The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
100
|
sequence length |
317
|
structure length |
312
|
Chain Sequence |
MKKTSRKVVIVGTGFVGTSIAYAMINQGVANELVLIDVNQEKAEGLDGMAWGEKNVSVWSGTYEECQDANLVILTAGVNQKPGQTRLDLVKTNATITRQIVKEVMASGFDGIFVVASNPVDILTYLTWQESGLPASRVVGTGTTLDTTRFRKEIALKLAVDPRSVHGYILGEHGDSEVAAWSHTTVGGKPIMEYVEKDHRLEENDLTVLADKVKNAAYEIIDRKKATYYGIGMSTTRIVKAILNNEQAVLPVSAYLNGEYGEEDIFTGVPSIVDENGVREIIDLSITPQEKAMFHQSVSELKAVLDTVRLEH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
An alternative allosteric regulation mechanism of an acidophilic l-lactate dehydrogenase from Enterococcus mundtii 15-1A
doi rcsb |
molecule tags |
Oxidoreductase
|
source organism |
Enterococcus mundtii
|
molecule keywords |
L-lactate dehydrogenase
|
total genus |
100
|
structure length |
312
|
sequence length |
317
|
chains with identical sequence |
B, C, D
|
ec nomenclature |
ec
1.1.1.27: L-lactate dehydrogenase. |
pdb deposition date | 2014-03-27 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00056 | Ldh_1_N | lactate/malate dehydrogenase, NAD binding domain |
A | PF02866 | Ldh_1_C | lactate/malate dehydrogenase, alpha/beta C-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | NAD(P)-binding Rossmann-like Domain | ||
Alpha Beta | Alpha-Beta Complex | L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 | Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal |