLLA 3VOSA 4H6WA 4RIIA 3RUPA 3B7PA 4PXSA 3K53A 3LX5A 4RF4A 2O23A 1FFXB 1DTWA 4R2XA 3T4EA 2XNJA 4WK2B 2AMVA 7REQA 5BN4A 2FPXA 5EESA 4ZT3A 2QE7A 3LLVA 2HXGA 4RJTA 5FUWA 2NUTA 3EQ9A 3R20A 3COVA 1Q3HA 4M3NA 3PGXA 3ZYCA 3OHSX 4L2IB 4FZ5A 1CRPA 1EGVB 1OA0A 4L4SA 1XLTC 3EUAA 4F04A 2ILVA 4QA9A 4G63A 4GI5A 5F2EA 3E9DA 2AMLA 4XGIA 5CFNA 4W8GA 4BP1A 3ASVA 4Y2TA 2YV3A 1GCOA 2BTEA 1D2EA 2AHOA 1MGOA 1RW4A 3ND9A 5B37A 4AZ0A 3ZGZA 1WU7A 4ZFNA 4EHLA 4YQZA 1ECLA 1GTJ1 3LXUX 2OVBA 3O0TA 4K1LA 4ZODA 3UJPA 4Y2SA 1Z0FA 2XYHA 1MX9A 2GN1A 1KF0A 1XLTA 4RV5A 4F5WA 2QBYB 2VWGA 1W48A 1PR0A 2ZFUA 3RC9A 1C7RA 4BO8A 1W5AA 2OBMA 5B1DA 4NDAA 3H8VA 1Z6PA 4IG4A 5B2FA 3R8FA 4NZZA 1IQUA 4N5MA 2VF7A 3ZDFA 4D3ZA 1ADGA 3HH8A 1M5RA 3AUXA 4GYKA 1JXMA 1P44A 3BGOS 3CZCA 3GXBA 3AETA 1SIOA 4HS9A 2II6A 2NLOA 4MKFA 2O8VA 4M1QA 1EEHA 3AERB 5MHTA 1AMUA 4NHOA 3GW8A 1IZYA 3A9TA 3OQVA 4HTFB 4NV1A 5IDXA 4IIXA 1ZLYA 3R0VA 2R2AA 3MWYW 4ZEXA 5JMTA 1GKYA 1QGYA 4KQ1A 3EGDB 4Y18A 1FZQA 5IXYA 2C0PA 3GJ7A 3Q3IA 4LY0A 3VSBA 1GJRA 1VLLA 1AMNA 4LJ8A 1E8NA 4LOIA 1C7IA 5ES3A 3K0CC 2DE0X 5IUJC 5K4HA 2LKCA 3ADDA 2ZDGA 3BXGA 4BRWA 5KYTA 3AL2A 2IXEA 2W71A 1EKXA 4MWCA 5FORA 1ODKA 3CNQS 2LR0A 3MD9A 4XLLA 4V0NA 3TX6A 4PXAA 2D7DA 2C9YA 3WJ2A 2NU8B 2MYUA 4ZV9A 1CVIA 2IH2A 3K0CA 1NL3A 4IIUA 4KUGA 3RYCB 4XD2A 2JGIA 3ZJ5A 4O0LA 1COWA 4EUKA 3O90A 3KVOA 3VC1A 2YJTD 3T15A 3H99A 2Y0BA 4L0CA 5ALYA 4ALLA 5KOHA 3A32A 2XKAA 1L7DA 2Z2KA 3AUJB 1Y5NA 3WTCA 1JHPA 2QX6A 4GDFA 1DTWB 2F8TA 3R6TA 1M2HA 4B3CA 1WUYA 3OX1A 3K0HA 1HGXA 1GOTA 2X41A 1DKQA 1U11A 1UJNA 4GD3Q 4UU0A 5BN4B 3VR4A 3H1PA 7REQB 1NE7A 5J4HA 3FHLA 1W7AA 4KFCA 2NUTB 3OCVA 5L3RA 3LAWA 4RTQA 2YJ5A 1FLDA 1AKQA 1Y3AA 1LJUA 2FMKA 2NSYA 3G85A 4FD3A 3HA5A 3O03A 1N34B 3IO3A 3CG0A 5JAHA 2DP4E 2I6GA 3FFAA 1Q91A 3PQ5A 4JB0A 1H2BA 2YIJA 2QLFA 4JJAA 4Y1FA 4DZZA 4V1CI 1I10A 5EP1A 4RVSA 4S2EA 5G41A 1T0HB 4X24A 5D84A 3L8ZA 1OUMA 3KKKA 3HBMA 1ISMA 1U28A 2FCRA 4F6LA 2PRSA 3PPYA 4QGGA 4W82A 4AZ0B 4AJJA 1Z3IX 4RLQA 4W5NA 2J7PA 3TVYA 3A4NA 4NNOA 2XNKA 1MLDA 1VBFA 3FYUC 4LV8B 3FN4A 3IELA 4UJ3A 2QV7A 1H94A 3LUJA 2WK1A 4EPVA 1JHMA 4M0DA 1VG1A 4G0UA 4OU5A 2AWNA 3SZGA 1Y89A 2Z9BA 1PP4A 1SB9A 2C2YA 3DE5X 5BUCA 3QUQA 2R8PA 5EJEA 4J0QA 3ZJVA 4QO7A 1FLNA 5AFSA 4TYWA 2CJYA 1UDXA 1N2EA 5CNKA 2CC2A 3AETB 2X58A 3O2QB 4J1NA 4D82A 1YB2A 1HYGA 3A1EA 4HRAA 4BV8A 5FUQA 5DX0A 1W47A 3HA2A 1JG2A 2PGAA 4LYEA 1OA1A 3PR1A 3ABOB 4NATA 3I64A 5DX8A 2XZOA 1TTHA 4ZICA 1KNXA 2IBTA 3ITKA 4G84A 3UZUA 4DG8A 4Y9UA 1JUDA 1U0RA 3LCMA 1OXMA 1U2SA 4HFRA 2VH2A 2D0DA 2VT2A 1H3FA 2XCIA 3ROEA 1IOVA 1ZMRA 3U6BA 4KGVA 4B46A 5A4KA 3PXCX 1ADCA 1YJCA 4HYEA 4DNQA 4X1YA 1YR1A 4S04A 4ZEOA 3LUDA 1OF1A 1ZOPA 1O0SA 4NICA 5HXAA 2PXHA 3ISTA 4EYGA 2F17A 4ERNA 3DE6X 5ERGB 5I8ZA 3IESA 5KYKA 3E7WA 4PVCA 4DUZB 2ZJFA 3KYBA 5ALJA 1BGVA 2I6XA 2V5AA 3FE2A 2FG6C 3M6AA 2XB4A 2K7ZA 1I36A 1NR5A 4FOLA 3IH5A 4XJXA 2FQQA 1N2OA 2R00A 1D2CA 1JSZA 2R8EA 4Q47A 3RIEA 3W8RA 4B1FA 1E2BA 1EG2A 1NR1A 5KOHB 2M6RA 4V0QA 2AL7A 4P3PA 1XN1A 4W8HA 1QBKC 1E0JA 3X43A 5KPJA 2HPZA 2Y1OA 3M1IA 5LYJA 4CMAA 4HLQB 5EQFA 3C1TA 1YZGA 3E1SA 1RLJA 3JCZA 1G38A 1W2GA 4YAGA 3OQ6A 4OQZA 1LWOA 4G0MA 1NJ8A 4FYKA 2R97A 4Z86A 5J23A 1WO8A 3WLQA 2HV8A 1U7OA 3ZHBA 3PP8A 4ZQFA 1DARA 5KDDA 3UQZA 2E1RA 1G8YA 1UM8A 2SECE 3IEXA 4A36A 4J6EA 2IZ6A 1TJ5A 3PEYA 4GEKA 5CHYA 3DMNA 1V8DA 5E8RA 2V7QD 4GU5A 1YI8A 4IWYA 1PNRA 2PJRA 4EGSA 4U3JA 2FZVA 2OXTA 2V98A 1Q74A 2HDNB 4ODIA 5CLGA 4HYQA 5CURA 3P20A 2Y6VA 1OFUX 2ONJA 2HJSA 5BOVA 1C8LA 1T3TA 1WPRA 2BTQA 1JEJA 1SQ5A 1TUIA 2C8KA 3G9TA 4NOJA 2EAUA 1KVRA 1MV5A 1MXFA 2WAOA 1KDPA 1VYHA 3KQQA 4U4AA 5L45A 2O48X 3BK1A 5BQPA 1WPXA 5DYYA 5DX1A 1E6WA 4PV7A 1HORA 1HG1A 2D7CA 4ZAWA 3K1YA 3OP1A 3ZLBA 3T7SA 1P5RA 2QNBA 3O2SB 5E4TA 2GZSA 1QCCA 2I66A 1R0BA 2JJ1D 4R2KA 1SUSA 3ZHUA 1NMXA 2AI3A 3UATA 2JS7A 3T54A 4BMSA 1RC1A 2RHMA 4YCCA 5CFRA 3N05A 2IF2A 4QJ4A 3T0IA 1GZSA 3AP1A 3GJXC 4GPD1 3GLSA 3VR3D 4HMPA 4RJIA 3T0GA 2AEFA 1BDMA 3VSDA 4X1YB 3H4MA 3JYPA 1AO0A 1PFWA 2ZB7A 1PR1A 3KKQA 3L7KA 1MC8A 1SD1A 3OY7A 1FTSA 3HUUA 3IBFA 3IUYA 1M33A 1O8BA 4UD2A 1KU6A 3CS3A 5LUBA 4RQUA 2PT7A 5BNFA 1NKVA 3HJCA 2RB4A 1P9NA 4OATA 1M1UA 3I4CA 3OKCA 4WJLA 2A9OA 5JY1A 1UFVA 3ECSA 1CNEA 4GHWA 4EHHA 2XF8A 3R44A 3BWYA 1QDUA 2JI9A 2WE7A 1U7HA 1N33B 1VGQA 4LBVA 3WB9A 1XMSA 4QDOA 2XE7A 3E3OA 4LDAA 4QYTA 5LP6C 3AVXA 5AM3A 1QLJA 1XL1A 3BSYA 5CA1A 3T5TA 5LYJB 4R7GA 1YH3A 4BBPA 4L5YA 2AC2A 3RRNA 3ZDZB 1M9NA 4BX9A 2FSGA 1E4EA 1UKEA 1QQ6A 3IMEA 1O95C 3P9PA 5IVHA 3OWOA 3WAKA 2DUNA 5CCDA 2WIBA 1KIFA 2D1YA 3M6XA 3RHTA 1E0AA 3ER6A 1DXQA 1BXRA 2J3EA 4F11A 2G9ZA 4FBLA 3RS7A 5JEEA 1WKBA 1HRKA 3RSHA 1LVGA 2GA9A 4TLEA 3KQYA 1W46A 3LG2A 4QU0A 5IBRA 4D8VA 3U48A 4QJ3A 1C30A 4YR9A 5BWLA 4CUKA 4HAYA 1TAHA 1NKTA 2JJ2D 1J2RA 2CFSA 2HA2A 1OYOA 3FM9A 2FHSA 4J49A 4U3JB 4TVSA 5C4MA 1XCPA 4XKJA 2AOUA 1FNSA 1M76A 1BVYF 1G4UR 3P2YA 4L4YA 3WLFA 4IICA 4CUJA 3F0TA 1M7BA 4QU9A 4DRZA 2BTQB 2PFKA 1KWGA 3B3AA 1P39A 1W36C 5J59A 3F73A 4M0EA 3IE1A 2NXJA 3KZMA 1CUCA 3MIIA 2EJUA 1YJ8A 4Q1VA 4ZEMA 1JEEA 2XTZA 5BURA 1G16A 4CMEC 4DBZA 3BT7A 1NIPA 2FEOA 2O5RA 3DCIA 3GRAA 4WCFA 5IX8A 3DBIA 4RYDA 5KTKA 4NX2A 4NMMA 5DBEX 1A1VA 3GEBA 4R0MA 1IG3A 1DIAA 1QH1A 1K0UA 1S8OA 3JZFA 2WUFA 3PS9A 3QBVA 3TNJA 4BP8A 4DAOA 4DIKA 2LP4Y 3W6OA 3SIRA 3PT9A 1U9YA 1BJTA 2J9GA 1DNPA 4G4IA 3TLEA 5COAA 1WCYA 4BCDA 1GU7A 3V34A 3NATA 3L07A 5DK4A 2I6FA 5TMBA 3ZHZA 5A04A 3H3XA 2Y1LA 1V16A 1UM9A 4BNDA 1TB4A 3A6JA 1N3IA 4E03A 4M0FA 5KX5A 1CT9A 1XO1A 4XGQA 4AF7A 1UL1X 4H7JA 2XTAA 2ZI9A 1KI7A 3AXTA 4G5YA 3EOZA 1JJAA 4YECA 4Y1RA 3R09A 4PGGA 4XIGS 5T64A 1Y82A 3QQ5A 2GK3A 3KSMA 2ZJYA 3OZSA 5CA1B 2AOVA 2EHDA 1RKVA 5DT9A 3CZPA 1E5LA 2ZUFA 2YWXA 1NVXQ 2IPXA 3LRPA 3A9SA 1NR7A 4G3XA 5JJCA 3RDPA 2ZSJA 4IGIA 4RL4A 3EEIA 4UDOA 1Z82A 1E4EB 4IMIB 4CLRA 2YMPA 2IX3A 1SOMA 4R9UC 5CFLA 2JGRA 3P5BA 3A9VA 1EFRA 3FCCA 1QZ3A 1R7RA 2V9ZA 1LW7A 1NA5A 3TL6A 1BXRB 1T15A 1XAHA 4YRLA 3DDHA 2NTEA 3NUGA 2IA5A 4NYJR 1QQTA 3EA5A 3HGMA 5IKOA 1IMOA 1OZGA 1FPQA 4O2AA 4NU6A 1C30B 1OLXA 2G0NA 5C5CA 5LLTA 2F90A 3HN7A 2CEAA 1O87A 3B9RA 5HUQA 3LC7O 2AOUB 5DYTA 5DM60 1YR3A 3KQSA 3I9V6 5DK6A 1BWPA 2O3QA 3N8DA 4FCTA 1KI6A 3BRQA 5EIFA 3RJMA 4UNQA 1B8OA 1C4XA 2ZIFA 4OG2A 5K8LA 2CHFA 4I2NA 2Q5CA 2LCQA 1Q2UA 3NDRA 1KJWA 5ICFA 2EIXA 4DR6B 5T4FA 2GPSA 3T9EA 1CEYA 2PYIA 1CR1A 4WASA 4CM4A 4AX4A 2AC7A 4MI3A 1KTVA 1XKXA 2ODPA 2V3WA 3K2IA 4WCFB 1GR0A 4BY9E 3BHJA 3CRVA 4R1OA 1S7CA 3I61A 5M29A 4HGRA 5HTOA 2XTNA 3OM8A 3ZZNA 1QH1B 4RORA 1XTKA 3NHYA 1NMZA 1BEUB 1NOJA 5EE0A 3KAQA 5DN6A 2P2SA 1D5CA 1BFUA 3DO8A 4WLEA 3QOYA 1YRQA 4CIYA 3HCDA 3K0AB 3C98A 1KQGA 4NEGA 4QODA 3COJA 2B1JA 1WB5A 4HOYA 3DEHA 3F7MA 5FYQA 3MIZA 4LKOA 4XOUA 3MN1A 3VR6D 2I9KA 3H7IA 2IXBA 2Z3WA 5F64A 1V16B 3C3XA 1UM9B 5K2MA 3VNSA 4B2LA 4BGIA 4BNDB 4K2HA 5JISA 1CR0A 1QIJA 4OI0A 5KX5B 1SC6A 2FDRA 4IFTA 1UBJS 4OM7A 2PL1A 1N8SA 2JI7A 3D3QA 3DL2A 4X71A 3F8SA 4B2PA 2VZ0A 3GOHA 4DMMA 3R5HA 4JEIA 4Y1RB 1EJ2A 4CM9D 1DL5A 4RVDA 3RB8A 4DAEA 4WAUA 2PFGA 4FGJA 3GEGA 1RTTA 1EE9A 2TYSB 3P0RA 4QEKA 3KLPX 4BP3A 3KJEA 3CH4B 2BBWA 3G9ZA 3JVIA 3JYQA 1JEQA 3OIFA 4OKNA 4R81A 5TPWA 7MHTA 2OM2A 3TZLA 4A2QA 2POCA 4JEHA 1JI3A 2QIPA 4WCVA 4CLRB 4KREA 4OHWA 1JA0A 3W1EA 1RXEA 2PX2A 4AY6A 4FCVA 1V0JA 1O3YA 4QTZA 2FA9A 5G4KA 4N49A 4HWRA 5HGXA 5LQKA 1RVV1 4H7KA 4FWBA 3W6PA 2QUZA 3PHIA 4GAEA 4K05A 2JFHA 5BN3A 3V8NA 2GO1A 3G0IA 3PGMA 3L8YA 1NBAA 5A0TA 1U3CA 4HDRA 2OWDA 4HSGA 2IU4A 4O2AB 3QA9A 3X2SA 4D44A 3ZVMA 4RGVA 4B34A 1OLXB 4RESA 3ZCVA 4NBNA 1N5OX 1QIEA 3E5HA 4JITA 1A7UA 5BP7A 3MLEA 1AB5A 3RK1A 1BROA 3PQDA 5EOVA 1OQAA 5BSUA 1NZJA 1KI6B 3TR6A 1KDVA 3LL4A 3E84A 2KSQA 5DGDA 5HYVA 1Y8AA 1NT2A 2ZRIA 2QQFA 3O5AA 4EY7A 3EDOA 2NPFA 2O1EA 3EW9A 2CLHB 4CM4B 2YVUA 3Q6NA 5H9VA 2FG7C 3OIDA 2X0DA 1KEZA 3RVQA 4QTTB 4EI2A 2CFOA 2VDNB 2YQZA 1ND6A 4QU8A 3I39X 2PU7A 3GRUA 3DT6A 5FOUA 2X0RA 1PR3A 3V1YA 4ITUA 4DB4A 3AJDA 3CZAA 3GHYA 2VS1A 1QRTA 2OLEA 1SKMA 5H1YA 3DEAA 3GT0A 3QLUA 1JH9A 3K8OE 3NC4A 3SDSA 5AJZA 3RFXA 3C24A 3FKSD 4PG8A 5ALWA 1DMSA 1HNWB 4BE9A 4XCXA 1EXDA 2B21A 1JQBA 1QB7A 3N2KA 1BJKA 3EG5A 3OBIA 4GQIA 4KLZA 5AJWA 1R9GA 2YWEA 4S1PA 3SX2A 4DCNA 4W5QA 3D02A 2ZIAA 1X2BA 1M34A 3Q0EA 3IP1A 4H27A 2C83A 2GZDA 4U9HS 2G40A 4Z2AA 5KWSA 3BA6A 1KO5A 2ZVDA 3H17A 3HDHA 1KO4A 4MJLA 2Q5JA 3O74A 1XA3A 1NVTA 5DGCA 1RCUA 5DXFA 2O8DA 4RTJA 1BIFA 1P1IA 2RGXA 2I2XB 3D6AA 1KQOA 1O77A 1KI2A 4BTLA 4DV0B 3W5VA 5A5GA 2BI4A 5CYOA 5TPWB 3QFHA 3R8CA 1JEQB 3E9MA 5C5IA 1XCLA 5KTYA 1U7XA 1W5BA 4MKZA 4W6ZA 3GP8A 4BB6A 4CW7A 1XK6A 4RM2A 1ULTA 1VDMA 2AXEA 1UAGA 1G3IA 3RYFA 1R0YA 1PR2A 4MP3A 5G4KB 3SHVA 2CDAA 1OI4A 3BAZA 1ZK0A 1YV9A 2BKVA 3QU9A 4QNMA 4BE4A 3RVDA 2DUWA 2I54A 1U0LA 3PSAA 3IYLW 5BN3B 2EG5A 3L1HA 3B6IA 3NM6B 4UXHA 3RWOA 2WHEA 3WRYC 4HAWA 2F59A 3R5FA 3B2QA 4HDRB 4IHQA 5C8XA 1XRQA 3L6EA 2PVPA 2YN4A 3RJ9A 1G5TA 4YMVA 5ELXA 2AOWA 2IGTA 1PGQA 2RB5A 3L6CA 5GV7A 4B48A 4KYVA 4N8DA 3PI7A 4GWGA 3OPYI 3ZY6A 4N03A 3OJFA 4JL5A 2OB2A 5BV8A 3G8DA 1R4ZA 1DBIA 3ENKA 2XW6A 3V7NA 4K03A 3WL5A 1QV6A 1EUDA 4J3JA 4HNUA 4P8RA 2C2MA 1VLJA 2V7XA 5LZ9A 4RACA 2PKQO 5JJ5A 3H2KA 2FWBA 1FYVA 1KI4A 1P77A 5EWMA 5HRCA 2ZYRA 3W90A 1EAMA 2A67A 1C41A 3VZDA 2F1KA 1EZZA 5KIAA 2ZR0A 3CRNA 2CYCA 5GZ1A 3U13A 1XDSA 5KSZA 4F7WA 3LRXA 5HCUA 3FZEA 1PHPA 1CQPA 4QWWA 1HZZA 1ESNA 2CDBA 3HCAA 2BMWA 4R0NA 4QRHA 4B3SB 2YXEA 2FP4A 4NC9A 1Z0UA 5AO9A 3ZE2B 1FVHA 3GROA 3S2UA 1EFDN 4HL6A 1RYMA 1PJSA 2B5OA 4U9IS 4X61A 1EWYA 2E87A 5H59A 3GMSA 5JSHA 3J81A 3VR2D 1XGKA 4MW2A 5FO0A 3EEYA 1E2QA 5TSDA 5BV1A 2W2OA 5I3ZA 2W6ID 2ODQA 5NLLA 3N2KB 3AEKA 2L2QA 5TMDA 3STUA 3CQ9A 1X13A 2EZUA 2RKOA 4N01A 5E7MA 3FX2A 3WP1B 5DNUA 1M34B 2BWJA 3ZK7A 4U0KA 3EF3A 1QGAA 4K6FA 2FF5A 4G81A 5GIPE 1E5VA 3KOMA 2RK6A 2V4MA 4MZDA 4ARBA 5T6BA 2O8DB 4S1WA 3TEJA 3K8QA 2H4FA 5SYMA 1MMFB 3IS3A 4TWRA 4D25A 5KYGA 1NFQA 1P3DA 2XADA 3KUXA 1NP7A 4DIFA 4PGMA 1DDIA 9ATCA 1NBEA 3QSYA 4M38A 2Q3BA 4F4UA 121PA 4J6FA 4JBIA 2VSNA 4NONA 4OJQA 5A3SA 3RYFB 4TVOA 3KZCA 2WICA 2ZE7A 2R6AA 4IJ6A 5IJ9A 3EPPA 2PZFA 5EIOA 5BMVA 1YJQA 2YHSA 4F92B 4DV3B 1NQWA 1HC7A 2JLQA 1YE3A 4IY1A 4X5OA 2ETVA 4DMKA 2IZZA 2YFYA 3VU8A 4ZGGA 1V9LA 1T8TA 5F7XA 3E23A 2D1FA 2GD6A 2Q7XA 3TLGA 1UKZA 4WI1A 3DFIA 3L8DA 3PKIA 3F47A 1LK5A 1QR2A 4BO7A 1DQYA 2JCVA 1UANA 3S28A 4K9KA 1CDZA 1NVUQ 3UANA 1NATA 2HH9A 3T3IA 3SLGA 2NV2B 2VOEA 1K27A 2IQ5A 2VP0A 4MUIA 3OCXA 4DPMA 1EUDB 1XTZA 2R6DA 1MOSA 2WWXA 4TV8F 5ALRA 3K94A 2OWEA 3KFXA 3OQOA 4MKRA 4QTYA 1PS0A 4YT2A 2Z8YA 2NNWB 2Z1NA 5DH9A 3UAVA 4AJ4A 3I2GA 1UC5B 1VIYA 4NESA 4CMKA 3CO5A 2C5AA 5IT4A 4JHLA 1RHJA 1U1EA 3WK4A 2HJWA 5D7NA 3LUPA 3FHJA 1ISJA 5K0SA 1PS9A 1OTHA 4Q4HA 1M1NA 4FEGA 2FZGA 4L95C 3LUFA 2R60A 2FP4B 1UEXC 2XGSA 4KO2S 1WQ1R 5AM4A 2VT7A 5CITA 1UJ5A 1VE7A 2DQZA 3M2PA 4ZANA 3IAXA 2W4QA 2ORIA 4I55F 4PVDA 1UAYA 1EBUA 2D00A 3IQDB 4WJZA 4D26A 3B85A 1A04A 1KHHA 1Y5MA 2CNLA 4WFKA 4BNJA 5L6MB 1G9SA 2Z3ZA 3QUSA 3MMSA 1KP2A 3ZQ4A 2Z4SA 3MRSA 1MQ8B 2G09A 1UBOS 5JMWA 3CRQA 3MBOA 3AEKB 3NTLA 2VQ3A 4KO4S 3WBKA 2V7QA 3IULA 2CLSA 2E4XA 5FFFA 3BRWD 3AY7A 5IHPA 2IPOA 5LYYA 4J90A 3GJYA 2B69A 1EVJA 1VI2A 1OBCA 1TFRA 4IAOA 4EKGA 2FMFA 4UBKA 2XCTB 1CP2A 2XUQA 1T9GS 2IL1A 2Q3DA 3ZS9A 2I2FA 3NQ41 2HPVA 1DO2A 3LYLA 5BV7A 1QG2A 3NT5A 3WK7A 1M2JA 4EQ6A 2OZKA 4E12A 4ZJUA 4PYRA 1UKVY 1YXMA 2QT9A 3BD8A 1QIDA 1I7QB 3PUVA 2QI9C 4FE7A 1FYDA 1CJCA 2EQAA 1K89A 5IJ9B 1RVDA 3THRA 2JJ1A 1L6RA 5BMVB 4QAQA 4XGKA 4WT7A 3OMWA 3NHLA 2FZ5A 2IS1A 1KA9H 2HSWA 5CVDA 2BZ0A 3ZNOA 3VR3A 3MSXA 3WMFA 2HTFA 4EO7A 5BSEA 2WNIA 5KKCA 3MQ2A 3QLTA 4Y6QA 4XCVA 5BR7A 1TKAA 3G0DA 2F9FA 4M1MA 1GZ3A 2FRXA 2BGMA 2ZB4A 3HU2A 4RSRA 4IVQA 4ZI5A 4P5PA 4JENA 5EMKA 3C6YA 4J3NA 3UMSA 4DLTA 3VUEA 3OJWA 4WHMA 3STYA 1S3GA 1LRJA 1N2BA 1CEXA 2IUSA 4PLHA 1V3UA 2J9XB 3U4IA 5EQJB 3VDMA 2CFTA 1ABFA 1L7MA 2A1TR 3E22A 3O47A 4MO2A 2AF4C 4UEQA 2VJOA 2O2CA 2HTEA 2Z8XA 4UU7A 4MS3A 4KRYA 1MX1A 4C1BA 4LQLA 3QE2A 4B8YA 3K70C 1G3QA 1CXZA 4Z1OA 4OHPA 3DOEA 1LZKA 2Z4RA 3O8NA 4I14A 3SHFA 4GE3A 1QVWA 4AQDA 4Q82A 1W6RA 4Q4HB 4A6PA 1M1NB 4JSYA 2D1QA 1I1NA 3U3MA 4WW0A 2HXYA 3VH4A 2ZP1A 3VPHA 4IP0A 3CCCA 3DOJA 4MHOA 3LPCA 5HWSA 5ADHA 2V1UA 2A0WA 3WIOA 1JHOA 3LDHA 4PPFA 4GOOD 1GPNA 1WNFA 3DULA 3FFBA 4Y0AA 3WFJA 3O75A 3MTBA 4FMDB 4OU4A 4EECA 5IVKA 3NV7A 2IDZA 3WLPA 4UARA 2XPCA 2PAAA 4URUR 1I4OA 4LMAA 1GQYA 3DVRX 3EVTA 4H3VA 3NGMA 5A7FA 1HMYA 1UFKA 2CXNA 1ZUHA 1IUPA 2G07A 5HILA 4F71A 3TNDA 2XHZA 4RUKA 2EX1A 1HDYA 1NAHA 5G3YA 3VOBA 4DA6A 3SSMA 2XBUA 1K8YB 3C0KA 5EVCA 5B58C 4LF9B 2W6CX 4EQ6B 4MJ7A 5F4ZA 1GWNA 1U8EA 5AI5A 4Z8YA 3G23A 3U1TA 3HI6A 3ABSB 4MPPA 1FJGB 2AGVA 2E18A 3F7NA 4IX9A 2F4VB 1T25A 2GZHA 2ZB3A 4DCTA 4K40A 4QBIA 5ALMA 3HB9A 3BZBA 3MS4A 4XTRA 3U9TA 4FDTA 2ZB2A 3LU1A 4YLGA 1J20A 1OXUA 2Y0DA 1A4IA 3NTVA 4MYUA 3R7AA 4DGQA 4UFOA 5CGZA 2A5GA 3OCCA 5ALDA 3TBFA 3VSEA 1DAMA 4BGUA 1AK1A 3AFOA 3I1JA 3A1SA 4P0QB 2FWAA 3RUFA 2BBOA 1SMKA 5HNKA 2OENG 3N74A 4FEEA 4RGYA 4E3ZA 1IQ0A 2LDBA 1T4DA 4RIGA 2BEJA 3DW3X 2ZQ5A 3JVEA 3HVIA 4I1VA 3SPXA 1XMJA 2HQ1A 1POXA 3BFVA 3IT1A 3UBMA 3I9KA 2PL3A 4X3PA 2WE8A 1M0TA 2WD9A 3E22B 3FCOA 3QOWA 3D3EA 3LQ4A 1QYWA 2BFEA 4J03A 5M7EA 3X1XA 1IRXA 1KZ6A 4MS3B 5IJ0A 2C7QA 1OH6A 4G0NA 3NTRA 2R62A 1XEAA 1T8PA 2VZEA 3FHOA 4PX9A 3WG9A 4ID3A 3SQXA 3LBHA 3DPIA 1XZFA 4O0MA 1BHQ1 5ABPA 4P0PB 1FW8A 1Q7RA 2ZR8A 1L7PA 1ZQ9A 2RCNA 1F8UA 3H1AA 1W29A 3PPVA 4GGOA 4RELA 3RS0A 3ZWAA 4D0LB 5ADVA 2H5IA 5LA6A 1GDTA 4P5DA 2RDMA 3UKDA 1BH2A 2JAWA 4KQFA 4PLGA 4YJ3F 1IZ9A 2W2LD 1M6VA 4ZRNA 1YZNA 3NBXX 3MAJA 4QBKA 2G4LA 1VL0A 2OOKA 3FSGD 4XARA 1B2LA 3NU1A 4IF4A 3LZ6A 3WGLA 2JIRA 4E5PA 4J43A 5DHTA 3W5AA 4ESEA 3OUZA 3EVNA 4L6IA 4BZQA 3BWVA 3R1IA 2I4OA 3FIJA 4FFDA 3ZD7A 2IYZA 3HY4A 1NBHA 4RDIA 9ABPA 2WRZA 4AAYA 3JD1A 4HNVA 3MAAC 1TQ4A 3LDGA 4IO1A 2DRIA 3TB6A 3FPGA 4ZO4A 3ZHSA 2PEYA 5E2IA 1ODTC 2K2QB 3SYMA 1NVKA 4BQPA 1ESMA 3K3PA 2VATA 3LCRA 2EWMA 3CEJA 3N6RA 4MW4A 4WKBA 3MJSA 3ZU6A 2G77B 4F60A 1P9LA 2HF2A 4YP0A 1HE2A 1YHZA 4FGUA 5TJ9A 3RRYA 3OFND 4C5AA 4F1JA 3KC2A 4YPVA 3G49A 2OBFA 3KB1A 1LK7A 1X70A 2ZBGA 4J2OA 2A4MA 1URPA 4KWIA 4PO9A 5C1IA 3KB2A 4Q3EA 4N6GA 3U7HB 2H63A 3DW1X 5EMHA 4QUGA 3F74A 3QYJA 4U2CA 1A88A 4U00A 1NW4A 1RWXA 1P4SA 5BNIA 1KDRA 3EXEA 3UO8B 3AR3A 3QE4A 3DVSX 4RH3A 3KL4A 4HNAA 1R5NA 1K8ZB 3BK2A 3ZVRA 2GBIA 1KMQA 4N7MA 2OPHA 2A9VA 2XMRA 2EJBA 5KCZA 5KNDD 3C8HA 3H9JA 1QMGA 4QDKA 3D5TA 4MP6A 3W7VA 4ZVTA 2BM0A 3D7SA 1Q6YA 5DF1A 4DJJA 5CDFA 1I7DA 4KR3A 3UB4A 2BV3A 2MTBA 1PG5A 2GBCA 2C5BA 2N75A 4V02A 2X0FA 4BEBA 1YZKA 3I2FA 4OMCA 4RKRA 3QX8A 3KOWA 3AVVA 4A3SA 3VR6A 2ZRHA 4YRBA 1HMPA 3DAGA 4ZZ0A 1P0FA 5LOVF 4QJIA 3KNZA 4MQEA 2FWJA 5EKTA 4Z4FA 3E8MA 5TT0A 3W1WA 1W0CA 1L7XA 1Q7BA 3IQWA 3ORFA 4GOLD 4JI2B 3AU9A 2FI1A 4EHJA 4UTNA 1E3MA 2BFEB 1GGEA 2JBAA 3HUFA 4CM9A 3U9LA 5IJ0B 3KQHA 4AUEA 1Y7HA 2WT8A 5AOAA 2A0FA 1R5BA 3F6PA 3N0VA 3O4VA 4OQNA 3VVBA 3QLJA 4YMTA 1Y4UA 2C03A 1F6BA 3SFZA 4EPRA 5I4CA 3CTPA 3F8TA 1RHRA 4ARZA 4MB6A 4Z5XA 4WNAA 1I2AA 5LA6B 3HBLA 1QTNA 3RBZA 1NQUA 3K70D 2QYSA 1AGNA 1M6VB 1OWOA 1GADO 2O0HA 4D4GA 4NCIA 3RKRA 1U0BB 3QLEA 3CUSA 2VP9A 3F5QA 1OIVA 1JDNA 1I30A 1KJZA 4M8KA 4B47A 5HKKD 2VC2B 4GLJA 2X8AA 2O3JA 2J0UA 1F5SA 2C9BA 2FFJA 3ENWA 3PZRA 5J2TF 4XDZA 3TPCA 5KTPA 1EZ4A 5HRUA 2BFAA 1EFPA 4MCHA 4QOJA 4OP1A 4LGVA 4DSOA 3C6BA 4Q9DA 3O94A 1YT5A 3OU7A 3VGJA 4DHEA 3MQFA 1OIWA 1WWKA 4IIYA 2DGDA 4HUTA 2FZWA 4U5QA 3A8TA 5CX4A 3TW6A 4ADSG 4MVJE 4MDFA 1D9XA 2IW1A 2OP1A 2XWBF 1PTJC 3O8LA 1VYUA 4G5HA 5AKEA 5ADWA 1YA4A 2AQIA 3R77A 1LXCA 3TDNA 4D6PA 2Y6UA 4CMIA 3VZRA 2J45A 3GUZA 3U62A 1AHHA 4B8ZA 5KNDH 3BMOA 3KE9A 4EOGA 1P2FA 2Z6VA 3VZQA 5A4MS 3EXEB 2E4UA 4FNGA 5FA8A 5D3KA 4ZAFA 4HNAB 1R0KA 1U3TA 3W34A 4Q24A 4RFLA 4DLBA 2PSFA 4EG7A 5JMOA 3DZJA 2XVYA 2F9LA 2YIMA 4RHEA 5F7ZA 2BKUA 3KP1A 2QL5A 7MDHA 2VSOA 3HB0A 2H2WA 2YVAA 4L15A 2BSQA 4OD0A 3MJCA 4B74A 4GWLA 4GM0A 4YCJA 4UBIA 3T5GA 1JJFA 1JJVA 2WAXA 2B36A 2JEZA 5DRTA 4X6YA 4KDRA 3MHPA 1UF9A 1M1XB 3WP0A 5A9SA 2B8EA 2VHEA 1P8JA 2WFMA 4Y9SA 1E2DA 3KEOA 4ARSA 4BVFA 4EJSA 2KB0A 1WR8A 1QHIA 2LRHA 1G17A 2EEPA 4G0OA 3FKSA 1F20A 3UWDA 1PTKA 3E15A 1FDSA 2CMGA 1KYQA 4HQOA 1EX7A 4GXRA 4MQEB 4DEVA 1G7RA 2MDTA 2R25B 2WF9A 4MPRA 4MVJD 1Y4DE 3DOIA 3IAHA 3H9CA 1NP3A 4JI1B 4DQVA 2JBAB 1S3SA 3H1BA 3ETGA 2GYYA 1Q0SA 2GA8A 3SR3A 3F1LA 2G5GX 1T2FA 3PE3A 2C9OA 1OKKD 4ZCQA 1O58A 2R5WA 3RBXA 3IT0A 4XWWA 3KG2A 4ARZB 4UAUA 5F5NA 3OJXA 4WNAB 1UJ2A 2D5CA 4DV6B 3O7MA 1PL6A 2UDPA 4IHJA 3HFGA 1ZXXA 2WIKA 2DFLA 1GSOA 3KYIB 4KI7A 5ALZA 3UWOA 2GNPA 1FUUA 3IR6A 4XI9A 3WLRA 2ZETA 4YB8A 1YC5A 3AM4A 1XMPA 2J0UB 4PWZA 2J9RA 3UMMA 4CMHA 1QP8A 5DOVA 3NOQA 3S2FA 3HYLA 3U7QA 4D5EA 1EFPB 1TVKA 3D6VA 2O20A 3L5KA 3JS5A 4GGMX 4CTJA 5CAEA 2HDOA 5C7OO 5KYYA 2Y1KA 2FQXA 2ZRJA 1RQXA 4OGWA 3SOPA 4AKIA 4GICA 3V4LA 1UZAA 2PL9A 1S2MA 1FMTA 1XTIA 2FF7A 3HDYA 2H1FA 3HBJA 4HZIA 2PRZA 4NYIR 3MS2A 2XVZA 1AF7A 4OOFA 4GYYA 4TOIA 4BGVA 4DLXA 5HKBA 2JHFA 1Z2PX 5HGJA 1P74A 4CMIB 1NWHA 3SQDA 3WV4A 3ZLJA 1YL5A 2JLRA 5IF3A 3BMOB 4RCYA 1AT1A 5JAUA 3D6HA 5K0LA 1RI4A 2NXEA 1DJOA 5JBIA 4YRKA 3OF5A 1L4GA 1IVYA 1P1KA 2V59A 3CMMA 5JWHA 5KC8A 1U8UA 1XDDA 1CUSA 2QRZA 3LC0A 3UJDA 3U9SA 2XH8A 1WLYA 1IDN1 4X63A 1EUQA 2EKPA 2WIJA 3K2QA 1Y1KE 1IBSA 2GKGA 2GN0A 3BD9A 3JD3A 3T5MA 1WLSA 1TKRA 1GHTA 1FSGA 4OHUA 5FI1B 3UXEA 1JVBA 4IIGA 1QAMA 2AZXA 1A76A 1FDIA 3CE6A 4ALMA 3FLMA 2C5HA 4XQ9A 3K73O 1TK2A 1A8HA 4E2YA 5A9SB 1DUSA 4EQZA 3ABQB 4EJSB 3VR2A 3A37A 3PL5A 1A95A 5CD9A 2APJA 2BGGA 1L7NA 1BVUA 5DPMA 4PLPA 2W6IA 3QSGA 1AKWA 4WKPA 3LPMA 1LTKA 1TJYA 4PX5A 2FE4A 1E63A 4S0XA 1BQ3A 2MU1A 3GGOA 4Q7JB 1XZJA 1EGHA 3DO5A 3ABZA 2P5TB 3WK6A 1QDEA 1QLWA 2IF0A 2WC1A 2WIGA 5AHOA 1FFYA 4UHFA 4BEVA 4NMHA 4C0XA 3EEFA 3QVJA 1THTA 3BVPA 1Y9JA 4B3BA 4X84A 2BGLA 3F4BA 2ZTSA 2VYFA 1NMEA 4B3MB 4QHSA 3FJYA 1O4VA 2C9MA 3SVLA 4LFAB 1B8NA 5L8VA 3BFJA 3MOGA 3N2YA 3F5MA 4IHJB 2VVTA 3BXZA 3LP5A 3UPDA 1EAYA 3EMBA 3KKLA 5JTTA 3T3OA 3ACBA 4I9HA 1YFJA 3LQKA 1I4DD 1HQKA 3JZDA 1L1QA 5LLSA 3FXAA 4L5BA 5REQA 1SXJD 1YACA 1MB4A 1BNCA 1Z6TA 4U2GA 2CB9A 1J97A 4BAGA 3GFVA 4TZ6A 1G8MA 1JBQA 1O08A 1VJ5A 2X9LA 3N70A 3U7QB 1TVKB 4PHCA 5KYYB 2ZPUA 5CAEB 4GVLA 1LA2A 1DKNA 1WDWB 4EATA 3SFTA 1Y3DE 4WADA 4A8JA 2O2EA 3MRXA 3HUEA 2DCMA 3QMWA 1V4NA 4NCJA 3RYTC 4GRDA 4DM3A 1TC1A 1A9YA 3LX6A 1Q11A 4IFEA 4L8VA 4JQCA 3TAHA 5CFOA 2JLUA 4ZHSA 3I4FA 1LZLA 1LNSA 3KQWA 2VAMA 2EF1A 3H9EO 1RHKA 2GPNA 3WLAA 2JLCA 3FG9A 3G0BA 3DBHA 3L01A 3TL2A 4AXXA 1Y9AA 1WMBA 3VOAA 4C3ZA 3LVQE 1OLSA 1ZCJA 1DU4A 4Z3OA 4HLUC 4M76B 5D3QA 5ESWA 3D4LA 4QO8A 2C57A 3L4BC 3THSA 3IERA 3C6QA 4RS4A 2B2XA 3OOHA 4DLYA 1Z7GA 2PS9A 1MJHA 5E4JA 4E14A 5A1JA 2PVSA 2V6FA 3B36A 3EUEA 5AYVA 2Q8QA 4XLZA 3UAZA 4HB2A 2C77A 3AG6A 4ZVVA 1PBNA 2FOXA 1F8YA 1U8AA 1IH8A 2OB1A 1JLLA 3L77A 3P7MA 4G1MB 4JJEA 3OIYA 4UUAA 2IIVA 4LOJA 2G1PA 1RRFA 2AG1A 3PENA 2PEZA 2NV0A 4CODB 1Q77A 4L16A 1QH8A 3K4QA 1SVKA 3ZDRA 3TM5A 1BJRE 1ZAKA 2ADFA 1H5UA 3BCUA 3FROA 1QRUA 2XMSA 4EFLA 3IP6A 1DLIA 3F97A 3T7DA 2P6PA 3GIDA 1XWFA 4C2UA 1JU3A 3MYRA 4DL9A 2GHRA 1DJMA 4FX5A 1GTVA 2BL4A 2WF7A 4TUYF 5GJVC 3WGVA 2XR1A 2C31A 3BRWA 4HSEA 1I01A 3UG6A 5H8WA 2GHIA 1HRDA 2AH5A 2R7MA 1R8JA 1ZN8A 3IKJA 1FQWA 1LY1A 1ZH2A 4W7IA 1XD2A 3NNNA 5AESA 3P0FA 2H4YA 2LXNA 4U9UA 1XZBA 1I14A 2OV3A 3PE6A 4O08A 1L5OA 4MIYA 2FMUA 2P6OA 2FCAA 1KRWA 1ZM7A 1NUSA 4TKVA 4D92A 1QJCA 1WXFA 4CT4B 4N76A 1U2QA 3BJZA 2RKWA 3OPYA 1SZCA 2WTNA 2BUCA 1V3TA 1XZ8A 2G88A 4Q4AA 3D5QA 3W77A 4LVNA 4MLDA 4K9LA 5F76A 1L4MA 5GAJA 3R3UA 3WIBA 1MQAA 1GTZA 4CIAA 5C5DA 2DLDA 1WMEA 5REQB 3VPSA 2IX9A 3RU9A 3QBDA 2PUCA 1U2TA 4AVYA 2IYXA 4UPVA 4MVJP 1ONBA 1JEYA 1RJDA 2PL5A 2QW1A 3JQPA 3A26A 3AF3A 3OIGA 4PPQA 1SBHA 2EKDA 3KLNA 5J5VA 3RFCA 4A8JB 2ZBUA 3G13A 1N36B 1S8AA 4HNSA 4BB5A 3WFIA 2FUG1 2NZWA 1CULC 2B8JA 4OUKX 4A82A 2YFQA 3CPHA 1LPNA 5DTQA 1FC0A 1U2GC 3RAPR 3Q3JB 3E70C 4RV4A 1VRCA 3DBHB 2PBZA 4IILA 4UVGA 5AVKA 3EXIA 1WXQA 1I3CA 1KI8A 1A5AB 1X1RA 2MR6A 1OLSB 3IAM1 4DLWA 1I9GA 1KAOA 5ALKA 1FMLA 3IDQA 1N4AA 3H9BA 4JMPA 3HYNA 3AGPA 1LLFA 2DY0A 3G2KA 5E4FA 3SBDA 4RKFA 3LGXA 2O7VA 5BUSA 9GPBA 1EVZA 1XL0A 5BW6B 5P21A 5JZMA 3TIFA 4BQEA 2DR0A 1BKYA 3IV6A 5DHAA 4AJOA 4UVHA 1XMQB 1WVGA 3OLXA 4REQA 4FTWA 4B6RA 1I1QB 2Q62A 4IKOA 1JLLB 1UOQA 4FHDA 5DGTA 4WOBA 1HNXB 1RQ7A 1EWTA 2RD2A 4UE2A 1NHWA 3TE6A 4M7WA 1ZIOA 1VIVA 5EJ8A 1QH8B 2H0QA 2QMEA 4U7FA 3UK7A 2OILA 5K8IA 1EVEA 1V37A 2IYTA 5FF9A 3FNQA 2Y1XA 1WOMA 1MX5A 1ZX1A 2EW1A 1T0JB 3A70A 3I6IA 3WLOA 4L4XA 2PRKA 1SC3A 1N3LA 2RARA 1XPRA 4XH9B 4PBRA 4YRNA 2IUEA 4BGEA 2YJZA 5IBQA 4WTOA 4D9JA 2JAUA 1M7HA 1PFGA 4WVFA 4W9NC 1OLOA 1XD2B 1ISGA 2H2IA 4NQZA 1CC1S 1R6VA 2HNAA 2Q5IA 1P4HA 3MCUA 5K6AC 3WAGA 5IANA 1RD4A 2HSZA 4TKVB 4ZCTA 3WRVA 2CMKA 1Y0BA 2PH3A 3OPYB 2XY4A 1JR6A 3NYQA 4JXKA 2BDEA 4Q4AB 2GZMA 4P98A 3GGSA 4TT8A 1V8FA 3X1JA 4BLOA 2H9IA 2ZXEA 4F91B 4CG2A 1QYDA 1PT9A 5TLSA 4HH1A 3MTAA 4G0WA 4WLOA 5K6AA 4WN3A 1IZZA 2VQ6A 3HXQA 4A23A 1HFWA 1GKUB 1ZD5A 2XF2A 1JEYB 1KSHA 2FETA 1T8UA 2V6IA 3OI7A 3OKFA 3B6EA 1D2MA 3GNLA 3QOFA 3R3ZA 4HO1X 4AULA 4EKNB 1P4AA 1TLFA 2GWRA 2IS2A 2XE8A 1RWPA 4J9UE 3RPEA 1HQYE 3COWA 1DAPA 4I4TA 1N5RA 1E2GA 4MH0R 3TRKA 1DJNA 3IEUA 4GXNA 1YZTA 1JTFA 1HOXA 4UE6A 1AUQA 1FTWA 5DT2A 3B89A 1E3EA 1EP2B 1YS6A 3EIFA 1DDOA 4NLLA 4BLSA 3S68A 3EXIB 4BRUA 3CY6A 1KEKA 1JFRA 4B2IA 4CMJA 1C80A 4GKAA 3LS2A 1YQQA 1P7WA 3AEXA 5CW1A 3W8FA 4DHWA 1FTQA 5KYNA 1NW5A 4HNTA 5GGXA 1GAJA 2J0VA 2Q5EA 3CH6A 4BNZA 4BWGA 2V7WA 4DWJA 1UZLA 2VWPA 4K9PA 5DTEA 2VUHB 4HPXB 3QWBA 5IARA 5TT1A 4GPBA 4REQB 4WH0A 2E21A 2NZUG 4YACA 3TSCA 1D04A 3A3YA 2RAVA 3T94A 2X0KA 2W2LA 1P2DA 4XFDA 1DBSA 1PJLA 3FSGA 1PLJA 4OXQA 4RFVA 3DOFA 2JB9A 5ALLA 5BSWA 4BKUA 4EYQ