3ESQA

Crystal structure of calcium-bound d,d-heptose 1.7-bisphosphate phosphatase from e. coli
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
182
structure length
182
Chain Sequence
b'SVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFRQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITPEAENAADWVLNSLADLPQAIKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D,D-heptose 1,7-bisphosphate phosphatase
publication title Crystal Structure of D,D-heptose 1.7-bisphosphate phosphatase from E. Coli.
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 63
structure length 182
sequence length 182
ec nomenclature ec 3.1.3.82: D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase.
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3esqA00
1ZRNA 3MPOA 4Y2RA 2IYEA 3ZUPA 3S6JA 2YBDA 1RPZA 1RDFA 4RETA 2B1QA 4EENA 1Z5UA 2HOQA 2WHEA 3NAMA 1Z4LA 2YY6A 2PQ0A 4NFLA 2FEAA 2BDEA 4Y2QA 2B8JA 3KD3A 1T5TA 2IOFK 3AR5A 2GO7A 3FGOA 1Z88A 1MH9A 3N1UA 1L7MA 2ZG6A 3U7GA 1YNSA 1SU4A 2PKEA 2B82A 5AI6A 2FUCA 2NO5A 4Y2VA 5AW6A 3ZTYA 2C88A 2P11A 1NF2A 3AR4A 3ET5A 3RFUA 4BNDB 5AW8A 2FPWA 2WM8A 3N28A 1QQ7A 2YFYA 5IT4A 3L8HA 5AI5A 3R9KA 2YJ3A 4I9GA 4BNDA 4Y2SA 4UMDA 1L8OA 4F71A 4Y2JA 1Z4NA 4F72A 5AW3A 3WK7A 2P9JA 1U02A 2JARA 3OCXA 5A3RA 4JDPA 3PDWA 3UMBA 4UAUA 1F5SA 2BY4A 2O9JA 1VFPA 5AKKA 3SHQA 3L0BA 1WPGA 4ZEXA 3QUQA 3QYPA 5AM3A 3EWIA 1NRWA 2JAWA 2JAUA 4OD0A 4XPZA 3R09A 3DDHA 3I28A 3ZWKA 2W4MA 2I54A 1K1EA 4UMEA 4PNHA 5ALDA 2MSNA 1RKVA 3J7TA 3QU2A 4GXTA 2ZBDA 1TA0A 3OCZA 1L8LA 3NALA 1L7OA 1JUDA 3WK6A 5AKLA 1YJ5A 2ZBEA 3L0YA 1RMQA 2FPRA 3IB6A 3E8MA 3KZXA 3QU9A 5AK4A 3L5KA 5ALEA 3WGVA 4EEKA 2IOHA 3OPXA 3QUCA 2GHTA 2EATA 2GMWA 2QYHA 5AKEA 3DV9A 1Z4OA 5ALWA 4XQ0A 1ZD2P 4AS2A 5AW7A 5T41A 3ZVLA 3U7EB 5AVQA 2HHLA 3U19A 4XE5A 2B0CA 5AK6A 1WVIA 4AS3A 2G80A 5AKZA 2HI0A 3NIWA 4NAVA 2YJ5A 4H1WA 4L57A 5AM1A 2IOFA 3QUTA 1RRCA 1U7OA 1YDFA 1RLOA 3L8EA 1L7NA 4MWOA 2I33A 5AKIA 3ZI4A 1RLMA 1CQZA 2G06A 1RQLA 2NYVA 3CNHA 2R8EA 3IRUA 1Q92A 2WF8A 3ESQA 2Q4TA 4Y3UA 4BX2A 5AKXA 5AICA 3UMCA 4UU1A 3A1DA 5AM0A 3PCTA 5AW1A 1L6RA 4UATA 3ED5A 1TJ4A 4YCLA 1Z4IA 5AK3A 3SF0A 3ZWDA 3E84A 4FFDA 1YV9A 3SMVA 3FPSA 2B1RA 2YJ6A 3A1EA 2G09A 4Y2TA 4EX7A 5AVSA 4DWOA 1CR6A 2JAOA 3L1VA 4YIHA 1Z4PX 2PR7A 3QX7A 4XOUA 2ODAA 4DCCA 1TJ5A 2ZBFA 4BX3A 4CE6A 4Y2YA 4HGRA 2RBKA 3BWVA 1XPJA 1ZS9A 2HO4A 5IT0A 3AR6A 2AGVA 2X4DA 1WR8A 1ZJJA 3OCWA 1QQ5A 5ALZA 4KNVA 1Z4MA 2Q5EA 3L7YA 5AIBA 3ZW7A 1RKQA 5AI9A 2OM6A 5AW2A 4HYTA 1T9ZA 5ALNA 3QNMA 3WKEA 2W11A 4HGQA 3HLTA 4B6JA 5AKGA 3MC1A 1ZOLA 2FPSA 1ZD5A 4KNWA 4DW8A 2HCFA 5ALJA 4UARA 4HGNA 3QXGA 3ZVMA 2DQSA 2OA0A 4RESA 1L7PA 2C4NA 1T5SA 3PGLA 4IG4A 3D6JA 3SKYA 5ALXA 2MU1A 4YIKA 4YH1A 3ZU6A 3AR9A 4UMVA 2HEGA 3N5KA 5ALSA 2R8ZA 3UM9A 3ZTWA 1RKUA 5ALHA 2CFRA 1LTQA 2HDOA 4OFZA 1Z4KA 2C9MA 5AK5A 1VJRA 5AKHA 5AVYA 3QU5A 5ALUA 3W5DA 3MN1A 4BX0A 2EAUA 3P96A 1KYTA 2WF7A 5AW4A 3E81A 5AVXA 1U2SA 4OHFA 4AP9A 3OCUA 3WKDA 3U7FB 1XVIA 3B9RA 2YMQA 4BEVA 3EPRA 3ZX4A 4HAIA 1LVHA 3OTQA 3EF0A 2WF6A 1FEZA 1EK2A 1AQ6A 4NABA 4Y2PA 4JB3A 4CNQA 2ZXEA 3OCYA 1VJ5A 4KN8A 3CZ4A 4L6AA 1S8OA 4HGOA 2GFHA 3WK4A 4QQFA 3AR7A 2YN4A 3N8GA 5AVWA 3L0CA 3MMZA 4L6CA 4BBJA 3ET4A 4YCMA 5ALOA 1RC8A 2B8EA 3I76A 5AVUA 5A3SA 3WK5A 1N9KA 1Q91A 3K1ZA 3GYGA 1PW5A 3EF1A 1SWWA 5ALQA 2G0AA 5AI0A 3F9RA 2R8YA 4GIBA 4I9FA 5AI4A 5AKJA 5E0OA 2C8LA 1QQ6A 4Y2UA 3I6BA 1QH9A 2AH5A 5AM2A 2I7DA 4KX3A 3RF6A 1J97A 5AW0A 3PGVA 2QLTA 2G1AA 3U7HB 1J8DA 4G9BA 4EELA 2ZOSA 4UMFA 2I34A 4EX6A 3A1CA 1QYIA 3L8FA 1EK1A 3B8EA 3FVVA 3DAOA 2HF7A 2JGAA 5AVZA 2C8KA 4Y2XA 2AUTA 4C4TA 2VKQA 3BA6A 3WKAA 5AVTA 2WF5A 5AM4A 2I6XA 4UAVA 2IA5A 1U7PA 5AVRA 4DFDA 3WK9A 5ALFA 1SWVA 4EZEA 2O2XA 5ALPA 1O03A 3SLRA 3VAYA 2RB5A 3NUQA 3M1YA 2R8XA 4YGYA 4FE3A 5AIAA 2BDUA 5JJBA 3AR2A 2OYCA 4BYGA 2HSZA 4OCZA 2NO4A 3I1YA 4ZEWA 3ONNA 5ALLA 5IS2A 5ALTA 3FZQA 2D2VA 4ZEVA 2ZBGA 3AR3A 3QU4A 3KDPA 4KX5A 3IJ5A 3OCVA 2HX1A 3KBBA 4NV0A 4QJBA 3WGUA 1RQNA 4UU0A 4BEWA 3L1UA 3SKXA 2CFTA 5ALIA 3NANA 3U26A 1WZCA 3ZX5A 1TE2A 1ZD4A 2HF2A 1O08A 2YJ4A 4J03A 5ALMA 3QU7A 1ZRMA 3TLMA 4J2TA 5AW9A 5AVVA 2P69A 1Z4JA 2RARA 3WKCA 1RMYA 1S2OA 3KOOA 1TJ3A 4HGPA 3R4CA 3WK8A 2FDRA 3A3YA 4KYTA 4CF3A 4UM5A 3E58A 3L8GA 1NNLA 1N8NA 1X42A 2P27A 1YMQA 1ZD3A 4IFTA 3W5CA 1XP5A 4G63A 3SD7A 2YMLA 2OBBA 2FUEA 2CFSA 5ALVA 1RLTA 2AMYA 2FPXA 4UASA 1Y8AA 1YS9A 3QGMA 2WFAA 4C4RA 3W5AA 3U13A 2G07A 2WF9A 5ALRA 2W43A 2EARA 2RAVA 3AR8A 2CN1A 2G08A 5FP0A 1Z5GA 4E88A 2B30A 4UW9A 3WKBA 3W5BA 5AM5A 5ALGA 2FI1A 2FPUA 2Q4RA 3KC2A 4MUMA 2YMMA 5AHXA 3FPBA 4C4SA 4CF4A 5A3QA 4YCNA 3FM9A 1Z4QA 3N07A 4UM7A 5AW5A 2GHQA 4BKMA 4FYPA 2YMPA 3UMGA 3HYCA 5ALKA 4CF5A 4NWIA 1U2TA 3NASA 5ALYA 3ESRA 3QLEA 5AKYA 3M9LA 1RMTA 3ZVNA 4O8CA 2I55A 3DNPA 5AESA 3NRJA 3QUBA 1IWOA 3B9BA 5AI8A
chains in the Genus database with same CATH superfamily
5HGXA 4U2BA 1H5UA 5CR9A 1UT8A 2PIAA 3AEUB 1ZI6A 2AOUB 1L5SA 3OQBA 4LSWA 4C7MA 4EUSA 1PUJA 1FY2A 1W4RA 3IEIA 3PGA1 4IUBS 3HCNA 1B23P 1WPXA 2VRWA 2C31A 4CKYA 3WG9A 4ZT7A 5EXSA 4BDTA 3PNQA 4DLAA 2R1UA 5MHTA 1NJGA 4L2IB 2NUPA 5HZKA 4CQMA 2WU4A 5HZMA 2PL3A 1KYZA 3KS9A 3O38A 4WESA 1MA0A 1JF8A 3AJAA 2LGJA 2O2SA 1QAQA 4RANA 3SICE 1A9XB 4AO7A 2ZFUA 3V2IA 2QG6A 3ZK9A 3BFVA 1HTTA 1DINA 3DPSA 4OIMA 1GZSA 4AF6A 4D0NA 4ENUA 1AMOA 4EL0A 5F98A 2HLDA 3BN3A 2O8NA 3CTPA 1RQPA 4HY3A 3TCKA 1RRGA 2AJLI 2H4FA 3DF7A 3O4FA 4NHEA 5I01A 4HT3B 5JAPA 2LWIA 2VYNA 3CMCO 4RF2A 2ZVQX 3SC3A 4ARCA 1E9BA 4IXWA 2PL5A 4H60A 1O54A 4JL6A 5K99A 4GKJB 2C5BA 1PJCA 4NATA 1NOIA 3U4CA 1UKBA 5EMJA 4D9FA 3O4HA 4I9NA 5IWAB 5IT4A 1E2MA 1YE5A 4DDUA 3IAAA 3P0IA 5CVUA 3ZXSA 2X5NA 3L82B 4G3XA 3MD9A 2PV7A 2REXB 4KZPA 3C4VA 3OM8A 4G09A 4QULA 1Y1RA 4MB2A 4M9ZA 4XM1A 3GG9A 1KU6A 1LPBB 4PSKA 3UH1A 3AESA 1SC6A 2BSAA 3UB2A 4IIUA 4FEEA 1WY5A 2DFPA 3I12A 3PDWA 4UAUA 3GUHA 1C30A 1CCWA 2FPIB 1LFAA 3H0CA 3BA1A 1VFPA 3FYTA 3OPYA 4PO8A 4PLCA 5E1DA 3SS9X 1O8BA 4H59A 2AFRA 2VDLB 1W8DA 1UKYA 4GR4A 4QRIA 5ELXA 3MZ0A 3VZQA 1UPFA 4QOFA 5JNTA 1VPVA 1XEXA 5FI0B 1KOLA 2AD5A 1Y8RA 3BHJA 4OD0A 1PK9A 1VLJA 3KZVA 2AT1A 3WQSB 3U81A 1H94A 3AFOA 3GVXA 2WWRA 1VMDA 2XGGA 3EZ2A 4F92B 1K7YA 1RR6A 4HR7A 3BWMA 2OP1A 1H1LA 2F64A 4FGWA 2YJTD 2ZBEA 1I2MA 1PL7A 4B3RB 5F5LA 1FA9A 2GUWA 3LDHA 1DB3A 4C5CA 3HFRA 3IB6A 2H4JA 4LJ8A 1RJWA 1OXUA 1FRQA 2OBNA 3IP5A 4HHEA 1EH5A 5ALEA 1T1IA 1UXOA 3C85A 2CXXA 3OEEA 4PAQA 1P1HA 1AZTA 1ECFA 1XMPA 2C4WA 2YWGA 4KR0A 5DTEA 4OHOA 4YR9A 3AB3A 1GNQA 3RU9A 4EJSC 4XR9A 4K6CA 5AKEA 3QEAZ 1FNMA 1KYWA 1PUXA 5F7XA 1MGOA 2QVBA 4CKEB 5C3MA 3TKLA 5J4VA 2DHDA 4WY2A 1ZD2P 3EXFB 5CIYA 2Q8NA 1KQGA 1W0KD 5IT9A 1FQJA 4GPBA 1C80A 2AOTA 1EBBA 4RLFA 5HFNA 3ROGA 2POCA 3DNFA 3SX4A 4WX2B 1NI4A 5DSTA 2OCDA 1TUBB 2XTZA 1Z2PX 5JQGF 4RZQA 5AH0A 4PC2A 3GEEA 5AM1A 4EHIA 1E79D 1LRKA 2QJFA 2WTXA 1ZJYA 2TMGA 4RFSA 4RZXA 2NPFA 1XZMA 3V7YA 4NNPA 4B40A 5C7OO 3AVXA 1W73A 2O4UX 1KQNA 1CEEA 4MKRA 2BELA 2PMDA 4Y1RA 2IS4A 1IL0A 2J3HA 2QN3A 4A6EA 2YN0A 3ZJTA 2I4OA 1W4LA 1RQLA 4JU9A 1O4VA 4N3GA 2A0FA 2O8CA 3S68A 3KB8A 2IWHA 1GGKA 1JR3E 3IUYA 1XMOB 3DE3X 3TWOA 3SVLA 2AZXA 2QU8A 4P8RA 3LX5A 1MZPA 3AVPA 3RKSA 1KEZA 4MYDA 2X7JA 5AW1A 1BJTA 3KZOA 5MGBA 4CL8A 1YQQA 3NEYA 3QXJA 2EP7A 3KUKA 1A77A 2HNKA 3EIOA 3L7MA 4JBXA 1Z4IA 2VBCA 5AM2A 3T1HB 4Z0TA 2IEAA 2Z4TA 2G25A 2HWYA 2VEDA 4DN6A 4XPIB 1D1PA 2M6RA 2OV3A 4Q1CA 5AJVB 2G09A 3RTGA 2C95A 2ZYTX 4U7WA 2BC9A 1EJBA 4R54A 3QX7A 5BOSB 1FUKA 4PPGA 1MDFA 1IY2A 4MYSA 1Y8QB 4TTIA 1K3TA 1Q0QA 3OUUA 4XM2A 1ZOPA 3AJ8A 4M9SA 2BFOA 1PD1A 3FNHA 1I4EB 2FSGA 2WE8A 3HCFA 4LHXA 3VHXA 2C7RA 2UYOA 4BTEA 4JEUA 3RIYA 1NAIA 3VDQA 2LDBA 1Q19A 3D6FA 4A8JA 5T4EA 3L8ZA 3THWA 4YCDA 1JFTA 3GRUA 2PGXA 3TKYA 1W94A 2IHVA 4NQRA 3C5HA 4BVFA 3Q7PA 4UXHA 1RACA 1HT1E 3DFIA 2QN7A 1RVDA 4OK5A 4OHWA 3RBZA 3VO9A 1QFYA 1QUEA 5CDHA 4EHKA 1WMDA 2WMYA 1E20A 1Q7TA 3TW8B 3NIBA 5HA5A 2UVDA 5J63A 1CS0A 4QBHA 2O2CA 3IDZA 3MC1A 2V45A 4RDCA 4RXTA 1W581 2XI4A 1DQSA 5EWJB 4KITB 1FUIA 1MVLA 5FEMA 5HG0A 1IDN1 4H16A 4PN7A 1D2MA 3QIVA 1JZQA 1XAIA 4K9RA 3T7DA 3LW7A 4P93A 3FFWA 1SBIA 3SQMA 1VMKA 3W5JA 5IJWA 2FUG1 1U0OC 2CYAA 3GJ8A 3F67A 2DQSA 1UXKA 1RKXA 2YV3A 3OZDA 5TLSA 4B3IA 3ICCA 5B2FA 4MS1B 4M8LA 3PGLA 4DMRA 1USWA 3TR6A 1E3WB 1P3Y1 1Q83A 1SVUA 2IE0A 2V4ZA 4L5CA 2QRHA 1H2FA 1NF3A 1SKYE 1XN1A 3M6IA 4BZPA 4YQFA 1RXVA 1DRKA 3FAZA 3K96A 4OXYA 3EGEA 1N1EA 2N0SA 1MO2A 1SXHA 1RHKA 3VZRA 5DXFA 3GFFA 1EQ2A 1HKUA 1WKCA 4FGSA 2JBHA 4C7BA 3CVUA 3FI0A 2NVOA 3K6RA 3ISJA 2GHRA 3DB1A 2JIOA 3KX2A 3TUZC 4DDWA 2ZIGA 3PC7A 3H2HA 4TWIA 2AN3A 3GJSA 2J3MA 4WXYB 3C3AA 3RK4A 1W34A 4EYKA 1C3EA 2OV6A 1KO8A 1Z63A 4JJFA 4V03A 3G0GA 2DJ5A 2X5XA 2NQ8A 2VUUA 4QXPA 3TQTA 2BI8A 2W93A 5C8YA 2WQ6A 3EA4A 4U6SA 4AQDA 1RRPA 3FD8A 3EPRA 5AO9A 5BSTA 4BVEA 4D44A 3VKVA 2VXOA 2PH5A 4GX5A 1HDXA 4F7WA 3R7DA 1DKNA 4PU0A 4DKXA 3SVTA 3CCFA 4IOJA 1WSAA 3MIIA 4J6FA 3ZJYA 4D8YA 2OENG 4CNQA 1GUAA 2ZXEA 2D7DA 3Q11A 4YK7A 3IE0A 4PTYA 3UJ3X 3JD3A 3BAZA 2ODNA 1G20B 4HGOA 4AB1A 1BDHA 4XSVA 3FBTA 3KPYA 4URXR 2FDCA 4COOA 3LUKA 1PVVA 4YWJA 5BWMA 1CLUA 1I4DD 3URKA 4HS4A 5F4BA 3ITEA 3O3CA 2J5XA 4Q4CA 2GS9A 1C0EA 4F2GA 4IZOA 3H3JA 1E64A 4L6CA 3BL5A 3OP4A 3OQPA 2Z0MA 2ABWA 1YR6A 2BHRA 4NJEB 1RSZA 1SURA 1NTRA 3RSGA 2R8PA 1H2XA 1I8TA 1MT3A 1RC8A 3EBLA 4MMYB 2FPPA 3D81A 3I76A 4YACA 3AVOA 3T1VA 5J58A 1JECA 4O3MA 1WBBA 1NDQA 4BJ1A 3IBSA 3QPWA 4AIIA 1J39A 4G0UA 3BE5A 2IBMA 4DL9A 4PYKA 1J9GA 5BR1A 1OXMA 3HV0A 5C1PA 2HWUA 2H1RA 4MULA 2DPYA 2YZNA 1YUMA 3VHRA 1TK9A 1OB2A 5CB4B 7REQB 3V9AA 1QZUA 2NQ2C 2QJWA 3MBOA 4F85A 5KJFA 1YZNA 1GQ2A 1IHYA 1R27A 3KHTA 2BFNA 4FMDB 4P33A 5GWXA 5H4HA 3L7LA 1QF7A 4NZZA 2C0QA 4WGFA 3JQBA 5BYAA 3QITA 4KH0A 5IABA 3D0QA 1J8DA 2DB3A 4J1SA 3DBLB 3ZE2B 4BMNA 2X1LA 4F46A 1GQOA 1WEHA 1YJQA 1L8QA 1EK1A 1L5VA 2H16A 2A9OA 4K81B 3P9IA 3IEMA 3WHLA 5SY9A 4LRQA 5KHOC 4HDKB 5EHIA 5IBRA 1FTNA 3RAJA 3T1NA 1FFWA 4E0BA 1YDHA 5LZ8A 4CWAA 4QO7A 2YS6A 3FX2A 4JX9A 1LQUA 1IHDA 2N46A 3KYCB 4N18A 5DV9A 2O8DA 1T9CA 4PYNA 3MXTA 3BQNB 1E98A 1L7VC 2IZ6A 4UAVA 1XXLA 4XQCA 2DZDA 2PTGA 3DEFA 4LSMA 4YJ2F 5LMUB 4ZJYA 4LJ7A 5SZJA 4CMEC 2F00A 4ASUA 2AOUA 3FPCA 2H9YA 1X1CA 3O8OA 1ZI8A 2JF0A 1C8LA 4XRRA 1OIXA 4WK4B 4MQFB 4ARZA 5DM70 3ZIAA 2QLJA 1GDDA 3AUUA 4RY0A 1FRVA 4GPIB 3BICA 1J2EA 3DKKA 1OV6A 4CMIB 1W5FA 3R6LA 2PWPA 4FOOA 1OI2A 1Z8NA 4X9XA 1A7KA 1I7SB 5IS2A 2G4CA 3AU9A 4B0PA 4RHEA 4AJEA 2XMPA 3WNZA 1KETA 3T4PA 1N2CA 3EPPA 3ZE7A 1JBQA 1QIJA 5D3QA 3OCVA 4M22A 2ZIFA 1IDOA 2HX1A 2NO6A 5AVKA 1R1DA 5JFGA 3G0OA 2YIVX 3GBSA 5TB5A 3DBHB 4ESEA 4G5SA 1JNYA 2Q7DA 1APBA 2C7QA 1GV1A 1TLTA 2Y99A 1ATZA 2CJXA 1MX3A 2NU7B 1VI2A 3IPXA 2P9QA 4BEWA 3SKXA 2A9VA 4JJAA 3VSDA 2ZQYA 3NBFA 2WILA 1FS6A 1FDTA 1S96A 2XMGA 2EZTA 3M33A 4H7FA 3WRXC 4D3ZA 4DIDA 1L5YA 1LPNA 1JHAA 1NKVA 2GRJA 1PWZA 4FYVA 3DZFA 1LLFA 3E9NA 2JH3A 1VG0B 4IW3B 2H1VA 5LCXA 3HH8A 2WWGA 4HN9A 3ZHXA 1JSLA 3IQEA 5HMMA 3O6VA 1DC4A 3QYAA 4P0QB 1COZA 1HDEA 2C83A 1QF9A 2B2CA 3GJ3A 3PQ8A 4OPMA 4CFSA 2RKWA 3C3DA 3T7IA 3R4CA 2O06A 3GJTA 3IO3A 3QF4B 4LGCA 4N0QA 4RY9A 4PIVA 5J3JA 2K5UA 5ICCA 2IHZA 5C4MA 3IJEB 3LY5A 1FRZA 1XQ6A 3H9BA 4X94A 4KYUA 4PCAA 3ZV4A 3J81k 2H2WA 3GNSA 4Z54A 1M2OB 3GG2A 1QK4A 5L8VA 2M9MA 1J5XA 5KHLB 5AXAA 1P73A 3I3SR 5GGYA 5I45A 4FFVA 1QKJA 4YP9A 3FKSD 2WJJA 2D4HA 2W6JD 3LBNA 4U9IS 1E94E 3QWFA 3COJA 1E1KA 1XEFA 3KRTA 4HMPA 5ICGA 4NSNA 1NN3A 3PVSA 4GLJA 4PZYA 1U3CA 2IDZA 3FDXA 2HF9A 3DWIA 2CLKB 1DOHA 2DPMA 3G6KA 3H7AA 5DGTA 3T7AA 3H8SA 1GDHA 4GOJA 5IULC 4U2KA 1ZVVA 4DREA 2BJVA 2PDAA 2EARA 2EP5A 4Z9FA 2RAVA 3CF6R 3WMFA 1KDTA 4P0TA 1YZVA 3GFSA 1YMVA 3R3YA 3I04A 3CUEF 4CKEA 4B6OA 4G9EA 1IQPA 4H3KB 4GX1A 2X77A 4WK0B 4QT0A 2D2XA 1TW2A 1HT2E 3GZJA 2P65A 3LSYA 2GLTA 4RHYA 2RCNA 1V3QE 3QVUA 4IS3A 1QZTA 3RU2A 4ZYWA 1M0EA 4C4SA 5KINB 1A2KC 1E99A 3HDQA 1XLUA 4PZLA 4UM7A 2R6GA 3O7WA 1DPFA 4B80A 3QEBZ 2LUOA 1NXPA 1DFIA 2PT6A 2R7LA 3T3HA 3R9WA 4MVCA 1ST2A 1E3QA 2R11A 3QFSA 1T29A 5HTKA 5KI6A 4QOGA 3TSWA 1A4IA 4YVFA 3VKFA 4W5WA 5GOZA 3W6OA 3NASA 1PYDA 2A5YB 4MARA 3PU6A 5KX5A 1JAHA 2WHQA 2ZCVA 3KJGA 4FS8A 1A9ZA 2VPQA 2WWTA 1KEWA 1JJ7A 4BO3A 2O07A 2BH2A 4HWPA 4I0WB 4M9UA 1WO8A 5SYAA 3ASVA 1Z74A 1CKEA 1GRCA 3DP9A 3W6PA 4ILEA 4JOQA 3MPOA 4BZQA 2O8BA 3ENQA 4FDUA 5JS6A 2AMVA 3UUFA 1HM5A 2RGRA 4KJXA 3ZCQA 3OSZA 4KQCA 1TU0A 1QMGA 2C7PA 2DKFA 2OXEA 3WWDA 4M0UA 1DARA 2AEFA 2PGLA 1J42A 2Z2JA 2ZS8A 3AKEA 3KFXA 4HVTA 5COBA 2X0DA 5DLDA 4OHKA 4BNYA 4WFJA 3QKRB 1E7QA 1ESNA 1G0OA 1B41A 1TF7A 4F6RB 3LT0A 4XPIA 4HZIA 2FEAA 3ZU4A 1G59A 1CX9B 1V41E 1JG2A 2B8JA 4REQA 3SLKA 2NPOA 1DFHA 1ORHA 2BGUA 1XQYA 1YNSA 2FZKA 3NHAA 4YYEA 1R8QA 4L0QA 3SQDA 4KR6A 3O8DA 4K7JA 3C8UA 2XITA 1Z22A 1RJEA 3EG5A 4Q24A 1CSEE 4NMWA 4XQGA 3SZMA 3HFJA 2Q2QA 3U17A 2XYHA 3UT5B 5AW6A 1ZGAA 1R6DA 3GDGA 3FYDA 3CUUA 5EQJB 5HQJA 4CIVA 4E5SA 8ABPA 4MI1A 4UZEA 2X0IA 5BNIA 2FR8A 3FPLA 1XIVA 2JRCA 4IJQA 4ZCSA 5BV0A 3JQ6A 2J4FA 5JNSA 3JWGA 1SC9A 3W77A 4BNDA 2XWPA 2NO0A 1KR2A 1EFHA 1OLUB 4U7GA 1BU8A 1JLLB 4YO8A 3LBIA 2ZJ6A 3TW8A 2KPOA 3U7QB 1B1CA 1DWPA 3JRNA 3LM8A 4IHJF 3X1WA 4OV6B 5FAKA 2WTBA 3WSVA 2CMGA 1CUYA 5B6JA 1M2WA 4EGAA 4BMZA 5JSFA 2B8NA 2BE9A 4D9KA 1H0RA 2A5LA 4X8MA 3JQGA 4DQLA 1FTWA 8GPBA 2FW0A 2C2BA 4HATA 6YASA 1ZHHA 2R751 4EPWA 1Y34E 2XUGA 4RGYA 2J59A 3R7WA 1M72A 3SHVA 3SCZA 2ZJ1A 3PYLA 4M0PA 4NF2A 4N6OA 5C32A 5HJ5A 2RH9B 2Q3MA 2YV2A 1PR5A 1PJZA 3FWPA 2JAWA 3GJZA 3K0EA 3NTOA 3TQIA 1C2YA 3BK7A 1SVOA 2XB9A 5DLEA 1H5NA 2V55B 5ALDA 1UP6A 1IXRC 3MQFA 4IZHA 2FG7C 1KNXA 2ZRAA 3PXUA 5LP6B 1NL3A 1S2MA 5LBUA 4D80A 3RHFA 2MSLA 4R98A 1GNLA 3CRMA 5AKLA 3WGHA 2XZOA 1G5QA 1HC7A 4XWYA 3T5CA 1O97D 2VP5A 3P5SA 4IIXA 4N7RA 2QRVA 3ON5A 3HXQA 3G8AA 3Q1KA 4J3FA 4FHCA 4U63A 1HT3A 2NTYC 3QG1A 4B3DA 2FZWA 2GXQA 4ROTA 3AI2A 3QMVA 1P1CA 4FEYA 4JHXA 2JGFA 1AKUA 4IVQA 4RU1A 1CFJA 4TMFA 2EF0A 4CLOB 1L6IA 1E4EB 2GKGA 3SE7A 5I48A 1NBIA 5F1KA 5CFQA 2BPOA 1WXDA 4KIGA 2I1QA 3MJTA 2EWVA 1NDUA 1NW7A 2HHLA 1QVVA 3ZS9A 2PZKA 2ISQA 2B0CA 1E7RA 3IS3A 4L9AA 5F4ZA 4BQPA 4AU1A 2YL2A 2Z3VA 3NP9A 3F98A 5CXQA 4BP8A 1EUCA 1Y7IA 4IJUA 4NAVA 3DAHA 3TR0A 1OYWA 3CWZA 5G3ZA 5ADHA 5AJXA 5JSQA 3ZLJA 4LTMA 2GESA 4DB2A 3RVLA 1UP7A 1PJ8A 16PKA 2G8LA 4E5VA 3BXOA 1JQAA 2GYUA 3GT0A 1H05A 3HI6A 1E2EA 1WVGA 5A9TA 2OB1A 4O2AA 2RGWA 3TPZA 4BU0A 5AFSA 1JR4A 3NHLA 3KT0A 1VRVA 2HRBA 1RI1A 4DC9A 1US8A 2YS7A 4TT3D 1QHSA 4OGFA 5LQSA 3HJGA 4QTZA 1F9AA 2ZYIA 1EDEA 2P2CA 3ZLUA 4DY6A 4EW2A 1Z7BA 1K2VN 4BNXA 1IN8A 3HPQA 2W2XA 1M0TA 4F38A 4FT2A 4OB6A 3V32A 3I3OA 1BXZA 1M1UA 1N9ZA 4OH1A 4G1UC 4IPTA 3ZE0B 4BX9A 2GA9A 4ZT5A 2PCLA 3KNZA 3H0KA 3P45A 3R3VA 1NT2A 1LSUA 5K6TA 3FPSA 1DTEA 4QGGA 2B1RA 2YJ6A 1VL1A 3FN4A 1B15A 3L1VA 2JAOA 3ZBUA 2XUIA 3GMTA 3I9V6 1QHHB 4YCJA 1Q0HA 4YUVA 2JKVA 4B73A 2WB2A 1SJ9A 1ZKMA 3ABRB 1AE1A 2FB9A 2PMBA 4OLJA 2HO4A 1RQ7A 1YASA 2CMFA 4M7RA 3RWMB 2ONYA 1DXOA 3DYBA 2HJRA 8ATCA 1YL6A 2ACVA 4UEOA 521PA 2VNSA 3ZW7A 2P62A 3TJMA 1KY4A 1TYDE 4PS0A 1DIAA 3R3ZA 1A71A 3G9TA 4ZIRA 3LQ4A 1W5BA 2JFOA 3GNLA 3IUNA 1CXZA 4I1YA 4ZVQA 5A9RA 2CFCA 5KQMA 1HORA 3PR3A 1G8JA 3QW4B 2IYPA 4HNHA 4LMPA 1E1NA 4MNTA 4JJ7A 4OHXA 3CQ9A 4PC7A 4TGLA 1EXVA 2H31A 3HJAA 4JGGA 4C0HA 3L2OB 3FJ1A 3W5SA 1DELA 3PCXA 4RDIA 5JRJA 1JEYA 4N12A 4IGKA 1GPMA 4B2IA 1MB9A 3VZBA 3EISA 3HNPA 2VQFB 2E5LB 2P5UA 4XX0B 4XGKA 5ADVA 3PFWO 1L7BA 4JLWA 1EIWA 5KTOA 1FQOA 1YB7A 2J3DA 4FC7A 1T8SA 3ZLVA 2JFNA 4OLBA 2ZUVA 4KMMA 1SUPA 2X0EA 3BG5A 4BFUA 3CLKA 1BE8A 2CY0A 1KI6B 2ZREA 1U3GA 2FR1A 3AHHA 3ZCUA 4YR7A 2A33A 5EZYF 1U98A 3SYTA 1NTOA 2QXYA 3I32A 3OT5A 4I2VA 1C1XB 3G5TA 4K03A 2PUWA 2PH7A 2WIBA 3R6TA 4ANFA 1PCXA 2QBYA 2ZIXB 1KOJA 4HPJB 1SUCA 2L42A 2Y2VA 1X2BA 3CX7A 5P21A 1JFSA 1ZL0A 1YB2A 1GU7A 1GGJA 1BCSA 2QIOA 4OF4A 3UM9A 3HVRA 4J2OA 4JT4A 4RV4A 4HXYA 2FMTA 3PFIA 3WFJA 5ITVA 5CT6A 2VIIA 4W1SA 3DBHA 3ETDA 4KLZA 1XCBA 2BEUB 4OAPA 4S24A 2OCPA 1UZMA 2QUIA 3DBOB 3LQKA 4BNZA 4UQOA 4KOAA 2HQ1A 5EOVA 3B89A 3HG7A 1ACLA 5F5NA 1PNRA 1CVRA 4HNUA 4JB8A 3NBUA 1OR8A 3K9FC 3DZKA 3GWGA 1W35A 2XAUA 3W2HA 2P8SA 3BRCA 4HNTA 4HG2A 4JXXA 1OBVA 4JP1A 3FUWA 3SHOA 4A9AA 1RI5A 3QW2A 2XQJA 1XVIA 2YYZA 3EDOA 3U7FB 4EUEA 2A14A 3DHEA 5TGTA 1XVLA 1JSCA 1P4JA 1UWVA 1VE1A 3OMXA 3N6RA 1ZNQO 2R1VB 3MW8A 4M36A 4MWSA 3S8EA 1QM5A 3UA3A 3DLPX 1GFSA 4ALNA 4H7EA 1ZIDA 1T1RA 3ISVA 3SZLA 2F3SA 2AWNA 4X90A 3NBKA 5J5VA 1JRLA 3EQ2A 3QKWA 3U4GA 4DC1A 3LU1A 3ZDXB 1W8IA 1JEQA 2PUTA 4L6AA 3WZMA 1T6BY 1KU0A 3N0VA 3C6KA 3VMFA 2Q2NA 3NDIA 3M8KA 5K20A 1AVTA 3K1YA 4IYRA 3KJIA 3N8GA 4YONB 2Y0CA 3M4XA 3C3BA 2O57A 1Z26A 4PZPA 4FEGA 4MCAA 5K1ZA 2Q8PA 3H4MA 2X0FA 4DNPA 2W5UA 1URPA 2BFBA 3EVDA 1XI2A 5B6IA 2ZR8A 3Q8KA 3FMVA 5KNCD 1QHIA 1PP4A 3FPGA 2HADA 3SIWA 3T35A 3TG2A 2IF2A 5BWLA 1P2VA 3Q3IA 3T52A 1FYDA 5G0TA 3BE8A 1ZUHA 1U2RA 6PFKA 1G8FA 2QSJA 1E0AA 4J0HA 3K1ZA 1SELA 3N6XA 1GTL1 1JJVA 2FPGB 4B17A 4P83A 5CFMA 5JS8A 1K0FA 3P97A 5EP3A 2YINC 2VDWA 1EJ0A 1O5TA 4EF4A 3DEKA 2UZ3A 1P29A 4NAHA 2Q0HA 3VHLB 4P81A 4KLRA 2GEVA 1ZW1A 3K70D 1VRCA 1JDBC 1PFQA 5SICE 5IMBA 3CV3A 3LRTA 4KXMA 4RADA 3DQZA 3TLBA 1XFDA 2ZYHA 4YAFA 3NIDB 3SSMA 2W2NA 1UT6A 1DXHA 3D3WB 3HCPA 4MJLA 4D9HA 1O6FA 1X7XB 5ESXA 5CVTA 4QFBA 5JO9A 3K1AB 4JT2A 4LMAA 2XRYA 4JX8A 2IGTA 3BE6A 4ZFNA 3CRQA 1QWSA 1CDZA 1XLTC 4YXWD 2NU8A 2C61A 1QYIA 2X13A 4LEIA 4OQ4A 3UYKA 4EO4A 3OLCX 1A4RA 1SG9A 1ECJA 1VE7A 1G5PA 1V47A 1U1GA 3JPWA 3L6BA 3OI7A 4JQZA 4TKVB 3RSQA 3PQ7A 4ABTA 4U0JA 4OOFA 3OJOA 3MCVA 3QEMB 1N6PA 1VLHA 1R3DA 1A8QA 1TIBA 4I3FA 3S2FA 1C9KA 3IAEA 4R5MA 4PG7A 1GRNA 1JILA 2PMWB 5CEFA 4OXNA 5KNLA 3OEWA 2H1SA 3KPJA 4WBNB 2B99A 1LBQA 3AW8A 3TW0A 5BN1A 2PZEA 2I2WA 4PGFA 2PL9A 5DW0A 3KEFA 3TNJA 1B73A 1JZSA 3PKJA 4CIYA 3K0HA 3RVBA 4FMBB 4D02A 4RZIA 3M1YA 4R41A 2D3TA 3L02A 4G1FA 1EDBA 1PZHA 4P3XA 4ZO8A 4C2BA 5L6MB 3FNEA 3GLUA 4EI9A 2R7AA 1IWBB 1OHHA 1XCMA 1RWWA 4IO0A 2NO4A 3EFHA 1JLKA 2HB6A 2O50A 3V42A 4NVRA 1XL0A 3CUWA 1DKMA 2ZTSA 4OHVA 4ZEWA 4ESOA 5IBCA 2CF5A 4DMUB 3IAM6 3MS2A 1WMSA 2FSVC 2I4MA 4IJVA 5E95A 2R65A 3VTZA 2VP6A 1GLNA 4GNKA 4R2LA 1E89A 1H85A 1H8HA 4FIDA 1SVMA 3CRRA 2PBZA 1QUFA 3TL3A 3TNDA 3X1ZA 1PR4A 5IYZF 4MW9A 4JEHA 3ZQKA 3IHKA 4ZZIA 4C7OA 2BGKA 2CD7A 2QRNA 2P3SA 3FDZB 2H5EA 3NATA 4Y7DA 2I6GA 4R2HA 1QG4A 2XYQA 4MYRA 4PW0A 3C6BA 4HDRA 1HG0A 4UHJA 2MMCA 4MUAA 2AR9A 5BURA 2JCXA 4QELA 4NV3A 1NMZA 3C4QA 4KN6A 1XKXA 5TQ2B 1V7CA 5EKUA 2ZSFA 4M0EA 1SHUX 5I9SA 1ZJ5A 5HM8A 2RAUA 3LP6A 5CPFA 3CFYA 2C7BA 1ZK3A 2OYRA 1XA4A 2ZCUA 1Y1PA 2BKAA 3RRJA 5EJ5A 2AC7A 2I7VA 4N3NA 4RTLA 1TVCA 1Y37A 1YKSA 1MV5A 2CKMA 4ZT6A 1JS1X 1K9SA 2OO7A 1NM5C 3L4BA 1RE0A 1DRUA 3G2HA 1XYVA 4FGLA 4G89A 4KWTA 1N5JA 3REGA 1RQRA 1RZ3A 1X0XA 1F0YA 2ECKA 4EHJA 4DJFC 2B5VA 4NE2A 4ZGWA 4FM9A 1RP1A 4GAEA 3JTMA 1P5FA 3PDCA 4WCFB 5TDHA 1DC5A 4IDPA 4UM5A 4UVEA 4DS3A 1CZKA 5F3WB 4E5MA 1O97C 4I4TB 3ZU2A 2ZTHA 4BPBA 3HWX1 4DMHA 2EDAA 1QIHA 2WK1A 1WV1A 3BGSA 3ONVA 1QNLA 1QS0B 4RD4A 1DCFA 2Q45A 5FIUA 2O4CA 4NZOA 2G63A 1IEXA 2XXBA 4DR6B 1KRXA 2DQZA 2Y0PA 3LNCA 5CCDA 4FYHA 5JDCC 3V8PA 5ALVA 2IS2A 4X7RA 1IHPA 2AI2A 2VNAA 3HJRA 3ORFA 5CUQA 3STUA 4DA0A 5JROA 3WXMA 4BRSA 3NWPA 4TLBA 5IAEA 1I2ZA 2D5CA 3RYTC 1M34A 4IGIA 1P81A 2IXDA 2VHUA 5FI1B 3WB2A 4UDYX 1C0KA 3FNGA 3DHNA 1P72A 3ILYA 3Q8WA 4C2UA 4MUJA 1X9HA 1KDPA 2EFCB 2CN1A 3FRHA 5FTLA 1P44A 3E3OA 1I6WA 1IRXA 4LBVA 4DSZA 4CLOA 1U31A 4KNYA 2E7ZA 2WWWA 1E4EA 4R7ZA 4A5OA 5FBVB 4L4UA 3S8YA 2G1JA 3FXAA 3RIEA 3NJ8A 1FL9A 5J40A 1JAXA 2AMFA 3UA4A 2XOEA 4LDAA 3OE7D 4PZ0A 2FPUA 3PQ3A 4POOA 2CXPA 5E3JA 2E1RA 3V1YA 3T5TA 2FN7A 4PYOA 1TW3A 1ZQ1A 2GPSA 3QKTA 4AG5A 4F8EA 5CAEA 5LBTA 1CQJB 3EASA 2R44A 3KOYA 4N49A 1F6WA 1UMDB 1YBFA 1CRZA 2JCYA 4JC5A 2H2IA 3UMMA 2COKA 1Y1LA 1GGHA 5A4JA 2EFEB 1VI6A 4TUYF 2Y1OA 1YS7A 2Z1MA 3QA9A 2QMOA 3DMFA 4UBNA 3WNQA 4ZPJA 4CEHB 4HOYA 4QU9A 1YZTA 2QQ0A 4B43A 4RUKA 4R1TA 4Y9UA 1AKQA 3FHJA 3C39A 2N9UA 3RRMA 3HY4A 4LBWA 4WQMA 5JEDA 5KYTA 5DXJA 2ERXA 4F2WA 1VA4A 2QDKA 4RGBA 1PFWA 3VA7A 4ALJA 3ROFA 3KXLA 1TLFA 2BAGA 2QPOA 3OE4A 3NXKA 2OE2A 4ND5A 4TZ0A 2PRIA 4PHHA 3FSEA 4BFTA 3I5MA 2Q9CA 3WOVA 2B1QA 4NK4A 4EENA 4EY4A 2ZT6A 2OXIA 4HDMA 3ZQJA 2I6TA 2WPDD 1FJXA 5HBRA 1N0HA 2C5GA 4YMUA 5CLGA 5KSYA 1VC2A 4PGAA 1HDCA 3IUBA 2F4VB 4GBJA 3ZWWA 5IDWA 2PQ0A 1MO5A 1EFVB 2EBHX 4L8YA 3TMKA 1OVMA 1G6HA 1VRWA 3V8NA 1H2AS 1QKKA 2GKOA 3OKPA 4Y1EA 1QHHA 5JSUA 4WNAA 4BNKA 1Z88A 1Z07A 3K8OE 4BN5A 2H4YA 3IBTA 1A2QA 2OILA 1TL7C 4HNSA 4ZVSA 2YASA 5K0CA 5D87A 4IH4A 4HLNA 4CM9A 3V33A 2GRUA 2AHOA 4TMYA 1D07A 2RGEA 1P5ZB 2HREA 3RRYA 1JIIA 1JQLB 2OGSA 3B6KA 3JPYA 2HBRA 1PS9A 1O94A 1YVRA 2CVPA 1QJCA 1DOAA 1FSSA 2H3HA 2OHHA 1P2TA 2J5RA 2QR3A 2YJ3A 3S0JA 3BRSA 1IBSA 3G8YA 1SAYA 1B6GA 1ZMRA 4UMDA 3V34A 3GF4A 1E7SA 1F8GA 1Z5OA 2RSLA 3PJEA 3OZIA 4X8OA 4BKRA 1TDJA 1CHNA 1TTHA 3RGWS 1BVUA 2JBAB 3JWJA 2WUFA 1QYVA 3E3NA 2ANBA 2Y2UA 1CUWA 1MORA 1HYQA 3EDCA 4A16A 1C9DB 4TXLA 1ZUNB 1DLJA 1F3OA 2CCJA 4GUDA 3A6JA 4KE7A 3OCCA 4NZNA 3QUAA 4PSAA 3UHJA 3ZZUA 5JCXA 1YQTA 1TEZA 2UUAB 1GADO 1IXYA 1QCZA 2VHVA 1UBSB 5JW6A 1KYYA 1M8GA 1WPGA 4QDUA 5TIIA 2RD2A 2QTMA 2IZ1A 4GQAA 1OSNA 5FUYA 2G5PA 1Q0TA 3A58B 2EFJA 1E9VA 1E5VA 4YROA 3N87A 3UN1A 3RYCA 4P4TA 3BVPA 1MQSA 3L0SA 4H1VA 2H29A 3F5QA 3LFHA 4TQUS 1HDGO 1UMKA 5FDFA 3LCCA 2BONA 3R5TA 3JYQA 3QVVA 4FNMA 4RMIA 5FO1A 3EPHA 2YVAA 1JUDA 2I1VB 5FWXB 5FTMA 3GLIE 4XARA 3AETA 5LA6A 5TMPA 2RGNA 3K9GA 2O2YA 3KXIA 3JU3A 2P3OA 1R6VA 4FR2A 4WZAB 1GDTA 4QSHA 2OOKA 3D5QA 4TV9F 3QU9A 2NV0A 2PBRA 3KZXA 3WRWA 1JH9A 1QGUA 3VNQA 1GQSA 2XIJA 1HT0A 3BTSA 4J94A 3R3HA 3RUIA 3TLJA 3EIQA 4LNUB 3OTGA 3OT4A 4ARUA 4EUHA 2QYHA 4IDDA 1E9FA 2NSJA 3IAS6 3L6UA 1T9KA 1L4LA 1EP2B 2R60A 3NOOA 5TXGA 3PR1A 3E9YA 4HEHA 3B52X 4XLLA 3SEQA 2JI9A 4JB0A 2RFLA 3MJDA 5CX1B 5AK6A 2IHBA 1F7VA 5DBIA 2KE5A 2YHSA 3DVRX 3Q2IA 3L1JA 4YCSA 1M66A 2Q3JA 3KQPA 1KI9A 1KY5A 3UJCA 2ST1A 4R3NA 3RUCA 5I9LA 2D5IA 5D86A 4KVFA 4GGOA 3H5IA 4DLUA 2A30A 3FSRA 3PB3A 3FUUA 1C4XA 2UYHA 4PIMA 3A9WA 1RLOA 3L8EA 3ZI4A 4QM6A 2HYIC 1JHUA 1RLMA 2VK2A 3PPIA 3GFQA 1CQZA 4Q3EA 5GM1A 3IA7A 2C9ZA 1GM5A 2RAFA 3JALB 3UWPA 1OJLA 2NYVA 1JAYA 2OG2A 3VC7A 1CR0A 4GM1A 2C97A 1ZGCA 4RMHA 3EIHA 3WIBA 1U3TA 1W85A 2FAXA 3M3HA 5CCEA 2P9YA 3WGTA 1JE0A 1CETA 4M0KA 1TLLA 2YWRA 3K70C 4UJ3A 3RC2A 4KQXA 3W7AA 2LIPA 3WYAA 4DA9A 8MHTA 1Z33A 2F1JA 5LQUA 1OASA 1U7ZA 2HMSA 3NHWA 4Y9SA 5IEBA 2ZU6A 4DSTA 3V3KA 5KBYA 2FPGA 3OETA 3PUKA 3Q9NA 1YV9A 4RXUA 3PGXA 1KOGA 1WXXA 2WSIA 2IYUA 5EFZA 2GSWA 3GEHA 5KS2A 3GLGE 1P33A 2F55A 1G9XA 2RI6A 4E09A 1T1GA 4ZARA 2RI0A 3HXMA 3V4RA 4RQTA 1MAVA 1AO3A 1CUXA 3UJ7A 2WA1A 3D3WA 3BULA 2H51A 3OA2A 5E2AA 3TQCA 1IJFA 4D4IA 1X80B 3EDRA 4HGRA 4WKPA 4UHHA 2R68A 2BTOA 1J33A 2C7VA 2X4DA 3CLRC 4MRNA 2C9DA 2Q8QA 1P5HA 1U8XX 2FSFA 1Z4MA 4PIPA 1U9JA 2AR0A 4O4JF 5KJ6A 1FX0B 4EG4A 1DL5A 2FGJA 5LQCA 2AZDA 1TTQB 4ZU6X 4C30A 5LXTF 4BFXA 4TKVA 5K8CA 1K7FB 4UBKA 5AI9A 3G5MA 5H83A 4BBAA 2G71A 4DLTA 2Y1EA 5CG1A 4DNQA 4MAAA 2C4KA 3QNMA 3EGVA 3QJGA 3IFSA 4FFMA 5U4QA 3EEBA 3V1LA 1NNUA 2AE2A 1YR9A 5BUSA 4NBTA 3SY8A 4U7JA 4DCNA 4PE5B 4EGCB 4IV8A 1LDGA 1U80A 4FGUA 1FNBA 3RD5A 3WLIA 3CVYA 5HM6A 2O8FB 2FUNB 1C9JA 3MCUA 3MS7A 2ERYA 3OAAA 3JTEA 2YOHA 2D1SA 3DWEX 4PWZA 3TQFA 3RADC 2QRUA 1I6MA 1NZDA 1X1SA 1PEDA 2UYGA 4JT8A 1M76A 3KSBC 3H8WA 3KUUA 3KVYA 1G1AA 4HF7A 3WYCA 5KQSA 4MGKR 5KOJA 1IVSA 1JFLA 2PX8A 4Y7CA 3TZCA 4BQSA 4FDVA 3QP9A 1E9DA 2C9YA 1GEGA 3I34X 5FV4A 2CJPA 2LDXA 3LRXA 1TAQA 2A5DA 4G8BA 2QP9X 5A0VA 1QFZA 1V3VA 5G0SA 2BW0A 3KCQA 2EHJA 1VHQA 1GZ7A 3L43A 3CSSA 4I6EA 4UMVA 5DO9A 3V6MA 4AL4A 1OMOA 1FMTA 3I6IA 4A7PA 3CKMA 3H7IA 1NIPA 4L75A 3ZTWA 5B30A 5IZCC 5DXAA 3KQUA 3FYUC 3ZDFA 4OFZA 3GOQA 1GAWA 2QD1A 2XDYA 3D2LA 5AJZA 1BXKA 5T4FA 2V9ZA 4F7DA 1FP4B 1GPJA 2FWBA 2XX3A 3FDZA 3LY8A 4A4DA 2EL9A 4B09A 3OJXA 3PNVA 3JAMA 2H63A 2WP8J 1ZUD1 1VLVA 1IPFA 3E7WA 2V03A 3QU5A 4DUZB 4BX0A 2E21A 2EAUA 1E8DA 1KYTA 2F3QA 3P96A 2LW7A 4KO3S 3H1TA 1AKTA 1WUTA 2GF9A 3HYLA 3HDJA 3IUMA 4LOAA 2IEDA 2G9VA 4L0DA 2I7CA 2H9IA 2JKZA 1SOVA 5CIWA 4N0EA 1A1VA 1C0IA 1SCUB 3BJIC 1NI3A 2ZROA 2GK7A 4XWAA 1RU3A 3BTVA 5I7RA 3M0EA 2QZ9A 1ISJA 3RYIA 5FWNA 1PG0A 2YQ4A 3ND9A 3BIJA 3I5YA 2ZR0A 4JJ6A 5BVHA 2C2HA 1H9CA 5FPPA 2WF6A 4XWOA 2L0XA 2PMKA 4OXRA 3ZD9A 2HIHA 4EHLA 3IOCA 4TMWA 4EA8A 2VBGA 3AUSA 1Y5MA 2CWDA 2A0UA 2HCRA 2NUTB 2WKWA 1SZCA 2B0JA 2WD7B 1ZK4A 4KRFA 1OILA 5C81A 3T3DA 3TOVA 4QPNA 1U0LA 2I22A 3PKZA 4US0R 5IK2D 5BO5A 4BNFA 4XRGA 3SZRA 4P4SA 4OLAA 1FW8A 4W6ZA 4RTQA 4LWPA 4CCAA 4UEJA 1UXHA 4PS1A 5HRCA 3BILA 2QN9A 2C0PA 3OPNA 2ON6A 2DAPA 2Z3ZA 2GASA 3ESDA 4HB2A 1PJ4A 1REQA 1GA6A 2OD7A 4HDCA 4LZPA 4MUEA 4ZO4A 5FFFA 3UF0A 4A2WA 1LFDB 1OWOA 2ZWAA 3GJRA 5AVUA 3ROXA 2FHPA 2DHEA 4LDJA 3UYLA 3WLTA 3T4UA 4LJAA 4C6TB 4IOLA 3DCIA 3ZHBA 1V1JA 5JXHA 1MO3A 4IHKA 4BTLA 4PO1A 2OCAA 3AF0A 4N6GA 4W82A 4UM8B 3VPAA 2NUAA 1WMEA 3CIFA 5IJ0B 1ICEA 2Z5FA 5HILA 2MSCB 4E70A 2CXOA 3SC4A 2XXAB 1U0JA 3ZNPA 1YF3A 3SBEA 1H2WA 4DXDA 4G5FA 4DBLC 2J30A 1EUYA 3TQOA 4PSVA 1UJBA 1NXVA 2JFZA 1BXRB 1N7HA 4M0CA 4YN3A 1J97A 2AFHB 2V6FA 5AW0A 1GPNA 4FW8A 3UMRA 1BX0A 1FJGB 1JHYA 1CQJA 4RA6A 4N6NA 4GKVA 5ITZA 3FSGA 1QGOA 4HYEA 2ZOSA 2GEJA 3VSEA 4DT1B 4EX6A 1F2TB 5KOYA 3NM4A 3COPA 4C88A 3EXIA 4QBKA 1E0DA 2VJMB 3QI2A 3SE0A 4BO1A 2DFLA 5AVZA 3IL2A 5JU6A 1JHMA 1PS8A 3TLCA 4Q6BA 4CEHA 3ZU3A 1ISFA 4K9NA 4ZP1A 4ZVKA 1PWHA 4KLAA 2XCSB 1JWBB 2VOJA 5LN1A 2A35A 1KRHA 3R5XA 1E61A 3D8RA 4G4JA 5A06A 4MW1A 3ZKAA 4MQMA 1FP7A 5FL7D 4R31A 1L8AA 1H23A 5C46F 3U6BA 4CYMA 4EYGA 4ME6A 1UBEA 2PKYX 3I2GA 4B79A 1QJ4A 2F9MA 3B6IA 3PKIA 1MFZA 4L85A 5DHTA 1UP4A 3AR2A 5B2EA 4V24A 2WJ3A 2HSZA 3A1SA 3KZMA 4PG4A 2VCYA 2WINI 3F90A 2AB0A 1UJMA 1N5DA 2FMKA 3AF5A 4R9SA 2NXWA 3ICEA 1V9SA 3WLPA 3FZQA 3HK2A 4R1UA 4JIMA 4CBVA 1EWQA 2Q4BA 1ZVKA 3VJKA 3H9UA 2O3RA 4BC0A 3INYA 2OAQ1 1M33A 3EFBA 2CL6X 3ONWA 5AHRA 2GZMA 1RTKA 3IXLA 2EV9A 5KYWA 1CF9A 5K9ZA 4YRTA 3T6KA 3C8ZA 2EGGA 2ZRGA 3PD0A 4H4DA 3GJXC 3GLHB 3L1UA 5WRFA 5GIOE 1FLDA 5KVSA 1N34B 1T4CA 4Q48A 4DEXA 5JJ5A 3G68A 3TXAA 2EG5A 1SU7A 1SG0A 3CWCA 2JJ1A 1WBJB 1NBMA 1O6BA 2VHZA 4R2IA 4X1OA 4OXXA 1S4QA 3FVQA 1IXKA 3QU7A 3ZDYB 5BSKA 3VJMA 1Q20A 1D5WA 1Z4JA 4M1ZA 2YRWA 1XNQB 1Y42X 3UAXA 2XUPA 3TXYA 4IKEA 3LHSA 5KNBD 3SM3A 1H9AA 1F6BA 3A3YA 1AKMA 2W48A 2Z5VA 4X3CA 1OBCA 5A5VA 3L1KA 1TM4E 2X4IA 3EMBA 2HQSA 1MTZA 2FQXA 4LMRA 2PAFA 3D3KA 4MA5A 3H5RA 1O1YA 1VPDA 2P1DA 1CVLA 4WE3A 3SNHA 4NI5A 3JVVA 4P7GA 3NOVA 3WL3A 1IM5A 4DJEC 4PLVA 2C2KA 4OXIA 2DTDA 2GUGA 3E35A 1E0JA 3T7RA 1R6XA 2BEVB 4Q9IA 4YB8A 1KQFA 1FFCA 1E1YA 2VAMA 4KIJA 2M1ZA 1OF1A 5TQ0B 1U9IA 5KYYA 2NXNA 3HGTA 2ZSDA 1VGQA 5BUCA 1V4BA 5LDDC 4KTVE 5K6AA 3I23A 4Q1EA 4D46A 1HNNA 3IEKA 3QVJA 2ZUWA 3DAGA 1Z0AA 3P52A 3MYRA 3QLVC 4OK3A 2WWVD 1L1QA 4EMSA 1TT5B 3ZNOA 1VDMA 3O9MA 5BWCA 1VZ3A 3RS8A 1VJTA 1T5IA 1X7ZA 4DCVA 4JOBA 1X7YB 2PE5A 4D4KA 2WWFA 3TQQA 4F84A 5CX1A 2FI1A 3RS3A 1U4SA 4H6WA 3P0JA 3FTPA 1DHRA 2V7QD 5K0NA 2YMMA 5A3QA 3CEPB 3FPBA 3HCWA 5DLPA 2HJGA 2FG6C 3S28A 1KMMA 4IL5A 4N3BA 4QPZA 3RRNA 3BIXA 1G2IA 4E31A 1A9PA 3B13B 3FLEA 3MQ4A 5FNVF 2GX6A 2LIVA 4BYMA 4KYIB 1FNSA 1PR1A 1CK4A 4KDFA 2Q1SA 2OK8A 1XZNA 8LDHA 1IHOA 1TO6A 4FN5A 4J4TA 3BL6A 5ALYA 1EP1B 4TLEA 3TLXA 4R3WA 1BQ4A 4WVFA 2DEUA 4BNJA 1GV0A 1AF7A 4QUKA 4O8CA 2NTEA 3SBXA 4LXIA 2E87A 1W7AA 1D09A 2I2CA 1NBHA 2OEPA 4GSLA 4HI0E 4C20A 1A97A 1OX5A 4M3NA 4BXOA 3AHIA 2O5VA 1OWNA 1NXWA 4HUQA 3I9V1 4L4XA 4X61A 1B2LA 1OLOA 1IHXA 2JCVA 1Q77A 3K72B 2H1CA 1ZCFA 2JA2A 3PQ5A 1KH1A 4M53A 3AV3A 3LT5A 3SYRA 1OBFO 2PK3A 5JV5A 4JYCA 1EFAA 4IJ5A 3DTVB 1F7UA 1KMIY 3L7OA 1DEKA 5AWFC 3UJDA 4HZUB 1SQ0A 4QOHA 4X54A 3NAMA 3P0HA 2YR0A 4AZSA 2CE7A 1A8HA 2Q5IA 4YCBA 1VECA 3A7EA 2JGIA 1Y4AE 2XLCA 3IMKA 4IH1A 1NVWQ 1D5CA 1G8KA 3Q4GA 1C14A 4Z1MD 3L4KA 2BFCB 1F2VA 2BMVA 2CVFA 2IOFK 3JQAB 5KTPA 3WC4A 1FDRA 1S8AA 3DV2A 4J16C 5DHRA 4DJTA 1SCJA 4NCHA 1H2HA 4CEJB 4WBXC 2R66A 1Y6GA 2H0AA 4CODB 5HFJA 1WZNA 2WG1A 4YGXB 4WRRA 2X9QA 1FMJA 4BWGA 3CO5A 3LDAA 4XGIA 3HO1A 4LPKA 5KIAA 4X20A 3ZTYA 3E5HA 5E38A 3ERCA 1OWMA 1BKDR 3H05A 3OT1B 3IKJA 4I1IA 4B3BA 3EW9A 4OQLA 4QUHA 2JK1A 3VNUA 5HKOA 2V7TA 2IZOA 1YTLA 3FCCA 5BSHA 3CUTA 2F43A 2YC2C 3B1XA 3NH6A 2EU8A 1JP7A 2IDMA 3A6ZA 3L8HA 3VR2A 5KDOA 1GPAA 1PHRA 2B1GA 2XNDA 4FFWA 3RARA 4CIDA 1S3IA 3K5PA 3I72A 1X1TA 2C2ZA 1ZIOA 3DFKA 3C5CA 4FBLA 2Y1KA 3TAUA 5I4IA 1C7EA 1QV6A 2PWZA 3G49A 3MWLA 2Y9PB 4DSOA 1C29B 1FDOA 3E9MA 4W6QA 1UXJA 4P2BA 5IHXA 3HB4X 4A0FA 1I3CA 4AY2A 3PGKA 3KZCA 5ELLA 3TOXA 1HPLA 1C3OB 2ZCJA 4X8HA 3R0VA 1CRQA 1ZESA 3BBPA 1SU8A 4WXMA 1VSBA 3SJ7A 4ZTZB 4UCXA 2OR3A 3C7TA 5LLDA 3E7FA 3MUEA 4NFYA 4JQCA 1R4MB 2E49A 1EINA 1KBZA 1G8GA 2WU3A 1KVTA 2BM0A 4XLTA 4MKIA 2QLLA 2VR1A 3ZXXA 3G9ZA 4MDEA 1ZJ6A 3ZNNA 1T1EA 5FA8A 5GONA 4KLCA 4OMUA 1YBVA 4BMPB 2GHIA 4ZQEA 2ZSKA 1SBHA 1JXMA 3PIIA 3ZE9A 2FU5C 5JFTA 2A9FA 2HD4A 5LYJB 1K7CA 1W0JD 1W4ZA 3A1WA 3ASZA 3DOIA 3WJ1A 1G21A 4FHZA 3BJEA 3EGXA 4WBSA 4ABYA 1CE8B 2WNHA 4OGGA 3K0CC 2YX1A 2P5TB 1KO1A 3NBXX 3W7VA 2PCJA 1YUBA 2EATA 2FXVA 2GMWA 4HDSB 5EZQA 5CDSA 2VO1A 1ORTA 2QTVA 1SBQA 2PXAA 1ODFA 3RIXA 4CLRA 4KGXA 4EEXA 1XCPA 1NPTO 1SCUA 2A94A 2P0EA 2P8JA 1P1BA 3GJ4A 4XYGA 4HAZA 3RW9A 3V4ZA 3INTA 1NVUQ 3EK2A 3WGNA 3WBKA 4E2ZA 3U19A 5FBZA 2A1IA 2HJWA 3GHHA 1R9JA 3ECAA 4KBYA 4Y6LA 1KAGA 1SCDA 4RKWA 3T06B 3TD6A 1Z2OX 2XE6A 4ZYUA 4PC6A 4QUBA 5TMBA 3ZD8A 4CMCA 2OHXA 5DE3A 4UCQA 3UW3A 5I7VA 1Z6AA 4A0RA 3OZWA 1OLXB 2IOFA 2R84A 3FOAA 3LS2A 721PA 4O4LB 2PZGA 1PT5A 1AXGA 2QUAA 3I8SA 3OECA 3KALA 1JNXX 3IOBA 2B4AA 1ILWA 4EIWA 4FPXA 3SJZA 1N2CE 3DZIA 3UAGA 3MJVA 3T94A 4NYJQ 1TQ4A 4IDNA 2IY7A 2GYWA 1PAUA 2JGMA 3TLAA 1V1RB 1K6IA 1K06A 4TZTA 5G0VA 3ZOZA 4Y3UA 1SCAA 4Z3OA 2FJUA 2XB2A 2IU3A 5FL3A 4M0MA 1IQUA 4QWWA 4F60A 4HNQA 3O4IA 1B43A 3H6KA 3SEFA 3KR0A 3D43A 3SWWA 1A9QA 2YWBA 5EIHA 4N4AA 3PXGA 2Z2KA 3TI7A 3SM9A 1ZZEA 3ROZA 3M3PA 5AK3A 3SF0A 1XP8A 3H1BA 4Q19A 1LPAB 2GF2A 5IJ0A 1NUPA 2WYVA 4QTUB 3QBTA 2UV8A 2OLKA 5LUBA 4I4CA 4WXEA 4TYNA 3A1EA 4UXIA 1E2FA 1BEEA 4CUKA 2HIMA 3D3NA 4NQZA 5EXEA 2B4TO 5DCLA 3U4QB 5FPYA 1IY1A 1YH3A 2CB9A 3ZCRA 3T5PA 3VR4H 2G5GX 1QIIA 4BOYA 3FJYA 4EYEA 3SQLA 3GJ7A 3I0MA 1NR7A 4X93A 1L5ZA 1Y3HA 1C2TA 4X1IA 3PI6A 1J7KA 2HL6A 2IX3A 1C1HA 4L1KA 3P9YA 3V1UA 5DJ5A 1WHSA 5AIBA 1QCCA 1Y9JA 2IS6A 3FSJX 1AHHA 3JR3A 2VJMA 4LOJA 1ZD8A 5SY6A 3OQIB 4YYZA 2P6UA 4LY9A 2VJBA 4WFQA 5K6RA 2K7FA 3BF7A 1ZUIA 2Z2XA 4ZVMA 3O8LA 2OFXA 3HCBA 3A4MA 4FFBA 4U1RA 3TE6A 2B94A 3GLVA 3EARA 1GKLA 3TE7A 3ZY2A 5BR7A 1TQ6A 4JI0B 2QRGA 4LE0A 5F1YA 5A5FA 3E9EA 4DKJA 2CK3A 4UTOA 1RNLA 4LZJA 3T3PB 1SUFA 1YRAA 2FP3A 3FWNA 5BPHA 3LVRE 3WLLA 4LSZA 3IAM1 3LYUA 3TOSA 4BNUA 2WUVA 1JMKC 4G81A 4RD0A 4V38A 3ZWCA 4OG2A 1S2GA 3NDJA 2R85A 3M5WA 4I1VA 4RIFA 5LDHA 3EPLA 3JVDA 2NXEA 4GVLA 3PUYA 5HRAA 1QOQB 1FUUA 1R0XA 2P0YA 4LC1A 1Z73A 4NPCA 5F52A 3PD1A 4D42A 4E5YA 2AMLA 3VR0A 3DVQX 4AO6A 4ID9A 1RBQA 2GTHA 2OG1A 2XHEA 2XKAA 3DEHA 5BW6B 1C41A 2ZYAA 2MSKA 3HUUA 1P2DA 3EC1A 2W6MA 3N5KA 2NZVG 3PFFA 1YQXA 3INNA 3K35A 4PXYA 2GWRA 4Y30A 3VPHA 5K2OA 2HT6A 3CH6A 2N1MA 4EF5A 3SJCA 2HXGA 1NY5A 2IEIA 3PA6A 5J4HA 1X8JA 2DBRA 1VJRA 3QMPA 3FDFA 3NT2A 3ODGA 3LD9A 1SD1A 2X8LA 1I6LA 1YS4A 2BUAA 4IV0A 1I1OA 3R0JA 1MGPA 1MAUA 1Q50A 1XZBA 1OT5A 4UU8A 2E85A 2PPVA 5ESDA 4ZC1A 3UK2A 5IUNC 3WNBA 2J85A 5AOCA 2WR8A 4E1VA 1W9MA 3JQDA 2XVYA 4G0NA 5F2EA 1U2SA 2QAIA 2QY9A 3ID6C 5D6NA 3JASA 4JIGA 5IDVA 3WX0A 1LK5A 3HB7A 4MS4A 3N3BC 4F2PA 1L5WA 2YMQA 4BEVA 3QE2A 3JD0A 3NAZA 5JDIC 2QMHA 1LVHA 3CIOA 2G9ZA 2ZI9A 4QLOA 1J25A 3S8MA 4LNAA 3GLFA 3N53A 1VBNA 1LK7A 3JYNA 3OUZA 3EC2A 1E69A 2DOKA 4XB1A 4C0WA 1QH0A 3FR8A 4TQGA 5IJZA 1U0RA 1FXWA 3ZDZB 4DBVO 1AN0A 3UAYA 2BM9A 2FN8A 2DQYA 3RSFA 1CIJA 3L3BA 4AJOA 2H4HA 3K9NA 5B3LA 3VVMA 4EVQA 1P5RA 1JHPA 1V8PA 1XRSB 2ZIUB 3GDHA 3HXTA 2GA8A 3EEIA 3JWHA 4IFBA 1I4WA 2WYHA 5NULA 3RAGA 1F2DA 1EX7A 3IR5A 2FWRA 3C7AA 4HMQA 3WJ2A 4DIBA 1BQEA 3ZI7A 2VL7A 2XSZA 2YWCA 4WY8A 1DWOA 3K32A 1JDNA 4KW7A 3Q2OA 3DAYA 2L82A 4AKIA 2BEVA 3MWYW 3IPRA 2B8EA 4MV0A 4TTJA 3NRCA 4ZDKA 2CVQA 2JJ2D 4D99A 3I73A 1Y1TA 3HKCA 3EAGA 1FVOA 2PLFA 1AX9A 1WXGA 2SKEA 4PM4A 3VX4A 2YQ5A 1J21A 3ADDA 2YOFA 4OHRA 5PNTA 3EF1A 3AI7A 2W4IA 3B3AA 3IVCA 1PJLA 4EKGA 1ISPA 5JRDS 4GIBA 1HMYA 1NFFA 1NVDA 2ASVA 1ZGZA 2JI6A 4Q7MB 1Z6QA 2VI5A 3E1SA 2D0OB 1M1YA 1SA0B 4NESA 4TLLB 1J0XO 1X7YA 2AG8A 2PQMA 3ESYA 3MHPA 4KWIA 3O93A 4Q21A 4Z0NA 3TUJC 1EHCA 2D1YA 2WD9A 3V8RA 2XYPA 5DNDA 1EVJA 3MJCA 1ZSNA 3CZAA 4FLEA 4TTVA 1PDVA 3UQYS 3W7BA 2L69A 4C21A 5CPBA 2Z1DA 4BNIA 3IYLW 1A2OA 4LV5B 1GKKA 2RH5A 1PWYE 3FF4A 4NIMA 2K2WA 2XE8A 3IQIX 1A4UA 1P77A 2VQDA 3PC6A 3PTLA 4FJ2A 1YB6A 3SF8A 4GYKA 2DECA 1QF6A 1XT6A 1YHZA 2J0SA 3AHCA 1M2VB 3WWPA 2ZB7A 5KPDA 7AT1A 5JZMA 1LDMA 3W3AD 5CVVA 3EA0A 5GZ6A 3WNDA 4QIHA 1EFRA 3RC9A 4CEIA 2ZR7A 4IDBA 5EJ6A 2V8BA 4JUDX 4Q82A 2FFBA 1T36B 3IIJA 1DKRA 2M1XA 2RHMA 2IA5A 4W1QA 5FUQA 1U7TA 3ZGOA 2BBOA 4G0XA 1JHRA 2P9GA 3LWNA 1H4VB 2AOVA 1PZFA 1POWA 2I2XB 3JAWB 3PITA 1HWYA 2EFDB 1L5HB 3F8TA 5FBKA 5C4GB 3CWQA 2NM0A 2Z4RA 4U7DA 1Q3HA 1FS4A 4JCOA 3DTVA 1E1CB 2VQ6A 3DL7A 1TAGA 5THKA 4KYVA 4EQ6B 4G37A 2X8JA 1UAYA 2IIVA 1VP9A 1V0JA 3DMTA 3HNRA 3L8MA 1W36B 2A4MA 4FD3A 1Y4ZA 2FRDA 2P9TA 3MAJA 5THQA 1NNI1 1XNGA 2D2VA 4N3AA 3S4YA 4C07A 5IXJA 1O89A 1SXQA 4KQ2A 3QKUA 4G1BA 3D6NB 1IAVA 4N48A 5EHGA 4D0SA 1UINA 2AI1A 3H3XA 1T35A 4Q47A 3RNOA 3UJPA 2ZIWB 4F8YA 2OPHA 1WNFA 4YJHB 4MGHA 1ZR4A 1YZ3A 1KP3A 2WJVA 1JJFA 4YMTA 1GWNA 4IUCS 3WL6A 2ZUBA 4D41A 1C81A 4G4IA 4XDZA 4MR9B 4MS3B 1NKSA 2J6HA 1CTQA 1N3YA 5TPZA 3H5TA 5ED0A 2P30A 3GA7A 3Q3JB 3E9DA 2Q1WA 4R84A 1XKTA 1KTVA 1TPZA 4L8VA 2D1QA 3N0RA 4MTCA 1N8KA 3CKKA 3IKTA 1OH5A 2XZTA 1Z16A 4N82A 5LD2C 1P2UA 1WLYA 3P71T 4Q4LA 5K8JB 1ZGBA 1YCGA 4M87A 4MKZA 2EP8A 4LXTA 3GLKA 5CJ2A 3RC7A 2EIHA 4IS2A 5LMCA 5MGNA 2MMGA 3TNFA 2V5UA 4G6ZA 1G1MA 4L15A 4GBED 2J0VA 3OQNA 2RDMA 5KWVA 1HX7A 1XPRA 1J49A 1K8RA 1NFQA 2HM7A 3KOOA 2P3QA 4WD3A 1K0UA 5BW5A 1K68A 3KTDA 3KSZO 4ND6A 4XIJA 2PQ6A 2BEWB 1ZH6A 4C08A 3DF9A 1YBHA 1UWLA 2EJVA 2GD1O 4FTWA 4TYMA 3DLIA 4QYTA 2PY6A 1QO0A 3OY7A 4OHBA 4NMXB 2X9NA 3UHPA 3RUEA 4AWXA 3HGQA 3DKPA 2BYTA 2VK1A 4LAFA 4XFKA 4XWGA 5FTJA 5C1DA 1AHIA 1XV5A 3RKUA 4UUQA 3L04A 3QPUA 4TROA 1HQYE 4K9OA 3W5HA 2PUVA 1NY6A 3M70A 5FBRB 2FUEA 1Z0SA 2ZTVA 1N5LA 5L7YA 1CJMA 1YI0A 3W04A 1DC3A 5BQFA 1PJRA 2R7KA 2SICE 4CGYA 4UVDA 1UBHS 1P2FA 1JAZA 1Y8AA 2QORA 3EZFA 4JKIA 5CXUA 2FMFA 2JIZD 3MVEA 4I50F 1RAAA 4M21A 3U0BA 1E5LA 4QUEA 3TTYA 1JI0A 4NOLA 4LG1A 1DJNA 2EYUA 2CF6A 3ETNA 4DDHA 2Z95A 2ZRHA 4LOIA 2WAOA 4XGQA 1JEJA 1F20A 1NXXA 2GCOB 2CE2X 1PRYA 3EXG1 1KHTA 1DKQA 5H7XA 1CRPA 2XCTB 4EG7A 1C7ZA 4UPEA 1NMEA 4HAOA 5JYEA 4MMXB 4O2BB 2O7QA 1SKYB 3L05A 4X45A 1SFRA 1UMBB 4JLNA 4KRXA 5FV7A 1C7FA 1U2QA 5DM60 4LZOA 2LNDA 5KYVA 1Z28A 7ABPA 3II6X 4I36A 3RWOA 2X6TA 2O0JA 3BXFA 5EFOA 4DIEA 1IQRA 2AOXA 3N05A 1KK0A 4PRZA 5KVAA 1U0BB 3PHHA 4MVJI 4NARA 4RVHA 4F86A 4MUYA 4NC9A 1Q14A 4P3KA 4UQLA 2JHAA 2F3PA 1MC5A 4NOJA 4MQLA 2PX4A 4HNGA 2BGMA 2GM4A 1ESCA 2X2FA 4BJ5A 3GY0A 4DPMA 2C84A 1TIPA 1H69A 1ZEMA 2M2IA 1RMTA 3SYLA 6REQB 1NT4A 2ZVDA 2DLCX 4LX8A 3LC0A 2CHGA 3N2YA 4GWGA 3VOTA 4AUKA 5IJ9A 3D7KA 4RPKA 2JAHA 3WY9A 1GL9B 1ZLXA 3LKDA 2H4ZA 3EZNA 4CV2A 1E2PA 4YQEA 4EKNB 3C3YA 3DT6A 1JJIA 3AUKA 4QGHA 3W9BA 2WDZA 2OCLA 1NX6A 5I7OA 1VYUA 2PFSA 4AYTA 3HV2A 9LDBA 5FBWB 4IIJB 4P36A 5B64A 5CBKA 1AMNA 2AQKA 3QOXA 2GJAA 1UKCA 1F2UB 3K7EA 3DC2A 3AF3A 3KYDB 1LTKA 3ZK8A 4CU5A 5JSZA 2BDEA 2IC5A 2V97A 1WXQA 2ZJAA 4WZ6A 2WSSD 4MQ6A 2C03A 5HSGA 1A98A 1T9GR 2GNPA 2HZ7A 3BM5A 1X0VA 3BSFA 4KODA 3WMXA 1CU1A 4PZDA 2GEFA 3N1UA 4ZEOA 2B35A 2F9FA 2QT1A 1QHNA 3P9NA 3PEUA 3AONB 2VPTA 4M8IA 3W05A 3D7LA 5B3AA 2W71A 4LK3A 3RASA 1U8UA 4OY3A 4Y2VA 4ACBA 1JEAA 1YZUA 2PRKA 4HNRA 4L95C 4XUCA 3QNWA 4IXTA 5B3JC 2A4KA 2RHCA 2G40A 3HC7A 3DAPA 3PWSA 4PN3A 4YC7A 4E5NA 5JNRA 2VNKA 2V3CC 1C4KA 4GO1A 3EUAA 1Q84A 1G9SA 3IV9A 3QHPA 1YFZA 3U5ZB 4CIAA 1B76A 5HIIA 2X76A 5J2UB 4F71A 1KL7A 5FUBA 1ILEA 3WL7A 1IM8A 1JU4A 2Y1GA 3GOHA 3HU2A 5C8XA 5K3CA 1RWNA 1AKRA 1J0DA 1OXXK 1CYDA 1QIMA 3CPJB 2W0SA 3STYA 4JJ8A 4B3SB 1TGVA 2YHBA 2W6ID 5E6UB 3E53A 1N9GB 1ZFNA 1VHDA 4O63O 1ZCAA 2A57A 1ZXXA 2D5BA 1QB7A 2W37A 3ANXA 3GBVA 4U6NA 4PPQA 2XMCA 1BRMA 4KFTA 1QIDA 2AYZA 2GLXA 4NPAA 2WMNB 5AM3A 1U7WA 1A7JA 2PPLA 3GJ5A 4PZUA 1SXJD 1F1JA 4MAFA 3ZWKA 1YOVA 1F6DA 4AKEA 1FFDA 1G7SA 3ESAA 4OIFA 4WN9A 4WHMA 3GN1A 1NP7A 1XTRA 2C78A 1S0UA 4PNHA 3OKFA 2I80A 5EXTA 3CF0A 1C7RA 3ZHCA 2VJYA 2G4VA 2FFQA 1TA0A 1QRDA 2ZRDA 1Z62A 4JOSA 5JCOC 1TKRA 3FUCA 1L3CA 5K0SA 3HKBB 3WP1B 3ZJVA 2CHUA 4F4FA 5ADWA 4ZMRA 3GL9A 3CB4A 2GN9A 3JCZA 5LM3A 3FI9A 4TV8F 4XGNA 5FR1A 2AFIA 1SM4A 5LB4A 2I3AA 1X1RA 3BWDD 4FZ5A 3N75A 4HS9A 3FKJA 4QG7A 4FCWA 3FBGA 2LVBA 1XAJA 1YWGO 1Y5LA 3KAKA 4CQMD 3KFVA 4R1MA 2JGKA 1EGMB 3JD1A 4FSXA 1FRNA 1NBAA 2C5LA 2VDPB 4EY5A 1CUSA 5CVJA 4ZAFA 4QHSA 1NQWA 4YRRA 1Z7WA 3TK1A 4EG3A 2B4QA 2CZQA 3M34A 1WF3A 1FFHA 1YAJA 3AOEC 3FWHA 5E9QA 3FZYA 4Y0AA 3HFGA 1V35A 4AKGA 4RD6A 4AS3A 1E1RD 1WLSA 3UG7A 4AZ3B 4YRSA 2YXLA 3MJFA 3VDNB 1E4OA 3WDKA 1OAAA 3F7TA 5KPJA 3CO0S 2B25A 3IPLA 1I9GA 4GX2A 4L57A 3C15C 5CB6A 4A36A 2A0WA 4ZQHA 4B47A 2A9KA 3VGJA 2DUNA 4BFVA 4BLVA 2XYRA 5CNMA 3NWBA 4QYIA 5E7IA 4CT0A 1O6ZA 3W5VA 2NPIA 3USZA 2GKSA 3KVVA 3JWIA 4Y0VA 3KIPA 4JNCA 4K5QA 4S12A 3IDOA 1F51E 1NKTA 5EHQA 4BLTA 1U2GC 1AC5A 3AVTA 4IXMA 3L5OA 3IRUA 4QSMA 1II8B 4MPDA 1FMCA 3HXKA 4BO6A 3LHDA 4F12A 4ZHQF 4ZMBA 2K7ZA 4ADSG 2Y77A 3GQVA 5FYDA 4LCEA 3O3MB 3VU0A 1JIQA 4NTZA 3RK1A 4JHLA 4ZI7F 1UBRS 1WUYA 4ZV7A 1ULAA 3A1DA 3HR8A 3D1VA 1Y6QA 2NVUB 1EDZA 2FVXA 5EHZA 1EPUA 1GZ3A 1U11A 3I0ZA 2ZETA 1D9XA 1DOZA 3NV9A 2QNIA 3QVGA 2QVGA 4M7OA 4IVNA 2V6JA 4OQNA 4BHTA 1RPNA 1OAOC 5A0TA 3GDWA 2R79A 1S1MA 3ENVA 3VR3D 4ZYZA 4FFDA 3A3PA 3BH0A 4H77A 2IV3A 5IFLA 1YRYE 1ZG3A 4JJKA 5JANA 3CR7A 4PXSA 3E0QA 3LPAA 4WNCA 3BORA 3SHWA 1GPYA 1SA0A 2FP4B 3C7KA 3FPJA 621PA 2DR2A 4YIHA 1UKEA 1OI4A 1XEWY 1DC7A 4HB4A 4QDZA 4CL3A 1IYZA 1JU3A 5I7AA 4JBLA 1SQGA 1DV2A 3G2OA 4MR7A 3DPUA 1IFXA 3RH0A 3NNSA 4YDHB 5IT0A 1GZHB 1TZBA 4AM8A 2O8EA 4QL3A 5DTRA 1NPDA 4PZZA 3UJHA 4GECA 2PT7A 1D1TA 1F3LA 2IUUA 4WN3A 1OIWA 1NW3A 1RIFA 2BFFA 4U00A 3MA0A 1SEVA 1T0BA 3TL2A 5BSUA 2Q3DA 3D7RA 3U56A 1QOPB 5THXA 3DLAA 1M5RA 1IJKA 1AUXA 3DXZA 4BUCA 1RVV1 3CINA 3MM4A 4G01B 4X1KB 4LWOA 4LY0A 4YJ3A 3ZY6A 4MRMA 3EAFA 1V37A 2DR3A 4NMMA 3RUPA 2XZPA 1D04A 5KNDA 1A1SA 1RQXA 4WNIA 3LDGA 4EARA 1W96A 4V0LA 4KHPB 1ZO8A 1PYOA 1V5FA 2PX5A 5A4IS 4BWYA 3UJAA 1N77A 1M34E 3RV3A 2C5AA 4R8VA 5ED4A 4G5HA 5D5PA 3MTIA 1L7AA 3L07A 2KI5A 2QG4A 4F2HA 1KDRA 1RYMA 2L18A 5PGMA 2J9FB 3DL0A 4MWTA 3BB1A 3QVXA 4DMCA 3ROMA 3ZHTA 3E3MA 3LOUA 3I8XA 2DFVA 2QZ4A 1LW6E 3GUUA 1NVBA 4WXPA 4HX9A 4ZRDA 1XLWA 3ZVMA 3ZD7A 2PSJA 1E6MA 3G82C 5BMVB 3IP3A 3F6PA 1XD9A 3T5GA 1SHLA 2B5WA 3E05A 2IPOA 4INOA 4Q9LA 1A69A 4M9CA 4R0NA 1J99A 1FFXB 1QR6A 3DNMA 3HJBA 5FADA 5AHKA 3RNLA 3BWYA 2ORVA 2OCBA 5TV2A 1J2TA 3HADA 5D2CA 1NJFA 3EAQA 1ISGA 1XD2A 4BASA 2MINB 4NFSA 4DWVA 2W6OA 4EFLA 4LDNA 3SLGA 5J2TA 3P7MA 2PO7A 2BFDB 2X41A 2DKNA 1LTQA 3OTWA 4HQRA 5E9WA 4DLKA 2ZAYA 1QYXA 2ANCA 2C2OA 1Z4KA 2C9MA 3MWEA 4N8SA 3GNTA 4EHBA 1JG3A 4B76A 1TM7E 2OVBA 4FFRA 4G4SP 4NJOA 5ILGA 5DB4A 1RC1A 1L1FA 3HM9A 1KK3A 1T26A 4GRDA 5INTA 1GIAA 3TVDA 2WSYB 1ZINA 1WEKA 2DLDA 1CERA 5JJCA 2Q3HA 1DTSA 2A7QA 3M2TA 4DNOA 1KQOA 1Q16A 2P7IA 4Z4HA 3UTCA 1HDOA 4QNMA 3WKDA 3LT4A 3HDHA 1NVEA 3VPXA 2YHAA 1MG0A 4YREA 3FHTA 1X15A 4R9UC 4ISBA 3VYTB 2JH9A 4J0EA 2XYVA 1FE8A 2HFKA 2BHSA 2QQGA 1DG9A 1G2QA 1Y9AA 5CDUA 2BEWA 1S5PA 5LP1A 4QFDA 4A26A 2XWQA 3ZWYA 2UU9B 3CZ4A 4I19A 4ZZ2A 1FZTA 2ORED 2NNLD 5H82A 1MQAA 1P0MA 4RH3A 1Q22A 3HKDA 3TEJA 3E3AA 4RY2A 2OGTA 1S9HA 3KXPA 3Q8XB 4NV1A 4RM2A 4RACA 3Q3EA 4QQFA 5BT9A 1Z83A 4LBZA 4LF6B 1XZJA 2RGXA 1WX1A 3E48A 3PE3A 5A5GA 3VFDA 2BGRA 3GPCA 1I0IA 3L0CA 3MMZA 3CVXA 3AJDA 3P4XA 2OV2A 4H4EA 1ENYA 2C3YA 3QPCA 1SZPA 5B53A 3PXBA 4BBJA 1ZJ4A 2QQFA 5E8RA 3JQFC 3WYNA 1PWEA 3ZIDA 1J0EA 1II9A 1MV8A 1Z3CA 1MOSA 1UANA 4NICA 1EP3B 1KFCB 2OV8A 4Q12A 3KJXA 3R0ZA 4DZZA 4E22A 1LWOA 2JFXA 2OAGA 4Y6SA 4YRBA 3WMRA 2DBYA 1XTQA 3BRWD 3PRJA 4U7PB 4RHCA 1XXHA 3AFIA 3KDSE 4CL2A 1MXFA 3FY4A 1HFJA 3C97A 2MR6A 3JAKB 3NGXA 4OXQA 2XDQB 3UXMA 1T4BA 3Q85A 4EZIA 1QH8A 5B12A 3PP8A 3HDYA 5BNZA 4PO9A 1NW4A 1G6Q1 3EUFA 5CA1A 4CM4B 5EN4A 4DPLA 4Y6QA 1PVOA 4NENB 2DU8A 3RF6A 1G7TA 5IC6A 3R3SA 2EEZA 1PJ2A 2BJWA 3E22B 3R40A 1ISRA 1PGQA 3ADKA 3I9MA 4ZXPA 5K45A 3GQBB 4US1R 2QLNA 3A26A 4EELA 4E30A 4UMFA 2I34A 3UZUA 4ZALA 4DJDC 3L8FA 3VC1A 3B8EA 4EJSA 5CM2Z 4GM4A 2NIPA 2VP0A 5DBEX 5CM9C 3HVHA 1QFJA 2EWWA 4XCVA 4YRAA 5JECA 2BMAA 1FTQA 2I5PO 4WXHA 3DQPA 4L8GA 2ZUCA 1R0ZA 5K3OA 2DBVO 1BU5A 1BWPA 3BHMA 2YW9A 4DZTA 1O95A 1A3CA 2ZI6A 1C50A 1ZN8A 3TKAA 3PG5A 1Y0BA 1D2NA 3IR6A 5DX8A 5T5QA 3CCBA 4RHFA 5CTJA 1GAEO 3C74A 3WO1A 4P3NA 5FAXA 4UUBA 2Z5GA 5DT2A 3X2FA 5JEEA 5IAGA 1JZTA 2IYOA 2PUCA 3PSHA 2IE8A 2M6KA 4IIJA 4GVXA 1UEXC 4DGSA 1E59A 1UODA 4L50A 1MUUA 1MIHA 4HBZA 1DJQA 4PHTA 4QUGA 5TY0A 2RIRA 3KYDA 4RIEA 3MELA 5K4AA 3IMEA 2ZUDA 4LZZA 3C3PA 3ZHOA 4TX1A 4BGEA 5JC1A 4F9EA 3G59A 4UZFA 3ME5A 3OMLA 3RJMA 3TW4A 3HBJA 1SIBE 1G19A 3JVEA 3W2FA 3OOWA 1G3IA 3KZNA 2W42A 4ZREA 1VMEA 3AY3A 3BS4A 1GCAA 3ILHA 1E8MA 3H5AA 1X7DA 3O47A 3O75A