3WSVA

Crystal structure of minor l-lactate dehydrogenase from enterococcus mundtii in the ligands-unbound form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
312
Chain Sequence
b'MKKTSRKVVIVGTGFVGTSIAYAMINQGVANELVLIDVNQEKAEGLDGMAWGEKNVSVWSGTYEECQDANLVILTAGVNQKPGQTRLDLVKTNATITRQIVKEVMASGFDGIFVVASNPVDILTYLTWQESGLPASRVVGTGTTLDTTRFRKEIALKLAVDPRSVHGYILGEHGDSEVAAWSHTTVGGKPIMEYVEKDHRLEENDLTVLADKVKNAAYEIIDRKKATYYGIGMSTTRIVKAILNNEQAVLPVSAYLNGEYGEEDIFTGVPSIVDENGVREIIDLSITPQEKAMFHQSVSELKAVLDTVRLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title An alternative allosteric regulation mechanism of an acidophilic l-lactate dehydrogenase from Enterococcus mundtii 15-1A
doi rcsb
source organism Enterococcus mundtii
molecule tags Oxidoreductase
total genus 100
structure length 312
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wsvA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3wsvA02
2GZ1A 3LSYA 4CM3A 1PU2A 3K92A 2X0IA 1HDYA 3PQEA 3CUKA 4MVJI 2X0JA 1NQAO 4HNGA 1YB5A 3WFIA 3TL3A 3ZHXA 1RM0A 4OAQA 5BR7A 1P0CA 3C7AA 4F46A 4NG5A 3ZGYA 5LDGA 4JJGA 2RHRA 1UXJA 4FJ0A 1EZ4A 1PR3A 3OQ1A 3U09A 5F1KA 4WCDA 3H9UA 3LU1A 3HDQA 3AI3A 2FHSA 4UVHA 1M67A 2UUOA 1U7HA 3MJEA 4R5HA 1H2BA 1QYCA 2CDAA 4ZQHA 5JCXA 3JQBC 1ZO8A 5ITVA 3PJFA 2QZZA 1R12A 3ZW8A 4E5YA 3NEPX 3OJLA 3PVZA 1A71A 1WMAA 2YJZA 3GA0A 5FEUA 2I9PA 3MJVA 4J43A 3OECA 1D8AA 2W2LD 2Y1EA 3NUGA 2I66A 2DFVA 1V3VA 4JBHA 3L07A 4DIBA 4BMSA 1ZVMA 4CR8A 1F14A 1CWUA 2JHGA 3D4OA 4MVJF 5EINA 4AFNA 1HLDA 4I5FA 3N58A 4I8XA 5JO9A 5ENVA 4KMSA 3WGYA 3AWDA 1A72A 5H82A 1XQ6A 1P31A 5L53A 4RVUA 3HZZA 4YVFA 3LF2A 4GLOA 1LSOA 2EWMA 4Z9XA 1JU9A 3EUWA 5ICMA 2DVMA 2CF5A 2BGLA 4HFJA 4H3VA 5GZ3A 4GVXA 4D3DA 1ISGA 1EMDA 1GEGA 1IPEA 2B4QA 3B1JA 3N74A 1P1JA 1S7CA 3H8VA 3R6DA 3VZQA 3NRCA 3CMMA 4MP3A 3UHAA 1KY5A 3K31A 3RD5A 4J7UA 3P2OA 4CLHA 1MP0A 4J4TA 5G2OA 4ZRMA 3RU7A 3H4VA 3RUAA 1V8BA 1DJQA 1VSUA 3DZBA 2PFGA 1PS8A 1BG6A 2ZTUA 3EGOA 4Z3KA 2VWPA 2X58A 3WXBA 1MG5A 4IMRA 3ABIA 1T1RA 2FPGA 1E3IA 3BTVA 4DL9A 1UXIA 2HK7A 4Q3NA 3BHIA 4EW6A 4DPKA 2G0TA 1I0ZA 1M2WA 2QIOA 2GPTA 3DBVO 3L6OO 1YBVA 2DFDA 4MINA 3R3SA 3LYLA 1O8CA 3G17A 4OKIA 3PQFA 1BRMA 2Y93A 4KQWA 4FOSA 1B16A 3BTSA 1GTMA 1EUCA 5DBFA 2Q1WA 4L4SA 2VWQA 4Y9DA 4YJHB 2YZ7A 3W4JA 3SC4A 2DT5A 2PKQP 4XDYA 4XIYA 3NT2A 4JROA 4MKZA 4J1QA 3SX2A 4E31A 2PLAA 3Q0EA 2YV3A 4OGWA 1GAEO 4R01A 3WGOA 2EV9A 4WKGA 3HB4X 2HRZA 1DSSG 4BKPA 4B4UA 3TZ6A 2P9GA 3ETDA 2QW8A 2PZMA 3C1TA 1U3TA 1UXGA 3ASVA 2WE7A 4W7IA 1HDGO 4CQMB 4YDRA 2RH4A 1DO8A 5FWNA 3GGGA 4WLOA 1HE4A 3DBLB 4J7CA 1Y81A 3HDYA 2VUUA 5A9SA 3OETA 2XPCA 3PZBA 3PHIA 2BHLA 4PZDA 5DZSA 3PHHA 3GHYA 3ZNNA 3AU9A 5JLAA 4NBWA 1ENOA 3I23A 1NHGA 3JQAD 1ZKMA 4E33A 3GMSA 3JQ9A 1XLTA 3INGA 4BNUA 5I7EA 1HWYA 4FD3A 5L45A 1I3MA 1RKXA 1RM3A 1YONA 3H6KA 3G0OA 3ZWNA 2NQTA 2Y05A 1T2AA 2VZ9A 3VPSA 1UZMA 3JQGB 3X2FA 4MIEA 1WDLA 1MXHA 4WLEA 4WUVA 3HSKA 4BO3A 3F4BA 1IY8A 2VYVA 3JD4A 3DMTC 3NJ4A 3INTA 4R1UA 3RBXA 3FD8A 4FIZA 5TLSA 1U7TA 1HDOA 4KTTE 4IINA 4BQPA 4HX5A 3CH6A 3FBTA 1GV0A 3C7CB 2X9VA 1CERA 4CM4A 1ENPA 4BL5A 3QIVA 1R0SA 4DQUA 2VHWA 1P1HA 3H7AA 3IMFA 3P7MA 4S1VA 1DOHA 3RFTA 2ET6A 3LT0A 3OA0A 1MX3A 1QXSA 5T64A 1M6WA 2JFGA 1FF9A 5ES3A 1U5AA 5IDWA 1ZSYA 3H9JA 2F00A 1GV1A 2X5KO 4CL8A 2X9NA 1QKIA 4CLRA 3ZWOA 2YUTA 3ZV6A 1NWHA 3ONDA 1PZFA 3HDHA 4QO8A 4UUNA 2NU8A 4AJLA 1ONNA 3PLNA 2O3QA 4EJ6A 4Z0HO 4D41A 2B5VA 4C7JA 1UH5A 2P91A 3I6QA 4JQCA 4TSKA 3ZDFA 4MJLA 4CMHA 5ER9A 4Z0TA 4XDZA 1BXKA 2JCXA 2NSDA 1PZGA 4LRTB 2CDBA 2VT3A 5JMPA 1JWAB 3MWDB 3E5MA 5I8ZA 1XGKA 1DLIA 3OSUA 5TIIA 2Q3EA 2BFOA 4ITUA 4TMFA 3DO5A 3IIEA 5FF9A 1ZJYA 1T2CA 4LSWA 3ZWYA 3WYBA 3GFBA 1NXQA 2OP1A 4YACA 4ND4A 3ZWPA 3AFNA 3MWEB 2VYNA 1G0OA 4FCCA 4Q3CA 1LDYA 2Q4EA 4ONEA 5B12A 4BNVA 2Y1FA 3VDQA 3VAZA 3VHRA 1JAYA 1U3UA 2AQHA 2Y1GA 1LA2A 1SC6A 3G3EA 3KUXA 1GQ2A 3ULKA 5BNTA 1SZJG 2BGKA 1P0FA 3PWSA 3HNPA 4LCEA 1OZAA 3W6UA 1LDBA 3MTGA 3VH4A 1SEVA 2QRKA 1NQTA 3PGJA 4CR6A 1HSZA 2D3TA 2NADA 4KUHA 2X8LA 4DMMA 1T25A 1Y5MA 5A03A 5AXAA 5IZ4A 3BYZA 2D2IA 3L6EA 3H9QA 4IJWA 5EJ2A 2CVQA 3GN2A 4AL4A 3GZNB 5IXYA 4G65A 2R2GA 3DZFA 4DLLA 2DPGA 1KC3A 4CV1A 3UAGA 2GZ3A 3BMCA 2NTJA 4IDBA 4WGGA 2YHIB 4YRAA 1IHXA 3V1YA 2DBZA 1EUZA 3I1JA 4R3NA 3TDKA 3WNVA 3DDNA 4B79A 2CY0A 2NM0A 3Q9UA 3VTZA 4D46A 4NU5A 1NYTA 2HCTA 1F8GA 2IEBA 3RQSA 5A3JA 3JD3A 4YJGA 1BXGA 4Z9YA 4W9NC 4BNGA 1F06A 1ZEJA 4DC1A 2XXBA 2XF8A 2QZ9A 4L4RA 3H5NA 1VC2A 7MDHA 1KEUA 4XRRA 4Q3EA 5EL0A 3WQQA 3SEFA 3TJRA 1RJWA 3S2IA 3BA1A 2DC1A 1KYQA 1RPNA 4IJUA 4OJNA 4PG8A 4DQXA 3WIDA 1C14A 5COAA 4XJTA 3UXYA 4E5PA 5DDIP 4EBFA 3SXPA 4LVCA 4KWIA 2CZCA 1WP4A 2OZPA 3AJRA 4IQ0A 1ONOA 4RPGA 4TKMA 1LX6A 4N54A 3HHPA 4MVJA 3AK4A 5A06A 2V7PA 2DAPA 3VPGA 1AXGA 4OHUA 1HE3A 4A5OA 2VUTA 3D4NA 4ALNA 1F8FA 1XDWA 3L9WA 4GX1A 1LLQA 1ZBQA 4FFOA 1HYEA 1SBYA 5ER6A 4DREA 3GAZA 3WICA 5THKA 2WD7A 3D3WA 3EHEA 4OQYA 2O48X 4ZGWA 4MOWA 3GR6A 3G79A 4PG5A 2Q2QA 2ILTA 3R1IA 3Q2KA 5ENDA 1XWFA 4E13A 3Q9NA 5JE8A 5DNAA 3WR5A 1U8FO 3OH8A 1YRLA 2GN6A 1MC5A 4BO8A 3PHLA 1I2ZA 4Y67A 1IOLA 1EUDA 3K2BA 5IDQA 4RPLA 4XQ9A 2GR9A 3I9NA 2YV1A 3ONEA 1K89A 2AMFA 5BNIA 1OC2A 4CM9A 5I9MA 1YJ8A 1P45A 1TVEA 3EW7A 4BMNA 4DIFA 1C0KA 3NDRA 3LZ6A 4IBOA 4XR9A 3CINA 3NDJA 1ZK1A 4JN6B 4BNTA 4ESOA 1Y8QA 4HFRA 1KETA 3JD2A 4G2NA 2ZB8A 1H6AA 4O5OA 5HS4A 3Q1LA 1PJ3A 4XYLA 3HDJA 4J9VA 2J3HA 3F3SA 1CYDA 2CDCA 4XWYA 1OBFO 3ICCA 5F1OA 3AFMA 4DC0A 1HKUA 1W73A 3GOHA 4B4VA 1A4UA 5CFZA 1E3JA 2AXQA 4UAGA 3D0OA 1UXHA 1NFQA 2A94A 3LK7A 3ZWAA 2ZQYA 4PFJA 5BSGA 1YBMA 2W98A 1BXZA 1KVUA 4NI5A 4XKJA 5HTOA 4D42A 2IYOA 2Y1OA 3GUYA 3GVIA 4NJMA 5A9RA 4U6SA 3H9EO 5THQA 1J49A 1K6JA 3JD0A 2YV2A 1OAAA 4TQGA 1KIFA 4GGPA 3MJTA 5G4KB 4A26A 2X9GA 1RYDA 2GYYA 4NBRA 2O3TA 3BMNA 1LLDA 2P68A 4IDCA 3TWOA 3D7LA 4DTIA 3EMKA 4FBGA 1LDMA 3S2GA 2I65A 5DT9A 3A14A 4R54A 1PWZA 4EYEA 3F4LA 3OF2A 3V5NA 1BMDA 3RI3A 4XZ3A 4R1SA 5JAIA 1DHTA 2ZTMA 3CEAA 5A1TA 3DTTA 3FTNA 4D3SA 2X0RA 1PJLA 1R4NA 4CLEA 3QVTA 1U9JA 1NVMB 1IHYA 2Z95A 2X5OA 3BXXA 4CR7A 3BHMA 4L75A 1X1EA 3V1TC 2BRUA 2I3AA 3WSWA 1WNTA 4U5QA 2YFHA 4OMUA 1K6IA 2BELA 3ENKA 3KYBA 2ZYDA 4PG6A 3WX0A 3DC2A 1HLPA 2C29D 5C37A 2JKVA 3QHAA 2RHCA 1C3VA 5TSDA 1GPDG 1HTBA 4W9NA 1FDSA 2Y0CA 3M1AA 3ZI0A 2CFCA 4CM1A 4AJOA 2O7SA 3G1TA 5IJZA 4IY1A 2YY7A 2CUKA 3HG7A 1B26A 1PWXA 3GDFA 5ICSA 5T8KC 1W8DA 3DAFA 4GMGA 1DC6A 1V3TA 4BO6A 1PL7A 3NKLA 1WDMA 4CPDA 2HKIA 3ZWVA 3ZH2A 4YWJA 3WMWA 3ONFA 4M8SA 1SCUA 1CDOA 1JDJA 4JBIA 4NFSA 3QE3A 1PS9A 1N2SA 3OQBA 4JJFA 3WQSB 2HDHA 2BF7A 2D5AA 1GY8A 4RZIA 3AOEA 3GY0A 1ZK2A 3M1LA 2VNAA 3P19A 1Z73A 3KYDA 3ORFA 4PLPA 1UXKA 1ZW1A 4XIJA 1PSDA 1P1RA 3S2EA 4YJDA 4RGBA 4YPOA 3EC7A 5IN5A 4XYBA 3WGZA 2C59A 4IPTA 2P5UA 1K5HA 1LTHR 3OJFA 4WNIA 1R4MB 2VQ3A 1UR5A 1HDCA 2AHRA 5F5LA 2EKPA 4LN1A 3O26A 5AXCA 1DIBA 3UF0A 2FSSA 2X0NA 4XGKA 1P1IA 1O94A 3H3FA 1J4AA 3W4IA 2PKQO 2NTVA 4GL4A 1HZZA 1LSUA 2C2YA 2J5QA 4LK3A 3W8EA 2PR2A 1V6AA 2EHDA 2B69A 1NPYA 4BHTA 1IL0A 1NM5A 4FJ2A 3VPFA 3DOJA 3QVSA 3VPHA 3IP3A 5L95A 1H9AA 4H16A 2JD1A 2E48A 4J2HA 4AJJA 3I52A 4GMFA 1VJTA 4GVLA 2LDXA 3Q3CA 4MPDA 4Y98A 5IZCC 1XU9A 5CG2A 1J5PA 4BO5A 3UICA 3ITKA 1VKOA 4XQCA 1GU7A 4A27A 4IS2A 4CM8A 1UUFA 3GVXA 4BIIA 1ADBA 1B8VA 1LDEA 1MA0A 1ZMTA 1E3LA 4WOKA 4CQMD 3ST7A 4KUEA 5CDGA 1G0NA 2IXAA 4FFPA 1KVRA 3E5RA 4M87A 4OH1A 4ZN6A 3WJAA 1YDEA 1QYXA 1SNYA 3H9GA 3IQDB 3LT2A 4P38A 4YAEA 3VVCA 1LRKA 1Y9AA 2AQIA 3C24A 1ZH8A 4K26A 2VHZA 4BOYA 3TZQA 1O95A 3RKUA 1GZ6A 3CE6A 2FRDA 2PA3A 3RASA 7ADHA 1ADCA 1I33A 5TX7A 4RLHA 4AJHA 3KLPX 2ZB4A 3U4CA 2W2KA 1N9GB 3AM3A 3K73O 3S55A 1YE3A 4FFNA 1IZ9A 1JKFA 3MJSA 4GKBA 4LMRA 1OC4A 1T1SA 4DQVA 2O3JA 2P2SA 2X22A 4NPCA 4AJPA 2GSDA 3GN1A 3I4FA 2VTEA 1BW9A 2PH5A 3HN2A 3M6IA 3EVTA 3PRJA 4HV4A 4E5NA 3WWZA 3AUSA 3QWFA 4WLNA 3PTZA 5G0TA 4JNKA 4DYVA 1PJSA 2XXJA 1GD1O 1YB4A 3RJ9A 3ZHZA 5G0UA 1BVRA 3AI1A 4CLDA 1HT0A 3OBBA 2UDPA 4PLHA 4FS3A 4ZICA 3RUIA 4FW8A 3MJCA 4JP3A 4BGIA 4CM4B 1MC4A 1Q0QA 4I9NA 1D4FA 4R69A 1O5IA 1P44A 3DXFA 3F6YA 1T4DA 1EFKA 2QG4A 2HLPA 2BLLA 3FWZA 1HDRA 5HWSA 1KVSA 5KNLA 1HF3A 2FN7A 2W8ZA 2J3KA 1B7GO 3DOCA 5KJ6A 1GYQA 3S2FA 3NAQA 3PHJA 1C0IA 4GQAA 2WJPA 2BFMA 3TZKA 4GSLA 1DFHA 2WD8A 3GGOA 8ADHA 4GGOA 3NTOA 1XR3A 4KTVE 3DZGA 4CLRB 4ID9A 3TZCA 3WTBA 4OM8A 3JQFA 4MKRA 4BV9A 5I8WA 4OOEA 5L4NA 3F47A 5CG1A 2O3RA 3PIIA 1OOEA 1Y6JA 3UCEA 1YOVB 1ISHA 3GC6A 5JXWA 4RLSA 3WMXA 1XEAA 1E7QA 1LSSA 4BNLA 3JYPA 3PQDA 6ADHA 3OP4A 1ZCJA 2VNSA 5LCXA 5BSFA 3FF4A 2HJSA 3DOOA 4W7HA 3K30A 2XAAA 5T57A 1J6UA 1RYEA 1PQWA 2Y0EA 3HE3A 1I01A 1I3NA 5CDSA 4QXMA 3GEMA 3PWZA 1KEPA 1MFPA 4J4BA 2VZ0A 1E7MA 4FGWA 3U3XA 5EQDA 4HY3A 4BKUA 4IXWA 3E6AA 4NJOA 2DTXA 3QRWA 4PLGA 4EUHA 3O38A 1T2FA 3VKVA 1DXYA 1PX0A 2C0CA 3MCVA 1DC5A 4BKOA 1YXMA 1MUUA 5F3RA 3RUEA 4DYDA 3TOZA 3UOGA 1ISIA 3K8ZA 4CUKA 3B70A 2V6BA 4YAGA 2PK3A 2IRWA 4IZHA 3B6ZA 4XEHA 4DPMA 1N7GA 3HUDA 4XD2A 3RC1A 2EEZA 5A9TA 1Q2XA 2ZCUA 3TZHA 4NH4A 2TMGA 2VRCA 1LSJA 4FQ8A 4ZVVA 1WDKA 2DUUA 3GUCA 1O0SA 5KOIA 4D45A 1I5RA 2H63A 3L9XA 5AYVA 3E9NA 2DU8A 2WYUA 3TL2A 4BNNA 4BO1A 2NVUA 2X4GA 3U0BA 4ZQFA 2UUPA 2DM6A 1VM6A 1YQDA 1NHWA 2FR0A 2ZJ0A 5T67A 3OICA 2Z1NA 1K6XA 2CNBA 5CHEA 3WTCA 3JV7A 1U3VA 1A5ZA 1KEVA 1XIVA 3FPLA 2GASA 3KYCA 4L73A 3QQPA 1EE9A 4R9RA 1PEDA 1DC3A 3WGQA 2BFAA 4CMIA 1HZJA 2GF2A 1FDWA 2X5JO 3KLMX 4R68A 1E3WB 1JTVA 2YHUA 3WSVA 2PD3A 1FDUA 1YH3A 1ISFA 1VI2A 5FI5A 3LDHA 4LISA 3VVBA 1N8KA 4U0KA 5T6BA 4AJ4A 3OJOA 4QQRA 1TT5A 2H1SA 4FDAA 2BD0A 4NHEA 3C1AA 4NZ9A 1JVSA 4IUYA 1MLDA 1EVIA 3QA9A 5DULA 4RPKA 5DCUA 3QJ5A 3QV1A 1KC1A 4YJFB 4O59O 2ZYAA 1ENZA 1LRJA 2I99A 3UW3A 4PLTA 1HL3A 5L3ZA 4F6LA 4D0SA 4NBTA 2WSBA 2HAEA 1GCOA 2NV6A 3KRTA 4ND1A 2ZIZA 4HADA 1EQ2A 1P3DA 3ZN2A 4BO4A 4X54A 3BIOA 2QQ5A 2ZYGA 3H2ZA 3JQEA 4QSMA 4TRJA 1G6KA 1QP8A 3GDOA 4XGNA 3PJEA 1C1DA 1YGYA 3NGXA 3OJ0A 4S3MA 3UCXA 3PYMA 2JAHA 2JD2A 3E9MA 2O2SA 1UP4A 5JDCC 2NTNA 2VZ8A 4MVJM 3JQCA 5JDIC 1P1FA 3R0IA 3CKYA 4FC7A 3KBOA 1LJ8A 1TT7A 3D3WB 3PYXA 4Q39A 3DMYA 4YT4A 3PEFA 4RQUA 1DRWA 4GPD1 3WYCA 3ZU2A 4UEKA 3S1LA 2FY8A 5TC4A 3FSRA 1QRRA 1XYGA 5KJCA 4IGFA 2EG9A 3VH2A 1H5QA 1P74A 2WWRA 2OMEA 1E6UA 3GEDA 3JCZA 4A73A 5IFLA 3JQBA 3RBVA 1HYHA 3IL2A 4E2ZA 4YCAA 4YT5A 4WEQA 2J5RA 5AXDA 1IB6A 2VOJA 3DBRB 3LVFO 1LDGA 5BSHA 1SOVA 1E5QA 2AQ8A 3TSCA 3O9ZA 5EERA 1YL5A 4J4HA 1I3KA 3JQDA 2AQKA 1N92A 1NPDA 3VH1A 3G1UA 4KWHA 1NFRA 3F1KA 5KVVA 1Y8QB 1YQXA 1YS4A 3P5SA 1NASA 3PZRA 1NR7A 4XR4A 4DMLA 4PVCA 1F17A 5K0ZA 4J16A 3FR7A 3IDSA 1SB9A 3GZ4A 2PGJA 2C5AA 3EVNA 3E9QA 2O4UX 2WTBA 1C1XB 3C1OA 4RL6A 1I8TA 1NR1A 4P4NA 2BH9A 1AHIA 5CAEA 4LRSB 3ASUA 3FRJA 3HADA 1LNQA 1QV7A 3OM9A 1GPJA 4P8RA 3OIDA 2G76A 4TRRA 4J90A 1GUFA 5F21A 3QVWA 4BO9A 4CM7A 3D5QA 4CQLA 4FC6A 3DFUA 4CLOA 3SJ7A 2IXBA 3FNEA 1E3EA 3IAHA 1ISJA 2G82A 4Z6KA 1XA0A 1JA9A 1H6CA 4C4OA 3AY7A 4KZPA 1WVGA 1X7GA 2EGGA 4Q3AA 4TROA 5DOZA 3COSA 2A4KA 3DR3A 3BMQB 4QTZA 2IODA 1PGPA 1QR6A 1LLCA 5IF3A 3KV3O 1PQUA 4R1NA 1HRDA 4XQGA 3SLKA 5L40A 3AUUA 3L4BC 2OBYA 2R00C 3IKVA 5HA5A 1HE2A 3OIFA 4C7KA 4YA6A 4E3ZA 4FPXA 5JMWA 4RQTA 4B7XA 1ZSVA 1W0CA 2OL4A 1LU9A 4NK4A 1V35A 1CQJA 1VPDA 5JC8A 4WK6A 3M2TA 3QP9A 1KBZA 3LLVA 3ZWBA 4BS9A 2FR8A 4AG3A 3H5RA 4QFDA 3WLFA 3I5MA 1BGVA 2JAPA 2BKAA 3K5PA 1LC0A 2PD6A 4E2XA 2UAGA 2Q1TA 4AJ1A 2AEJA 3TOXA 4HFNA 3FR8A 3I9LA 4JK3A 1Q7CA 4PLYA 5CDYA 2VT2A 4ZHSA 4R41A 5BT9A 4K6CA 4RF5A 1ARZA 2OGUA 3GPDG 3TRIA 3ZWWA 9LDBA 4JBGA 4J91A 5FYDA 2JL1A 5JCJA 3RU9A 5DOVA 4ND2A 3NT4A 4IDEA 4WCFB 4YJHA 5U4QA 1R6DA 3KOUA 4MP8A 4ZA2A 5IN4A 1NX6A 4FSHA 3LC1O 2X1HA 1VLLA 5J23A 3ROMA 1LC3A 1SAYA 4IIVA 3F9IA 5DP2A 3WLEA 2ZTVA 3RROA 3I9KA 5JDCA 5CEFA 2YFQA 3GRPA 3PIDA 2GN8A 4P22A 5B4VA 1TB4A 3Q6IA 4CMEC 1F12A 3UKOA 1B3RA 2NLOA 3ZHBA 1PL8A 2W90A 3F1LA 1Z45A 1NAHA 5JS6A 5C5IA 1PGOA 3CXRA 1YL6A 4JJIA 5G4LA 3DMTA 3RC2A 1GYPA 3DBLA 5TNXA 3IC5A 4ALKA 4CMKA 2B37A 4MP6A 1UZLA 4NU6A 3RC9A 1VJ0A 2HMWA 3ZW9A 4IQ8A 1YO6A 5B4TA 3NJ8A 5JBIA 3U9LA 3QWIA 4RO0A 4N5MA 1LQTA 4NIMA 4Z3DA 2TMDA 2C2XA 3F5SA 2NU9A 2PWZA 1WWKA 1EVYA 2ZTLA 1ZUD1 5LDHA 3GG9A 3DWFA 4BNYA 5CDTA 3PJGA 3UN1A 4TRNA 1B8UA 3DZHA 2VHVA 3EDMA 3D5TA 1JKJA 3D1LA 3UH1A 5EESA 3I4CA 4PLVA 4CM8B 4K28A 3TQHA 3L0DA 3JYLA 3QWHA 3JQGA 2Y0DA 3WOHA 4PN3A 3QY9A 1ZXBA 5C7LO 1R37A 4TKLA 4YAIA 1E1LA 1U2GA 4M54A 2AEMA 3ZV5A 1UDBA 2JJYA 1SMKA 2AE1A 3SC6A 4RVDA 2OHXA 3CZRA 3NX4A 4ZD6A 1VRWA 3WS7A 2P9CA 3KEOA 2ZK7A 1GZ4A 4ND3A 4BQRA 4BMVA 3DHYA 3OFSA 4GBJA 5MDHA 1GYRA 4II2A 1N5DA 1D7OA 3AW9A 4U7WA 3DFZA 4NFYA 3UCFA 1D1SA 1GQQA 4ALMA 5AQ1A 3DHEA 1X15A 4IJVA 4CLXA 2VTDA 5HRUA 1ZIDA 4Y6RA 2W2LA 3PJDA 1T2EA 1PZEA 2IZZA 2FR1A 4U0JA 4Y6SA 2I76A 2VYVD 5EQFA 3ANLA 3ZHYA 4A03A 4GWGA 3DEYX 4I9HA 4JLWA 4YAJA 4DRYA 4TVOA 3PFWO 1BSVA 4O1MA 3F46A 2FOIA 4UUPA 1J0XO 2E6UX 2OFPA 1CQIA 1DC4A 2BGMA 3U4IA 5I7FA 4KDEA 2VUSA 4EZBA 3RVDA 4CM6A 2VHYA 4E4YA 8LDHA 3WBBA 4YQYA 4XQEA 3BHJA 3OJEA 1UJMA 1GZ3A 1NNUA 4II3A 4GWKA 1R66A 2HMTA 1BTOA 3GGPA 3JSAA 1ZJZA 1PR9A 5COBA 5KWEA 1LI4A 1NAIA 3VTFA 4B8WA 4Y8VA 4XRGA 1E1MA 4IM7A 4OO3A 3RSHA 4GKVA 3WGIA 4BNXA 1MXFA 1JN0A 1TI7A 5A3VA 1IPFA 4K9DA 5T5QA 4FR5A 4PLZA 3QWBA 1YVEI 2RBEA 1W6UA 4P4GA 4IDFA 5L4SA 2PZLA 3QVOA 1E77A 3WG9A 4D43A 1E3SA 3E8XA 2B35A 5JNLA 4R4JA 3IJRA 3PP8A 4YT8A 1I32A 2E82A 2HK9A 2WMDA 1U8XX 1RM5A 3I3OA 1B8PA 1EDZA 5H81A 4BKRA 4MIYA 4U6QA 2AG8A 4RF3A 6LDHA 3ZZNA 4NNJA 1ONPA 1Y1PA 2FP4A 2G17A 1XU7A 1Y8RA 5TGDA 5KTKA 2I67A 4WLFA 4J7XA 4XGIA 5DN9A 2VYND 2D59A 2O3UA 3JQ8A 3WBFA 4GAEA 4J2OA 4DBVO 3GVCA 2SCUA 3B20A 4RF2A 4QEDA 1QSGA 3STHA 4ALIA 4TVBA 4BNHA 3D3EA 3AY6A 3HB5X 2YQ5A 2O23A 3WQRA 4BO0A 5JC1A 3LQFA 1AHHA 2CF6A 5A05A 4BNWA 2AG5A 4F3YA 5B4UA 1E7SA 1SEPA 4CMEA 1WLYA 3R3JA 4Z9FA 4DIOA 3IS3A 3ZU3A 2JD0A 3ICPA 3MOIA 3V1UA 5K6AC 3RUDA 2D5CA 2QYTA 4J1TA 5TT0A 4AJNA 9LDTA 3GNTA 3CMCO 3O8QA 1YB1A 1IUKA 2J5KA 4E5MA 4YRDA 1AGNA 1UDCA 4QUKA 2G5CA 1AN9A 2WM3A 3GEGA 1XCBA 5TS3A 2NVUB 3TPCA 1PJ4A 1JVBA 1NP3A 1WPQA 4P4LA 2H6EA 2HMUA 2GZ2A 1M66A 3A28A 3A1NA 4WNCA 1CRWG 3ZNOA 1EBUA 4XB1A 1A27A 3WDSA 3KYCB 1HDXA 3FI9A 4H15A 1DAPA 4DPLA 2Y99A 1XSEA 2AW5A 3C8MA 1E1NA 3HFSA 1YWGO 5KJ1A 2BMAA 2A92A 3WGGA 1NBOA 5A4DA 5JY6A 4E30A 5B1YA 4Z0PA 2Q1UA 3JQAA 3AI2A 3M2PA 1YL7A 2VN8A 2Y1DA 1LQUA 3QSGA 4NFHA 4NR0A 4OYRA 1PJQA 3GK3A 1TT5B 1ZZEA 4EJ0A 1XG5A 2ZATA 5ITWA 2D1YA 3N7UA 4DUPA 5BQFA 4E12A 4ILKA 2FSVA 4AJIA 2OO5A 2JFHA 2PTGA 2EF1A 3ZWCA 1VL8A 5JAMA 2EP7A 4D7AA 2VOEA 3IKTA 2OP0A 3WGTA 4BO7A 2GNAA 5DCYA 4BNMA 4DBZA 3RUCA 4N18A 3K9QO 4MVJD 1Z82A 5GMOA 5G0SA 5A9SB 4BNKA 4KP7A 1DPGA 1YDWA 5C3MA 4B3HA 3RKRA 3UUWA 1AUPA 3W4KA 5C7OO 4D79A 5CDUA 3GNQA 2I6TA 1ORRA 4HWKA 4UUMA 4HP8A 3IP1A 3GVPA 3NGLA 2XOXA 1Z74A 3TNLA 1RM4A 4RVGA 4E32A 2ZJ1A 1EEHA 3VC7A 2B0JA 2BI7A 4UVEA 4XA8A 4I9UA 1I2CA 1T24A 1A9ZA 2PKRA 2FPPA 3RJ5A 3BAZA 4WASA 3T4EA 5KCZA 4W6ZA 5JY1A 2HJRA 3JTMA 3T4XA 1D1TA 4Q3DA 5G0VA 1T2DA 1DFGA 1LDNA 4IIUA 4M86A 3PFFA 3E03A 4I5DA 5IXSA 3HFGA 5BSEA 5FI3A 2GGSA 1QYWA 2VCYA 3DAPA 4WEOA 4YTEA 5DF1A 4CM9D 2QYSA 2Y66A 3AY3A 4B4OA 4BB5A 2EJWA 5FFFA 2C7VA 3JQ9C 1E0DA 2O7QA 1ZK0A 3JQ7A 4NDNE 5L7YA 1ADGA 3ANMA 5A02A 4JX8A 3T7CA 4RF4A 1DB3A 3HWRA 1EK5A 5IDXA 1MB4A 4LGVA 5TT1A 1G1AA 5HM8A 1HSOA 2D4AA 2Q45A 5G4KA 5AXBA 3ROKA 5AOVA 3OIGA 3EZLA 4EITA 3SVTA 3KSZO 3SLGA 1RWBA 2JCYA 4W4TA 2Y67A 5JW6A 4PZEA 1JW9B 1Z7EA 1E7YA 3LF1A 2PZKA 3UFXA 2DLDA 3E82A 3GFGA 4PRKA 3WJ7A 5A04A 1UZNA 4CUJA 5T8KA 3RIHA 1JWBB 3ETGA 4XX0A 1KY4A 2H5LA 2VHXA 4CQLB 1HETA 1ULSA 2NWQA 3DHNA 4FN4A 4CLOB 1M76A 1TLTA 1BDBA 2GLXA 4JP2A 4MDHA 1CIVA 1QYDA 4HXYA 2IEDA 4OL9A 1N1GA 4OIMA 1I24A 1F0YA 3JYQA 3C3XA 3LLSA 1H93A 5GY7A 1DIRA 4NQZA 2Q2VA 5JAQA 5L51A 2CSUA 1KEWA 4EEZA 1DAOA 1H6DA 2DBVO 1GUZA 4AICA 5U9CA 3A9WA 4BVAA 1E1KA 4E21A 5K6AA 4A0SA 3K96A 5F5NA 1P1KA 1ZSNA 4UEJA 2O3SA 1ISMA 2YDXA 3DB2A 2CVZA 3NDIA 1ID1A 3ADPA 1P33A 3FNGA 3MTJA 5KVCA 3G49A 3JYNA 4XB2A 3VH3A 4RCVA 1I3LA 3GVHA 3BMOA 5KVQA 1PGQA 1UDAA 4FJ1A 4IS3A 4IDDA 5ADHA 2H9IA 2V6MA 4XCVA 3TFOA 1BVUA 4RJTA 4KOAA 4FFLA 4FFMA 1PZHA 3V2HA 4B3JA 2OORA 1K2WA 1QV6A 2P4HX 1CEQA 3AU8A 5EMHA 1SPXA 4J0EA 5KKCA 3PYLA 1UP7A 1SOWA 1MG0A 3DBHA 3RAJA 3BMCB 1E6EA 1M6HA 4RPHA 3IUSA 5I7VA 4E2WA 4KQXA 1FK8A 5A5EA 2VWHA 1O89A 1ZEMA 4ZRNA 1A4IA 5IZCA 2RAFA 5JO0A 1XELA 4G81A 3H3JA 4FFRA 3JD1A 1YQGA 2EKQA 3TF5A 1R4MA 4PG7A 1GDHA 2WDZA 1B0AA 3AUTA 1BXGB 4YJGB 1QMGA 4DA9A 4XYMA 4K6FA 2D8AA 1GL3A 4IMPA 1Q7GA 2PY6A 4O63O 3EK2A 2X6TA 3LT1A 2BI8A 5GZ6A 1GR0A 5DBGA 4WECA 2B5WA 3E18A 3KZVA 2DBQA 2Q49A 5F1PA 3BTUA 2WE8A 2GRAA 5IAAA 2J8ZA 3U4DA 4W99A 4ALLA 4GLLA 1WW8A 4CUZA 1VJ1A 3C7DB 4PVDA 2X86A 4GX5A 4PIVA 3ADOA 1YBAA 3IJPA 1R0LA 3RBZA 3ZV4A 2JHFA 2RCYA 3GLQA 4BO2A 3DTYA 4ROSA 3MJ4A 3RCBA 1BHSA 1X0XA 3PDUA 3VOSA 1X1TA 4KUGA 3GRKA 3ZNPA 4YB8A 5CPBA 4MVJE 3OEYA 2P4QA 2WD7B 2Q99A 1ADFA 3CTMA 1K3TA 4UVGA 3RC7A 1CF2O 4Y6PA 3K6JA 4CV0A 3IOYA 4BNZA 4YAKA 5GZ1A 1Y7TA 3GT0A 3WGHA 2NUAA 2YDYA 1GUYA 4D0RA 2DTDA 3NYWA 4EI2A 4YXFA 1DIGA 3A4VA 3VKUA 4BUCA 3LC2O 3AM5A 4CM5A 1N9GA 2C5EA 2J6IA 4RVFA 3MOGA 5DCWA 3KETA 2QRLA 1B3BA 2PV7A 3KTDA 1DEHA 1HDZA 2C7GA 1H94A 4BNFA 5C7IO 1EVJA 2FPIA 4A10A 5JSFA 4EGFA 4R3WA 5L4LA 4IDGA 1X13A 3GNSA 3X2EA 1U4SA 1B14A 2OXIA 2Y1CA 3DQPA 2NVBA 2Q2WA 5AVOA 5IDYA 3ZNQA 2Q4BA 2YQ4A 3I83A 2C07A 1QYVA 3C85A 2FWMX 2QRJA 5CEJA 4WPGA 1PGJA 2Z1MA 2C82A 4UVIA 3VDRA 1ENYA 1T26A 3WYEA 5DP1A 4OOFA 3WFJA 3KEQA 2B36A 3ZU4A 4UEOA 1FJHA 3ZCXA 1L7EA 2I5PO 4J6FA 3GPIA 3O03A 3ON5A 3D64A 4IZIA 4WE3A 4UREA 5G0WA 1U3WA 4DLAA 4Q3BA 1Y9EA 2VWGA 3ZV3A 3NTQA 3JQ6A 3RFXA 1OMOA 1ZK4A 4M89A 4QFCA 2HMVA 3ROQA 1A7KA 3PWKA 1NQOA 4YT2A 4XYGA 1EBFA 2JCVA 1XQ1A 2O4CA 4IJKA 1GADO 4NJMB 2ZB3A 4EUFA 1OI7A 4G5HA 4YBZA 1JLLA 2GN9A 4R51A 1YOVA 3Q2IA 4Q9NA 2HO5A 2HMSA 3RFVA 2PGLA 4MIOA 3AUAA 4J1SA 2V65A 5CPFA 1KS9A 3BMNB 4BNIA 1W4ZA 1PJBA 1HE5A 4EUEA 4M1QA 2QHXA 4F45A 1KERA 3BZUA 1PQPA 3L4SO 4I5EA 4I5GA 4L0QA 4ZQGA 4MVJH 4A2CA 5A5FA 4D44A 4CMCA 4E2YA 3U49A 5L7WA 3H5AA 2B4RO 2O2YA 4BKQA 3AM4A 3FWNA 5CP8A 5TJ9A 1I10A 2ZCVA 1MFZA 5ILGA 1R4NB 3VZPA 1O6ZA 3S8MA 4NMHA 3WNQA 1OFGA 2D0IA 2RH8A 1CJCA 2EW2A 1Q0LA 1X14A 3MZ0A 2Z5LA 4XYEA 1BDMA 1B15A 3NTRA 3Q11A 1U1IA 2FZEA 1P9LA 2Q46A 1NTOA 5EIOA 4CL3A 2LDBA 2DPHA 1H2HA 3FCOA 4JIGA 2IZ1A 3F5QA 4EJMA 1CETA 2P5YA 4AJEA 1X7HA 2E37A 2UVDA 4GX2A 3PPIA 4TZTA 4PG4A 2EXXA 1UP6A 1GFSA 1Y8RB 2DQ4A 4E0BA 3IUPA 4IDAA 1L7DA 4LW8A 3I6IA 1QG6A 3VZRA 1ZK3A 3JQ8B 4FOOA 4CJXA 3DONA 4UULA 5JFOA 1GQYA 1TXGA 4J49A 1WAMA 2NNLD 4GX0A 2CMDA 1TEHA 2POQX 3SBOA 1U4OA 4XJSA 2HK8A 1S6YA 1PJ2A 2UV8A 5EPOA 2GN4A 5JYDA 1I30A 3DZIA 4H7PA 1O9BA 1E3WA 3UGKA 1LBEA 2HSDA 4DGSA 1WXDA 4NBVA 3ROPA 1ZXLA 4BV8A 3KYDB 3DL2A 3H2SA 4OKNA 3HN7A 5DBIA 4L76A 2C20A 2VRCD 4OXYA 3OMLA 4FB5A 5JDIA 1LRLA 1LXCA 3O8QB 1DHRA 3EAGA 1D3AA 1MGOA 1VE9A 2FMUA 4YJFA 1QORA 2PNFA 3U62A 1NFFA 1DLJA 3EY4A 1QLJA 3GDGA 4HFMA 4PGFA 4CQMA 4RV9A 4CODB 3RUHA 1WZIA 4EEXA 4OSPA 1SB8A 4NK5A 1I36A 3DZJA 1U28A 1E5LA 1XKQA 2HUNA 4ALJA 2O50A 5TQVA 3E48A 1E6WA 4WCFC 4RVHA 4CV2A 3V2GA 3T7EA 3FPCA 3GF4A 1P77A 3QLJA 4CMJA 3AOEC 5B37A 2NU7A 4L4XA 3K2EA 1EQUA 2RIRA 4L9RA 3GMDA 1Z6ZA 4RVSA 3JQAB 5CEEA 4PLWA 2B83A 5MGBA 1Q1NA 2PD4A 3GH3A 2I3GA 5LC1A 1FDTA 4ZJUA 3FHLA 2CD9A 5JYEA 4HNHA 5K9ZA 1FXSA 1DDOA 2GD1O 1HEUA 1UAYA 5COQA 3ANNA 4BGVA 1Z7BA 4J9UE 3CIFA 1X7DA 1WZEA 4RDHA 3PGXA 4O0LA 4IGEA 1SO8A 2HRBA 4DWVA 4B7UA 3RWBA 1EK6A 4ND5A 4AJKA 1H0KA 1BWSA 1ZFNA 1HXHA 3LC7O 1NVTA 2FZWA 3DBRA 4HKTA 2A9FA 4YYZA 2GO1A 1HYGA 4TRMA 1V9LA 3CPSA 3ZWMA 3KO8A 4CMAA 3RUFA 1LUAA 5KIAA 5TF4A 3PLRA 2W2KB 2NU6A 5HS6A 4N5NA 2Y68A 2QX7A 2V6FA 2VRBA 5I7SA 2EERA 3OEWA 5JPIA 3FTPA 1ZMOA 2X23A 1E7RA 2J3IA 1BW9B 3VZSA 1YKFA 3KSUA 4W82A 1DBVO 4YEDA 3HQ4O 2IYPA 2P9EA 1PJCA 4PZCA 4MVJG 4L74A 3GG2A 1ML3A 3KB6A 3PHGA 4WOJA 1KVQA 1X0VA 5KJFA 1H6BA 1MV8A 1C0LA 5KKAA 4B4WA 1LLUA 2EP5A 4MKXA 1C1XA 1N1EA 4GI2A 4NBUA 4F6CA 3L4BA 4I08A 3W1VA 2NVWA 2R00A 4MO2A 5TJHA 3GAFA 3U4HA 4B3IA 2DUWA 2EGHA 1U5CA 2C54A 2GUGA 1PGNA 1WMBA 4J0FA 1EE2A 3KXDA 4LCJA 4J3FA 4TZKA 3OA2A 3JQ7B 4LVUA 1E92A 4QX6A 3TN7A 4ZQEA 1VSVA 5HBRA 4AJ2A 3PDJA 4DVJA 4UUOA 4WLVA 1EDOA 4ZQBA 1DIHA 3TFQA 2R6JA 2IZ0A 4YR9A 2AEFA 1KVTA 2B4TO 4URFA 3BMQA 4HBGA 2OUIA 2CVOA 4R16A 2F1KA 3CSDA 3NV9A 2OBNA 3OHSX 4INAA 1A9YA 1AXEA 1DIAA 1U2DA 1C0PA 2HQ1A 2NQ8A 3ETEA 4R5MA 4RZHA 5H83A 5ILOA 1Y5RA 4U8GA 5I9LA 5L9AA 4WLUA 2DKNA 3V8BA 4EDFA 1Q0HA 3LT4A 2DBRA 3ENNA 1T4BA 4B8ZA 1IE3A 2X7HA 4BGEA 3JYOA 3KVOA 1IZ0A 4CMGA 3I9MA 1R0KA 1V3UA 1IYZA 3ZWXA 1Q7BA 4AVYA 2IDZA 4GH5A 1I2BA 3L77A 1YJQA 5KVSA 1NPTO 1V0JA 2GERA 3GZNA 4D3FA 1JAXA 4JCOA 3U5TA 4M55A 1JKIA 3FBGA 1L1FA 5I9NA 2Q50A 3ITDA 3SJUA 2EKLA 4RORA 3O4RA 3KSDO 1EVZA 1PS0A 3JQFC 2ZB7A 4CV3A 4OSOA 4N5LA 2YHIA 2NACA 4OQZA 2PGDA 4MVJP 1XHLA 2WEKA 1Z75A 5BNFA 4E6PA 1H9BA 3A06A 1VL6A 4R9SA 1DJNA 2AE2A 2E49A 2WYVA 3EYWA 3I9JA 4QECA 2EJVA 1EFLA 2E4AA 3BMOB 3GQVA 2V6GA 1B2LA 4IQGA 4JXKA 4M49A 4PLFA 4BNJA 3D4PA 4QO7A 3V2UA 3GHHA 2W4QA 4WCFA 2A35A 1UAGA 3QW2A 1M75A 4BB6A 1PL6A 1FMCA 3KM0A 2WYWA 2DTEA 3PK0A 3DBHB 4TWRA 2Q1SA 3MEQA 3OQ6A 2J3JA 3L6DA 1AE1A 3B1KA 1VKNA 4RDIA 1K0UA 3BTOA 4A7PA 4CMIB 1DFIA 1N7HA 2PH3A 3CZMA 2ZKLA 2HU2A 1R16A 2PZJA 4LSMA 4N7RA 2YYYA 4YRBA 3P2YA 3KHUA 3FNFA 1PIWA 4B7CA 2G1UA 5U1PA 4FGSA 4R1TA 5IG2A 4PRLA 4DLBA 2EIHA 5JCJD 1ULUA 4IXTA 1NVGA 1DRUA 3DZKA 2AA3A 3INRA 4K1LA 4RPJA 1KOLA 3VPXA 5TRTA 5JAZA 4GSKA 1PJTA 3H65A 4YQZA 2GDZA 1JQBA 4PCVA 3W6ZA 3E1KA 3DAGA 4O6VA 2OOSA 3FN4A 1GCUA 3UVEA 3QVXA 3FNHA 4WJZA 4LMPA 1E7WA 3W8FA 2BFPA 3WWYA 4JGBA 4ZU3A 4KDFA 4L8VA 3I9OA 2GCGA 2ZQZA 2UYYA 3PI7A 3PXXA 1C1DB 5KJEA 4E5KA 4QT0A 1R15A 3EZYA 4OXNA 3HJAA 3QWAA 5L7TA 1NWCA 4BGUA 1DRVA 1QLHA 1TA4A 2EW8A 4OXKA 4J1NA 4PLCA 3NT5A 1FDVA 1GEEA 3AOGA 4HUJA 4UVDA 4I1IA 3B1FA 1NQ5A 1A7AA 4DXHA 3W8DA 3WB9A 1ZNQO 1VL0A 1LEHA 2JFFA 4CMBA 3WIEA 1IULA 3ZU5A 2IE0A 2YW9A 1PTJA 5EN4A
chains in the Genus database with same CATH superfamily
3T54A 2AZMA 2ONYA 3FPEA 3LSYA 4H60A 3WDKA 2CW5A 4ITRC 4Z2AA 2PX4A 5DYYA 4MVJI 1KSHA 1L4BA 1NQAO 5KDLA 5HP4A 1YB5A 2RKBA 4C06A 1RQ7A 4TWJA 1RM0A 4EYKA 5BR7A 1P0CA 4M36A 4BMDA 4NG5A 3FOZA 2P9HA 3O3MB 4F72A 1UANA 2X2FA 3DMNA 3OQ1A 4K9NA 4Z4GA 1GRVA 3U39A 1GGNA 2YL2A 2XZDA 3H9UA 1VDMA 3NVMB 3V7YA 1QRTA 4L78A 4ROTA 2FHSA 1LTQA 3SZGA 3BXEA 4UVHA 1XPUA 1VYHA 3UUGA 3MJEA 4K9SA 3ORYA 3ECCA 1QYCA 5H16A 5CTAA 2WU0A 1KDRA 1IUPA 1H0SA 2QG6A 3PJFA 2DWCA 1E0JA 1R12A 5ALTA 4JIMA 4EIWA 2BFBA 3JZDA 3OJLA 3OKCA 2Q6LA 3GA0A 3BS4A 1LBQA 4DV1B 2ERCA 1IHDA 1GTZA 3NIDB 3QTLA 2PUEA 3R0XA 4J43A 1X3LA 1HL7A 1MQ9A 4KDRA 5DXFA 5ED0A 2A7QA 3NUGA 3T12A 2FEMA 2W83A 4AURA 4Y6GB 1DDIA 3T1HB 1CP2A 4L8LA 4XASA 4F4FA 1LS1A 3LUGA 4BMSA 1SC1A 2JHGA 1CWUA 3D4OA 3UOAB 1GNLA 3FI0A 5A0TA 5F2OA 4Z9AA 1EWRA 1R1DA 4WY8A 3Q85A 3I09A 1JLLB 5EMMA 5J2TB 2WAMA 1QHGA 5H9VA 1YZYA 3AYZB 4RZ2A 5ENVA 4LDPA 5HFAA 3PSAA 3STXA 3WGYA 3S81A 3AWDA 1NNI1 4WINA 1A72A 2I9KA 4TVKA 5E7JA 2HJHA 5LA6F 1P31A 5GOZA 2ORVA 5HG0A 3UK1A 4NX2A 4M38A 5K8CA 1WRBA 1URPA 3ASYA 3C43A 1TVKA 2I78A 3HZZA 3MNFA 3O7MA 4N0PA 1LSOA 2EWMA 1L9XA 1I4WA 2RHMA 1M10A 2WPDD 2YJTD 3Q0IA 4JOSA 4JEUA 3EUWA 4NYJR 2IHTA 1ZUHA 4TQAA 3TCKA 5HGXA 1H5NA 2JZNA 1T9BA 3T35A 3F4KA 1YZNA 3RVJA 3N0WA 1Y6GA 4D3DA 4RWZA 4XW2A 5HJ7A 4D2IA 4P33A 1GEGA 4E94A 4EHBA 2Z2ZA 1K7SN 3B1JA 4MV7A 3GPLA 1S7CA 3H8VA 1KDPA 4XDHA 3J81A 1TZKA 1KPIA 3REQB 3ADKA 3PEYA 2AF3C 3W77A 1A4RA 3CO5A 2O7NA 4J7UA 1P2UA 2DYKA 3MJFA 3R3XA 4FLEA 4ZRMA 1Q16A 2Z8YM 3M8KA 5ELMA 5G2OA 5HRCA 3VAAA 3SR4A 2X7XA 3JALB 3O0TA 2R6R1 3GIDA 1VSUA 2OCKA 4YO8A 1QYRA 4LXXA 3I72A 4RD0A 1WSBA 4WNYA 1IWBB 1EAMA 1BG6A 2ZZNA 1OWLA 4S35A 2J48A 3ZC3A 3FY4A 3EGOA 2AMVA 1P5RA 1K4KA 3DAOA 3HYLA 1ZUWA 2OAGA 2X58A 3EGVA 2FQYA 3WXBA 5IVKA 1RXIA 3D4IA 3PT9A 3BE8A 1T1RA 2GYVA 1N2GA 3K71B 3CX6A 4JT9A 5HKKD 3KLBA 5HDQA 1UXIA 2CMKA 2HK7A 4FD2A 4HH3C 5LD2B 4XUGB 4C2UA 5FWDA 2G0TA 4NAHA 3L5OA 3C0KA 4DJAA 2IS2A 3JVDA 1XV5A 3FNIA 3DBVO 2REOA 1J9ZA 1RLJA 1SKBA 4GYYA 5M04A 4V39A 4MINA 4U3JA 4ECEA 3KT3A 3G17A 3E58A 4CFSA 4DMKA 1JUDA 1L0BA 2C96A 2Y93A 2JCSA 2X6RA 1B16A 1WXHA 1QB8A 1SD5A 3IT1A 4FOSA 3V3TA 3PITA 4F86A 4Y9DA 1ZA1A 2YZ7A 5FV7A 4LHEA 4OV6B 1XZLA 3SC4A 3WAKA 4LVNA 1YR1A 4AY3A 3W5IA 2D62A 1QFYA 1XDZA 2ETXA 4RA6A 3UO8B 4B43A 4JROA 1OBOA 3ONWA 4UTXA 1YQ9A 2PLAA 5IU6A 2YV3A 3WGOA 1GAEO 5KTNA 3FMIA 2Q28A 4BKPA 4EG1A 1G8JA 1HY3A 2ZSUA 3FPBA 4ZEMA 2ZUFA 1BAPA 3DGEC 2QW8A 4NBLA 3WLSA 8ATCA 1NNEA 1U3TA 5TARA 3D2LA 1DXHA 3U3MA 1XD9A 4D9BA 4OHWA 4G23A 1A8SA 3NHBA 2X2PA 2DFKB 2XTMA 1E9AA 1TMYA 4B5LA 4KOEC 4I3GA 3AR6A 1PDWA 3A3OA 2BP7B 2QRNA 1JDPA 4FNAA 4ARBA 2FCAA 2JH3A 2JZOA 2DERA 3HDYA 3UNXA 4ND8B 5A9SA 4PYJA 3F6EX 3WO1A 1ZRSA 4PZDA 1IHOA 3PHHA 3Q0TA 1BXRA 4C0KA 2WMNB 2W2OA 5IARA 5C8YA 2NU9B 4RPCA 2GI4A 1ENOA 3T7TA 1NHGA 4MWSA 1X8JA 1AMNA 3CV3A 3GMSA 1XLTA 2ZRIA 2IUYA 1JG2A 1H1LA 4LJKA 2G1AA 4FD3A 5L45A 3YASA 1QH8B 3NYIA 2HBYA 5MHTA 4JLUA 3Q5DA 4N39A 3LGSA 3V1LA 3GJ8A 4Q93A 1W93A 1XQ9A 2H7XA 5E9JA 3WMEA 4IMIB 4RNDB 4D3ZA 2Y05A 2GM4A 3L8FA 3C6ZA 4EZIA 1KRXA 5D85A 3X2FA 4MIEA 4M8KA 2VKTA 3HSKA 5F64A 2QU8A 4BO3A 5KTRA 3RBXA 3NC1C 4FIZA 1D07A 1D4OA 1HDOA 3TR6A 3LVQE 4JR1A 1OR8A 1XRNA 2W4MA 3FBTA 3G59A 1BS2A 1DZIA 1HKHA 1CERA 2O5VA 4Q02A 4CM4A 3K9FC 4DSZA 2OV1A 1R0RE 3EXHB 4NPAA 4B45A 2OZLA 5SYAA 1MO4A 1IJKA 2X3FA 3H7AA 1GSAA 3P7MA 3WGUA 1ZVVA 3ELUA 4E14A 4EA9A 2NU6B 3EF3A 1PR0A 4AMZA 4CIBA 2J9GA 2VHQA 1RI4A 1JDBB 4Z4CA 2V59A 1U5AA 1Q83A 1O57A 1ZSYA 3H9JA 1IQ0A 1JPVA 2A5LA 1A9RA 4G5QA 2C88A 5I4IA 1Y3AA 4KXLA 1MEJA 2YN2A 2ZXUA 2OHHA 1SZCA 4CFZA 1BE6A 4JEIA 3PC2A 5J4HA 2LCIA 3BMXA 1PZMA 2A9PA 2V97A 2BIFA 4M7WA 4YCNA 2BN4A 3DT6A 3O7WA 4QO8A 4LYFA 2NU8A 1ONNA 2O3QA 4EJ6A 3GNLA 4CG0A 1OROA 4HWTA 4NE9A 2MSLA 3DVAB 4C7JA 3K3PA 5LYYA 1UH5A 2YYSA 1OCEA 3P97A 4TSKA 2CE2X 5E2AA 4Z0TA 4PQRA 4XDZA 1BXKA 2JCXA 2NSDA 2P1RA 1Z5OA 1O6GA 4Y1RA 4EG0A 1JWLA 3GZTB 5TF0A 2BKEA 2QF7A 3MWDB 4H08A 3DZDA 3F5FA 2P77A 1RWMA 1U3GA 4TTIA 3FHTA 3IIIA 1XGKA 2F59A 3OSUA 4AMYA 5TIIA 4LGCA 4BZZA 5FA8A 4H3KB 1Y9JA 4HEQA 5EP1A 3OOYA 1D1PA 1GA4A 1T2CA 1ZJYA 4J6EA 5TY0A 3WYBA 2OFOA 3GFBA 2WTMA 4DG8A 1TQ4A 5FTMA 4ND4A 4B3DA 4UU0A 1VXRA 2R1VA 4JP1A 4ID3A 5K8TA 3SSNA 5IAKA 2AJDA 1M1YB 2Q4EA 4ONEA 2PRSA 1K4MA 1YR8A 4Y1FA 5C8ZA 3LUJA 4PAMA 1T5SA 1CVIA 2P0AA 3LUBA 1JAYA 4U7HA 3TI7A 3KUXA 2NUAB 1GQ2A 2NNWB 3LT5A 3T0GA 2XMSA 1ODTC 2BHRA 4IIJB 1OZAA 4IEFB 1ZD5A 3R7LA 4DF3A 1M1YE 4DSUA 1N5LA 1RSZA 2QRKA 4KREA 3KSRA 4EJSB 2IXEA 1H0RA 4KUHA 2WA1A 5KOJB 2X8LA 2AFIA 1Y5MA 3TQFA 5FOVA 2QPOA 3W6PA 4LBYA 1B0ZA 2XUAA 1S96A 2II6A 1X7ZA 3H1AA 3WOVA 4QDOA 4D9EA 2JLWA 4QFBA 3K4PA 1BJTA 1JAZA 1JI0A 4AL4A 3GZNB 4HTAA 3ZLVA 1WVIA 4ZVSA 1WMEA 1D6JA 4ZAWA 4DLLA 5HQ3A 3QH4A 2V0GA 3AM1A 1AKNA 2BPOA 2NAFA 1COZA 2VNHA 3BRWD 4X24A 2DPGA 4X00A 5K3AA 3BMCA 2YIVX 3R5HA 1CU1A 2WVHA 4IV0A 5ALQA 2NTJA 4HXEB 2P9QA 2ETVA 1NGSA 3T06B 4F4UA 4YRAA 2VDRB 2BVNA 3UXMA 1R7RA 1W88A 4ZJPA 3TDKA 4R3NA 4B79A 4FZJA 4N3AA 4D4MA 4B3GA 3ZI4A 2HCTA 3UK7A 3I45A 1F8GA 2AIRA 3VXKA 4UNRA 4AECA 5A3JA 1DAKA 1E20A 4TTPA 2AC7A 2XVMA 3N07A 4JQOA 5C1BA 3AR7A 5CB4F 4G6ZA 2VDUE 1ZEJA 4BNGA 3I6BA 3QX8A 5DW3A 1T2NA 2QZ9A 1D4ZA 1P5ZB 5AK4A 5GADl 2I2XB 2JJ2D 3A1TA 4XSHA 4BX0A 3SHOA 5KWIA 3ADCA 5HE9A 1IAQA 1PV1A 2JGMA 4HTFA 4FINA 1IIRA 2YCBA 2JIZD 3BA1A 3CX7A 4IJUA 4OJNA 4JOQA 5JVDA 2CLCX 1YJCA 4DZTA 2AYYA 4J0KA 4MUXA 3UXYA 3N2IA 4XJTA 1CP3A 3SXPA 3FIJA 4MRVA 4X6XA 4ISBA 4DRXA 5IVDA 3VZDA 5LDDC 2HN9A 5JJLA 1AD2A 2N42A 3DTVA 2EKZA 1M8GA 4MVJA 1DOAA 4URHA 4L02A 2V7PA 3CVWA 1Z9BA 2V9CA 1G8YA 4OHUA 1HE3A 4KLAA 1T29A 3D4NA 4US2R 3ND6A 4PR0A 5FPKA 1D2MA 2ZIVB 3FPKA 3IODA 4ALNA 4DCPA 3HJBA 1F8FA 4CF6A 5BMVF 3L9WA 4GX1A 4JI4B 2PUGA 1HYEA 5ER6A 1OXVA 1B8NA 3R3UA 3SSAA 4B7AA 4CT0A 3DG9A 2WD7A 4EWLA 2MT9A 2OBXA 1F5SA 1OH7A 3GFSA 1N0UA 3DUWA 1RP7A 4ZIRA 2HC9A 3E81A 4JXXA 2C2HA 2Q2QA 4M9SA 1KZ9A 1IM2A 4WUTA 2OCGA 3IV7A 4LPKA 4TMKA 4LJ9A 3IBCA 2YY5A 3S5JA 1X92A 5ENDA 1VE6A 4E13A 1SU4A 3ZCVA 5DNAA 3BEDA 3ETNA 4URUR 3OH8A 4N5DA 4P7BA 4PX9A 3KEGA 4U9HS 1NRJB 3PHLA 2QY9A 3H1EA 4Y67A 4G1MB 5JJ5A 1EUDA 1ZW6A 5BSMA 3K2BA 3CHYA 4A16A 4GUDA 4RPLA 4DJJA 4U7DA 2GR9A 3AZOA 3MS4A 2W6ID 2YV1A 4ZU1X 1E2JA 4RETA 4TMZA 1RRKA 1K89A 2R7AA 5BNIA 1OC2A 3IBGA 3C14C 4CM9A 1VPWA 3M33A 3ACCA 1YU9A 1UPBA 2J9FB 2Z9CA 2EAUA 1BHQ1 2PMWB 1P45A 4HPWA 4HPJB 5I9MA 3O4IA 1DMRA 3WI7A 4DIFA 4UFPA 3ZE2B 3NDRA 3LZ6A 1Z4PX 1YGPA 2HZ7A 3AF0A 5DLEA 3TRKA 4CKBB 1Y8QA 4IXDA 4HFRA 4RCYA 4U02A 4G2NA 2ZB8A 4GECA 3F49S 4O5OA 1QYIA 4NCKA 4DCOA 1JTEA 2FPPB 4XYLA 4J9VA 5LR6A 3WMFA 2FXVA 2J3HA 1BFKA 1GPH1 1CYDA 3JXEA 4MDEA 1U2EA 3AETB 2PXCA 4DLKA 4LF9B 5TDHA 1HKUA 3EVGA 3TPZA 3VQTA 4C0XA 2B1RA 2C0PA 4XJVA 5IDVA 4B4VA 3FFTA 5CFZA 3TR0A 2PL3A 1MAVA 2CMFA 2GAJA 3CR7A 1DCTA 1KQOA 1VHTA 1J2RA 4C7BA 4EPTA 2BHTA 5C32A 4QUBA 4X8LA 4X71A 3WWEA 3U61B 4H35A 3ZWAA 1G64A 5C46F 1CEEA 1BXZA 1ORVA 1PFYA 1Q0UA 3MLBA 4FMCB 4XKJA 1RXVA 1LK5A 4NJMA 1QS0B 4IYRA 1SKYB 3PUHA 4LF5B 1G7SA 4KNWA 4OQLA 4YRRA 1P7YA 5EJ7A 2VJNA 1QIIA 2PX2A 4JY7A 5G4KB 2GYYA 1GCAA 2O1XA 3H83A 4NBRA 2O19A 4K2HA 3OF5A 3A9UA 3AVPA 4IDCA 1IMJA 3D7LA 1NKTA 2ZRDA 3DE1X 1WIWA 2BM8A 1NN5A 2XQFA 1C3XA 1H0HA 2ZUTA 3S2GA 3AGPA 2YNMD 3C15C 3IAS1 3A14A 3M6LA 4FKZA 3T52A 4BWVA 1L5RA 4Q3KA 1JSZA 1RLMA 1E9FA 1NRWA 1WTCA 1BMDA 3RI3A 3MWLA 2VFAA 4PYMA 4O4HA 4XZ3A 5JAIA 4NP6A 1THTA 3GLIE 1DHTA 2GPSA 1GPBA 3DTTA 3FTNA 2A9RA 4D3SA 2X0RA 1IVSA 1FLDA 2H0QA 4XX0B 5AVTA 4PZLA 3KHKA 1BWPA 1XN4A 2RK6A 2WAXA 2Z2IA 2KMLA 2Z95A 3GH1A 4WN9B 4B80A 5JASA 4NOMA 2REQA 1X1EA 1XUOA 2AZTA 3B13B 3AIOA 4WBNB 5B55A 2EOAA 4ER0A 4TKZA 1NR5A 2BMFA 2JIBA 4EVSA 3EEFA 4OMUA 1N6RA 4ARSA 1K6IA 2JK0A 1W34A 1ZCZA 2HL6A 3KYBA 4PG6A 3SQXA 1RFLA 2AOTB 2GYWA 2JKZA 3BDVA 3F5MA 3K0AB 4WKNA 4I4TF 5A2GA 1C3VA 5KTYA 1EXNA 1HTBA 4W9NA 3AZPA 1T36B 4RFVA 4PFSA 1FDSA 1XLWA 2PZ8A 4W5NA 4N6GA 3ZI0A 2R8BA 4CM1A 1PHRA 1MA3A 3G1TA 4XQ0A 5HF5A 5AVYA 4Y7CA 4J2TA 4MI6A 4EGAA 3HG7A 3MAJA 2E5FA 4WZAA 4B74A 5LZ2A 5K01A 2JIOA 4N03A 5T8KC 4BJ5A 2B4AA 5E3HA 3DAFA 1L5MA 3LIPA 4WIAA 1DC6A 1V3TA 2DJ5A 4GMHA 5ESDA 4RK1A 3AR8A 4BO6A 1OSNA 1BGWA 2C04A 4CPDA 5JIBA 2B82A 3NCTA 2HHJA 3FTEA 3UG6A 3ILHA 4YCJA 3NHRA 4HLUC 2D13A 3W3AA 4UQPA 4UU1A 3PNQA 4ZOQI 1OASA 3GLFB 1JDJA 2O20A 3RSGA 3ZXUB 4BTLA 4EI9A 1LX7A 3RDPA 1N2SA 3WQSB 5F35A 4PCAA 4LY3A 1RDFA 2H54A 2BMDA 2AVDA 4XUDA 2FUG1 1G3RA 4OP3A 3IQHX 2M32A 3LD9A 3AOEA 1T9GR 3GY0A 4JB8A 2YMMA 3M1LA 4GF5A 3ANXA 3KYDA 1W0KA 1LV7A 3O4GA 3HVIA 3ORFA 4WVFA 4GVPA 2QSZA 4XIJA 4GC9A 5FD8A 1PSDA 3BT7A 4WCVA 5FUMA 1M2OA 1P1RA 3E15A 3S2EA 4YJDA 4CIXA 2QN1A 1T1IA 1X7YB 4P1ZA 3AJDA 3EC7A 2COKA 3WGZA 4RC9A 2XWSA 5BV0A 1GA6A 1AK2A 3KELA 1LTHR 1FTQA 2J59A 3MBOA 1VCMA 2QY6A 5IUKC 4HJXA 3AERA 4YCDA 3FPJA 3IPYA 3E61A 1BH2A 1N4DA 4HGZA 3S8EA 1Q6YA 1EFVA 2VK8A 3KOWA 3L02A 3R7WB 4FSXA 4CI9A 1O94A 3OZFA 1OQAA 1KYTA 1DKUA 3BK7A 3PUKA 3W4IA 1HZZA 1LSUA 2C2YA 3GP5A 1U5BA 5JD6A 4CQNA 5BQ3A 4DJFC 1V6AA 2X14A 3PEWA 4TTVA 4Q6BA 1EFRA 4C0JA 2EL7A 4Z4HA 3KTOA 3LQ2A 2AKAB 2QW1A 1PR1A 5CVJA 1FS5A 5EUQB 3VPFA 3ZWKA 3ER9A 1HNXB 5FHQA 2HBRA 3QVSA 4YP0A 5DPMA 1H42A 2GK3A 2Y71A 4DB2A 4FB4A 3L84A 1KDVA 3AONB 4AJJA 3I52A 4GMFA 4GOXA 4IDQA 1VJTA 2NUPB 4K6HA 3Q3CA 2ASVA 4Y9UA 3W2GA 5C1PA 3MC1A 5IZCC 1YFKA 3EZXA 4BO5A 4F3CA 4A27A 4CM8A 2HA3A 2FPRA 1K3FA 2FLVA 5GJCA 1E0SA 2I2AA 1Z5PA 1K92A 4RUKA 3ST7A 3MTQA 2DEUA 5CDGA 3T1YB 1Q74A 1PK8A 4R0NA 1XMQB 4REQA 1ADYA 1RKUA 1FMJA 1X1QA 2NVOA 3C24A 5KQRA 5HIMA 3RVQA 4E5VA 2VHZA 4BOYA 3OCUA 2V1UA 2XCTB 4MKHA 1W76A 1NJFA 2JARA 4OHVA 4BMCA 5T3YA 1UIRA 2FRDA 2Q8PA 2PA3A 1OXBB 2YHAA 3L6RA 4TLEA 2JBWA 4FYXA 1JS1X 4JI5B 1W4LA 1I33A 1RAAA 3QX3A 3MUOA 1K8RA 2W2KA 1N9GB 3DUFB 3KC2A 2H2HA 2OKCA 3HDTA 4JJ4A 3EGCA 4UM7A 4FFNA 1JKFA 2JLVA 1R0CA 1ZUNA 3D6MA 5B53A 4PYRA 4AMVA 5E95A 4NPCA 4AJPA 1OXMA 1FLVA 3HN2A 2FPIB 2YN0A 3M6IA 5KQMA 3EVTA 3LCUA 3EIXA 5IC6A 1FZTA 1KP9A 1R5NA 1BVYF 3QWFA 4RMGA 3UHFA 5C52B 2B4YA 3EIWA 4JNKA 2KWIA 5G0TA 2ZAYA 3I64A 1M2VA 2Q41A 4DLPA 2ZM6B 4KPYA 3DKIA 1JBQA 2QBYB 2J67A 1U4NA 1P2FA 1UMBB 5G0UA 3DO6A 2VHUA 3QKTA 2FJ0A 1CRZA 1N0WA 1WXGA 3H2GA 1E4YA 4FNMA 4LKRA 3WJ1A 4FW8A 3URMA 4W9MC 5L3RA 5KHLB 4JI7B 2IS1A 3I73A 2VP0A 4S2EA 3FYSA 4MV8A 4G5OA 4NEGA 4C08A 4DDVA 1P44A 3F6YA 3OLQA 2PJRA 3KUKA 4OQXA 1T4DA 3WK9A 4EGSA 2BLLA 1KVSA 1W35A 2F4NA 3HEMA 1B7GO 3KQHA 1M8PA 3D6VA 1IXKA 3D6JA 4UBOA 4DW8A 1VLMA 2YWGA 3GAAA 1C0IA 5C1IA 2DR3A 4GQAA 1OLUB 3TZKA 5HW0A 5HZMA 2D2XA 4KQGA 4E2FA 3LKDA 3NTOA 3HR7A 3BHNA 4PRYA 5IJAA 4MUHA 4ID9A 1MO5A 2BR5A 1KI2A 2ZAIA 1C30A 3W2HA 1VHJA 4F3TA 2MINB 3O92A 4D4KA 5CG1A 4GP7A 2WJ3A 1AV6A 1NUQA 4I5IA 4C0BA 1YOVB 1ISHA 3EXEB 5FOUA 3WMXA 5DTEA 1LSSA 4C7XA 3FFXA 221PA 3N2ZB 3PQDA 4FR0A 1ZCJA 2BZ1A 5LCXA 2HMYB 1SK9A 3DOOA 4TPKA 4MQBA 1FMFA 5C1DA 2XAAA 3F0TA 2ZTHA 1NU8A 1XMVA 1XO1A 2BTEA 1VL1A 5DHSA 1OBCA 2H92A 2Y0EA 3HE3A 1I01A 2OV3A 5DW0A 3G2MA 3SXJA 3W8RA 3ZBQA 3HGQA 4MTCA 2OG2A 3GEMA 1YRYE 1AQ6A 4MAFA 3UK2A 1RRFA 3DGFC 1SKAA 3RRFA 4J4BA 3KU1A 1XPOA 4HY3A 4IXWA 1U31A 2ZUVA 2ZBEA 1HH4A 2DTXA 2E18A 1PNOA 2P0YA 3V55A 3R8XA 1GDTA 3COWA 3A2MA 5CW1A 1PG5A 1XL0A 3IAAA 3TUZC 5BRJA 2PANA 5EY5B 1SOUA 3FG9A 1N5IA 3VKVA 3JSXA 3QFFA 4Q05A 3NOOA 5AI9A 1RBMA 3WQBA 3ZZ1A 4L5YA 1PX0A 4TYPA 2IOYA 1KYZA 1MAUA 3MCVA 1UQRA 2FKNA 2C2OA 1YXMA 2QAJA 4IWNA 3B6JA 1HPLA 4CUKA 4ZVLA 2H2DA 2QVCA 2PK3A 4FGZA 4F2WA 1IBCA 2B7BA 1N7GA 4AWAA 4RH3A 1XZJA 1YVPA 3CRZA 3ZVNA 4QOSA 4R2XA 4NVRA 2EEZA 3RC1A 1Q2XA 2ECFA 1NLUA 4TSFA 4QLAA 4D9MA 5KOIA 1LSJA 1X80B 2DUUA 1O0SA 2DF8A 2DQYA 1I5RA 1NONA 2F9MA 3UWSA 3I62A 3KS9A 2QTVA 5AYVA 5E2IA 2P8SA 5HBGA 5FT9A 3TL2A 4BNNA 4DUGD 2C7OA 5BXYA 2NVUA 1J0CA 1H9CA 1ZM4A 4OYLA 3QU4A 1K08A 2FR0A 1YQDA 3H4IA 2IP4A 4KQFA 2ZJ0A 1P5HA 1PR2A 2LZ0A 5JJKA 2HF2A 1MB0A 4XUEA 2Q0HA 4BFXA 1K6XA 3MS2A 1AKMA 3BILA 4WXYB 3GMTA 1WCXA 4B6OA 1HUQA 2FSIA 2AL7A 5SYNA 1DTEA 2P1DA 4C4XA 3I53A 3H1PA 3QQPA 1EE9A 3QXJA 3RS5A 3T3OA 2BFNA 4R9RA 1SUBA 5E6UA 3WXMA 1XAJA 2HT1A 3EXG2 3TM5A 1HZJA 1CZKA 1FDWA 5JNTA 1E3WB 3WL5A 2IFTA 3SLRA 1YH3A 1ISFA 1KQFA 3B2QA 1ULBA 4U0KA 3KQKA 2H4ZA 3FNRA 1DQZA 3OJOA 2VK1A 4NU8X 4PS0A 4C0AC 1FYFA 1KXZA 2GCPA 2JGAA 2XQGA 4FDAA 4KQ6A 3C1AA 4YRNA 5FBVB 5ITZA 1DAIA 2B99A 4R1MA 4BQEA 5DULA 4RPKA 5LD2C 1C4KA 1GN8A 3QJ5A 5DIFA 4A5SA 2IV2X 4O59O 3TM4A 3DW1X 1ENZA 1OV4A 4LXUA 3PE6A 3ND9A 3DV0A 3JWPA 3R5XA 4IGAA 4JWKA 4PLTA 4B3BA 3NVAA 2ZAOA 2P9YA 3GFVA 4V0KA 3STUA 2EDCA 4F6LA 4AX4A 1ZU4A 3TCXB 1XXHB 4R05A 5LU8A 3CBQA 1PNQA 3EFEA 3KRTA 2ZIZA 3FCAA 3OWXA 4FK8A 4JHXA 1P3DA 3SIWA 3ZN2A 4O2RA 4F5ZA 3BIOA 1N1MA 5HQTA 1OX5A 4D9NA 1C81A 2NYUA 3IIJA 1QP8A 2ANCA 3CNBA 1JHMA 4KYVA 3IDZA 4TYMA 3M6MD 2OYSA 5EJ9A 3NGXA 3OJ0A 1TRHA 2XCLA 2Y76A 3N8DA 3HXOA 1XXHE 4R7TA 1RXEA 4JLBA 1XN1A 1XVUA 3KR1A 4PGHA 1Z4OA 3R0IA 2Q9BA 2YXDA 3CKYA 2BEVB 3U7JA 1N5OX 1TT7A 3PYXA 4FE4A 3VJRA 3R6TA 5LOVF 1CZUA 4YT4A 1KU0A 1ND6A 4RQUA 4BZQA 3UT5A 3DEAA 5A5DA 5JZ9A 5ARBA 3VR4D 3FSRA 2NTYC 3ZJTA 4CKWA 3HBNA 3G5UA 4TS4A 4LXTA 3VH2A 5KJCA 3A1WA 3C3JA 3D6AA 3E9RA 1ZMRA 5FOTA 1P74A 5FPTA 2WRZA 4F8JA 1DV2A 2WUEA 1ZG3A 2HHCA 1XFDA 3RBVA 3IL2A 4PINA 1G66A 3IIMA 3TLGB 4DWWA 4WEQA 1IMOA 2J5RA 1DWOA 1U8YA 2IW3A 2PWYA 2DR2A 1DPFA 2PT6A 3DAYA 3WGKA 3FB1A 3E23A 4FHZA 3LVFO 5FLKA 1Z8HA 4EJFA 5BSHA 3ZUGA 4C29A 1E5QA 3B1XA 2Q3LA 3TSCA 4FHGA 5EERA 3CF4G 5DNCA 4J4HA 1I3KA 3GT7A 4RK4A 5JPDA 3JPWA 1TK3A 2BJWA 2AQKA 3S1AB 2OGSA 5JFTA 3VSEA 3QVJA 4BV3A 1NF3A 2WT9A 3DR5A 3EBPA 5ABPA 3D3QA 4KWHA 1NFRA 3F1KA 3K16A 3FTCA 1Q20A 1U7PA 4PQGA 1QANA 5KVVA 4GOKA 1J25A 2QSYA 1NR7A 3N28A 4NC9A 4R8MA 3ORHA 3WL7A 1A9QA 4DV3B 1Y8ZA 1L8LA 1JT2A 4FDLA 1F17A 4KIJA 2ZJ5A 521PA 2EQ5A 3WK7A 2WG0A 5K0ZA 5CCBA 5NLLA 5IVPA 3RYCB 2HRCA 2C5AA 1SQ0A 2IV3A 1M7HA 2CV1A 3QEMB 2C7PA 2G67A 4RL6A 4UM8B 2D4HA 1UQTA 3EXHC 1AHIA 2I4MA 4DM7A 3ASUA 3FRJA 1BDIA 3ROXA 4LXHA 1YJAA 4ARZB 3V48A 3N2EA 2VDKB 3K9WA 4BUJA 3A1VA 2C97A 3OM9A 3FCUB 3OIDA 1N1DA 2ZGVA 3QVWA 4I14A 2IL1A 3MGGA 4BO9A 1CUDA 4CQLA 1O6BA 2QYHA 4TMYA 3IAFA 3VUEA 1HI9A 1L7OA 1JDBC 1E3EA 3FNEA 3T0FA 3VA7A 5DU2A 2G82A 2Q0XA 1WF3A 2NUBA 1IJBA 1TEXA 1WSAA 2QWXA 4LYYA 3AY7A 3FTQA 4AZVA 2VTKA 3RAGA 3AR4A 2K4MA 4A6DA 3E9CA 1X7GA 3DFIA 2E4WA 5E4YA 2KLHA 3DNFA 2NYRA 2VZEA 3BL5A 5DOZA 3NKFA 4TN1A 3COSA 1E3QA 4PC6A 3GD5A 1G5FA 1ETUA 4QTZA 1PGPA 1G8HA 3HWWA 3WWOA 5IF3A 4TX1A 2ZITA 4MQ5A 1PQUA 4OMDA 5IH3A 3T94A 3A2KA 3RYTC 4YDHB 3SFZA 1L7VC 3D7RA 3LQ4A 3DL4A 3HUUA 1UKVY 2OBYA 3IHLA 2DBYA 4KB5A 3LCMA 4QYIB 2WILA 3SX4A 5LFAA 3I61A 3V00A 1NW4A 3C48A 4ZAYA 3ZXSA 2IBSA 3OIFA 5IT0A 3AHIA 2B2NA 4QGHA 4XWGA 4P5DA 3REGA 3EPHA 4KPUB 4OCZA 4QUJA 1G38A 1VL2A 1D03A 1ZSVA 2E1PA 2OL4A 5BYAA 3SU8A 2GX6A 3BF8A 4MCAA 1PP4A 1R6AA 2ORIA 1CNMA 3DWGA 1HM5A 3LY7A 4NK4A 3A9CA 3M2TA 4H4CA 3KQNA 3QP9A 2ZBDA 1S89A 1Z8NA 2FR8A 3RSQA 3MYRA 4R83A 3H75A 1K6MA 3H5RA 2C84A 2WJVA 4JSTA 4ML3A 3VVMA 1C3OA 1T4MA 3EA4A 1W5FA 1E2MA 1NYRA 3L04A 3L8DA 3M49A 3K5PA 2R751 2PD6A 3BIWA 3VR1A 4E2XA 1UK9A 2UAGA 4I6EA 3T3EA 1Y80A 5AHWA 5DWQA 4AJ1A 2V7UA 4Q9IA 3TOXA 5KYUB 2C8VA 1GTL1 1Y3HA 5LZ9A 3HZRA 2XA1A 3D2CA 2GN2A 3THOA 3F98A 4WRRA 1Q7CA 4P80A 2ZI6A 3T99A 4EJSC 1W5EA 4O8CA 1KTVA 1SUFA 3I92A 2GUWA 4KQMA 5BT9A 5C35A 1O0BA 4LRUA 2OGUA 1UJBA 3TNDA 2Z5FA 2ZRHA 5ICCA 5CLLA 4FDVA 3NTUA 3P2IA 4G5RA 4J91A 3EFOA 4OQFA 3NG1A 2NOAA 1WXXA 4K9LA 2YHBA 3NT4A 4P2GA 4DZRA 4B76A 5CD9A 3FF1A 2JLAA 1R6DA 3WLQA 3F7MA 3MD9A 4D6XA 1NX6A 3ESQA 3OP1A 3PGA1 5TVGA 5I51A 2X1HA 1P4HA 5J23A 3PJRA 2EYUA 3WL3A 2FH5B 3ZZTA 4IIVA 3HL0A 5DP2A 3VI4B 3WLEA 2O8NA 1UINA 4RS3A 4HNRA 421PA 1SVOA 3I9KA 4HRAA 4YUWA 1FTGA 1XMPA 3ZBPA 2HA0A 3N2YA 3PL5A 5SZHB 4EYQA 4KXUA 4CMEC 1WB9A 1J21A 4Y2UA 1PX2A 4CL2A 5JRJA 1GWNA 1Z45A 1NAHA 1YQTA 2Y0BA 4MKGA 4B8ZA 2J33A 3OSZA 4E4RA 2O57A 4UDNA 1CRPA 1YL6A 1KTIA 4XSVA 2CSXA 2RHLA 4AZTA 1TPYA 5KBYA 2VJMB 5CFMA 3ESCA 3DBLA 1F9EA 2RHJA 4MA4A 8OHMA 4XFDA 3PUVA 1UZLA 4MP6A 1VJ0A 3PPWA 2HMWA 5JV5A 3U26A 2VPTA 3U9LA 2KE5A 3Q3JB 4N5MA 4ZO7A 2XYPA 1LQTA 4NIMA 5L3QA 1MRNA 2QM0A 5HJ5A 1GL9B 1NP6A 1SN7A 2ZTLA 1ZUD1 4IKPA 5D01A 1CB0A 4KXYA 4EPRA 3V8QA 5AR1A 3HYRA 2QTTA 1AGXA 5AMXA 1GA1A 4V0ME 2BZSA 3W6OA 3GELA 2VHVA 4MR9B 4Q4HA 4DUZB 2IX9A 3D5TA 5LMZA 4RQBA 1JKJA 4OLAA 4H27A 2IUUA 2WIKA 2PS3A 6Q21A 3I4CA 3VAYA 1O58A 4XPIA 3V4VB 5KS2A 4MUFA 4PLVA 3RYHB 2AUMA 5AKGA 3L0DA 4Y7DA 2OC4A 1C41A 5DGCA 3JQGA 3DV2A 3FCEA 4MV1A 4AULA 5I7RA 4OU5A 1O5OA 1DARA 1Y4AE 3GRCA 4KN8A 5BUQA 1U1FA 1R9GA 4TKLA 4TKVB 4ZOEA 4YAIA 3KZXA 1YK1A 4JAVC 4X61A 2C98A 4E5DA 1WMSA 3WDLA 2R8ZA 4LHZA 5JNSA 3K2IA 4REOA 1JB9A 4KG7A 2UYHA 5D7NA 2OWEA 4K9QA 5LBUA 2V3VA 2P9CA 1VG9B 2V9PA 1JPNA 2Z8ZA 1P9RA 2N1BA 3EB9A 4TV9A 3OPYB 4H1UA 2MTBA 1QTNA 1FX0B 1NI3A 1GYRA 4FGUA 2Q8QA 1N5DA 2FRVA 4RTMA 2P30A 2QQGA 3AW9A 4U7WA 5EQJB 4LJYA 4XLLA 1D1SA 5GOTA 1RJFA 3PG5A 1U3DA 5AQ1A 3DHEA 1Q0SA 1X15A 2F48A 5K0JA 4CLXA 1UBLS 4QYWA 3LLUA 2VTDA 4YCMA 3VSCA 4L5CA 3QFRA 4ZYZA 2I76A 3HP4A 4HEHA 5D7BA 1V6SA 3HLTA 5CT5A 2RG7A 3DEYX 2IS6A 4TVOA 3PFWO 1BSVA 4Y1EA 3BXZA 1EFUA 2BZGA 3OG9A 5EEGA 4BDTA 4QQ8A 1DC4A 3T9BA 2C9CA 3G2NA 3IEIA 4WK4B 3UJ3X 4WD3A 4TS3A 1NW6A 2DULA 4PZAA 4HGOA 1FFGA 4Q03A 1W9HA 2M1XA 2VHYA 3NATA 3WBBA 1UMCA 4QYMA 4XQEA 3LDUA 3EODA 3HXTA 5CCDA 3DDWA 1VHLA 3KT0A 3EG5A 3H8SA 4JV5B 4CTOA 1WZCA 4ACBA 5BR4A 3OJEA 2I8AA 3CA8A 2JNWA 1NNUA 4GWKA 1B1CA 3W7AA 4C5BA 3BXOA 3JSAA 4RACA 2XKKA 5KWEA 2WY2D 2LPMA 1LI4A 1AN0A 2PE5A 1OYWA 2BFBB 4Y8VA 1ZD1A 1E1MA 4OO3A 2XVZA 1KARA 4OQEA 4OMFG 4OA8A 1RWQA 5EWLB 4O33A 1L5QA 4FT4A 8GPBA 1TI7A 1XZMA 3Q8XB 4GBED 1L1EA 5A3VA 4K9DA 5CRIA 4PLZA 3QWBA 2RBEA 2R44A 2PKEA 1NF9A 4GBMA 3KB2A 3PB3A 4PHFA 4WY5A 4Z4QA 1E77A 1NU6A 2QL9A 1WOYA 4Z5XA 1NOKA 4YREA 3RWMB 4CIWA 3FWHA 4M1EA 4P3KA 5F4ZA 4I3FA 2HXGA 1H2XA 1HNWB 4UATA 4DQLA 2PEZA 2ZBQA 3FXAA 1AQUA 1C9KA 1EBBA 2PWPA 2YV4A 2VNKA 3QYAA 2ISCA 2QD5A 3KPYA 1I32A 3VR4H 3TIVA 4EVIA 1XAGA 3EQZA 1M1NA 1TVKB 2XUQA 1CR4A 5KDDA 2C2BA 3MTBA 3MINA 4UHCA 5ALWA 5H81A 1DU4A 2JKYA 1ZM7A 2AG8A 4ESEA 1TJ5A 1QP0A 4BPBA 4IAOA 3SK0A 6LDHA 3ZZNA 2JJ1A 1G9TA 3AZQA 4W1SA 1NMEA 1Y1PA 2I03A 1LLFA 1QOPB 3EQ8A 4A1OA 1N5KA 3E05A 3GWZA 5EJEA 4JQSA 5KTKA 3FYHA 3RS8A 2I67A 3R3VA 1F6WA 1E4OA 1JHQA 3FPGA 2PSHA 5DN9A 5C8YF 1ZVQA 2EWWA 5JQGA 1YB7A 1JFSA 4N49A 3JQ8A 3M4ZA 2XB6A 4Q1DA 2E7ZA 4U2DA 1S2IA 3GVCA 3K0CC 3O47A 2SCUA 4PTLA 1GNPA 4DXAA 1GNRA 2F6RA 1KI3A 2QUZA 4TVBA 3RIXA 1HYQA 1UMKA 1V8OA 4MGZR 4EGQA 2YQ5A 3QPWA 3QKRB 3WQRA 4M1YA 3LQFA 1NI4B 2CF6A 2P67A 2I8LA 4U4AA 4BNWA 4F3YA 2JI4A 3IUJA 5T4FA 1E7SA 4X1OA 1SEPA 3RRJA 3AHGA 2QA5A 3CS3A 5EHXA 2VCEA 4CETA 3GLGA 3HBAA 1YQWA 3ZE1B 2QL7A 2DB3A 1JV2B 1FFWA 2JD0A 3ICPA 3K20A 2N46A 4HVAA 1BKYA 2KBEA 3E1GA 2AX4A 2BLNA 3GU3A 3N7AA 3BGWA 1DBRA 2A3NA 4JB2A 1G8KA 4N8SA 4UDOA 5I47A 3A4YA 3HXPA 2C2WA 2M6SA 3F5DA 3PENA 5TT0A 9LDTA 3CMCO 5AM3A 3O8QA 5JSKA 3AHDA 1IUKA 1E79A 3MK31 4IILA 3GRYA 1JKXA 5JNWA 1YRAA 2XBLA 4HDNA 4RTRA 3TPCA 5TS3A 1XCBA 2CWWA 3VV2A 2OBLA 4BMOB 5KC8A 3GYGA 5FCDA 5I7OA 1NP3A 2CUTA 3QKSA 1QCDA 2HMUA 2Y6UA 4FT2A 4R2HA 4HLDA 4MROA 2NPIA 3A1NA 3IHTA 1EBUA 3BWVA 4C20A 2XIQA 3OM8A 2YXBA 1FUKA 1FDOA 3ICOA 4AWXA 1XD8A 2IPAB 4HMOA 1P2SA 4DPLA 2AW5A 2W0MA 5DNWA 3FYTA 3BB4A 1TK2A 4HX9A 3ND5A 4BU1A 1JFTA 2ZJ3A 1NBOA 4F8EA 4HNAA 5B1YA 1JHUA 1SRRA