3WSVA

Crystal structure of minor l-lactate dehydrogenase from enterococcus mundtii in the ligands-unbound form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
312
Chain Sequence
MKKTSRKVVIVGTGFVGTSIAYAMINQGVANELVLIDVNQEKAEGLDGMAWGEKNVSVWSGTYEECQDANLVILTAGVNQKPGQTRLDLVKTNATITRQIVKEVMASGFDGIFVVASNPVDILTYLTWQESGLPASRVVGTGTTLDTTRFRKEIALKLAVDPRSVHGYILGEHGDSEVAAWSHTTVGGKPIMEYVEKDHRLEENDLTVLADKVKNAAYEIIDRKKATYYGIGMSTTRIVKAILNNEQAVLPVSAYLNGEYGEEDIFTGVPSIVDENGVREIIDLSITPQEKAMFHQSVSELKAVLDTVRLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
publication title An alternative allosteric regulation mechanism of an acidophilic l-lactate dehydrogenase from Enterococcus mundtii 15-1A
doi rcsb
source organism Enterococcus mundtii
total genus 100
structure length 312
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wsvA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3wsvA02
4I9UA 4YDRA 3D5TA 5G0VA 3WB9A 3PXXA 3RKUA 5KJCA 2EJWA 4PLTA 4PLZA 1CERA 1I2ZA 2CD9A 3NRCA 1E0DA 4GVLA 1X1TA 3DDNA 4MDHA 5LDGA 3ZV5A 3FHLA 4NR0A 3VOSA 1SEVA 1DFIA 3C1AA 2IODA 2WYUA 1X0VA 4EI2A 3TFOA 3TNLA 1M75A 4CUZA 4OJNA 4EUFA 5FF9A 4MO2A 4L73A 1K2WA 4HFNA 3HN2A 4TRMA 1XA0A 1MX3A 4CM7A 5TF4A 1DO8A 1UZMA 1A72A 3OEYA 3LC2O 4TRJA 4E2YA 3KETA 1L7DA 5CDYA 3HFSA 1H6DA 4EUEA 4XQCA 3UF0A 5FI3A 5AXCA 1I0ZA 4GH5A 2O50A 3VTZA 1P1RA 2AEFA 2G1UA 4IQGA 2D0IA 3Q2IA 3H9EO 1VL8A 3V1UA 3WMXA 1RPNA 1K0UA 3B20A 1A71A 5JLAA 5DNAA 1P31A 2P5UA 3K96A 1AHHA 4YVFA 1EBFA 5I7VA 5CPFA 2X0RA 1DRUA 2DBVO 2CDBA 2JD0A 2BGMA 2Q4EA 3RCBA 3L4BC 2AQIA 2NADA 2WTBA 4A10A 3CUKA 2EIHA 3LQFA 4CPDA 3WGGA 1B26A 3GDFA 4EDFA 4Y67A 3B6ZA 2VCYA 3AM5A 2VT2A 4D7AA 1OOEA 4G5HA 2YV1A 2B36A 3S8MA 2VZ8A 5AXBA 1B8VA 3ZI0A 2H9IA 2AQKA 3BHJA 2AMFA 1FJHA 2GZ1A 2NSDA 1GEEA 4AJJA 4CR7A 3E9NA 4QECA 4NFYA 1QV7A 4D42A 1S6YA 5U4QA 1DXYA 4NU5A 2FOIA 4L0QA 4DTIA 1T4DA 1VL6A 2VHXA 1KVRA 3DZIA 1ONOA 3C7CB 5ENVA 3HE3A 1QYDA 3WGQA 1AHIA 1XLTA 4LW8A 4YWJA 4DL9A 3H2ZA 4XYMA 3AI2A 5GMOA 4L4RA 3NTRA 5B4UA 4BVAA 4XEHA 6LDHA 3W8DA 1E6WA 1PS9A 5IAAA 1E3WA 4E21A 2V6FA 2CF5A 2E49A 1NHGA 3IC5A 1E7WA 4HWKA 4ZVVA 1LI4A 1DIBA 1I2BA 5HBRA 1ZO8A 1I3LA 4TRNA 3ZV4A 1CJCA 3KYBA 3OHSX 1XGKA 3Q2KA 2CNBA 2AE1A 1QXSA 4U8GA 2Q4BA 1PR9A 2JCXA 3DZHA 4XYEA 1VJTA 5DBGA 2OP1A 1XKQA 3M1AA 4FOOA 4UVEA 3Q9UA 2R2GA 1GR0A 4UUPA 3E6AA 3O26A 4BKUA 4CLXA 4DIOA 2WE7A 1PJ4A 3OQBA 3DAPA 1DBVO 2E48A 2YFHA 4RV9A 3BHMA 4DRYA 1ZFNA 3G0OA 5TRTA 2OHXA 4R9SA 2WE8A 5KJ1A 2FPPA 3JQ9C 3UHAA 5C7IO 1R0SA 4CR6A 3C3XA 4RLHA 3CMCO 3GNQA 2OGUA 1ZCJA 4W82A 2HK7A 1I24A 4XYLA 2PWZA 1XG5A 4H16A 4UULA 3B70A 5FFFA 5T67A 2PK3A 3ENKA 1LDNA 2GSDA 3KBOA 1HKUA 4Q9NA 2Y0CA 1ADCA 1X15A 3LC1O 1U5AA 3O8QA 4ESOA 5C7LO 3VVCA 3ZW8A 4BO7A 3GZNA 4RVUA 4OM8A 1IYZA 3QA9A 3BMNA 1GFSA 3FWNA 3OIFA 4YAKA 3JQEA 4NFHA 4Y8VA 2B69A 4YT2A 5LDHA 5EJ2A 3UCEA 4C4OA 1DC6A 1ULSA 3DBRB 1TLTA 3ZU4A 2VOJA 7ADHA 1CETA 1OC4A 5ADHA 3SEFA 4CQMD 1UP4A 4HP8A 1CQJA 4P4GA 4MPDA 2OL4A 5T8KA 1XEAA 1UDCA 4BNZA 4CV0A 3U49A 5L40A 1NVTA 4H7PA 2HDHA 2O4CA 2WYVA 5KVVA 1LRLA 4PG7A 3RKRA 3GVIA 1NR1A 4MVJH 1YXMA 2X9GA 1OAAA 3F9IA 3I9NA 4K6FA 3UH1A 5HM8A 1GUZA 4I5EA 2EKPA 3K30A 5JAIA 4CM6A 1PGNA 4N54A 4YJHB 5EERA 2YDYA 1A9YA 1XIVA 2LDBA 4FSHA 4R4JA 5JO0A 1NFFA 3KEQA 4WK6A 3RSHA 3JQFA 3JD1A 3IIEA 2G5CA 3C8MA 3TL3A 2GCGA 4LN1A 2BKAA 5EIOA 3A1NA 2QW8A 3RUEA 3AOEC 1QYCA 4DWVA 3I9MA 5K0ZA 3OETA 4R69A 3UGKA 2E37A 1UZLA 3WWZA 1O0SA 4Z9YA 3U3XA 1Q2XA 2HK9A 3JD3A 3PJGA 1AE1A 4IZIA 3ZWNA 3HDHA 4CJXA 3QVXA 1EK5A 1F12A 5EMHA 1B0AA 2ZYAA 2OBNA 3R3SA 3VAZA 4RORA 4GGPA 4TROA 3KYDA 1MC4A 1A4IA 5F1OA 4NJOA 3GEMA 3KSUA 2NTVA 4BKOA 1V3VA 5A06A 1V6AA 3BMQB 1SCUA 3I6IA 3DBLB 4PLCA 4AL4A 1YJQA 2GN9A 4BNYA 1EZ4A 1JN0A 1QRRA 4BKRA 4F3YA 1KETA 2VYND 3HDJA 3ZWWA 5DOZA 3GMSA 1C1DB 3ZHBA 3P19A 5JCXA 5A3JA 2TMDA 1XQ1A 2PZMA 5EL0A 3F5SA 4NPCA 3UUWA 2O2SA 2PKQO 3JQBA 1GAEO 1WP4A 1Z82A 2IE0A 2JD1A 4KTVE 4BGVA 1ZEMA 1U1IA 2BMAA 4GWGA 3E18A 4RVFA 2DLDA 1WDMA 1LDEA 5L51A 3VTFA 2BGLA 2NUAA 5TIIA 1GDHA 3HN7A 4FJ0A 1LDYA 1YO6A 3GHHA 3I1JA 3NEPX 3ABIA 3I9JA 1R0KA 5MDHA 3UVEA 2H63A 1ZMOA 2Y67A 4TKMA 3CPSA 1VJ1A 1KEWA 3C1OA 1I01A 1UXGA 2EW8A 1JVSA 3ICCA 4PG6A 4RCVA 4FGWA 4OXKA 4BO3A 4MIEA 3K31A 3C24A 1RM5A 3DMTA 3GUCA 2X22A 1DIRA 5GZ3A 1YBMA 2VYVA 5HRUA 3QY9A 4FS3A 4RPKA 1F8GA 3IUSA 3U0BA 4S3MA 3DBHA 3LT4A 1ML3A 1O8CA 2Y1EA 4JJIA 3ITKA 1I36A 1LQUA 1H9AA 3ZW9A 3AY7A 4YB8A 2PY6A 3DZKA 2CUKA 1V8BA 1X1EA 4BQRA 1C14A 3EVNA 1HEUA 4YJFA 4C7KA 2JHFA 4LK3A 3K73O 4IS3A 3PJDA 5B37A 4CR8A 3PI7A 3P2OA 5A3VA 2VZ0A 3JYOA 3V2GA 3EW7A 1D1TA 3JQGB 4PZDA 4FFRA 2C5AA 3UICA 4BUCA 2UYYA 3C85A 1Y8RA 3GUYA 4OMUA 3QV1A 1P74A 3DFZA 4NBWA 2DTDA 3ZNOA 4FR5A 4GMGA 4IGFA 1FK8A 3GGOA 4ROSA 1B8PA 1LDGA 2BELA 4L75A 3NJ4A 3GY0A 1Y8QA 5EPOA 1BMDA 4M55A 1ZEJA 4IMRA 3W8EA 4GLOA 2V6BA 1TT5A 1RYDA 2Y1CA 4KMSA 4W99A 4RPGA 1H5QA 1EUDA 1LDMA 2DT5A 5K6AC 3ZCXA 2EV9A 2J5RA 3SX2A 1DJQA 4R41A 4YAIA 3WGHA 2GASA 2P9CA 5IN4A 1ISJA 1E3SA 4AJKA 4WCFC 4QQRA 1HETA 3F1LA 3UW3A 4YA6A 1RJWA 4PCVA 2ZTUA 4TKLA 4YJGB 2PGLA 1EBUA 4Z9FA 4ZRMA 2C2YA 4RGBA 3I6QA 5L95A 5F1PA 4RL6A 3D0OA 1VSUA 2ZIZA 3KM0A 2GDZA 3MTGA 5JC1A 3ETEA 3GDOA 3JQ6A 2EGHA 5G4KA 2UUOA 3PZRA 4M87A 2J5KA 3RD5A 3HFGA 1KC1A 2PLAA 2A92A 2FPGA 1S7CA 1MC5A 4DQXA 4Z3DA 1C1XA 2X0JA 1UDAA 1PGPA 2C7VA 1GQYA 3D3WB 4EEXA 1N2SA 1WDLA 3EVTA 1U2DA 1E5QA 4RPLA 2AXQA 3KEOA 3LYLA 2Y66A 4XR4A 1NHWA 2XAAA 3PHGA 4CM1A 5I7EA 5T64A 3V8BA 4XIJA 4DYDA 3BMCA 1IHYA 2ZB4A 3EHEA 4ZHSA 3TF5A 1SOVA 1IHXA 4FQ8A 1PQPA 2I5PO 2RIRA 3CINA 1Q7BA 3FPCA 3NX4A 1P0FA 5JAMA 1SO8A 2BH9A 4IQ0A 1A9ZA 2Q1UA 2AA3A 3D4OA 1EK6A 1WZEA 3DTTA 3INTA 3S1LA 3WQRA 2VWHA 5I7FA 4Z0PA 5B4TA 3LF2A 3WX0A 1VKNA 3GNTA 3VDRA 4A26A 4BMNA 1HTBA 1GU7A 1NX6A 2Q2QA 5L4NA 3OP4A 3QWBA 2I3GA 4FBGA 2PD3A 3TWOA 5IN5A 2IDZA 1CWUA 3VKVA 5CDGA 3GAZA 1IB6A 3E5MA 3X2EA 5DCWA 2POQX 1JTVA 3WYBA 2F1KA 3WGOA 2V6MA 4BL5A 3OF2A 1R4MB 1L7EA 1NWHA 4NZ9A 1KYQA 5IDQA 4Z0TA 3DEYX 3GT0A 2BFPA 2NU8A 2YJZA 4U5QA 3QW2A 3VPHA 4D0SA 4BNIA 3TRIA 3QVSA 1T2DA 2UUPA 4W4TA 2JFGA 1YVEI 4QFDA 2JKVA 3LF1A 4FCCA 3KLPX 1HLPA 4RVHA 1JAYA 4IS2A 3SBOA 1MFZA 3MZ0A 2P2SA 4CMCA 4GLLA 5A03A 2EWMA 4CM8B 4E31A 1EFKA 4OXNA 4CMEA 3ZZNA 5JE8A 4X54A 4DQUA 1XSEA 1YH3A 4D3DA 3BAZA 2DU8A 3AUUA 1IE3A 1JKIA 1K3TA 5I9NA 1QLHA 4WLVA 1PJ2A 4FJ2A 1XCBA 1E3IA 1YQDA 4B3JA 3FBTA 3DB2A 3RWBA 2FZWA 3VDQA 4DGSA 5TLSA 3RFXA 4R16A 3EK2A 1ADBA 4HFMA 3WSWA 1VL0A 3HSKA 1YOVA 3LC7O 3PPIA 3UN1A 5L4SA 2CF6A 3RIHA 5KVCA 3CZRA 1PQUA 4R5MA 3OQ1A 5KTKA 3ZV6A 3F46A 2P9GA 4ILKA 3KRTA 2BFAA 1ONNA 3F1KA 1AXEA 5KWEA 5DCYA 5LC1A 5CEJA 3RJ5A 3KYCA 4RDIA 3GF4A 1ZUD1 2W90A 2WD7A 1YKFA 4TVBA 4EJ6A 2OORA 3AUAA 2VUUA 3ZNPA 1JU9A 2GR9A 3N7UA 4JNKA 3NYWA 3DHYA 1QG6A 3GVHA 3ROKA 2NWQA 3U5TA 1F8FA 4BGEA 4MJLA 3WNQA 4AJEA 2FPIA 4GMFA 2X5OA 4I5GA 4J16A 1GPJA 4ND5A 2J3IA 5DCUA 3WQQA 1M6HA 3DR3A 2ZK7A 4N7RA 3EAGA 1J4AA 3DL2A 1VJ0A 2EERA 3GG9A 1QR6A 4UEOA 3G1UA 4BKQA 1ZSNA 4RF3A 5ER6A 2FR0A 2CVOA 4EUHA 3AY3A 4OHUA 2I9PA 1DAPA 3K5PA 4IXWA 3D4NA 3G3EA 4NHEA 2X7HA 4XYBA 3LT2A 5JFOA 1H93A 3JQ7B 2FHSA 3GQVA 2NQ8A 1E1KA 4KQXA 1LLCA 1LTHR 4GKBA 2NVUB 2HKIA 1OI7A 2UAGA 3KSDO 2VQ3A 3OJEA 4OOEA 4P4NA 3S2GA 4CLEA 2D8AA 2ZYDA 3KLMX 2BFOA 1T4BA 3ZN2A 4WCFB 2UV8A 2Z1MA 1I30A 1SMKA 4RF4A 5COQA 2V6GA 5T5QA 3WSVA 3ZHZA 2G82A 2IZ1A 1W0CA 1BW9A 3LDHA 5JPIA 3DBVO 1ENOA 4CM4A 4BNJA 1P9LA 3H9JA 4NBUA 3RBZA 3WS7A 3KO8A 3N74A 3LT0A 4TVOA 4J9VA 4BO2A 1KBZA 3Q0EA 2QG4A 4UVIA 3ROMA 1JLLA 5T8KC 1GQ2A 4CMIA 1E1LA 2FY8A 1Y1PA 4GBJA 1J6UA 2QRLA 4BNTA 4CM3A 1DHRA 4CQMA 4LVCA 1HDOA 1VM6A 1HSZA 3T4EA 3VKUA 3I4CA 2XPCA 2Y68A 4RVGA 4NK4A 5ILGA 5I7SA 1IPEA 2EF1A 4ZQEA 1U4OA 4BNFA 3WJAA 3OSUA 2HAEA 1V35A 1U5CA 3FCOA 3E9MA 1QORA 1PS8A 3NTOA 1BXKA 4B3IA 4QTZA 1YGYA 4R3NA 2W2LD 4FFNA 3H65A 5CG2A 1Q7CA 5I8ZA 4CMHA 1ZXLA 4LMPA 1LX6A 2VOEA 2RBEA 2O3UA 2Y1FA 4TQGA 4Q3AA 4CV3A 3JQFC 3JD0A 3MOIA 4BO0A 3IOYA 5IJZA 5CDTA 4XGIA 2YHIB 3AM4A 3E1KA 4ZQGA 1YDEA 1WNTA 1T2EA 4O63O 4S1VA 3WTCA 4CLDA 3F3SA 4J7UA 1PU2A 2X9VA 4KOAA 4CV1A 1IZ9A 4Z3KA 4E5MA 3JV7A 3CXRA 4E12A 5HS4A 1EEHA 2JFFA 2X4GA 4Y9DA 2Q46A 4NI5A 2DBRA 3SLKA 1EDZA 3IKTA 3MCVA 4D3FA 3PLRA 3FR8A 3GDGA 4DMMA 1NASA 3JD4A 2HK8A 1Z74A 4BKPA 4G65A 2A9FA 1B15A 5CHEA 6ADHA 1R37A 4FW8A 4R1SA 1E7MA 1M67A 4E5NA 1ULUA 1EE2A 1E92A 2HU2A 2VNAA 4FIZA 1WPQA 4A03A 5COBA 4DIBA 4RJTA 4D0RA 4WLNA 4FFOA 4IPTA 1K6JA 4Y6PA 1UR5A 4MVJI 4EBFA 5F5LA 4BNMA 5CEEA 3FR7A 2FZEA 4ONEA 1R6DA 4GL4A 1U3VA 4UVGA 4EW6A 3W1VA 4R01A 2BFMA 2PZJA 3T7CA 5A02A 3ANLA 4O5OA 2DBZA 3OJLA 2VYNA 4I9NA 4ZJUA 3JQBC 1X7DA 4D46A 5JW6A 4BO1A 4L4XA 3LK7A 1HF3A 2JAPA 1SBYA 2RAFA 2D59A 3AWDA 4DBVO 1IL0A 3IS3A 2A35A 3WICA 4PLFA 1QYXA 4BGUA 3EMKA 3OM9A 1LEHA 1EMDA 3MJ4A 1GCOA 1J0XO 1X0XA 2FR1A 5T6BA 1P33A 4M8SA 2VWGA 3ONEA 5H83A 3QP9A 3NV9A 4DREA 2WWRA 4CQLB 4BB5A 3HB4X 1LLQA 4IDGA 1I10A 4HUJA 1V9LA 1F06A 3I9KA 3NT4A 5ITWA 1LC3A 2D3TA 5C37A 4ZU3A 1LQTA 4UVDA 5THKA 2O3JA 5A05A 3W6UA 1KVTA 1B8UA 4MVJD 3WJ7A 1Z7EA 1NR7A 2P5YA 4QO7A 1SEPA 1N1GA 3JYLA 4PN3A 4UEKA 4L4SA 5G0WA 3TZ6A 3ETGA 4FFPA 2ZB7A 4H3VA 1NTOA 4HFRA 4KP7A 4DPMA 1PQWA 2RCYA 1PJCA 3GEDA 2NLOA 3OH8A 4OOFA 4J3FA 1QV6A 3RUFA 2X5KO 2C5EA 4UUMA 3QIVA 3M2PA 3R3JA 4CLHA 3FNEA 2AQHA 3VC7A 4YT5A 1OBFO 3ZNQA 5JXWA 3DZJA 1Q0LA 2CVQA 4YT8A 4HNHA 4Q3NA 1V3UA 3FSRA 1P1IA 1NFQA 1PGJA 4FD3A 3PQDA 2ZQZA 3ASUA 4DLAA 1PR3A 4FOSA 3MJEA 3GA0A 1TI7A 1U3TA 2EKQA 3NT5A 4J2OA 2B5VA 4I9HA 4NMHA 1K6IA 1Y5MA 1HZZA 2QZ9A 3FBGA 4WOKA 1E7SA 1K6XA 5TC4A 1GEGA 3GN2A 2VHWA 3ZHXA 1E7QA 3MJVA 3PK0A 5FEUA 1GD1O 2YV3A 3QVWA 3W4KA 4LVUA 5JBIA 5AQ1A 1XHLA 3FTPA 4WCDA 4UREA 4BNWA 4TMFA 1HZJA 2B35A 1X14A 1YQGA 4ALMA 1C0PA 1WDKA 3C7DB 4NK5A 2O2YA 3GMDA 1KEUA 4R3WA 3PFFA 2YZ7A 1L1FA 4AJ2A 2Y0DA 3GVCA 3JQDA 3DBRA 2DM6A 5H82A 4P22A 4YRBA 2R00A 1FF9A 2DTEA 2O23A 4ZICA 1DFHA 3AUTA 3L0DA 1E1NA 4GSLA 5IXSA 4UUNA 4I8XA 4XWYA 4A27A 1IULA 3DAGA 1RM4A 3MJSA 5BNIA 3TN7A 2EEZA 5TX7A 3OBBA 3OIDA 3AOGA 4L76A 4ND2A 4BIIA 1R4NB 1J49A 1KOLA 3GAFA 3ZNNA 1ADGA 1Y9AA 4JROA 3PIIA 4BOYA 1KY5A 3FPLA 1EFLA 3D4PA 2X86A 1PZFA 2DPGA 1TEHA 1I3MA 4Y98A 2FRDA 4D79A 4EYEA 5CDSA 4Y6RA 4Z0HO 4ALIA 3WGTA 3W6ZA 2ZATA 4FFMA 4M1QA 4OGWA 4YJHA 4WJZA 4MVJE 3IMFA 2BI7A 3FRJA 5EN4A 1UP6A 2RH4A 4UAGA 3LU1A 2J3HA 2I65A 1X7HA 4AJIA 4J6FA 4AJ4A 5JDCC 4OO3A 4Q3DA 3I23A 3MJCA 2I99A 4AJNA 4IINA 2V65A 1MA0A 3GPIA 3L4BA 3UOGA 4MVJM 4WLOA 1T24A 1W6UA 3V1YA 4NJMB 4JQCA 2PGJA 1MFPA 5A9SB 3W8FA 1HDCA 4LRTB 2WJPA 2B4TO 4BNHA 1DIAA 4XCVA 1GUFA 4ID9A 3WBBA 2PH3A 3OECA 4C7JA 1U8FO 2DPHA 4PG4A 3JSAA 1I32A 4N5LA 2VUTA 1G6KA 1P0CA 2EHDA 2HCTA 2Q99A 3AW9A 3H4VA 4CMKA 2PH5A 3ONDA 3ZWCA 5L4LA 1MUUA 3EC7A 3HUDA 2WEKA 3LLSA 4OKIA 4YQZA 3RFTA 5TS3A 4ITUA 2B4RO 1W73A 3FWZA 1DEHA 4HV4A 1Y81A 4BO4A 4WE3A 3ANNA 2OO5A 1WZIA 1N9GB 2NU9A 3NDJA 5BSFA 5B4VA 3QQPA 3GRPA 3BMQA 2X8LA 4GKVA 3VH4A 2GN8A 1PJTA 2FSSA 3DBLA 5B1YA 5IF3A 3L77A 1ORRA 1ID1A 5IDXA 4B79A 5KKCA 1ENZA 1TA4A 4JBGA 3PJEA 4E33A 1XDWA 2D1YA 4MP3A 4E5YA 4F6CA 1C1DA 4CM9D 5IZCA 3TL2A 3UCFA 5EESA 4RF2A 1VPDA 3HHPA 3AFNA 4R54A 4IDEA 1HDGO 4L8VA 5KVQA 2J5QA 2AG8A 2ILTA 3NDRA 2NNLD 4WPGA 3JQ8B 1BVRA 4E5KA 5B12A 1LUAA 1YRLA 1Y6JA 3PGJA 1TXGA 2O3RA 1EE9A 3OFSA 1D8AA 2QYSA 1VSVA 2BGKA 3U62A 2Z5LA 4GWKA 3H2SA 4OSPA 1LLUA 3QSGA 4YBZA 5IZ4A 4J1SA 3HJAA 3BTUA 3PP8A 4UUOA 3S2EA 3GHYA 4K1LA 3QHAA 2P68A 1U28A 4U0KA 4B3HA 3ANMA 1I33A 1NM5A 3WOHA 4IIUA 1YBVA 3H6KA 3U4CA 1HYEA 4HNGA 1LU9A 4RQUA 4J1QA 1VE9A 3S2FA 2ZTMA 1ZSVA 3KB6A 3D5QA 1Q7GA 1RKXA 2W2KB 5BQFA 5JCJD 1LNQA 3G49A 1BWSA 4R68A 5DZSA 5BNTA 1YDWA 3BMOB 3I83A 2VRCD 2O7SA 1CRWG 1KIFA 2HUNA 1PJQA 3WMWA 5JY6A 4ND3A 3ICPA 4NNJA 3CMMA 2EP7A 2PGDA 4QT0A 1HRDA 3JQ9A 4GSKA 4RO0A 1Q1NA 4J91A 1BDMA 3W4JA 2I76A 3BHIA 3I4FA 4BNUA 4U0JA 3JQAB 1PIWA 3T7EA 2I3AA 1O95A 3BZUA 2GF2A 2C82A 3ZWBA 1V0JA 5A04A 2PD4A 3DQPA 3EDMA 3LVFO 4TSKA 2GLXA 3GG2A 4LSWA 2GGSA 1JVBA 1HYGA 3E5RA 4JLWA 1Y7TA 2XXJA 1FXSA 1F17A 3FNGA 1JWAB 2WSBA 4CMJA 2JL1A 4B7CA 4CM5A 1E7RA 3R1IA 4AG3A 1YQXA 3JQGA 4E6PA 1NVMB 1PX0A 4H15A 1MGOA 1ZK0A 1NYTA 1WXDA 3V5NA 4ALLA 5BSEA 1XQ6A 1ISIA 4CLOB 4E2XA 2ZTLA 3WXBA 3CIFA 4R9RA 2NU6A 3PYMA 3KVOA 3SC4A 2X1HA 1GQQA 2Q1SA 2Y05A 1DLIA 3ZWMA 3BYZA 4A0SA 4CMGA 2Q3EA 4B7UA 4A2CA 3RJ9A 4G2NA 4YRDA 3HDYA 2R6JA 4R5HA 3WYCA 1P1KA 3GPDG 3QWHA 1G0OA 1H2HA 2FMUA 3MOGA 1HSOA 1Y9EA 1GL3A 2XF8A 3S2IA 2P91A 5BT9A 3WYEA 3RC1A 3DHEA 3GEGA 5JYEA 3RUIA 3CKYA 3TSCA 3KHUA 4MKXA 5F21A 5CG1A 1C0KA 5CP8A 1NPDA 2Y99A 4RZIA 4NU6A 4J43A 5GY7A 4B4UA 4L74A 4J0FA 1XELA 4EZBA 2ZJ0A 1ISMA 4BNGA 1Z45A 1CF2O 5G2OA 4YJGA 1HYHA 1ZK1A 4XIYA 3QVTA 5TJHA 2PFGA 1F14A 1DC4A 2WYWA 3STHA 5CEFA 2CMDA 1UXHA 3JQCA 4U6QA 2BF7A 4TZKA 1LLDA 2H5LA 4XGKA 5F3RA 3Q11A 4EJMA 1MLDA 3I9OA 4QFCA 2Y0EA 3PHIA 3DZGA 3PQEA 3ZHYA 1GZ6A 1D7OA 1BXGB 3DOCA 3IUPA 1PL7A 3OIGA 4BMSA 2GO1A 2NTJA 2GN4A 3COSA 3F4LA 3GH3A 2ZYGA 2W2LA 1VRWA 5TNXA 2IYOA 2ZCUA 3FD8A 2HRBA 3D3WA 4YQYA 4D45A 5A9RA 4OQYA 3RC9A 1WMBA 4B8WA 2VTDA 1UH5A 4FPXA 3I3OA 1FDTA 3E9QA 4FC7A 1UXJA 3IP1A 4RQTA 4UEJA 2HMSA 4NBVA 1PSDA 1T1SA 4JJGA 3KUXA 2UVDA 5L45A 2C20A 4JN6B 2YY7A 1KEPA 1PTJA 2G17A 2SCUA 4PIVA 5K9ZA 3DZBA 5I9LA 1RYEA 1ZK3A 1PGOA 4DA9A 3RC7A 5FI5A 2A4KA 3ASVA 1SB9A 1D4FA 1YS4A 4TZTA 4B4WA 3DC2A 4M86A 3I5MA 5DP2A 3GZ4A 1IOLA 3OICA 2YV2A 2ZB8A 1KVUA 2FR8A 1PGQA 3ZU5A 3S55A 2C2XA 5DULA 2GZ3A 4II3A 1W4ZA 4PRLA 2DUUA 2RH8A 2OXIA 4LISA 1R4MA 2NQTA 4DXHA 4QSMA 3KOUA 4I1IA 1P1FA 3O03A 4EEZA 1LRKA 4NDNE 4XJSA 4MIYA 1F0YA 2GRAA 1ZMTA 3AJRA 1YOVB 1T2AA 1FDVA 3RBXA 1C3VA 3ZWOA 5DBIA 5HA5A 3SJUA 4CM8A 1D1SA 4Q39A 3AU8A 4DYVA 1T2FA 3FI9A 3PHLA 4MP6A 3GVPA 3G17A 4MKRA 1B7GO 2Q50A 1O5IA 4IMPA 2O3TA 3MEQA 3TQHA 3ZWVA 4DPKA 2ZB3A 3U9LA 5F1KA 1D3AA 2E6UX 2IRWA 4ZQHA 2Q2VA 1EVJA 2GN6A 5G0TA 1H6AA 4DC1A 3RVDA 4WEQA 1H0KA 3GFBA 1LC0A 2JJYA 3DAFA 2VZ9A 4MKZA 4MOWA 4OSOA 4CMBA 4BNVA 4IDBA 4IY1A 1IPFA 1ZH8A 3U09A 2HJRA 3HZZA 4PLYA 4CL3A 3UFXA 3OJFA 1Z75A 2X23A 5AOVA 5AYVA 1ZKMA 1RWBA 4W9NA 1QP8A 2AEJA 1QKIA 1HE4A 4XRRA 3FTNA 3UCXA 1GADO 3ROPA 1DRWA 1TT7A 4R1TA 1BTOA 2BHLA 1O94A 4WGGA 3JQAD 2W8ZA 1UAGA 2ZQYA 5G0UA 1BDBA 2DFDA 4BS9A 3OJ0A 1LBEA 1ZJZA 4MVJA 1NVGA 4XA8A 3B1KA 2GZ2A 1Z7BA 1I3KA 4AJOA 4J9UE 4CLRB 1H2BA 4IDFA 4GGOA 2HLPA 1U7TA 3VPXA 2WMDA 2ET6A 1HE5A 4RDHA 4K9DA 2YW9A 4M54A 1SNYA 2J3JA 3ZH2A 4PLPA 4WASA 2GPTA 2CVZA 4J7CA 3HDQA 2PV7A 1SZJG 1AXGA 5JSFA 8LDHA 2QRKA 2JCYA 1PJBA 3RASA 3T4XA 4D44A 4F46A 4YYZA 4ZN6A 5L53A 3JQ7A 3VZRA 3CE6A 3PVZA 2OOSA 1VKOA 1PZHA 3PYLA 2RHCA 2NVUA 4D3SA 3BXXA 1ZNQO 4INAA 4F45A 4BO6A 1GZ3A 2NM0A 1NNUA 4XYGA 1DPGA 4WCFA 3H5AA 3VVBA 4EITA 3DZFA 2PKRA 5G4LA 2CFCA 2OZPA 2QYTA 1K89A 1N92A 1WWKA 4JP2A 1XWFA 4GAEA 4WEOA 2VUSA 2GERA 1U3WA 1UJMA 4J4TA 1I8TA 1BVUA 1EVIA 3ZV3A 2C7GA 2VWPA 2IZZA 3PHHA 1LSOA 4ALNA 2E82A 2A94A 5L7YA 2R00C 4BV9A 4WUVA 1IY8A 2QRJA 2W98A 1LDBA 3A14A 3ZWPA 3QVOA 4AVYA 5HTOA 3MTJA 3DO5A 4KDFA 4KWHA 1I5RA 2YUTA 3KZVA 4D41A 1YL5A 1KC3A 1AN9A 1VI2A 4L9RA 1QYVA 5A9TA 3GNSA 2BD0A 3RUCA 5KIAA 3PJFA 3H9QA 4O6VA 1LRJA 4PZCA 2F00A 3DFUA 5L3ZA 5TQVA 1YB1A 5DP1A 1H9BA 1WLYA 3M1LA 1DB3A 1GV0A 1U2GA 4JBIA 3K2BA 2D4AA 3D3EA 4M49A 1H6BA 1QMGA 4YEDA 3L4SO 1ISGA 1E3EA 3NTQA 3PDJA 4YPOA 3QWFA 4MINA 2G0TA 1DSSG 4PZEA 2NTNA 1N8KA 4CL8A 4DUPA 4OIMA 5CAEA 2O3QA 2QX7A 4KUHA 4RPJA 4ZGWA 3R0IA 4FC6A 3NKLA 1DIHA 1UZNA 3P5SA 3QE3A 1JQBA 4FJ1A 5DN9A 1ZIDA 3TZKA 1DLJA 2EXXA 3E82A 3DWFA 1B14A 3IKVA 1YBAA 4P8RA 4J4BA 3FN4A 3G1TA 3VH3A 3DTYA 4PLWA 2YHIA 3RI3A 1X7GA 2QQ5A 1YL7A 2H1SA 2H6EA 3FNHA 3HQ4O 4KQWA 4B7XA 4CV2A 4PGFA 3ST7A 3WTBA 1G0NA 2J3KA 2I66A 4QUKA 2JD2A 3WGIA 1YB5A 3VPFA 5U1PA 1DC3A 3BTOA 5DDIP 4IZHA 4AJHA 3PWKA 1GY8A 3RU7A 5DT9A 3D64A 2PZLA 1R12A 4E30A 4B4VA 2B0JA 5KNLA 5BSGA 5HS6A 4BGIA 2HSDA 1MP0A 3PYXA 1UAYA 4R1NA 1E3WB 5JS6A 3PGXA 4RVSA 3U4IA 1U3UA 1B2LA 5A5FA 2NU7A 2I67A 4AFNA 2ZTVA 4J49A 3GR6A 2C29D 3INGA 1N7HA 3K2EA 5ICMA 1LSUA 1PZEA 5JDIA 2CDAA 2D5CA 1ADFA 4WNCA 5IFLA 4E3ZA 1NQAO 2GNAA 3PQFA 5IZCC 3FF4A 2OBYA 1BSVA 2Y1OA 1PWXA 4DIFA 5ICSA 1IZ0A 4QO8A 3A06A 4YRAA 4K6CA 1X13A 1FMCA 4CM9A 3QWIA 2AW5A 3H9GA 4BNKA 5FWNA 4TWRA 2QHXA 4QXMA 1ONPA 3DMTC 5FYDA 3GGGA 1LA2A 1ISFA 2HMVA 3KV3O 1LXCA 2G76A 3L9WA 3H9UA 4IM7A 5JMWA 2HQ1A 2P4HX 1Z73A 4BHTA 2X6TA 3JYQA 4JX8A 1GYRA 4WLFA 1VLLA 2JHGA 1KY4A 3EGOA 4WOJA 3K8ZA 4CQLA 3G79A 2AHRA 3JD2A 3P2YA 3O9ZA 4HFJA 2JAHA 2D5AA 4OAQA 5A1TA 2WM3A 4IBOA 1RM0A 3O8QB 4XJTA 1VC2A 2EKLA 5JCJA 1DIGA 1JKJA 4N18A 3GZNB 1YJ8A 3ZWAA 2XXBA 4ZRNA 3BMNB 3WFIA 2VRCA 4YT4A 2J6IA 2AG5A 3CEAA 3H8VA 2Y1DA 3ZU2A 5GZ1A 2ZCVA 1KEVA 3H7AA 2PA3A 2I6TA 2TMGA 4JIGA 4BNXA 4WLEA 3VZPA 4YACA 3C1TA 1R16A 3AFMA 3GLQA 4FDAA 2IZ0A 3AY6A 5A5EA 3GK3A 4HX5A 5IG2A 3VPSA 1BGVA 1WW8A 4Z9XA 1PJLA 1UDBA 3N58A 3UAGA 3MWEB 3ETDA 5I8WA 1UP7A 3AK4A 3RROA 4E13A 1UXIA 4QX6A 1WAMA 3QJ5A 3WGZA 4O0LA 4I08A 3K6JA 4D43A 1CEQA 2Z95A 2VT3A 1TVEA 2PKQP 3RUAA 4M89A 1NPYA 2W4QA 1NPTO 5ER9A 4DVJA 2AQ8A 4Q3CA 2BLLA 3IDSA 3TOZA 5ILOA 3IJRA 4GX1A 4K28A 4BNNA 3BIOA 5KVSA 5C3MA 2DFVA 4RZHA 3HG7A 1ENYA 4RPHA 4XRGA 4OQZA 2EJVA 4GQAA 3H3FA 3Q3CA 4YTEA 4XQGA 3K9QO 3LLVA 3ZU3A 3R6DA 4JCOA 5MGBA 1BG6A 2OMEA 4J1NA 4XD2A 4Z6KA 2O48X 3DMYA 4BMVA 4ZD6A 4IGEA 1MV8A 4AJ1A 5BSHA 1FDUA 4Q3BA 3ENNA 4MVJP 2O7QA 3TDKA 3WWYA 1GYQA 4NH4A 4RF5A 1PS0A 3JYPA 3EZYA 9LDBA 4XKJA 3DHNA 1B3RA 1E7YA 3JCZA 4ZQBA 2Q49A 2Y93A 3KXDA 1R4NA 3BA1A 3WR5A 2B4QA 3ADPA 1ARZA 4NG5A 4MP8A 5L9AA 3KYDB 5F5NA 3E03A 3RFVA 1EQ2A 2PTGA 5BNFA 4YAEA 1E77A 3F4BA 3GVXA 3OA2A 2X58A 2HMWA 5TT0A 1GZ4A 1EVYA 3NDIA 2HJSA 2EGGA 4A73A 2DKNA 4BO8A 4AJPA 3ADOA 3GFGA 5JNLA 2AEMA 1NFRA 3I52A 1GUYA 1M2WA 2ZJ1A 3NJ8A 1EUZA 4WKGA 3ON5A 5KJ6A 2VHYA 4PG5A 1Y5RA 3Q9NA 4XGNA 4XZ3A 1T25A 3OA0A 1BRMA 4XQ9A 2DC1A 1P45A 3W4IA 5DF1A 4LCJA 3SC6A 2X0IA 1OZAA 3AM3A 5JO9A 3ZWXA 4KTTE 4R51A 1SB8A 4HADA 2GUGA 2Q45A 4NJMA 2IEDA 3IJPA 4G81A 2IXAA 5A9SA 1U9JA 4ALJA 2FSVA 3D1LA 4YR9A 4XB1A 1I2CA 1CDOA 2EG9A 4E5PA 2PZKA 3DONA 3CH6A 1B3BA 4P38A 1HL3A 2NV6A 1HE2A 5BR7A 3UXYA 4E2ZA 4XR9A 1ZK4A 1T1RA 4N5NA 1NAHA 4IJUA 2UDPA 3MWDB 4BB6A 4CMEC 1E6EA 3PFWO 4OKNA 3L9XA 4IUYA 4PLHA 2HMUA 1N9GA 1XYGA 4NIMA 1QSGA 1A4UA 1EVZA 1W8DA 4NFSA 3LT1A 3X2FA 5CPBA 4OXYA 1ZXBA 3ZWYA 3QWAA 4GX5A 1RM3A 1R15A 2GYYA 4YAGA 1HE3A 2IEBA 4PLVA 2GD1O 4YXFA 3INRA 3OMLA 3DBHB 2PD6A 4IQ8A 1JA9A 1U8XX 4PVCA 3ROQA 8ADHA 5EQFA 3A28A 2C07A 5JYDA 1MXFA 3QLJA 1M76A 3D7LA 1PL6A 3OEWA 1T2CA 3VZSA 3V2UA 2QZZA 3A9WA 3P7MA 4RLSA 1NQ5A 1R66A 1CQIA 1JKFA 4N5MA 3JQ8A 3E48A 2Q1WA 4YJFB 5JMPA 3WQSB 1I3NA 3WIDA 3WFJA 3MJTA 2IXBA 2EW2A 4I5FA 2IYPA 4FB5A 5DOVA 5C5IA 4W6ZA 1PJ3A 4NBRA 1MG5A 4IIVA 3ITDA 4J90A 3DXFA 3EYWA 3HB5X 1Y8RB 1KS9A 4W7HA 1GTMA 2D2IA 4IXTA 3U4DA 3WBFA 3AU9A 2JCVA 1NQTA 2PNFA 2VNSA 1N1EA 2X0NA 3O38A 4IDDA 2W2KA 4URFA 1SPXA 3JYNA 3E8XA 4JK3A 4AJLA 4E0BA 3AI1A 4W9NC 2B37A 1NP3A 1H6CA 3BMOA 5JAZA 5JC8A 1P1HA 1MB4A 5I9MA 2J8ZA 4EJ0A 3GOHA 2QIOA 1KVQA 3KSZO 1Y8QB 1DJNA 2C59A 2YHUA 1BHSA 2FN7A 2YQ4A 1P44A 1TT5B 3LZ6A 3NT2A 3PRJA 1WMAA 2DBQA 3AI3A 3RUDA 3WLFA 1R0LA 4WNIA 1A7KA 2HO5A 1T26A 3VZQA 2C0CA 1O89A 3JQAA 4YAJA 5L7TA 1ENPA 2DAPA 1HLDA 1M66A 3EY4A 3GRKA 5G0SA 1ZZEA 4KZPA 1LJ8A 3JTMA 3K92A 3UKOA 1DAOA 4J1TA 7MDHA 3OJOA 1KVSA 3CSDA 1OMOA 4KWIA 2WD8A 4I5DA 3EZLA 3CTMA 4JJFA 1GPDG 3NGLA 5C7OO 1YE3A 1XU7A 4XDYA 3PWZA 3PIDA 3RUHA 1EUCA 1NAIA 4MVJG 1FDSA 4B8ZA 3A4VA 4LCEA 3Q1LA 1M6WA 3WG9A 4JGBA 3U4HA 1JWBB 1E3JA 4IJWA 4CLOA 4WECA 4JP3A 1G1AA 4AICA 3PTZA 5G4KB 5TJ9A 3WNVA 2OFPA 4LRSB 3DOOA 4TRRA 4CODB 3L6DA 3RAJA 1P3DA 3M2TA 4ND1A 1NQOA 3I9LA 2NACA 3VH2A 3DOJA 3WGYA 1C1XB 3IL2A 1LSJA 2AE2A 4GVXA 3TFQA 1ISHA 1Q0QA 5EINA 1XR3A 4GI2A 3TJRA 3F6YA 4J2HA 1MG0A 4JXKA 3IAHA 5CDUA 1HXHA 2ZKLA 5TGDA 2FWMX 1B16A 4GX2A 2OUIA 3RBVA 3BMCB 3SJ7A 3AOEA 3F47A 1H94A 2P4QA 1OC2A 4Q3EA 2XOXA 3SXPA 1BXZA 1PZGA 1DHTA 1PWZA 3HNPA 5KKAA 3RC2A 4BQPA 2CSUA 4E32A 2FP4A 4J7XA 3L6OO 1J5PA 4DMLA 4OYRA 3F5QA 3KTDA 1CYDA 3B1JA 4CMAA 5IXYA 1UUFA 4J0EA 3OQ6A 3PWSA 5DBFA 4IJKA 5IDYA 2CZCA 5JDCA 4DPLA 3VH1A 4OL9A 4PVDA 4ZQFA 5U9CA 5AXAA 5AXDA 2BRUA 2O4UX 4KDEA 1NWCA 2X5JO 3NAQA 1YL6A 1BXGA 3GGPA 4E4YA 2V7PA 3Q6IA 3GC6A 5H81A 3AUSA 4XB2A 2VHZA 5A4DA 1O6ZA 1Q0HA 4R1UA 1N5DA 3H5NA 4O1MA 1HDZA 3RQSA 3ONFA 1NBOA 1JW9B 1GV1A 3ULKA 3TZQA 1K5HA 4U6SA 4BO5A 1DFGA 2HMTA 2VWQA 1XU9A 1E1MA 3EUWA 3VHRA 2YFQA 1IUKA 2VTEA 4IDCA 3NUGA 2Z1NA 4WLUA 2DQ4A 1GCUA 4P4LA 2NVBA 2B5WA 2DVMA 4LMRA 4CUJA 2WDZA 3V1TC 1U4SA 5EQDA 1UXKA 4EGFA 5AVOA 1O9BA 1HT0A 9LDTA 4CUKA 5CFZA 4KUEA 3ORFA 2VN8A 1JDJA 4GX0A 1SC6A 4YJDA 4W7IA 5IDWA 1YWGO 3H3JA 4FGSA 4HXYA 4NQZA 1QYWA 1TB4A 3M6IA 4U7WA 1PL8A 1WVGA 1FDWA 2P9EA 1ZBQA 4A7PA 2VYVD 1SAYA 5KJEA 3PZBA 1Z6ZA 3WIEA 5JDIC 5JY1A 5KOIA 3SLGA 3WLEA 1MXHA 2LDXA 4KUGA 3RU9A 1DRVA 3KYCB 3ZGYA 1HWYA 2WD7B 3PEFA 4HKTA 5JAQA 4BNLA 1KERA 2PR2A 1ZK2A 2CY0A 3V2HA 2RHRA 4OH1A 2YDXA 4DC0A 3O4RA 4PFJA 3QRWA 1EQUA 1QLJA 3BTSA 5THQA 3TZCA 3H5RA 1C0LA 3TPCA 4FFLA 4J4HA 4B4OA 3GN1A 1ZVMA 1CIVA 2C54A 4PLGA 5T57A 4DBZA 1DC5A 5ITVA 1U7HA 3CZMA 3NGXA 1SOWA 4GPD1 4II2A 5LCXA 4XX0A 1C0IA 1ZW1A 1E6UA 1PJSA 5TT1A 5L7WA 2EP5A 1V3TA 1A7AA 1OFGA 1HDRA 3C7AA 3FNFA 1A27A 3L6EA 4K26A 1E5LA 2NVWA 4MIOA 2Y1GA 2B83A 1P77A 1N7GA 1ZJYA 2DTXA 4DLLA 3L07A 4LGVA 1LSSA 3PDUA 4JBHA 5KCZA 1EDOA 2DUWA 2Q2WA 3WDSA 5TSDA 3SVTA 1HDYA 2E4AA 3IQDB 1NXQA 4A5OA 1DDOA 4DLBA 4DQVA 4IDAA 3PHJA 1DOHA 1BW9B 4QEDA 5HWSA 2O3SA 1YB4A 4CM4B 3IP3A 1YONA 4YCAA 5ENDA 2Q1TA 2YYYA 4XDZA 4F6LA 2HRZA 2YQ5A 1PEDA 4LSMA 4HY3A 4ND4A 1JAXA 5K6AA 4CLRA 1AGNA 3B1FA 1A5ZA 1HDXA 4CMIB 3LSYA 1AUPA 4BV8A 4MVJF 4ZA2A 3BTVA 3ZDFA 4BO9A 4XQEA 4CQMB 4E2WA 1E3LA 2X9NA 3TZHA 3VPGA 4UVHA 2CDCA 1P1JA 2JFHA 4O59O 5ES3A 4RVDA 2BI8A 4NBTA 5KJFA 3PLNA 4PRKA 4HBGA 3TOXA 1GYPA 4IJVA 4PG8A 3HWRA 5COAA 4FN4A 1ZSYA 4ALKA 3HADA 2VHVA 4Y6SA 5J23A 2VRBA 2OP0A 5GZ6A
chains in the Genus database with same CATH superfamily
4OI1A 4FR2A 1LI5A 4MA0A 1Z35A 3D5TA 4X93A 5C8XA 3V7YA 4OFBA 4KGZA 1CERA 3PNPA 2CD9A 1YZVA 1TE2A 2RGGA 3NRCA 3PG5A 1E0DA 4GVLA 1X1TA 2H2HA 3DDNA 4IV0A 4KPUA 4MDHA 2W6JD 2VP2A 4MCAA 3ZZUA 1EWVA 1HMPA 1V26A 2Z3ZA 3QK7A 4NR0A 4LSGA 2G09A 4EL5A 4C5CA 1L7XA 4WT7A 3NYIA 1L4GA 1YC5A 3TFOA 1W87A 3G1WA 3TNLA 4FGZA 1C29B 4NEGA 2LCIA 4IF4A 4F3NA 1C7RA 1CZNA 3HKDA 5DKFA 3S81A 4ZO4A 3ENWA 3L0PA 1DWUA 3O31A 1K2WA 1PQ4A 1BN7A 3ZCUA 1NI4B 1XA0A 2DR0A 1OBOA 1QV9A 2FPKA 1KGDA 4LRYA 1DO8A 4B74A 4IHAA 3BXFA 3OEYA 5EE9A 3LC2O 4OAOA 2J3DA 4A8PA 4C87A 4E2YA 4EAAA 4GM0A 5CDYA 1GZVA 3CPJB 4K2HA 3LH5A 2IEZA 4QOIA 4LXUA 3RFFA 1S9HA 3UENA 1MRZA 5FI3A 3UF0A 4AT1A 1PJZA 3VTZA 2SNIE 1UL1X 3ILHA 3M6MD 1LCIA 3NO4A 3WMXA 1F51E 2D0IA 3EXIB 3H9EO 1RPNA 3I92A 1ZD8A 1K0UA 3QU9A 1OV6A 2JVJA 3B2NA 2QY9A 5JLAA 1FW8A 4CHGA 4BFSA 1L5FA 1EBFA 4WY5A 3GJ7A 1U8CB 4RV5A 3HNRA 5CPFA 1BH2A 1QYRA 2JD0A 1OLXA 1NUAA 3E05A 1R0ZA 2AQIA 1MA3A 3E9RA 1XZEA 2BI4A 3IPLA 4NE7A 3WL5A 3K8QA 1GHTA 2C5HA 2IX9A 2Y6VA 4CPDA 5HPYB 1II0A 1FYEA 4FMDB 2DHDA 2ZR9A 1TCAA 2W2NA 3AM5A 3SXUA 1AQLA 3V4PB 1RLJA 4JOQA 4D7AA 1ECCA 3QUAA 2ZUDA 1TM4E 5G1OA 3AUYA 3EZGA 4G5HA 4M53A 6REQB 3S8MA 3NVAA 4Q15A 1WMFA 4FKMA 1F2DA 2DWUA 1CUEA 4QBGB 2BEUB 2GDJA 2XYVA 4X8LA 2AQKA 1B8OA 1H1LB 2PXCA 1ZL0A 3ZI0A 3ZK7A 4PHCA 2AMFA 3Q6MA 4JJ4A 3UIEA 2FSGA 3VU1A 2OHOA 3ZLJA 4EG3A 4QECA 5JAHA 2I4IA 4NFYA 1QV7A 1QIFA 3IVGA 3OZTA 1PE0A 3OZBA 3C5CA 4YRQA 4RHCA 5FUXA 4DTIA 1NVVR 1T4DA 3E7FA 3OZVA 3AIOA 4MVYA 1VIMA 2I2WA 2D1FA 4JWTA 3AIMA 4LNUB 1ONOA 3FSGA 3C7CB 3LY5A 3LUHA 4HDSB 1KHHA 1QDEA 1ST3A 3HE3A 5ENVA 3PEVA 3R3XA 1AHIA 1XLTA 4DL9A 2ECQA 3H2ZA 2YY5A 4JXZA 3JPYA 3AI2A 5CMLA 3NTRA 5KNCA 5B4UA 4XEHA 3L40A 4YP1A 2VSNA 4HL6A 3JALA 2UZ0A 4A8JB 5I7HA 1Y3BE 5CB0A 1D1QA 2I4TA 2FWAA 4PEVA 1M0EA 1JXAA 1NRJB 1CE8B 2E49A 1QZXA 1VKRA 3K1JA 3I05A 5DTJA 3RRXA 3ZXYA 4AO6A 4U8HA 3VR5A 3W5UA 2GLUA 3LE8A 1Z7YA 2VDWB 2W2TA 2RG7A 3RSQA 4AP5A 1UPTA 2WFZA 1R27A 1S2MA 5KTOA 3H2GA 5EKXA 4Y30A 1CJCA 3KYBA 5DYIA 2FA9A 2L2QA 3R0XA 1YAHA 5BV2P 4BUZA 3O2JA 4F3TA 2AE1A 2IKQA 4U8GA 2PWPA 1IDN1 1U28C 1PR9A 2G25A 2JCXA 1KNQA 3A3OA 4FE4A 3GNLA 1WX1A 5AI9A 2H0QA 3EBLA 3G5UA 3M1AA 4FOOA 1NVXQ 4MGYR 3L7YA 4UHDA 1G5PA 5I9SA 4YS6A 5SYMA 1Q91A 3IPXA 3N8IA 2ZIXA 1JIIA 4EY3A 3SZOA 3JRXA 1OBVA 3SGLA 5KC8A 3T3NA 3TKAA 1K4KA 2WVGA 1AKNA 4QGHA 3OQBA 2ZYVX 5CB4A 2O2DA 2VPXA 2Y1WA 4KPYA 1P3JA 2B7LA 3RIGA 5ALSA 1EB8A 3KU1A 3T3IA 3R5XA 4O2BF 4DRYA 5EIAA 2G8LA 2H4JA 2WE8A 3O9MA 5DXFA 4D6YA 4Q1AA 5K3BA 4CR6A 3C3XA 3IVAA 5K2MA 3OCCA 3VSDA 5JQWA 4ZYXA 3GNQA 1U0FA 2E4VA 1F60A 4COKA 1E6KA 1JXOA 2R2AA 3O8OB 1I24A 1KO4A 3F49S 4XYLA 4KMOA 1DO2A 5FFFA 3FXAA 1XMJA 2Y0BA 1NI5A 2RHOA 1EFHA 2NO9A 3JVUA 4Q47A 4DQLA 4DA8A 5B3LA 4LECA 2XSZA 3LC1O 1U5AA 1B0UA 3W8RA 1T6YA 2MHCA 3Q40A 3F8SA 1JIUA 4J0IA 2NP7A 3VVCA 3KPYA 3ZW8A 1AUOA 2JA1A 3GZNA 2VA9A 5BQXA 1F0NA 2O8FA 1IYZA 3PGKA 3QA9A 1G9TA 3FWNA 3OIFA 4B6FA 4F9FA 1JFLA 1WCYA 1GFIA 5HDBB 4YFVA 2WFMA 4Y8VA 5H16A 1YI1A 4YDQA 2EJTA 1LZLA 5LDHA 1AKUA 2GA9A 1R50A 1DC6A 5ISMA 1ULSA 3NNNA 1UBGA 3B2QA 3KS9A 1TLTA 2FMIA 3ZU4A 2C9YA 2HSJA 4DA7A 1DNPA 2O2JA 1KZ7B 2QN7A 4CQMD 1UP4A 4HP8A 2X42A 2GZHA 5CLHA 4KLNA 1LTKA 4L72A 2RHHA 3UK0A 4RD4A 5T8KA 1ACLA 3FIJA 4IL5A 2PT9A 5KEIA 2O8EA 1N0HA 1AU9A 1UDCA 5AHKA 3UYLA 3M9WA 4A91A 4BNZA 1AUXA 3U49A 5TDHA 1NVTA 1E8MA 2PX3A 3JWGA 4H7PA 1NNEA 2O4CA 5I5GA 4PG7A 4OGFA 1GN9A 1RBQA 4TV8B 2HN9A 1RQNA 2X9GA 1AV6A 1OAAA 4I6EA 2HHAA 4QL3A 1WHSA 3QE4A 4AKHA 2BE9A 4K6FA 3VR2A 1A4RA 4OUKX 3DMPA 2VKTA 3HUTA 2PUAA 5FJIA 2IU3A 3UTCA 2XGOA 4MRMB 2LD4A 3VHXA 2WAMA 1M2EA 1J1ZA 2FPRA 1DE0A 1PGNA 3R0QA 2E6KA 4N54A 5IC5A 1R74A 3INYA 4YJHB 5EERA 2PMBA 2X5XA 2ACVA 3O8DA 4RW0A 2OO7A 3EDYA 3ORQA 1A9YA 1GPWB 1UM8A 1XIVA 3DZCA 3ELYA 3HKEA 1T5LA 1UOOA 4GS5A 4IH4A 4C4RA 4A16A 4CCYB 2E1PA 3TL6A 5HM6A 4ZXPA 2W5UA 4WK6A 4X66B 4PGMA 4GICA 4JYMA 3RV3A 3IHLA 1CHNA 4KE6A 2G5CA 3C8MA 2VPZA 2XQVA 1SUBA 3DEZA 3MTBA 1JJVA 4UHFA 3L1HA 5KSPA 3EPPA 1CP2A 4EY8A 4OHVA 1S1MA 2VUIB 5FI1B 3NI2A 4DJTA 1BKSB 4CIWA 1E1CA 4FQ7A 5LXTA 1Y3DE 5MHTA 3NHYA 3TAXA 1YRQA 2YC2C 1G6Q1 1SHLA 2GKSA 3PUWA 1CQXA 1DARA 4UNPA 1QDUA 4WZBB 5AJTA 3AESA 4ID3A 1U0BB 4C6HA 1XVTA 3RRMA 2H2FA 4BN0A 4YRZA 3FFAA 1XD2A 2MMCA 5ICGA 2ZYAA 3PF9A 4EGJA 3R40A 1PHPA 1QBKC 2QORA 4RORA 3HABA 1NF3A 4CTKA 1B6TA 3KAQA 4GGPA 2A57A 3A2LA 3OZGA 3B3QA 1T9AA 4ENSA 1MC4A 1XO1A 2BRUC 3OC0A 1A4IA 3RS5A 2VZEA 3II6X 4YLGA 1RIFA 5F1OA 3MTQA 5U4XA 1JU3A 3SAJA 3EW9A 5I7WA 1KNXA 2XV1A 5A06A 3V7FA 1Q0PA 3O83A 3B9PA 3PXUA 4FFDA 1S8FA 3WZ2A 1JFFA 3BFVA 1YC2A 3BMQB 4ZVNA 3I6IA 5FTMA 4AZ0B 4TL7A 2E4XA 5SYAA 4AL4A 2GN9A 1A8SA 1EZ4A 4ZPJA 2Y9MB 1Q1ZA 2P2LA 3HUEA 4JAVC 1Q16A 2RJOA 2I4MA 3ZWWA 4BQEA 1NRXA 5I3CA 2H08A 3FDZB 4QUBA 2JIQA 3THXB 1E9VA 1O7JA 3GMSA 2R86A 3ZHBA 4HO1X 4MARA 1MDFA 3R8CA 4GPZA 4L3WA 3ZE0B 4WTOA 2ZXEA 3FTEA 1BQ4A 4NPCA 4RK1A 3VC1A 2O8CA 5C1DA 2AD5A 2X1MA 4UJ5A 2PRSA 1N6KA 1TYBE 1Z82A 5DU2A 3JAKB 3D4BA 2JLCA 4KTVE 2H11A 4UUBA 4RVFA 1EWYA 3E18A 2DT8A 5F23A 5CK5A 2QEQA 2W0SA 1LDEA 3AF1A 1GDHA 2I7XA 2GHTA 3VI4B 3B3AA 3SN6A 1Q44A 2YHSA 2GPAA 5MDHA 1EKXA 5D5HA 3TPFA 1NMEA 2H63A 3ANXA 3MB5A 3MFYA 4CNBA 5IC4A 2C4HA 3OFJA 3GRFA 1TZKA 3MWDA 4M9RA 4NNPA 2EW1A 2FSHA 3G7NA 4FGWA 3FDIA 3JWIA 3GEEA 1RM5A 3GUCA 3AEQB 3A36A 3D8TA 3BS4A 3HXKA 3H11B 1SUDA 1ZMBA 3D31A 4I50A 4LRWA 2VYVA 4G26A 3GRZA 1CUBA 4MQMA 4RPKA 1F8GA 1YZHA 2QPOA 4HC4A 3U0BA 2AD1A 2NPFA 3E3AA 1VGVA 3DTVA 4TUYB 2QMEA 3DBHA 3KZCA 1ZPDA 1HV8A 1ML3A 2Y1EA 3IR5A 3NTVA 4KWEA 4OHBA 4NYIR 4MQBA 3ITKA 3FGZA 1UINA 1X7YA 2ODAA 2Z2YA 1KSJA 4OLFA 3FOZA 3ZW9A 1H9AA 1KYXA 3K5IA 4W8OA 2AI1A 4YB8A 2HJHA 2J31A 3OEHA 1C14A 1VL2A 3H3XA 1MX5A 3NKFA 4JA2A 1MJNA 5IYZB 3VNVA 4LK3A 1PLKA 5DX0A 4CR8A 5KAMA 5T4FA 3D6FA 3G5MA 2XMQA 1SVOA 2JDIA 3OT4A 5EJ5A 1D1TA 5C81A 4M1WA 4OHCA 2C5AA 3VSAA 5ALLA 1XJ5A 3HV0A 5CH8A 4C0WA 4MQFB 2CJWA 3MUFA 4DCCA 4CEHA 2G9QA 1Y3FE 2NAFA 1Z6PA 3GUYA 2GPBA 4X3PA 3RTDA 3UMBA 5IKMA 4LC9A 5KAPA 2AXPA 3KJHA 3L8FA 2BEWA 1VDMA 2NU6B 2JLXA 2DTDA 3KTOA 2FW9A 2ZYHA 3FTCA 3M83A 3OCXA 4FYYA 4FR5A 4I4TA 3KJZA 4L7QA 4QHYA 4OHKA 2F59A 2IYEA 2ZRGA 3UKJA 1O0CA 4B3MB 3CR3C 2YWGA 1GZ7A 1LDGA 2WINI 2XUQA 3O1IC 5DHSA 3NJ4A 4RELA 4DCNA 1Z25A 4ZCPA 3A3PA 4MS4A 5DCLA 1P39A 1ZEJA 2IQ5A 4H1UA 4S24A 4YMTA 2C4VA 3EWIA 4KMSA 3SVZA 1RRMA 1H5QA 4B33A 3VPAA 4CEIA 3LTEA 1WU8A 2DT5A 4AMYA 5K6AC 2Y4OA 3ZCXA 3LDFA 2J5RA 1NOIA 3UPTA 3WGHA 1ULBA 1WXHA 1T9DA 3FLAA 3U0VA 5IN4A 1G38A 2CCGA 3F6EX 3ONNA 4QU5A 4F4IA 2Y3IA 4KC0A 2J6HA 1E3SA 2OE2A 3A31A 1YF3A 4BIMA 2IY9A 2ST1A 5DM2A 3TLAA 3UW3A 2QUIA 4PCVA 3WGUA 3C39A 1T6XA 4TKLA 1H0SA 4YJGB 3QHPA 4IWNA 3RJZA 3LPDA 4NECA 1DS6A 2HNBA 3QF4A 4TKVB 3QJYA 4G1BA 1B1CA 3KB2A 4Q4HA 4RA6A 3STUA 5G53C 1MAAA 3H97A 2B1IA 3H5VA 3D0OA 4P3NA 4KK4A 3KM0A 5EYPA 3O90A 5FOQA 2ZRDA 3RVOA 3ETEA 1X9HA 1PI3A 4Z51A 2R751 1RYMA 4ZV7A 3IAM1 3OM8A 3R7WB 2I6FA 2C9CA 4F72A 1AO0A 2BGGA 4KNVA 4WBNA 4ENQA 1UODA 2BPOA 2QWXA 1KMQA 2PLAA 2WUDA 3S29A 4RLQA 5D2CA 4DZRA 5KKNB 3COWA 2EP8A 2VAXA 4GBMA 2CBZA 4UTXA 3ZHRA 4CMHA 4DQXA 4MMXB 2B6NA 2C1ZA 2OFXA 1NNSA 2J07A 3H6HA 1IJKA 1AKYA 3U48A 1T1EA 5K4GA 3H2HA 1IEXA 1N2SA 4NMLA 1WVMA 2W6JA 3L1VA 3MERA 4RPLA 2FFAA 3SM9A 1Q50A 1SH7A 4Y6GB 3VR4D 4BP8A 4MXDA 2YFKA 4XR4A 4NOLA 5DHPA 1VPLA 4WCVA 2F43A 5JHHB 1IOZA 1C4OA 3A1SA 2V0GA 2PU7A 3ZY2A 2B2NA 3KUUA 3FMGA 3J7TA 1UOPA 5SZHB 4RY2A 3REOA 2IWRA 2JGJA 4H7KA 2PWBA 3B6JA 3LXXA 3BM5A 1QFMA 1U7UA 1F7VA 3BSSA 4YRPA 2G70A 1KZ1A 4QA9A 5I7FA 1H2YA 3WLNA 4ZAZA 4ESVA 3LF2A 1CDEA 1K5PA 3C6QA 3TKYA 2F64A 3H2IA 4GI5A 2GRUA 1AKTA 1GCGA 2ANCA 4BMNA 1TDJA 3OP4A 2I3GA 5EQJB 3H0KA 1NBIA 4BNDB 3VYTB 3TWOA 2PJUA 2HXSA 4Q7EA 5IN5A 3K6KA 4B3FX 1IB6A 1ECJA 5EJAA 4G9GA 3OQIA 3X2EA 1KR5A 1IRXA 3OEED 5EJ7A 4R7ZA 1JTVA 3UXEA 1GXSB 1BXRB 1FDOA 1JG7A 1MBZA 2P5SA 4ZDWA 4NZ9A 2WQ6A 3GLHB 4LYAA 3AF4A 3B13B 3DEYX 4U7JA 4UMDA 5FRDA 2PV0A 3L8GA 1Z0SA 2IZOA 2RKWA 4JKOA 4R8LA 1WVIA 4BWGA 1T2DA 2EJBA 4JJZA 1UJ6A 4C2BA 1ZGJA 4N5HX 1NQXA 3DXYA 5FBWB 4KKVA 4WWHA 1HLPA 4G0YA 5FOWA 3F7OA 2G7MC 3B6KA 3IULA 4DSAA 3U37A 1NN3A 4M6WB 4PC3A 5JI2E 3CBGA 1FU4A 2P2SA 1E94E 3ENZA 3WNZA 5HKKD 3NBXX 1G6OA 4UOQA 3D5EA 3ADKA 1GGFA 4IEIA 4OBEA 4OXNA 3S70A 3WKCA 3ZZNA 4Z1MA 5AVVA 2Z58A 4RTSA 3GDHA 4HX2A 3TE6A 5HQTA 3PGVA 1OUMA 3TM4A 4D81A 1E1YA 3BAZA 2DU8A 5EGNA 1IXYA 1NJGA 1K86A 1FY2A 4DCTA 4IKPA 2XITA 1WJGA 2DY0A 2WVAA 2AOUB 4IRUB 3T5TA 1NJ8A 1Q22A 4NAVA 4DHWA 1E5DA 2FZWA 3O0TA 3RFXA 2ECKA 2JIMA 5J1TB 4E88A 1TC2A 1ADBA 3H0CA 1CUGA 2PH1A 1NU6A 1VL0A 3WSWA 1T6BY 1A9XA 2FXVA 4ND7A 4X8MA 3HSKA 4LOKA 2A58A 3ZIDA 3IURA 4HDAA 2VJKA 3OQ1A 1BGWA 3O4JA 2XZPA 2EAUA 5F52A 4ILKA 1M0SA 2ZUEA 5FV4A 3RYTC 4QZVA 3D8RA 5EMNA 4DHEA 5C8DA 2AF4C 3A6LA 1K7XB 3P9SA 2JNWA 5FWXB 2R8ZA 1UOQA 3KKQA 3LL7A 1C8BA 4M7RA 1T4CB 3QKRB 2VHTA 1ZUD1 1QYIA 4ZC8A 2ZJFA 3KZ1E 2P9FA 5JCOC 4HXGA 2BKUA 3H1GA 3KXPA 1VXRA 5F35A 1WLSA 2W2MA 4FOTA 3WFZA 3JR3A 1QG6A 4WZBE 1UIMA 1V47A 5GOZA 3OKAA 2NWQA 2EKDA 1X19A 3LRTA 1PD0A 4PICA 1NG1A 2FPIA 5EHXA 2YWBA 3MQ2A 2QX4A 4J16A 1GPJA 2Q2OA 1E59A 4ND5A 4WADA 4YCBA 4DJFC 1Y6ZA 5JBNA 4MS1B 3DF9A 5AM5A 1VJ0A 4UEOA 3G1UA 4BKQA 3U7EB 3HS3A 2IHKA 4DJAA 1Z0IA 2I9PA 3M33A 2ORVA 1XLVA 3AETB 2NZJA 4QYIA 3I5AA 2BDUA 3DKRA 5AOBA 4XVCA 1I6MA 1HRKA 3ESCA 3GOQA 4NHEA 1LK5A 1MQSA 4YP6A 4G8CA 3RUPA 2JF0A 2PS1A 4OYLA 3HO6A 4UHJA 2GOYA 5K3FA 1GG5A 2Q0HA 3CCBA 5E9QA 5JFOA 5DTQA 3IUBA 1H93A 1JLMA 3SNHA 2K2QB 1KR2A 1VSTA 4KQXA 1VIAA 1PNQA 3QELA 1LLCA 1LTHR 3FY4A 4OI4A 4QGBA 3X1WA 3ZCPA 1EUYA 1S2NA 1OI7A 3HDGA 3AVXA 4TT8A 3S2GA 5JSZB 5K6TA 1EH5A 5E2BA 4PCUA 4DR4B 4Y3UA 1KXJA 5BN5A 3BGOS 4DG5A 1EGMB 2Z1MA 3IP5A 5JLJA 3QTBA 4MHSA 1HY3A 1R88A 2IVFA 4RF4A 4X20A 5T5QA 2XXAA 2J0QA 3AR8A 3ZHZA 1FTSA 1WZNA 4U3JB 4ZK2A 2A9OA 3V4OA 4BYMA 1FMJA 1V11B 3LCVB 1ESMA 3FJYA 3LDHA 3THWA 2PGNA 1JHAA 3WL4A 5I4BA 4G9EA 1Z8FA 4CM4A 2VHJA 2EZ8A 4BNJA 4CF6A 1XWWA 4EUNA 2WC1A 4MS3B 3TD2A 4IGAA 3P2EA 3SHTA 4FM9A 2YXPX 4J9VA 5J47A 4KLRA 1S2LA 4UUAA 4BO2A 4O29A 5FLYA 1I1OA 5JD6A 3Q0EA 1SQ0A 3OZWA 1N9KA 4L5BA 3BWVA 1GA6A 3ID6C 4GO1A 4CMIA 5GIPE 3Q7TA 3SR3A 1IJBA 1JG2A 2FWBA 5E3HA 3D7NA 4GBJA 1J6UA 3P4UA 2EOAA 2QRLA 4BNTA 4E4TA 4ESHA 4N0PA 2DF8A 4BAZA 4CQMA 3T4EA 2V5UA 1HSZA 4B76A 1GJRA 4RVGA 2REOA 3VPCA 3DOEA 4JS0A 2ZJ3A 3QX8A 4NK4A 5I7SA 4PGGA 2XMRA 1RWWA 3BIJA 5DV9A 2EF1A 2GJKA 5IFKA 1W47A 1E3QA 1V95A 4ZXFA 2HAEA 5B2FA 5JTTA 3CNHA 4J0KA 4MUKA 1ZXXA 1U5CA 4OXXA 5KWVA 1EDDA 3AQIA 4RABA 1W35A 3FPBA 3KOMA 1QORA 4B3BA 5ERYA 1YGYA 3UJPA 1GNSA 2OXRA 2W2LD 3BXEA 1JKXA 3OM0A 1XTBA 4FFNA 3KYJB 4DT1B 1OF1A 4UXHA 3B12A 3CSSA 1Q74A 3O3MB 1ZXLA 5EJFA 1P7WA 2GZAA 2RBEA 1C9NA 2Y1FA 2EDAA 1JDTA 2VT7A 2VPIA 4X6UA 4OB8A 4TQGA 4XH9B 1AQ6A 2GAOA 2REXB 2YHBA 4Q3AA 3RLIA 3RK1A 3JQFC 4QYXA 1OHHD 5B2ZA 5KNDH 3UK6A 3IOYA 1GUDA 2RC6A 3TCXB 1IN4A 2OB1A 2ZRAA 4PYIA 4XGIA 3WLJA 4KREA 1WNTA 1AUQA 2B1QA 4GXTA 3WTCA 3KJIA 2BC9A 4Q16A 3ADDA 2V7TA 4J7UA 4CIVA 4CV1A 4FONA 2X7XA 2FVYA 4Z3KA 1L5VA 3JV7A 3LZCA 1NI4A 2OLKA 3K4QA 3W7VA 4YMHA 5FUYA 5DNDA 4UD6A 4BB0A 3ZGNA 3OQOA 1RMQA 1V41E 1DBRA 3P0EA 5B7PA 2PJZA 3MCVA 4MRNA 4FE3A 3DAHA 3FR8A 1J8YF 1ES9A 3GDGA 4PPGA 2HK8A 3UAZA 1Z0ZA 4ARUA 1F6DA 3EXIA 4DMMA 5BYKA 1BMFD 2F62A 3FYHA 4G65A 4HSEA 4JL5A 2A9FA 2FEOA 5J59A 4AO7A 1KH2A 4BKPA 1IH8A 4GNRA 4OREX 2K7ZA 1BIFA 1J8VA 1R37A 1DQZA 4LKRA 4UNRA 4YMGA 1PWHA 2AN5A 1OAOC 2RHWA 3EEIA 5IEJA 2W6ZA 2ZBQA 3PU6A 4MR9B 5K5EA 1E92A 2GKOA 2VNAA 3WLIA 1WPQA 2G67A 3JR7A 4IVQA 4RJTA 1D2GA 4FFOA 2NU7B 4GI1A 1H3FA 1U9IA 4EG4A 5EUMA 1SN7A 4UC0A 3QI7A 1Z15A 5EMJA 4MPJA 2JIPA 4BNMA 2QZ4A 4GRDA 5CEEA 3RS9A 1R6DA 2KPOA 3CKMA 1D2AA 4GL4A 1MD9A 4IVNA 4ZT4A 1XV5A 3CCFA 2OOKA 4DY4A 1OB5A 4KVFA 3ZHUA 4DA4A 6REQA 3FAZA 1GR1A 2N47A 2OUKA 2Z43A 3I0ZA 2BFMA 1G3UA 4PSAA 4AMZA 3I61A 4EPWA 2BEUA 4O5OA 3OJLA 5IYZA 4ZJUA 1H1LA 1XD9A 3JQBC 5EEHA 4EKIA 3MMSA 4IF6A 4D46A 2QW0X 4TLBA 4JNCA 2G5TA 5CLLA 4CFYA 3DYIA 5LLSA 3CZAA 4G5SA 3P1JA 4DBVO 4S2EA 5CB6A 2GTIA 3ECAA 3D0QA 1KYVA 1NE7A 1O5OA 2ZT5A 3GCGA 4OFWA 4PLFA 2FDRA 4LNUA 5DI9A 4AS1A 1YVPA 4HDSA 2ECPA 2QM0A 3OM9A 5THXA 3SSMA 4UAVA 1EMDA 1GCOA 3D6VA 3MW8A 1XAIA 2FJ0A 3WC4A 1NVKA 3CW8X 1Y4SA 1RNLA 1WIWA 3A0RB 2CUTA 5H83A 3VTKA 4DNPA 5K8TA 2O5EA 4HN9A 4A8JA 3PTLA 2QJTA 5LWHA 2XQIA 4CQLB 3HB4X 1CP3A 1CUCA 1CE8A 1OVMA 4IIJF 4IDGA 3TDNA 4LZZA 3UWDA 3P45A 2VDWA 1AGRA 2PYIA 1HNZB 3OPYI 5H0IA 3NT4A 2JGLA 3R7BA 2JAQA 5ICCA 2ZM5A 4R9VA 1O94D 4QXPA 1R6AA 5TMDA 2YWXA 2XW6A 3RHSA 2FK7A 4MVJD 2IKSA 3HKBA 1P1BA 1TCVA 1TTQB 3TLYA 5CA1B 4Z5XA 2Q62A 5D5QA 2IH5A 2R7NA 2WKSA 4L4SA 3UJNA 1NJ2A 3MWFA 4TYNA 3ETGA 4H3VA 4DPMA 2Q28A 3OQVA 1PJCA 2LIVA 1W52X 2V8BA 4TV9B 4I3HA 3CEHA 5J3JA 2NLOA 1G8SA 4OOFA 1JEOA 1QV6A 2CL0X 2RHLA 2J3EA 2C5EA 2KM1A 4UUMA 2AN9A 1MHPA 2XVAA 4EF5A 3M2PA 3PI6A 2I6SA 2HQOA 1T0PA 1OBFO 3NV7A 3U7RA 1SR8A 4OP1A 1SKYB 3EGWA 5LMZA 1E3MA 1I14A 4Q3NA 2XA1A 1V3UA 4WJKB 4INZA 1NFQA 1PGJA 4HDOB 3PQDA 1J20A 3BZBA 3GLHE 4Y2VA 4UQOA 1K8QA 3O8OA 1DL5A 3KR0A 4NMHA 4PS0A 2ZVJA 3DLAA 4KGDA 3FBGA 4UPEA 2QZ9A 4LMBA 3UT5B 2ETVA 1E7SA 3WJ2A 4F2PA 4UTRA 1K63A 2MSWA 3GN2A 1BDIA 2WRZA 4D9NA 3ZHXA 1E7QA 5FEUA 1DBPA 2PQ2A 2VHEA 3W4KA 4ZHQB 3U1VA 3WGLA 4L4YA 3VDMA 3KPJA 4MI3A 4WCDA 4DV1B 1QP4A 1GQOA 4ERNA 1JHXA 1NXXA 1W4BA 2FSUA 5ANRB 4ALMA 3MPOA 3T0FA 1P2DA 2O0KA 4R3WA 1B4DA 1KEUA 3PFFA 3ZJVA 3LWZA 1L1FA 2V7GA 5H82A 1D4ZA 2J7KA 4YRBA 3ZY3A 5EPEA 4E22A 2NAPA 1FF9A 4OJKA 2JFQA 2DTEA 3A9RA 4DLSA 3L0DA 4UUNA 3WL3A 2VDVE 2ID8A 3O9VA 4O4LF 1Z8HA 4IJ6A 4KO2S 3CLKA 4L5IA 4OJTA 5IABA 3OBBA 3OIDA 4LYHA 1Z2OX 1Y7LA 3HI4A 4EG0A 1J49A 2O6HA 3E53A 2EZUA 4B80A 4P4SB 1O4VA 4TV8A 3R75A 5I9BA 1VECA 3QHQA 4F9TA 1X86B 4HVTA 2H1LA 4I4CA 1KY5A 3O4GA 3T38A 4C6TB 3LVQE 4AK9A 4ENPA 5A4IS 2DPGA 1B42A 3W5AA 5BSRA 1TEHA 2DZDA 1Y4AE 4FZ3A 4D79A 3O1LA 4Y6RA 3BB1A 2Q6LA 3QENA 4MRMA 4ALIA 4ODIA 3D3NA 2AZDA 3FRHA 1FNBA 4PFKA 4QPNA 1TW3A 3L8DA 4MLPA 4AI6A 1DKNA 1IHUA 3HEMA 4YJHA 4WJZA 1FPQA 4RMHA 4MVJE 3FFTA 1SHTX 5BUSA 5K05A 2EBHX 2R3SA 2ADOA 2BI7A 3FRJA 3IMFA 4CCYA 1M1UA 8ABPA 4CI9A 2EKBA 2GBIA 1N5LA 3LU1A 4UAGA 4ACAA 1G55A 2I65A 2FDXA 4J6FA 3S2ZA 4RTOA 1NVWQ 3MJCA 3GGSA 4BV3A 1IBKB 5CFPA 2GAJA 1FNMA 1XE3A 2A59A 5HZMA 2ATEA 3GPIA 2HDNB 1FVXA 4MVJM 4Q1BA 3U56A 3VR4A 3NVDA 3V1YA 1MO2A 4NJMB 4JQCA 1Z33A 5E4JA 2C4WA 1DBQA 1THGA 2OK8A 4L6CA 4ECEA 2ACWA 2A30A 2XVYA 1J25A 4M38A 4WZBA 1CR1A 1ZJ4A 2B4TO 2WJPA 5AQEA 1R8XA 1V8FA 2GK6A 4RACA 3AVWA 3FYCA 4ID9A 4PC1A 3FE2A 3SS8A 1Q14A 4G07A 3MMPA 3WBBA 4AMUA 4F8YA 5I7OA 3OECA 5EVCA 1U8FO 3JSAA 2VUTA 4MPPA 2HCTA 2EHDA 3AW9A 3GUUA 3T35A 4C6SA 4AYXA 2PH5A 4AIIA 3EY9A 4IFIA 5L4LA 3V4FA 3HUDA 2L42A 4YQZA 3RFTA 1PNOA 3WB0A 2QUAA 5TS3A 1CY4A 3HACA 3R6LA 1WXGA 3RS8A 4HV4A 4LFCB 2B7CA 4YIHA 1U9YA 2FMHA 4KEAA 3QMMA 5HMMA 4PIMA 3QBEA 4RX1A 3U26A 3ANNA 4UEQA 2HHJA 4YO8A 3RIXA 1SC9A 1U3FA 4F8JA 2AI2A 1IIRA 2ZJZA 3NDJA 1DU4A 4JLDA 5B53A 3VYRB 3BMQA 1HQCA 2Q8PA 3OEEA 1WXIA 4AZ0A 3RSOA 5B1YA 1W9HA 3EUEA 3L77A 1ORRA 2H54A 4YRFA 5IDXA 5HRAA 1LLFA 4QYTA 1NZJA 1IBLB 4AG5A 4RIHA 1ENZA 1TPYA 2QN6A 4JBGA 1WQ4A 3PJEA 4KHZA 1XDWA 1KY2A 2D1YA 1DTWB 1Q77A 3FDZA 4E33A 3THXA 3TL2A 3FTFA 2F67A 1VKHA 1JBEA 3GMTA 5DNVA 5EAIA 3NRBA 3D6HA 4CL0A 2FOXA 1AKQA 4M0UA 1Q7TA 3BK2A 4NZMA 3TTUA 1O6FA 1BO6A 5FA6A 4L8VA 1RKUA 3C4JA 5KVQA 4BFXA 4UTZA 1CQIB 3JAKA 1XU4A 3ONVA 5B12A 3FWKA 5HKKA 3KT3A 1LUAA 1YRLA 1Y6JA 3PGJA 1TXGA 2O3RA 5KU7A 3BILA 2X9QA 2A5GA 3AKDA 4U2DA 3QOYA 1TIKA 2HYDA 3AJAA 3BRQA 2CD7A 2QVCA 2ZJ7A 3QSGA 4OSPA 4PZ9A 1CJUC 3BTUA 3RBAA 4A1OA 4Q1EA 3S2EA 2CK3D 4HQRA 1SULA 1RCUA 3OMWA 3PPXA 2QMYA 1B00A 4B3HA 1JDPA 1I33A 4A0QA 2DJIA 3MB8A 1M5RA 4IIUA 3FAKA 4BXOB 2F9LA 4HRVA 3V1MA 4DLKA 4RQUA 2AW3A 2JFWA 1C8VB 3WDLA 2WNIA 3WK5A 1N5JA 1U63A 1KDZA 1LNQA 1VA5A 2OO3A 4RJIA 1KARA 4TWBA 1BWSA 3NWJA 4GZ5A 1NYQA 1VMKA 3P2JA 3BMOB 3BXHA 4HAOA 3AEQA 2O7SA 1CRWG 3H11A 4HEA6 1CTQA 3F3KA 1SELA 4ETMA 2CMKA 5CVVA 1OH6A 2RJ3A 3DLTA 4U2FA 3B1ZA 4BZXA 1OFIA 3ASYA 3DV0B 3LT5A 4HN2A 4UFNA 3CMMA 4TUYA 4QT0A 4RO0A 2RHBA 1BDMA 1TGVA 3DV2A 3I4FA 1FX0B 2P6MA 2D6FA 4QASA 1KBOA 1X92A 3JQAB 5EHGA 1RP7A 4ZEMA 3K2IA 2C88A 1RLIA 3HY3A 4M98A 2CEKA 2GF2A 3AZOA 2GT1A 3R76A 1CJKC 2C82A 3EDMA 1HTWA 1TKAA 3K35A 4LSWA 3K53A 3N2LA 1AM4D 1FXWF 1FXSA 2XXJA 3AZQA 3FNGA 4RIGA 1VGQA 3NXKA 1JWAB 6AT1A 2KJQA 1VE1A 2JL1A 5IBPA 3HC7A 1E7RA 4B7CA 3QSYA 2Q4RA 1NVMB 1PX0A 1KMIY 1U80A 2HH9A 1VP9A 1XRJA 4MQFA 1LPMA 3CF4G 4P7GA 3V5NA 1SCDA 3HR8A 4ALLA 4TM8A 4DAOA 1X7WB 2FEPA 2MSEB 4O4HF 4E2XA 1E2HA 1NDQA 1SUSA 3I45A 1YA6A 4RAOA 2NU6A 2PMCA 4G56A 3ZDRA 2WQ7A 3SC4A 2X1HA 1KZYC 1BDJA 2QTBA 1BX0A 1GQQA 2Z08A 4F85A 3FUUA 4CMGA 5JPCA 1F8XA 5A6SA 4HDCA 3MGBA 3EISA 1EA7A 1NUUA 2VCEA 5HIKA 1G0OA 4GM1A 1QP7A 5EZQA 3NIDB 1BNCA 1Y33E 2HDOA 4KWCA 1KZGB 4ZC1A 3T95A 1G4HA 1QRUA 4F84A 1VL1A 3ELBA 3TSCA 1TMKA 2QUJA 4DRXB 2AWOA 3CG0A 1V1MB 2L18A 4JGGA 4OP3A 5F21A 4C0KA 5CG1A 1GL7A 2DQYA 3CKLA 2Z30A 2QBYB 5LR6A 1NPDA 2PZAA 5AI0A 4OSEA 4DKXA 1DCKA 1U7PA 3GRCA 2AKYA 4CZ2A 1Z45A 1U8TA 3KE8A 2NN3C 4YJGA 3GMIA 1FSGA 4URYR 1GNLA 4FSDA 3OPVA 4TKVA 4CM7A 1X1AA 1DAIA 2RE8A 3H16A 3L7LA 4HXEB 3H75A 3QITA 4GFDA 3F73A 1I7DA 5AVRA 1UXHA 2OXTA 2IELA 2BF7A 2VH2A 1LLDA 3P0RA 2VQ6A 4XGKA 1CJTC 3AYZB 1ODSA 3DXZA 3I9OA 4QFCA 4YQEA 1BN6A 2PFKA 3P27A 2GI4A 3QF7A 4KQ9A 1ELOA 2OLJA 3HMKA 3D2CA 3IVCA 5AKJA 5EZYB 5LBUA 3R7WA 4HMPA 1S3IA 3IUPA 3OIGA 2IZ5A 4BMSA 2HI0A 3HUFA 4F7DA 2FFQA 1ISSA 2W2LA 3TIFA 3U4AA 5FFNA 1ND6A 3NM5A 1PHRA 1PZXA 3FD8A 2H7VA 3ENQA 4TTJA 5J2UB 2H16A 1Q19A 1OHHA 1UH5A 1AGPA 2FN3A 2R7MA 3I3OA 1FDTA 1TYZA 1D5WA 3BL6A 3U81A 3IODA 1SG9A 4UEJA 3L0SA 3BK1A 1K2VN 3WRVA 3ZE7A 4KZKA 4C3ZA 2IYZA 3TPZA 4MYCA 2UVDA 4FLEA 2C20A 3JW8A 3DMHA 2TYSB 4BRUA 1DV2A 2ZE6A 1TEXA 3SF0A 1RYEA 3EQ8A 3H2BA 2DPYA 1V96A 2WP8J 2F4VB 1MJHA 1ZK3A 1PGOA 1ZS9A 2GPYA 3ZDQA 2NGRA 5KX5B 3RC7A 1AZLA 1W75A 2AFIB 1JP7A 1SB9A 1TM3E 1D4FA 1YS4A 3PXBA 3F8WA 3MD0A 1EFPB 2HA7A 3IT0A 4GOKA 4YJ3F 3RR2A 3M0EA 1Z5NA 4NXMB 3GZ4A 3Q5EA 4BNDA 2YV2A 3I62A 2FUNB 3ROZA 1PGQA 2J0VA 2JGFA 3ODPA 4OFZA 5ESWA 5I4KA 4PRLA 2A9KA 2VFAA 1IG0A 3H19A 1GXSA 1BXRA 2XNHA 3CLUD 2IUYA 3HZOA 1UK9A 2O7VA 1MH9A 3GLHA 4DXHA 2H07A 2ONYA 1XLTC 3KOUA 4MQ6A 4Q9DA 1P1FA 3C1UA 3O03A 4DLPA 3O8CA 2C83A 1MORA 5JAOA 5K6AA 1TM1E 2B8TA 3FOAA 4NDNE 2BTEA 3FPKA 4UFPA 4FFWA 5I01A 2ZU6A 1JR2A 4FGUA 4MIYA 4GD3Q 1EQAA 4HTAA 2R4QA 4M6WA 4XARA 4EQ6B 3CC8A 2YS6A 4PU0A 3NEAA 2B8EA 3WBJA 3RBXA 4KLCA 2B9EA 3ZWOA 5DBIA 1VZ2A 3OX1A 4DUGD 3V6MA 2G1JA 4Q39A 3OBIA 4K87A 4M99A 3UOWA 1A7UA 3GU3A 1T2FA 1XI2A 3PHLA 3EXHC 4I46A 1SUAA 2IF0A 4CODB 3GVPA 1XZAA 3ZGXA 4ROTA 4UDNA 4XX0B 2P11A 3U80A 4BFZA 1Z9BA 3MEQA 2KHZA 3L8ZA 2ZB3A 1NMXA 4NAHA 4IIGA 2GKGA 2F4NA 5F1KA 3VO9A 2E6UX 4QKQA 2IRWA 1ETHA 2VQSA 2Q2VA 2WUEA 4JBLA 1EVJA 1EM8B 4U02A 2VSXA 2C2HA 4NMMA 4BB9A 2QG9A 3PQ2A 3RVDA 3GFBA 1II9A 2V7XA 3HCAA 3BGDA 3LZDA 2VZ9A 4OSOA 3ZS8A 3CRZA 1W5EA 3TLBA 4IDBA 1IPFA 1ZH8A 2QN9A 1KTIA 2YVAA 3NU1A 3K0AB 4BFWA 1P2SA 4CL3A 4D8YA 1QVAA 5D85A 3OE5A 3KOWA 4TQ9A 2IVZA 2AG1A 5FWXA 2X23A 1XKTA 5AOVA 3D8HA 3MWJA 2ENUA 4DB2A 2GM3A 2AEJA 3JAWB 5HZGA 1P7YA 1HE4A 1T4CA 3QKRA 1FVHA 1X1BA 2V4UA 4OEHA 3O4HA 1WZCA 4RUKA 3B9BA 2JAOA 4L95C 1TT7A 4R1TA 1TAGA 3GCZA 1O94A 3Q0IA 4XW2A 3JQAD 3AR9A 1U6IA 1H69A 3FFBA 3F5MA