3ESQA

Crystal structure of calcium-bound d,d-heptose 1.7-bisphosphate phosphatase from e. coli
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
182
structure length
182
Chain Sequence
SVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFRQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITPEAENAADWVLNSLADLPQAIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of D,D-heptose 1.7-bisphosphate phosphatase from E. Coli.
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords D,D-heptose 1,7-bisphosphate phosphatase
total genus 63
structure length 182
sequence length 182
ec nomenclature ec 3.1.3.82: D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase.
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13242 Hydrolase_like HAD-hyrolase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3esqA00
3MN1A 2AH5A 1Q92A 2R8YA 1RLTA 3NIWA 4GXTA 4CF4A 2HDOA 3FPSA 3E58A 3SKYA 1L7PA 3L0CA 3WK6A 2WF9A 3KOOA 4IG4A 4EELA 1Z5GA 3RF6A 3PDWA 4XOUA 2B8JA 2NO4A 2GHTA 3KC2A 5AK6A 5AKJA 4Y2YA 4BEVA 1RQNA 3DNPA 3DAOA 5AIAA 1U2TA 2YMLA 2HF2A 4XQ0A 5AW7A 1TJ4A 4I9GA 2FEAA 4BX3A 5AVSA 4YGYA 3M1YA 4I9FA 2B8EA 1Z4MA 2R8XA 4UMDA 5AKEA 2WM8A 3FGOA 1AQ6A 5AI4A 4F72A 2O9JA 1MH9A 1VJRA 2FUEA 1J97A 1RKVA 2BDEA 5A3SA 2B1RA 2B82A 3ZX4A 2G08A 3W5DA 1XPJA 3VAYA 1Z4NA 3NASA 5ALNA 4ZEWA 4L57A 3A1CA 3AR4A 2OBBA 4BKMA 2AGVA 3QU2A 5AKGA 1Q91A 3QXGA 2CFTA 2ZBFA 2FPSA 4NWIA 4RESA 1ZJJA 1ZRNA 4Y2PA 1YNSA 1L6RA 3L0YA 3NAMA 4OFZA 5AM1A 1ZS9A 2YJ6A 4NABA 3N07A 4KNVA 5AKHA 2HEGA 3BA6A 3WGVA 2OA0A 2C88A 3W5CA 2FPRA 2WFAA 3KBBA 1Z4IA 2ZBEA 4NV0A 2Q4RA 4Y2QA 3N1UA 4DW8A 2HOQA 3EF1A 3OCZA 5AKZA 2HI0A 2Q4TA 3A3YA 4QJBA 3FPBA 2ZXEA 4YCLA 4UU1A 1L7OA 5AW3A 5JJBA 4HGQA 4OCZA 3IRUA 4PNHA 5ALWA 1Z4OA 2BY4A 3RFUA 1RDFA 2EAUA 3L0BA 1WVIA 4EENA 4H1WA 5AI8A 3L8EA 1N9KA 2Q5EA 3KD3A 5ALDA 3IJ5A 3QU4A 1TE2A 3ESQA 1YS9A 2RARA 2QYHA 3ZTWA 2G80A 2YJ3A 3QU5A 4C4RA 5ALQA 1U02A 4IFTA 2ZOSA 1RQLA 2ZG6A 4KNWA 4BNDA 2PR7A 1WZCA 1Y8AA 5ALJA 1S2OA 5ALPA 2YMPA 4G63A 2YFYA 5A3QA 2FPXA 1RKUA 2JGAA 5ALRA 1WR8A 1YV9A 2IOFK 3IB6A 2G09A 2ZBDA 5AVYA 3QU9A 1ZD3A 5AVTA 1RKQA 2JAUA 3W5AA 1T5TA 4OD0A 3AR9A 2RB5A 1U7OA 3AR7A 4BX0A 3CNHA 5E0OA 3UMGA 4UM5A 4BNDB 1L8OA 4XE5A 3ZU6A 3AR3A 2B30A 5AW0A 2AMYA 5AM3A 3OCXA 5ALKA 2HCFA 4CE6A 5ALSA 2FPWA 5ALVA 2EARA 3NRJA 1ZRMA 3D6JA 2W43A 5IT0A 4HYTA 4KX3A 2JAOA 2IOHA 3WKDA 2AUTA 2W4MA 3R09A 5AI6A 1NRWA 5AKXA 1KYTA 2CFSA 5AVVA 5ALLA 3PCTA 2D2VA 3OCWA 3WKEA 1LVHA 2R8EA 4BEWA 5IS2A 3UMBA 2ZBGA 4UASA 3J7TA 1WPGA 3OPXA 3A1EA 4Y3UA 5ALHA 2BDUA 1JUDA 3NUQA 5AI5A 2G0AA 3M9LA 5AVQA 1O03A 2I33A 2FUCA 1TJ3A 5FP0A 3WKCA 4EEKA 1ZD4A 3ET5A 3EWIA 4B6JA 2I34A 2I7DA 3OCUA 1RMYA 3WK9A 1EK1A 3S6JA 1LTQA 4XPZA 3WK5A 2OYCA 2I6XA 3WK8A 5AVZA 3AR2A 1Z88A 3WK4A 5ALFA 1RRCA 2WF8A 2IOFA 3P96A 3N28A 1RPZA 2HX1A 3ZVNA 1Z4JA 3EPRA 3QUQA 1RC8A 1ZOLA 1NNLA 3QLEA 3ESRA 1RLMA 2R8ZA 3CZ4A 4NAVA 1XP5A 3DDHA 1RMTA 3PGVA 2WHEA 2YJ4A 4FFDA 1VFPA 5AICA 4RETA 3I76A 3UM9A 1YDFA 2MSNA 4AS2A 5AM0A 5ALGA 2G07A 3ZTYA 5AK3A 3L8FA 1SU4A 1S8OA 5ALOA 1QQ5A 1TA0A 5AW6A 3FVVA 4FE3A 4KYTA 4DCCA 2YBDA 4CNQA 2YN4A 1F5SA 2C8KA 3QGMA 4O8CA 1L7MA 2ODAA 3QX7A 2IYEA 1QQ6A 1J8DA 3WK7A 1CQZA 3QUTA 3OCVA 2WF7A 4UATA 2FDRA 2NO5A 4L6AA 3WKAA 3F9RA 5AKIA 3B8EA 4UW9A 3SHQA 5IT4A 3GYGA 3MC1A 5T41A 3QU7A 5AW2A 3NALA 5ALYA 4HGNA 5ALEA 3L5KA 4NFLA 2B1QA 2I54A 4AS3A 5AW9A 4UAUA 1K1EA 4HGOA 4UMEA 5AK5A 2PKEA 3L8GA 2X4DA 3U7EB 3TLMA 5AKKA 1SWWA 3HYCA 4AP9A 5AW1A 1ZD2P 4HGPA 4C4TA 4YH1A 3QUCA 3WGUA 4FYPA 3E84A 3KDPA 1U7PA 1X42A 4MUMA 1L7NA 1T9ZA 4EX6A 3K1ZA 3E8MA 4Y2TA 3AR6A 5AK4A 4J2TA 5ALUA 3L8HA 4YCMA 4OHFA 2PQ0A 5AKYA 4UMFA 5ALIA 1SWVA 2I55A 1TJ5A 2HF7A 4UMVA 2RBKA 4G9BA 3R9KA 3SLRA 4GIBA 2GFHA 3MMZA 5AI9A 3I28A 2W11A 4Y2RA 4ZEXA 4BYGA 1XVIA 1Z4LA 3DV9A 2P27A 4HGRA 5AW5A 2CFRA 3FZQA 4CF3A 3N5KA 4UM7A 4E88A 1L8LA 3ONNA 5AVXA 2GO7A 4Y2JA 5ALMA 3ED5A 1Z4PX 3SKXA 2C4NA 2YMQA 1PW5A 3ZWDA 1QH9A 5AW4A 5AESA 2VKQA 3N8GA 1CR6A 2JARA 2O2XA 3B9RA 1VJ5A 4ZEVA 5AVWA 4UARA 2OM6A 3R4CA 4QQFA 3U19A 5ALTA 4JDPA 3B9BA 2B0CA 3EF0A 3U7FB 3ET4A 5AM4A 3ZX5A 5A3RA 4BBJA 1YMQA 2JAWA 2G1AA 1IWOA 3UMCA 2GHQA 5AM2A 5AI0A 1RLOA 1FEZA 2EATA 1O08A 2NYVA 3W5BA 4CF5A 2MU1A 2HHLA 5AVUA 4DFDA 2YY6A 1Z4KA 3QNMA 4KN8A 2QLTA 2FPUA 3AR5A 5ALXA 3ZVMA 2HSZA 3SF0A 3PGLA 5AHXA 3U7HB 4MWOA 5ALZA 3WKBA 3U7GA 2WF6A 4YIHA 4EZEA 4UAVA 1Z5UA 3U13A 3QYPA 3BWVA 4Y2UA 3ZI4A 3I6BA 3OTQA 4UU0A 3KZXA 3ZUPA 3ZVLA 2HO4A 4C4SA 1QQ7A 3ZW7A 5AW8A 2WF5A 2YJ5A 3E81A 3I1YA 1ZD5A 2G06A 2DQSA 3L1UA 5AKLA 5AIBA 3MPOA 1T5SA 2C8LA 2GMWA 4YCNA 4F71A 4Y2SA 5AM5A 1NF2A 3ZWKA 1U2SA 3SMVA 4L6CA 2FI1A 3A1DA 1RMQA 1QYIA 5AVRA 4DWOA 3AR8A 3L1VA 4BX2A 3HLTA 2RAVA 4KX5A 2C9MA 3FM9A 2CN1A 4HAIA 3OCYA 4JB3A 3NANA 4Y2VA 1YJ5A 4Y2XA 4EX7A 4YIKA 3SD7A 2P69A 3QUBA 1EK2A 3L7YA 2P11A 4J03A 2IA5A 3U26A 2P9JA 2YMMA 1N8NA 1Z4QA
chains in the Genus database with same CATH superfamily
1IYZA 4R8LA 3RK1A 2PK3A 1EXDA 3K9HA 2AH5A 2DT5A 1SPXA 1KZHA 2VNSA 2CE7A 3E58A 5FBZA 2FNAA 3S5JA 4ZKDA 4EI7A 1V3VA 4Z8YA 1M5RA 1QHXA 2FPKA 4PQYA 2YZGA 1YGPA 1Z0AA 2JFXA 1VRWA 3GZNB 3QBJA 4U9IS 4B71A 5KYXA 1FDRA 1OHHA 2OENG 5JBQA 2P6NA 1ZGJA 4OOFA 3GA0A 4XOUA 4E30A 4QXOA 2V6IA 4TN5A 5AKJA 2CEAA 3TN7A 4EPXA 3FDFA 1T3HA 4BWFB 1PAUA 2ES4A 2OHGA 4OQXA 4BCDA 2BDTA 4RMJA 2OQ2A 5JCJD 1OX4A 5L51A 1ND5A 4IQ4A 5M7EA 1PZNA 1CERA 2B5WA 3AEYA 3C5WP 3HVJA 5A71A 3SYLA 5CFOA 5IBCA 3MJRA 4BE7B 3AUSA 3OQBA 1RD4A 4Y18A 3U0VA 1T4GA 1Z4MA 4Z7OB 3KZVA 4KO2S 2BLNA 4KIWA 3ICOA 4J29A 1U7ZA 4JBGA 4LHXA 3DPIA 4F72A 1ZISA 1GAXA 1S02A 4UU8A 1VMIA 1AQYA 5JSYA 1YL5A 3VPAA 4BO2A 4RIHA 3HCAA 1WPRA 4ZU6X 4KK3A 1XTTA 3AVPA 2DBRA 3BJMA 3BTVA 3ZHOA 5IARA 4D02A 2IXTA 1OR8A 4IINA 4ZP1A 1KFEB 2JANA 4PR3A 1FOEB 4MR8B 1YB7A 3UPDA 3WO1A 3UUFA 1RBYA 2PSJA 3GLHB 1MV5A 3LWDA 3MINB 1RWOA 2C42A 5FFFA 1OI3A 1ZMBA 5A5VA 4TV9A 2XA9A 1DC4A 3M3PA 4FWTA 1XTBA 2XT9A 1VA5A 3ZUGA 1HBJA 3QY9A 1JHOA 1QZXA 1Y6QA 2OVBA 4WVLA 3I9FA 4CI9A 1JWBB 3NTLA 2FPSA 2WTNA 3GEIA 4TSRA 2DLCX 3TJRA 1OXXK 4Q37A 4DV5B 3P20A 1PR2A 2WG2A 2J3KA 4GXNA 4L73A 2V54A 5BR1A 3LUJA 3PHCA 2GM4A 4U7JA 2QL9A 4YJ3B 2C77A 4Q1BA 4XASA 3STUA 4CN9A 4F85A 3DE5X 3DFIA 1Z12A 3DMTA 4NABA 5BOVA 3AUUA 2FEPA 1ECBA 1TT5B 3G59A 2Y1CA 1LZKA 2BUAA 2C5GA 2C88A 3LGAA 4LC1A 5A6VA 5KNCA 3K20A 3X43A 4AG5A 1UODA 1DDOA 5AD1A 1G2IA 3ZIAA 1W4BA 3LHIA 1DEKA 2PGLA 5KYXB 1NIJA 2XUIA 3DMTC 4L78A 3ZWNA 4F96A 3UHPA 2WUGA 3G0BA 3OWXA 3SXUA 3ZWVA 3UAXA 4AJ2A 2RFLA 3OCZA 1FUEA 1IY9A 1NYRA 2H63A 1EVLA 5JVDB 1E0JA 2NSDA 3A9TA 4HX2A 2YH2A 2LRHA 5TQ2B 2AFVA 3SJUA 3VR6H 4IR7A 1K4MA 3FZYA 4POOA 1MB9A 4G23A 4N5LA 2P62A 3SIPA 1J42A 5L3QA 1P7CA 1R64A 1Y8RB 3A7EA 3CVUA 1KP9A 5IT4A 1VG9B 2J7PA 2Q6KA 3AFNA 1U1EA 3E0QA 2FOIA 3LDGA 2EAUA 2WE8A 2IYUA 1C1XA 1JLMA 3FROA 2XOXA 3K30A 2JGFA 4TZ6A 4QQ8A 4PF1A 3D8HA 3VDQA 4ZVRA 2VK4A 5TLSA 4KFTA 3IQZA 4PAMA 2ZM6B 2XRZA 2AYXA 1PLJA 1JYFA 2JRCA 4Z9BA 1H6BA 3TS1A 3LOPA 1E94E 4LZAA 3JWPA 1TB4A 3BL8A 3E61A 1U02A 3DR3A 5A4KA 2XD4A 2QG9A 4B5KA 2NTYC 3I2FA 4LNUA 1KH1A 1JB9A 1JBKA 1EXMA 1N2BA 2QRVB 2W6NA 2X8WA 4WEOA 2IV3A 3ZH2A 3VR4A 3ZJTA 1Y4DE 4G0UA 3VZPA 4WXEA 4F12A 1X7WB 1D4ZA 1PJQA 2BKVA 1X1TA 2X5JO 1WR8A 2XF8A 1H2EA 2W8BB 3NU1A 4LGCA 3TB4A 5FWXB 1MA3A 1US8A 5HCUA 1PJBA 4UKDA 521PA 3WAJA 1AK1A 2PZFA 1UJ2A 1U2RA 5IUKC 2I4TA 1SBZA 3UT5A 3ZZ0A 1SFRA 4FHFA 3TM5A 4YRMA 2Z2KA 2VDMB 1HDRA 1OTXA 2ZYVX 3COSA 3E05A 4KQ6A 5HS6A 1HT0A 3WL4A 3C3DA 2O8DB 5HFJA 4MLZA 3BHIA 5DBOA 4KR3A 2H1LA 2PKWA 1WEHA 2VKTA 4Z9XA 5H83A 2HQSA 5CTAA 5E0OA 3UMGA 3HA7A 3GCWA 4MULA 3JQGA 1U5BA 2VT3A 4AKSA 3IR7A 1GTG1 5KWVA 1P7WA 1O5IA 3VDNB 5JAZA 5AW0A 2I4RA 2UXDB 3FPGA 2RHBA 2WEKA 2ZAGA 4HZUA 4CZ2A 4YP6A 3BMQB 1PWYE 2W00A 1GPMA 5FI3A 3CF0A 5HSGA 2FSPA 1IZZA 4CKYA 3L8DA 1WRBA 5FQNA 1E2LA 1Z8FA 2DBYA 5EKDA 2IH2A 4PO1A 3AHEA 1FPMA 1J2RA 3PICA 2FW7A 1E7RA 1BKDR 4KX3A 4MJ3A 4GMHA 1B0PA 3R5FA 5B58T 3VR6D 3KELA 2UUAB 4LVCA 1SUDA 1WXGA 1XWIA 1RAAA 3E3OA 4FHGA 2D0DA 4O8ZA 2ZIFA 1N36B 1Y5RA 1TAUA 2BEVB 1LPPA 2BMJA 3JRNA 4MO2A 1C7IA 1ECPA 5AVVA 4LGYA 4DR1B 1V2GA 2G1UA 1KIFA 2HJGA 4X8HA 3TI7A 5LFAA 1U0EA 1JJAA 2J31A 2J3JA 3EGEA 2OO5C 1Y1PA 3HUEA 4DZTA 3Q0EA 3QXHA 4C6RA 1HE8B 1WPGA 3Q7PA 2XUHA 2QN1A 2RBEA 3ASVA 4CLOB 5HKOA 4DR5B 4Q34A 4UC0A 1J23A 1FMCA 1JUDA 1T0BA 2WP8J 1P44A 1TQ4A 2ERCA 2XEXA 2IHYA 4TTVA 5DIZA 3RJTA 5AVQA 4RY2A 4WRRA 1PVDA 3COWA 1JTVA 3DAPA 5J4HA 4A27A 4EEKA 2P4UA 5E6UB 1JHUA 1Z26A 3N9IA 2NNWB 3TPZA 2VWPA 2CL0X 1UAYA 1G3IA 1J9ZA 1E2QA 1CUSA 4PX9A 5L3ZA 4CM9D 1EFAA 4Q3AA 2VK2A 3I6MA 2AOUB 3RADC 1E6WA 4CLRA 1U6IA 4YAIA 3LXUX 4JI5B 3P2JA 4PO3X 3WK8A 4REMA 2C9OA 2JBHA 1RAHA 3IKVA 2Z5GA 2FMIA 2FZWA 5DNUA 4OLHA 3X1ZA 3W9BA 4XVUA 5I4IA 4QVIA 2QM3A 1Q22A 3DMPA 3MAGA 3QYJA 4BBAA 1Z4JA 2LKCA 3BGDA 1DBVO 1T2DA 4CXMA 2M6SA 3IAS6 5HXAA 1NRXA 3NNSA 1GRRA 2HHCA 4WJZA 1ZOLA 5BV0A 1VKRA 2ZVJA 3THSA 3K6SB 1F60A 4ZQGA 2RD2A 1FNMA 4K87A 1GZ3A 5TF4A 1FL9A 1HE3A 1N0VC 5K0SA 4HPJB 3KKLA 3T35A 4XM0A 1M2GA 4BNVA 4KUEA 3ACBA 4B4VA 1JIXA 4QDTA 1NUHA 3JASB 1XCJA 3PZRA 1O95C 4X84A 3IUNA 3GO4A 3IT1A 4B3BA 2YC4C 4YJKA 2W98A 2HU5A 1VFPA 4XYLA 2OXCA 3D4OA 3IURA 3NCTA 4LVUA 4GX5A 3CH7A 1SBCA 1WXWA 3FPCA 5ALGA 1N78A 2NZ2A 3HYRA 4ENPA 2H8KA 3WG9A 1YQEA 5AK3A 3ZV6A 4EW2A 2H0QA 3IALA 4ZVVA 3LK7A 5TVKA 1ZHFA 4JELA 2HFJA 1ECGA 5HCNA 1P9NA 2IYOA 3KQTA 3LRXA 4ZI7A 1QMPA 3EBPA 3OOSA 3G9XA 2PU5A 4NCKA 4RD0A 4R05A 4WFQA 4R7ZA 4X8LA 4C6SA 1JHVA 4K9NA 3F6BX 4TV8B 1KSGA 4EMUA 1LNSA 1QLJA 2XE8A 3IELA 2VSFA 4TLMB 2PZLA 1P33A 3TGPA 3HJRA 4ARZA 3QXCA 1PQWA 4RMNA 2YWRA 2ZJ5A 5IBPA 2FFJA 3TIGA 2TMDA 5EA2A 4E6PA 3WGIA 4J90A 4BFUA 3HYSA 1IFXA 4G56A 4JYCA 4R5HA 1E6CA 3DEHA 3GJ4A 2H4JA 3OIVA 4Q16A 4R8RA 4YQYA 4B3DA 2FZ5A 3W8FA 3NALA 4OI1A 4HGNA 3DC7A 3PA8A 3F6SA 2JASA 5DW0A 4HRAA 2XADA 3BD8A 5FWYB 3AEKA 3P2YA 16PKA 4YFVA 1XZFA 4NFYA 1F14A 1DBSA 2QSZA 2AG1A 4JLVA 1NP7A 3IH5A 1GL7A 2ZT8A 3PI7A 1OILA 4NYMQ 5JASA 2GCGA 3BIOA 5BXQC 1D3AA 3GJQA 4M1WA 5LP6C 4GI3A 1UBNA 3WJ2A 2H7XA 3E3NA 4BWVA 2XZOA 4RZSA 4QGAA 1X77A 1CUUA 1FYVA 4EFDA 3F7OA 2QTMA 5EJGA 3QA9A 4RIFA 5G0VA 3TJMA 3N2ZB 3G9ZA 3TSCA 4K6MA 1K5HA 1KDRA 1NYQA 1ITZA 3GD7A 4KSBA 2C8JA 5LA6A 4A5OA 1LA2A 2KLBA 5IJ9B 2E21A 1NXVA 1KPHA 2HCBA 2P2GA 2D4AA 2VRNA 1GCGA 1P39A 3IJRA 3IMCA 5TF0A 3F8TA 4W8OA 2V7UA 2ZDGA 3D3WA 1M0TA 4ZRMA 5IKOA 4YONB 1E3SA 2GKSA 3OQ6A 2VTDA 2Z8YM 1Y82A 1REQA 2ZJOA 1PR0A 3AKZA 4FUQA 5LMCA 1OX5A 1SUWA 1WP9A 1M6VA 4TLDA 5LBIA 2O7RA 2J09A 4MYSA 3D3KA 4C5BA 2JLYA 1QCDA 1C1YA 4HG2A 4LOKA 1CJMA 2NAFA 3DO8A 1PWHA 1YJAA 3ETHA 4EFMA 3KR9A 3WLTA 5DSTA 2WJHA 4Y2JA 3QI2A 1N6RA 1M8GA 5AHKA 2CXUA 4KPUA 3BWBA 4P81A 4ZAFA 3B2NA 1AGPA 1PTJC 5EXSA 1V9CA 3BQNB 3VRHA 2A0WA 3AMVA 4ETNA 5CA0F 2IVZA 4D3SA 3QXXA 5AW4A 1PGNA 2XCUA 3PQ2A 1TLTA 3AZQA 2Q46A 2JAPA 1IJKA 1NNEA 1G7RA 3ZCRA 5MGNA 2FSFA 3ZOKA 3DQQA 3HG7A 1AKRA 3CVWA 4LFAB 3UFXA 4NU5A 3UPUA 1A9TA 4X3PA 2BHRA 1YDEA 2TMKA 4UD2A 1VC2A 3BCRA 5LA6F 1P1JA 4LOAA 3Q87B 5G0WA 1B42A 5HVNA 1PYGA 5CH5A 4BIMA 4XGIA 4FMCF 1VIAA 1DOAA 2X1HA 2VZ0A 4YASA 3HKEB 2NYVA 5FCDA 4KZKA 1FNCA 2JATA 2RCYA 5CM2Z 3I0NA 3NFRA 2ZIXB 3SM3A 1XU9A 1FFGA 2J59A 2F9LA 4E2WA 3H04A 1DKMA 4DCJA 3IO5A 4NH4A 1MIOB 1TAGA 4IIJA 4Q4HB 3KL4A 3ZK8A 5KYWA 3U4AA 1U8YA 4BVLA 4UTNA 4U39A 4CLXA 5CYOA 4JGBA 3O0TA 5B58C 1BFDA 4Q9KA 1X3SA 4IMRA 4RS4A 3BMCA 1KRXA 3G5UA 3VH2A 5B4UA 4FJ0A 4HNTA 1NN3A 1C9MA 2R7MA 3DOEA 4O4LF 4WASA 4YIHA 1XNRB 2L42A 3WOHA 1Z5UA 2BISA 2CF5A 5F7OA 3EW7A 1V4BA 3MWKA 3HSYA 2W6IA 1ZM2A 2DHRA 1LTKA 2EGHA 1XTVA 5AJTA 1QQ7A 4MKZA 4QM7A 2WR8A 1WWKA 3OBIA 4RD2A 2MYPA 1O89A 3NTXA 2VXOA 3Q40A 1SXHA 2OLEA 3ANYB 4TUYB 2H1IA 1PW7A 4HQRA 2IY8A 1M76A 4DF3A 2G06A 3DULA 4O4HF 3QSYA 5EIOA 2G8LA 3OE7D 1ENYA 3BRWA 1QV7A 1MO5A 2F43B 2VHEA 4TLLB 1U7WA 4QFBA 3GUZA 3WLFA 3ZWKA 5EUMA 4JI1B 4L7QA 4OIFA 5D87A 1G2OA 3CLSD 2FZVA 1NMEA 1EJBA 2AJLI 2C82A 4I50F 4TTTS 4M83A 4BNMA 3ZE2B 3F97A 4G3XA 5JYEA 3CCFA 2OCXA 4C0JA 4YRPA 3FMGA 1EDBA 1SG0A 4PY2A 4IJQA 2CE2X 1I10A 1T26A 3FM9A 3MMNA 1PV4A 3WL7A 1EFRA 2I2WA 2I3ZA 3ROMA 3PENA 3QLJA 5J2UA 5HIIA 4KGDA 3RYTC 4H17A 1LDYA 2YIMA 3QVGB 4TXLA 4YIKA 2GS9A 4HN9A 4L08A 3QUBA 4IV5A 4IIBA 3ZG6A 4J03A 721PA 4RY9A 1FTNA 1I7NA 1KYWA 2I6UA 3K1YA 1P62B 1ZXBA 4EPYA 1QH8B 1UMDA 5TS2A 1UPBA 1I3LA 3K9FC 4NCAA 1M2OB 2VDWA 3CV3A 3O93A 1K08A 4AY2A 2HDOA 3FY4A 4YRIA 1E4VA 2GEBA 3NM4A 1QJCA 4H4DA 5EE1A 3AEUA 3H8WA 1J99A 3G17A 3FNGA 3BJIC 3CZ9A 1JPNA 2Q5OA 2VYNA 1R8JA 1Q3HA 3LDAA 3N74A 4IG4A 1JT2A 4LN1A 3RF6A 3K73O 2J0UA 2N0SA 5F9HA 3MJTA 1SH7A 2ZRCA 2QHXA 3FUXA 2PLWA 1MJFA 3BHMA 4OJQA 1J5XA 1F2TA 5KHOC 1GSIA 3COYA 3G88A 1LRLA 1QZTA 2QSUA 2YXBA 1U0HC 4M88A 4QDUA 4G9GA 4ZD6A 1XVTA 1U2TA 2A5LA 5LZ8A 3T7KA 4IV0A 4CMEC 2Q3BA 4BPBA 2JFYA 5DI3B 2I6GA 4JB2A 2QN3A 3HC7A 3KSDO 3JYOA 1QGUB 2KWIA 3QV2A 1SVUA 2QLNA 1RLIA 3DPUA 3GRUA 4MP6A 3SFVA 4CMEA 2PUVA 3H5RA 1F0KA 2IUTA 4DCOA 2WWRA 5IUNC 2JHFA 2R8PA 5IWAB 5U9CA 2FG7C 1GVNB 4LV8B 3OCCA 3NBAA 4N0EA 2XVZA 2PSSA 4Y2GA 1E3DA 3ZY6A 2J9FB 4KP7A 1YCDA 2X9LA 4GZLA 3PUHA 1X7HA 4B6SA 3I2KA 4ZMBA 1I9GA 1VJRA 1QKIA 3ADPA 5HUQA 2B9VA 4DS3A 2AKAB 2FCRA 3NAGA 2HWUA 2CLFB 1DAGA 3DEKA 4LZZA 2ZR7A 1KZ7B 1TX4B 2CLEB 1K98A 1UM8A 4K6KA 1EVIA 3OLYA 4FGLA 3PNOA 4Q48A 1RR6A 1YRLA 3LFHA 4NI5A 4ZDKA 4ZO7A 2ZPUA 4E12A 1GZVA 1E9RA 4S1PA 5FI0B 3HE3A 3KSUA 5EPOA 2UZ3A 4QUIA 3USZA 2VT2A 2V0GA 3NHUA 1T9CA 1UOEA 1A8IA 1NQ5A 2GQ0A 1O0BA 3E7DA 3ECSA 1HDYA 4JKOA 4NONA 1S8FA 4OB6A 4YACA 3SZ3A 4ZFNA 4F91B 4F1KA 1WSWA 2NO1A 4QYIA 5EESA 3L0YA 1D2NA 3IXQA 1TUGA 1K7EB 3EN0A 3HV2A 2FP4A 1Q83A 1OH7A 4D45A 1Y33E 3SEAA 4AYTA 1Y4SA 4PAWA 3QFSA 2FZEA 2YVQA 1VE7A 1HFJA 3MLAA 1YRAA 4QEKA 4B09A 4EJ6A 1KHHA 1RCUA 4HKTA 3D4BA 5CMLA 1U1FA 5K0JA 1NI3A 2AOWA 2ESRA 4EUHA 4MKIA 2YASA 1GR0A 1P8AA 2RE8A 3BRSA 4LZOA 2XMSA 3S68A 2D1QA 2O8EA 1MPXA 3FFTA 4GH5A 4FB5A 3W8RA 2C0CA 2PTHA 3MWDB 4WW0A 5DOZA 4F1WA 2MIIA 2VDVE 3GP3A 1ZM4A 1BXKA 1TF7A 3OZAA 3PS9A 5CB8A 2UDPA 3IV9A 3RAFC 1M8FA 2I76A 4BUCA 1PGOA 3F78A 5BT9A 2JIMA 5KTOA 2WJIA 1XTRA 4O4IB 3A9CA 4P3OA 4WLFA 3DEJA 3O82A 2GAOA 5FEUA 4KO4S 1EGHA 4JLSA 1M1YA 2DM6A 3E5HA 3PPXA 6ABPA 1SELA 1U5AA 5ESXA 2R3SA 3SM9A 1T2EA 5DULA 5DHPA 2VF5X 3N0VA 1HNNA 1UJ4A 4NDNE 1D1SA 1I51A 1MABA 2CXXA 3H5IA 3LLMA 3O73A 1FU7A 1SCAA 2WI8A 3AI1A 3H4TA 5BNZA 5GADl 4LZNA 4Q3OA 2H8GA 3AJAA 3UPTA 3H42B 1T25A 3UF0A 1GNQA 1K7YA 1U7UA 2DWQA 2FR8C 3PITA 4JOBA 3ZHSA 3I01A 1DAKA 4M1TA 2PR7A 4KIJA 1F8FA 1BHSA 1Q7BA 3A4LA 4Z2AA 4IPTA 3P9PA 3RE1A 4AZVA 4JI7B 3AL0C 5EQFA 1ID1A 1VZ2A 1Z2NX 1GY8A 5IDYA 2ZUWA 1DIBA 3JVDA 3PJDA 1XTKA 3EAGA 3DT9A 4TYPA 5ALRA 1NONA 2HHAA 1JHRA 1HEUA 2RK6A 1X39A 3B48A 2OR3A 3S2GA 3U3MA 2XWQA 4BGUA 3CVVA 2BLLA 1PQYA 1RWNA 2DAPA 4M1EA 3QVOA 4PC6A 4QTXA 9LDTA 2PIDA 3PKZA 2NO0A 1UKBA 2PU7A 4J2OA 1E1CA 4EUSA 2BEJA 2FX3A 1AZWA 1Q14A 5IK2D 3LQ2A 1P9RA 3DBLA 1T5TA 3O84A 4FFBA 5D8DA 1UBFA 3KYCB 5EE3A 1N75A 5JZBA 4QOFA 4LW8A 4F8JA 1EWVA 1SM4A 3H1AA 4RVGA 3MOIA 4UJ5A 2R7NA 3NZEA 1K66A 4UU7A 2L69A 5ARBA 3N59A 4KE8A 3G85A 1CX9B 1GPH1 2BBTA 2WTMA 2YWHA 3KBOA 5BN1A 3HY4A 4PS1A 1JHPA 1MQ8B 1SPBS 1YZGA 2ZWOA 3O6VA 2FMFA 2X4LA 4MV6A 5LQCA 2AMYA 1KRWA 4YP0A 2AR7A 2OV1A 3JCZA 2QRUA 3X1MA 4TZ0A 2J0QA 2PD3A 2XZPA 1Y7HA 1YIOA 1WZUA 5A1TA 2SBTA 3EC7A 3OH8A 4URHA 1GADO 1K7FB 1ONOA 1KIMA 2VT6A 3LSYA 3MRSA 4B2YA 4DIKA 4QUKA 5LQKA 3LOUA 4HYTA 4CKEB 1ZFNA 4HV4A 4OFBA 4H2DA 2W4MA 3AOGA 5C1DA 4LI3X 3K71B 3DKIA 1KYTA 4JLNA 5P8WA 4KZPA 4BQEA 2HTFA 5K6TA 4KNYA 1L8AA 1OXUA 1PEKE 2ID9A 2PT9A 1P6XA 3DLTA 2R2AA 4PNPA 4Q1DA 5L40A 2A5YB 3EY9A 3ZBPA 5F2EA 4WAUA 4F4CA 3KHSA 3BTUA 4DJDC 3VZRA 4FK8A 2MR5A 2X6RA 2XQVA 4LWZA 2HNKA 1ZH8A 2QV7A 1PL0A 3A10A 1CR1A 2QRKA 3ZE0B 2QR2A 3IQIX 1E99A 3HKBB 4ND3A 4UM9B 4AL4A 7MDHA 2FUCA 1ODSA 2G5PA 1GN8A 2HAEA 3RAEC 3Q6NA 1E77A 1IM8A 3I0MA 3C3WA 3ET5A 1TA9A 2HDHA 2ZTSA 3NTOA 1OLOA 4A0FA 2AEEA 3PE4A 4RDHA 4WBXC 4FKZA 4B7CA 4H3KB 5ICMA 1CQPA 2CJYA 3FETA 3G5LA 4G24A 4NNOA 4ALMA 5CDSA 5G40A 2CLHB 5AVZA 1HG0A 3A3PA 1MO3A 1KZ6A 2BF7A 4FNMA 3LIPA 4S1WA 3EJ6A 4FLEA 4BO4A 5K3OA 3LHSA 4GRAA 2WTUA 2DX7A 3GUHA 1NDHA 3EZGA 2AI3A 4FGJA 2LR0A 2CC2A 2ZAMA 4UUBA 1JSZA 1KJWA 1RCTE 2ADFA 4Y7DA 3W4IA 1WVGA 3K9QO 1KZ1A 5CBPA 1KYXA 3AJRA 1HC7A 4LC9A 3AYZB 5K0TA 1D7AA 3C7AA 4WCFC 1MP0A 1S3FA 2QWXA 3SX2A 2V4UA 4CUKA 3HVRA 3ZWYA 1R0ZA 5I5EA 2FWNA 1H0RA 2QT9A 2X2PA 3ORHA 3UK1A 3GCGA 3PF8A 2P9CA 2HIHA 4A73A 2Y1XA 1NLMA 1NR7A 2XT6A 1LK7A 1CR4A 1RZRA 1F48A 3ZTYA 3CHYA 1KE1A 4LJ4A 3KLBA 4H4EA 1HFWA 4L6IA 1A9XA 3KZKA 1NBME 2PGXA 3HCCA 4N6OA 5FTNA 4OUKX 4CGZA 2BGJA 3G1UA 4J0IA 5JI2E 4CNQA 1ZK1A 3IHKA 2X8AA 3ZYZA 4P93A 2DFDA 2TYSB 1ZNXA 4JYBA 1G0NA 5CA0B 5G4LA 4BO1A 3BA1A 2O2GA 3TE6A 4MDEA 4M3NA 3HNOA 1HYEA 1U0LA 3W05A 5JYBA 4DIFA 4IOKA 1EM6A 2K87A 3ELDA 5TQVA 2LDXA 3GJSA 2O7SA 4GPD1 1CJVC 1KO1A 4OQEA 3QE4A 3N8DA 1N1DA 3BFXA 1F9AA 1L0BA 3IP3A 2H2AA 3NWJA 4IIDA 1EZ1A 1F8GA 1KK2A 2WU4A 3K09C 1SCBA 1P0IA 3DGFC 3CG0A 1E32A 1Z18A 2I1QA 5E38A 1HM5A 2WINI 1DLJA 1HLGA 2Z3VA 2OQVA 3TWOA 1WABA 3OMWA 5EN4A 1U28A 3WO0A 3ZE7A 4EVSA 2FPGB 2FPLA 2KB0A 2FN4A 3RVPA 1YRBA 2NGRA 5TJHA 4DIBA 2JC3A 4EI2A 4ZAVA 2XNDA 2P9HA 1HDIA 3G8CA 5T8KA 4U8GA 2M1ZA 4HMQA 4OPMA 4QUAA 4IF4A 1UPUA 2CVFA 3HU2A 3SKVA 1EQUA 3IBYA 5D7NA 3WGKA 3NDJA 3WGUA 2GPYA 4FYPA 3VU9A 2O5RA 1K27A 3MFYA 3NGXA 1D2CA 4YREA 1HI9A 4MUMA 4NJMB 4UVGA 3SG0A 1ARZA 1Z39A 1YRWA 3Q3HA 3VSAA 4GVLA 2J1LA 2DG2A 2F1HA 1XRNA 2YRWA 2NU8A 3U1BA 5FLEX 3BE4A 2J9XB 4F7WA 4HFMA 5AK4A 1OD6A 4LF4B 2YQ5A 4JU8A 2XH8A 2QMYA 3E3LA 5CP8A 3QE3A 3UT5B 3Q7IA 5GIPE 3GNQA 4I5DA 2I55A 1CLEA 1FFXB 2XCTB 3WGQA 1FC0A 1NJFA 2BMDA 1ULBA 2CL5A 5E9WA 2V7QD 3INGA 3K53A 4NSNA 1Y9AA 4FNAA 3OZTA 4L0MA 1MH1A 1NMQA 5J1TB 5BXYA 5GP1A 1II8B 1BDHA 4M7RA 3ER6A 4UREA 1EX6A 2FJPA 9LDBA 2REQA 2B98A 4G5YA 5F78A 3ZV5A 3TR5A 4BYGA 3GFPA 3L0ZA 2F3QA 3ROFA 4KIGA 5A0FA 1U0RA 2CLIB 3DE4X 1DAPA 1Z6YA 2BGUA 4DR4B 2OZPA 3F9IA 2PUEA 3ORRA 1FNBA 2CD9A 3S5UA 4WZBB 2WUWE 2ID8A 1G66A 1SUSA 2X15A 3ED5A 3PIIA 5EEGA 3ROEA 1QH1A 2DPYA 2VJBA 4N01A 5I48A 5JZ9A 3GEGA 3AKYA 5DNEA 3SOPA 4AZ3B 2G17A 1LLFA 4GDMA 1YK0A 3B3GA 2NLOA 4RA6A 2O0JA 4XYEA 1GQRA 3AK4A 4XD7A 5FKJA 1ZESA 4NG5A 4IGIA 3UMSA 3D8TA 2JGEA 4K9PA 1PK7A 2QTGA 2FW1A 2DQZA 4HLUA 1UKYA 5HGJA 4F2GA 1RAEA 2Y2VA 2QX6A 1MQSA 3SC2B 4FDAA 4MUNA 3DV2A 3GVCA 1GLNA 2E87A 4JDPA 3SSOA 3P71T 3ZD9A 5JCOC 3UG6A 5HE9A 3MA0A 3C3YA 2IS4A 3ZX5A 1WL8A 4YEDA 4J94A 4UAGA 3I3SR 4WK4B 3RUIA 3GEEA 4NJEA 3ZU4A 4LHYA 5CDFE 3BKWA 5JCOA 4ETIA 5JJCA 1M34B 5JR3A 1KFCB 5T64A 1YFKA 4EH1A 2I4OA 1FYEA 4D6PA 1Q6YA 1W29A 5FB3A 3LY9A 1MGOA 3GLFA 2VHWA 3ZGXA 2YFQA 1R0RE 3I73A 3RRXA 1FW6A 2R60A 5KX5F 4GM1A 4BU1A 2QTVA 4IO1A 5LWHA 4PCUA 2HSZA 4AU1A 2HV9A 4ZMRA 4P31A 5BY2A 4G1UC 5ALZA 5JNTA 4M53A 1XZCA 1ONNA 1RC1A 4EF6A 4BLVA 1DQYA 2W83A 4OA5A 1VHLA 3GP5A 2GOYA 1NHWA 3FSEA 9GPBA 1ZKMA 4J16C 3HDHA 5KQLA 3ZUPA 3DWFA 4IZ6A 3T9EA 4II3A 3GNTA 4YYEA 3MCAA 1GNVA 2V7QA 4BO5A 4D79A 2JFHA 4M0MA 4R68A 5DX8A 3HUFA 3TINA 1U3CA 3K9GA 4BFLA 3ISJA 3UOWA 4CNBA 2NACA 2ZI7A 3ZQKA 1KI6B 3M4XA 1ZD5A 4G5HA 4A16A 2P3LA 4C6TA 2Y4NA 3MPOA 1BXGA 5E1MA 3UHOA 3OIDA 2C8LA 3QKTA 1M6HA 4MV0A 4NP6A 4MR8A 3V6LA 4BNKA 1Z6QA 3AF0A 4JL6A 1L8QA 3PWKA 4YMTA 3AJ8A 3KOXA 4TMFA 2F4VB 4UDNA 3D7LA 4EECA 1PV1A 4EB3A 2O8FA 1YZUA 3NWBA 5KC9A 2X2OA 3HYLA 4I66A 2PV7A 3LNCA 1ZIOA 2WIFA 2D1RA 4ND8B 4GOLD 4TV8A 2QX9A 4MMXB 4TSKA 3ZCVA 4TPKA 4E5DA 4L4YA 1GPUA 1G9TA 1RYEA 1SVWA 1DV2A 4PAOA 3IRVA 5BVHA 4RTOA 4IZOA 2VAMA 2ZIXA 4Y2VA 4Y2XA 2Q62A 3TCXB 2QVZX 4HNSA 2GBPA 1ZUNB 1I3KA 2P69A 2V5VA 5KHLB 4XWOA 3PC2A 4G5OA 1OIXA 1AUXA 4LDNA 4DM3A 1QGED 4I1YA 1Y48E 1E20A 2DWUA 3A3NA 4L3WA 1KVRA 3H2HA 3EX7C 4HXFB 4ZT2A 2GEFA 2V1UA 1FZTA 2FOLA 3RRNA 2A9FA 1IEQA 4I55F 1I3NA 2GEJA 1IMOA 2C4TA 1FPQA 2I7XA 2LPMA 1R0SA 3FPSA 4HLCA 4A92A 3U3DA 1YAJA 1VIYA 3ML1A 3M2PA 3Q11A 2J0EA 4GM4A 3KOOA 1OU4A 2ZK7A 1JBQA 2Q27A 2ZSKA 2V7TA 3ILXA 3QKRA 4UHCA 5A4JA 1G8PA 3F8WA 3ZTTA 1Q7CA 1NBHA 1UKCA 1E96A 3QPBA 4JT8A 121PA 5ES3A 3D8SA 1QP4A 3L06A 3D6AA 5LVAA 1H5NA 4HDQB 1TEVA 3P97A 2CXRA 2NZJA 4RY8A 2XCQA 1WDWB 4MYDA 1AMOA 5HRCA 3WB1A 5JNRA 5ETJA 3OOHA 4CR7A 3SJBA 3ZHZA 1MU0A 4AJPA 1K4YA 2IY7A 3G6WA 4IZHA 4BX3A 4XB6B 4MYUA 5A5GA 2YZMA 2BBOA 5ANRB 3S70A 4NATA 3C41J 4HGZA 3A05A 2B8EA 4MR7A 3EQ2A 4WK0B 4CI0B 4J9VA 2XDYA 3K0AB 3D7NA 3DEFA 4IIUA 4MEJA 4NTZA 4KE7A 1LCIA 1TKBA 2HTEA 4OL0A 1SCKA 1W94A 4AMYA 4BVAA 2BPOA 2B2CA 2H5IA 3BHJA 2CNBA 3VSEA 1RHMA 2BMFA 1D6JA 2QTLA 1RJ9A 3V7NA 4DBZA 4HN2A 4IP0A 4R2HA 1U3WA 3QA3E 4DDMA 4RV5A 1M5UA 3OX4A 2G08A 4ER6A 5HTKA 5DHAA 1LB1B 1XPJA 5C8ZA 3LBNA 2PEYA 4I9NA 2ZQZA 1T2VA 4ZEWA 1J7KA 5E6SB 3RVJA 5TPWA 4MUYA 4YJDA 1ISJA 4PG6A 1S01A 5JSUA 1HDCA 4YUAA 1JAHA 1C81A 2DPLA 4PXAA 1V5EA 1EGMB 3BRCA 5D3KA 1U63A 2D00A 3RB8A 4EITA 3AY0A 1WEKA 3A6DA 5K0ZA 4ZT5A 2OCKA 3QHPA 1RWPA 2OB1A 1FYFA 1K6XA 2IE0A 3RRBA 1DQNA 2W7TA 5B36A 4QUGA 2ENUA 4OYHA 2OECA 3FG9A 3TUZC 1PL6A 1CT9A 4DC0A 1DL5A 3DDNA 1FYXA 1GUZA 1AKEA 1TIPA 1WHTA 4ZV9A 3PYXA 4A0SA 4XUGB 2G36A 1TUIA 5JROA 4ARZB 3U48A 1LF5A 2H65A 2QI9C 2AZMA 5CM8B 1E9AA 5HDQA 3G6KA 2FPRA 2DKNA 3IOBA 1PWXA 3I12A 3IVCA 1OAKA 2VR1A 3A9VA 3KBBA 2WP0A 4Y2QA 5JAMA 4NNJA 2NADA 4ICIA 3CKYA 3ZWQA 5C8YB 1IDOA 2IZ0A 3MJEA 3GUUA 2W9XA 1SHLA 2H2FA 2Z56A 4OV6B 1V16A 3RKUA 4ZYYA 4NBWA 2YV4A 1D9ZA 2CL7X 3VDMA 1GZ4A 1G8YA 1AM4D 4XH9B 4F4HA 5AW3A 1Q2UA 3A6KA 4RL4A 3F5QA 3DZKA 2R5FA 3KOYA 4M38A 1ZK0A 3BGIA 5DHQA 1IG3A 2X9NA 5JLAA 1E89A 2VK8A 4QUHA 2QMEA 2AMVA 1JDVA 1WUKS 1Q0TA 2VHQA 3RWOA 3A2KA 3U56A 2QYOA 4GNRA 5C7IO 2ST1A 4IBOA 2Q0QA 2R1ZA 4G4SO 2DVMA 2HIAA 2EL9A 3E1KA 3TIFA 4OLJA 4NZZA 3EB9A 4MR7B 3V4OA 5F77A 4LSZA 2MDTA 3RKRA 1E5TA 2JZNA 3HU3A 4C4RA 4ZV4A 3ZEIA 4RH1A 4IFTA 4JQOA 2ZG6A 3RSZA 4OQMA 3V9PA 3IVGA 2YFHA 3NWOA 3IDAA 1NJ1A 4LGMA 4P4SB 4B45A 2PCJA 1ESMA 1RQRA 1WV1A 1DINA 3OOJA 4HP8A 1LV7A 3ANXA 4UUAA 3M2TA 5CDUA 2YMPA 3GXBA 4TRJA 4HFJA 1WKCA 1E3LA 1KRHA 1NVUQ 2PX0A 1BQ3A 3EDCA 3OZDA 3PXBA 3BCSA 2C2HA 2ZB8A 3EMVA 3KXPA 4DXAA 1VTKA 1I4TD 1TF5A 1U5CA 3CVYA 3IPLA 1OI7A 5KNDD 2CZGA 4RS3A 4TKVB 2WU3A 2Q5HA 2N46A 3H9QA 3NPAA 1NQAO 1FU8A 4TRMA 4Q1VA 5H80A 5IN4A 1NM5A 3QHQA 1J0BA 5FOSA 4CDGA 4Z7QB 3JQ8B 2NWQA 1W4AA 4Y6RA 3GQVA 1L3CA 4UUQA 3AR7A 4F0JA 3K5PA 3V4VB 3D3JA 1E79D 3W8NA 3HUDA 3KP1A 2GBCA 2X9GA 3N2KA 5H02A 2D5IA 1WZEA 2AXPA 2CMGA 1YWGO 1L3IA 3LWBA 4NAHA 3AUJB 2EHDA 1SU6A 2FRXA 1AVTA 2IE8A 2KHZA 4S1NA 2BHNA 2VNHA 4X00A 3S44A 4TTIA 1BMDA 1XNHA 3C8HA 2XCSB 3KV1A 5KYUA 3W04A 5I5GA 1L4MA 1Z0IA 4I4IA 4UHFA 4ZV7A 3TR0A 2DUUA 3ZLVA 1O8BA 2QZZA 2QTZA 1OF1A 3VR6A 2OFXA 4Q19A 9ABPA 1XK6A 3CG4A 1S8AA 2FX5A 3GIWA 1X1EA 4PG5A 1EA5A 2QNBA 2OGZA 9ATCA 4GPAA 1VSUA 2NPOA 3ABSB 1T5LA 2MINB 3BXXA 2QAGA 1XWFA 3G0IA 3IHWA 3NAZA 3QEKA 4TL7A 4EO4A 4Z1MD 1T10A 4ITVA 4MKFA 2YOHA 4RKRA 1UC8A 3NRBA 1XZNA 2DTEA 3P2KA 3QPDA 3KU1A 5JZOA 4IFEA 1UZUA 1I4LD 1WF6A 2GSDA 3FWKA 3LXRA 4P2GA 3HKCB 4PONA 4V3BA 4MA4A 3JQGB 5BYBA 2IJGX 5K3CA 1B3BA 4L0CA 4WHMA 1BTOA 3DAHA 4BEWA 1PDWA 3A4IA 2PE5A 2ZIGA 4R54A 1H93A 2PKQP 3ZCUA 1UBCA 3KWLA 1DEOA 2ATCA 1J21A 3B85A 2HZ7A 3LLSA 4IHQA 1SCUB 2WWYA 3EUEA 2QVCA 5AI5A 3I32A 1G2QA 2BFWA 2NMVA 2R96A 2AX3A 2XNHA 4JKIA 5EIBD 3L49A 4UVIA 1J1IA 1B76A 3BXGA 3ROKA 5JYCA 4FYMA 4XGRA 2WJZB 1UWLA 3GFSA 2DUMA 4HDOB 4IX1A 1UMBB 3DEZA 1H0SA 1KKUA 1PD1A 5IXSA 1PG5A 1N4DA 1K0FA 1OX4B 1PKXA 2YVLA 3EXG1 4MP8A 4QX6A 2PRIA 3L7OA 2ZYWX 1JNYA 5HJ5A 2ATEA 1QM5A 4NU6A 2V3VA 2XB9A 2CXNA 3DBOB 3ZWOA 4AJ4A 3EIHA 4M54A 1XZ8A 3IKLA 4I1OA 5L6LB 2NP7A 2FDXA 1PGJA 2ONKA 3F6PA 1CF9A 4AJNA 3I2JA 4YAUA 3QOXA 2C9BA 1GRNA 2E7ZA 3E7XA 1RTTA 4ER3A 4R81A 3EJWA 1VL0A 3UFBA 2ZJ8A 1NYTA 3CEAA 3H1GA 3Q1LA 3BZWA 3KKOA 4YRGA 4MI9A 1IC6A 4TWAA 1W5TA 1UJ6A 3ZGOA 1U0JA 2AWNA 5DWVA 2C7QA 3O8LA 1ST3A 2JFBA 1PEAA 4RDIA 1RYHA 5EXTA 3PGVA 2PMBA 3FIJA 1I36A 1UMKA 5DM2A 5CD1A 2G0TA 1MOZA 2XITA 4TXJA 5AICA 2QSJA 1KEEA 2KS6A 3L77A 4OAQA 2G70A 4WBSA 2A88A 3DQZA 3QUSA 4J0KA 1WV0A 1TPZA 1P1RA 2JIBA 2I7VA 3F67A 3IA7A 1S8OA 3OJCA 4MQFA 4OVKA 1VMKA 1TMKA 4BO9A 1J49A 3K2BA 5HF9A 3UTDA 3QITA 4N18A 5AUPB 2BCJQ 4DCCA 2WB4A 1EM8B 3Q2IA 3TZKA 3M89A 1AMNA 2R1UA 4ZYXA 3AVTA 4FYIA 4G0XA 4HH0A 3WHLA 1Q0UA 3C7DB 4RAOA 2JVJA 2OOKA 5B4VA 4LXQA 4PHTA 1XUOA 1U3GA 2GPNA 4CU2A 5AVJA 1J1UA 4LE2A 1ESCA 1A96A 5I8WA 3NOXA 3W06A 2Q2OA 4DIUA 2C1XA 3CEHA 3QWHA 1IK4A 4WZAB 5A4AA 2AF4C 5AKIA 3LH5A 1FMLA 4LDQA 4EJ2A 4AJ1A 1UXHA 4OYLA 4LE0A 5IM5A 1YR7A 3SI7A 3I23A 3W2HA 3RU2A 2FXVA 2LGJA 3CCCA 3GYGA 3FPAA 1VJ1A 5EP1A 4UPEA 5AW2A 1FVFA 1EDEA 4X92A 4ZDJA 3OEYA 3VHLB 4IDFA 5TT1A 3C6XA 4XM1A 4F6RB 5DYIA 1W93A 2F90A 1P0FA 1USVA 4QAJA 4TKLA 5BQXA 4PN3A 2OBMA 1HOXA 4FOLA 4R3WA 5HIKA 2CYCA 3IDOA 5CT8A 1A2KC 1H3FA 3I05A 1YMVA 2X7HA 3UA4A 1VLLA 3BXFA 3ZQ6A 1SWWA 2JCSA 4MDFA 4OQLA 2PQMA 4HATA 4MJ7A 4URWR 3AF2A 3LDUA 4XJSA 4YH1A 1TM1E 3ND8A 2RBGA 4QECA 3PEWA 3E84A 1XXHE 3FLBA 1FFAA 3QHAA 4H7IA 1KI1A 1XMOB 1U2EA 1KBOA 1SKAA 4KCGA 4QO8A 2QB5A 1DADA 2WAAA 2BSXA 2GN0A 1JKJB 3DYVA 2E2WA 3H19A 2P1DA 1NATA 4HUJA 4W6QA 4WKBA 2A33A 2ORVA 3WB0A 4EUFA 5KCZA 2ADMA 3JWGA 4LCJA 2BSQA 4IJ6A 4YCMA 4WI1A 2R1TA 1I0ZA 1JRLA 4C78A 3OEHD 2AR0A 5ICCA 5FR2A 3QJ5A 1T3ZA 1ZJ6A 1O9BA 5IAGA 5JPIA 4F3TA 5HMMA 3IQDB 2AFIB 4OB8A 4LF9B 3HU5A 1D8AA 1YBFA 1O87A 1RFGE 4K81B 5A62A 4QLOA 2Y4OA 3U1VA 4C14A 1LF0A 2YYAA 7AT1A 1NMXA 1VSVA 5GVRA 2JKVA 3O4GA 5YASA 2Y66A 3QKWA 4RHUA 1CUYA 1T8YA 2D3TA 1MD9A 3OT1B 4N5NA 1LSJA 1KAQA 1UOOA 4FHDA 3RS5A 4P08A 1OYOA 5CA0A 3VR3D 2VDQB 4CF3A 4YJ2B 4UM7A 1PBTA 2QW0X 2YS6A 2ZSUA 4E3WA 5IT5A 2Q6IA 1NW9B 3EMBA 5THXA 5IJWA 1FS4A 2NUAB 3OFKA 4UTVA 1YOVA 5KQGA 4AY6A 2CSUA 1QG0A 1L8XA 2XHZA 3SKXA 3VFDA 1LFDB 2R84A 3QJYA 3C2QA 2P2DA 4HPWA 4J4BA 4DCNA 1SZJG 4PC7A 2E18A 3WMFA 2AVDA 4B7AA 7REQB 2Z9BA 4B6OA 5AESA 5CNMA 3K6SA 2HA7A 2J32A 3HDQA 3ZXUB 3UUGA 4BNWA 4F3CA 4EL5A 2EQBA 5EFOA 2OTCA 3WP0A 3UMFA 4B4OA 4UQLA 2H08A 1F2DA 1VLMA 3C15C 3EA5A 1SJ9A 4US0R 5C1PA 2DFTA 5BN3A 3TG2A 4FCCA 1N6HA 5K0EA 2BYTA 1QIIA 4GP7A 3SBEA 1NTOA 5CFPA 1XD9A 2EP7A 4BAGA 1CNFA 4KO8A 3WNVA 4CFSA 1ID8A 2D6FA 1IXZA 1IJFA 5CBPB 3FDXA 4LZJA 1E5QA 4XSHA 1FUUA 1G4HA 1WVMA 2BTQA 2HHLA 2MU1A 3KU4A 3IVAA 2ID7A 4Q9NA 2YWEA 3AFOA 3T5PA 4MIKA 3K5WA 2XVMA 3CEMA 4ZT4A 1PNRA 4MB2A 2QLTA 2V4ZA 4GKVA 2XXAB 4KRFA 2E89A 1B3RA 1ZAKA 4X3OA 1C9JA 2JHAA 3GPCA 2J9YB 3W5UA 1FFSA 2C2OA 1G4AE 6GPBA 3FTDA 3W7AA 1XWWA 2A4MA 4QDOA 2GCOB 4V0NA 3UV7A 4MS1A 5HGXA 3IVRA 4WCFB 1XRQA 1Z7BA 1ODLA 2I4IA 1NBEA 3V5NA 1AS2A 4DNXA 4RVHA 1ZUNA 1PT5A 3KVOA 4AW9A 1H2BA 4S1OA 4KN9S 2DETA 3KXKA 3VR1A 1OI2A 1DELA 2BZSA 1H5UA 4DR3B 4CDNA 3JD4A 4E4RA 2W22A 1EVZA 4N5DA 5DN9A 1XMJA 2Y71A 1L6IA 1CQIB 1XZIA 4AD8A 3O47A 5LQAA 3JQDA 2VHTA 4QRIA 4M46A 4KI0A 4HAZA 2O8BA 2Y76A 4RZHA 4P0PB 1R3DA 4CKBA 4QT0A 1B8OA 4TQAA 4WNYA 4D4LA 3U3RA 2R2GA 4QLAA 3UCFA 1ENPA 4U00A 1CR2A 3ZWBA 5AM5A 3VHXB 1WHTB 2JCXA 5D7BA 1IZ0A 3BB4A 2FN3A 4ENVA 1KIAA 1E9FA 1CCWA 1EH5A 2GNAA 3KLOA 3QTTA 4XIIA 1N0WA 4UE3S 4BNUA 5GV7A 4JLOA 2E4ZA 4CVNA 5JMWA 1TZKA 3EG5A 1C0EA 5C35A 4PRLA 2PSHA 2J85A 3TMYA 4WSOA 3M6UA 2YQZA 2ZUFA 2JD1A 2P5TB 2IYAA 4FFPA 2GVNA 2XYGA 5ECDA 3GFTA 4ZAYA 4DTIA 3L82B 5GQSA 5HYVA 1DDGA 2W8BA 2G1JA 1O4WA 2FPIB 2JKZA 4LUCA 3IE2A 2V0CA 1TRHA 1N6IA 4DIMA 4MJXA 4ABYA 4N7BA 3SYKA 5IZ4A 4BXOB 4OXYA 1EINA 1WAMA 2E9SA 2FR1A 5C5EA 8AT1A 1IQUA 1NZDA 3WISA 1SNYA 2GERA 5FYQA 1ZNQO 3F7TA 1C8BA 2QR3A 4QICA 3WMEA 3MCTA 4U2BA 1C9KA 4ZJZA 2R25B 1DBPA 1WB4A 2XQJA 1AGXA 1T0UA 2ZPTX 5E7QA 1R0WA 2EFJA 3M9WA 1Z5GA 2JHGA 2CNOA 1JEYA 4R1QA 5FUBA 1W36C 4RIEA 3HO8A 3PXEA 3KC2A 5BN4B 3RUDA 4A8HA 3T1HB 2WJVA 4JNKA 3W5SA 1YDMA 3WYBA 1KI2A 1QRTA 1L5OA 3DB1A 5AIAA 1SO8A 4DJFC 4R69A 4DYDA 4YAGA 1NP6A 2YW2A 1E3IA 1EG7A 4AXXA 5JH7B 2G4LA 4WCFA 2X0RA 4J4TA 2OHJA 5K2OA 1V1RA 1OU0A 5DXAA 1W75A 1Y1SA 4WADA 3VR2D 3AM1A 1T2FA 1SMKA 5EKUA 3TCNA 2R0QC 5KS2A 4FINA 1A72A 1W96A 3TQOA 2AMJA 3WGJA 2OMKA 1RT9A 2EBFX 1RXYA 1FP1D 1HE1C 4FOTA 4U3JB 1YZQA 2GCPA 5T67A 2XYRA 4ZEMA 4V1CA 4GRIA 3EEQA 1S2IA 1ZCJA 3L01A 1NE7A 5DCLA 1PK9A 2FJUA 1OI4A 1VLJA 3SDBA 4BTVA 1VI5A 1JLHA 3PJFA 4RKYA 3VJLA 1KJNA 2Z2ZA 5E3JA 5J2TB 1II8A 1M1YB 4EAAA 4KITB 3TLZA 3AIKA 5EJ9A 1USKA 3ELYA 5ALNA 4E03A 2JJ2D 5M34A 2X0EA 5CGQB 3OG9A 4KN5A 4RD1A 3Q3EA 1P3JA 3UHFA 3HCEA 4L5IA 2YYZA 1KK0A 2M2IA 3BBLA 4DM4A 2D5LA 2IYVA 3F98A 3FDIA 4UEKA 5EWJB 1LSSA 1I24A 2R97A 5EVCA 1XEXB 1M33A 2GT1A 3W79A 2NU9A 1H2HA 5BW4A 3WI7A 2Q28A 2I2AA 3K09A 3MINA 3U60B 5D5QA 5EERA 1C30B 2FPPA 5AUNB 1HT1E 4GBED 1EXNA 3RJZA 3CNEA 1U28C 3KWJA 2HB6A 1ZCFA 2GRJA 5EHXA 1KBZA 3M4ZA 5I7WA 1H8ED 3ZWCA 1UIMA 4XGKA 2MINA 4POAA 3SNHA 3H8VA 1FRVA 3QY0A 1FP4B 1PHPA 3LQ1A 5EZYB 1Q0ZA 1CJKC 2PM8A 4OLAA 3PUKA 7ABPA 4QG3A 2EJCA 2NT4A 3TL3A 3NJ4A 2UKDA 4K6OA 2HNBA 3N1UA 3EISA 1Y3DE 2NZUG 3BCHA 3WLOA 4ACBA 4D9FA 2PQ2A 1IHOA 2EZ8A 4QVKA 1D1QA 1A7KA 3FPBA 4C5AA 1XZLA 1F17A 4P0TA 4Z0PA 4U2KA 5JNSA 1E8DA 4N39A 2XLCA 4MX8A 1NXSA 2GCEA 3GLHE 1JLSA 3HZOA 4S05A 4B8WA 1KP2A 4LXIA 1NW6A 2IELA 1XCBA 3TQIA 3PHBE 2H1WA 4FGSA 1PTJA 2GTHA 1CPYA 1SZPA 4GP9A 4NOMA 1COZA 4TL9A 1EK5A 2CDBA 3U62A 4EHJA 1R4ZA 3IJ5A 3QU4A 4K9DA 4DLLA 5IVDA 3JTEA 3L0OA 2BAGA 4N3NA 2QZPA 1UR5A 4DCGA 4U1RA 2DWCA 5FFMA 4JA0A 1G42A 4G6ZA 1GQQA 5LC1A 1YU6A 2W5UA 3TLKA 2EOAA 1QYWA 2LD4A 2R7KA 3WGGA 3OPMA 4CQJA 3MWGA 1ZGGA 1VBKA 1SG9A 4RPHA 4CYMA 1OTYA 4EYQA 4NDAA 1Y8AA 4D9IA 3E15A 3PFNA 4KMRA 2FPOA 2WYVA 5K3EA 4GRDA 2CFOA 4XDHA 2WFLB 3G2HA 4GE3A 2YFYA 1NC3A 2Q2QA 3PD7A 2QX7A 5DGIA 1J2UA 1O96A 3PRKE 2VHVA 3OLCX 3IB6A 3G8DA 2J6CA 1B6GA 5K8VA 1XC7A 5KPDA 4YHBA 5F7ZA 2CFIA 3TTYA 4P7JA 4UHDA 2ODPA 1XDDA 4UCWA 1N5MA 1TK2A 5COQA 4M9XA 4BKOA 3KX2A 1T1EA 4UHBA 1JFRA 4HQ6A 2WAMA 1T1SA 1YB6A 3ICVA 1CHDA 3JAWB 1K8QA 1QO0D 2RGEA 1YCGA 2H16A 2X0JA 2OCYC 5JI3E 3NMUF 2F3TA 2EYQA 1YGYA 2WIDA 1E7YA 1MJ5A 4JSRA 5C1BA 4D0SA 3KB6A 1GNTA 3HQ4O 2Q6VA 4C2BA 2DT8A 1NQUA 3NATA 1RI1A 1FUIA 4WXYB 2HSDA 3T0IA 4IHJF 3FKSA 1TVCA 3RIYA 2EX1A 3LCUA 3CXRA 1YR6A 3V33A 4P5EA 4P7KA 5J2UB 4AY4A 4KR7A 4AT1A 1UPFA 3UMJA 1LWOA 1SKUA 3ORSA 2D54A 2F59A 4D9GA 5TC4A 4LY6A 5C5DA 2PH7A 1DJQA 3KTDA 1ZRMA 4J43A 2CEKA 2E48A 1RQPA 2AL7A 2BP7B 1DPGA 3NHFA 2VUUA 3FN4A 4OMCA 4REOA 2IOHA 4JLKA 1PZGA 3T9DA 2DFLA 2FKAA 2PMKA 3I5MA 1BAPA 2CZQA 3KRTA 4RXMA 4AY3A 4DJ5X 3LXXA 1L4YA 2FWIA 1RWBA 3O91A 4G4JA 3ESAA 1JQAA 4J0JA 4MA5A 5CPBA 2B7LA 3K2IA 3STYA 4H1TA 3SIRA 5CBKA 2QS9A 1TMGE 2R62A 1DAHA 2OQRA 3P9IA 3RHSA 4M22A 3H8JA 2H00A 2YJZA 1E6UA 2G7MC 1CZNA 1U2DC 3GK3A 4OB7A 4QDZA 1ZLYA 4CWAA 5I9IA 2XKAA 3LI2A 2VPTA 6ADHA 1VL6A 5KOJB 1HGXA 1W49A 3OPXA 4IUBS 4O5AA 1C29B 1I5RA 4UCFA 3MB5A 4KODA 5LD2C 1JKXA 5FULA 1HL3A 1J9GA 1QRSA 4ZHQB 1Z8NA 4IDNA 4ZANA 4IQFA 2WKSA 3A6EA 4PQEA 3H2SA 1XZAA 4UHHA 4Z7JA 1FX0A 1QGZA 4GECA 1Z2OX 4ZOLA 4ITUA 5TPWB 2G72A 5EHQA 3TSWA 1WUIS 3FVTA 3CRW1 3MTJA 1IZYA 1CUFA 1NF8A 1XAJA 1ZVKA 4JOQA 4UDYX 3B6EA 3UKJA 2ZWVA 4MVJI 3BMCB 2QR5A 2ZB2A 1BYIA 1J2JA 1NN5A 4HEJA 1R37A 4MGKR 1KJJA 2WDPA 1DC3A 1X70A 2PXXA 2WF8A 2ZE7A 4FS3A 2O06A 4RCYA 3U3JA 5K6RA 1G38A 1DGQA 1OWNA 2I2BA 4WGGA 1XQWA 1GNSA 2B36A 4AIRA 2C7OA 1RPZA 2J7PD 3MLBA 3NH9A 4K9LA 4KKXB 4BNHA 4PXYA 3SJ7A 1I6WA 4GX2A 5IW8A 3IJPA 3M4NA 1GRCA 1JIKA 2WA2A 2COUA 3L8ZA 1G1AA 5TQ0B 3VV2A 1C9EA 5LQUA 4HL6A 3K05A 2FGJA 3MF4A 1TD9A 3KUKA 4F9GA 4ALJA 3W7BA 5JWRA 4RFSA 4K1LA 1WOYA 2B5OA 4IH4A 5ERGB 4R8MA 4TX1A 5I7UA 2CMKA 3OM8A 2OLJA 3SDSA 1JFVA 4G5FA 4PYIA 1QB8A 3B82A 3MS2A 4KXMA 5WRFA 2POQX 1QR6A 1W6UA 3A4VA 4AS2A 5DISB 1ZGZA 1RWKA 1Z2CA 1WCV1 3CNNA 3IUPA 4D9EA 1R6TA 1QNFA 2EW2A 2GFQA 4C0KA 1Q1ZA 2WMNB 1W5FA 2HRZA 4H1UA 4P86A 2N3ZA 2QAJA 3IV7A 1NC1A 4EW3A 3BWYA 4FE3A 3EBOA 3H7IA 2YBDA 2R4UA 1Z7WA 2ZE5A 1HY3A 3JXEA 3AL3A 2MSKA 2KSQA 1U9IC 2X14A 4FTWA 1QYXA 2G82A 4DCMA 2IYEA 3ZDBA 4JHLA 3UEOA 4X63A 1DKPA 2C3UA 1E1RD 1BXZA 3KOWA 1O7JA 3JTMA 2G0NA 4YJFB 1ZEMA 3A2LA 1EHIA 4DZRA 5BN4A 1RRMA 2DPMA 3AONB 4KOEC 4UW9A 1C9NA 4B3IA 1BA3A 4NCJA 4DWWA 4X8MA 1E2NA 4MUJA 4G0VA 3F7MA 5EQDA 1RFLA 3VR3A 1JSCA 3C5CA 4CGYA 4Z2YA 2A9JA 4LHWA 5DNYB 2C2GA 4DV0B 4QDXA 4L50A 1BH6A 1RRGA 2XNDD 1W2GA 4PFKA 4I14A 5SZJA 5CCBA 1YQ9A 1GYQA 1TC1A 5DCUA 2I6TA 2OV3A 1UJMA 3AY6A 4OFXA 4UAUA 5CH8A 3UJ3X 4YY3B 3BRQA 1A7UA 3H13A 1GYRA 2REOA 1GCOA 3GVXA 4ENRA 2XYVA 4W5HA 1J2TA 1IUOA 1V6AA 2IPOA 1R6VA 2QRZA 2GVDC 3HVIA 1LVUA 2H11A 3TOSA 5EMHA 1R3UA 2WSLA 3GQBA 1CQWA 1MW8X 5E7JA 1ACMA 2RHOA 3K1ZA 2GRAA 4FZ3A 4OQ4A 1PJ4A 3STXA 4O25A 3GFOA 2WDZA 5K20A 1H65A 3S1LA 4F5WA 5U1PA 4ND7A 1IAVA 3LGXA 1G55A 4BVKA 4B1FA 2R8RA 5SZKB 2Q2VA 5BYAA 1DEXA 3PNLA 4LEIA 3KSMA 1NOKA 3ZWXA 1II9A 1QORA 5FPSA 1EESA 1O0SA 2VJYA 2BM8A 4CEJB 2RBKA 5COBA 2IS6A 4QOGA 2PAFA 4Y1RB 4K2AA 3MGAA 4MI6A 4S3MA 1MB2A 1Q0QA 2QTVB 2W2MA 1Y8CA 4GGMX 4KO1S 1SU8A 1LW6E 4L3VA 1KOLA 1OFTA 1X1SA 2I7TA 1R9MA 3SZMA 3ZE8A 1ZUIA 4UPDA 1WZ2A 3D4NA 4MW0A 3K0CC 1W85B 3ICCA 5JY6A 2RCNA 3IPCA 4PYQA 1XL0A 4HWSA 1NW4A 1WMFA 4D9NA 3WAGA 5FXMA 1RPTA 3DBLB 1KDPA 2EW1A 4P0QB 1N7HA 3Q2KA 1YS6A 1PRYA 2H4XA 3UIEA 3ZDFA 4DLWA 5D84A 4IGFA 1JQ3A 3MUNA 1WP4A 3GEBA 4CMIB 5BR7A 5F76A 2AEJA 1PW5A 3HVHA 3KFLA 4TLBA 1GKKA 1QHHA 1WOMA 5C32A 1Z06A 3QG1A 4NOLA 5KNLA 1HQKA 1GYPA 3R0ZA 3CR8A 3O4JA 4ZOEA 1SD2A 1ZNZA 5A3VA 4E4TA 3AXTA 3C98A 2EERA 3ZDCA 4CM4B 4BJ5A 3KJZA 1CY7A 3KZNA 2FW8A 3EQ9A 5CNKA 1ECCA 3U19A 2B0CA 3SQOA 2HK8A 3FA2A 2WYIA 4JXKA 1Q5PA 2OC4A 4IMIB 1OZAA 3S27A 5B55A 3JYNA 1IWOA 1U0BB 4AYWA 3BCUA 1R74A 5EHIA 3BSWA 1ZJ5A 3EF3A 3Q5GA 5BWNA 2ZAOA 5JE8A 5I7HA 5IFLA 3NC0C 2X76A 4EA8A 4R9UC 3RSCA 1VKHA 3TNDA 4ARUA 2WHPB 4ZIRA 2F8MA 3IMFA 2IODA 3ENNA 2NXNA 2O1SA 1KPIA 1J0CA 4FFMA 4U0JA 3AR5A 2FVYA 4OKNA 4DWVA 4J7CA 3RYHA 3IPYA 5JSHA 1I32A 2UUBB 3S1SA 4LJLA 4LK2A 4IF6A 4H4CA 4MB6A 2DR0A 4KACA 1ZJYA 3AO0B 4C3ZA 5BN3B 2FMXA 4YMWA 2YS7A 5FI5A 1SC4A 2VAPA 2RGGA 1E1DA 1E9SA 2I0FA 3M8KA 3R5HA 2QE7A 3JVEA 4FR0A 3DV0B 4R1OA 4EZEA 3U13A 1YRHA 2QN2A 3AGPA 5DM1A 3TK1A 4C05A 3DLBA 3OMXA 2GM9A 5DRTA 4EUKA 3ZE9A 1LPSA 2HJHA 3QW2A 4MRSA 1G3UA 2WNSA 1Y7LA 1GR1A 3AHJA 5M04A 1OSNA 2C78A 4MYCA 5K99A 2R48A 4HB4A 4FI3F 3G02A 2GN1A 1W4RA 4RD6A 4XIFA 2ZXUA 3I1YA 1MX5A 1HPLA 1B2RA 1Z63A 2NUAA 3EDOA 2ZRFA 1V25A 3I0ZA 2W2VA 1CS0A 4QTTB 1BW9A 2QL7A 3LT2A 1RXVA 3R20A 2VS1A 1CKEA 1ZUD1 3FCEA 3MRTA 1JLLA 3MT0A 1GZ5A 1I1NA 3OAAD 4N8EA 3P4UA 4IVNA 3SR4A 3WIEA 4C4ZA 3CUUA 4KXWA 4CM9A 4HY3A 4FLMA 4OATA 3AG6A 3PFGA 1LLCA 3R6WA 4WOPA 3W9YA 3P9XA 3FUTA 1GGVA 1QHHB 5HIJA 4PG4A 4G9EA 2H1VA 1SA0B 3HN7A 4TKMA 5AT1A 4AB1A 2ZRQA 4CMIA 1NBIA 2BGLA 3HDYA 3VV3A 1OC4A 5A06A 4HD8A 2FZLA 1V11A 1VIVA 2VBFA 3AJEA 2FWJA 5HM6A 1OV6A 5AQEA 3GLGA 4AURA 1FW8A 2RGWA 2YDXA 4DT1A 4DLZA 3U26A 3AFHA 1PG0A 5KYTA 1R5BA 3R3YA 1XKXA 3UC9A 4GHWA 4DMHA 1RHJA 3TLCA 3NKVA 3IQGX 3DFKA 2X9VA 4H6XA 3EVZA 3QBTA 4DY4A 4OL9A 3MN1A 5BQPA 4BGVA 2CWDA 2IXDA 4CF4A 4DLVA 4P4TA 1U31A 4N47A 2C5EA 3PWTA 4IDEA 2PGAA 2EGUA 3I58A 1CDDA 3DAGA 4CTMA 1E3WB 2J3DA 2VPPA 3DOJA 2FZCA 3L0CA 4Q05A 2ZSEA 4HX9A 4RORA 3USCS 3KJNA 2LP4Y 4G8DA 4HMOA 2QDXA 5FTWA 2B5VA 2YCBA 4MVJP 4ENQA 3CF4A 2JFGA 2EG9A 4J8PA 5BSMA 4O4HB 1ZXLA 2PNJA 2PD4A 1TC2A 1IHDA 2C29D 2FW0A 2HREA 5EYPB 4BKRA 3R9WA 4QRDA 3KHKA 4Q7EA 1T36A 4G26A 3EXIB 4OMDA 3NO4A 1J70A 1YASA 1KSJA 3M5PA 1BS1A 1NRIA 3ELUA 3PLAE 3Q72A 5CLIA 3KR1A 4I9GA 4UBNA 1C0IA 1F2TB 5DYYA 4R9VA 1F7UA 5CB4B 1J6UA 2UVQA 5DH9A 2IV7A 1HMYA 3TRFA 2BM0A 3JQCA 4QHTA 4K0RA 1WB5A 2XPCA 4K86A 3ETGA 4CCYB 2Y1FA 4XQEA 1R6UA 1SQ5A 2LV8A 3C74A 1E2FA 2HMWA 2QW1A 1UBOS 2H2WA 2O8VA 1R8QA 4XB1A 4L5YA 3B9QA 4DC9A 1YHNA 3HXPA 3FOWA 3H9BA 3PTZA 1Z4NA 2FG5A 2VDJA 3L8CA 4YJHA 5EWLB 1L5KA 1QE0A 5IBRA 3HA5A 1BVUA 2CNWD 3MUFA 4N9WA 4YAEA 1Y3AA 3SLKA 5JAOA 5IKPA 5C3MA 3ZV3A 4N7MA 3UH0A 4QPPA 3BJZA 3MTEA 1DAFA 2FLKA 4W5NA 5BV7A 3NHAA 4LNAA 1M54A 5B1EA 2CZCA 5T8KC 1ORDA 1NLZA 4B6QA 1GG2A 5BQFA 2IDKA 3KB2A 3X0DA 1DIHA 4Z49A 3LZCA 2YXLA 2JJYA 2RI0A 3WYGA 3DJFA 2IY9A 2AEMA 4XVQA 1UDBA 2HA3A 1EVYA 4ENWA 1XK7A 3RAPR 5MN5A 2X7XA 3LUPA 3O90A 5FOXA 2D74A 4MSUA 2JLCA 3OZSA 3U09A 1P9LA 1UMBA 1FSPA 1PD0A 1Y7TA 5AKHA 3BA6A 3DT6A 3REQA 2P2CA 1XT6A 2WICA 2WILA 3K0FA 4NARA 3HV0A 4PCAA 2WFAA 4E7PA 5DM70 3AM5A 3A37A 4FOSA 4RABA 3IEVA 2CWWA 3PNMA 1VPWA 3ITNA 1N8SA 1OXBB 4LYJA 4TOIA 1JEAA 1KDOA 3UOGA 4IMJB 5KDDA 1VSBA 3NIGB 2HLDA 4MQUA 5A05A 5LYJA 2H59A 4C6HA 1JYEA 1E2KA 4TWBA 4OP3A 1ZI6A 2Q4TA 4I55B 4DLAA 2VRCA 3SZRA 4UD6A 1FP7A 4V02A 2V7WA 5KYYB 1G98A 3R9XB 2WMYA 3C45A 5J4LA 2QDKA 4HGQA 1C9YA 4B2IA 1UDWA 1JDJA 3D8RA 4IVQA 3MTDA 4CL3A 4GI2A 2EWMA 5FWDA 2RHWA 2XMDA 2H9YA 1VJ0A 5HQTA 3L6OO 3W5IA 5KOHA 4L76A 2PX5A 3WYNA 1KOGA 1GGJA 1HG1A 1E6MA 4NG4A 3P0EA 1YI8A 3ESQA 4RKEA 3HCWA 3SS9X 1EX9A 4MQMA 2CLLB 3W2FA 2DBZA 5L7TA 2EU8A 3ACCA 1GRVA 3FZEA 3WB2A 9MHTA 1LH0A 1MX9A 5CG1A 4A23A 4AJJA 4DUYB 2BZ1A 2PWBA 3SWWA 1F8UA 2A1IA 2QJOA 3C3XA 4MV1A 4QBTA 1NJ5A 3HJTA 1S2OA 2CLSA 2IUUA 3PJGA 5L95A 1P2VA 1PT9A 2ZSBA 3K1AB 1N5KA 2UVDA 2TECE 1W2HA 1USIA 3OU6A 5CIYA 3DBHB 2FPXA 2IEBA 3PKIA 1KJQA 2PGNA 3ER9A 1LC0A 2A5JA 1JT9A 5KO2A 1GPAA 2BD0A 4ZYLA 2HPZA 3IESA 2FW9A 2BFAA 2ZATA 3QUAA 4N6NA 4ZZIA 2G09A 3GZNA 1NVVQ 3DYBA 4RF5A 3UTCA 5AVTA 1MABB 3AVQA 4QZVA 3M34A 1OH8A 3E53A 1QV6A 4O59O 1VCHA 3OA0A 3ZS9A 3KJGA 5KPJA 2NTVA 1K5DA 1K9SA 2PZBA 1LBSA 2NVUA 2H48A 2MJLA 3N86A 4JI2B 2AJCA 4F4UA 3OIGA 1M0WA 1Z83A 4G0WA 1RRVA 1CJUC 4ID9A 3ZDXB 5I3CA 3G0HA 3PQ8A 1L8OA 3RSHA 4YRSA 5IJXA 2VAWA 2PRZA 4WPGA 3FNEA 3INNA 5L3SA 3PXAA 1BU5A 1OTHA 4FQ5A 1I7LA 1DQRA 2HJSA 4OI2A 5I45A 1E0KA 1GZDA 2IKSA 4J6FA 3I1JA 3QEMB 4BVGA 1QHSA 4TXHA 3DZCA 1XJ0A 3KQNA 1ISFA 1JR4A 4Z1MA 4ZGGA 2VH1A 3IGFA 2GYYA 4DDVA 3L43A 2B2NA 3H5LA 2DHEA 4WINA 2V03A 5LPNA 3MIIA 3LWZA 4YRBA 1NE2A 4PPNA 2R7AA 4BV3A 1DKUA 1KVTA 4IRMA 2I1WA 5F73A 4Q12A 1WHSA 3RHFA 4ZK6A 1QS0B 5DLPA 5KB3A 4K0KB 4GX1A 2FQYA 1ATZA 4ARCA 4XRGA 3A70A 1GFIA 2B4QA 2CHQA 2WFLA 3AJ9A 1JJVA 2CNKA 2PH3A 5FD8A 3L1IA 3WWYA 2GPAA 4ZTBA 5TARA 2M98A 5IM4A 3I53A 2ZRHA 3K70B 3NTRA 3R1IA 2ZRDA 4KIUA 2BFPA 1CEEA 4BNGA 2VP2A 2VL7A 5ICSA 1KMIY 2WTAA 2AFHE 2EYUA 3KEMA 4OGWA 3VC7A 3PBKA 1R0LA 3VKGA 3FCYA 4LWOA 4CIVA 1BFKA 1YJXA 2QTWB 3FCUB 3HGQA 4TYQA 2O5EA 2NXEA 3FXAA 1ICEA 1R4AA 5CRIA 4ZC8A 5H4HA 1RQXA 4L8YA 4EKNB 4AM8A 3S6JA 1KQ3A 2DFKB 4W7HA 3LC7O 2ZYTX 2OZVA 1L4EA 3F3KA 1F3LA 3MAJA 3QTLA 4Q9HA 2OYCA 4DE5A 4NENA 3DFFA 3PD0A 2CYBA 2KX7A 3O74A 4PX5A 4YMUA 1MKYA 3AR2A 4C21A 4ZGBA 3LQQA 2XBMA 4QJ5A 2JGDA 3FSRA 2H4YA 1WG8A 2JHCA 2Y1OA 5SYNA 3PEYA 4X24A 2Z9CA 3URMA 1TL7C 4HWRA 5BOSA 1NIPA 1FUYB 4FMDB 4PYLA 2Z2YA 3O21A 1P7VA 4MRPA 4LY0A 3NX4A 2PLRA 5GZ1A 2VG8A 4QODA 1HDEA 1MNQA 3RBAA 1WX1A 4WNCA 3VR5A 3ZCQA 2MYTA 1SBIA 1FP4A 1XN1A 4BNIA 4UNRA 1NDQA 2DKOA 1KI4A 4JIGA 3PNVA 1OX6A 1QVRA 3LCRA 3TM4A 4CTNA 4EHBA 1XEWY 1YDFA 3KQVA 4RGYA 4W8HA 1J0EA 5ENVA 3ZE1B 3OTHA 4D98A 2HYIC 2G07A 4RANA 2XGJA 2AN3A 1OFUA 1VL8A 1U1GA 2C1ZA 1NDUA 2EG5A 4H59A 4MWGA 3Q9UA 4NCIA 1ZM9A 4OK6A 2X1MA 3G68A 3WBFA 4KYTA 2E3JA 4NE2A 4U7PB 1UPXA 3RUHA 4LFBB 2XNJA 3H1FA 1E1CB 3JD2A 3P0FA 4TN1A 2VWQA 5P21A 4EKIA 2P9QA 2BFCA 4YRJA 3EGVA 1A82A 4BECA 1M6WA 1N5DA 2ARKA 5KVQA 3E5NA 3L93A 4EHIA 2ZJ4A 3FRIA 3EODA 3VKFA 1L5VA 1NVXQ 2OPBA 3OCVA 1NG1A 4FW8A 4DA8A 2GZDA 3N0RA 4XGQA 5EIFA 4ND5A 5CK4A 3WNQA 1DWOA 5KQMA 1WB6A 1ZA1A 3UW1A 2QD4A 5J9FA 3NI2A 5B6IA 5JVDF 4RTQA 4B47A 4KH0A 3LX8A 5ALYA 1Q7RA 3MAAC 4XFKA 3KZOA 1G21B 3G2NA 4MQ4A 2C4VA 3LVBA 1T13A 1UK9A 1VXOA 1W0KA 3KHUA 4MPRA 2ZAYA 3O95A 4LECA 5C8VA 1I2ZA 3O3OB 2PKEA 4RK5A 3RUAA 1K86A 1WXIA 4E70A 2O3SA 3ESCA 4XARA 1UOQA 1YNOA 5LXTB 3K7EA 3GT3A 1KJZA 4PZ9A 1N7JA 2VO1A 4JSYA 4ZOLF 3PXGA 1MX1A 3CLVA 4G67A 3ED1A 1BCRA 3QXJA 3B3FA 1KQPA 1U98A 2JI6A 1AV6A 1ISSA 4Z3OA 4BZQA 4EGSA 1JNXX 1R0CA 4MPTA 4L2IA 3DT8A 4EATA 2AZXA 2I2XB 4TV9B 3TLGB 4WWHA 2TS1A 3KOMA 3UJBA 2W8ZA 3DTTA 4QG7A 2O2EA 4QXMA 2YN0A 2C92A 1XLVA 3TPCA 4ALLA 2VP0A 4BRUA 1L5HB 3QTBA 3KVRA 2E4UA 1WSDA 2PZ8A 3NEYA 4DQVA 5LD2B 4DUGA 1NF3A 2H17A 4K1XA 1KYIA 3L8YA 1XAGA 2QUJA 2R85A 1HWYA 2YRFA 4JB0A 1EFLA 4QOSA 5LOVB 4JMLA 1GPYA 5BUZA 1LPOA 4E15A 2JEYA 3VA7A 2O07A 1N92A 1EX7A 1NY6A 2QY6A 1VXRA 4G4IA 1MF7A 4BWGA 1OFGA 3O92A 1YJCA 2VEDA 1RIIA 3B6IA 1E6EA 1N6PA 3ILYA 2UUPA 5K05A 1PUXA 3QE9Y 3IMEA 5CU7A 1H69A 5AVXA 1KQGA 2GCNA 3G2IA 2A9PA 3Q6MA 3IVMA 3EMDA 1U8FO 3SR3A 3WTCA 3QSGA 4X7PA 1CJTC 2EFYA 1YACA 4FGKA 5LB2A 4I36A 1DLIA 1U90A 4M6WA 2GDJA 3MBIA 5JBIA 2FP3A 2QROA 4PYRA 1X7WA 5FFNA 2O7QA 5B3AA 4BMPB 5LDDC 5MF6A 1K0UA 4PRKA 4B17A 2YWDA 3GL9A 3RBZA 2GXAA 1AURA 5CCDA 4DDUA 1G5RA 2IEIA 1IOVA 4UARA 2GLTA 1TXGA 3X3HA 3BIWA 3MJFA 2ZT5A 3B6KA 3KVVA 1RHRA 4NBTA 3SNKA 2SHKA 5MN6A 4MP3A 3L4KA 1YMQA 3A2MA 1E2UA 1AUPA 2X8JB 1D6SA 4PWZA 3RSOA 5I6DA 2BFNA 3BSYA 3M70A 4QUEA 3BL6A 1Y0BA 4QPZA 3KKNA 2XMBA 4GOXA 3GN1A 5CVUA 4GQIA 1Y4UA 5IH7A 3VPHA 1NVMB 1L5ZA 4WESB 5K3BA 4O2RA 1H0HA 4KLAA 4DLKA 1BGXT 4R31A 3AERA 2PZEA 1TCVA 4FEGA 3HBLA 1AKVA 1LX6A 1V2HE 1V26A 2NTNA 2X6TA 3K3PA 3GW8A 2NXJA 2WC1A 3KWMA 4RADA 1JPJA 5TMBA 3WZ2A 5C52B 3UBTA 3VBEA 1G16A 3GAMA 3MD9A 2HBQA 4Q4DA 3VNBA 5KC8A 2AD1A 4KWEA 1TZ2A 3U7GA 4L8FA 3TDKA 1NWCA 1P6UA 1P4JA 2BKAA 5EPUA 1U8UA 1KNQA 5CT9A 1FSZA 1G7CA 1IE3A 3BWVA 1W581 1W30A 4UU0A 1W19A 1BDMA 3ZJYA 1C3EA 2K4MA 3QVUA 4CCYA 4HRXA 1R0XA 3CZQA 1F51E 1NNUA 4FPXA 5E1BA 2J30A 5LA6B 1WO8A 2PTGA 1G6HA 3U4HA 5KVVA 4B80A 2ZCUA 2WIKA 4M49A 2V7EA 3OZRA </