3WSVA

Crystal structure of minor l-lactate dehydrogenase from enterococcus mundtii in the ligands-unbound form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
312
Chain Sequence
MKKTSRKVVIVGTGFVGTSIAYAMINQGVANELVLIDVNQEKAEGLDGMAWGEKNVSVWSGTYEECQDANLVILTAGVNQKPGQTRLDLVKTNATITRQIVKEVMASGFDGIFVVASNPVDILTYLTWQESGLPASRVVGTGTTLDTTRFRKEIALKLAVDPRSVHGYILGEHGDSEVAAWSHTTVGGKPIMEYVEKDHRLEENDLTVLADKVKNAAYEIIDRKKATYYGIGMSTTRIVKAILNNEQAVLPVSAYLNGEYGEEDIFTGVPSIVDENGVREIIDLSITPQEKAMFHQSVSELKAVLDTVRLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An alternative allosteric regulation mechanism of an acidophilic l-lactate dehydrogenase from Enterococcus mundtii 15-1A
doi rcsb
source organism Enterococcus mundtii
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
total genus 100
structure length 312
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wsvA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3wsvA02
4E5PA 3JQAD 3LZ6A 4FFRA 1J6UA 1EE9A 2PKQP 4GWKA 2QRLA 4BO6A 1DIRA 3H9QA 3UW3A 5JXWA 1QR6A 2GERA 1E1KA 2YFHA 3GY0A 3TL2A 1HRDA 1HWYA 1E77A 3ZWAA 4TRJA 4J4HA 1P45A 1GZ4A 3DBRA 2FMUA 4CM3A 3DBLA 2BHLA 2CY0A 3O9ZA 4BO7A 2RH8A 3ZGYA 3PXXA 3GEGA 1WNTA 4IDFA 3PHHA 2NNLD 1ZMTA 1EQ2A 1NPYA 1VKNA 2I99A 2V6GA 3I1JA 2EF1A 4FCCA 4ZQHA 3JD2A 4WOKA 2ZJ1A 3O38A 3MOGA 3C7AA 1NHWA 3HUDA 4B4OA 1CDOA 2J6IA 1GFSA 1ULUA 2GO1A 1PZEA 4ZQBA 3QJ5A 3FBTA 1YJ8A 2NUAA 3G79A 4PZCA 1P77A 4HFJA 4WECA 3RKUA 3CSDA 1GYRA 3L4BC 5I9NA 3JQ9A 1E1MA 1QYWA 2C29D 4FOOA 4ND4A 4AFNA 3U5TA 3S2EA 5MGBA 1FDUA 5KTKA 3QVOA 5A05A 4RVSA 2PY6A 1NAIA 4UUOA 1I10A 4DC1A 4UVIA 4I08A 3ANMA 3A28A 2PH5A 5GZ3A 4FR5A 4BO5A 1QKIA 3U49A 2VNAA 1Q0QA 4KZPA 2ZATA 5A06A 3UFXA 3H4VA 1HLDA 2PA3A 4KWIA 2BD0A 1JAYA 1ZEMA 5H82A 2YV1A 2NVUB 1EZ4A 4TSKA 2VHXA 4TQGA 4YWJA 3LLVA 4FGSA 5TIIA 3I9NA 1CJCA 2O2SA 4CQMD 4Z0PA 3E5MA 2OGUA 3PJDA 1LDEA 4I8XA 4NU5A 3K92A 4CMEA 2O48X 2G17A 1VLLA 2ZCVA 4J4BA 4E33A 3EZLA 5JY1A 1ZUD1 4BGEA 1I24A 1MFPA 1OC4A 3ITKA 2NU8A 2Y1DA 4E3ZA 1PL7A 1XU7A 1B8UA 1YWGO 2IDZA 3ZHZA 2IEBA 2B69A 5IN5A 3QWAA 1HE4A 4J90A 4RQUA 2YHIB 3D4NA 3R0IA 1PJQA 3W8FA 5DOZA 4F6LA 1IOLA 1E7SA 2Y1GA 1LNQA 1Y8QA 4S1VA 1Z7EA 1YXMA 3G1TA 4XB2A 5HTOA 2E6UX 1YB5A 4TROA 2JHFA 2RH4A 2EHDA 4WGGA 1J5PA 3HSKA 4WCFA 3GGGA 4NDNE 2FZEA 5BNIA 3HG7A 1IY8A 4O1MA 2QW8A 3L4SO 2OO5A 2JD2A 4MVJP 1EDZA 4BUCA 3K73O 3ORFA 1SB8A 5KVSA 4AJ4A 4HADA 1T1SA 4XKJA 1HEUA 4CL3A 2AE1A 2HMUA 3GVXA 4ZHSA 4PLZA 5C3MA 1PR3A 3TDKA 4WNIA 3SX2A 1K3TA 3ANNA 3F3SA 4PLWA 4R5HA 3RJ9A 3QQPA 3KV3O 2CZCA 4NQZA 3RC2A 4ONEA 1GAEO 1ADGA 4CM9D 4CQMB 4HWKA 1Q0HA 1U4SA 1PGQA 4Q3NA 3DBLB 2HDHA 4BS9A 4XD2A 3GG2A 4PGFA 3HDYA 5G0WA 3W8EA 2WE7A 3GNQA 5I9MA 4BIIA 1GQQA 4NG5A 3WMWA 4E32A 4FW8A 7MDHA 4PLTA 4AJ2A 3WXBA 1NFQA 2PFGA 1A7AA 4PLGA 4ND3A 1ZK0A 4BKPA 4YJFB 2O3JA 3WBBA 2H5LA 1UP7A 4RPKA 4EBFA 1IPFA 4IQGA 1DJQA 4U0JA 1O6ZA 1R0SA 1VM6A 3K8ZA 3WWZA 2DBRA 5G4LA 1A72A 4Z9YA 1HDRA 1YS4A 3D7LA 4PLHA 3V5NA 4OIMA 5ER9A 1QYDA 4JLWA 4YTEA 1TA4A 3ZWBA 2G1UA 4XEHA 1UXHA 2C7VA 4JGBA 1P74A 3FD8A 4QQRA 3WICA 3TF5A 2Y05A 4DIBA 3QSGA 1B8PA 3SVTA 3H8VA 1DLIA 1TLTA 2QZZA 3JYLA 4I5FA 4XGNA 3G1UA 4H7PA 5ENVA 2Q4BA 4BNIA 3QY9A 5F21A 2NWQA 3OIDA 1M75A 3ZWMA 3WYBA 2VRBA 4GX0A 4RVHA 4ZRMA 1H2BA 1R4MB 4IBOA 2DUUA 1DOHA 1SAYA 4CLHA 3GDFA 3DFUA 4BNVA 4JBIA 1A4IA 2RIRA 3EDMA 3QLJA 2YJZA 3NKLA 4Y9DA 3RUCA 4B79A 1R15A 1EEHA 2D59A 3DFZA 1LRLA 2PH3A 4RO0A 2ZTMA 3K30A 1RYDA 3OEWA 4RF3A 1NR7A 1DDOA 4CMGA 2WYWA 6LDHA 2Y0CA 2VYVA 4CPDA 2HAEA 2CVQA 2ZK7A 3PQDA 4IDBA 1WPQA 1UH5A 3D0OA 4AG3A 3IL2A 4EEXA 3ICCA 5T67A 5L51A 3OEYA 1BW9A 1HDZA 3FNEA 1ULSA 1BTOA 1YDEA 3TZCA 4D79A 1O95A 4GI2A 3LYLA 2X1HA 4R9SA 1E3JA 4ZQFA 4MIEA 3TRIA 1DLJA 3FBGA 3QVWA 3RFXA 1GPJA 3ZWWA 1OI7A 4MVJM 2VHYA 4XYBA 2Q1TA 3HN7A 4BGVA 2V7PA 1ZK1A 4OOFA 4U6QA 2B5WA 2IZZA 4EZBA 2C5EA 2VRCD 1D7OA 4H3VA 4OH1A 4Y8VA 2X0JA 1DRWA 3PQFA 5T6BA 2VQ3A 3AOGA 3QVTA 1U3VA 2J3HA 4YJDA 1PTJA 3PVZA 3RUDA 1X0VA 1GV1A 1Q7BA 4EEZA 4XCVA 4PLVA 1MLDA 4KUHA 5ENDA 3L77A 3SC6A 3UCEA 4QX6A 3ADPA 3JQFA 2JFGA 5DDIP 4RPGA 3CMMA 1NNUA 4WEOA 4ROSA 4WUVA 1QV7A 2TMDA 4RCVA 1TEHA 4YCAA 5TS3A 3T7CA 1VJ0A 4A27A 1JN0A 4XQEA 4I9NA 3CH6A 3RC1A 2O3QA 2HCTA 3AI3A 3AUSA 1JKFA 1AXGA 3QA9A 4ALNA 4RVFA 5B4VA 3LK7A 4B4WA 4TKLA 3IJRA 2I6TA 3DBHA 2UVDA 3KUXA 4L0QA 5IDWA 1ZBQA 2QYSA 3JD1A 3VZQA 2NVBA 3PZBA 4L4SA 4FC6A 3GQVA 2O23A 2EJVA 4HUJA 4FS3A 5B4TA 4CMKA 2LDXA 3RUFA 1KYQA 1P1IA 3FPCA 2VZ9A 1HLPA 4P8RA 4GGOA 4RORA 3BTSA 3ZZNA 5L45A 3DMTC 2IXAA 4LCEA 4E2XA 4J9VA 4IDDA 4L8VA 2PK3A 1ZK4A 4JP2A 3PJGA 4CLOA 2ZKLA 4CM5A 4TZTA 1E7WA 3DDNA 1C1XA 2JCXA 3JQCA 2BGLA 4H16A 2CSUA 4IQ0A 4NZ9A 4E2ZA 3X2EA 3ZCXA 5KIAA 5IDQA 4RPLA 3UXYA 3VZRA 2G5CA 4GSKA 1XIVA 5EMHA 5HM8A 2OP0A 4XRGA 2Y1EA 4I5EA 4QO7A 5IZCA 1UXIA 2AG8A 3H9JA 1CRWG 4IY1A 3OQBA 2YUTA 1HE3A 4GH5A 1HSZA 4GX1A 4YJHB 2V6MA 4KDEA 4EITA 3CEAA 1LRKA 3KHUA 1PQWA 5KJEA 3SXPA 4MVJG 1BRMA 1YBMA 1Q1NA 3PWZA 4MIOA 4GWGA 5K9ZA 1E1NA 1WXDA 4CMIA 3FR8A 1LRJA 1Y9AA 2WDZA 3DZFA 2X23A 5JSFA 3WX0A 1DC4A 3E03A 2O3SA 1ID1A 5ILOA 1QG6A 1B14A 3ANLA 2DVMA 2GCGA 3MJTA 3NDJA 1Q0LA 3E1KA 5FWNA 3PK0A 3ZU3A 2C7GA 4MDHA 4OQYA 3V2UA 1N9GA 4NMHA 1UZMA 3X2FA 2B36A 4RJTA 2B4RO 1EUZA 3GT0A 3MJVA 1GPDG 3NEPX 3EMKA 2NTJA 3R1IA 1BHSA 4PVCA 3PHJA 4FC7A 1A9YA 4P4GA 2Q49A 3LT1A 4OL9A 4D43A 3FWZA 1UZNA 2P4QA 2BGKA 2WEKA 1YVEI 3DO5A 4ALKA 2P5UA 1XU9A 1E6EA 1H6AA 1SEPA 2ZIZA 3NTRA 3H3JA 4Q3BA 1F0YA 1LDNA 3T7EA 1Z75A 3Q2IA 3UHAA 1E7YA 4PG6A 3BHMA 4GLLA 4J7XA 4IGEA 4R4JA 2JJYA 4Q9NA 3ZW8A 4ALMA 1LU9A 1V6AA 5ADHA 3R3JA 1E6WA 2VUSA 4CMCA 1HDYA 3WLFA 3D3WA 4AJEA 2JL1A 4WLUA 4D42A 1W8DA 3GAZA 3U3XA 3OM9A 2GPTA 2HMVA 3LC2O 4MINA 2XAAA 2OXIA 3BTUA 1U3TA 1N5DA 2YDYA 5IDYA 4JN6B 3RD5A 4UVEA 5F1OA 3I9OA 2OL4A 2W2LD 4AJLA 1PWXA 1ISFA 5L7TA 1NM5A 3MJSA 3ONFA 1HYGA 2QYTA 1JTVA 1N1EA 5ILGA 2PWZA 3SBOA 4ZA2A 1WLYA 2C07A 5EPOA 2ZQZA 4ITUA 5BNTA 3AU9A 3ZNNA 3H2SA 3W1VA 3A06A 3ETEA 5EL0A 2VNSA 3OQ6A 3NJ8A 1YOVB 1B2LA 4JQCA 5JAQA 4EI2A 2Z1NA 3DBRB 2YQ5A 4M49A 4Z6KA 1HT0A 4BNNA 5EESA 2GR9A 2X9GA 3U0BA 5L9AA 3ZN2A 1GZ6A 2ZB7A 3CMCO 3EVNA 5A5FA 5KVCA 4KMSA 1QXSA 3UUWA 3NAQA 1Z73A 5HRUA 4FFLA 1XWFA 5JMPA 4YJGB 1LSJA 3JV7A 2GZ1A 3U4DA 1F8GA 4R1TA 2JCYA 5CDUA 5JYDA 5TLSA 4EW6A 2EERA 1WAMA 5EERA 1XKQA 2VHVA 3C85A 1H0KA 3JQ9C 4ND1A 3HN2A 2VUTA 4U6SA 4QSMA 1ORRA 1ZO8A 4J7CA 4YEDA 4YAJA 3WSVA 3HB4X 4YJGA 1XLTA 2X22A 4FFNA 5KJCA 1B8VA 1PJ2A 1NWCA 3KXDA 3DB2A 1V35A 2CDAA 2VOJA 3H9GA 4R69A 3UCFA 3MWDB 4JJGA 2I66A 4DLAA 1VJ1A 5DBGA 5F1PA 2CUKA 2RHRA 4E6PA 4LW8A 2HJSA 2YHUA 2J3KA 3FNGA 1O5IA 4BKOA 3D4PA 4NIMA 1X15A 2FR1A 3WIDA 2WYVA 4D3FA 4JNKA 1YB4A 2E49A 2PZMA 1MV8A 3D64A 3HDHA 2AEMA 3H3FA 4N18A 1EVIA 3VPSA 2FWMX 3PQEA 4M55A 1KC1A 3Q3CA 3WTCA 2DQ4A 2OMEA 2JAHA 3VPHA 4YQYA 2D8AA 1XDWA 1PQPA 1YONA 3KRTA 2C82A 4PCVA 3ETDA 3WLEA 4NR0A 5CPBA 1IULA 2H1SA 3OJOA 5A1TA 3V8BA 1LBEA 4DVJA 5JDCA 4IIUA 1ZW1A 3BMOB 4BO3A 5JW6A 3OJ0A 4YJFA 3D3WB 5BNFA 3HADA 2JD0A 2ET6A 5AXCA 1PEDA 2WYUA 2JD1A 5C7LO 1DRVA 4E5KA 2YZ7A 4R68A 2AHRA 2YV2A 1WDKA 2EEZA 3JYPA 4QEDA 4CM6A 3I4CA 3LVFO 4ILKA 2QRJA 4GLOA 2IYPA 4AJ1A 3V1TC 5KKCA 2AE2A 3ENKA 1P1RA 4NK5A 1PGOA 1YE3A 4II2A 4RF5A 2FSSA 4O5OA 4WCFC 5A9TA 2GN8A 1LC0A 3GA0A 3CE6A 3FTPA 5THQA 1ZK2A 3ULKA 3VZPA 3GFBA 3CINA 4FB5A 1ZXLA 1NTOA 4NI5A 2E48A 4R1NA 2OOSA 4ND2A 4Z3KA 5GZ1A 1UDCA 2FR0A 1EE2A 3D1LA 3JQ7A 3ZNPA 3V1YA 1LDYA 1CETA 3WQSB 4DA9A 5JS6A 4UVHA 4PVDA 2J8ZA 5G4KB 5L7YA 4BOYA 1AXEA 3ITDA 1DC3A 1A9ZA 2PTGA 4QECA 2VCYA 1WMBA 3CIFA 3DXFA 3FF4A 5F5NA 4YAIA 4TZKA 1O94A 5JAIA 4HX5A 3IS3A 4TKMA 1C0PA 5JYEA 1HDOA 2OFPA 4BNHA 4PRLA 1CQIA 1O89A 1GUYA 3F5SA 1ZXBA 4PIVA 1BGVA 3D5QA 5DULA 3OQ1A 1NPDA 1TT5B 4D3SA 1YOVA 3U4HA 3LC1O 3PWSA 1JVBA 1WW8A 2PD6A 4A10A 5JMWA 1BG6A 3IIEA 5EINA 1RM5A 2BF7A 2YQ4A 3BMQA 2QQ5A 5JO9A 4II3A 3SEFA 2F1KA 3U4CA 3QIVA 1QV6A 5AQ1A 1NQAO 5K0ZA 2DLDA 2EKLA 1J49A 4DQUA 1TT5A 4BB6A 4BNYA 1FF9A 4PG4A 5F1KA 3PHLA 1RWBA 4J4TA 2X7HA 4ALJA 5ICSA 4K1LA 3M1AA 1C0KA 4GSLA 5IXYA 2FRDA 4R5MA 3JQDA 1AHIA 5JCJA 1ZJZA 4Q39A 3NT2A 2IRWA 3TNLA 2Q2WA 4GX2A 5I7SA 1LDBA 2Y0EA 2GZ2A 5U4QA 3GLQA 1BVRA 4IMRA 1WZIA 1KY5A 2GRAA 2JCVA 3DR3A 4J49A 3ASVA 4IJVA 1DHRA 1QYXA 4Y6RA 3RBXA 5GMOA 4EUFA 2VTDA 2HK9A 3NV9A 1MFZA 5A9SA 4L76A 3C24A 4B7CA 4R01A 3IQDB 2NQTA 4B8ZA 3I52A 5T8KA 2OP1A 3VH2A 5IFLA 1D3AA 2X0IA 4DMMA 5L4LA 3JYOA 5JE8A 2ZYDA 2QG4A 1E1LA 1LLDA 3V1UA 4HBGA 1G0NA 4PLCA 5H81A 3WOHA 2BFOA 1IE3A 1NXQA 1Q2XA 3MJ4A 3RUHA 1E6UA 2EKPA 3RROA 2FY8A 3VHRA 1I0ZA 5GY7A 2B37A 1ENPA 4XA8A 1N2SA 4E13A 3H9UA 4RZHA 2HKIA 2DC1A 4UEKA 4CM9A 3HE3A 4JBHA 1PJLA 3OH8A 4D0SA 6ADHA 1SO8A 4IZIA 4UVGA 4D3DA 2UYYA 1VPDA 1N8KA 5LC1A 1UP6A 4NNJA 2W98A 2GDZA 2NVWA 2EKQA 4LCJA 5A03A 4CR7A 2Q4EA 4XQ9A 4DQXA 3L07A 3UN1A 2O3TA 1ENOA 1WWKA 1TI7A 3KEQA 3G17A 4IJWA 3NYWA 2ZYAA 4OKNA 2DUWA 5AXBA 5I9LA 1ML3A 1ARZA 2JKVA 3AFMA 3DQPA 4UAGA 4AJOA 4BNZA 3M2TA 1JU9A 5TQVA 2HMWA 3DONA 3PYLA 3JQGB 4MVJE 3WGYA 3IKTA 2GSDA 1LDGA 3PI7A 3ZU5A 4QT0A 3WGQA 1JA9A 3WMXA 5KJ1A 5FF9A 3WFJA 3ZU2A 3WSWA 2OBYA 3F6YA 2BMAA 4RF4A 3HNPA 1HTBA 1PL6A 1NFRA 4W6ZA 1NYTA 1UR5A 1GCUA 1ZFNA 4NJOA 1FXSA 4FN4A 5JBIA 4YAEA 2R6JA 2FR8A 1E5LA 3AY7A 3RCBA 4PLYA 2VWQA 4FBGA 4XR4A 3WR5A 5DCWA 4CV0A 2EGGA 1MGOA 5KKAA 4BL5A 4BQPA 4AJKA 5C5IA 1BXGA 3LLSA 2X5JO 1Y6JA 5CHEA 5B4UA 1ZZEA 2HRBA 2Y93A 1NVMB 2PKQO 3QVSA 2PD3A 3JQAB 4KOAA 1LUAA 4CL8A 3OSUA 2OHXA 4YB8A 4M8SA 4IUYA 3JQ8A 3PYXA 3ZHYA 4DUPA 2VZ0A 4YT2A 5A02A 2EW8A 1P1JA 4IS2A 5HA5A 3TN7A 1PJCA 4CLRB 5K6AA 2X4GA 1YRLA 2Q46A 4F45A 2B83A 2O4UX 3DAFA 2HLPA 4OAQA 1YKFA 3GF4A 1JWAB 2RAFA 3IP3A 4WCFB 5DCYA 4NHEA 4BMNA 4J0EA 4CQLB 1K89A 3AI1A 3DHNA 4E5NA 3S1LA 3TQHA 4CV2A 1WZEA 4L4XA 1L7EA 2IE0A 1IUKA 3HHPA 1PR9A 3VH4A 3JQ6A 1BDBA 1I36A 2C2YA 2D5CA 2GASA 4J9UE 4FOSA 2CDCA 1K6XA 5EQFA 4B4VA 1U5AA 4HNHA 1YL7A 2Y1OA 2ZB3A 4OSPA 2AW5A 1F17A 1NASA 4E4YA 1E3WB 3GAFA 4P38A 3JYQA 2X58A 3JQEA 3WGOA 4CLXA 4FJ2A 1C1DB 5A9SB 5KVVA 3RC7A 4ZRNA 4PLFA 3DHYA 4L9RA 5F5LA 2Q1WA 3QWHA 2PD4A 3ASUA 3F4LA 4O0LA 3OFSA 1P1KA 4GVLA 3BMCB 3BAZA 1I32A 2P91A 3V2GA 1WMAA 4DTIA 3NUGA 4E21A 2V6BA 4FD3A 4NBVA 2NV6A 4WASA 1RYEA 5BSEA 1MC4A 2WWRA 1PL8A 1YGYA 1FMCA 2J3JA 4WLNA 3KOUA 2UUPA 4AJNA 4WPGA 1TXGA 3OIGA 1D1SA 4XRRA 1ISGA 1LC3A 4CM7A 5G0UA 3H65A 1KOLA 1HKUA 4PZDA 3RWBA 4HXYA 5A4DA 1ADCA 3CTMA 5G4KA 2XF8A 1RM0A 1UAYA 1LDMA 1HL3A 3ON5A 4KUGA 1YH3A 3E9NA 4IDGA 4LMPA 1GU7A 1LEHA 3VVBA 4OKIA 2DFDA 4D0RA 4R3WA 1X1TA 3E8XA 1OAAA 4Q3CA 3STHA 3U9LA 4P22A 4R3NA 3IAHA 3I9JA 4JJFA 2O3UA 1ZSYA 1VSUA 3DAGA 3WWYA 4F3YA 1NVGA 1GEEA 4KTVE 4RQTA 1T4DA 4WLVA 4RL6A 3F5QA 3HFGA 1ZNQO 4LGVA 2AQ8A 3RC9A 3RKRA 5H83A 4AVYA 1EK5A 2Y1CA 3UH1A 3FCOA 1GTMA 3OHSX 1W6UA 1ZEJA 3G49A 3ONEA 1UP4A 3W6ZA 1JKJA 1OBFO 1DFGA 2J5KA 2X0NA 4B3JA 1Z45A 4NBUA 1E7QA 1JQBA 1B3BA 1P1FA 3NTQA 1P44A 1B7GO 2VN8A 1VL0A 3EHEA 4BO1A 1BWSA 1U8XX 3O26A 1YQGA 3RI3A 1RM3A 1KEWA 3WQRA 1Y8QB 1ADBA 3KB6A 4N5MA 4BNMA 1GQ2A 3ZWPA 3AUUA 2YYYA 3K5PA 4UREA 1R37A 1YBVA 3EYWA 3ONDA 2UV8A 3ZV5A 1DAPA 2BH9A 1E7MA 1SB9A 1DC5A 4B4UA 4BNJA 5L4NA 4LMRA 3OBBA 4U5QA 2B0JA 1HXHA 4P4LA 2PKRA 2XXJA 3O8QA 3S2FA 5HBRA 1GD1O 3EC7A 4J91A 3GEMA 2YFQA 1P0FA 3UOGA 1NBOA 4RVUA 2RHCA 3QRWA 1EFLA 4QXMA 5C7IO 1MXFA 4YBZA 3DZGA 5T5QA 4CMAA 3O03A 1I2BA 1XQ6A 3N58A 4BO9A 2VWHA 2QX7A 3P5SA 1XR3A 4JROA 1T2AA 1PX0A 3VTFA 1XSEA 1HZJA 4M87A 2DAPA 2D4AA 4MP8A 1E3LA 2H9IA 4NU6A 4CQMA 2RCYA 2Q1SA 4XYMA 3AM5A 1DBVO 4DMLA 2W2KB 3E9MA 3VZSA 5CEJA 5DBIA 4EYEA 3GPIA 4D44A 2ZCUA 1E7RA 2Y99A 3S2IA 5JCJD 3QHAA 3DBVO 4R41A 5JAZA 5CEFA 4Q3DA 3AM3A 1YQDA 4DPKA 4BQRA 1IPEA 4IDAA 2EGHA 2VOEA 4PG5A 4XJTA 2BI8A 2EP5A 2VT3A 3BHIA 2BGMA 1DIGA 1DSSG 2C20A 3DMYA 4GQAA 3Q9UA 4OHUA 4EGFA 4DIFA 3EY4A 4AJIA 5KVQA 4TMFA 3GVIA 3U62A 4M89A 4C4OA 1HDGO 4ZQEA 2P5YA 1UXJA 4FFMA 3NGXA 4G5HA 4DBZA 3VTZA 3VKVA 5I8ZA 5AXAA 1R0KA 2C2XA 4RF2A 3WFIA 1BSVA 3H6KA 4XJSA 5AYVA 3GR6A 3VDRA 3R6DA 5TSDA 1HDXA 3AOEA 3VPGA 2VHZA 1U7HA 5CP8A 4YT8A 2VWGA 1QYVA 1PJTA 4W7HA 4DPMA 1N92A 2C59A 4OXNA 3TZKA 7ADHA 3AU8A 1ZCJA 2D1YA 1TB4A 1H6CA 3E5RA 5DNAA 2VYND 5TJHA 1PS0A 4AL4A 4WJZA 3H5AA 4GVXA 3VAZA 1N1GA 1XG5A 3C8MA 3MJEA 4A5OA 1PS8A 1TT7A 2Q50A 3PIIA 2P9CA 1C3VA 2R2GA 2ZQYA 4Q3AA 1BXGB 2EWMA 3EW7A 4FIZA 4OQZA 3BMNB 3UF0A 4ND5A 1A4UA 1LJ8A 4IJKA 1KVRA 1VE9A 5C7OO 2I9PA 5T8KC 3PLNA 4I5DA 3WTBA 3ABIA 3LT4A 2OORA 1X7DA 2Q99A 5I7VA 3OJFA 3ROKA 4FJ0A 4X54A 1N7GA 2W4QA 1C14A 4MOWA 2B4TO 1M2WA 3UAGA 5EQDA 1GUZA 1ENZA 1T1RA 3UGKA 3RAJA 4WKGA 3K6JA 1W0CA 3PEFA 4S3MA 2Q2VA 4J1NA 3ZDFA 2X0RA 5IZCC 3NDRA 2OBNA 3P2YA 2VZ8A 1XEAA 4ZJUA 3I5MA 5DP1A 2R00C 1I3KA 3CZRA 1LQTA 2VRCA 5TRTA 3LSYA 2X86A 4HP8A 1KVUA 3RJ5A 3DTYA 3A9WA 3ST7A 4R1UA 1LLUA 5K6AC 3PJEA 3JSAA 3VH1A 1GY8A 5A9RA 2BELA 4XWYA 3T4XA 1G6KA 3P19A 2IZ0A 3M2PA 3CXRA 1B15A 2J3IA 4JIGA 3ZV6A 2NSDA 1UZLA 4XDYA 1DRUA 1E0DA 5IG2A 4K6CA 5J23A 1MP0A 1K0UA 1VI2A 1R16A 1JDJA 4I9UA 4A73A 4YT4A 2H6EA 1NAHA 1UXGA 3GEDA 4DWVA 3I23A 3ZNQA 2PNFA 1QLJA 3MWEB 5IDXA 1CERA 3ZHBA 4GMFA 3AUTA 3RU9A 3PZRA 4B7UA 3RUAA 4W4TA 1ZJYA 4IXTA 4OGWA 4YRBA 2Z5LA 1P31A 3FHLA 3GOHA 2VYVD 1Z7BA 4D45A 1R4NA 1T2DA 5LDGA 3JD3A 3DTTA 5T64A 1H9BA 4UEJA 1GL3A 4R54A 3JTMA 3AFNA 3ICPA 2AMFA 3D3EA 1EUDA 1AHHA 5JFOA 3WGZA 1L7DA 3MZ0A 2W2KA 4KQXA 4FQ8A 3BTOA 1VL6A 1Q7GA 3BMQB 1HE2A 4IIVA 1IYZA 4J1QA 5B37A 4RLSA 5CDYA 1IZ9A 5T57A 4DYVA 4UUMA 3GHYA 2Y0DA 1NQTA 3GNSA 1ISMA 1KVSA 3H5RA 4JK3A 3AM4A 1MA0A 1TVEA 3O4RA 3HFSA 2WJPA 4GL4A 4XQCA 4Z9FA 4C7KA 4CM4B 3QE3A 4NJMB 2P9GA 3DWFA 1X7HA 1N7HA 4Z9XA 1YL5A 4ZN6A 4N7RA 4B8WA 3R3SA 4K26A 1I2ZA 4BNFA 4AJHA 1H9AA 1Q7CA 3DEYX 1UDBA 3AJRA 3IDSA 3W6UA 2CD9A 3DAPA 3TFOA 1FDWA 2GZ3A 4FPXA 2WSBA 4IS3A 3KZVA 3WJ7A 1EUCA 2GYYA 1DFIA 2XXBA 3BXXA 3BMNA 5I7FA 1GR0A 3PHIA 3H2ZA 5G0TA 4MVJH 1OZAA 2HJRA 3SJUA 2AEJA 2JAPA 1N9GB 2ZYGA 3KYBA 3FN4A 2P4HX 2AG5A 5DCUA 1FDSA 3QP9A 4YAGA 2B4QA 5L4SA 1ZH8A 3KO8A 2NQ8A 3HB5X 3TFQA 1IHYA 4CMEC 4IGFA 2NVUA 4MP6A 1HSOA 3LF1A 4R9RA 1X14A 1EBUA 3M6IA 1LX6A 1NFFA 1ZK3A 1CYDA 3WBFA 4G81A 4MPDA 1K6IA 4D7AA 2DTEA 4M86A 5FI5A 5I8WA 1RM4A 1V3UA 4W9NC 1I2CA 5L7WA 3KEOA 3FPLA 2DKNA 4E0BA 2HO5A 1SMKA 4EJ6A 1DIHA 4LVUA 5HS6A 1S6YA 2YV3A 3AOEC 2C54A 3WGIA 3T4EA 3TZQA 4OSOA 4FSHA 2VHWA 5BR7A 1GYPA 2AQIA 3GGOA 1UDAA 4RPHA 1ENYA 3JQBA 3NT4A 4OOEA 3ROMA 1QLHA 3SC4A 2SCUA 3N7UA 2D3TA 3INTA 1EMDA 2Q3EA 1BXKA 2HRZA 4PN3A 4XGKA 4XGIA 1T2CA 3JQBC 1I01A 3ZWVA 4B7XA 3OECA 3A4VA 3K2EA 4Z0HO 1W73A 1JKIA 1H2HA 1Y5RA 1GCOA 2ZJ0A 4JXKA 2EW2A 1UXKA 2GN4A 1CWUA 2D0IA 3VH3A 4DPLA 3WG9A 2EV9A 4AJJA 1M6WA 3C7CB 3C1AA 1G1AA 4KDFA 1JVSA 4C7JA 1H6DA 3ZW9A 4A7PA 4GBJA 3K9QO 4MP3A 3GUCA 5LDHA 4NPCA 1EDOA 3PLRA 1H5QA 4A03A 1D8AA 1LLCA 1LSUA 1PZFA 2I3GA 2Y68A 1PSDA 5BQFA 2WD7A 4GKVA 2AEFA 4WK6A 4Y67A 1B26A 4JX8A 3BMCA 4MKRA 1B16A 4DREA 5KCZA 4E5MA 1RKXA 4QTZA 3QVXA 3IUSA 1YJQA 2GF2A 4TRNA 4YR9A 4ALLA 3WJAA 3GFGA 3PGJA 4MVJI 4NBWA 1XQ1A 1E3WA 4L4RA 4BVAA 4OXYA 3GZ4A 3MTGA 3PFWO 1SC6A 4CMHA 4KWHA 5DP2A 1E5QA 1I5RA 2F00A 3EAGA 3KLMX 4BHTA 4Z3DA 1LQUA 1F14A 1PJSA 3DZBA 4GX5A 3HWRA 4CV1A 1U8FO 1Y7TA 3CKYA 1T2FA 4RGBA 4U7WA 1MG5A 4LSMA 3JQFC 1SCUA 3RBVA 1M67A 4DGSA 1P3DA 4XQGA 2WE8A 5BSHA 5IZ4A 3H5NA 3F4BA 4UULA 1LTHR 3OF2A 3TJRA 5B12A 3KBOA 1GDHA 3F47A 3UICA 3PDUA 4CM1A 1M76A 3W8DA 4HFMA 1Z74A 1R0LA 4BO2A 3I3OA 4EJ0A 3NDIA 1QYCA 4J2HA 3TPCA 2DT5A 3Q1LA 4BB5A 1PJ3A 1T4BA 3JD0A 3GK3A 4KUEA 2C5AA 1C1XB 3VKUA 4EUEA 3G0OA 1JLLA 2UUOA 1I3NA 2J5RA 1YBAA 4YRAA 1KETA 1W4ZA 1E3EA 4W9NA 4A0SA 2CVOA 3L6OO 1C0LA 5COAA 1KIFA 3TWOA 3WNVA 3I9LA 3F9IA 2BLLA 3IUPA 1SOWA 3KM0A 1YB1A 1DIAA 1B0AA 1KVTA 2DM6A 2Q45A 3FSRA 3U4IA 5TF4A 4E30A 2NU6A 4DQVA 4W99A 2G82A 4FFPA 1VL8A 4YRDA 2FPPA 3IP1A 5G2OA 1OC2A 2QHXA 4HFNA 2PV7A 4CMBA 1P0CA 3GN2A 5AXDA 5EIOA 4CLRA 4PG7A 1VKOA 1PWZA 1T26A 4CODB 4ZVVA 2ZB4A 4DLBA 3RU7A 1BMDA 4Q3EA 3ZV4A 5CEEA 3DZHA 4E2WA 1D1TA 1QMGA 1KS9A 3WGHA 1ZKMA 3KETA 4F6CA 1AUPA 2BI7A 1GADO 1JAXA 1YQXA 2GLXA 2IODA 2NU9A 3GVPA 4IXWA 1Y8RA 2Y1FA 3A1NA 4WNCA 4CM8A 1XA0A 3KTDA 5DZSA 4YXFA 5JPIA 4MKXA 1FDTA 4YACA 1V0JA 1U3UA 3HDJA 1EFKA 1NPTO 3H7AA 5DN9A 1ONNA 3GDGA 1U9JA 3I6IA 3EUWA 3FWNA 4FGWA 2VT2A 5A5EA 3LT2A 1Y5MA 3IKVA 5ITWA 2DTDA 2CNBA 2E4AA 5IAAA 4J0FA 1A71A 5BSFA 5JDIC 4JBGA 1XCBA 3ZWNA 2HMSA 1MC5A 3GVHA 4XX0A 2V6FA 4L73A 5U9CA 2A92A 2WTBA 1SOVA 4YJHA 3C3XA 4HKTA 4B3IA 4ZU3A 3AI2A 5FYDA 5COQA 1QSGA 1EK6A 2BRUA 3C1TA 1U4OA 3L9XA 5TNXA 2O7QA 1SZJG 1SBYA 3ROPA 5ER6A 5ES3A 3ZWOA 3BYZA 1R66A 3OP4A 4BNLA 2DBQA 1V9LA 4YT5A 5THKA 5C37A 4LVCA 4MKZA 4UVDA 4DRYA 4URFA 1K5HA 1NQOA 3SJ7A 1UAGA 1X1EA 2HK7A 4LRTB 4RDIA 4ESOA 1O9BA 4J7UA 4YQZA 3DZKA 3KYCB 4A2CA 3BZUA 1PQUA 1G0OA 2GNAA 5TJ9A 1ISHA 5JAMA 1WDMA 2QIOA 2CVZA 4Y6PA 1T2EA 2O3RA 4FJ1A 4UUNA 3W4JA 1U28A 2O50A 1DFHA 3E48A 2FZWA 3OICA 1PZHA 1CF2O 1V8BA 1GUFA 1XGKA 3GUYA 1PZGA 3LDHA 4JP3A 3WYEA 4PRKA 3KVOA 2EIHA 3TOXA 1O8CA 4O63O 3OIFA 3OJLA 3TZHA 4CMIB 4L74A 3TZ6A 3A14A 3F1LA 4I5GA 3ZI0A 1EBFA 3L9WA 4F46A 1FK8A 2FSVA 3JCZA 5JDCC 4CUJA 1KEPA 1GZ3A 3JYNA 2ILTA 1PGNA 5EN4A 4YVFA 3Q2KA 3ZV3A 4CLDA 1HDCA 3DC2A 1HZZA 4XR9A 1ZVMA 3G3EA 1V3TA 1PGPA 1PJBA 4BV9A 4IMPA 5G0SA 1YL6A 3WQQA 3ZH2A 3AUAA 1E3SA 1KEVA 2X9NA 1ADFA 2D2IA 1DJNA 4G2NA 4BNTA 3AW9A 2I76A 2RBEA 4IPTA 5A3JA 3L6EA 3RSHA 5EJ2A 3VPXA 5U1PA 3S2GA 1VRWA 3RASA 4BMSA 4Y6SA 4PZEA 9LDBA 1LA2A 5F3RA 4J2OA 2HU2A 4WEQA 4B3HA 1L1FA 3KSZO 1LSSA 2AQKA 2PGLA 3BTVA 3ROQA 1NHGA 5CG1A 1R12A 5IF3A 4HV4A 3QWIA 2AXQA 4LISA 3NTOA 3V2HA 2XPCA 2Z1MA 4BKQA 4MIYA 1C1DA 2I5PO 3AK4A 4IZHA 3WGGA 4K28A 4J16A 4BMVA 1M66A 1P1HA 3FNFA 1OFGA 4RV9A 1NX6A 2CF5A 3RQSA 1YO6A 1D4FA 4MO2A 3JQGA 5TT1A 2PZKA 3GPDG 2QZ9A 2WMDA 3JD4A 3W4KA 4ALIA 2FP4A 4DYDA 3KYCA 3LC7O 1LSOA 4GAEA 3OA0A 3I9MA 2X5KO 1IB6A 3ETGA 1CQJA 4INAA 3WNQA 3PJFA 4CM4A 3RBZA 4H15A 4BV8A 3PHGA 3DOCA 3PDJA 3DL2A 3N74A 5KJFA 3B20A 3HDQA 3PIDA 3GRKA 4IQ8A 1S7CA 2V65A 2I67A 1LXCA 3PWKA 4CJXA 1OMOA 4U8GA 2GD1O 4K6FA 3PFFA 1VSVA 3RFVA 5KNLA 4GKBA 5HS4A 4ZD6A 3B70A 3PRJA 1NWHA 2VYNA 2W2LA 4XZ3A 4CLOB 2Y67A 5IJZA 3B1JA 5FI3A 2Q2QA 5JDIA 2IXBA 4W82A 1DHTA 2I65A 3VVCA 3B1FA 4KTTE 3DOJA 3AWDA 1I33A 4CLEA 5KOIA 5BSGA 4IDEA 3DZJA 1R4NB 4HY3A 4QFDA 1HF3A 4CV3A 3HZZA 1A27A 1B3RA 1A7KA 1CEQA 1YDWA 5L53A 5IN4A 3BA1A 4BNXA 3LU1A 1IL0A 4OMUA 3FTNA 4PLPA 2DBVO 4NBTA 3GZNB 2BFMA 1EVJA 2B35A 5CDTA 4G65A 2IYOA 3EGOA 5DOVA 1CIVA 1XHLA 3NRCA 2LDBA 2HUNA 2NTNA 3OMLA 2PGDA 4ZQGA 4YDRA 2ZTVA 4QO8A 1X7GA 1EQUA 2GN6A 5AVOA 3ZNOA 4BKRA 1Y1PA 3OETA 3M1LA 3E6AA 1T25A 3PYMA 2YY7A 3WDSA 1U2DA 5GZ6A 4NJMA 1ONPA 4D41A 1MB4A 2POQX 2YW9A 2HQ1A 5JNLA 4W7IA 1ISIA 3GZNA 1Z6ZA 2DBZA 4GMGA 4MJLA 4DLLA 1OOEA 2A9FA 1UUFA 4E2YA 1XYGA 2DPGA 1LLQA 1ZIDA 1R4MA 4BNKA 2FN7A 2VWPA 3PPIA 1PU2A 4IM7A 1GEGA 1X0XA 4Z0TA 4IDCA 1IHXA 1DAOA 5JC1A 3SLGA 4BKUA 3DHEA 4R51A 5AOVA 3C7DB 3I6QA 3ZU4A 2NADA 4LRSB 2H63A 1BDMA 2PLAA 3ENNA 3UCXA 1QP8A 3VDQA 4MVJF 1P33A 1Y9EA 1DXYA 1FDVA 1MXHA 1SEVA 2PZLA 1HYHA 1U3WA 3CZMA 3HJAA 3VPFA 2O4CA 3K31A 4N5NA 4WCDA 3TOZA 1JW9B 2BFAA 3BIOA 3LF2A 4TRRA 1AGNA 3DBHB 4AICA 3D4OA 3B6ZA 1J0XO 2JHGA 1X13A 2A94A 5HWSA 1NP3A 1WDLA 4E31A 3W4IA 3P2OA 3L0DA 2JFFA 5DBFA 1P9LA 1U7TA 1H94A 2D5AA 3GNTA 1MX3A 1ZSVA 2P2SA 2NACA 2BKAA 2O2YA 1ZMOA 5L95A 1PS9A 3DOOA 3RIHA 2UDPA 3L6DA 1DO8A 4KP7A 5L40A 3K96A 1E3IA 4GGPA 1ZSNA 2YDXA 5JC8A 1F12A 5JLAA 4MVJD 1NVTA 2EXXA 1WVGA 4ZGWA 3OA2A 5DT9A 4OYRA 1H6BA 3WIEA 1K6JA 4O6VA 1V3VA 3D5TA 1KY4A 3AY6A 3GMDA 2NTVA 2W8ZA 1HYEA 3GH3A 3KLPX 5CAEA 3GN1A 3INGA 3FRJA 3GC6A 3MTJA 1QRRA 3MEQA 4DXHA 1F8FA 2G76A 2DFVA 1H93A 2IEDA 5JCXA 1KBZA 2DU8A 4BGUA 8LDHA 3F1KA 4NK4A 1DC6A 2GUGA 3FR7A 4J3FA 5CFZA 2ZTLA 3PTZA 4BO4A 5ITVA 2NM0A 1U1IA 3NGLA 4DBVO 1AE1A 3JQ8B 3RFTA 1GYQA 4EDFA 2Z95A 5B1YA 3F46A 3GVCA 3INRA 1HE5A 1ONOA 2OUIA 4XIYA 4WOJA 4WE3A 3OJEA 1NR1A 3GG9A 2O7SA 4J43A 5DF1A 4YAKA 2A4KA 2OZPA 2NU7A 2FPIA 4L75A 1NQ5A 1PIWA 3HQ4O 2FPGA 5G0VA 3ZWXA 4PG8A 2EG9A 4UEOA 3VC7A 1KC3A 4J1TA 1XELA 4TWRA 4QFCA 3Q11A 3O8QB 1LI4A 4TVBA 1DEHA 3FNHA 1O0SA 4N54A 3NJ4A 3KSUA 3LT0A 1EVZA 1AN9A 2GN9A 4K9DA 2AQHA 3RUIA 1A5ZA 4OJNA 3DMTA 4HFRA 1HETA 4PFJA 2CDBA 5BT9A 4YA6A 4M54A 4EJMA 5I7EA 5CDGA 4J1SA 1KERA 4GPD1 2PZJA 2WD7B 4LK3A 5KJ6A 3ZWCA 4U0KA 2EP7A 2JFHA 3EVTA 4XDZA 4BO0A 4CUKA 3GDOA 1C0IA 5FEUA 3UKOA 3IJPA 4EUHA 3AY3A 4I9HA 5MDHA 4XYLA 3S55A 3TL3A 3Q0EA 5LCXA 4UUPA 1Y81A 2AA3A 1DPGA 3BMOA 2X5OA 3WYCA 9LDTA 1KEUA 2CF6A 2E82A 3PGXA 2HSDA 4N5LA 5TGDA 3GMSA 3B1KA 4RLHA 3IC5A 2EJWA 3NX4A 5KWEA 4A26A 4CR8A 3S8MA 4BNGA 2A35A 3MJCA 4J6FA 4BGIA 4RVDA 4D46A 2WM3A 4CMJA 2VUUA 4R16A 4I1IA 3PP8A 1U5CA 4XB1A 4E12A 3I9KA 4BNUA 3ADOA 3QV1A 4XYGA 4O59O 3I83A 5COBA 4NFSA 3ZWYA 3K2BA 2B5VA 4RVGA 2G0TA 3RVDA 3WS7A 2CFCA 3JQ7B 3QWBA 4LN1A 4E5YA 1VJTA 5CG2A 2HK8A 3EZYA 4BO8A 4Y98A 1JWBB 3GGPA 2VTEA 3TSCA 4RZIA 3L4BA 4TVOA 2X8LA 4FDAA 3C1OA 4CUZA 1M6HA 2GGSA 3E18A 1WP4A 3P7MA 4DL9A 4LSWA 4FFOA 4YYZA 1Y8RB 4CM8B 2DTXA 3Q9NA 4NFYA 3COSA 3E9QA 8ADHA 1SPXA 1PGJA 1MUUA 1VC2A 3SLKA 1T24A 1UJMA 3CUKA 4IJUA 3FI9A 3H9EO 3MOIA 2J5QA 5A3VA 2QRKA 2Y66A 4YPOA 1RJWA 1SNYA 2PR2A 1EVYA 5A04A 1PJ4A 2DPHA 3IMFA 5CPFA 1FJHA 2X6TA 1I3MA 3QW2A 3E82A 1R6DA 1BXZA 3NT5A 4DC0A 2CMDA 2BFPA 2ZB8A 4TRMA 1KVQA 4NH4A 2FOIA 3JQAA 4CR6A 4KQWA 5TT0A 4MVJA 4WLFA 3IOYA 3Q6IA 1K2WA 1MG0A 4XIJA 2XOXA 3RUEA 5JY6A 3LQFA 4ID9A 4WLOA 3KYDB 1ISJA 2P9EA 2P68A 3EK2A 5TX7A 2UAGA 1DIBA 4JJIA 3U09A 4QUKA 2NLOA 2YHIA 2IZ1A 1E92A 1GQYA 1GV0A 2X9VA 3GHHA 4BNWA 1Z82A 5ICMA 5JO0A 3I4FA 4HNGA 3MCVA 4OM8A 1BVUA 4JCOA 1BW9B 2TMGA 2E37A 3UVEA 4P4NA 3CPSA 3VOSA 3WB9A 4ZICA 1I8TA 4DIOA 2Q1UA 4RDHA 5TC4A 4CQLA 4RPJA 3WGTA 4OXKA 3KSDO 4R1SA 1QORA 3GRPA 2WD8A 3KYDA 2W90A 1I3LA 2R00A 4WLEA 1I30A 4IINA 4M1QA 4NBRA 1U2GA 4XYEA 5IXSA 3ZHXA 1RPNA 2FHSA 2I3AA 2PGJA 2HMTA 2ZTUA 5FFFA 1F06A 4OO3A 1J4AA 2C0CA 3QWFA 1DB3A 5L3ZA 4AJPA 3BHJA 1IZ0A 3DZIA 5CDSA 4NFHA
chains in the Genus database with same CATH superfamily
3AUYA 2D54A 3B8HA 1J56A 3IEPA 3PQ6A 3LZ6A 4OX9Y 4MGZR 3ZHCA 1J6UA 4ENWA 1EE9A 1SUBA 3MUNA 2QRLA 1XDBA 4A82A 3EXEA 5F7ZA 3GY0A 1R9MA 2GERA 1ECCA 4DCGA 5KZMB 2GN2A 5REQB 3LX6A 1S01A 1ZMXA 1GZ4A 3DBRA 3H6HA 2QRVA 4L95C 5D87A 5HKOA 2CY0A 2PGXA 2X2OA 1Z8FA 1KMHB 3GEGA 2WJ6A 4BVBA 3BQMB 1ZD3A 4URXR 1XTBA 3AR7A 4MUIA 4X5OA 2EC5A 2HF9A 1I6MA 1EQ2A 2I99A 2FTKE 1C2YA 4RH0A 3FH0A 3UBMA 1AK1A 4P33A 4JEHA 5DXJA 4WA7A 5EVCA 1WA5A 4Z4QA 4OQ4A 1JT9A 2CVHA 3FWKA 3UJCA 4HRXA 3WGVA 2G3YA 1OLUB 3KDAA 2J6IA 4ZCRA 1XTPA 4I0WB 2Z6AA 1PZEA 1US8B 1JUDA 1L4UA 1QONA 4B6GA 3DFFA 1OILA 2YZ2A 4Z1MD 4PZCA 4H7HA 3RKUA 3CSDA 5IJ9B 2ZOSA 3LG2A 3U5TA 2C29D 4FOOA 2XMGA 3COWA 5ECYA 5P21A 2AN1A 2D6FA 4GT1A 2W4MA 4C6TA 4U7FA 4RVSA 3R6WA 1TL7C 1GG8A 3TR0A 1P1CA 4YRQA 4LG1A 3WMFA 4Q48A 1K7FB 2I7DA 5KSOA 1W35A 3FE2A 4UVIA 1OB5A 3LYAA 3VO2A 2VDPB 4PSAA 1M8JA 3OPNA 3FYHA 1YJCA 4MRVA 4KR9A 5GZ3A 3PL1A 1QKIA 1YZGA 2PMKA 4FHGA 4IYJA 2VDKB 1S4MA 2EIXA 1Q0QA 2WBLC 1AB6A 1NW6A 2G25A 4RA9B 3DKPA 4IZ6A 5F4BA 4Z99A 1C4XA 2QTCA 4ZP1A 4A8PA 1ZEMA 2Y1WA 4B32A 3HP7A 5H82A 2YV1A 5J4KA 4LTMA 1PDOA 1UQUA 1EZ4A 2OHIA 4WY8A 2NV2B 1RXVA 2F2TA 5TIIA 2P90A 4PO1A 1OI2A 4ZTUB 4UU1A 4DCOA 5EIBC 2CDRA 4C4YA 3VR3A 4D98A 4CMEA 4E5SA 2BM8A 2VUHB 2PWYA 5BPHA 3F7NA 1I24A 4LYDA 1MFPA 1Q3TA 1HT2E 2NU8A 4MB0A 1KH1A 1PL7A 4K88A 2VT6A 4ZDKA 5JALA 2JZOA 4TTRA 5LYYA 5BWNA 4RQUA 1MO6A 3R0IA 3T1HB 4A0RA 3EEIA 1EFDN 4Z86A 2VHCA 3Q9LA 2CBGA 3VR6H 2QUJA 2UZIR 1E7SA 1LNQA 1XWWA 3VVLA 1M8KA 2XGMA 4NCNA 3WV4A 1YXMA 4F4FA 1LD3A 5HTOA 3L7NA 3TLEA 1RIIA 2P8JA 5CFRA 4WGGA 1U7DA 3CGWA 1G8MA 4JP5A 1FUYB 3QF4A 2Q28A 4YS6A 3HG7A 5BNIA 2LCIA 1E6KA 2JD2A 4BWYA 4CLRB 3T9FA 3JASB 4JFAA 7YASA 3MWDA 5KINB 2F1JA 1EIZA 2FW9A 5KX5B 5KVSA 1LPOA 5H16A 1DCMA 4AJ4A 2O7RA 3SVLA 2YNMC 3DMDA 1PKXA 4Q7LA 4I55B 3FVVA 1B41A 2DX7A 3N6XA 5ES4B 3EAQA 4ZHSA 3B36A 2XKAA 3ZE0B 3QBTA 1NP6A 5AJWA 3T1VA 1F2VA 2JFOA 2J3LA 3SM3A 2FZKA 4F86A 3DD5A 3FFTA 3PSAA 4L6CA 1KDOA 3C5VA 1LVHA 2D2XA 3THYB 1R50A 3QQPA 3GPBA 4C0BA 2WFZA 5BSMA 1ADGA 1BQEA 1SOUA 4CM9D 4QYSA 1Z0SA 4HWKA 1AT1A 1Q0HA 3ZDZB 1Y6QA 3ADBA 4TVSA 2HDHA 3VAYA 1PWHA 4X41A 3V4PB 3P9ZA 3C3MA 2VSQA 2WHPB 4CKWB 1YACA 3DC7A 3RK1A 3HDYA 1UBHS 1QH1A 1VJDA 4BIIA 1PYGA 4BCCA 2BW0A 2DHRA 3VO9A 2JGAA 3C3PA 1FYFA 1CEYA 1NFQA 3R3XA 3RDPA 1SXHA 2QI9C 4BY9E 5JCZA 2BM0A 4BLSA 4BKPA 3E35A 4YJFB 5E1DA 4FFVA 4G1CA 5DEOA 4BCDA 1OH7A 3DDCA 3F8WA 2O3JA 4H0CA 3QKWA 4RPKA 1P2TA 2WU8A 1SQ5A 1VPTA 2P41A 2CK3A 4IQGA 4W1RA 1N6KA 2XRYA 4Z8YA 3E7DA 3OE4A 5FP0A 1L5LA 1VM6A 3GJ6A 1FXWA 1TCAA 3UJAA 4AYWA 3I0MA 4XX0B 1BEEA 5EIAA 4N65A 2ZU6A 5TPZD 2DBRA 4L0CA 2W0MA 2E1RA 2XT6A 3L1IA 3LY8A 4HF7A 4QTTB 1HDRA 5F9HA 3AKYA 2JAXA 5E0OA 2FQQA 2FX3A 2FA9A 3GRCA 1Y1RA 2JKYA 3R77A 4FXOA 4JLWA 2IT1A 1TA4A 1FRVA 4HLQB 2CW5A 2G1UA 2EZ8A 3IXMA 2C7VA 4JGBA 3K05A 3FD8A 3LXRA 1N6IA 3OQHA 4KG7A 4ZALA 1A9TA 1JSXA 2BKXA 3FUCA 3LY7A 1B8PA 4XGQA 1V9SA 3DEKA 1EFRD 1VPVA 3JYLA 1XLWA 4H7PA 1R4ZA 4I5FA 5DSTA 4BNDA 3QY9A 3N2KA 2LKDA 3O83A 3RTAA 4JLNA 1F60A 3WYBA 2VRBA 5LU8A 1NURA 4FBMA 4RVHA 3M4XA 3OCCA 1P7ZA 3N70A 4ZRMA 3W2GA 1A50B 1J07A 4KQ6A 3SCZA 4ER6A 4AM8A 1YS2X 3KS9A 4KBFA 1ZM3A 1A4IA 3AQ4A 3NNNA 4WSOA 1JDZA 4IIFA 4WQMA 2X8JB 1RQXA 3EDMA 1V8ZA 2X1VA 3WAGA 1CS4C 4RKEA 3I6YA 2ZSEA 5K8UA 4I36A 1KDTA 1R15A 1WKBA 2P4UA 2FGJA 2QN9A 1Q22A 3N9IA 1DX9A 3OFNA 2H2WA 1QGYA 3K0AB 4GM4A 3RVOA 3TPZA 3FWHA 1C3EA 1NR7A 1XQXA 3QVUA 2CJFA 5HKLA 3BWBA 1TMGE 2CLMB 4G25A 4K3VA 4CPDA 2ZK7A 1D5WA 2QM8A 2BSAA 4IDBA 3EISA 4ASUD 1UH5A 4HX9A 1B4DA 5EQJB 2BZ1A 4CVNA 2EJUA 5CFNA 2ZAGA 4PXAA 5K3FA 5EKSA 3J7AC 4ZAYA 3FNEA 4MK4A 1YDEA 2DWQA 1SQ6A 4D79A 2GAOA 2QTTA 1V2HE 5K0CA 2X1HA 3V8PA 1QOPB 4JC0A 1OFUX 4CBVA 4KO8A 1PNQA 2PSJA 4MVJM 1WXHA 2GNOA 2VHYA 1J90A 4HWOA 4Q7EA 4ZZIA 1PVOA 5A3QA 2B0CA 2CXNA 2V7PA 4PS1A 1L5QA 4ZCQA 3ZCRA 4JYMA 3TLMA 4RVCA 4EZBA 3JARA 2VRCD 1TM5E 5LJLA 2GN0A 3BZWA 1YE8A 4M0KA 1X87A 2J31A 3OZWA 3R7WA 3LAWA 3B1VA 5KOJB 3NONA 2IWRA 2JJ8A 1D2CA 2OHHA 4ZJYA 1KZHA 3N8KA 3RUDA 4F2DA 5ITZB 4NZYA 2GXQA 4PXYA 4PLVA 2WABA 3I76A 5CBKA 4KUHA 1DAHA 2JLZA 1P72A 2AR0A 3LFTA 3HLTA 3L77A 3SC6A 2OESA 2GXSA 2PVPA 3IIKA 3F0TA 4KE6A 4JXZA 1UBGA 1MB3A 3PD1A 4NOLA 5DM2A 4C1NA 1RHKA 2B4YA 4TS9A 2QVYX 2Q2OA 4GBED 1OXUA 4X1YA 5G1NA 3CMMA 3C7TA 4ROSA 4WUVA 1QV7A 2TMDA 4RCVA 5CJ2A 5EZ5A 5TS3A 5BORA 1VJ0A 3EGXB 3I2KA 4IICA 4I9NA 3CH6A 4NICA 1JKFA 2VDMB 5TQ0B 1OXTA 2WJJA 1RJ9A 3JWJA 2GJ9A 2VTKA 4L5JA 4RIFA 3BWVA 5IXJA 4TYWA 2BCGY 4WESB 4TKLA 3DTVD 2F4NA 3IJRA 3IT3A 2ZVQX 1DVRA 4B4WA 4YY3B 2QUKA 2IDMA 1GKYA 4MUXA 1OI4A 1WSBA 2WJGA 3PKIA 4R8LA 13PKA 1N5OX 4RXMA 4DNFA 4GZ5A 3PZBA 4L4SA 2FDRA 4D80A 3GQVA 4JVSB 2FJPA 2O23A 3IVCA 4GYYA 2XGGA 4P4TA 4PGHA 3R5KA 2NO0A 5FEMA 4YP5A 4CMKA 1G3IA 1JQEA 3T15A 1KYQA 1Z22A 2VZ9A 1MENA 3M83A 4CHTA 4EARA 3L8YA 2OM2A 1IXSB 4DCUA 2KX7A 4BQFA 5BVGA 5MN6A 4ESHA 4P31A 2IXAA 1MTZA 1WMEA 2PHZA 3TL6A 2HX1A 4CDGA 4L8VA 1TF5A 3A9CA 3CUEF 4DJTA 5JAUA 1ANKA 2EQBA 3VC3A 4BZZA 1E7WA 4CM5A 3GGJA 3R3ZA 1IN8A 1C1XA 3EIHA 2BGLA 4H16A 4YDQA 2CSUA 4CU2A 4B3TB 1NMZA 5EIFA 5CW2A 2XT0A 3UMJA 1ZJJA 1I3OA 1OFUA 3HBFA 4HOYA 4L3VA 4K6MA 4OGLA 3ROEA 3QE0A 5CT9A 3N5KA 3VDXA 2G5CA 4GSKA 3H2GA 2C04A 2J41A 4G89A 1XIVA 1BA2A 4JR0A 5EMHA 1Z9BA 5EKTA 4EKYA 4UM7A 1G6Q1 4G26A 1P7VA 2ZKIA 4I5EA 4QO7A 1Y9DA 1NATA 1Z0JA 1W29A 1WCV1 1T3TA 2Y2VA 3OQBA 3KKEA 2Q0HA 2VAWA 5DJ5A 3WK6A 4D9NA 2YWXA 4GX1A 2FZLA 1MAWA 4UPDA 3KHUA 1PQWA 2GNPA 4HDRB 4WK0B 3S68A 4W6QA 1SHJA 4HEQA 1Q1NA 1MC1A 4AS1A 4DT1B 3WBKA 2L69A 3PNSA 1E1NA 1MJGA 2QUHA 2DH5A 4MQUA 1CFZA 4RCYA 2IEGA 1SXJE 2X23A 4ML3A 3U7QA 3WX0A 3WYNA 4D4IA 5JASA 3E3OA 5JSFA 1P5JA 3HJGA 3U0VA 3TUIC 1B14A 3NDJA 2GCGA 4DCVA 1Q0LA 2Q8NA 2GZMA 4HQNA 4NZZA 3E1KA 4J7AA 2PH7A 2IV3A 2DH6A 2L42A 5JECA 3CIOA 2HCRA 1FQKA 1WF3A 4COKA 2CLOB 2HI0A 2O0MA 2PDAA 4A16A 3V2UA 2ASVA 2EL7A 4ZKDA 3AMVA 1QGOA 4LPKA 4NMHA 4I50B 2JCSA 1RPAA 1WX1A 3MJVA 2NTJA 2XOEA 3BFJA 3R1IA 3R0ZA 4Q12A 4BKMA 5B6JA 1RMTA 3PD0A 1QG0A 1JDSA 1A9YA 3CNEA 4MPRA 5E2IA 4CKCB 4RENA 1RIFA 2BFEB 1JB1A 1ECPA 2CLEB 3LT1A 4RH1A 5AFSA 1MO2A 2YWCA 2J4CA 4RD0A 4JBYA 1K97A 4FYPA 3H6GA 1SEPA 5C1BA 1W52X 4G9BA 1G7CA 4Q3BA 4EPXA 1WNFA 3J81k 3T7EA 2B1IA 3I34X 4OA8A 3TTYA 3Q2IA 1XA4A 1FYWA 3AX6A 3FMVA 4PG6A 4RTQA 3BHMA 1G42A 4MUHA 3GRVA 1J0AA 1E5XA 2GK4A 3Q8XB 4IGEA 2O1EA 4ALMA 2QL6A 1QB8A 3TJZA 4B3CA 3MXOA 4GKAA 2VUSA 3T99A 1HDYA 1NUPA 5IK2A 4MW2A 3DXXA 3WLFA 1IBMB 1W8DA 5AT1A 3FHOA 5ISMA 3W5UA 4H6PA 4QZVA 4GMHA 4D0LB 3EMBA 3CEMA 1PYDA 1ZHOA 5CBPA 3PNOA 2XAAA 3NV7A 4DN6A 2OXIA 2WJ4A 3H2KA 1XZFA 1OX4A 4JN6B 3UMYA 4UVEA 5F1OA 5HJEA 2A5JA 2OL4A 5CDFE 1FBTA 121PA 1JHZA 1KYYA 4PGAA 3BRSA 1FLAA 1JEEA 3NAMA 1ISFA 1Y4UA 4GHWA 2CLHB 5L7TA 5EWJA 4ON9A 2IZOA 1HYGA 2QYTA 1LS1A 2W2MA 2WILA 3IJ5A 1TQ2A 4IWXA 3AV0B 4OUKX 5ILGA 2JJ2D 5HCNA 3UG6A 4EPVA 1E9VA 2XWPA 3BK7A 4DDWA 5EPOA 2W93A 1SZPA 2HFKA 4NCKA 3VU9B 4E14A 3H2SA 4JWTA 2O57A 4B3FX 2BIFA 4MWZA 5E6RB 1XT6A 2Q6LA 4ED9A 3Q7IA 2VNSA 4JBWA 1GRNA 2J7PA 2LE0A 3NJ8A 1L5HB 2WZCA 3R75A 2EX1A 3B2QA 5JAQA 3NBMA 3DBRB 5FPKA 5DXFA 3WLPA 2WUDA 4EL5A 1Z56C 3CLUC 2H18A 2X0EA 4X7MA 4A1OA 3RF6A 1OKKD 1VSTA 2R3SA 2QVZX 2KE5A 1BJRE 3VMMA 5L9AA 2X9GA 3FLMA 4YLGA 4C5CA 5DHSA 1NR5A 4Y2UA 3O9MA 2HPHA 4JD5A 1JQLB 4KMSA 2W6OA 2GAJA 3UUWA 2HW8A 2XH8A 3L02A 1Z2DA 1Z73A 2HIAA 3KLNA 1XWFA 5HRUA 3U4DA 4DR2B 5CDUA 3U7FB 2JCYA 3CX6A 1TM2A 4Q21A 3SKXA 1ML4A 3S2YA 3RS5A 3BK1A 4KYUA 5E1OA 3D3QA 5J2TF 3C85A 2R4UA 2V6IA 3O8OB 3JQ9C 4NQRA 5EFOA 4CW7A 4EQZA 3BVPA 1IBKB 1TEVA 1ODSA 1U7PA 3ABZA 3HCEA 3FMFA 1ZI6A 1NJ5A 3NKVA 1KFEB 3PHBE 1ORRA 4J7CA 2C42A 3L3BA 4YEDA 2YV5A 3LA8A 3QIAA 5AW5A 4DDHA 2ZPTX 4IWNA 2XUPA 4FFNA 4LYGA 2HCJB 4RD6A 5KJCA 4DR3B 1V35A 3H9GA 3KJFA 1JEJA 5J2TA 3CKLA 3KUCA 3G8CA 4DLAA 3A6EA 4NBLA 2EFYA 4EO4A 2PVSA 4AKIA 3SY8A 2CUKA 4QYWA 5ELMA 1J1IA 1CSEE 1COWA 2GARA 1W44A 1CQIB 1DRJA 5EQTA 5FJIA 3FNGA 1O5IA 2BONA 3OIYA 4IOMA 1GPAA 3OD5A 3OZAA 5FPPA 3LKDA 2QVLA 3L04A 2FR1A 4HZUA 4HLDA 4TTPA 4O4JB 3RBAA 1FQOA 2E49A 2WMYA 4HUTA 3P94A 1MB0A 2PA0A 3ENQA 4DADA 2FWMX 3HR8A 2XYRA 5TPWA 3A2LA 1KC1A 5DCLA 4IH4A 4C4AA 2YASA 2AYZA 1JEDA 2RCNA 5TMEA 4M98A 1K7YA 1XDWA 2MR6A 4P6VF 5T4HA 2C82A 3TLXA 3ETDA 4BVFA 1L7MA 3WLEA 1SELA 4MS4A 3AL2A 4NXNB 4IMIB 5FA6A 2O5EA 1E1YA 3FCYA 2C9CA 3AG6A 1LBEA 3V9PA 3KB2A 2FPPB 4DVJA 1WCIA 1V1JA 3R44A 5B6PA 5JDCA 3IHLA 2WB4A 2YKGA 2OLEA 1E2QA 2YXEA 4M0FA 3BMOB 2DR3A 4RMHA 4WI1A 3CR3C 1M5UA 3EODA 5H68A 1VPWA 1WPRA 1YVUA 3ZZUA 2A9PA 1BD4A 3IULA 1CC1S 1M6VB 4MYSA 4CF7A 3PUIA 2D2VA 1PEDA 2E3JA 1KO1A 2I3DA 2DGDA 1DRVA 2IPAB 2FUG1 1HFEL 2WUWE 3CWQA 4R68A 4P32A 2YV2A 4RPCA 1I6KA 3NANA 3T3DA 4CM6A 4Q4JB 5AVVA 2CHQA 1PV4A 5IYZA 3CZ4A 1VFPA 3ENKA 2W8BB 1XL0A 3AV3A 3GRZA 3LUPA 4I4TF 1PGOA 1UODA 2VDLB 4HG2A 5B7GA 1M0SA 4WCFC 2ZETA 3ZG6A 1H8ED 2E6KA 3PR1A 1VI6A 2RGWA 3JR3A 1BDHA 4AY2A 3T7AA 1EJ6A 3NBKA 1Y4DE 1ZK2A 3ULKA 3GFBA 3GLFA 3O1IC 1ZXLA 4NI5A 2JGIA 2R1VB 2YC2C 1KU0A 2XTMA 2FR0A 1XNJA 3ZDEA 2P79A 4KN5A 1EE2A 2BJWA 1JMVA 3KUKA 1CR2A 4DLWA 4GRDA 2XECA 3BEDA 2FMHA 5TEVA 3L7JA 3S28A 1NXWA 3LX4A 2BMFA 3UUEA 1QFJA 4D8YA 3O94A 2DQKA 1RQPA 1JIXA 3L0BA 4R84A 2HLDA 3QE4A 4PSCA 2GK3A 4KAJA 3LKVA 3GAMA 2BVNA 2ST1A 1F1JA 1AXEA 1K06A 4W5HA 4D4JA 1XZBA 3QEJA 5AJVB 2PBFA 3CIFA 3NH9A 3NTUA 5F5NA 3I0ZA 1AQIA 3H18A 2CHUA 4FK8A 4WZAA 1EJBA 4ARZA 5JAIA 4MW7A 4ZOLB 3HU2A 3IS3A 5KDOA 2XBLA 5C4IA 2D7CA 1O03A 4PYRA 4YV0A 4P3YA 5E3IA 4LJ9A 4MV0A 4UMVA 2QG6A 5JFGA 4W9MC 1USVA 1YS7A 4FYXA 1CQIA 2EGUA 2PWBA 5DW3A 3C39A 2RAPA 4BX2A 1I7QB 1NT2A 4OQDA 4PIVA 3D5QA 2ZUEA 3OPVA 2FRDC 2MYTA 1TT5B 1IZYA 2V0GA 4K05A 2RI6A 3DE0X 3LX5A 4D9IA 3UTDA 3O8LA 4N6GA 2QDXA 3I32A 4L4YA 5BVHB 3HRHA 3QG5A 5JMWA 2AC4A 3HZRA 4RHYA 3OF3A 4QT4A 3VTAA 1MPTA 4EY7A 2W2VA 2W00A 4C4RA 1HG0A 4XW2A 4ZYWA 5JO9A 1G21E 1Z4MA 1KJ8A 4P3XA 4LNAA 2Y1KA 5C4MA 3T38A 2JGDB 4LF6B 3PCTA 1QRUA 1L2TA 2EKLA 2LGJA 2ZUDA 3IRVA 1Z47A 2VIIA 4DQUA 2LD4A 4WOCA 2AYYA 3Q3HA 2A14A 5DYWA 4J4TA 4ALJA 2XQGA 4ZU6X 2HRCA 1QDLB 1CG6A 3WJ2A 1U7OA 4F4UA 4E51A 5CCEA 2O14A 5JCJA 2DFKB 4Q39A 5HFJA 2XD9A 3R76A 3RSGA 1OJLA 1VECA 2P75A 3LCVB 1GGHA 2CZQA 2Y0EA 3LQ1A 4J0KA 4KACA 3GLQA 4CDRA 2Q9UA 4IGKA 4DSUA 4TWBA 4Z5XA 1GG2A 1ODKA 4LRXA 4LHSA 4CTOA 4IXMA 3ZE8A 4F0JA 2QX9A 2A88A 2C3UA 5C53B 4GR5A 2OBMA 4QJBA 3BH0A 1TYCA 4D9JA 1YQWA 1O94C 5IMSA 1KMIY 1WHSB 2HK9A 5K3FB 3C24A 4B7CA 4R01A 4MR8A 4UDYX 3IQDB 1URPA 3UWPA 5CLQA 3EZ2A 3L41A 1U0LA 2QXYA 4DMMA 3BHNA 4XWTA 4ETMA 2P6RA 4GPEA 2XWJI 5JE8A 3M9XA 3N05A 4HDNA 3VR4A 5CD9A 4KQ1A 1E1LA 5BT8A 1W1WA 5DMXA 3V1UA 3URKA 4F9EA 3VNVA 3N6VA 5H81A 4IUDS 3WOHA 3WGUA 2JW5A 3MJ4A 4CFSA 1RAHA 4F3KA 2EQAA 4HS4A 2NZXA 3C6KA 3RB8A 4RBNA 3DD1A 2H4JA 2VF7A 3ZUGA 1VYTA 5LOVA 1X7ZA 1W30A 2BKLA 3MS7A 1VHDA 2F8TA 1GOTA 1U04A 4HATA 4LY6A 4QXPA 5L3QB 1TPZA 3A1VA 3HE3A 1RZVA 1PJLA 4ARUA 3KFLA 4AD8A 1SO8A 3RV3A 3HC7A 4GMXA 1Q0TA 3OEEA 1N8KA 5LC1A 1UP6A 4PCUA 1GUBA 1TMYA 2P11A 3TW6A 2GDZA 5ARBA 2Q4EA 5HRCA 5DKFA 2P9BA 4PPQA 4DQXA 1ZMRA 2HA2A 3P9PA 4IP0A 2VP6A 3MPUA 4U1RA 3UN1A 3O93A 4DXAA 10MHA 2WSYB 2WSIA 3LLUA 3NIBA 2UZ1B 1GNQA 4GECA 1FOEB 4ANFA 1DZIA 1W5AA 1FVOA 3DZDA 3IAM1 5ESXA 1HRKA 1YI1A 4QBTA 2IYXA 3QUAA 4C6SA 2RHBA 1JU9A 2C4MA 1PR6A 4C5BA 3DONA 3IVMA 4AF7A 4J03A 1F8YA 4DCTA 4MVJE 4E1VA 2BBSA 1P19A 3NU1A 1LDGA 5TARA 2F1OA 5KTSA 3IIMA 1ZYUA 1J23A 1JR4A 1NLUA 3FPSA 1ZM2A 2RH5A 3LPAA 3WMXA 2B8EA 2QN3A 3O38A 2AL7A 3BWEA 3E4DA 2EOAA 2PMDA 2NQ2C 3EIWA 3ZKAA 2BMAA 1QZTA 2QSUA 1R88A 1U7UA 4K3UA 3HNPA 5DGXA 1B0PA 1HTBA 1PL6A 1EYZA 2C98A 5DSZA 2DHCA 4JUCA 1UR5A 2FPIB 3LMKA 1GCUA 1ZFNA 1NIPA 4NJOA 3BBPA 5JBIA 1OWMA 2FR8A 1L9KA 1BX0A 2WWTA 3AY7A 2EBUA 1L6IA 3ORQA 3F5DA 3ESAA 3C6BA 4QOSA 4XR4A 2NUTA 4GL2A 4C78A 3LY9A 4EFDA 5KKAA 2OK7A 4FI3C 3V4OA 1BXGA 1Y6JA 5JATA 1GPNA 5JZ9A 5KBYA 4YMIA 1Z6YA 3MGBA 3QXXA 2CJYA 5CT8A 3BCSA 1F7VA 2JIDA 5JARA 5C35A 4L8WB 1LPSA 3ZHYA 4RESA 5LIRA 2JNWA 3G2OA 2B9VA 3HR7A 3O8BA 3V1MA 4YT2A 1EUCB 3TQFA 3HXTA 5A02A 2EW8A 4LYYA 3MWFA 4EO7A 1UL1X 3FNQA 4GC9A 4HWSA 4IS2A 2R68A 2RHLA 3EVEA 4N8SA 3RYIA 3TN7A 3UC9A 3G2HA 4Z53A 2Q46A 3GROA 4OYHA 2H7CA 3KQHA 1TUBB 2O4UX 4KRGA 4H18A 5WRFA 5LLTA 2HLPA 1XVAA 4RJJA 2OZLA 3OT5A 4DZTA 2RC5A 1GAWA 2I6QA 3QPBA 4QAQA 3BFVA 5K3DA 3ZDAA 5B1HA 1XCJA 4J0EA 3TQHA 5JMOA 1ADYA 2YVUA 3REFA 2VLBA 3RYHA 3TEMA 2E85A 2QRHA 4IHJF 4WJKB 1HNXB 3TSAA 2H1IA 3JQ6A 2GASA 1EGMB 1K7SN 4J9UE 4JLUA 1P81A 1G7TA 2XSZD 1F51E 1KAHA 1U5AA 2Y1OA 1FTSA 1DTEA 3F74A 1IBLB 1TKAA 2R8EA 3TIXB 4QBHA 2FP3A 4GYWA 3ZHQA 1Y7PA 1E2LA 4DHEA 2AW5A 1MQSA 1S3FA 1SBTA 2G5TA 3MUFA 4UMEA 2LCFA 1BXRA 4P38A 4MV6A 2X58A 1JR3D 5FNZA 5DV9A 3LY5A 1XPRA 3O2NA 2JIZD 2WJAA 1C1DB 1WB6A 4R2WA 3HBLA 3IR5A 2CL7X 3CVVA 3RC7A 3UAZA 1KDZA 2QTWB 3DHYA 6CHYA 4KQHA 2ZWOA 4RJLA 4UHKA 5C8YF 1SCJA 3OFSA 4DUGD 3AUXA 5CM9C 3TW8B 2C2MA 2O0JA 1TM1E 4NCXA 4V0MA 4EG0A 3V48A 1I32A 1YV9A 3V2GA 1DKPA 5CLGA 5JNRA 5KDLA 5AESA 5EG5A 4DR7B 4FD3A 1FTWA 1RYEA 5BSEA 2WWRA 1PL8A 4RANA 4XCQA 3MCUA 3P71T 5G3YA 4WLNA 3JRNA 1QNLA 4XFDA 4LDRA 2OEPA 3GMIA 5E8RA 4AJNA 4B87A 3OOJA 4CR8A 4EYGA 2A5YB 3SDZA 4ZYXA 5AR1A 3OIGA 4XRRA 1UEJA 1NP7A 2IHYA 2I8CA 1X8XA 3H65A 5DBHX 5G0UA 2LR0A 2IYTA 2HNBA 3RWBA 2WUEA 2B5OA 1QE5A 1WXQA 3HY4A 3OZTA 1JALA 4KK4A 3A4NA 3JR7A 1HC7A 3VU0A 1UAYA 1XP5A 1N5IA 4L3WA 2GX6A 1HL3A 1Z2AA 1THZA 1W0JA 3E1GA 2BFWA 4PQFA 1Z38A 3SZOA 4LMPA 1LEHA 4MICA 4QVIA 1G16A 1M6NA 1W85A 2VF4X 4AF8A 4OHYA 3EVAA 4R3WA 4CQJA 3E8XA 1YFLA 1QHHA 5DM70 3RTGA 3O2JA 1LPAB 2ENWA 5KMGB 1JH8A 3LQYA 3IAHA 3I9JA 4DM7A 4JJFA 1DAKA 2CYBA 3PIRA 3X44A 1NQUA 3CRRA 3F49S 2N3ZA 1G8SA 4HN4B 2O8DA 4LKOA 3UMGA 2OCGA 3Q9SA 2FPLA 4EUSA 3UFXB 5BNZA 1GFIA 2NZ8A 1C3JA 1GTRA 4YP0A 4LCBA 2IEZA 4CGZA 1A5AB 3A0UA 4EB8A 2NX2A 1T0PA 2GPYA 2I7VA 3MT0A 3CVXA 3OHSX 4B73A 2ZRJA 1IQUA 5AUQA 1V7ZA 1RI4A 2IFTA 3FPFA 3WLSA 1OBFO 2ZRMA 3MTBA 1DFGA 1QC5A 1WIWA 2J5KA 2X0NA 4TKVA 4HJXA 1V39A 4NBUA 1BFKA 1SN7A 1T0BA 2AX3A 3MUOA 5DLDA 5G1PA 1KDYA 1FFHA 1J00A 3C8ZA 1SQSA 2QNRA 2Z3WA 2ACWA 2VN8A 1EWYA 3G9XA 2FUCA 3GA5A 1M33A 1N33B 2K7FA 2WLTA 3AEUB 3YASA 3O26A 1U8XX 3DE1X 1SBQA 2ZT5A 1YQGA 2VHTA 4GRAA 3USZA 2F9FA 2ZRGA 3P2EA 4LDNA 1LNSA 3UGQA 3WQRA 2ZBQA 1NVVR 2ALJA 1Y8QB 4I3GA 2E89A 3QHPA 4MKFA 5I7AA 4N5MA 16PKA 4F60A 3SNKA 4DT1A 2FWIA 4UREA 5J43A 3HA7A 1U80A 2DMRA 3OZ7A 2J0UA 4FYHA 4UNIA 1JPUA 3ABRB 3MGGA 1DAPA 1FSGA 1DEXA 2BH9A 2VF8A 3SXUB 3D1JA 4RMGA 4ZMBA 4KREA 3CS3A 3QYAA 1WVMA 5L4NA 2XUHA 1MPXA 3IUBA 2H4XA 3ZUPA 4GQBA 2FSGA 2NZJA 1N8NA 1N2BA 4G23A 4ER3A 2CV1A 4U5QA 5JXGA 3HXOA 2CXRA 1I14A 1ECFA 2PKRA 3ZCQA 2V8BA 3GFQA 4U00A 3TI7A 3EC7A 3ZPXA 3NXKA 2BOVA 3H0EA 2HYDA 4RVUA 4ZVNA 1HTTA 5C7IO 1YR7A 4BFSA 4AK9A 4KV9A 5HRAA 1I2BA 2VWHA 3ND6A 4DA0A 4UCWA 1P4JA 3P5SA 1ZAYA 1TMKA 4N3BA 3I6BA 3LK6A 3SHVA 4XSVA 4N5HX 2LW7A 4CQMA 5I01A 2ATEA 2RCYA 1PO7A 2RGYA 1TX4B 2FEPA 1FNSA 2WSLA 3R5TA 2CEKA 3AM5A 4XYMA 2W2KB 3ZVMA 2I3ZA 4TV8F 3VZSA 2J3EA 4LWOA 2YJ6A 3ZTWA 5AVSA 5K0BA 1YR8A 3WZ2A 4OQNA 1XTKA 2B4AA 2VEDA 3HCFA 3I1FA 4EYEA 1MO5A 2GH1A 2ZCUA 3HKBA 2QPOA 1MT3A 3S2IA 1L7RA 2Z56A 3V34A 4UXHA 1ZIOA 4ZT3A 5CEFA 1TJYA 4IH9A 3GLGA 4K9QA 1N34B 3WLOA 4MLCA 1E69A 3AM3A 3L7CA 1YQDA 1R6BX 4DPKA 1NSTA 1VLHA 2OAQ1 2DHDA 1OBCA 1DMSA 2EGHA 2VOEA 4M8LA 1AG9A 2BI8A 1GDDA 2VT3A 4PG5A 1UC8A 4YI3A 2XTAA 3VYRB 4C22A 3DT6A 3R3UA 1DSSG 2C20A 3DMYA 1OZGA 2FU5C 2WKWA 3QH4A 3RNOA 5AW4A 4EGFA 2OC4A 2Z2ZA 1TKRA 2QD5A 3EY4A 3LS2A 3FLEA 4K8RB 1T5DX 2QZJA 4OKSA 1XROA 3SE7A 3U62A 3CY6A 3JPYA 2P5YA 1NI5A 2WVHA 4ZI3A 1NJSA 4FFMA 2QM3A 4JI0B 1HY3A 1WMSA 1YA8A 4BN5A 4R71A 5I8ZA 1NXXA 4B2PA 4N0QA 4TVKA 1R0KA 4N8DA 5HGXA 3NUQA 4KVZA 3X1ZA 5AYVA 4QGAA 5FI0B 3ESBA 3LLCA 3B13B 2AW3A 4FGJA 5CTJA 3FPEA 3VDRA 3H4TA 5TSDA 3AOEA 3G0CA 4LBYA 5H4GA 2HBRA 5CP8A 5EC8A 1C4KA 4Y3UA 2K2QB 2XMRA 1Y5NA 2Z3ZA 4DOMA 3ZZ1A 2PUCA 4YJ2F 5JO0A 2P4SA 4OXNA 1JIVA 2D1YA 5FLYA 1H6CA 3JAKA 4RIGA 2VYND 5DNAA 4AL4A 1E2PA 5ESWA 4C0WA 5CH8A 3VAZA 2C58A 3C8MA 3MJEA 5EHQA 3PIIA 1TT7A 1R64A 5FWDA 2ZJBA 4C3VA 5FOSA 3HR4A 4Q3AA 1N57A 2EWMA 3EW7A 2HNKA 1OXMA 1TAHA 2ZJOA 2VCEA 3MT7A 2FFHA 2QAIA 2ZVPX 4ND5A 3UJDA 4G5OA 4M36A 3PLAE 1PV1A 3C3AA 4BAUA 5C7OO 2PXXA 4GOOD 5T8KC 3R9KA 4JC5A 1O96A 3V1KA 1SBIA 1KRWA 3C1UA 2OORA 5KTYA 1IN6A 1EH5A 1X7DA 2Q99A 4R2MA 5EWLB 1CIJA 3A6LA 2CXHA 3LSTA 1I7DA 5IAKA 2EDAA 1RRGA 1CJUC 1X8JA 3MWGA 4CHGA 1PKEA 4U39A 3AL3A 1T1RA 1JEYB 5AI0A 1XQVA 3RAJA 2QV0A 4PSKA 3LZCA 3OO0A 4N6OA 1W0CA 4AKSA 1KMCA 4EA8A 1GQOA 2Q2VA 4V24A 2X0RA 1UBTS 4NAHA 3NH6A 3E58A 3HJRA 4OAPA 2IZ5A 2QL9A 2VZ8A 3P2YA 3NHMA 4B48A 4G97A 3P9QA 4GZ3A 1X3SA 2Z83A 3U39A 2R00C 4EFLA 2H52A 3V8QA 1LQTA 5EJMA 5ANRB 3LSYA 4HP8A 2FP4B 4W5TA 2X0KA 4U2CA 5GWXA 3SIPA 3ST7A 4R1UA 3O2SB 4C06A 5HM6A 3AUJB 5K6AC 1YZQA 1HORA 4JR1A 3TRFA 3N8HA 3ODGA 3VH1A 1TYEB 3RTEA 4BCBA 3T35A 3A2KA 4TS4A 4MQFA 3MGCA 5A1JA 3RRMA 1GFZA 3P19A 1DEOA 3M2PA 5H4HA 3CXRA 2O6HA 5K5EA 3IDAA 3NBQA 4QWMA 4AZVA 4RQBA 2W6IA 2C8KA 2CL0X 4XDYA 1DCKA 3E15A 1H4TA 2WHRA 5IG2A 2QX6A 1C3OB 1M1YE 3CJQA 1MP0A 2OE2A 3TIGA 4PF1A 2REQA 3UMRA 5J23A 1SCAA 4YT4A 2H6EA 3D3JA 1PD1A 1UJ5A 1HURA 4FFSA 4D3YA 2PMWB 3GEDA 3I23A 5IDXA 3MWEB 3BX1A 3CRVA 3RODA 3ZHBA 3V7WA 4TSFD 3RU9A 5AVYA 1W4CA 4LDJA 3PPWA 5CIQA 2XMBA 2H3EA 3UTCA 4KVAA 4DM4A 1JU3A 3UW1A 5KWJA 4IWYA 5LM3A 3AESA 3AM1A 2DP4E 3EBLA 2WKPA 1Q16A 4BBJA 3C45A 2IHNA 3MOSA 1R4NA 2XXAA 1LY1A 1T2DA 4BP8A 4F11A 1N5MA 5T64A 4UQLA 4BFLA 1H9BA 4FDUA 2CE7A 1FSPA 2HF2A 4G8DA 1AGYA 5JNWA 2AMFA 2WAAA 3COPA 4I1PA 4BEVA 3WGZA 2F8MA 2ECOA 3C48A 3VJKA 1ZVKA 4MV8A 4FQ8A 4I4TA 3TMAA 3KQVA 1Y37A 1QR2A 3PC8A 5EWMB 5JXHA 4MI6A 1Z4KA 1VL6A 3BE5A 4NEGA 1E64A 3WYGA 2G1KA 1HE2A 2PUWA 3G5UA 2IYAA 4URUR 1K5GA 4J1QA 3W2HA 4BV3A 4P3OA 4HVCA 4D26A 1U2PA 3M4ZA 5K3EA 1ZH4A 2BDUA 3DOHA 1NQTA 2DZDA 3GNSA 1KVSA 2CLSA 1C9NA 2BN4A 1B42A 2Z2KA 2ZRLA 4JK3A 4M1YA 1CUVA 1TVEA 1RHUA 2AWOA 5ERGB 5JEDA 3O4RA 4IIHA 3HFSA 3TKLA 3QVJA 1KI9A 4NEHB 4GL4A 1V5FA 4XFJA 4XQCA 4YRGA 4EGAA 4B6RA 2FQWA 5LQRA 3FPJA 3DWFA 1MABA 1VLZA 4Z8XA 1QWOA 4B47A 1OHHA 1KJJA 1NSYA 3SQWA 9ATCA 4C1BA 1S2DA 4BNFA 4QPJC 5EFZA 5PGMA 4AJHA 4DJAA 3LXMA 1UDBA 3L0PA 3B3QA 4OBXA 2X3UA 2QJWA 2Z8YM 2QY9A 2XZTA 4WFQA 3KJIA 4MAMA 1H4QA 4IS3A 1XTZA 2Q6VA 1F38A 4B6FA 1CUIA 3BXXA 3FTDA 4H08A 3MMSA 2YMQA 4JJZA 1GAXA 1JILA 1VIVA 2HQOA 4LXGA 3UPUA 2DUMA 3H2ZA 3E2IA 2Y2UA 2H1HA 3GLIB 4MVJH 1FNNA 3SJUA 3V97A 4BJ5A 2H0AA 2KS6A 3PX7A 4EM6A 3FN4A 5DCUA 4TYNA 1FDSA 1HX7A 5HF9A 3WLMA 3F73A 1W88B 2B4QA 5L4SA 1SUAA 1ZH8A 5IULC 2NQ8A 1NVEA 4XUGB 4Y6QA 3TFQA 3W2IA 4IDQA 3BWMA 1OT5A 1F6WA 3KQQA 4M53A 3GFSA 3J81A 1M1NB 5F23A 1W0KA 1YI8A 1NFFA 5AKKA 2D7JA 2XYPA 4HEA1 2VDWA 4DIEA 5DB4A 4C2AA 4A6EA 3W34A 4A4DA 2AOTB 2YN2A 4UHEA 1USUA 5FI5A 1KOJA 3HZHA 4UUAA 1V3UA 3I9V6 5L7WA 2F59A 1T13A 2WG2A 1SIUA 1H0SA 3QXJA 1SMKA 2XVXA 4EJ6A 5JSUA 3M70A 2V6JA 3AOEC 1M2OB 3PC2A 4M83A 4BE4A 3ZD6A 5BR7A 1RWMA 3R5FA 4I1VA 4F71A 1JDTA 2IDJA 4XOIA 4AROA 4RPHA 1TQ8A 5EJ8A 3GRYA 1ZBDA 4DR6B 3DFKA 1Y6FA 3ZLBA 6AT1A 3FF1A 2AXEA 3AVYA 1PRYA 2JGJA 2WJ3A 4TL6A 3P2KA 2Q3LA 3EH2A 1SG6A 1KE1A 3T5MA 5AUOB 1BXKA 4X6LA 3M1YA 2Z0MA 4QUGA 5CXQA 3U60B 4CKBB 4LJ6A 1D09A 4XGKA 1AU9A 4M7OA 3N2IA 4TV9B 1I01A 1N2XA 4IDOA 3ZQ6A 4B7XA 4BZWA 4ZHQA 3A4VA 3ET4A 1OFTA 3UB3A 4JS0A 1H2HA 1NUTA 3BD6A 1GCOA 4URZR 1C8VB