3ESQA

Crystal structure of calcium-bound d,d-heptose 1.7-bisphosphate phosphatase from e. coli
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
182
structure length
182
Chain Sequence
SVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFRQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITPEAENAADWVLNSLADLPQAIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D,D-heptose 1,7-bisphosphate phosphatase
publication title Crystal Structure of D,D-heptose 1.7-bisphosphate phosphatase from E. Coli.
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 63
structure length 182
sequence length 182
ec nomenclature ec 3.1.3.82: D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase.
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3esqA00
3N07A 5AM1A 1ZRNA 2HOQA 3QXGA 5ALFA 2B1RA 5ALDA 3OCVA 3WK6A 3CNHA 3SHQA 4Y2JA 2QYHA 5AKXA 2P9JA 4B6JA 2OA0A 2HEGA 3I1YA 3OCZA 1JUDA 2FUEA 2P11A 1S2OA 5ALUA 5AVYA 3U7GA 1YMQA 5AW5A 1XVIA 3QU9A 3AR9A 3ZW7A 5AVQA 4L57A 3NIWA 1YDFA 5ALIA 3N28A 4FYPA 2D2VA 3DAOA 3U19A 2HO4A 3MN1A 1TJ5A 2YN4A 3EF1A 3D6JA 3FGOA 3L1VA 2HDOA 1VFPA 3B9BA 3U7HB 3M1YA 5ALHA 4L6CA 3ESRA 4Y2RA 2DQSA 2BY4A 1NF2A 2YMLA 2ZXEA 4J03A 1EK1A 3NASA 3VAYA 3B9RA 4H1WA 3L5KA 4O8CA 4UMEA 3A1CA 1Z4JA 3ESQA 3HLTA 2IYEA 5AW3A 5A3RA 5AKJA 4UAUA 5ALYA 1ZJJA 1U02A 4DFDA 3MPOA 1RMTA 3I28A 3OCXA 2AUTA 3WK4A 2AMYA 5AI8A 3FPBA 1ZD5A 2I54A 1QYIA 4FFDA 1XP5A 1WVIA 2PQ0A 2WM8A 5AKIA 1QQ7A 5AVSA 1RQNA 1RRCA 1RKQA 4BNDB 4UM7A 4OHFA 2FI1A 3OCUA 3MC1A 2G80A 1RQLA 2YMPA 1Z4MA 3FPSA 3ZWDA 3KC2A 1RKVA 4JB3A 3WK9A 5IT4A 5AW9A 3K1ZA 3FZQA 4YH1A 4AS2A 1YS9A 2YJ3A 5A3SA 3OCWA 3EPRA 1NRWA 4BX2A 1Z4NA 2YJ5A 4XPZA 2FPRA 2G0AA 3IB6A 2NO4A 2JARA 3WKBA 1Q92A 2WHEA 2ZBGA 3SF0A 1T9ZA 4Y2PA 1TA0A 1SWWA 4CF5A 3NRJA 1N9KA 5AHXA 1L8LA 2IOFK 5AIBA 3SKYA 1L6RA 3SD7A 5AW6A 3GYGA 3R09A 2EARA 2WF6A 3IRUA 2HCFA 5JJBA 1S8OA 3AR2A 1EK2A 1ZRMA 4UMDA 1U2SA 2RARA 2PR7A 3U26A 3QUTA 5T41A 3DNPA 1RMYA 3P96A 2G08A 1WR8A 4C4SA 5AI4A 5AK6A 3W5BA 3FVVA 5AI9A 2BDUA 3SKXA 4IG4A 5AVXA 4ZEVA 3ZTYA 2FUCA 2FPWA 2GMWA 3ZWKA 5ALWA 4BKMA 3NANA 3KZXA 3ZI4A 2HI0A 5ALGA 2C8KA 2R8XA 3L8FA 1WPGA 2ZOSA 5AKZA 5ALNA 4UASA 3AR7A 2HF7A 2R8ZA 1RLTA 3BA6A 2GHQA 4RETA 4Y2UA 1Z4QA 3L1UA 4ZEWA 1N8NA 1X42A 2Q4TA 1CQZA 2QLTA 1TE2A 2G1AA 4HGNA 1L7OA 4F72A 4XOUA 1MH9A 1XPJA 4I9FA 4HGQA 1VJ5A 4GXTA 3UMBA 4HYTA 4DW8A 3U7EB 3N1UA 4CE6A 4C4TA 2B82A 5IT0A 1Z88A 2IOHA 1ZS9A 4EX6A 5AW8A 5ALOA 4JDPA 3RF6A 5AK5A 2B30A 3ET4A 1RC8A 2W43A 4EEKA 4I9GA 3OTQA 2OM6A 1O08A 3M9LA 4Y2SA 5AK3A 1L7MA 2G09A 2G06A 1QQ6A 3ET5A 1SU4A 3E81A 1QQ5A 2HSZA 1FEZA 3QU2A 3L8GA 5AW7A 3L0CA 3L0BA 2YJ4A 3KBBA 5ALSA 4YCMA 2NO5A 2AH5A 4Y2TA 2IA5A 5AW2A 4PNHA 3ED5A 5AM5A 3WGVA 4BNDA 4NWIA 5AM2A 2C9MA 2I34A 1Z4KA 2YMQA 2OBBA 1J97A 5ALJA 3KDPA 2C4NA 4AS3A 3F9RA 4J2TA 3NALA 3QX7A 5AKLA 4UATA 2P69A 2ZG6A 3AR8A 2YFYA 5ALZA 1YV9A 1PW5A 4KNWA 2JAOA 4KN8A 3ZVNA 1O03A 5AKYA 4E88A 3L0YA 3WK5A 4HGRA 5AW1A 1F5SA 5ALLA 2GO7A 3QUCA 3OPXA 4UW9A 2OYCA 1K1EA 2Q4RA 3B8EA 2JAWA 3ZX4A 5ALPA 2B8JA 1TJ3A 4OD0A 4IFTA 3WK7A 3AR5A 4NABA 4MUMA 2HX1A 3ZU6A 5AVUA 3IJ5A 2P27A 4Y2XA 4EZEA 2MU1A 2B1QA 4NAVA 4BX3A 3PCTA 1NNLA 2CFRA 2RB5A 3A1DA 3L8EA 4ZEXA 4DCCA 5A3QA 3EF0A 4CNQA 3NUQA 3PGLA 1U7OA 3ZVLA 5AESA 5AW0A 3EWIA 3QYPA 4YIHA 5AW4A 1CR6A 4BX0A 3DV9A 5AKHA 3BWVA 4NV0A 4OCZA 1SWVA 4Y3UA 1RDFA 2PKEA 1Z4IA 3CZ4A 2O9JA 2B0CA 1ZOLA 3QUBA 2VKQA 2IOFA 2WF8A 1Z4LA 1QH9A 3UMCA 2W11A 2BDEA 5ALTA 1ZD3A 2JAUA 5ALVA 4UARA 5AIAA 5AVZA 1ZD4A 4YCLA 2FEAA 4UMVA 4YGYA 4Y2VA 5AVTA 5AM3A 2I6XA 3U7FB 1T5TA 4CF4A 5AM0A 1LTQA 3WKAA 1RPZA 2ZBEA 4KYTA 1LVHA 2WF7A 3A1EA 5AI0A 3N5KA 4HGPA 4UU1A 4BYGA 5AICA 5FP0A 3S6JA 4BEVA 1J8DA 5AI5A 3AR6A 3OCYA 3ZTWA 1AQ6A 4Y2QA 4Y2YA 4HGOA 3FM9A 4BBJA 1IWOA 4YIKA 3U13A 3NAMA 4RESA 5ALQA 4EELA 2ODAA 4BEWA 4KNVA 2C88A 2O2XA 5AKEA 4F71A 3ZUPA 2MSNA 3MMZA 4YCNA 1KYTA 4CF3A 3HYCA 3QLEA 1U2TA 3WKEA 3UM9A 1Y8AA 3PDWA 2EATA 3W5DA 2ZBFA 3ZX5A 1T5SA 4UAVA 4G63A 5ALMA 1Q91A 1RMQA 2WFAA 2EAUA 3I76A 3ONNA 4L6AA 3WK8A 2CFSA 2X4DA 3R9KA 2YJ6A 2RBKA 5AM4A 5ALRA 2GFHA 3R4CA 4UMFA 3QU5A 3SMVA 1RLOA 2R8YA 4GIBA 3AR3A 4FE3A 5ALKA 2I55A 4AP9A 3J7TA 3QUQA 3WGUA 3N8GA 5ALEA 3L8HA 2CFTA 5AVWA 2FPXA 3L7YA 3E84A 1WZCA 2YBDA 3SLRA 1TJ4A 3W5CA 1L7NA 3QGMA 2B8EA 3QNMA 3KOOA 3WKDA 5AVVA 3QU7A 1YNSA 3E8MA 4EX7A 2C8LA 3I6BA 4G9BA 2YMMA 4QJBA 3ZVMA 4NFLA 4QQFA 4HAIA 1U7PA 5AK4A 4C4RA 1RKUA 2WF5A 1YJ5A 4OFZA 2YY6A 1Z4PX 2I7DA 4EENA 2HF2A 5AI6A 3DDHA 3WKCA 5E0OA 3A3YA 2ZBDA 3TLMA 3UMGA 2CN1A 2I33A 1Z4OA 3PGVA 3QU4A 1VJRA 2G07A 4UU0A 2FPSA 2GHTA 2Q5EA 2AGVA 3AR4A 1L7PA 5AKGA 5AKKA 2HHLA 1ZD2P 5AVRA 4UM5A 5IS2A 1L8OA 1Z5UA 4KX5A 2FDRA 1Z5GA 4XQ0A 2W4MA 2RAVA 3KD3A 1RLMA 3E58A 2NYVA 4DWOA 3W5AA 2WF9A 2FPUA 4MWOA 2R8EA 3RFUA 2JGAA 5ALXA 4KX3A 4XE5A
chains in the Genus database with same CATH superfamily
4UOZA 2HUNA 4CR8A 4QJ3A 1JEQB 4PRZA 3UJ3X 2EF0A 3RGGA 1Y3CE 3PGMA 5KDOA 3SHQA 2VKTA 3A32A 4O1IA 4REQB 4OM8A 4MCHA 2XZDA 3JQQA 3DLIA 4HDKB 4R9NA 2X9NA 3CCCA 3P1JA 5E7QA 4M89A 3ZNPA 4LSZA 3HR7A 1ECCA 1NLUA 1P2VA 1VJDA 5AKXA 2WYVA 1IN5A 5BQXA 1L7RA 2PQ2A 3TXYA 1YE3A 3BICA 1A71A 2XUAA 2XUPA 4U9UA 1NBHA 5TPZA 3OCZA 4EJ2A 4C7OB 8ADHA 4B74A 2VF2A 4D74A 3QPAA 5LJLA 1KQOA 1LW6E 3IVMA 5E4FA 5B30A 1GV0A 1H1DA 4NCKA 5KNCA 1YBMA 1R4MA 2YIMA 3GFRA 3T95A 2NGRA 1FP1D 1SXJA 3GNQA 4MYRA 3QU9A 4MVYA 4XVQA 4HS9A 4D8UA 3E7FA 3HGTA 3N28A 1C81A 3EMKA 1IUNA 1MVOA 4JJAA 3T1TA 3U19A 4R0VA 1ZU4A 4D80A 2WNSA 2OAGA 4IH9A 1QP8A 4WZBB 4RHFA 4E4RA 1OA1A 2OKGA 4RMIA 4BNFA 1F2UB 1ZH6A 4MV0A 2B5VA 2DQ4A 1WXEA 1VIAA 2F9FA 1ZKDA 4Q3EA 2HDOA 4IYRA 4NG5A 4OAOA 3HFGA 8LDHA 1YRHA 1U8CB 1FX0A 2LCIA 2BEUA 1NF2A 2FPGA 2Q49A 5LZ9A 1UIMA 1C0PA 3TOSA 4RZSA 2VXBA 1W87A 2Q6OA 2BGWA 3W1VA 4XB2A 3BIWA 1EK1A 1RKXA 2I4MA 5HNKA 1U28A 3L5KA 3CZ9A 4PTYA 5BUCA 3C39A 4LY3A 3U40A 6PFKA 3ME5A 2XTZA 1VFNA 4CKBB 4JUIA 2VPIA 2VJNA 1R9JA 2BHNA 4H18A 4PC2A 5CT9A 1ZM9A 3SZLA 1KHHA 1ZJJA 1CRLA 2HKIA 1DHTA 1D2NA 1E8MA 3OQPA 1CY8A 2B4QA 3VX4A 1J9GA 2MR6A 1X15A 2RGAA 3DFMA 4OQDA 3A28A 1JB1A 1Z2CA 2WU0A 4A6EA 1P2GA 1N2CB 2CLKB 2VK8A 4IM7A 4Y6OA 5TEWA 3KUDA 3ENWA 4HS4A 4LQDA 4HV4A 5HGXA 4MUNA 3LTNC 2IW3A 2WM8A 3WGKA 4LMBA 1HF3A 3GQVA 3OPQA 2PUBA 1CY6A 3NV9A 3S8YA 4U8GA 1WIWA 3A6DA 3R9IA 3KB6A 5DHUA 4CYMA 3IBCA 3ELYA 3T34A 1Z2DA 5EJAA 3OOHA 4P4SB 4QGFA 3BCUA 4HY3A 3MTIA 1B26A 3UZUA 4TMXA 4JMPA 3L7AA 3JVEA 3L0SA 5JD5A 1QH8B 3ESCA 4EUHA 1PEYA 1RWVA 1MAAA 4F21A 2LW7A 2JVIA 5D01A 3F5QA 4EHIA 3L7CA 4R2LA 4JT9A 1G3MA 3QW2A 3W8NA 4R16A 2G0AA 1ML4A 4C05A 1AK2A 4X97A 1JLKA 1GAEO 1GKIA 4JLVA 4WSOA 5CVJA 5IDYA 3UJDA 4ZICA 4ENVA 1KVQA 1S6YA 2JATA 1YK1A 2ZIVB 3BSWA 3H13A 3PUWA 2C1ZA 1L8LA 3L7OA 2V5AA 2QJOA 3BD8A 4IJ5A 2C2KA 4IYJA 4NONA 4Q4CA 5JPCA 4WASA 1PJZA 3O1LA 2VT7A 2I4RA 3ZYZA 4J43A 5JSHA 4BAGA 2X41A 1RXEA 1SOVA 3DZKA 1VPDA 4PHHA 2LP4Y 1P2DA 2Q99A 5FNZA 2R66A 3MRVA 1O77A 2FW8A 2ZTUA 4GICA 1JXAA 1T13A 2VR1A 3BXPA 1DBIA 5KOHA 1EB9A 3KLOA 1FMJA 5DWQA 2XKBA 3ABZA 3CBQA 4DYDA 1TQ8A 2SKCA 3BFXA 4CCWA 2MSKA 2MSCB 5BY2A 3O26A 3WOHA 1V3VA 2RKWA 4XYBA 4KFCA 2FN4A 5C80A 2R2GA 5K0GA 4EG5A 1M83A 5SYNA 4IG4A 5KNDD 1HTTA 1A5TA 1NJ8A 2H85A 2UVPB 3IUSA 3FMPB 3QPBA 2GETA 5C35A 2GUWA 1IMOA 1Z45A 2I1WA 3P9SA 5DCYA 4WFJA 3KQNA 2JLRA 4ARUA 2V59A 4LDAA 3REGA 3ZI4A 4CDGA 3SC2A 2QG6A 2EHDA 3WO1A 4KO3S 3I5YA 4WA8A 2DRIA 2QF7A 3DVAA 4U63A 2DB3A 3ANXA 3EXG1 3SDSA 1M6VB 3W2IA 4Q01A 4RFSA 4IL5A 1OF1A 2WJYA 4JXJA 1DTEA 2Z95A 4CR6A 1OYWA 3Q9SA 1LD3A 1PTJC 1USGA 2GAFA 1ZCFA 1MTOA 4K0RA 5DU2A 4DQ0A 1HLDA 1NW4A 2JVJA 4UE2A 2HA2A 5FPYA 4IUBS 3TIXB 4BEBA 2BISA 1VJ1A 4YRNA 3H3FA 1IONA 2CHEA 3LI2A 4L27A 4YR9A 1MU0A 1G5RA 4OLFA 3UTDA 3UAVA 3USCS 1EKXA 4CM5A 1DUVG 4XOUA 4OXRA 1I4WA 3DHEA 4C0HA 3GGDA 3NQ41 2FPIA 2HL6A 1NNI1 2VA8A 2IHYA 2OZVA 3GNSA 5LLDA 2BGTA 1Z0FA 3O93A 4H77A 1M8GA 3AY6A 1BCSB 4YJ2F 3U7EB 2P90A 3HUFA 3PXUA 4RHTA 1KE1A 1T3SA 1GLNA 1O89A 1VYTA 2O3RA 2PMCA 3FBGA 2QI9C 3H11A 3O2QB 2GD0A 2R97A 1JJBA 4GNRA 4HB0A 5DM1A 1U9IA 3D0OA 1C3OA 1XK7A 3NYWA 4ABYA 2IOHA 1XEWX 3NBFA 2VSNA 3BFKA 2ZXUA 3ESBA 2PGAA 1OFIA 2CWWA 2W6JA 3FI9A 5FADA 1VSTA 3SQMA 2BFDB 5KSOA 4Z4QA 1TDJA 4WDQA 2UDPA 3NOVA 4GECA 3COSA 5DNEA 3T9DA 1V3TA 3I37X 5BWMA 1KDZA 1FRZA 2J3HA 3WL7A 5A5DA 5JFGA 3IDSA 1R5NA 3JAKA 3F5DA 5L3VA 2Q41A 1FA9A 2VXYA 3RK1A 1Q1NA 3N5CA 3CXRA 2EC5A 2OXTA 1YRWA 1JQ5A 1BQ4A 3E1KA 3QG5A 4UTVA 4I2VA 4MYUA 3BMQA 1EDOA 4U1RA 1EXMA 3N70A 4DLVA 1C0EA 3LVQE 1RHRA 2YJ4A 4MAFA 1FQWA 3JQGB 4DMKA 2A0KA 1Z83A 5P8WA 4ATNA 3HADA 1KU0A 1Z12A 2IBSA 3RRYA 3VYRB 2E3JA 2HA5A 1W0JA 1DL5A 2PWAA 2ZUBA 4PRKA 3QIAA 1MJFA 4BNDA 2WUEA 1GSHA 1KMHB 1LTKA 3FX2A 4XGIA 1P0PA 4MH0R 4XKJA 1PR2A 3C8MA 3W78A 3C7KA 3HCBA 3S99A 4QDUA 3ZWWA 1Z4KA 4G8CA 5KYKA 1TVKA 1E2FA 3GJ0A 1U0FA 5ALJA 3CEHA 2ZW9A 5DHAA 4DZZA 1QO0D 2IEGA 5K0SA 4TSFA 2WHYA 1S01A 1LU9A 2YUTA 3PP8A 3SXJA 3VU9A 4D9BA 1TIBA 1QH1B 3IOBA 4WD3A 5G4KB 1CR4A 3BT7A 1EIWA 3C6YA 4W5HA 3LLMA 1SZPA 3CNQS 1NKVA 3G9XA 4YJFB 1MCZA 1T36B 1OTHA 1WEHA 3FPGA 1I1OA 3DBOB 2FK8A 3EPKA 1HDIA 2NSYA 1N5KA 4WKBA 4YRPA 3A9WA 3OZIA 2J45A 2QRNA 2DFTA 3IAUA 5CM2Z 3FCOA 3EGIA 2QRKA 4TYNA 4KLZA 3ZWXA 2WJZB 1NVGA 1M74A 2FWRA 3P0FA 3GEMA 3QVUA 2D7CA 2AC4A 2GEFA 3REFA 1YJXA 1O95A 1T34A 3QLVA 1JQEA 4ND1A 2A88A 1A96A 2EKPA 3BOSA 5G53C 4DCMA 2Z1DA 4LHZA 4HMOA 1N5IA 1NAHA 2ZETA 3T5BA 5HE8A 1DRKA 2V45A 3TLYA 5JAMA 4XYLA 3FF1A 1Z22A 2B20A 2NO6A 1H1TA 2JK0A 4O5AA 5BUSA 1JPJA 4ICIA 4RZ3A 2OHVA 3EF3A 3W4KA 3X1JA 1ISIA 4CCYB 5FLXA 4INAA 1OT3A 3OTHA 4AKIA 2QPAA 3S1SA 1VMEA 2RGNC 4UHEA 3GLKA 4C0QC 3JSXA 3AWIA 1MORA 5JDCA 4TMTA 3EVZA 4HFMA 1RM0A 3EH1A 3KWJA 4BB6A 4O3FA 4FHZA 1DC4A 2XHZA 4FEYA 4LOJA 4OQMA 4MRRA 1SVNA 1C9DB 1DKOA 1GP2A 2IEAA 2D2FA 3GO4A 3LWDA 1TMKA 3PIRA 3DE2X 3QEOA 3QVGA 3K20A 4R1OA 1GNLA 3OM8A 5BXQC 3J7AC 3WISA 4M0FA 5L3RA 5C34B 1HETA 4ARAA 1PX0A 5B1YA 4JT8A 3BWVA 4X7PA 1ZGHA 2WG1A 3Q5GA 4HX9A 4QRDA 2NLOA 1Q2UA 2PWZA 3IULA 2AFHB 2CGEA 2IHBA 3NP7A 2PGOA 1UXJA 2IGTA 1N57A 5IC5A 2WOOA 1O2DA 2DKFA 3EZ7A 2Y6VA 1ETUA 1ZD3A 4FCWA 3TQFA 4E2ZA 3G5UA 3FMIA 1IIRA 3COWA 1F4LA 2O1WA 1IVYA 2P4UA 4W7IA 3TW8B 1H9BA 2WU3A 3ZKAA 3O4IA 1N5RA 2B3DA 2QM8A 3OFVA 4RBNA 1FU4A 4B3FX 1AMUA 1UANA 1F7UA 1B8PA 5DP1A 1WQ3A 3ILSA 5BWLA 3AFHA 2XMDA 3THYA 2I6XA 3R6WA 3O3NB 1YIAA 1MRZA 4LHEA 1Y37A 4A1OA 3OWOA 3PLRA 1RPZA 1SFRA 4N7BA 3VZRA 4HDRB 1MAUA 1H6AA 4V2IA 3AF2A 2HFJA 3N5KA 2ZB8A 2WSSD 4MP6A 4BJ3A 4BYGA 5BN5B 3S6JA 4AICA 3FGPA 1FU7A 4OHVA 1P80A 1CHNA 1KI1A 2ZSEA 2ZTHA 4ZI3A 2VJMA 4YTEA 3QBEA 4DR6B 3BGVA 5CFPA 1OLOA 4HAZA 3FG9A 2X5KO 3NTLA 4DJTA 3RTDA 1T3TA 3V4RA 4O4HF 3ECSA 3SYKA 3LCVB 3H4IA 3M9WA 3LPLA 4MCAA 4EHBA 5HIJA 1UOPA 5BQFA 2NMVA 5AKEA 1TO6A 5J2UF 2PRYA 3ZEIA 3HXQA 2DR3A 5E9AA 1LX7A 2FUNB 1IOZA 3WGHA 3ABSB 3QOWA 1C9EA 1TPYA 3KU4A 4V24A 5J47A 4D4GA 5AJWA 1RQPA 5BP7A 1UOQA 5C1DA 4KTVE 4G81A 2FK7A 1KZ9A 3G49A 2CCGA 2X5OA 3RYFB 2A4KA 1QC5A 3H9GA 3V8VA 4G63A 4W5RA 1E4YA 2ODTX 3HNPA 4C4OA 1QPZA 3UAOA 3D2CA 3EGOA 1E3DA 4Q00A 2X4DA 3IBTA 1FRQA 3B1YA 3DEJA 3ZXIA 1T2AA 1HEUA 4D6YA 5DGIA 3GA5A 1E2KA 1H0RA 2WP0A 3R4CA 3EIOA 2C1XA 5JROA 5LMCA 4JV5B 1XWFA 3JTEA 3NDIA 3OPMA 1V1MA 3MWLA 1W9MA 2FSVC 3OESA 3MCAA 4KRGA 1H6CA 5REQA 1TM5E 2GBPA 4LJKA 5JWHA 3PPXA 1FYWA 2PMEA 1PO7A 2GTIA 5KWIA 3OFJA 3L4JA 1T5HX 3TQCA 3CKMA 1MV8A 1Q0QA 1XZIA 4YA6A 3RHZA 2HXGA 4GS5A 5CX1A 3P2MA 1J1ZA 3BMNB 1T0PA 3RU7A 2BSAA 5CDFA 1H2AS 3A3PA 2V0CA 2AZ4A 1SOWA 2XVYA 1SVOA 1IPEA 1Z68A 1W8IA 2NZVG 4BKRA 5LA6B 4C5AA 1Z26A 3FF4A 5L53A 1VYVA 2IQ5A 2H5EA 5HQJA 3FPJA 2FZGA 4Z4HA 4H4DA 3DMRA 3GLHE 3HY3A 1EQAA 2QROA 1U7PA 2WLSA 4OI4A 4RKYA 3ZDXB 1PDOA 1L5HA 3Q7PA 4PYNA 1HL7A 4C4RA 1RKUA 1XRPA 2J0UA 1GNQA 1RRKA 2O3UA 4Q4AA 4BJ6A 2JI4A 3KQSA 2G9UA 4X65B 3KBOA 4COKA 4J3FA 3CMCO 4G09A 4K9RA 2IS6A 2XIQA 1XRMA 2W6NA 2G04A 4O2BF 4N0DA 1YKSA 4RIIA 5JO0A 2B7CA 2P2GA 2XGJA 4MVJA 5IUJC 1UBEA 4FXOA 5GONA 4LSMA 3UMGA 1G2PA 3D3EA 1NIJA 1DDOA 3JARB 2H7CA 2J9ZB 5LN1A 5KYYA 2JD0A 3BRWA 3W6ZA 5JMPA 1ENOA 1G9TA 3RC7A 4HWSA 2ISSD 3NBQA 5KI6A 1VIDA 5LNK6 4M0LA 4BNHA 1WBBA 2AD1A 4LDJA 4EQ6B 4PLFA 3ILVA 4DBVO 2QLNA 4LRUA 4N41A 1XO1A 4I9NA 4G0NA 3NTXA 2FFBA 3PQCA 1FLAA 3B51X 3AETB 4YUYA 2D0IA 2W4MA 1A9QA 1Y7IA 1JKJA 3FJOA 3K9CA 5B1SA 3R7SA 4B75A 1NMEA 1W5BA 2X5XA 3M2TA 2BEWB 2NWQA 3V80A 5IARA 1GTZA 2GO1A 2FPUA 2J4CA 3QVKA 3LX8A 3V3KA 4EA7A 2YVAA 2QGFA 2XB4A 3I9NA 1MEJA 4BZXA 3IS3A 3N07A 5AM1A 2CEKA 2HOQA 4UXJA 3JYOA 1NXVA 4BLTA 1K89A 1VOTA 3L0IB 3FUCA 5DNUA 3DYIA 1R0CA 4PW0A 6AT1A 4H15A 1U7WA 1DIAA 2OMEA 1ATZA 4YFVA 2GLXA 5IYZF 4CLRA 5CVDA 3QVJA 5M34A 2P9JA 5KAPA 3TSCA 3BD9A 3WS7A 2MSDB 2EBUA 2W8BB 3PNQA 4M54A 1M66A 4V1CI 3PHLA 4GPAA 2E5FA 1PFUA 2Z98A 3DZCA 2WNIA 1W75A 3HFRA 4G07A 2Z8ZA 2NU7A 3MPUA 2DFVA 2JFFA 3Q8KA 3UKOA 5HTKA 3M4XA 4IZ6A 1UP6A 1P6UA 2WV9A 1V1JA 4NX2A 3BMOA 3QI2A 2GHIA 3HP1A 1BE0A 1CNEA 2JA1A 3ROQA 1Q1QA 3ABQB 1IM5A 2RI6A 1QHEA 3OC0A 4HLQB 4N0EA 3HM9A 1F9EA 1DUSA 2GZRA 4PLWA 3U4GA 2VK4A 2I91A 5B3JA 2PNFA 4GGPA 4ECEA 5JSYA 3L4KA 4IDFA 4TTSA 1Y3HA 5KAMA 3L1KA 2F64A 4OKNA 4Q3CA 2ZU0C 1UMCA 2Z58A 5A05A 1V9LA 3U7HB 5ALHA 5JLJA 3KXIA 1EFLA 1W0KA 2FSSA 2Z9CA 4G0XA 1XAIA 1ZWKA 2IHUA 4YDSA 3C48A 3UY4A 1U0JA 2YXNA 1R6VA 2E4VA 5KJ1A 5EE5B 2DFLA 4TOIA 1PZGA 3FWNA 2QMHA 3KT8A 3BRCA 3CVJA 3UHFA 2EJBA 2XMRA 1H2XA 5D6NA 1EEXB 2H9IA 1VE9A 3ZWCA 1YF3A 2VT6A 1A5AB 1ND6A 4PFSA 3A04A 3U9LA 5IG2A 3I58A 1OWMA 2VL7A 1V5WA 4Y6PA 1XG5A 2VTBA 2DERA 1V5GA 3WGLA 4IJ6A 2AMYA 4D02A 2H4WA 3LUJA 1ECGA 2C99A 2QD2A 3HU5A 5CW1A 3VR3A 3UEOA 1KTIA 4TL7A 3NJ8A 2WWGA 1A8QA 4FDUA 2MWMA 4QPCA 1RI1A 5K8JB 4MV6A 5FUXA 4TWJA 1U8AA 1XN4A 1SZDA 1W4ZA 1Z6GA 1HX7A 5HP4A 3OCUA 4U2BA 4HDSB 1T43A 1ZJ6A 1Z16A 1AGRA 2A9RA 3NWEA 3U56A 4Z51A 2WA2A 3FKQA 3LUHA 3IT1A 4J07A 1ONPA 2LKDA 4R1PA 4R1SA 4X90A 1O5TA 5BW6B 3PQ2A 4BNGA 3FETA 3T9CA 4DYVA 2WHPB 2GBCA 2YOGA 1JR2A 1NBWB 2D5CA 1V3QE 3GDOA 4ZIRA 1VP9A 1PRYA 5AOBA 4JI6B 1C1XA 3V9PA 4B2IA 4LXXA 4I1SA 1H6BA 4DLXA 2UVDA 4HUTA 3NHRA 4MVXA 1Q92A 5B6PA 2WHEA 4WUVA 2C61A 1T8WA 3WYBA 3E23A 4J0QA 3MWEB 3IP7A 4TV8A 1LUAA 4I3HA 3GQBA 3ZE2B 1NF9A 3T5MA 4DF3A 5DULA 1JFTA 1ZCJA 3CZRA 2X6RA 3RIEA 4TLBA 2JL1A 2OHHA 4AN0A 3PNKA 4EYQA 5DNCA 5DYTA 3C41J 1CRWG 3SD7A 3JQ7B 4L3OA 2E85A 4GYYA 4MQMA 1OI3A 2YVKA 4FSDA 4HQKA 2ZJFA 5H68A 1ZSYA 4AZ0B 3RRJA 4B2YA 1ICEA 5SV2A 3DKIA 5BPFA 1I7SB 3DW1X 3Q9LA 4PXSA 2AKYA 1R2QA 1GEGA 1JWBB 1MPTA 1QZTA 5EMJA 3IPAA 2BFAA 1GGKA 3MA0A 4IJMA 3WRXA 4ZZ3A 4RTMA 5AVKA 5IHXA 5D1NA 5CURA 1U1FA 4JFAA 4BQPA 4EDFA 5CLQA 2WMYA 3QQ5A 1W4BA 1X39A 3V3TA 3TN7A 4ZGGA 2J87A 4FWIB 1SIUA 5AK6A 5CB4F 1N0HA 1ORHA 1P72A 1PVVA 2EX4A 4JBNA 1OC4A 3R8CA 5FBHA 1G7RA 1U1CA 3MWDB 4HX2A 3K0SA 2ZT7A 2ZYVX 1LF0A 3GFBA 4KQWA 4B3SB 4OYHA 5CP8A 1Y5IA 2HSDA 4KXVA 4AY6A 4QQRA 1KEEA 1N3BA 2YXBA 3TFWA 3ESYA 2VQSA 3TMAA 3QY0A 3STTA 3B85A 3IV9A 1KSJA 4QXAA 5I9IA 4BFSA 1AU9A 5HQ3B 3NO4A 3R2JA 1YBHA 3L0DA 2Y05A 4L85A 3TZQA 4E31A 4KI0A 1R0KA 4RTPA 2GHQA 5BMVF 2Q46A 4D97A 2F17A 2FQQA 2GOYA 1X42A 3URKA 3K5WA 5K5EA 2W6ZA 1CQWA 4JITA 4ER0A 1L4HA 3O9ZA 5K8CA 6ADHA 3TQHA 1UDAA 2B7LA 1XU4A 2FMFA 4FOPA 3RFCA 4JP5A 1UDXA 3D7SA 5ER6A 5F7JA 1JIJA 1GUFA 3W2EA 5TARA 4I4IA 5JI2E 3I53A 1U1DA 3AV3A 1IH8A 4OH7A 5F2EA 3ROKA 4C0AC 5A5GA 1KFEB 2QGZA 2IRWA 3CF4G 4YR7A 1TMOA 4ARZA 5FBKA 5E2BA 5L3QB 4D43A 5IVKA 1JZQA 5FUQA 1OC2A 1IY0A 4YDHB 1RZRD 3WDLA 1JBQA 2FEKA 4ZYXA 2JIRA 2R60A 3BCSA 1JF8A 4RLFA 4FD2A 5TB5A 1ZS9A 2OV6A 3B6IA 5I5GA 1HZZC 1T6ZA 1XWWA 2VPTA 3EGDB 3HJTA 2I3GA 3JWGA 1XAJA 3UMFA 2G1UA 4L02A 2WSYB 1OTXA 3IEUA 3NOQA 1TLTA 5TMDA 1R8XA 1DPGA 1Y1SA 3DL2A 4FYMA 4KLRA 5D3QA 1SVMA 1WG8A 4AX8A 1HY3A 1AHHA 3EFBA 4MW9A 4R69A 2AX4A 4OPMA 3GN2A 3H6HA 2VZLA 3PS9A 3VPHA 1D5WA 1KO5A 1A9ZA 3RSHA 2GWHA 3G1UA 3IALA 4LWOA 2KJQA 3ET5A 1YVDA 2PKXA 3HA5A 3PXAA 4G5YA 4MV5A 5HIKA 3W0LB 3FHOA 3V1KA 1ZD8A 2GCIA 4G26A 2JDIA 3P0EA 4Q7EA 4HUJA 3OE1A 1WEKA 4F6RB 5BVHA 3DHNA 3C5EA 3RU3A 1PL7A 2C7BA 1FMCA 5B3LA 1O6BA 4BO1A 3WLNA 2CHGA 2J09A 2IVZA 3ENZA 4PXYA 4S1OA 5GJCA 2G5PA 2WKWA 3O3CA 3I52A 2Q1SA 2D7JA 3DOFA 1G4UR 4J1QA 4MEBA 2ZBRA 4CN8A 4ZOBA 4QYWA 1PBNA 3CW8X 2ZTMA 3DUFA 3MD9A 3A10A 3UAZA 5SZKB 4OMDA 3IDQA 4FJ1A 5BV0A 4DV6B 2XBMA 3VJRA 1QHYA 4V02A 2VRBA 3LUKA 1EXNA 2E7ZA 3MTAA 5ES4B 4BXOA 1KSHA 1QCDA 2XB8A 4ZAYA 1M34B 2JIMA 1G3UA 3AHDA 1GFZA 1Y5MA 1TUGA 1YV9A 4Y1RB 5FF9A 3I0MA 4EJMA 2ZDHA 1Q95A 3CE9A 3JVDA 4DSTA 3DTVB 3M4JA 4JGGA 3UMRA 3O1JC 4A0FA 4BDTA 4TXMA 1ULBA 5JARA 3V4VB 1KJ9A 4WKGA 3MLBA 2G5CA 3GEEA 2AXQA 3JASA 4QGSA 4NFSA 1EE9A 4OVKA 1MXFA 3DWEX 2OYCA 4HH1A 3GEBA 3MCZA 3WHPA 5KHAA 4XW2A 2JCYA 1H8EA 1NPTO 1YZTA 2AN3A 4UHFA 2B8JA 3SYTA 3EXEB 2PD3A 1CG6A 1SMKA 5EHZA 2XUFA 3WIBA 1PNTA 3FWHA 5HJ2A 3I5XA 1QTQA 4OIFA 2O59A 4R7GA 3AF5A 8GPBA 3RAFC 3I2HA 4MUMA 1TA9A 1BVUA 4OGFA 4NENA 1K63A 2IQIA 1O96B 1X7XA 2G0NA 4WESA 2XQFA 3C87A 5LZ5A 5BSEA 4BO9A 3PJFA 4Y9SA 1HDXA 3UWOA 4DRXB 5JS1A 1N33B 2IDZA 1TM3E 4B6PA 1RAHA 3L8YA 3GEGA 1M2EA 3DO5A 3DJFA 1ZJ4A 4QOEA 5BRJA 1IHXA 3AT1A 3BMCB 3PEVA 3WBBA 5BWBA 1V4NA 2O2DA 3FB1A 3EF0A 4R83A 4JSTA 1SQ5A 1Q20A 1W581 2BKAA 4X93A 5H3LA 4ALMA 4BV3A 4RJTA 4MHTA 3V4OA 1BVYF 3DQPA 1DKPA 5JCOC 2ADMA 5HDQA 4AYWA 3TEMA 1YTLA 3IR7A 4O1MA 5BV7A 1WUHS 1Z29A 4KZPA 2FRDC 2MR5A 2P1ZA 1JEQA 5IUKC 5CAEA 1SOAA 4DV2B 4YT8A 1SUBA 1J8QA 4OCZA 3ZJVA 2PA3A 1Z5ZA 2DCMA 5JXIA 1N7HA 3CZ4A 3ETGA 2JLVA 4TZ0A 3L7NA 1QHHA 4G65A 3DZHA 4HDKA 3KSDO 3W6NA 3E3AA 2J9YB 1ECBA 2J0QA 3G85A 3JYPA 2R47A 4LJ7A 2RFLA 4Y6RA 1R6UA 1N0WA 1NJSA 3DZBA 1ZD4A 3CRW1 4H3KB 5EJ2A 4C7BA 4C7OA 1MC5A 4TT8A 1KJNA 1P60A 3NIFB 3K0AB 3OUZA 2NM0A 4LHYA 4X6YA 2PFSA 1G16A 2M6RA 3BZWA 3GRVA 4YGYA 1JFFB 1EVYA 2XSZD 3CKYA 4AL4A 4BQIA 5ESXA 4HH0A 5IZ4A 1Q17A 1AZTA 1GAWA 3UJ6A 4BHTA 2P8SA 3SP1A 2IYSA 3LQ4A 3SX4A 5FPSA 1CUDA 2ZSBA 4L9WA 4A0GA 5EE3A 2HLDD 2VUUA 4CR7A 1PN3A 1OLSB 3S2SA 1PJ3A 4KYTA 3GG9A 1OWOA 2BKUA 1LPAB 1RYDA 3VHXB 4B35A 5H3HA 2HSGA 4COOA 4C2UA 4DRZA 1FSZA 1OROA 4Q1DA 2CXRA 4MV9A 4AZWA 1A1VA 2QNBA 4ER6A 1NZFA 4FLEA 1FMFA 1DBRA 2ZVDA 3B36A 1BMFA 4B3IA 2HQSA 3MIIA 3OO1A 2JFPA 4Y2YA 5BUZA 1MW8X 2O8VA 4G9GA 1IWOA 5AXBA 3BIXA 1E3WB 1OYVA 3H1EA 4O2AF 1DXQA 3G89A 4IDAA 3OUUA 5EIOA 1FFGA 3EC2A 3KHKA 2GYWA 3EZFA 3COVA 3HP4A 3KZMA 3DNFA 1EVIA 1VCHA 3AU8A 1SD1A 3C1AA 3H0KA 4W82A 4HSEA 4PQGA 2Q0QA 1DIRA 4KK3A 4UBMA 4M36A 3S1AB 4OK3A 3DDCA 5I4BA 1C50A 1W5SA 4XIGS 5BNTA 5KJ6A 2J67A 1TCVA 4CF3A 4CIBA 1HYEA 3I9MA 1M8KA 4ND2A 4AB1A 1NLYA 3UK1A 4BRWA 4M38A 1Y8AA 2RC5A 1YASA 3G0GA 1C3XA 2JGDA 2VTVA 1F3LA 2BTQB 1BDBA 1PSDA 2O5RA 3F47A 4Y6GB 1TEXA 2DHCA 3DOIA 3PXGA 2ZJ4A 3IQHX 4I81A 4NCHA 1S96A 3GDWA 2EFDB 2AZMA 3P9QA 2CFSA 3DQQA 2AXEA 2N46A 3GHYA 4QYTA 4J9UE 4WBNB 1QRTA 4DTIA 3B1KA 2BT4A 1E7SA 4C6HA 1HBJA 4NFYA 1F60A 3MGKA 4LMAA 2X13A 3DEHA 4P4SA 4M1WA 4PZLA 4DM7A 2X6TA 5JJ5A 1UR5A 1K6XA 2A9FA 4PLHA 5E9JA 3B3GA 4IO1A 3EGEA 3SBXA 4D81A 2G1KA 1TAUA 2Q6VA 3HB4X 4FIZA 1WZCA 3DBLA 3P4UA 1ZGBA 5KJCA 4FEGA 4NLLA 1NXTA 1WV1A 5J4LA 1L7NA 1ZBDA 3TIIA 4C0JA 2HTEA 2A1TS 1VLVA 4U2KA 3CB4A 4FFLA 5JE8A 4CCAA 4EO9A 4EO7A 4LMRA 4BMYA 2UUCB 2AJDA 1BS1A 1EBFA 3C1TA 3GPLA 4XWOA 1TZMA 2B9VA 4C7XA 3I30X 4PLYA 5LD2B 4FYWA 5BW8A 4CF7A 1DQZA 4JVNA 3QIVA 4HQOA 4I46A 1ACMA 3RODA 2XR1A 5LDHA 2A5GA 3OE5A 1P29A 1ZD1A 1V4VA 5LWQA 1DC3A 5LZ4A 3O3MB 4CIYA 1PCXA 1G21B 5HXAA 4Z1MA 3H7AA 4XLZA 2VAXA 2R6R1 2ATIA 3INNA 4QBFA 5IKPA 3DVQX 4WVFA 1Z4PX 3C5WP 1KZHA 2MT9A 3RHSA 4DUZB 3HCRA 2R1ZA 4P0QB 2FZCA 4BWVA 4G89A 4N6OA 1WXGA 5AI6A 3PJDA 3HCNA 1GNVA 5L4SA 1RHQA 1HNWB 5K8IA 1NXXA 4OH1A 3OQ6A 2UVPA 2WQZA 1YZGA 1G9XA 1JNXX 2Y9PB 1E1QA 4JA2A 1CEQA 1VE7A 3QU4A 3NGXA 3CIFA 5IRCD 4OB7A 5E7IA 3L8ZA 2XTMA 1NUTA 3VSCA 3KCQA 4CMBA 1CJKC 1GYRA 2VUIB 1FDOA 3PICA 2PZLA 3FCUB 3ND5A 2Q5IA 4UHJA 2F48A 4UEQA 1XTSA 3H2KA 3ONWA 4A4DA 3VDRA 4JLBA 4J6FA 3A1SA 2ECKA 2XOKA 4WLUA 5ANRB 3KQHA 1Z5GA 3G13A 4EA9A 3VO1A 4PFJA 4EKNB 4GPZA 5LKAA 2Z5LA 4DWWA 1SXIA 2RSLA 1SVKA 5B7PA 3W5AA 4PR3A 4AI6A 1USWA 1QE0A 4NCIA 1P33A 2NAFA 4TVOA 1SC1A 5ALXA 1WB5A 3BBLA 4I08A 4G0VA 1MNQA 5B1EA 2CVZA 2HJSA 4MKHA 4CEHB 1LI7A 3RPEA 4IQ0A 1UMDB 1LY1A 2P6NA 3WMXA 3ER8A 5TT0A 1BCSA 1HRDA 4NBNA 4XUGB 2QRZA 1BFDA 1BH2A 1SKYE 3CT6A 3RIHA 3BQ9A 1ZXXA 2WZBA 1XHFA 1B16A 1BXGB 4J0IA 3ZE6A 4M4SA 5C37A 1JA0A 3B3AA 3JD3A 4AMBA 4M6WB 1CYDA 1TO1E 4NS1A 5B36A 4I1PA 2VNSA 1F2VA 1US8B 4NBWA 1JDJA 4IMRA 4N5MA 1KBQA 1Y3IA 2BFDA 5E3IA 2NZ2A 5ALUA 3KR2A 4WNCA 1DIGA 3QK7A 4IIYA 1RCTE 3EZNA 3IDZA 4L16A 5FI0B 1OH5A 5TPWB 3TLEA 1MO2A 2IXTA 3AG5A 3QLUC 1EZZA 1ESDA 3FHLA 3T7TA 4PZAA 4L57A 5EESA 3NIWA 3WDKA 4AJLA 2WFZA 3FNBA 2FOIA 3L6CA 5H70A 3SIPA 4HNTA 2X4GA 5E2IA 1K8ZB 1HL3A 3EVCA 5FV4A 5B37A 3ZXUB 2RK4A 2JLBA 3AKDA 3LLUA 3E9MA 3NUZA 1V3UA 4TWAA 5B53A 1FRNA 4I66A 4B6FA 1Z15A 4YMHA 4HAOA 2FW7A 1UP4A 3NH6A 4DV5B 1ZIXA 3CKLA 1E1RD 221PA 5EZYB 3FY4A 3HDVA 5FTNA 5JBQA 1I3CA 2CB0A 3ESRA 2DQSA 2YMLA 1THZA 3AM5A 3HRIA 3JQGA 5CT6A 3SJUA 4G37A 1PLLA 4R41A 4DMCA 3A4IA 3OX1A 2DSNA 3NTOA 4A91A 1FP4B 1Q15A 4ED9A 3W4JA 3RYIA 3VZSA 1EH5A 3FTDA 4I55A 2UZAA 4X85A 2VQ6A 3EOAI 3TI9A 4YRGA 2P3QA 1G4HA 3JPYA 4A15A 2H07A 1XJ0A 5A4FS 1U02A 4YMLA 1AK1A 3PU6A 3SE0A 1XZMA 1S2LA 4PY2A 4A16A 5I8PA 2V03A 3C3EA 2CV1A 3T7JA 2IUFA 5DM0A 1OI4A 4X0EA 1QH1A 2C3PA 2XX3A 1C1YA 3OZWA 5G4KA 5KO2A 3ZIUA 5B2FA 4KR3A 1G63A 2ZSUA 5KVSA 3N7TA 1PTKA 4NMXB 3TIVA 4HWRA 1BVHA 1T36A 4URHA 3GV0A 4FFBA 1A8SA 2P9TA 2LRHA 4P38A 4YV2A 2IYPA 3K1TA 1MP0A 1JXQA 4U39A 3UFBA 3AUFA 4LY9A 4IXTA 1N4DA 3QKSA 5B7QA 2CLFB 1PBTA 3DZFA 3VSDA 2JH9A 1SBZA 1XVVA 3L7IA 4HAYA 4TUYA 2IU0A 3BJIC 3P0RA 1XPUA 1XTPA 1T8UA 2CXTA 3EUEA 4GT1A 3RSQA 3W77A 5BUQA 5FRDA 5IF9A 5FPHA 3ZCRA 5F4BA 1T4BA 3A6ZA 4JB3A 1G2IA 4H2DA 3RYHB 4EITA 1PJAA 3N39C 2Q4OA 4KP7A 4X71A 3SQNA 2P5YA 4L1KA 4F46A 2GJKA 3JYNA 4EB6B 1UK8A 4E33A 2QBYB 2FPRA 3C43A 4O4JF 5LB2A 1CUYA 2P3SA 2WHRA 3CH5A 3OZVA 3VZQA 3WKBA 5KX5F 1GDHA 3KQLA 2XITA 4CCYA 5C8ZA 3K0CC 5M3BA 3OEHD 1RAEA 3CWQA 3K15A 4Y7CA 1Z0SA 3PC8A 4ZANA 3VV2A 4RVGA 3U3DA 2DXIA 5AHXA 1G20A 2IDMA 1NJ5A 1TLFA 1KH2A 4GEKA 4BV9A 1NW8A 3JRWA 1GZ7A 3TSOA 4F5WA 4QPNA 1GFWA 4MUIA 4X64B 4NH0A 1X1SA 3H0EA 3QWBA 5FUVA 5JTUA 3RAEC 3J80A 1BW9A 4ZYLA 3MCWA 4GMDA 4FEEA 4AMZA 4ENUA 7MDHA 1JS1X 1HE3A 4CI9A 4E08A 1J25A 2IPNA 1UT8A 1I9GA 4WZAE 3LVRE 3CNOA 1N8SA 2AFHA 1UBSB 2PPLA 1CZUA 2O2ZA 1HA3A 3H0CA 4WXMA 1WXWA 2HPVA 2ZSDA 5AI4A 4FI3C 5HKBA 1IBMB 4G0UA 5FHQA 4D4KA 3SKXA 3QWIA 1M6NA 1OKKA 4JWKA 5IAAA 3MRSA 3UPTA 3HJAA 2HJRA 1VSBA 2HSEA 3ZTYA 4S0XA 3EIXA 2GMWA 3LRTA 2VP0A 4PNEA 2WNHA 2ICAA 4N6NA 1HRKA 3DFZA 3ZWKA 5FBLB 1DEXA 1KPIA 1B8NA 2HI0A 3PQEA 1BSVA 3U44A 3E9NA 3SQLA 1J0BA 2A59A 1ZM4A 4J76A 3ZQUA 5MHTA 5AFSA 2MINB 1IJKA 2HM7A 2DLDA 3UGKA 5KTYA 3WL8A 4ZHSA 1AGNA 1SHTX 1TC2A 2ROQA 1A88A 1G7SA 1FS6A 1I7NA 3RLFA 3ZU4A 4B7AA 3LT4A 3TM4A 1JDTA 2HSWA 2JIZA 4LJSA 3IOYA 2YWHA 4R2WA 3RRBA 2WUWE 4MULA 1W1UA 4QASA 4A6DA 2HR1A 5BMOA 2OD7A 1U2GC 5FTLA 1AVTA 3K2EA 1JU9A 3MMNA 2YWGA 2P6RA 3YASA 3RVPA 1UPUA 3QX8A 2DKNA 1KS2A 2X4LA 4GQIA 2AW5A 2BDTA 1OU4A 2IP4A 2IE0A 2YYSA 5FLYA 4UVHA 4DG9A 1T8RA 1IPFA 1R0LA 1WZUA 2ZIAA 3QE0A 4IHQA 4MKIA 5LXTF 4YJ2B 3TRJA 2DEUA 2WSLA 5JDIA 3ZU5A 5JNLA 1S2DA 2QUBA 3ASVA 3OQHA 5FLEX 1VKZA 2ZS7A 3CWZA 3FZEA 4PYQA 4TQ9A 4BGVA 4MWTA 4U7WA 2P79A 2PSJA 2QZ4A 1XLTA 4DE5A 4A2QA 1DKLA 1LRLA 3G0OA 2XWBF 3ETHA 3NKFA 4G23A 5COBA 3ZZ1A 2FYTA 1KE2A 1X9HA 3EBLA 4JDPA 2NTVA 2J4DA 3ET4A 1IULA 2YIJA 5JAOA 4OXNA 2OWEA 3BF7A 1HSOA 2VFAA 4JU8A 4RVHA 2IJGX 3D1LA 5GAJA 1X3LA 3TZEA 1PFKA 2P3LA 4MUEA 5AK3A 2XDQB 4TTPA 3RT9A 4TVKA 3R76A 3MJEA 4MPDA 4MO9A 4YAUA 3P71T 1BWPA 1W36C 1I6KA 1NR5A 2J3LA 1TW3A 3RTAA 3ZXXA 2D54A 1QQ5A 4NH4A 1Y5NA 1NQOA 1BEUB 4ZT6A 3VC3A 1OXUA 1YK0A 4W1QA 1R12A 1T5OA 3U17A 3BK7A 1ARZA 3GCZA 2JLZA 1K5DA 2AH5A 2QQFA 1PR3A 2XNSA 1YU9A 1SUAA 1XXHA 4RTSA 5F78A 4UVGA 1JMVA 1SG9A 1WCWA 4A0QA 4RW0A 3BMNA 5EJ8A 2MMGA 3EY9A 1JYSA 2XDAA 3TI7A 2CD7A 4TS9A 3AF0A 3HM2A 3TTTA 1VDZA 1KEKA 4S04A 2R6AA 4W4TA 1JAZA 1ZO8A 4JVLA 4N4AA 4C7KA 4X66B 4BQNA 2ZRBA 2BE9A 3GLIE 4IJVA 2AQ8A 2PHZA 4FI3F 3IX7A 4KGVA 2W2PA 4JL6A 4RXMA 4QTUB 4ZOQI 5J4KA 2G5TA 3NALA 2P67A 1GD1O 1NQWA 5AKLA 1TQ4A 3OE4A 4B84A 4WK6A 5DHQA 3OFNA 1FBTA 3OT1A 2DT5A 1AUPA 2R96A 2FSPA 1UM9B 1CF9A 4LJ5A 4DNOA 4EHNA 1BFUA 1OPRA 5JZMA 5ILOA 4A8JC 3H83A 2IX3A 2P2NA 3Q15C 4HWPA 1Y3FE 4IEFB 1B14A 3CF0A 3ID6C 2P9BA 3RC3A 2CUKA 1F5SA 1KRWA 3DPSA 1MOPA 4KL8S 2NU6B 4RWEA 1ZIYA 2RHOA 2V8OA 3AG6A 3P52A 5SY4A 4ZHQF 1KKLA 1XA4A 1Q83A 3IA7A 2Z8YA 4XAQA 3COYA 3JARA 4MW4A 4D2IA 2FLVA 4GUDA 5E1OA 5I9LA 4OJMX 1PUIA 3U16A 1JG7A 4L8WB 1LQ2A 1UBJS 4CQLA 1U2DA 3BULA 2HREA 1LI5A 4RJJA 3UV6A 4IIBA 1I0ZA 2H5LA 2DWPA 3LQFA 3TCXB 3WNQA 4D6XA 2J3JA 3RSZA 2HDHA 5J3JA 4ZDIA 2OFWA 1HR0B 1L2TA 1TUBB 1U0OC 1D2AA 3H5VA 1YRAA 2ZRFA 5JLAA 1S0UA 2C59A 3AETA 4ONEA 3PGA1 2VDRB 4L73A 4YHBA 1QV9A 1ESZA 3FPAA 4F11A 1ZH8A 4NATA 4GZ3A 1NE2A 3U81A 3FYDA 2ZJ1A 3NWOA 1AKQA 1R5OA 1W76A 4PO9A 1L4YA 4G01B 4LHXA 3ZHXA 1AM4D 2DUWA 4A7PA 3QKWA 2Y0PA 5AW0A 5I7FA 3ZY4A 4M87A 2DMRA 2OSVA 1CR6A 4JBWA 2ASEA 4J0DA 3RFTA 3DV9A 4YQFA 1NQVA 5B58C 3FAKA 1L7DA 3EVTA 1E6KA 3MCTA 3I61A 2ECQA 3PNVA 5T3YA 2OBNA 4Y98A 1KOGA 4MGZR 1PWEA 1IG3A 1XNQB 1NULA 3BIJA 2F1OA 1T25A 4NS4A 1SR8A 1U0HC 1XD2B 1DS6A 2BDEA 1T8SA 1JKMA 2HA4A 2W8BA 3AXSA 4ZMRA 2ZJ6A 4IR7A 4HQ0A 2XH8A 2V3CC 3QZUA 3S2ZA 4Z49A 1ZH4A 3RG8A 3M4NA 1MIOB 2Z2ZA 1WB9A 1A2KC 5AMXA 5IEJA 3PQFA 3BSFA 2D8AA 4RGYA 5DBHX 3SVZA 3GRKA 2BD0A 5KYNA 1N1DA 2HGSA 3CF4A 3VPGA 4PYKA 4MV1A 4TTIA 3ACCA 1RFLA 3I6ZA 1E6UA 4QT4A 1AQJA 3IEVA 2QX8A 1YBAA 4OA8A 3OOEA 2VXOA 3HVKA 1C2TA 4GNKA 4HGPA 1XEXB 3IMKA 5EQDA 2OB2A 2ZJAA 4I1VA 4OFXA 5AICA 2WTAA 3G3EA 4KIJA 4P7JA 4OXYA 1NUAA 3AVQA 3ZGXA 3K9GA 4K5QA 3HACA 1A9OA 3F6RA 1CY2A 2IIVA 2EP8A 2X0RA 3BVPA 3JXEA 2YVLA 4L5AA 4OHRA 5K6TA 2A4MA 2WHQA 5ALQA 1KNQA 4YRCA 4PTZA 3QFHA 3EG9B 2HJVA 2CDAA 3KLBA 4KNVA 4O4HB 3F6EX 4LECA 4AJ4A 4BTEA 4NMHA 1J20A 2VZEA 1QGOA 3A9UA 5J2UB 1CUVA 2JJYA 2QVCA 1NJ1A 2IUEA 1XLVA 3I4LA 5A6SB 3VV3A 4D3XA 1N78A 4P81A 1GVHA 1ZA1A 2NVUA 4JC8A 2VEOA 4INZA 4KE8A 2OCPA 3BAFA 3OO0A 2IKSA 2PCLA 3LHIA 1M72A 1MX3A 4JCCA 2DFPA 2P6PA 5L7WA 1LX6A 2BFCB 2IKQA 1I2ZA 3QPDA 1BE8A 1BHO1 3H19A 3PBKA 4FZRA 1QZ3A 4RTQA 1JHUA 4HTAA 2OT3B 2GSWA 3HHEA 5HCIA 2J9GA 4WOKA 1FYDA 5JXJA 4RGVA 2QX9A 5LKRA 3RYCA 2RBKA 1KI6A 3DEKA 5ALRA 3WGYA 5LU8A 5IXSA 4IVRA 4KG7A 3VTZA 4ID3A 4HDSA 3S2FA 3LPDA 4UMFA 5AO9A 5LP6F 4ZVLA 2H4JA 421PA 1XWIA 2XNDA 1LRKA 5DGTA 4DJAA 3PNBA 2JPDA 2AMFA 4QELA 4LF6B 1FZTA 2ZRAA 3BDAA 1PAUA 4DDMA 4XPIB 1VM6A 1XN1A 2C84A 4WKNA 4NPCA 2ZFUA 1ZMXA 1GGEA 1T3ZA 1WCIA 5AQEA 2PJRA 1UBRS 3Q6MA 4HNAB 2VCHA 1NZJA 2EFGA 1M2KA 2C3MA 3NHBA 3AGQA 2QRPA 4RIFA 5EWLA 1JEYB 1CUJA 5JEEA 4DIBA 2IGBA 1OBFO 1OFGA 2O8CB 4ZMBA 1QFYA 3BGDA 1XFDA 2DE0X 4PNPA 3GMSA 2Y2UA 2OBMA 2ZJBA 3QE2A 2OZEA 4YWHA 1JLHA 3HA7A 1NQ5A 1H2BA 2PGXA 3DD5A 3V8MA 3HEMA 1L9XA 1SC9A 4HAIA 3CNEA 3AV0B 3ZY2A 3OJOA 2IP2A 2SBTA 3PEUA 1MB2A 4YCSA 4PLCA 1WUKS 3P9ZA 4MDFA 2E9SA 2WF5A 3R3UA 2QTCA 3LLSA 2YY6A 4ZODA 3UUEA 2PMDA 5I7VA 2PGNA 4RAOA 2QW0X 1H8HA 1Q2XA 2HJGA 1JR3E 3BXXA 4IH4A 4UE3S 4ZAXA 1U3CA 1FXUA 2UUOA 4QOSA 1CUZA 4C5BA 1AA9A 1N5JA 5CFZA 5GINE 1RYFA 2R8RA 4XZ3A 4KXFB 5FFFA 1EINA 1V8FA 1X80A 4ZT7A 1IVNA 1EI9A 2QIPA 1U28C 1K6MA 3L40A 3QPVA 2IEDA 4F6CA 3I6YA 1OASA 3KOYA 3MJVA 4WHMA 4CT5A 5CEFA 1JT2A 1JFSA 1PLKA 4EGSA 5TS2A 2BMWA 4FMCB 2X2PA 4ZYUA 5MN4A 2QTAA 4ALNA 4EA8A 4QBKA 3QOYA 3AR4A 2GBLC 3DM9B 1V37A 3RSCA 1U5CA 1XQVA 2P0YA 3LGAA 1GL3A 1XDDA 4AZ3A 4O8ZA 3C5HA 4UM5A 3CWCA 2QRMA 4PO1A 3WYNA 4ZGBA 2RD2A 4PZ0A 3JD0A 3TZLA 4GYKA 2X0DA 4QDJA 3KD3A 1XQ9A 2NYVA 2WJPA 2P6MA 3AUYA 4HVTA 5GM1A 3IBYA 2CK3D 3U4AA 1CJUC 4MVJM 2NUTB 4UUAA 4G86A 3I1JA 2WD7B 3BE6A 3VYTB 2CLOB 5HM6A 4MJLA 2NO9A 1RYYA 1C4XA 1CJMA 2WTEA 1YOVB 4OGKA 3M33A 5ECWA 1WY5A 1R4AA 3ZNQA 4I14A 4LYFA 3W3ZB 4DLRA 1DAEA 3FYCA 3KX2A 4BKPA 3HCAA 1X0XA 3N2NA 4U0KA 2ISCA 5HMLA 1GN9A 7ABPA 5HTOA 3PNOA 1ODSA 1LSOA 4AX4A 4CLOB 1TCBA 5I9NA 2H3HA 4WBNF 4QDXA 4PYLA 4RVCA 3FN4A 1SCKA 1A72A 4F1WA 1NVEA 2X8WA 5IC4A 3ADBA 5HF6A 5A9SB 4Z1OA 2FUEA 2OYRA 1EJ0A 2AN1A 3AJRA 3EGDA 2ZUUA 2Q9UA 4CKWB 5EE9A 3ZQ4A 4JKOA 1QV7A 3KEOA 3VO8A 2VSOA 4L50A 4D8VA 1SVUA 2P0EA 4DC1A 1MD9A 3ZDQA 3OAAA 2I1QA 2D2VA 3CW9A 2V6IA 3DMYA 3S70A 1SAYA 2OSBA 1J39A 1AGYA 2N0SA 5TQJA 1MC1A 1TJ5A 1WDKA 1YE5A 3IILA 5CDSA 1ID8A 4YP5A 2TECE 1OBVA 2K7ZA 5D5PA 1V5IA 2QP3A 5F9MA 2KB0A 3C3YA 3UB2A 1IBKB 3HCCA 1CV2A 2R8BA 5DI9A 3NT4A 3MUEA 4HRAA 4F6RA 3E4DA 1D6MA 4UUOA 3MQFA 2XDWA 1KI4A 2NSJA 5JXGA 1UMBA 3VAYA 2ZQ5A 3VO2A 3IQFA 1H0SA 2F8LA 4KYVA 2R1VA 1GCIA 1ZVKA 2QTMA 4JR1A 4PG8A 2DR2A 4ARCA 1XTRA 5AW3A 1L4EA 1UC5B 4GP7A 2Z08A 1HMPA 4RVNA 3WJ2A 4OUDB 1E1KA 1SNYA 3QXSA 3UMJA 1RMTA 4ZK6A 1MIHA 2OR3A 3LK6A 4J0GA 4K2HA 4PSKA 3ZEAA 1ZMOA 5CD1A 1PWHA 1O6CA 4O63O 1AX9A 4JAVC 5A04A 4JLJA 5JALA 1M34A 4QJIA 3BYZA 3DWFA 3WK4A 4BJ5A 3TB4A 3DP9A 4MICA 2I54A 4JB2A 3UJAA 4FFDA 1D6NA 4WCDA 2P6OA 2G77B 4W5NA 3DTVA 2VNAA 3H8WA 4YAWA 1V8BA 4N39A 1EK5A 3O4GA 3VKGA 3I9LA 3NHLA 4HN4B 2HMWA 3CH6A 4ODIA 3Q3CA 1FRVA 3HBJA 2EF1A 1KIAA 2P5TB 2XNKA 4WXYB 3LC2O 2CVHA 1YC2A 2WJ3A 3D7MA 1WCXA 1KFKB 4Z99A 5B1IA 2IS1A 3GXOA 3KV1A 4H7DA 4MWDA 3W79A 3SG0A 3WLIA 3L0ZA 1JG3A 1L1EA 3L7JA 2XUHA 1L1RA 2PUJA 2W6CX 3K1ZA 5DMXA 5TF4A 2G4CA 2VQ3A 2VHTA 4QUEA 4TYMA 4QM7A 5ECGC 4KN9S 1Z2AA 3UMVA 1OVGA 1XQWA 2NO4A 1O96A 4D82A 1GILA 5LQCA 1LFAA 3JWJA 1SBCA 2KLBA 3TRHA 4EW6A 1FVFA 3SEFA 4OJYA 5J4HA 1TA0A 1Y4ZA 3SYRA 3TSZA 1GGFA 1IFXA 2P62A 4KGXA 3PNSA 2DF8A 4X00A 3U31A 1L6RA 2P9HA 1XF9A 3BMCA 4GRAA 3TLCA 3WZLA 2HN9A 1Q1EA 4E1VA 1E1DA 4RPCA 3OCCA 3BJRA 2BMAA 1V6AA 2NVOA 4BE9A 2GBIA 1Y9AA 3IRUA 4KRXA 3IR6A 4MDYA 2WC1A 1G5IA 2WYIA 3M70A 4K8OA 4LDZA 4EUNA 3EPJA 3ORRA 4K9LA 1JQBA 3WP0A 1DX4A 1WAMA 2H2FA 4Z7QB 2PR7A 2PVSA 3UWPA 1HQDA 1I2MA 2FKAA 4IGFA 2BOVA 1RI2A 5DXAA 1BXRB 3SC3A 5C1OA 1N77A 3HTXA 4E32A 4CGZA 2PX8A 1A8HA 1N6KA 2IHKA 3HDYA 3L02A 4EUKA 3FDIA 3AONB 1X7YA 1K3FA 5AI9A 4EARA 1Y8RB 2W7TA 5CB4B 4GI7A 3SN6A 4H60A 1PFGA 2CL7X 2JNWA 2QN6A 3DONA 3EIWA 3QKRB 1P0MA 5DGCA 3BJZA 1NVVQ 1HT3A 1NU6A 3DVRX 2I8CA 3HLYA 3K0AA 3KZXA 1TM2A 2C78A 2Z2XA 4H0NA 4HN2A 4X20B 1JFFA 3UYKA 4RA6A 4JXKA 4AJNA 3D0QA 1JL3A 4C08A 5A7FA 1H3NA 5AKZA 4EPYA 4HN9A 3JWHA 2XMQA 1Y4DE 2WW8A 2GBGA 2QMEA 4UNIA 4AIRA 2R8ZA 4LFAB 1Y1RA 5LVAA 3OZDA 1RLTA 1AK9A 4OGGA 4X6XA 1CDOA 1OLSA 2BN4A 3NIDB 5IVIA 5HEKA 4Y2UA 3RTBA 4XQCA 2OAQ1 4ZAGA 3W5JA 2WPDA 5DTJA 3L1UA 3IE0A 3OU7A 3V5NA 2B99A 1U2RA 5DNVA 4JOCA 5CNKA 2XKKA 1RE0A 4FBMA 2V7PA 4F2HA 1QGUB 1TE2A 2G1AA 1X1DA 2QRUA 2XNHA 3PI7A 5EKSA 3TJRA 2R44A 3KSRA 4A23A 2QTTA 5GWXA 1NT4A 1XMIA 3PQ7A 2CXNA 1YDHA 2ZSIA 1PJ4A 4AJHA 2ZYUX 2GT1A 4FPXA 2PLAA 4OQ4A 2DUNA 1U3FA 2HCBA 3HVJA 3KSZO 3OHMA 4QBGB 5CVVA 1KXZA 3LT1A 4BO2A 2JCGA 2WIJA 4BV8A 3BGIA 3E3NA 5FUMA 1A9SA 4KMMA 3L1JA 3QPUA 1O95C 3QLVC 4ZI7A 4K6KA 4X60A 1EFVB 5DT2A 3D6MA 3EVFA 2C3UA 4LC9A 1R0YA 5C5CA 3BDVA 2GEJA 3PHGA 2HA0A 4K40A 2EBWA 2QQEA 3BA1A 5CX1B 1O58A 2H8KA 4HXFB 1DB3A 4M0UA 3RRZA 1TU4A 4ARSA 4EY5A 3UPUA 2BMVA 2BTQA 2DBZA 2G4VA 5DGDA 5C1BA 4Y67A 3FSEA 4M1QA 2QENA 1ZKMA 3DE1X 4FBGA 1QOPB 2PJUA 4IDGA 4LBYA 5GZ6A 3U4CA 3S8MA 2O8FB 4NMMA 1F2TB 3E0QA 3ZV5A 4P80A 1FNBA 2HHCA 1DUIA 1OUMA 3EEBA 3D8NA 3DE0X 3PQ5A 4Y2SA 4FMBB 1WZ2A 4REOA 4KE6A 4KKXB 3ZIAA 1QGAA 1C80A 2SKEA 5G1NA 3ZBTA 3GFQA 2AG5A 3KLNA 4LNHA 3IH5A 3GX1A 3KTDA 3CGWA 4ZU3A 2X86A 2FETA 2WMDA 4R9RA 2NQ2C 1KYWA 2H1SA 2P6UA 1VP3A 4QAQA 5JD3A 3UB3A 1LGYA 2NO5A 3I45A 1WNTA 1X6VA 2OVFA 1MJHA 3UXEA 3EMDA 3RREA 1E0DA 2AL7A 2Q2NA 2F3UA 4B32A 3RS3A 1E2PA 3H5NA 3TLGA 2MYNA 1WXXA 2QX7A 1QZXA 1PFWA 4HLCA 3JD4A 4QQNA 3TOVA 2QM0A 1MB4A 1WF6A 4D9IA 3CONA 2UYHA 3PT9A 4Z9XA 4LXTA 1T0JB 2QAIA 1ZDMA 2YNMA 2QKYA 2Z2IA 3L92A 4FC7A 4ND3A 2OD2A 3BSYA 2ZATA 1B43A 1KSGA 4JQSA 4P0PB 1N6OA 4PICA 1MRNA 5M2QA 1G21A 2WT8A 1EVKA 3DLPX 1LTHR 3DC7A 3MBKA 4OG2A 2C2XA 3UH0A 3M81A 4MV7A 3ZDAA 2A0FA 1IM2A 2EW8A 3LP5A 3WWYA 5JY1A 2VJQA 5AXAA 2C7VA 1LC0A 1B0AA 5KCMA 3U3OA 5C8XA 2IXGA 4E07A 2CHQA 1UK7A 1PL6A 3QPWA 4S24A 1XVTA 2E4AA 3WGZA 3QYJA 5JJLA 1K0UA 2BBOA 3KOXA 1BAPA 2BKXA 2X8JB 3OPXA 3L82B 1M67A 2ECPA 1LZLA 4GLLA 3UANA 3ZWYA 9ABPA 2Q4RA 5CB0A 4LIPD 3OWXA 4OK6A 3I6QA 3N2EA 4CMJA 4CJXA 5KPJA 2CFIA 4KQMA 5F12A 4GOMD 4UNPA 3T1VA 3UG6A 3NM4A 4P8RA 3GP8A 4WZZA 5B1HA 5EUCA 2WUGA 3T9FA 2R85A 4HSGA 4A8PA 1IHDA 3KJXA 5LZ8A 1EXWA 4C22A 2O52A 2CUNA 1W47A 5C8YB 2C03A 2B1QA 1ZHHA 4ARBA 1TF2A 3PCTA 4MUHA 4XLLA 3ICQB 2A35A 2C7OA 3DZJA 4DCCA 3GLUA 3OZCA 4JYCA 4PQFA 4Y1EA 5G1PA 5FAKA 2WJIA 4GWLA 2ZRJA 1SCUA 4V0MA 5JAIA 2I6SA 2NNWB 4FBLA 4NBUA 2GEDA 5I3CA 3NI2A 1L4NA 2C7GA 5JECA 1K27A 4L0CA 5JNRA 3QUSA 3I8SA 1Q3KA 3CC8A 4BX0A 5HS4A 3WY9A 4CEHA 3G9ZA 3MMSA 1LNQA 4Q9JA 3OJCA 3ZPXA 5TV2A 4PLGA 1TPZA 4J0FA 1L4KA 2O9JA 1ZOLA 3ENVA 1BXGA 4P4GA 1NXQA 2PRIA 3AMVA 3K6RA 3RVSA 4TXNA 1JI0A 3LZDA 1QH9A 2VRNA 1T91A 2F8TA 1R3DA 4BN0A 3CO0S 1CJCA 4LDNA 1Z33A 4KV7A 1JAIA 5AIAA 1US8A 2ZT6A 2XLCA 3DV2A 4JT4A 1AIPA 3LOUA 3OJ0A 2P0AA 4JP2A 5A4JA 4RKQA 5DWVA 1NVUQ 2C04A 4FUQA 4KSBA 3JWIA 1KARA 4QAJA 4QNNA 5FQOA 2D1QA 5ITWA 3GRCA 3M6AA 1IWBB 2AYYA 1YQTA 3UGJA 1TUEA 1HFWA 3C6KA 1X7GA 3HDHA 5DZSA 1OGYA 5EXSA 3LBIA 5CA1F 1FFWA 3DYBA 2CCJA 3HLKA 4UUNA 3TNFA 2YWEA 4CKZA 4P5EA 5MN6A 1ABBA 3WKAA 3AVVA 2Q1WA 1KJYA 2VSXA 2LIVA 4G97A 1SM4A 1XALA 4HF7A 2XF2A 1DTWB 3A1EA 3JQ9A 4ZXPA 2C9CA 1XJWA 4RV9A 4Z7NB 4ZGWA 5E6UB 1DINA 3N3AC 3NONA 1O0CA 5CT5A 2WICA 4G1FA 3W90A 3PK0A 4BEVA 1YQWA 2QTGA 3I9FA 3KELA 2SCUA 2OXIA 4RZXA 3K9BA 2W2VA 4FCVA 4N5HX 3LC0A 4QU9A 4IDBA 1R5BA 1UWVA 3HWSA 1SKBA 5MF6A 3NAMA 4RESA 3RUCA 4DLSA 1XC7A 2ZUVA 4Z2YA 5K01A 4O2AB 1D0SA 3LIIA 2QT1A 1L4LA 5B3KA 2P2CA 3L7DA 4XLTA 3AW8A 2ZM6B 5IKEA 1VDMA 1AGPA 3ZJ4A 3T9AA 1L4MA 2FZ4A 3TUIC 3NTVA 3VC2A 1FUIA 1E0AA 5LQUA 2PH7A 2O8NA 2ZUSA 3IIEA 4Q19A 5JCJA 1I3OA 3RO7A 3A6JA 4CXMA 4B3DA 3QLEA 1KFJB 4INPA 4ZZIA 3DB2A 1S2NA 3UM9A 3IPCA 2AR0A 3E5HA 5D3MB 4UHHA 3FJYA 5F52A 1TMYA 3KVNA 1SUIA 1JR3D 3IT3A 3V2UA 5CB6A 4UFNA 1BRTA 1NLFA 1E9AA 1GDTA 1ISMA 2YZKA 1YZ3A 5HMMA 1S3GA 1OH8A 3FMFA 4DIOA 1W6UA 1NZDA 4RS4A 3BIOA 3FWYA 4HTFB 1P4JA 4EDHA 4XQEA 5K8VA 4UVIA 4WJLA 2J33A 1RLOA 3W06A 1JG6A 1QLJA 4GIBA 3CLVA 4TV9B 4BNXA 2I55A 4KIUA 4XVUA 3VPFA 1H94A 3GPBA 3K0KA 4F1JA 4G4IA 1V7QA 2A9QA 3QEMB 4BTLA 1R1DA 4ZPJA 3L7YA 3H5OA 3IUNA 2ZU6A 4KDRA 3V6MA 2QBYA 1JHDA 4UM9B 3PNYA 4IF6A 3CUEF 4RSGA 2PJZA 1PJLA 3HKDB 4DIEA 2B8EA 4X91A 1HURA 1YI0A 3NOOA 4KCGA 3TLAA 1UKVY 2JF0A 2R8PA 3D5EA 1QNLA 3CNBA 3HCOA 4HEA1 4YRQA 3I01A 4G9BA 3VKVA 3Q1KA 5KTKA 1E18A 2HGZA 3TNLA 1PV4A 4WE3A 4AAYA 3PJGA 3KQYA 2VYNA 3WLLA 4N03A 1A04A 3GJTA 4RIGA 4B4KA 3DMDA 3A70A 3DEAA 5COQA 2AOUB 1N25A 2NZXA 3ZWMA 1K6IA 5FO1A 3HG7A 4LRQA 3RK4A 1UBTS 5TX7A 1UKYA 2PGIA 3X0DA 2VPXA 1SY7A 7REQB 1FSSA 2PKCA 3HY6A 2WINI 3RVMA 3UPDA 3G2HA 1EDBA 4OQNA 5B3JC 4JNKA 5T3UA 3KVOA 3KYIB 4R9UC 4LJ4A 3B1ZA 4M49A 1K5GA 3RUHA 4GVLA 2PKRA 3RWMB 1AZSC 1G98A 3AEQB 4OQXA 1KI8A 4AP6A 2RGDA 1YB5A 3EASA 2WM2A 3PFFA 2XD9A 1JQLB 2WIGA 4FX2A 2JKVA 3E18A 2D7DA 3ADPA 2FGJA 1QS0B 2EEZA 3KOMA 5HYVA 1QIIA 3KK0A 2CNWA 2PMKA 2AG0A 3U4HA 4PN3A 1D4FA 1GR0A 5IBPA 3NWJA 1PDWA 1XI2A 3VDMA 2C0QA 1XE3A 1UC9A 4UU0A 5E4TA 5G02A 2MINA 4ZVNA 1KWKA 1T9GS 2AK2A 1N2BA 2TS1A 1R8JA 5LZ2A 2YH2A 4WACA 3ZCPA 4ZKDA 1H42A 3G02A 2YV3A 3WFIA 4I3GA 4ZRDA 1ENYA 1AB6A 2JJ1A 3DZIA 1WX1A 3IGFA 1IHYA 2TSYB 4FZJA 1E7MA 2Z5VA 4F12A 1RLMA 3KKPA 4JJKA 3UJCA 3MUOA 1Y7LA 2BP7B 3JWEA 4MYHA 2Q3MA 3EHEA 4DIKA 4DWOA 4ETWA 1C7RA 1FFYA 5LLTA 1X7ZA 3GLQA 3AY0A 4YREA 5A3VA 4XD7A 2IPXA 2V4ZA 1LWOA 1WW3A 2Q6IA 1J2YA 2NZYA 3AI2A 3ANYB 3EDOA 4YP9A 1SCQA 3DWIA 2I9KA 3U3RA 4YJ2A 4HG2A 4KREA 2DULA 2X0EA 3M8KA 5SYAA 3OLZA 3SNKA 4YRKA 3OM0A 1QO9A 1F51E 1MNAA 3ZDDA 4DDVA 4OF4A 4NOKA 2DP4E 5FR1A 2OGWA 2JRLA 3ROEA 3AJEA 1NM5A 4YX9A 2XBUA 1FNMA 4EO4A 1YULA 3P7MA 4I1RA 4EEZA 4IDOA 4MKZA 4PG7A 4DAEA 3JQAD 1SURA 3K9NA 2C20A 2CNOA 3NAQA 4JWTA 3O9MA 3HU2A 3EXHC 4PAWA 1DRJA 1O4VA 2LIPA 2G40A 3AR9A 2E48A 3FYTA 4GYWA 2QPOA 4B81A 2HZBA 3D8SA 3F5FA 5ALIA 2HHJA 2XDQA 3P32A 4D79A 4NQZA 5EGSA 3ENNA 5DFAA 3ADDA 1DJQA 2J08A 4YXWA 3QSGA 1SKAA 2ZPAA 3MINB 4ZO9A 3MEQA 2W0MA 3GLRA 2HWUA 3CCFA 3R3SA 3CGGA 1VFPA 2M9MA 3JS5A 3WRXC 5ADUS 3A11A 1M1NB 2UZ0A 3DGEC 2IX9A 1UFQA 1ZITA 2L2QA 2XYHA 2ZXEA 4G67A 3GVPA 1NBMA 3GRUA 4RHEA 2Z3WA 3PDJA 5EAIA 5J59A 1F1BA 4RPLA 5DBEX 2OLEA 2FN9A 4UMEA 4Q37A 3IBSA 1ZGJA 1YZYA 3MT7A 4JR0A 4X44A 4XWAA 2RONA 3HLTA 2V58A 2OG1A 1Z2PX 4MR9B 3T3PB 1QK3A 3UT0A 1WKBA 3TZCA 4EW3A 4TTRA 4DLLA 1G3RA 3ICOA 1P75A 1GRQA 4ZQIA 1PHRA 1I2CA 1OZHA 1CHDA 1AXEA 3CRNA 4HWKA 1QF7A 1CERA 1E9DA 4NYIQ 3BN3A 4D98A 3PUZA 3WHLA 2PYIA 5KEIA 2AUTA 3N2GB 4MYSA 2VH2A 2C5HA 3DO8A 4FWBA 5FOTA 3HRHA 4HGYA 4JJ8A 5FB3A 1QYIA 2WM3A 4L4YA 2OORA 5IBCA 3G1TA 3H6KA 4HWGA 1I6WA 2QM3A 2NUAB 5JBNA 3U6BA 1OLUB 2C2OA 2K7FA 2O19A 3LYAA 1RQNA 1WV0A 3KOWA 1R9MA 3Q72A 4FZVA 2OUKA 4OHFA 5IEBA 3WA7A 4Q21A 4YJ3F 5AJUA 3B7PA 4L8FA 1DWUA 1K68A 2D2IA 3I04A 5CLIA 4EJSB 4X5OA 4TM7A 5LP1A 5K45A 3CVYA 1PS8A 2OCYC 2R6GA 3NDRA 3NFYA 5DN6D 2IYAA 1IEXA 1OBHA 4RQAA 1XNRB 2YCLA 1IQUA 4XGQA 4D26A 2YY5A 3GLHB 5AUOB 2BM8A 4URXR 3V7WA 1GUBA 4L15A 1ZGCA 2A84A 1XTUA 1YB6A 1VJ0A 2TMKA 1X2EA 4H1HA 5DNYB 2XB9A 1FJ2A 3IKVA 4L28A 2WZDA 1SBHA 2NXCA 4O4JB 5L3ZA 1Q1AA 1OILA 4HVAA 1TAQA 3V1MA 2NU9A 5KX5B 1TUBA 1GYQA 2VDJA 1A4UA 1FFAA 2VYFA 2F3QA 4UTPA 1V8ZA 2AFIE 4IHJF 4CF5A 3NRJA 1V11B 4ZOLF 1EWRA 4ZEOA 2VT2A 3R7WB 3WA6A 2OK8A 5E6SB 3KKOA 5ESWA 4WCFB 4AKTA 4KIWA 2FSHA 3QJYA 3UWKA 3M1IA 2ZJ3A 2NIPA 2UV8A 3NHSA 4P9NA 6ABPA 1AO0A 1T0UA 2C5GA 2WD8A 2ZRIA 4PSCA 1HQCA 1JR4A 2Q9AA 3V1LA 4O1HA 2VJOA 4KSCA 4BVLA 3ORSA 3HV0A 2CZQA 2E2WA 3B89A 1V8OA 3HBMA 4QD3A 2HRCA 5GVRA 2DWOA 3SC6A 3ZCUA 5HVNA 4GQAA 3KEMA 4ESOA 3PGKA 3L4BC 1W0CA 2KI5A 4C4SA 2ZE8A 4OQZA 1RP1A 4X7RA 3SYLA 4D0NA 4GX5A 1EVEA 2VDNB 2VTKA 2Y1CA 3DR5A 3OY7A 1U0BB 1PD1A 5AVXA 3V32A 5HUQA 3DLHA 1BHSA 3ETNA 4MJ3A 1OXSC 1U4SA 2NZJA 2YBEA 4AY5A 2FMTA 4FIDA 1EWQA 1PVDA 1DAPA 1ZJYA 4AUEA 4PG5A 4TTVA 2O2SA 4EK9A 1L5KA 4D9KA 1RR6A 4TVSA 1UXGA 4L5JA 1NNEA 1NJGA 3IMEA 5JQWA 2H00A 4FJ2A 2QP9X 4W5JA 3KKNA 1D2RA 4ZAFA 1ZHOA 1ODCA 3ISVA 1J1UA 3HDGA 2D8MA 2I99A 4G4SO 4NU8X 1K97A 1YRLA 3I23A 1JPVA 1S1CA 3L49A 4MTLA 4RV4A 4DADA 3AM3A 4CW7A 5EJ9A 1DV2A 3SJCA 3RVJA 1W5AA 4O2LA 2R25B 3MCVA 3PSHA 2BFNA 1WM1A 5I7OA 2O7SA 5I51A 2BR3A 4F72A 1Q7TA 4XI9A 4RHCA 5AHWA 4F4DA 3GI1A 4RVOA 5JXWA 2NN3C 3FWZA 1I80A 1OXMA 5KNDA 2UXCB 3PXXA 2O2IA 1Y80A 3B1WA 1UC4B 1XU9A 3GCWA 5DXFA 5KMGA 1P19A 2QRVB 3KTAB 4O4HA 1ZN2A 1JXMA 1PZNA 2GCGA 5LXTB 4CE6A 2Q4BA 4TS3A 3CTPA 5J2UA 5A6SA 3LGXA 3SX2A 4ZREA 2P7IA 4EL0A 3IDFA 1G8FA 3HU1A 4F4HA 1Z88A 3T1QA 3DLBA 2P2YA 2ZI4A 3ELUA 2CYCA 2H11A 3CLRD 4QG3A 3RWOA 2R6DA 3GG2A 5ALOA 1Y8ZA 3I1FA 1UCFA 1PYDA 3P9NA 5EPEA 4YUXA 5K03A 1HGXA 4ROTA 1ONNA 3PFHA 3VPAA 2OO5A 1SXJE 4RY9A 1VKJA 1TF7A 4P3XA 3ZLBA 2Z6AA 3HBNA 3OTQA 3PA6A 2ZI9A 2RIRA 3EARA 3V97A 1V95A 3DKPA 1GSOA 3STVA 5GIPE 1YI1A 2AHRA 5HOEA 4AUKA 1EHYA 3WC4A 3WGJA 1VSQA 3DFFA 1YVUA 3GROA 4GF5A 2OFOA 1CJVC 4PHCA 1RJ9B 4P7FA 2RGNA 3A3KA 5EHNA 1TYBE 1WWKA 3EIUA 5KNLA 1P5JA 3OIUA 1G5FA 1U3TA 2KPOA 2W2OA 5H82A 2PZGA 1U9CA 4HNAA 3L07A 5G0TA 5AJZA 4ENTA 4V0NA 3D5TA 5AM5A 3KHSA 3A6KA 4PGGA 5E95A 1APBA 2QSZA 1JEYA 3E9ZA 2PA0A 3NXKA 1KDOA 3VNAA 1QKKA 2YV1A 4GAEA 4PC3A 1J56A 3SIWA 4K05A 2O8CA 4EJ0A 1L4BA 3RS7A 4CQMD 3RIYA 5JR3A 1E79D 1FFHA 1ADJA 3MERA 3T3DA 3W34A 1VB3A 3GJ8A 3IVGA 4K0KB 5EZ6B 1XJQA 3GVXA 4RLHA 2OCLA 3IDAA 2O2CA 2P69A 1ZIDA 3C6ZA 3CSSA 3T8YA 3W5VA 4EPRA 3U7QB 3AHJA 1J33A 4QXOA 1DAKA 2JAOA 5D51S 2BONA 1E96A 5FWYB 4II3A 1JP7A 5AKYA 2UZ4A 3DTTA 4KQ2A 3FOFC 3TDKA 8MHTA 5E1MA 4NNPA 1F0NA 1TUIA 3L7BA 4O2BA 3Q7RA 2ORIA 5GOTA 3IFSA 3TUJC 4TL9A 1GEEA 1U0SY 5DHRA 2VJYA 4EMUA 5EJ5A 4LSGA 2VLBA 4ZHQB 1UJNA 3OZ7A 1RKBA 3WLQA 2NG1A 1W4RA 1U2ZA 3F3MA 3GFFA 4EM6A 3K09A 2X8LA 2C5SA 3ICCA 2O8BA 2AEJA 2GJAA 3K7EA 3QELB 3CYFA 4C29A 5BVGB 1Q7BA 4NABA 4X94A 3ZDYB 3CJTA 4Q1AA 1AD2A 1QO0A 5CIQA 3ZU6A 3W8FA 1I1NA 3D9QX 3LPMA 3KQUA 2OENG 5B6JA 3FUVA 3HC7A 3TX2A 4PBTA 2AWNA 2P9ZA 1EAYA 4H4EA 2VHZA 3EDQA 4EYOA 2VHVA 2BFOA 3FMOB 3T7DA 1Z0IA 2DGDA 2OK7A 3M49A 4NBKA 5FWAA 1NQXA 5JNUA 3DVLA 3TK1A 1DPFA 3HDTA 2NUTA 1UZAA 2HT1A 1N5MA 1E2EA 4YQEA 1EFHA 2WD7A 3ELBA 3VOSA 1U8ZA 1V7ZA 2Z8YM 2PZAA 4E14A 4EB8A 1TYZA 5J1TB 2WV7A 2ZSKA 4GO1A 4RK0A 3L3BA 4XARA 4Y3UA 2WKRA 1H0HA 4G0YA 3VVBA 3D81A 1JU3A 1AQUA 4NJMB 1RLIA 1YGYA 2WAOA 1VB5A 5IYZA 1CUCA 1ECFA 1X9GA 2RHTA 3FVWA 5TQ2A 5C0OE 3LXUX 1M1UA 3KQVA 4YRSA 3R7FA 1J4AA 4M7RA 1BJKA 4ILEA 3ZW8A 1YCDA 3TKYA 5A9SA 4GD3Q 3GT3A 4BMVA 5CDUA 2ZCJA 4JVOA 3L05A 4YCLA 3OUTA 4C0SA 4CKWA 1W4LA 2NSDA 4RH1A 3GLFA 1REQB 3G68A 1I2BA 3FNQA 1UP7A 1MVLA 2CNBA 4A2WA 3AYXB 5BSVA 1J99A 3AJDA 2I2BA 5DM70 3U7FB 3H1TA 2PKQP 3NHFA 2IWHA 3U39A 1T1RA 4RD0A 4PONA 1J8VA 5A5FA 4MUJA 5FULA 3AI1A 2LZ0A 3CMMA 2WF7A 3BHJA 3N59A 2JAQA 1FVOA 5IDVA 4A6XA 3TR6A 3DCNA 2QUIA 2EFCB 3DR3A 3FYUB 3L0OA 4MQLA 1GA1A 2HRBA 2OGZA 3F8TA 2X9LA 1ZW1A 2JD1A 2ZTLA 2Y1OA 4KUHA 1Z5PA 4NZPA 1L5FA 1EFTA 2QLMA 2H1IA 1OH6A 3LO5A 4ZT4A 4YIKA 1I36A 1MLDA 2Q8PA 3UO8B 2WJGA 2JZCA 4WKCA 4X8O