3WSVA

Crystal structure of minor l-lactate dehydrogenase from enterococcus mundtii in the ligands-unbound form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
312
Chain Sequence
MKKTSRKVVIVGTGFVGTSIAYAMINQGVANELVLIDVNQEKAEGLDGMAWGEKNVSVWSGTYEECQDANLVILTAGVNQKPGQTRLDLVKTNATITRQIVKEVMASGFDGIFVVASNPVDILTYLTWQESGLPASRVVGTGTTLDTTRFRKEIALKLAVDPRSVHGYILGEHGDSEVAAWSHTTVGGKPIMEYVEKDHRLEENDLTVLADKVKNAAYEIIDRKKATYYGIGMSTTRIVKAILNNEQAVLPVSAYLNGEYGEEDIFTGVPSIVDENGVREIIDLSITPQEKAMFHQSVSELKAVLDTVRLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An alternative allosteric regulation mechanism of an acidophilic l-lactate dehydrogenase from Enterococcus mundtii 15-1A
doi rcsb
source organism Enterococcus mundtii
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
total genus 100
structure length 312
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wsvA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3wsvA02
4NIMA 3DFZA 1BVRA 5LDGA 1TLTA 2BFOA 3GC6A 1DLJA 1X13A 4ZN6A 1XEAA 3GDFA 3JYOA 3I6QA 3RBXA 4BUCA 1MLDA 4EYEA 4M49A 2C2XA 4EZBA 1HT0A 3L6OO 4RPJA 2NVUB 1D4FA 5A5EA 2AEFA 2V6GA 2J3KA 1HDOA 2VYVD 3JD2A 3KEOA 4KWIA 3VH4A 1E7SA 3DAPA 3S1LA 2D3TA 1X0VA 1CETA 1DC6A 5JLAA 4OXKA 3OF2A 3OQ1A 3WSWA 1O9BA 3OA0A 3CMCO 3DAFA 2AEMA 4J2HA 1HDZA 1M6HA 4GX5A 1F06A 1PJ4A 4DVJA 3QWAA 2C0CA 4HFRA 4YQYA 3NRCA 3OJFA 2JCVA 3NJ8A 3ZWYA 4DRYA 5I7FA 2WD8A 2AG5A 2YJZA 3IOYA 2EF1A 1OI7A 1Y8QA 3C24A 3Q2IA 1RYEA 3TOXA 4RZIA 1PZEA 1DFIA 3WTCA 4IM7A 3VZSA 1M66A 3R3JA 4DPLA 3QQPA 3ASVA 2EKQA 2J6IA 4RV9A 4TVBA 5TJ9A 5EQFA 5BQFA 2VNAA 1PR3A 4WCDA 3VZPA 4FR5A 3WQRA 4DIFA 1E1LA 4J43A 1HSOA 3UAGA 1I8TA 2GD1O 1KY5A 4PVCA 4UVIA 3GUYA 1IB6A 5EESA 3LT1A 4LGVA 1N9GB 3H9QA 3KLPX 1ORRA 4BIIA 4FDAA 4D3DA 5I8WA 3P5SA 1QMGA 4YACA 4ZQHA 3JD0A 2Y05A 4II2A 1DHTA 2J3IA 2PZJA 3G0OA 3VHRA 1NFRA 1P31A 4TZTA 3EW7A 4D41A 2ZYGA 1NVGA 4DC1A 4WLOA 4J4HA 4UVGA 2CDCA 2C7VA 1EBUA 2O3QA 2CDAA 2Q1TA 3CEAA 1K6XA 4E33A 1EBFA 4RVUA 2BI8A 2O50A 3O4RA 4Q3NA 4J1TA 2FSVA 1MUUA 4I9HA 5COQA 1E3IA 1Y9EA 1RM4A 1R4NA 2GNAA 4XWYA 3QHAA 2JFFA 3KTDA 4P38A 4BGVA 5IZCC 5JDCA 4AJ1A 3WBFA 2AMFA 1R0KA 3DZHA 1DFGA 3RBVA 3GNQA 4R41A 3ON5A 3RI3A 2VZ9A 3PRJA 3DBHA 1LDEA 1SCUA 4RDHA 1HE4A 1Y81A 3V8BA 4RF2A 4GLLA 4GL4A 4YJHA 3VKVA 5JO0A 3FD8A 3MJTA 4LSMA 4DPMA 2X0RA 4R1UA 1HDRA 1C1DA 3NEPX 3C7AA 1DIHA 5HS4A 3VOSA 3EAGA 3DTYA 1ZVMA 2C07A 2HCTA 1SBYA 2W2KA 2VWGA 4GAEA 1JLLA 1ZH8A 1NAHA 4OYRA 3ZHZA 5G4KB 3ZV3A 1N92A 1MX3A 4QT0A 4DQUA 3BTOA 2NM0A 5L4LA 1C1XA 1W0CA 3D4OA 2PKQO 1GUYA 1GQQA 4KZPA 3JSAA 4A7PA 3H3JA 3IDSA 4I5GA 2AQIA 5A3VA 2Y0EA 3MOGA 4BL5A 1VJTA 4UEKA 8LDHA 3MCVA 3IS3A 4R5HA 2WE8A 5GZ3A 1UAGA 2PFGA 2Q2WA 4AJ4A 1NPTO 3AY3A 5AVOA 1V3UA 2FPGA 3WJ7A 3JQFC 4O5OA 3MOIA 3H5RA 3U09A 2BGMA 1TI7A 3FPCA 2WEKA 3QVOA 4CLEA 4LSWA 1PTJA 4WJZA 3D1LA 1UR5A 2FP4A 4XQEA 2P9EA 3WYBA 5BNIA 2H9IA 1WMBA 1Z7EA 4QSMA 2E6UX 1QG6A 1L1FA 5A1TA 2ZTLA 4OQZA 3EUWA 4YJGB 1HYGA 3AI3A 1ISGA 2EJWA 4WEOA 2AA3A 3GEGA 3INRA 1NWHA 4PZDA 4IJKA 3BMNB 5A04A 4E4YA 1OC4A 5EJ2A 1MFPA 2FR1A 2RHRA 5EINA 4AJKA 2PV7A 2FPPA 2VOJA 3WGOA 5KIAA 1MG5A 2GZ2A 3HN2A 2NTJA 4OHUA 1YL5A 4RDIA 3C1OA 4S3MA 2X0IA 4DYDA 1VE9A 3A06A 5CPFA 3SJ7A 1PS0A 4Q3DA 1GV1A 3I4FA 1AHHA 3ANNA 1JWAB 3QWBA 1T2AA 5JDCC 2ZK7A 3WGGA 3QVWA 1HRDA 5KTKA 1MXFA 1F14A 2EP7A 1NP3A 2Q3EA 3JV7A 4MKRA 2NTNA 3GK3A 3OICA 2I6TA 3SXPA 4W9NC 4ND1A 5HA5A 1HKUA 1P1FA 1KY4A 2PD6A 1FXSA 2HKIA 4OGWA 3V1UA 3ZNNA 4FB5A 1MA0A 1A4IA 3BMQA 4RORA 1TXGA 4DREA 3KEQA 4IS3A 2SCUA 2ILTA 2EG9A 4XX0A 3GMSA 5JDIC 4Y6PA 4H3VA 4BKOA 2AG8A 4MVJA 1BWSA 1LA2A 4CJXA 4KTTE 3AI2A 2OUIA 3DB2A 3LC1O 2HU2A 1ZKMA 1PWZA 2AE2A 3WFIA 1EUZA 3ZZNA 3JQ7A 3CMMA 3C1TA 1A27A 1R4MA 4XJTA 3C85A 5JPIA 3P2YA 3EVTA 1O89A 2B5WA 5LC1A 3VKUA 1EVZA 4ZD6A 3PWZA 4XJSA 1NM5A 2A92A 2CF6A 5KOIA 1E3SA 1E77A 1FK8A 5JYEA 2ET6A 4XIJA 1W73A 4CM9A 1ZNQO 1HEUA 1HDYA 2Q49A 3NTOA 1U28A 2E49A 1H9BA 3ZU2A 2OOSA 3PLNA 3TZ6A 3KSUA 5TT1A 2FWMX 4KWHA 4BNJA 4Y8VA 5TIIA 2X5OA 3BYZA 4BMVA 1C1DB 2O23A 2YUTA 2VQ3A 3I23A 3L07A 3SLKA 1PJTA 1JDJA 1PL7A 1KEVA 5JNLA 2X58A 3FTPA 3ZWPA 3U5TA 1LDBA 4OL9A 2VHYA 1XELA 3QRWA 3W6ZA 2E48A 1BRMA 1LI4A 2OBNA 2JHFA 1P74A 3WNVA 4XB1A 5TRTA 4XB2A 4F6CA 4YAGA 2G0TA 4GWKA 5ILGA 1HXHA 3GNSA 4IY1A 3JYLA 4IIUA 2FN7A 4K6FA 5TJHA 4NZ9A 1ZEMA 1E92A 3CKYA 3UH1A 4JROA 4Z3KA 5L3ZA 1LSOA 3WIDA 4EJ6A 2GR9A 5T64A 1GPJA 4NG5A 4BNMA 4AFNA 2V7PA 4KOAA 5G0UA 4BB5A 3HNPA 2EHDA 4KUHA 4RJTA 2FZWA 5CG2A 1GYRA 2X86A 3RVDA 5THQA 1K6IA 4FN4A 4BMSA 4NJMA 3EY4A 1QR6A 3AOGA 1ONPA 3IKTA 4EUFA 5DBGA 3F1KA 4Z0HO 4I5FA 2ZTUA 4AG3A 3IJRA 3RUFA 3BHJA 4D43A 3GFGA 3JQCA 3BMNA 1A9YA 3A4VA 4LMRA 4D46A 3V2UA 4F45A 2XAAA 4YTEA 2O48X 3H9GA 1T25A 1O8CA 4JIGA 2D1YA 2PWZA 3GG9A 2HMUA 4FFRA 5EPOA 2X7HA 4FFLA 3IAHA 2H1SA 1PQPA 3SBOA 3K2BA 4G5HA 1XR3A 4NBUA 5B4VA 1R4MB 2IYPA 3UCFA 1QORA 2GN4A 3JD1A 3RUHA 1U9JA 2WYWA 3I6IA 1DJNA 2PZMA 3RSHA 1YGYA 2V6BA 1KS9A 1U4SA 4X54A 4Y6SA 4CMBA 1LRLA 1NQ5A 2DFVA 1JKIA 1ZO8A 2G5CA 3ONEA 4CM8A 2YW9A 4CQLB 2IDZA 3OFSA 1P1HA 1DFHA 5H83A 3FN4A 3MTJA 3WYCA 3ZV6A 5K6AC 4QFCA 3AW9A 3VPGA 1NASA 3KV3O 3WGTA 4DL9A 3IP3A 4BV9A 3QVTA 2CDBA 2P9CA 3ANMA 5BSFA 4IXWA 2DVMA 3K73O 1N1EA 2QZ9A 4A10A 4QFDA 3RUCA 2ZKLA 3DZBA 1BDMA 5EMHA 3H4VA 3KRTA 4ALNA 1TVEA 3CXRA 4BHTA 3AM4A 2EW8A 4Q3AA 4XYEA 3WOHA 1XSEA 3GGOA 2WSBA 4IPTA 3CE6A 1PZGA 4W82A 4ZQEA 1NBOA 4BNHA 3GLQA 3GVXA 2R2GA 3F9IA 5JAMA 4K1LA 4YJFA 4BGEA 4BO4A 4BQPA 3E03A 3IUPA 1VKNA 2HLPA 3B1JA 3T4EA 1W4ZA 2ZB4A 3B1KA 3E8XA 2BI7A 4W99A 2O7QA 3X2FA 4R3NA 1VC2A 3WTBA 3IC5A 4AVYA 2P2SA 2QYSA 4JJIA 3RU9A 1K5HA 3M6IA 3AUTA 1VJ1A 1YB1A 4BOYA 4AJIA 4YXFA 1Y8RA 2DLDA 3LU1A 2R6JA 3H6KA 4U0JA 5JYDA 3WSVA 2VHXA 4CM4B 1Z7BA 1EMDA 2DU8A 3FBTA 4YB8A 5AOVA 4CQMB 5KVVA 1I0ZA 2CUKA 2A35A 2VYVA 3KZVA 3PHIA 2BLLA 1C0IA 1AGNA 4R51A 3H65A 3KYCA 1H6AA 1NR7A 3D3WB 2IEBA 3KUXA 2X9GA 3F5QA 1H6CA 1F17A 1PS8A 2B36A 3GN2A 5CP8A 1PGNA 3F46A 3VH3A 4JP3A 3NJ4A 4N18A 1EDZA 4DQXA 4TWRA 3JQBA 4GLOA 1I3NA 2DPGA 3WGHA 4CM6A 1XKQA 3JQDA 3S2EA 3AU8A 2Y1OA 5JAIA 5TS3A 1M2WA 3RCBA 2EKPA 1JKFA 4Z3DA 2OGUA 4NK4A 3E5MA 3ULKA 5GZ6A 3DMTC 5J23A 3WXBA 1SNYA 4E3ZA 1ZK4A 5IZCA 3OJ0A 1FF9A 2I76A 4C7JA 4CM4A 4WCFB 1CWUA 1WZIA 5G0SA 2B37A 3GEDA 5A9TA 3JQ9A 1CIVA 2ZYDA 4U5QA 1WLYA 3I9KA 4PLTA 1HE3A 1N7GA 2HK7A 4L74A 5DCUA 1DO8A 1LLDA 3H8VA 3TWOA 4MVJG 1ENOA 4PVDA 4R16A 4NR0A 4M54A 4D3FA 3UOGA 2Q50A 4M87A 1ZJYA 1P9LA 3JQAA 3JQGB 3RJ5A 2BFAA 4DA9A 5LDHA 5ILOA 1Z75A 4NHEA 2P91A 2EV9A 3INGA 2W8ZA 3JD3A 3D0OA 2BGKA 1YH3A 2CVOA 1T2DA 1WNTA 2EEZA 4J1QA 3UGKA 2HMSA 5DN9A 5L4NA 4MIYA 4XGKA 1YVEI 4GMGA 1HDCA 3JQFA 3O8QB 2X22A 3T4XA 4GKBA 4WLFA 4N5LA 3EDMA 2QRLA 3E18A 2RAFA 1W8DA 2NLOA 3GVIA 3K2EA 4IIVA 5L51A 4Z9FA 3R1IA 1K89A 2VHZA 1IE3A 4GKVA 4YQZA 2CF5A 1UXJA 4YYZA 3PP8A 4R01A 2P5UA 4HUJA 1EVJA 2DBZA 3OECA 1AXGA 1G0NA 4MVJH 3TDKA 1L7DA 1YBMA 4WCFC 2ZB8A 1GAEO 3K31A 1DAPA 3WJAA 3S8MA 3TZQA 3HG7A 1I10A 2C7GA 1HETA 4JLWA 5A3JA 1ISMA 1E0DA 1N5DA 2ZIZA 2D8AA 3GEMA 4CQMA 1WWKA 2BF7A 4ZQGA 3UXYA 4CMKA 1SZJG 2H5LA 2DC1A 1D1TA 1DIAA 5DNAA 1P0CA 2B83A 1PGQA 1YBAA 2O3RA 3G1UA 2J5KA 4J4BA 3IQDB 4B3HA 1N7HA 4FFMA 1ENYA 3V2HA 1CJCA 1DRVA 4L0QA 3KSDO 4CUZA 2X1HA 2AQKA 4BNLA 1J0XO 2UYYA 4AJ2A 1ONOA 3GPDG 5JFOA 5IDWA 3BHMA 3HE3A 1GR0A 1QLJA 1TB4A 4WEQA 4DYVA 2O4UX 2H6EA 1VLLA 4HWKA 1EK5A 4OO3A 1ARZA 1BVUA 5IXSA 2C20A 2HO5A 3AY7A 5A06A 2DUWA 2IXBA 3GGGA 2Q4EA 3U3XA 1NYTA 3VTFA 4CV0A 3QWIA 4IDCA 2H63A 4L4RA 5TNXA 3RASA 3HDYA 3MWDB 1YL7A 3C1AA 1SC6A 4NU6A 4OM8A 1MXHA 1LRJA 4B4UA 4A0SA 5KNLA 3HWRA 3ZI0A 1SMKA 4FFOA 3DDNA 2HAEA 2BH9A 4L9RA 1X1TA 3PHHA 1M67A 1P1JA 4ZHSA 4F46A 5DULA 2G1UA 4H7PA 4M55A 4MP8A 3ZV5A 5CDYA 1QYWA 1O0SA 5F5LA 1BG6A 1YKFA 3DOCA 3EVNA 3KOUA 4UUOA 4RGBA 1B15A 3GZ4A 5AYVA 5JMPA 2W90A 3P7MA 3WQQA 5KJCA 3RUAA 5CFZA 1A4UA 4ZGWA 5F5NA 2VRCD 3BTUA 1YQXA 4MVJM 3WWYA 1T2EA 1PX0A 5C7OO 4H15A 1R0LA 4RZHA 4QTZA 3TF5A 1ZFNA 4YJFB 4CM1A 3F4BA 4BNFA 1HE5A 3G79A 3S55A 5ENVA 5TF4A 1HYEA 4P4LA 1NFFA 1P1IA 2Q4BA 2X23A 4E5NA 3WLFA 4BB6A 4UUNA 4J7XA 1H6BA 4A73A 1LDMA 5JS6A 1XWFA 4ZQBA 2CY0A 2YV2A 1KEWA 2PZKA 5G0WA 1GUFA 1X7HA 4IDEA 4CM7A 3PQEA 2OXIA 2OMEA 4CLDA 2YY7A 1KOLA 2QG4A 1DDOA 1B3BA 1UP7A 1H6DA 3DXFA 3KHUA 1PGPA 1ULUA 3ZCXA 4BNWA 1BW9B 3Q3CA 2ZYAA 1O6ZA 4OSPA 4RLSA 2HDHA 3ZU5A 2GPTA 3GFBA 4ALKA 3OM9A 1M76A 1FJHA 1Q1NA 3EHEA 3NDRA 3HN7A 5C5IA 5L53A 3U4IA 2Y1EA 3NX4A 4M8SA 3L4BA 3ITKA 4BNVA 1V9LA 2NADA 3FF4A 4UUPA 3LLVA 4J16A 2HJRA 3W8FA 3PLRA 2VTDA 4TZKA 1EVIA 3KLMX 3BMCA 5MGBA 5I7EA 4NBRA 2I66A 1UXKA 1ZK2A 2A94A 2JCYA 3RIHA 3MJSA 1WDLA 3HJAA 3Q0EA 4RPHA 4WNIA 5A9SB 2ZATA 1EK6A 2DPHA 3Q2KA 1KBZA 4AJEA 1R6DA 3PYXA 3T7CA 4D79A 2WWRA 4PG6A 4CMIB 4J4TA 3ADPA 4FPXA 3BTSA 3LF1A 3R0IA 1Z74A 5HTOA 3CIFA 4EI2A 4D0SA 1Y7TA 2YFHA 5I9MA 2D4AA 4BNUA 2YQ5A 2X9VA 3GN1A 4NQZA 4OKNA 2PA3A 3DBVO 3ZWVA 1X7DA 1MFZA 4FJ1A 5DZSA 1EFLA 1U1IA 2PGLA 3H9UA 4GVXA 1QYVA 1TT7A 2ZB3A 3DOOA 3PJFA 1K6JA 4GGPA 1PL6A 2ZCVA 1LU9A 4RQTA 4AL4A 1E6UA 1YONA 4I1IA 4P8RA 2POQX 1ZUD1 2B4RO 1ADBA 1UH5A 3D5TA 4E13A 3EK2A 5JAZA 4EITA 1SOVA 2Y99A 3DHYA 5FF9A 1E7YA 3TOZA 1UJMA 1PJCA 1Q7BA 3EYWA 2PZLA 4BO1A 1I36A 4HBGA 4U8GA 2C5EA 2IXAA 3ZW8A 3O38A 3JQ8B 4R54A 4YVFA 2FMUA 4J1NA 4IDGA 1C0KA 3RUIA 4BGUA 4IQ8A 4BO3A 2C5AA 3NT4A 4FBGA 4ITUA 3TRIA 4C4OA 5DP1A 2Y1GA 3E5RA 2FHSA 4CM3A 2C82A 4RL6A 4Y9DA 4YA6A 2XXJA 3DTTA 4XR4A 1YOVB 3GUCA 1XYGA 4J1SA 4JBGA 1HLPA 3FCOA 4XEHA 1V0JA 4WLNA 1GZ6A 2WD7B 1IZ9A 3PJEA 1ZEJA 3AUSA 4QECA 2C2YA 1VSVA 2E4AA 4I9UA 4CODB 4M89A 2I67A 2WDZA 1I2ZA 3U9LA 2DBRA 5IJZA 4YDRA 1VL0A 3V1YA 1OAAA 5I7SA 3GZNA 1PGJA 3AM5A 2PNFA 3O26A 3A1NA 1H9AA 1XQ1A 1GEGA 1K2WA 2GN9A 4CLOB 3PHGA 4L73A 4KQWA 5L7WA 3INTA 4IQ0A 4BO7A 3GY0A 1YOVA 4KUEA 2UUOA 3ZW9A 1WDKA 2YV3A 3PGJA 1ZCJA 3KYDA 3FNGA 4JN6B 3FI9A 4HFJA 3D7LA 4IJVA 1IL0A 2WE7A 5KJFA 3OHSX 1U5CA 5K0ZA 2AXQA 3PJDA 3W4KA 4CM8B 1NHWA 2YV1A 4RQUA 3TZHA 3C7DB 1I2CA 1WP4A 4R1NA 2J3HA 4IGFA 3TSCA 3P19A 1GEEA 4B8WA 2WYVA 2GN8A 1RYDA 3ONDA 4FGWA 1M75A 5HS6A 1EFKA 5HM8A 3QE3A 1OZAA 3E9QA 3WIEA 4MPDA 4D42A 5IDQA 1M6WA 4W7HA 5IN5A 1S6YA 4XCVA 4OMUA 3CINA 4MVJF 4NFSA 3R3SA 1ISIA 2OORA 1NXQA 4DBVO 1R37A 1S7CA 2X4GA 1PQWA 1GV0A 3F4LA 1UZMA 2VZ8A 4WGGA 4BNNA 5JCJD 2IZZA 4HXYA 1GD1O 4U6QA 3ETDA 2UVDA 2UV8A 3DBRA 4FOSA 4XQCA 2QYTA 2Z95A 3JQ8A 4NBWA 3AI1A 4MP6A 4CMGA 4WOJA 1J5PA 4JGBA 4JJFA 4GSLA 2VOEA 3QVSA 4URFA 1KC3A 3PFFA 2Q2QA 4CM5A 3WX0A 1JTVA 5JCJA 9LDBA 4BNTA 4IZHA 4NDNE 1T1SA 3JQ7B 2GYYA 5B4TA 4UREA 2Y1CA 3W4JA 3IKVA 1HSZA 1D1SA 3JTMA 3FWNA 4OJNA 4MOWA 4CR8A 1FDVA 4S1VA 4XYLA 5JC1A 4IGEA 4Z0PA 1GY8A 3E82A 3TL2A 2VT3A 2VZ0A 4U7WA 3V5NA 2DBQA 3LT4A 3D3EA 3EZYA 4IINA 4TQGA 1UXHA 1B8VA 3CZMA 3PIIA 1LLUA 3K9QO 4E31A 5A4DA 5ICSA 1NQAO 3LYLA 1DRWA 3SC4A 2YFQA 4M1QA 3OQ6A 4GMFA 4L4XA 4R4JA 4K6CA 1UDAA 2CSUA 4J0FA 4ND3A 1ADGA 4Z9XA 3U49A 4D45A 1PGOA 3MWEB 4BNZA 3F1LA 4CLRB 3Q9NA 3TZCA 1QV6A 2EKLA 3C8MA 2AW5A 1NVTA 2IZ0A 4MVJD 4OOFA 2HSDA 1YB5A 1NPYA 1H94A 1DOHA 3ROMA 4HNHA 1KETA 3Q1LA 4O0LA 2BFMA 2Z1MA 4B79A 1ZMOA 4BO8A 4N5MA 2I9PA 5THKA 5DCWA 2QW8A 3R6DA 3ST7A 1LTHR 4ESOA 1QYXA 5T8KC 1TA4A 4PLZA 2O3UA 1UDCA 2JCXA 3OH8A 1KVRA 2CVZA 3PHLA 2Y0CA 1G6KA 1ZK3A 2NQ8A 4XRRA 3O03A 1AN9A 4CQMD 1YJ8A 1B26A 1C0PA 1F0YA 1I5RA 3KO8A 3GRPA 3CPSA 5ENDA 3LZ6A 2ZJ0A 4RCVA 2VT2A 2CZCA 4CM9D 1E7MA 4OXYA 3H5NA 4R69A 1ENZA 3EC7A 1BXZA 4FSHA 4IZIA 4ALMA 5JO9A 1DB3A 2GZ3A 3JQ6A 4CMHA 4WOKA 4RPKA 3ADOA 4CR6A 2BELA 2DT5A 3ZHYA 3WICA 2BD0A 2ZTVA 4WASA 3N7UA 4NH4A 2DTXA 2EGGA 5F1OA 3PVZA 3TFQA 1JQBA 1OC2A 1O94A 5A05A 4DC0A 5TSDA 2X0JA 4ZRMA 3RKRA 1Z82A 1YS4A 2D59A 2VWHA 5A5FA 1IOLA 3RC9A 5G4KA 4UULA 4K26A 4FD3A 3PHJA 3ROKA 4R1TA 4WK6A 2B35A 1YE3A 3B20A 1DIGA 3LT2A 4B3IA 4EJMA 4B4VA 2YDXA 3AU9A 5FI3A 3V2GA 3TN7A 3TFOA 1RM5A 4D0RA 2IZ1A 4A27A 3WFJA 3IMFA 1EVYA 2D0IA 4YAIA 4NI5A 1ZXBA 4OIMA 2XXBA 3JYQA 5T57A 3ZHBA 4QO8A 5HRUA 1LDYA 4FJ0A 5FI5A 1C0LA 1XLTA 2PD4A 3GVCA 5ADHA 2VWQA 2GRAA 3WB9A 4PN3A 1HWYA 2ZQYA 1UP4A 3W8DA 4TRMA 4CR7A 3OQBA 1Y9AA 3OBBA 1E3WB 3H7AA 4RF5A 3PI7A 4XYGA 3K8ZA 3UVEA 3ZU3A 4BKUA 1P1KA 4CUJA 1R4NB 3U4DA 3GVHA 1WXDA 5FEUA 2Y66A 4MKZA 3EMKA 4Z9YA 2EW2A 1A71A 5BNFA 3PZRA 4DXHA 2O3TA 5MDHA 1GCOA 1R12A 5DOZA 3S2GA 1JAYA 5CEJA 1ZXLA 1YDEA 5JCXA 1DC3A 4EUHA 1QSGA 3OJEA 2VYND 1DEHA 3OEYA 3L9WA 3DR3A 3ZWOA 1EQUA 1YWGO 2AHRA 1UXIA 1IULA 3FHLA 2FSSA 4XYBA 2BHLA 4J49A 2PY6A 2B4TO 2LDBA 2BGLA 1PS9A 3RFVA 2P4HX 3LVFO 2W2LA 1LRKA 2J3JA 4IBOA 2JFGA 2HMVA 4J7UA 4E2WA 2O4CA 2PD3A 3IJPA 1F8FA 2YHUA 4PRKA 4NU5A 5ES3A 2GF2A 1H0KA 3FNHA 2XPCA 3JD4A 1E5LA 3E6AA 3JQAB 3JQGA 3KYCB 3ASUA 3LDHA 3M1AA 5DT9A 1Q7CA 1B8UA 1C3VA 3JYNA 1Y5RA 4DQVA 6ADHA 1ML3A 4BNXA 4RVFA 4AJHA 1PJ2A 3PTZA 4FIZA 4FC6A 2ZQZA 3I9LA 1I3LA 5CDSA 3RC7A 3L4SO 4CMIA 2E82A 3VTZA 1RWBA 2J8ZA 4XDYA 5U1PA 4ZQFA 3ZNOA 3GG2A 1PJLA 4D3SA 4BO0A 1Q0HA 5B1YA 4YCAA 4A03A 1SEPA 1VM6A 4ND5A 1ADCA 3MZ0A 4XRGA 1I32A 2JD0A 3OIGA 3VZQA 1YDWA 2P68A 1ISHA 4DLBA 4LVUA 3MEQA 1PIWA 1L7EA 4YT2A 4TKLA 2UAGA 4MJLA 1LNQA 2HK9A 4DLAA 1CEQA 1BXGA 2I65A 3K5PA 2NSDA 3ZWBA 3GZNB 3TJRA 4AJLA 5B12A 5CDGA 4CLOA 4J7CA 4BKQA 3H2SA 3STHA 3PQDA 3ROQA 1B7GO 4BV8A 5L45A 2JAPA 3AOEC 1IHYA 4YT5A 3ZWAA 4DGSA 4MINA 1WMAA 1CQIA 1IYZA 2FR0A 1DHRA 3E9MA 5EN4A 2JAHA 4OKIA 4ROSA 5JE8A 3NV9A 3RAJA 4E21A 2VNSA 4QO7A 4XQGA 1LDGA 3ICPA 3PWSA 3GR6A 3KYDB 4YAKA 2YZ7A 5DDIP 2QRKA 3LQFA 4ONEA 5CHEA 3H9EO 1H2BA 3JYPA 3KVOA 1T4DA 1EZ4A 1U3UA 2Q45A 1ZSYA 1AHIA 4EBFA 2JD1A 5LCXA 1N9GA 3SVTA 1QYDA 5A9SA 1IPEA 1U4OA 2RH8A 4WLVA 4CV1A 1U3WA 2JHGA 2RHCA 1IY8A 4Q3BA 4E30A 1LJ8A 1JA9A 3U0BA 1VPDA 4D7AA 3F47A 1NNUA 5ICMA 1OBFO 4Q39A 4DMLA 5JW6A 3AFNA 2DUUA 3C7CB 3AOEA 1GCUA 3K96A 5H82A 1OOEA 3DQPA 3I9OA 4TMFA 1JN0A 3P2OA 4IMRA 3W1VA 3ZGYA 4E0BA 3FWZA 3DMYA 4YJDA 2A4KA 1DLIA 3FBGA 1QKIA 3HFSA 4OQYA 3AK4A 1E3WA 3SJUA 4I9NA 3E1KA 4RF3A 3I9JA 4J9VA 3JQAD 2PGJA 3OA2A 2Y93A 3BHIA 4NPCA 4ALJA 3N58A 1BW9A 3DBHB 3GT0A 1PU2A 3QA9A 4O1MA 1UP6A 3BIOA 1V8BA 3ANLA 2IRWA 5JDIA 4LISA 4UEOA 1V35A 3QIVA 4GPD1 4R68A 5F1KA 1MC5A 1QRRA 4ALLA 4E5MA 4IJUA 3HDJA 2NQTA 3ORFA 4TRJA 3TZKA 4H16A 2O2YA 4LVCA 3VPXA 4W7IA 3VPSA 5TGDA 1B14A 2QZZA 3FSRA 3HHPA 4QX6A 3G3EA 4W9NA 3RU7A 3K6JA 1JKJA 3GMDA 3AM3A 3QWHA 4JXKA 2I3GA 1Z45A 2EERA 4YEDA 5JAQA 1YL6A 2GN6A 3ZWMA 3FR8A 1GQYA 1NVMB 4MKXA 2WD7A 1AE1A 4ILKA 4Z0TA 3HSKA 3BTVA 4WE3A 1Y6JA 1NQOA 3GHHA 4YPOA 4PCVA 4E2YA 1H5QA 1ZSVA 1VKOA 3DAGA 3DO5A 1KIFA 1BTOA 4PG5A 1HDXA 3FR7A 1B0AA 5L7TA 2RIRA 1AXEA 4QQRA 1HYHA 3NUGA 4MDHA 4ND4A 5EQDA 1GFSA 4INAA 4O63O 4B7CA 3AUUA 1Q2XA 1T2CA 4L76A 1GL3A 2JFHA 1TEHA 1HDGO 1KVUA 4CMEA 1UUFA 2O2SA 2ZB7A 5KVQA 3IUSA 5DBFA 3ROPA 5JY1A 4EEZA 1X1EA 5I9LA 1GQ2A 5L9AA 2OFPA 4KDFA 5T8KA 4BS9A 2HK8A 3DZJA 3ITDA 5L40A 1PJSA 3NAQA 4KUGA 4YR9A 5JMWA 4IDBA 1WPQA 1SB8A 4BKPA 1BXGB 5EL0A 1VRWA 1H2HA 2R00C 4B7UA 1X15A 1YB4A 1R66A 4UEJA 1WVGA 2P4QA 4YRDA 4G65A 2CMDA 5KWEA 3DZKA 1VL6A 2I5PO 1SAYA 4E2XA 4E2ZA 4B7XA 4EEXA 1QYCA 2D5AA 1ID1A 3JQBC 2W4QA 2EIHA 1XHLA 3PWKA 1EE9A 1RM0A 1VJ0A 1LSSA 2C59A 4L8VA 4YJGA 3WDSA 1MGOA 3M2PA 4ZA2A 4B4WA 4CL8A 2VWPA 5KVCA 3GHYA 3VDRA 2X5JO 2B0JA 2C29D 2NU9A 3HB4X 3UCEA 2PKRA 2RH4A 3PZBA 4ID9A 4GX0A 3PYMA 3LC7O 1XDWA 1EUDA 1VI2A 3QW2A 2PH3A 3VPHA 1SO8A 1UZNA 3GNTA 1A7AA 2IE0A 4KP7A 2R00A 1V3TA 2OP0A 4G2NA 4R9RA 5B4UA 3WBBA 3RQSA 3HZZA 1HL3A 3MJVA 4XA8A 1BHSA 2VRCA 3JQEA 1PSDA 1HZJA 1Z73A 1YQGA 2OBYA 4FQ8A 4IDFA 1FDUA 1XU9A 4TROA 1QXSA 3U4CA 2DM6A 1BDBA 5A03A 4CLHA 4CPDA 2HQ1A 5T6BA 4NJOA 3GQVA 4YAEA 3HFGA 4XYMA 2TMDA 4GI2A 3DHEA 1HE2A 1A9ZA 2RCYA 1DRUA 2W2KB 2WTBA 4OAQA 5BSGA 1LSUA 2EWMA 3RC2A 1HTBA 4FFNA 4PLFA 5GY7A 3GA0A 2YYYA 3GAZA 1NPDA 4HFNA 5L4SA 2JL1A 1GYQA 1LDNA 3UCXA 1PJ3A 5JC8A 4II3A 4J0EA 1G1AA 4GSKA 3GOHA 3L6DA 3NDJA 1ADFA 5GMOA 5CPBA 4ALIA 2OP1A 2JD2A 3H9JA 2J5QA 2O3SA 1YO6A 3VZRA 2ZTMA 1PWXA 1T4BA 1EEHA 3OMLA 4DWVA 3I52A 5KVSA 1JU9A 4IMPA 2GUGA 3I1JA 2VCYA 1KVQA 1GZ4A 3H3FA 1N1GA 4E5KA 1FMCA 4LN1A 4IUYA 1KC1A 1ZSNA 4OXNA 1QP8A 4LK3A 3LLSA 2PGDA 2GCGA 4LRSB 5B37A 3ETEA 3ZV4A 4JBIA 4GGOA 5BNTA 2FR8A 5EERA 5GZ1A 5KCZA 2NWQA 1CYDA 2V6MA 3DBLB 4HFMA 5EIOA 4EDFA 4YRBA 3UW3A 3BMCB 4N5NA 1XG5A 1B16A 3LF2A 2P5YA 4FJ2A 1FDSA 4J90A 3DOJA 3I5MA 4A26A 1I33A 3WWZA 1N8KA 3BMQB 3I4CA 3LK7A 1XA0A 4J3FA 3QJ5A 3DONA 2YDYA 1CQJA 2F1KA 3QSGA 3SX2A 2FPIA 3QY9A 3QVXA 1A5ZA 1V3VA 5CDTA 1KVSA 3GAFA 4PLVA 5IXYA 3A28A 4R1SA 1AUPA 4DIOA 4HADA 3OSUA 3MJ4A 3KXDA 1RM3A 3KSZO 1X7GA 3PPIA 4PG4A 4XKJA 3UN1A 5ER9A 4CL3A 4JP2A 1X14A 4PGFA 4HP8A 5COAA 5F3RA 4YAJA 1DIBA 3O8QA 3WGQA 3GDOA 1K3TA 4JBHA 1TT5A 1LC3A 1XGKA 4JNKA 3HADA 4PG8A 3RUEA 1YQDA 9LDTA 1LXCA 1I01A 2AEJA 4XQ9A 2HJSA 4CMCA 4AJJA 1N2SA 1LUAA 1E1KA 1GADO 1RJWA 4HY3A 1F12A 4M86A 3ZH2A 3BXXA 1U5AA 1EUCA 2OHXA 2X9NA 3DEYX 2F00A 2Q1SA 1OMOA 3W8EA 3WGZA 2NU8A 1YBVA 1WDMA 4J91A 1FDTA 1ULSA 4J6FA 2FY8A 5F21A 4NNJA 2HUNA 3QP9A 4N7RA 3RROA 4RPGA 1XU7A 4LMPA 2ZCUA 3ABIA 3FNEA 4J2OA 5DF1A 4BNKA 1P44A 1BSVA 1PZHA 4QXMA 5TX7A 4L75A 1J6UA 3WMXA 2E37A 3GGPA 4FGSA 1R0SA 1ZZEA 4JJGA 4NMHA 1JWBB 1A72A 2Q99A 4BKRA 2UDPA 2I3AA 3OIDA 3D4PA 3ZNQA 3GVPA 2JJYA 1CERA 1I3KA 5C3MA 1U8FO 2BKAA 2Y1DA 5DP2A 3HDQA 2Q1WA 4GWGA 4HX5A 1T2FA 4YBZA 3PIDA 5JXWA 2J5RA 2B5VA 3KM0A 1E7WA 3M1LA 3B1FA 3C3XA 4RF4A 3PDJA 5C37A 1PJBA 5CAEA 2NVBA 4E6PA 3UKOA 4IQGA 4U0KA 1LBEA 5G4LA 1P33A 4CLRA 3ZWCA 4BGIA 3L4BC 2AE1A 3ICCA 3UICA 1T26A 4NJMB 5AXAA 1U3VA 5AQ1A 2OL4A 1UDBA 2Y0DA 1UZLA 4Q3EA 4E12A 1E6EA 4BO5A 4DLLA 2CFCA 3NGXA 3CSDA 5L95A 1PL8A 1E3EA 4PZCA 3HUDA 4JCOA 2NTVA 4GX1A 4UAGA 5DOVA 3ZWWA 5ER6A 4Y67A 3WGYA 4BNIA 2FRDA 1P45A 2BRUA 4WCFA 2AQHA 2ZJ1A 4DMMA 5DBIA 2O7SA 2DTDA 4CMEC 4DBZA 3GPIA 2NU6A 2X5KO 4TRNA 4IDAA 1XIVA 4N54A 4QUKA 2CNBA 4DPKA 1JW9B 3OP4A 1DJQA 4TKMA 1IZ0A 3DWFA 1SOWA 2CVQA 3TNLA 3ZDFA 5KKAA 1I3MA 1HF3A 3ZU4A 4RLHA 4F3YA 3SC6A 1YJQA 3IIEA 4PG7A 4RVHA 2VUSA 4AJNA 3DFUA 3ENKA 3MTGA 4NFHA 3NDIA 4BNGA 1BGVA 4MVJE 3ZN2A 1E3JA 3CH6A 2VTEA 1SB9A 3COSA 4WLUA 1ISFA 1WW8A 3VVCA 1ZW1A 4EW6A 3G1TA 4CQLA 1G0OA 5TT0A 1XQ6A 5AXBA 4ZICA 4YWJA 4GBJA 1LQTA 5IDXA 3DL2A 4Q9NA 3PJGA 1GDHA 1ZK0A 4RVGA 2IEDA 3I9NA 3KB6A 4E5PA 5JBIA 3LC2O 4R3WA 3UUWA 2VHVA 3D64A 3D5QA 3DZIA 4R5MA 5IDYA 2NU7A 1B3RA 4P4NA 4BO6A 5ITWA 3WGIA 1HZZA 1DC4A 4O6VA 3B6ZA 3LSYA 2IODA 4B4OA 3NT2A 2CD9A 2X6TA 3OJLA 1UXGA 2DQ4A 3RFTA 5G0TA 2G76A 4PLCA 3WG9A 3WNQA 4BO9A 5I9NA 5ITVA 1E5QA 5FYDA 3VC7A 5TQVA 3BZUA 1H93A 3E9NA 4LCJA 1NQTA 1O95A 4ZU3A 3VVBA 4EJ0A 4JK3A 5I7VA 2Q1UA 4IDDA 3HDHA 3ETGA 3GRKA 4RVSA 5U4QA 3WMWA 3EGOA 3A9WA 3SLGA 1YXMA 3L0DA 2NACA 2GZ1A 3WQSB 1P1RA 3FRJA 3F5SA 3ZWXA 3U62A 4XDZA 4I8XA 4ZRNA 1O5IA 4HKTA 1NX6A 1EDOA 1SEVA 4L4SA 1PJQA 1FDWA 4CV2A 1ENPA 2WJPA 4WUVA 4F6LA 3TQHA 2LDXA 3Q6IA 3TL3A 5BSEA 3TPCA 1JAXA 1NFQA 1VSUA 3DBLA 1B2LA 4J9UE 4JX8A 1MC4A 3D3WA 2VHWA 1LQUA 5COBA 3NTRA 2WYUA 8ADHA 5TLSA 1E6WA 1JVBA 3RD5A 3D4NA 3NGLA 4E32A 2DBVO 1EE2A 3DHNA 3FPLA 1BXKA 5C7LO 2GSDA 4K28A 2XOXA 5FWNA 3E48A 3WS7A 3GDGA 1K0UA 1E1MA 2GASA 1LEHA 3IP1A 3M2TA 5BT9A 4Q3CA 4MIOA 1U3TA 1DBVO 4O59O 3FTNA 3DC2A 2HMTA 2Q2VA 5CEFA 3RFXA 4ZVVA 4Y6RA 4NK5A 1LC0A 2BFPA 1PQUA 1CRWG 1ISJA 1C14A 3QV1A 2DFDA 4PZEA 2V6FA 1WAMA 4YT4A 3BAZA 1D7OA 3RUDA 4YT8A 2VUTA 1IHXA 2EGHA 3SEFA 4UVHA 4EGFA 1ZK1A 1WZEA 5HWSA 5BSHA 1NAIA 2PLAA 3L6EA 1GUZA 3IL2A 4I08A 5G2OA 4WECA 2P9GA 2D2IA 4D44A 5A9RA 5IF3A 3OEWA 1NWCA 3I83A 3ZNPA 2Y1FA 5CDUA 2YHIA 3GF4A 3UF0A 2OO5A 4BNYA 3JCZA 3GH3A 3PK0A 4MVJP 5HBRA 4FW8A 2Z5LA 1ZBQA 1U2DA 1ZJZA 4Z6KA 5T5QA 2NV6A 1I30A 2WM3A 1T1RA 2PTGA 4ND2A 4P4GA 3Q9UA 4PLHA 3AFMA 1U8XX 4Y98A 3QLJA 1Y8QB 1J4AA 2PR2A 4WNCA 1J49A 4BO2A 3WYEA 3X2EA 1Q7GA 1PEDA 2QQ5A 2PKQP 4CMAA 3PDUA 4BVAA 3AUAA 4JQCA 1GTMA 3KBOA 4WLEA 3RC1A 1YRLA 4DTIA 1MG0A 1NR1A 3S2FA 3U4HA 4IJWA 5DCYA 4CV3A 4XR9A 4UUMA 1P0FA 1GYPA 3QWFA 6LDHA 4YRAA 4W4TA 4LRTB 5CG1A 2VYNA 3NKLA 5FFFA 1T24A 2FOIA 1GPDG 1KYQA 2VN8A 2DAPA 2G17A 2GO1A 3K30A 3PEFA 3KYBA 1Q0QA 3MJEA 1LSJA 1ONNA 3RKUA 3L77A 1OFGA 4OOEA 4E5YA 2W2LD 5L7YA 3S2IA 5K9ZA 1Y8RB 2Y68A 4CMJA 3PGXA 1TT5B 4I5DA 3DZFA 2I99A 1D3AA 2QIOA 5H81A 2DKNA 5IG2A 3OETA 1ZIDA 4PLPA 1RPNA 3RJ9A 3HB5X 4WKGA 3RWBA 5CEEA 3BA1A 1I24A 4BQRA 2B69A 3ENNA 4FC7A 2X8LA 3VDQA 3BMOB 4XGIA 3ZHXA 1MP0A 2Y67A 2PH5A 4LCEA 1I2BA 4KMSA 1W6UA 2GLXA 3I9MA 3HQ4O 4CUKA 4GVLA 2FZEA 4BMNA 1Z6ZA 2VUUA 4FCCA 4YJHB 1MV8A 4RVDA 7ADHA 2GDZA 4NBTA 1BMDA 3CZRA 4UVDA 5IZ4A 3OIFA 5KJ6A 5F1PA 1E1NA 2IYOA 4GQAA 2EXXA 4KTVE 2UUPA 5I8ZA 4DUPA 1D8AA 2EJVA 2A9FA 1B8PA 2NNLD 4I5EA 3PXXA 3AWDA 4MP3A 1P77A 2WMDA 5KJ1A 4PIVA 1DSSG 4IXTA 3LT0A 1C1XB 1QLHA 3DZGA 3B70A 1KERA 5TC4A 3O9ZA 3H2ZA 3PYLA 3Q11A 2HRZA 1CDOA 3VAZA 1DXYA 3JQ9C 3F3SA 4WPGA 3MJCA 3T7EA 5G0VA 5C7IO 1R15A 1GU7A 2HMWA 3G49A 3NTQA 2GGSA 2EP5A 2NVWA 3G17A 2QX7A 4PLWA 4PLYA 4QEDA 3KETA 1DIRA 3EZLA 1E3LA 4KQXA 3PQFA 3H5AA 3UHAA 4TVOA 1JVSA 4XIYA 2NVUA 1Y1PA 1A7KA 4B3JA 1DPGA 2G82A 3NYWA 2PK3A 1IUKA 5KJEA 7MDHA 3CTMA 2TMGA 1KEPA 1LX6A 3AJRA 3PFWO 2GERA 1RKXA 1V6AA 2V65A 3FNFA 3N74A 4PFJA 2W98A 5AXCA 4DIBA 4W6ZA 2JKVA 4PRLA 1R16A 4P22A 3ONFA 2YQ4A 3NT5A 4ZJUA 1U2GA 3OJOA 4AJPA 3WR5A 3DBRB 4HNGA 5K6AA 2B4QA 4MVJI 3W6UA 3W4IA 5BR7A 4U6SA 3RBZA 1LLQA 4MO2A 2QRJA 3WLEA 4MIEA 1PZFA 2YHIB 1HLDA 3AY6A 4GH5A 1LLCA 1U7HA 3VPFA 1DC5A 4OH1A 3VH1A 2DTEA 2VRBA 5A02A 1QV7A 3DMTA 4XGNA 4NBVA 4LW8A 2BMAA 4XZ3A 1CF2O 2C54A 4OSOA 4RO0A 4RPLA 3I3OA 2Q46A 5AXDA 5JY6A 1DAOA 5KKCA 4IS2A 4FFPA 4XD2A 4FS3A 4C7KA 1IPFA 3BMOA 3K92A 1VL8A 2RBEA 1NHGA 1UAYA 1KEUA 4AICA 3VH2A 1EQ2A 4PLGA 1Y5MA 2X0NA 3V1TC 4AJOA 5IAAA 2QHXA 4R9SA 1GZ3A 4NFYA 4G81A 4CLXA 3L9XA 4TSKA 1PR9A 1MB4A 3F6YA 5T67A 5U9CA 1U7TA 1Q0LA 3A14A 3CUKA 4KDEA 4EUEA 1P3DA 4A5OA 1F8GA 3ZWNA 2OZPA 1KVTA 1X0XA 5IN4A 2AQ8A 1ZMTA 2O3JA 4UVEA 2D5CA 1E7RA 4FOOA 2XF8A 2Z1NA 4K9DA 4B8ZA 5JSFA 1NTOA 4TRRA 1SPXA 4GX2A 1XCBA 5IFLA 2NUAA 4HV4A 4A2CA 1E7QA 2HRBA 3UFXA
chains in the Genus database with same CATH superfamily
3PD0A 4JB3A 2AMLA 2G9UA 1R6VA 2BM1A 4AUEA 1DLJA 1X13A 1N75A 3GFTA 2G9QA 4JEUA 3K0SA 4OB6A 4QJBA 1JQ3A 2C2XA 2RGNC 4UASA 5A71A 1Q57A 4EZBA 4RPJA 1UMBA 3LAWA 4FNMA 4N5IX 4OBEA 3KEOA 1YC5A 5F73A 4K6KA 3VH4A 3DAPA 1GNRA 1CETA 1DC6A 1PD1A 4FMDB 4G0PA 1TC1A 4EG0A 4LQ4A 3U39A 2RSLA 1UEIA 5JSQA 3SWWA 5TY0A 1VI5A 2IC5A 1O9BA 3C3YA 4MZDA 1LI5A 4X1IB 5KCMA 5B30A 5T4FA 3P4UA 4JLDA 2XNDA 3VZBA 1FUEA 1HDZA 2JC3A 3NYQA 4GX5A 3HR7A 3R74A 1EG7A 2DPMA 1WBJB 3C6ZA 1PJ4A 4QOIA 2F3PA 3ZWYA 5I7FA 3OJFA 4F93B 3NJ8A 4URXR 1XCMA 1AK1A 4P80A 1Y8QA 2E21A 3IBCA 1VE3A 1RRGA 1SC4A 1PZEA 1DFIA 4MI1A 5SYMA 5AIBA 2XCUA 1Z4KA 4HEJA 3N2KB 4JLVA 1LPAB 2CZGA 4IM7A 3DE1X 3FWKA 1B1CA 1DEAA 1NJ5A 2A9VA 4TLEA 1ZP6A 1IQ0A 1DAGA 2J6IA 4WN3A 1CULC 3UKDA 1IC6A 4CKWB 4RXUA 1RWXA 4DEYA 4EHLA 2AG1A 3ZIAD 4WCDA 4JBNA 1RJDA 2CXQA 3IIIA 3NIWA 3R76A 4PRZA 5CYFA 1BMQA 4M7RA 1OXSC 3GEBA 3O84A 3HXLA 3N76A 1L5YA 4QJ4A 4UBNA 4J43A 4X85A 3WQRA 4DR6B 3WDLA 5EQTA 3UXHA 2JHAA 1OLSA 4N8SA 4UVIA 1IB6A 1LPOA 5EESA 3AFIA 4LGVA 4US1R 2OE2A 3KLPX 3FYTA 3RS0A 1ORRA 3N87A 3PFIA 4MQMA 2QRVB 3VOBA 4EYSA 3VZDA 1ZX1A 1QMGA 4ASUD 4YACA 3T5MA 3PNPA 4G1MB 3VSAA 4IQFA 5JS7A 1ABEA 4CKXA 5ECGC 4DA0A 3JD0A 1KZ6A 2OZLA 1KJIA 2C00A 1XC7A 1N0VC 4Y2GA 2AOVA 2R79A 3C3PA 1K9SA 2WU3A 3E23A 3G0OA 3KFVA 4TZTA 4D41A 5HSGA 1NVGA 3B8EA 3QUBA 4UVGA 1EFVB 4CG2A 4OQQA 2WUGA 3NW9A 3R9WA 3IOMA 1K6XA 3GRFA 3HMKA 4E33A 4JMLA 5KYXA 3DLAA 1QIMA 5KNBA 3X1DA 2TRSB 4Q3NA 3FZYA 1AT1A 2XVAA 2CWDA 4OI1A 2O8EB 1EX6A 1KJJA 1SC9A 4MKGA 2GNAA 4LF4B 3GFQA 1J7KA 3AC0A 5L6MB 2R86A 3KJEA 5IZCC 2ZDHA 3FMIA 2AFIA 5JDCA 3WBFA 3OOYA 1FP1D 3UYKA 1DFGA 1GSAA 1ZJ6A 2PU7A 3RBVA 3ZLJA 1N7JA 2RBGA 2R4QA 3CUEF 4JT2A 4Q21A 4EUNA 4G01B 4B3FX 2C5SA 1BKSB 1ZH0A 3PRJA 1SOUA 2V8OA 2IU6A 4ZOBA 1RBMA 2FN9A 3T7JA 1ISRA 1RRCA 1Y81A 4FT2A 2D2XA 2QQ0A 4BQOA 2FW6A 2QVGA 4YJHA 3OQOA 2AX4A 2XTNA 1PBTA 3MJTA 2P9BA 2Q9BA 4DPMA 2I8CA 2ZRCA 3TTUA 4C2UA 2Z6AA 1YS9A 3JTEA 6REQA 3GLGE 3K0FA 1FS4A 3C7AA 5HS4A 3PFNA 1IXSB 3EAGA 3A3PA 2EL9A 2MSDB 4HB0A 1ZVMA 3F7NA 4WFJA 2W2KA 3USES 2VWGA 4GAEA 1UC5B 3C6XA 1NUHA 4OYRA 5FPTA 4HLNA 2QGFA 4RSHA 2VRNA 3CA8A 4FGZA 1U28C 3H87A 5C5EA 3QKTA 1GKLA 1FP6A 1U7PA 2NM0A 3BTOA 4FCWA 1PFQA 1C1XA 1NDUA 3REFA 4DCPA 3WXMA 4ABTA 3DLCA 1RCTE 1RQ7A 3JSAA 3PIRA 4YCMA 1SCDA 3ORYA 2AQIA 3I34X 4CEJA 2P79A 2J9RA 5EE5B 3HNOA 4JVOA 4RETA 1MNQA 3SDZA 3M34A 1FP4B 1OH8A 1JFLA 1UAGA 1RP1A 3FZQA 3KQPA 3WMRA 5G02A 2FPGA 4PC7A 3QVVA 2F8LA 4UCFA 4U9IS 4KQ9A 1YOBA 3IA7A 4CNQA 4ENPA 5A0FA 3U09A 2BGMA 3FPCA 3IMEA 3WO1A 3QVOA 4WXEA 2CMHA 3F8TA 4U7HA 1PTJA 4HGPA 4I7EA 5DM0A 3D1LA 1H23A 1ZI6A 3AUXA 4F96A 5BY2A 3ANTA 3NRBA 1XQXA 4HPWA 2E6UX 1C7FA 2OO3A 1L1FA 2ZTLA 1SBQA 3G1WA 3N7TA 4OQZA 2GVZC 3P2KA 3AI3A 3IEVA 1P2FA 3EMBA 4UZSA 4WEOA 2HJWA 4JV5B 3V4SA 3NBFA 1XMXA 1XZJA 2FLWA 1WV0A 3HKCB 4PZDA 4BVJA 1ZQ1A 4ZYLA 3F90A 3GT3A 4C14A 1NBMD 4TUYA 2RHRA 3EPJA 2QVZX 5EINA 4OJMX 1NL3A 4JJ4A 4AJKA 4OX9Y 2YZKA 2FPPA 1B0UA 1LNSA 4D9FA 4L16A 3CSUA 1TTPB 3T3IA 3SI7A 1IG0A 2K6GA 1C3OA 4I36A 2NTJA 1K98A 4YMSA 1JZTA 4Q3DA 3ADDA 3HO8A 3GLFB 1AK9A 4G09A 5JDCC 1JWAB 4MWCA 2FMFA 4ZTZB 1JVNA 2GKSA 5EJMA 2D2EA 1I1OA 3QVWA 1B6GA 1I7PA 2VL7A 4A3SA 2O59A 2Z04A 5KTKA 1VHTA 1MXFA 1NBMA 3DVLA 2EP7A 2G77B 2VEDA 3MMXA 1FSFA 3OLZA 1LVGA 1KU6A 2IYLD 4PHFA 5DTEA 1HKUA 4AMYA 2O5CA 2A6PA 3ZNNA 2P6MA 2YRWA 4IILA 4AZSA 3G9UA 1QFJA 1VP9A 4D92A 4DJ5X 4HNTA 4TMZA 2APJA 3BREA 4RA6B 1XJ0A 4R8VA 1LV8A 3FOZA 3W6OA 2AG8A 1RAEA 3EMVA 2PZFA 1IOVA 3CLSC 1Q83A 5REQB 4LC0A 5IJ0A 1SR8A 4KTTE 4ZC8A 3AI2A 3ET4A 3NHPA 2EFDB 3LC1O 4UPVA 1N6IA 1H5NA 1XLTC 5KX5B 2DETA 4OXIA 4MITA 1SA0A 1ZKMA 2IHBA 4UJ5A 4YAWA 4R1OA 2GPJA 1E9RA 1C8LA 1LW6E 1EUZA 3HI6A 3SIRA 3LW8A 3RGGA 3AINA 4OGKA 3W79A 2O2JA 1A27A 1R4MA 2JGKA 2YH2A 4N40A 4XJTA 1SUSA 4GR4A 1C30A 4TS1A 5T4HA 3WADA 5BR1A 2OZKA 1EVZA 3A1WA 1CVRA 4US0R 5JNTA 2FW7A 2JIBA 1K06A 3EVCA 4L5IA 4DMCA 4QTYA 4WA8A 4OATA 1QF6A 1PKEA 5KOIA 3AFHA 3SKYA 2Q62A 2YXPX 5J58A 1VCOA 2ZT6A 2JGNA 4CFSA 5JYEA 2ET6A 1MT0A 1US8B 3AIKA 4RVNA 5HE9A 1KS2A 1ZNQO 2QBYB 3BH0A 1HEUA 4KI7A 2Q49A 4OFWA 1JJIA 1RAGA 1RMYA 1H9BA 2BEUB 2OO7A 4HC4A 4L9WA 5FOXA 1O94C 1DBWA 2H1CA 4B6JA 1SD5A 1SQSA 1G291 1FPQA 1ZHOA 1ZD2P 3WYNA 2J33A 5BMOA 2GWRA 3OLQA 2J3LA 4H3HB 5TIIA 1ZW6A 3BYZA 4AY4A 5C0OE 1C1DB 4B31A 2YUTA 2VQ3A 1JWLA 1W4CA 4W8OA 5EWLA 3JARA 4B35A 2NUTA 5I51A 2Q6TA 3F6RA 3FTPA 3ZWPA 4D8WA 2UZ0A 3LXUX 4ZEWA 4NCIA 3PE6A 1EINA 1QF9A 2VHYA 1XELA 4YGXB 4E22A 4KXYA 3F2VA 2E48A 2JRLA 4YJ2F 1AB6A 1TVKB 4WBXC 2IHYA 3LP6A 4R40A 2C3UA 4G0VA 4I6JA 1M2VB 1XRNA 2EF0A 4ZPJA 3WK6A 2H1HA 3AY0A 3CVYA 5J4KA 5HIJA 3RT1A 4XB2A 3K35A 1I1QB 3PF9A 4F6CA 4L08A 2Q6KA 3FH0A 3TLZA 2CCGA 3GNSA 2JASA 5CW1A 4BRZA 5K7SA 2GXQA 1Q12A 3FYUC 2AB0A 3SC2B 2FN7A 2REQB 4K6FA 3ZD9A 1A8SA 4IHKA 4OLFA 3AKEA 3DPSA 3JALA 3N3BC 2NU7B 3E22B 3D5EA 1Z36A 1LSOA 5L3ZA 4L0DA 3UH1A 2GR9A 5T64A 5BN5A 5H8WA 1RWMA 1U1CA 4KMMA 4BNMA 1E6KA 1JHQA 4AFNA 3E8MA 3EJWA 3RAEC 1D1QA 2WA1A 4X45A 3RTAA 3PRHA 3QEBZ 1BFDA 4JQSA 4JBYA 2PU5A 3RVDA 2P2GA 5THQA 1FZTA 1Q20A 5CNJA 5K3DA 5KQLA 3MBIA 3ZE6A 1CY6A 3NCTA 3F1KA 3VUEA 1JMVA 4I5FA 4Z7QB 5D84A 1II8A 1THGA 2XOKA 1IONA 3PXCX 5ETJA 4C0BA 3BHJA 3VX3A 1Y3BE 2H2WA 3BMNA 4Z7OB 1A9YA 3A4VA 4MV5A 2L18A 2CMGA 3ZI4A 3K70C 3KLOA 1T9KA 1JBKA 1C9KA 2D7DA 1NTRA 4YP9A 4BJ3A 1P73A 4I4TF 4QYIA 5EWJA 1W4AA 1O8CA 1TYBE 1RZRD 4NQRA 4IF4A 4DR3B 4JP5A 4AX8A 3AWIA 3ZGVA 5KZMB 4FFLA 3USZA 5IVHA 1FTYA 4M7WA 5C37A 4Z49A 3UAXA 1AQYA 1QORA 3AF5A 3DCIA 4X97A 1U9JA 3AIIA 2BGWA 2RAPA 4DA8A 2WD9A 4KWCA 1VMDA 2P4SA 3I6IA 1JBEA 4FBLA 1SVWA 1DRJA 2XUHA 1YGYA 2YHAA 1KQPA 4DMKA 2JEOA 1RHUA 3WWPA 1YASA 2EZUA 4G4IA 4BJ6A 5EGSA 2QTTA 2DFVA 2G5CA 2YW9A 1FB5A 2IDZA 2ZIEA 4C6HA 2DHEA 2PPLA 3OFSA 1DFHA 1ND6A 5ALHA 2QKYA 3FN4A 1WZ2A 3F6EX 3WYCA 3ZV6A 2AYXA 5MGNA 3KL4A 4DOMA 4M1OA 1NW7A 1W0JD 4QFCA 4HQOA 3VYSB 3KV3O 1ZY2A 4HWPA 1ZJJA 2I33A 1H4VB 2NYVA 2R1VB 4EJSA 1FX1A 4G0QA 3L4EA 5LVAA 2P9CA 3K73O 1N1EA 1YB2A 1Q6ZA 3OQHA 3BVPA 3KSAC 3RUCA 3LY9A 1Z0DA 1DXQA 1RRPA 3H4VA 8AT1A 1J0CA 4ALNA 1TVEA 2ZRGA 4LJRA 2WWVD 2IPAB 1Z2OX 4ZJPA 2XCRB 5AJZA 4B44A 1D5WA 1X1DA 2J0QA 4W82A 1HY3A 4ZQEA 3NWPA 4ER0A 4ZCTA 3I39X 1GXSA 2XE4A 4EHIA 4DSNA 3WYDA 1E1RA 4COOA 1UBTS 2IBMA 4K1LA 3VC1A 1OGYA 4BQPA 2Q0HA 3IUPA 2OB2A 5CVEA 2V3VA 1WR8A 1DS6A 4BQEA 5JEDA 1K08A 3A6PC 3B1JA 1MD9A 2HDNB 3T4EA 2H29A 5ALPA 4YMVA 4EW2A 5J43A 3FKJA 5DNEA 1EFPB 2NPFA 4MS1B 3D6UA 4B3GA 4FINA 2ZXFA 2BI7A 3CUYA 2A67A 1AMUA 2O7QA 3I64A 4RL4A 1P7PA 1G98A 1KYYA 2ETXA 2PDAA 4MQFA 5EQJB 2H4ZA 2VDUE 3PFKA 4BX2A 1JG6A 2OZEA 4O4HA 3M6IA 5GIPE 1VJ1A 1QUEA 1YB1A 3H17A 3QBJA 4MCAA 4YWHA 2ZVQX 2VK8A 1N57A 3A0RB 2HT6A 3IQXA 1DKMA 3FYUB 1MTOA 1V43A 4U0JA 1Q0RA 5JYDA 3WSVA 1SIWA 2JFBA 3V1KA 3UMBA 2CUKA 3I6ZA 4GKJB 1OYOA 1TO1E 3KZVA 3N9IA 4IVQA 1C0IA 1II0A 2HD4A 4R51A 3UWMA 3H65A 4LOJA 5DRTA 5GWXA 2XT9A 1NR7A 3JR3A 3BFJA 2X9GA 2NUBA 2B36A 3HEBA 1BYIA 1PYGA 4RV5A 1LBIA 2GILA 3SFTA 2D2FA 2VXCA 2H9YA 1QTNA 2X1LA 1QH1A 3L1KA 3W2GA 2WA2A 2ZI4A 3QFSA 3VR6A 4TWRA 2FFHA 4WJKB 2GAIA 5M04A 3RCBA 2XB4A 1MJGM 4FOPA 3U3RA 3FMGA 5JZVA 4E2FA 4Z3DA 2OGUA 2F90A 4NJEA 5TDHA 3E5MA 5CK5A 4FZJA 1R50A 3QSYA 1SNYA 4MQBA 4E3ZA 3O8RA 4HQ6A 1D2RA 1ZK4A 4KGZA 3AW8A 4L8GA 3H19A 3WAGA 1FF9A 1ZOOA 4ZYUA 1EUYA 3BF7A 2EKZA 5A7HA 3SC3A 1W36D 5G0SA 3G9ZA 2WJ6A 3KCQA 2PSSA 2ZYDA 1CSEE 1I2DA 2A5JA 1ZVJA 1DX9A 4E1AA 3U56A 5DCUA 4HNAA 1DO8A 3BPSA 4BYMA 3PI6A 1YVDA 3TWOA 1T9AA 4R16A 3NUZA 4NR0A 4D3FA 5LMZA 4I5IA 2QY6A 1A2OA 1ZUHA 4I55B 5AHKA 2NTYC 3JQAA 1CFZA 1U02A 2XKAA 4L0CA 3ND5A 1LW7A 1YT5A 3N5KA 3KKLA 5LDHA 2AFIE 3CX3A 4JOBA 4PFQA 2ZUCA 3CLSD 4F60A 3PA8A 4DR1B 4B32A 1ZZGA 2CFRA 3D0OA 1QE5A 2IYVA 3C3CA 3DHWC 4HVAA 1YH3A 4MDFA 1IAQA 1MN6A 4L6IA 1T2DA 2EEZA 1AUXA 1XVTA 5DN9A 5BMVF 3PU6A 4ROTA 5L4NA 2KSQA 1L9KA 4RIEA 3HZHA 1YVEI 1ECGA 3U9TA 3JQFA 4IUDS 5IDVA 1RRKA 2X22A 5HF6A 5JSUA 2E55A 4B09A 4LHWA 3OO0A 4RLFA 1D0VA 1A7JA 4WLFA 7YASA 3UMGA 2AJDA 4HN4B 1P4HA 3IESA 5HYVA 1MZVA 3SF0A 1W8DA 2NLOA 1NQVA 2CFTA 3K9FC 3LWZA 3R1IA 1XD9A 1ZUNB 3EIEA 4OSEA 3M6AA 4Q3OA 2WIDA 4YYZA 2W2XA 5C53B 5F9FA 2M6LA 1UFVA 2NV0A 1CUFA 5ICCA 2IDJA 3OQPA 2P5UA 2Q3BA 3LHFA 1QE0A 2DBZA 5AUOB 2C2WA 2PUJA 3OESA 3Q7PA 1N2OA 1XTBA 1L7DA 2H17A 4LZWA 3ZW7A 4QYWA 2I78A 4A6XA 3WB1A 1KMQA 1FW8A 2C4NA 2ST1A 3K31A 4CE6A 1DAPA 3WJAA 1SXHA 2B1JA 3EFOA 4Q1DA 4XGQA 3TRFA 1I10A 2C7GA 3N8HA 4L07A 1E5VA 2GHQA 3O75A 4J6EA 1ISMA 1RZ3A 3MWJA 1E0DA 4Z9BA 1ZGAA 2D8AA 1SU8A 3E0QA 4WESA 3GEMA 3DCNA 2RC5A 3LY7A 4OHZA 3IALA 3RODA 4NE9A 1ZONA 4X8OA 4AMBA 2WJJA 5E95A 4CMKA 4W7SA 3NUQA 1D1TA 3QLVA 4R2MA 4CU5A 1P0CA 2B83A 3KB2A 1MC1A 1PGQA 2DQKA 2EARA 2O3RA 4UQOA 2DY0A 4TL8A 1KZHA 3IQDB 2GPYA 2BFEA 4JJKA 2AV6A 4EATA 4M9CA 1M1NA 1DRVA 1U0EA 2ENWA 4HAIA 4XXHA 2X1HA 1QGDA 4YH1A 3ZCRA 2GHTA 3OZ7A 5JLJA 3C4VA 1J0XO 4BEBA 4AJ2A 2P6PA 3Q6MA 5AP9A 4JLMA 3SVLA 2PN1A 1N0WA 2VJYA 1GR0A 2XYQA 4GBMA 1M8KA 4MAMA 2X3UA 1DUIA 5FOSA 1VLLA 3JQQA 2PL9A 4OO3A 1EK5A 2P7IA 1M6EX 2FMHA 3TKLA 3CBGA 2A5LA 4Z7JA 4TLMB 5KBYA 2PTHA 5EP4A 2OY0A 2BISA 2IWRA 5JR3A 4ZT6A 2B1GA 2C20A 2VO1A 2HO5A 2OSBA 4HAXA 4DV7B 1RLJA 2IXBA 1TO6A 3RV3A 3U3XA 1SVKA 1NYTA 3VTFA 1RVDA 4O2BB 5BWBA 4IDCA 3BGOS 4NHOA 4C2AA 4EPYA 1WQ3A 2JLCA 2QR5A 4CW7A 1F0NA 3JS5A 3RK4A 4NU6A 2V0CA 3CEHA 4MA5A 3EIWA 3RG2A 3TEMA 2HT1A 3RYTC 1DOZA 1MAUA 3D54D 2A2ZA 1C3JA 1FYVA 5CVTA 4QPJC 1LS1A 2CHGA 4LV5B 1VMKA 3A04A 1JH9A 2W83A 4FFOA 4WZAE 1Z6AA 2BH9A 4L9RA 1G5PA 3PHHA 1ESMA 4PAWA 3HP7A 4Y9RA 4YFYA 1ZS9A 3BWEA 3EQ9A 4RZ2A 4CKYA 2PT9A 3ZV5A 2HOQA 1QR2A 1XMIA 4JI1B 3DOCA 5FLXA 1DMRA 4UDXX 4WA7A 4HZUB 3KJZA 4ZVTA 1IBLB 1MNAA 1FPMA 5JMPA 4HDRB 3WQQA 1VSBA 3VR2A 1K2VN 5IC6A 2XRFA 2EDCA 2Z98A 1Z12A 3MWKA 3B6JA 4MVJM 2R65A 1T2EA 4LKRA 3ZDXB 1YKSA 4H15A 4M6WB 3HR8A 5C7OO 4LTMA 2WTEA 3H2GA 5B1HA 3CZQA 3PS9A 4M9ZA 3CPEA 1TTQB 1HC7A 1TECE 4X8HA 5AVUA 4IH9A 1PO7A 4MV1A 3OM1A 5DNWA 2G67A 5EPEA 4S35A 4BNFA 1F1BA 3K05A 3PFHA 2GCNA 5JADA 2QVYX 1Z7GA 4B3DA 4RA9B 2WSSA 4BB6A 1N33B 4UUNA 1C29B 3MBKA 2QJOA 5IK2A 3DVQX 4E11A 2F1IA 3KE8A 1MB0A 1Y4SA 1HT3A 1UC8A 4HAOA 3KAKA 4K9MA 4EPWA 2ERYA 4RUKA 5ILQA 1F2UA 2PZKA 1I7NA 1GUFA 2XUQA 2YVQA 3KLNA 5F4ZA 3S2YA 5SZHB 4BFSA 4EYKA 3QMPA 1PRYA 3PQEA 1K7YA 1DZ3A 5JS1A 4F6RA 4LYFA 1KOLA 1JQLB 3OM8A 3IT2A 4DJDC 5TB5A 4DV0B 3EWSA 2REOA 1B3BA 2A9QA 1UP7A 1BE0A 1H6DA 3KHUA 1RC8A 2XLBA 2X41A 3KHTA 4WI1A 5IK2D 3AUYA 2FPRA 4V3CA 3T41A 3EXG2 5B3KA 5AI4A 421PA 4G8DA 4EY6A 3GLHB 5IT4A 4IOLA 5EP2A 4E09A 1FLDA 2HTEA 4MEBA 3EHEA 4C2BA 3Q5GA 4CIXA 1O03A 1VKJA 4ZT5A 4M8SA 1Z88A 3FVQA 2DFTA 3H9CA 5HOEA 2XKBA 4ZEOA 5TQJA 1JP7A 1X2EA 4J16A 1D03A 1SXJA 2VTDA 2QN3A 1EVIA 2D13A 3B38A 3KLMX 2N9UA 3BMCA 1BFKA 1R2QA 1RHMA 1E0JA 3IV6A 2P3LA 3KYJB 4LVOA 4NBRA 3ZHUA 4M0PA 1FU7A 5BT8A 4G8BA 4ZU6X 4WNIA 3SVZA 3DMRA 1P0PA 2WSMA 1XF9A 2WAOA 1E6LA 2NXCA 4G23A 1L1EA 2A1IA 2JANA 3N2GA 3RIXA 4ZT2A 4TM8A 3RHSA 4W5RA 2V8BA 4D79A 3LH5A 5HDQA 4AYXA 4PG6A 3QXJA 3P9IA 3GJ5A 3WLLA 1KR2A 3ADPA 5AI5A 3BTSA 3P0RA 1R18A 4G3XA 2H54A 5ES4B 1VCNA 3N2IA 1SCQA 1RWPA 1Y7TA 2RGGA 2ADOA 3CZCA 4UUAA 5I9MA 2J41A 1USWA 2PVCA 2YQ5A 4IEEA 4ZCQA 5IASA 1IZZA 2P2YA 3DBVO 4QRDA 5GIOE 1A5TA 1QPZA 2X4LA 2QSJA 2WKSA 4KQGA 2XCOA 2PGLA 4PLHA 4Y98A 1QYVA 1QFSA 2ZB3A 1K6JA 5FOTA 2ZUDA 5CM9C 1EAMA 5H02A 2IZ5A 4GPTA 4UD2A 1D2GA 1OI3A 1YONA 2GDJA 4I3HA 3T5DA 4EAAA 1X9IA 5IKOA 2P6UA 3PL1A 2GEUA 1JL3A 1T0BA 2JGLA 2A4MA 3D5TA 1JR3D 4OU5A 3S2UA 2AJLI 4V1CB 1T0PA 4CKEA 3MCTA 5F2NA 1O08A 1WULS 4C05A 3RYCB 1WXIA 2XOKD 2Y99A 3GCWA 2YY5A 4X9XA 3EAFA 1UJMA 1PJCA 1NJGA 4FE7A 3SQWA 4BQQA 2WP0A 4I66A 3DM5A 4X1YA 4A6PA 4YMUA 2IXAA 2ZSBA 4UNNA 2AN5A 5DYGA 4C20A 4EF6A 1XEFA 4P3PA 4YVFA 1TEVA 3O3NB 4IQ8A 2WR8A 4IIJB 3UHFA 4ITUA 2FJPA 5I9IA 4H4EA 5DP1A 2C5GA 4H0CA 4R1MA 4WXHA 2Y1GA 3RYFB 2XYGA 1USGA 3T9DA 1QBGA 1VFPA 3OPNA 3WL4A 4DTCA 1PNRA 4CM3A 1SWVA 3A37A 3AR4A 3ETCA 2HXGA 2QVXX 3CUUA 3GUCA 4FYJA 4IICA 4WY8A 5LPNA 3FCOA 1G2QA 3LCUA 4RJIA 3FPHA 3D81A 3L0IB 5CFMA 4Y2JA 1SHTX 4CVNA 1VSVA 3D8HA 2Z9CA 3UJPA 3R3WA 1E2EA 2JA1A 2NPIA 2ZYRA 1RIFA 4CODB 2ZYHA 2WDZA 3SX0A 2NZ2A 4JYCA 1I2ZA 3VPAA 4MVWA 2IPXA 5IJZA 4NXMB 2YXEA 2G1JA 4EEKA 3EUAA 1ZN2A 2ZRQA 1OAAA 4ZV9A 2YCLA 4CFZA 5FBVB 3B6EA 2RAVA 3EVFA 4Y2SA 4F9TA 2NU9B 4ZVRA 4GXQA 5A6SA 1PGJA 3FPSA 2Q1XA 1BMTA 1Z15A 3AM5A 4JS0A 3H5TA 3QBDA 1K2WA 2GN9A 2GA9A 2RAUA 2OPHA 3WZLA 1TM4E 2E18A 5EJ9A 1IK4A 4C03A 1KQGA 4KQWA 2WOJA 1O6CA 5H9VA 5K0GA 2QUBA 5L7WA 2TMKA 3INTA 1NP7A 4NCBA 3CVVA 1CRZA 4NCNA 2CCKA 4DF3A 4NFLA 3U7EB 2G80A 1FQOA 1YOVA 4B3CA 3ZD6A 3ECCA 1WDKA 2A0WA 2YV3A 1FP7A 2DLCX 4KSBA 3WC4A 3O93A 2PZEA 3FNGA 2GJ4A 3LIPA 4PZ0A 3TNFA 1CBUA 1GNPA 1GPNA 2I3BA 3TX6A 4D6PA 3DDHA 3NC4A 4KR0A 3DUWA 4DY6A 1UANA 4LF8B 2QW1A 1C4XA 1S8AA 1X7WB 3PJDA 3Q41A 3X1YA 1ZH2A 4CM8B 1I1HA 2YV1A 4DG9A 5AW2A 1VI6A 3TZHA 1NW3A 1LPMA 4B1FA 3C7DB 1I2CA 3HXOA 1Z0UA 5KYVA 2BZ1A 5F2OA 2HQSA 4D56A 1KSHA 5AIAA 3TSCA 5HFNA 4B8WA 3QPAA 1KO4A 3TGPA 5DHQA 4S0ZA 4HS4A 1RYYA 4IOMA 3WBKA 2WMYA 1OBVA 1HQDA 1Z13A 2PUBA 2W6MA 5HM8A 1XLVA 2B7CA 3QE3A 3N6VA 1OZAA 3U4QA 3R3XA 3BXEA 2OZVA 1UM9A 4D42A 2NO5A 6PFKA 1N8TA 1M6WA 2EL7A 4W7HA 4XX1A 5IN5A 3TTWA 1MENA 5HCNA 4K3UA 4D74A 1TQ4A 2HJVA 2R1TB 3DVRX 4JC0A 2FN3A 1XMOB 1CXZA 4NFSA 4HK4A 3R3SA 4O1IA 1ISIA 4J0IA 2C77A 4X6UA 2OORA 1M7BA 1S7CA 2WFZA 2FLKA 4GM0A 2P30A 4OQDA 1U2SA 2OD9A 4NPHA 4U6QA 4JB8A 3TMYA 3W5VA 8MHTA 2GBLA 3KEFA 4XQCA 5FJIA 2G3YA 2Z95A 5F35A 3JQ8A 3IODA 4NV0A 4R2KA 1T29A 3MPUA 4MP6A 4A8PA 4WOJA 1J5PA 4U7PB 2OBBA 3NHLA 3ND8A 3NOVA 4JELA 5FNVF 4MUKA 4JA0A 5TS2A 5BVGB 3CLVA 3OC6A 4KH0A 2EX4A 2FPSA 4KO1S 5LZ7A 1N5JA 2YWFA 4GUAA 3C5WP 1KC3A 4FQ7A 1S2DA 2C5FA 3AIOA 5ALJA 5TPZD 1KAEA 2HIMA 1JTVA 2ZBDA 4BLTA 4BNTA 1G64A 1F4VA 2YWJA 4NDNE 9LDBA 1QHXA 2OENG 3NVDA 3Q3GE 1I7DA 1CY4A 1U65A 5IT0A 1MBZA 1PV2A 2QTZA 3KSRA 4I6EA 3SYTA 1Z0AA 5CT5A 5B4TA 1IQRA 4TN1A 1YZFA 3BJEA 3W4JA 3JPWA 3NPMA 1OLUA 2RJNA 5GM1A 3DPUA 5TMPA 2YNMC 3N0TA 1FYFA 5JANA 3GRAA 2AJCA 2QRUA 4ZOLB 5FWAA 4CR8A 4XYLA 1O6BA 3ZQ6A 4FDLA 3AB8A 3B1YA 2BL4A 3KTOA 1GY8A 4I4IA 5JBQA 4DSTA 1EB9A 4QNNA 4B9EA 3IELA 1KYWA 1HRKA 4U7WA 1KOJA 5KNDA 2XQKA 2C9ZA 1GPKA 5BYKA 4IWXA 2XSZA 3LT4A 3D3EA 4S12A 4EQ6B 4Z7NB 1UXHA 2KHZA 2ODWA 1A9OA 1QHHA 3J81k 3PIIA 3K9QO 2P7HA 3DAYA 1BHQ1 3W7VA 3GIDA 1T6ZA 1NA5A 1MO3A 5LZ2A 3OQ6A 3SM9A 1DL5A 1IRXA 3R24A 4G1FA 5DM2A 1VRVA 1XL1A 4Z9XA 4IX9A 3U49A 1L5VA 5E0OA 1PGOA 2ECFA 1KJNA 3MWEB 1T1GA 3F1LA 2OECA 1SOMA 1RHQA 3FW1A 1I13A 1ZM2A 3Q9NA 1Z56C 4KKXB 4TPKA 3TZCA 1T34A 4BFCA 4MVJD 1NVTA 2IZ0A 5DW0A 1DBQA 2HSDA 5F9HA 1H94A 3KB8A 1V6CA 5AJYA 3BL6A 1Y5IA 4ZMBA 2ID7A 3MRXA 3H99A 1I14A 1DADA 1KETA 3NHYA 4GZ5A 5D86A 2WJHA 4ZZ3A 4HX2A 1ZI9A 6AT1A 2CFOA 4P7BA 4B79A 3N53A 2X9LA 1XFAA 2KLHA 4Y6GB 3DTVB 4LYYA 2YZ2A 4PWYA 2Q5IA 1NF2A 3MSXA 2WINI 1V4BA 1LTHR 3R6DA 3SOPA 4EY8A 1ZA1A 2JI4A 2CLLB 1PG2A 2UZIR 3E5HA 4Y0VA 5F12A 4CCYA 5MN4A 1NW4A 3T9EA 2KBEA 1YMVA 5JCZA 2Y0CA 2MSNA 2NQ8A 3BRWD 4L5YA 3IPYA 4CEJB 1NG9A 3TI7A 1PFYA 1B26A 1I5RA 3D6MA 3KO8A 3PNBA 3CPSA 1UBOS 3C74A 3T0FA 1BXRA 2ZJ0A 1Q22A 4RCVA 4OHBA 1TVMA 3TRJA 2RGAA 2CZCA 3TLYA 3KQHA 5AICA 3H5NA 4LXYA 4IZIA 3KSMA 2ODNA 1KHHA 3L7MA 1CIJA 3QNUA 1G55A 1TW2A 2XDWA 4QOJA 3CF2A 4V0SA 4PO1A 2DT5A 3AETB 4Q3LA 1CF9A 3A9VA 3ZHYA 4E94A 5AD1A 1L1RA 3N7UA 4WL0A 4QIHA 3PVZA 1E64A 1LLFA 3A1UA 3AR7A 3WP1B 1O94A 3FOAA 3L8CA 1SUIA 5A4MS 3A6FA 4BLPA 1OVMA 3KZKA 4RANA 2A0YA 2D59A 4P84A 1WCIB 5JJIA 2NZYA 5B5SA 4BZPA 1WMEA 3MHPA 3TLBA 4HNAB 4FD3A 2VF7A 4JWTA 3GW8A 4GZMA 2XWPA 4HTFB 1P1BA 4LJ8A 4CKEB 1NVXQ 3RTEA 3RFCA 1YE3A 4Z51A 2VT6A 2YDXA 4RHCA 4QARA 4Q7LA 1N5LA 3AF3A 5T4BA 3TN7A 1O94D 4NMLA 2R96A 4A27A 5LKAA 1MJ5A 4U7DA 3Q7TA 4BZQA 2WWYA 1DPFA 4I0WB 4EB8A 1J22A 2QAGC 4OIMA 4QGHA 3ER8A 1POXA 4HMOA 5LLSA 5HRUA 5FI5A 4TS4A 5K0JA 3GVCA 3SP1A 1G4AE 2GRAA 4XJVA 3EB9A 1FRVA 1HWYA 1ODSA 3WLRA 4X71A 3M5DA 4D9NA 1QOZA 4JHXA 4TRMA 3OQBA 3VQTA 1HKHA 3LLUA 3OBBA 1E3WB 1SIBE 3ZU3A 1ODTC 2AL7A 3UVEA 4BKUA 4PR3A 4D8UA 2O8CB 3R3HA 2PYIA 2Z57A 4JVMA 1RXYA 3U4DA 4E5SA 2CV1A 3AR3A 4UOQA 5AFSA 1KAOA 2OAGA 3LVBA 3MIIA 2EJUA 3ZHTA 1ESNA 4JQOA 4RTQA 4QDTA 4B6GA 3R0XA 4UMEA 4S2EA 1XMQB 1GCOA 1PR1A 2DUJA 3PG5A 1FUKA 3L8GA 1YDEA 3WP0A 5FEMA 4RGQA 4UM9D 1E1CA 4RK0A 1EQUA 3SR0A 3N3AC 1UBHS 1YWGO 4PYIA 3T7DA 1NMSA 4DVGA 4BEWA 1UCFA 5CNMA 4JOQA 2FSSA 1GZHB 4YMGA 1OPRA 2I4TA 5FOWA 4KJZA 1DBRA 2GETA 2LDBA 4K7JA 4KSYA 1PS9A 1U80A 3EWIA 3MPOA 3LVFO 3B85A 3IAAA 3G0CA 2J3JA 1R9GA 1F8UA 2OK7A 3RSFA 1BN6A 4M99A 2NO7A 2O4CA 4AXXA 2IYTA 4EG5A 1F8FA 2WU0A 4L8LA 4PRKA 5ES3A 5AM5A 3MCAA 1AKUA 3FVWA 2XPCA 3GFPA 3QE4A 5KINB 1HG1A 3M1AA 3AQ4A 1Q7CA 3MGBA 5H3CA 1OFHA 3JYNA 3UJ8A 1D9ZA 1YTLA 4BNXA 2GBLC 4LHSA 5KNCD 3HBJA 4RVFA 4AJHA 4FIZA 1XWIA 4FC6A 1I3LA 1TIPA 3T06B 1SG9A 2R87A 4LHVA 4HBZA 2P2DA 3G2PA 4NV1A 4PW0A 4YS6A 1E1QD 1RWBA 2UZAA 1MH1A 2ZITA 2XVMA 3FDXA 2H16A 5D51S 3AHDA 3GG2A 3KVRA 5DLQC 5ERYA 4AMVA 1ORIA 3I4LA 1WSWA 3IPXA 3F9RA 2M6RA 3AF1A 3W3AD 4ARBA 4D3SA 1U94A 1T5LA 1VM6A 3HY6A 1CJSA 2C96A 3D8UA 4HQ0A 5LN1A 5KHLB 5KOYA 4DLBA 1SXJD 1TVCA 2X8WA 2WOOA 3MEQA 3TIIA 4FEAA 2AS0A 1KJQA 1ZPDA 1MW8X 2OV1A 1D6SA 1TUBA 3ORQA 5K0TA 1BXGA 4NP6A 4UTVA 2Z08A 3CLTC 4HGRA 3AB7A 5CVDA 2CL0X 4AJLA 3V46A 4ENWA 1O97C 4YHBA 1TZCA 4CLOA 4R81A 1QO0A 2V7GA 4MUAA 2R6ZA 4BKQA 2IF2A 4M8LA 3H2SA 4K9SA 3PQDA 1E3TA 1B7GO 1JB9A 1THZA 1W44A 4DV6B 3M4JA 2JAPA 1JEAA 3AR8A 3V4LA 4UTPA 1JT9A 4G9EA 4C43A 4EVSA 1DHRA 3E9MA 1BWPA 2FK8A 4MRVA 2WHPA 1S3FA 3CJRA 4J2TA 2H1LA 4CDNA 2Y3IA 4MXDA 3PWSA 1YC2A 2BV3A 2JJ2A 3KYDB 4BMCA 2FNAA 4BMOB 2QRKA 2XT0A 4ONEA 1XF1A 4F86A 1XTIA 1RHJA 3WNZA 1ZESA 1EZ4A 3R40A 2O5RA 1ZSYA 2C98A 4FDMA 4JC4A 5BQPA 3E58A 4JUBA 1LVUA 1SKQA 3O91A 5K2MA 1QYDA 5A9SA 1TGYA 3EZ2A 5EFZA 2RH8A 1MAWA 2A3RA 1BNCA 4DZZA 5LFAA 4R1PA 5J2UF 2JHGA 3GGDA 1QTIA 4Q3BA 4RC9A 4TMXA 5B58C 1T3ZA 1JA9A 3U0BA 5ED4A 1KOGA 3NC1C 3O4FA 1YZTA 1FY2A 2ISQA 2PVPA 4JJ8A 4ZRDA 4D7AA 3E53A 3NATA 5ALVA 2XYPA 5IJ9A 5ICMA 4NWIA 4EQ6A 5DHPA 5KNDH 3KSBC 4LOHA 4EKYA 5JW6A 3T9CA 1PV1A 2DUUA 3C6BA 4RY9A 3FVVA 3PKZA 4N0MA 3T3EA 1NW8A 2D5LA 2FUG6 5LLTA 3KD2A 1GCUA 4QKQA 1OOEA 4W1PA 5IWCA 1QK5A 1C3XA 4TMFA 4AQ7A 4E0BA 1VGVA 3NTLA 1R74A 1V9CA 1SVLA 4AKGA 2A4KA 1OHHA 1DLIA 1USUA 3FBGA 1NG1A 1JG1A 2V7XA 3PX7A 4FNAA 5T6MA 2P6NA 4JLJA 3CLRD 5CJPA 1S2MA 1V5FA 4RF3A 4Q16A 5BVHB 2K2QB 3I9JA 3UAWA 4F2WA 1FDOA 2RKWA 1HBJA 1VJGA 1LZLA 3EIXA 3X0DA 2IX9A 4WUTA 2BMWA 2WMNB 3WHIA 3QI2A 1UDWA 3RK1A 2BFNA 5C4IA 3ITEA 3P9NA 3BIOA 1V8BA 4PHGA 4U9UA 5K0EA 2JRCA 4PICA 1N6RA 3QIVA 4GPD1 4R68A 4N8DA 3A3NA 2C2HA 2BEUA 4IJUA 4WSOA 4FYXA 1TEXA 3BK7A 2BFCA 3ORRA 5JXGA 3QU7A 3VJRA 3FFXA 1JHXA 4LVCA 5DISB 2OD7A 1MPTA 3CX8A 2V45A 3MGCA 2YMLA 5E9WA 1UT8A 5IBRA 3BS4A 5DTIA 3FSRA 3B1VA 3HHPA 5K8IA 1XX6A 1O95D 2GPWA 2O2EA 2XTAA 3M83A 3RU7A 3GAMA 2FEMA 3GMDA 3PDHA 3QWHA 4GC9A 4HYTA 2HEIA 4KO2S 1SXJC 1ORWA 4AYTA 2EERA 2IYAA 4HVCA 1GRCA 2IZ6A 4AZ3A 4R0VA 2O8FA 1GQYA 1RXVA 1W9MA 2W4MA 1AKYA 2BDUA 3MELA 4ILKA 2G1PA 2HFKA 1GGEA 3HSKA 4WE3A 2XJ4A 1IVSA 1NQOA 4CDGA 1HV8A 4TQ9A 1UKAA 2A0KA 1QNLA 4DBLE 5JYBA 1Q0TA 1CZHA 5DU2A 1L5LA 2QR3A 2A0XA 3K94A 3KQOA 3OZXA 1VHWA 5F64A 2PZ8A 3DO5A 1KIFA 2MYUA 2ZIUB 5DH9A 4ERXA 2QPTA 4QBGB 5L7TA 1CY0A 3AR9A 2RJ3A 2OQIA 3EBOA 1KEEB 2D06A