3WSVA

Crystal structure of minor l-lactate dehydrogenase from enterococcus mundtii in the ligands-unbound form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
312
Chain Sequence
MKKTSRKVVIVGTGFVGTSIAYAMINQGVANELVLIDVNQEKAEGLDGMAWGEKNVSVWSGTYEECQDANLVILTAGVNQKPGQTRLDLVKTNATITRQIVKEVMASGFDGIFVVASNPVDILTYLTWQESGLPASRVVGTGTTLDTTRFRKEIALKLAVDPRSVHGYILGEHGDSEVAAWSHTTVGGKPIMEYVEKDHRLEENDLTVLADKVKNAAYEIIDRKKATYYGIGMSTTRIVKAILNNEQAVLPVSAYLNGEYGEEDIFTGVPSIVDENGVREIIDLSITPQEKAMFHQSVSELKAVLDTVRLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title An alternative allosteric regulation mechanism of an acidophilic l-lactate dehydrogenase from Enterococcus mundtii 15-1A
doi rcsb
source organism Enterococcus mundtii
molecule tags Oxidoreductase
total genus 100
structure length 312
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wsvA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3wsvA02
3I4CA 2JD1A 3C7DB 3JQ7B 4KOAA 3ADOA 3RC1A 3SC6A 3A4VA 4P8RA 4AICA 4CLRA 3LK7A 2PR2A 1UP4A 1E1MA 4LVCA 5TT0A 1N5DA 1D8AA 5A5FA 1KVUA 1L7EA 4ZQGA 2NNLD 3C1AA 4AVYA 4IDEA 1H93A 4F6LA 1BHSA 3PDJA 2WYWA 1HE3A 1JN0A 1O6ZA 4OSPA 4IM7A 2YFQA 4E32A 1DLIA 3FR7A 5IZCC 5IG2A 2FY8A 5A4DA 4RPHA 4C4OA 5K6AC 1UDAA 4XYLA 4FFNA 1UJMA 3D3WB 2OP1A 3RROA 4L4SA 3W6UA 4WASA 4FFOA 3QWIA 2Y05A 4J9VA 1M76A 1YOVB 3IIEA 1VC2A 4ND1A 2GPTA 3PWZA 3UN1A 3WGYA 2HSDA 2QYSA 5EJ2A 1YL6A 3PEFA 5JO9A 4F45A 1R0KA 2NVBA 4LMRA 1R0SA 1X7DA 3COSA 4Y9DA 4GLOA 2Y0DA 1OC2A 4PLWA 2GRAA 4PLYA 2Y1DA 4B4VA 3H9UA 3U4CA 4LCJA 1JVSA 4OQZA 2C2XA 5JDCA 1VRWA 3GGOA 2UAGA 3ZV3A 1YBMA 4YT2A 2LDBA 3B1KA 2VT2A 3GAZA 3HE3A 4LGVA 2GO1A 1T2CA 3DEYX 5DBGA 3TZKA 1RYDA 1U7HA 4EEZA 4XJTA 3D0OA 4II2A 4C7JA 4BL5A 3ZU4A 1XIVA 1QORA 3RUCA 2QHXA 3PJEA 4R1TA 3TF5A 4NFSA 4DBVO 1PGQA 4QO8A 1L7DA 1QLJA 1E3WB 1I3KA 1NNUA 2FSSA 1UXJA 3UICA 3KEOA 1DC6A 1PJSA 4TVBA 2JHGA 4M55A 3UCEA 1Q0QA 2WWRA 3FPLA 5JAMA 4EJ0A 1HZJA 4ITUA 3GGPA 5G4LA 1Y9AA 3JD1A 3TQHA 4U6SA 4KTVE 2C20A 2G5CA 4J0EA 1XDWA 5IXSA 5DDIP 5A9SA 3BTUA 4NFYA 3JQ6A 4BNNA 3TL2A 3PDUA 1MXFA 2WEKA 4YAEA 2OOSA 5DT9A 4CMIB 1GR0A 1E3IA 2G1UA 4JP2A 3ON5A 3RKRA 3IUSA 4BNVA 1ADGA 3G79A 4UUMA 1X0XA 4O63O 1N1EA 2YW9A 4BNWA 2I9PA 1KBZA 3F4BA 4Z0PA 1UXHA 5C37A 5AXDA 3QY9A 1PL6A 4NIMA 2DBZA 1BTOA 2AG5A 1EDZA 3BHJA 1T2DA 3NX4A 1U3WA 1ENPA 4E5YA 1PL8A 3LYLA 2P5YA 2VWPA 1NHGA 1ONOA 3GHHA 3GK3A 4TMFA 4Y67A 5JE8A 3RKUA 2H9IA 4E5MA 3DBLB 3OBBA 1E3EA 2ZATA 3LT2A 1XU7A 1R4NB 4OKIA 2VHYA 1LQTA 4YRAA 1GYPA 2FR8A 4XDZA 4RGBA 1SB9A 1LI4A 2RCYA 1EVJA 3GG9A 1U9JA 1Z82A 1ZW1A 4YJGA 5AXBA 3VTFA 3S1LA 1YQDA 1IULA 1Y8QA 3VH3A 3DQPA 4ND2A 1WWKA 1PZFA 3HN2A 3LU1A 3DC2A 3FPCA 4O0LA 2CF6A 3D4NA 3E9QA 3I23A 3H9QA 3ST7A 4L4RA 4AJJA 4B7CA 1CWUA 4YAIA 2PV7A 1U2GA 1FDVA 4IXWA 4RCVA 4JJIA 3OICA 4R16A 4IQ8A 3P19A 1U8XX 3CEAA 3M1AA 3WTCA 1JVBA 2H63A 4OSOA 3SJ7A 2X7HA 5JFOA 4H16A 3UUWA 1LNQA 2EKPA 1DJQA 3AFNA 1GFSA 2PK3A 4AG3A 4QECA 4GVXA 1QKIA 1A5ZA 3PHIA 5CG1A 5U9CA 1DHTA 2F1KA 2G0TA 1BW9A 3R0IA 3HSKA 4CMBA 4OXNA 4OYRA 5ITWA 2X5OA 3JQ9A 3AOEC 5CEJA 5JXWA 3ANMA 4QSMA 1R12A 2X1HA 1PZEA 2X0RA 3PXXA 3ADPA 3AI3A 3Q3CA 3UGKA 2YFHA 1QYWA 1ZMTA 5CEFA 1SPXA 2A35A 1NQ5A 1T26A 4XR4A 4MKZA 5L4NA 1WDKA 5BNTA 3HNPA 5KCZA 3GUYA 1P1KA 4WGGA 3GN1A 2B35A 4ALLA 3E9MA 4MOWA 4BB6A 5GZ1A 4MVJA 4CQMA 1YB5A 1CF2O 1E7YA 3BMCA 2JKVA 4R1SA 4RLSA 3VH2A 3ANLA 3UKOA 2IODA 4AJPA 1CETA 2IZZA 1VL8A 3NJ8A 4CLXA 1XEAA 3IQDB 2HCTA 3AY6A 5I7VA 3WQRA 2QX7A 3MZ0A 1Y6JA 3PWSA 1MG5A 2J5RA 3NAQA 3RUAA 4CUZA 4DBZA 3DBRA 4JQCA 5C5IA 3C1TA 1E7MA 4E6PA 4FW8A 2CDCA 1KEPA 1SAYA 3QW2A 4MIEA 3BTSA 5A5EA 3WGZA 3WR5A 2HO5A 1ZK1A 3MJEA 1E77A 5FI5A 4MVJF 3TSCA 3V1UA 2PZJA 5B1YA 1ZEJA 5L95A 3PQFA 4FIZA 4IY1A 4XGNA 5GZ3A 3AM3A 4NR0A 5A9SB 2AXQA 3VZQA 1E92A 2OBNA 3RJ5A 4J1NA 3AWDA 3S2GA 2Y1OA 1PZHA 2WDZA 4O59O 2JHFA 3PYLA 3VAZA 3DBHA 3GZNA 1DO8A 5LCXA 1NFRA 4IDBA 1U2DA 3PJDA 4GWGA 1PJTA 4XQ9A 1HZZA 3GDFA 2Q1SA 4URFA 1W8DA 4HFRA 1PJ2A 4MDHA 5BSFA 4WCFA 1NAHA 1PS8A 2LDXA 2O4CA 3T7CA 2JJYA 1PJ3A 2I66A 2VHXA 3RBZA 3E1KA 4Q9NA 3AM5A 1NR1A 5I8WA 4I9UA 5L7YA 3GG2A 3NTOA 4IPTA 3BXXA 3SVTA 4LISA 4UREA 2BELA 4K6FA 4NBWA 2VTDA 4B8ZA 4J1SA 1PQWA 3ZWBA 4YJGB 1NQAO 2RHCA 1M6HA 1Y8QB 4GVLA 2HMTA 4BKOA 4CM9D 1J4AA 5ICMA 3IL2A 4YCAA 2O3SA 3HQ4O 3SEFA 1DJNA 5CG2A 2JD2A 3RU9A 3TOZA 1NFFA 2NU9A 3DHYA 1GL3A 5IZCA 4W4TA 5K6AA 1WXDA 3AM4A 3GLQA 3WQQA 2VQ3A 2NU7A 3IKTA 1HE5A 1K5HA 1SMKA 2PD6A 4KUGA 4WE3A 1HDGO 2QG4A 2GUGA 4ZICA 4BVAA 4XQGA 4WLEA 2W8ZA 4F3YA 1ENYA 3ZNNA 1A9ZA 1VJTA 3TDKA 5CAEA 3UCFA 5FWNA 5B12A 5EQDA 1BW9B 2GZ1A 1JKIA 1LJ8A 5TT1A 4ZRNA 5T8KC 1B7GO 1LRJA 2X86A 1XYGA 4RDHA 4FC6A 1PJCA 2CDAA 4R1NA 2Q4BA 4IDGA 1V3VA 3OM9A 1AN9A 2V6GA 1T1RA 3MJ4A 3C3XA 3PWKA 5IN5A 2NU8A 3X2EA 1PQPA 4GI2A 3JTMA 2VT3A 3LF1A 3PIDA 2NVUA 3CZMA 1LQUA 4JIGA 2OZPA 3BTOA 2Y0CA 3RVDA 4AJOA 3BMCB 1WAMA 3DZHA 4IINA 4NNJA 3CE6A 3B20A 4B7UA 4YAJA 5L3ZA 4BNZA 6ADHA 2PGLA 4MINA 4E3ZA 1QV6A 4U7WA 3OF2A 1PGOA 2BKAA 3DBRB 1YXMA 5IFLA 2P9GA 1J6UA 1NWCA 1EMDA 1C14A 4BMNA 3G1UA 5MDHA 1EUCA 1EE9A 2AMFA 4KQXA 4FQ8A 1Y5MA 4PG7A 5L40A 1C1DA 4PLCA 1P1RA 1CIVA 3HHPA 4Q3AA 5AYVA 5IDWA 1HLDA 3JD2A 4J0FA 3V2HA 2B4TO 4OL9A 3LC7O 4ZQEA 1WLYA 4NZ9A 3IAHA 4PLTA 3TZQA 3ROKA 3DHEA 4KUHA 3VH4A 2I99A 4KQWA 4FD3A 2RHRA 4JP3A 3H8VA 3FWNA 2FRDA 5U1PA 3V8BA 1EUDA 1U5CA 1ISHA 4N54A 1N92A 1WW8A 5J23A 4XGIA 3HFSA 3S2IA 3ZNPA 2B4QA 3CIFA 4IQGA 1EFLA 3BAZA 1QR6A 3DBHB 1DIGA 3GZNB 2BF7A 3HWRA 4GL4A 5A9TA 1DHRA 4PG4A 3GRPA 3GVXA 3QRWA 2O2YA 2A92A 4UVGA 2X58A 1D4FA 2OORA 4J2OA 3DOCA 5MGBA 2VUSA 4NQZA 4WCFB 3TWOA 4CL3A 4L0QA 2WE8A 1UXGA 5IDQA 5K0ZA 3PZBA 3ZWOA 3K31A 4DLBA 1R16A 2I67A 3Q0EA 5KWEA 3M6IA 1JU9A 4N5MA 4RDIA 3GMSA 2JFHA 4QFDA 1A27A 3FNFA 3KO8A 2XAAA 4JJGA 3VOSA 5GMOA 2V7PA 4E31A 4NG5A 2Y93A 2BD0A 2JD0A 1NYTA 1ISGA 1H6AA 2EG9A 2O50A 3U0BA 3FNHA 1YH3A 3HB5X 4LSMA 4L74A 4JBIA 5JC1A 4U8GA 3OIGA 3RUIA 3V1YA 4RVFA 3QWHA 1GY8A 4Z0TA 3L0DA 4E2WA 1DFHA 2B0JA 1N9GA 5IXYA 5L51A 1YDWA 3HG7A 4P4LA 5JS6A 5BSGA 2DTXA 2HDHA 8LDHA 3AJRA 2Q1UA 4FDAA 4ROSA 2X4GA 3G3EA 4I1IA 4OO3A 1U28A 1PWZA 4NDNE 4WLVA 2D2IA 4OJNA 4XX0A 1RM4A 1ID1A 4NU5A 3PYXA 5DULA 5TJ9A 1GV0A 5EPOA 4BOYA 1MX3A 1P45A 4P22A 2I5PO 2E48A 2DVMA 3IS3A 3H2SA 2DBQA 4WEQA 1JQBA 4Q3EA 2AEJA 1LSSA 1QXSA 3CPSA 1IL0A 2NVUB 1NVMB 3L4SO 4OKNA 2NU6A 4B7XA 2WJPA 5B37A 5JY6A 4DA9A 1U8FO 1I36A 1ZK4A 1EVZA 4PIVA 4K28A 1PEDA 4PG5A 4R9SA 2PKRA 3L4BC 1BGVA 4AJKA 1RM3A 2Q4EA 1RKXA 2YY7A 3PYMA 3D4PA 3QP9A 5I7SA 4DMLA 1PU2A 4CLOB 3CKYA 2J5QA 4RVSA 3KSZO 1LC3A 1DC3A 1QLHA 1SNYA 2B69A 2C54A 4I5DA 4M8SA 4XDYA 5IAAA 3LC1O 1C1DB 1DRUA 4IDFA 4YVFA 4QT0A 1MP0A 2Q46A 3ZWPA 2DPHA 4A26A 3TFQA 4E12A 3WGIA 1B3BA 3MJTA 5HRUA 1NHWA 4QX6A 4TSKA 3OJFA 2NTNA 3EZYA 2BI7A 4YT8A 5DCYA 2IZ1A 4INAA 2H5LA 3R3SA 1KVQA 2CVZA 4G65A 5JNLA 1XA0A 2D5AA 4N5LA 3D3EA 4CM4A 1HSZA 2FHSA 1C0IA 1FXSA 2YV3A 2BI8A 2Z5LA 3NGXA 4QTZA 4I08A 3OIDA 3DMYA 3WYCA 2DLDA 3U5TA 4YAGA 1PJQA 3KEQA 1GEGA 4DPMA 1A7KA 4D45A 4IIUA 3DDNA 3FF4A 3R6DA 4FJ2A 4MIOA 3DZGA 2HLPA 3MJVA 1GPJA 3OMLA 1IZ9A 3JQAD 1KEWA 1E6WA 3HZZA 4OH1A 4RVDA 1K3TA 1MUUA 1D3AA 3ZHZA 5JSFA 4J43A 4FGSA 3AUTA 4BNMA 4G2NA 4KMSA 2D8AA 4XEHA 3EVTA 2VTEA 1ZEMA 1TT7A 3SXPA 2C5AA 1J5PA 3VDRA 5I7EA 3P5SA 3RU7A 1B14A 2NTJA 4OOFA 1B2LA 5DCWA 1IY8A 3L6DA 2W4QA 1V6AA 3GNSA 3EAGA 2E49A 4CM1A 2O2SA 1N9GB 4GPD1 3VPHA 2CSUA 5DP2A 1HT0A 2J6IA 2VRBA 4KWIA 5JAZA 3GAFA 3VKVA 1IE3A 4CPDA 4ZHSA 2RIRA 1BXGA 5T8KA 2X8LA 4OM8A 1VJ1A 5JCJD 1T2AA 4S3MA 3F1LA 3GMDA 3DWFA 1ISIA 4PRKA 2PD3A 4BO7A 1HKUA 2HMVA 3IDSA 1LX6A 1GQYA 4IGEA 3WBFA 3NDRA 4BUCA 1B0AA 1E7WA 3K8ZA 3KVOA 4RQUA 2J5KA 1E1KA 2XOXA 5F5NA 3DL2A 3JD0A 1HE2A 1XU9A 2DPGA 3LF2A 1XQ6A 4NBUA 2GN8A 3K5PA 1N1GA 2C2YA 3DTTA 3QE3A 1X1TA 4G81A 1PJLA 4IJUA 1Z75A 4B4WA 4W99A 4E2YA 2HRZA 4TZTA 4ZD6A 3N7UA 2O3JA 2YJZA 3DBLA 2Z1MA 5L45A 3TPCA 3TFOA 4NU6A 1AUPA 4YEDA 4I9NA 4FJ1A 4IS2A 1E6EA 5AXAA 3WWZA 5C7LO 4DXHA 1DLJA 4O1MA 1CERA 2X23A 1P31A 1LUAA 5KKCA 3P7MA 1KC3A 3DZJA 1GUYA 3JQAA 1J0XO 2NSDA 1U4SA 1AHIA 4UUPA 4ALMA 3M1LA 1VE9A 1YVEI 3CMCO 5I8ZA 4AFNA 5A05A 4DRYA 1GQ2A 3UAGA 2IE0A 1RM0A 4BNLA 1U7TA 4UEOA 4EZBA 1RM5A 3F9IA 3GNQA 2UVDA 2AQKA 4OOEA 3ZNOA 1GCOA 1D7OA 3I83A 4IQ0A 1IYZA 3D4OA 4JROA 3ZHXA 4RF5A 2WD8A 3VPSA 3I9NA 4JK3A 4TQGA 2E37A 4D3DA 5JBIA 2ZCVA 1UUFA 1WDLA 4E33A 2HMWA 2OL4A 5BQFA 2C59A 1M67A 1LDBA 2DM6A 3U4DA 3KOUA 2O4UX 5T64A 2HKIA 5AVOA 4CM4B 4EUHA 1UZNA 4WECA 5TRTA 3I5MA 2NVWA 3JQFC 2DU8A 3MTGA 1GTMA 3H6KA 4PLFA 2GR9A 4DMMA 3E6AA 4I8XA 2Y99A 8ADHA 1T2FA 3PLRA 2P9EA 3W4KA 2VYVA 3OECA 1P0FA 4Y6PA 1F8GA 4P38A 3ZWVA 1WZEA 4XWYA 1TEHA 3R1IA 1LDMA 3BA1A 1BWSA 3ROPA 3UH1A 2EGGA 2XXBA 1J49A 3JQ8B 1G0OA 1NVGA 2GD1O 2YHUA 3V1TC 4XQCA 3E9NA 1N7HA 1FJHA 3ZU5A 2Y1CA 1HDRA 1Y8RA 3D5QA 5HTOA 1QYVA 3JYNA 4MVJI 5G0TA 5G2OA 3WBBA 2FZEA 3AI2A 4J2HA 4J4TA 4E13A 1K6JA 1WVGA 2XXJA 3F5QA 1H6DA 3IJPA 4MVJM 1UXIA 2CVQA 4B3IA 1EDOA 1ML3A 1BVUA 3C1OA 3WG9A 3BHIA 4BMVA 3DHNA 1ZKMA 3IKVA 5TNXA 1NM5A 4MVJP 3U9LA 3WTBA 3H7AA 4J4HA 3VPXA 1Q0LA 1BXGB 2WMDA 4LW8A 4M89A 4AJLA 3LLVA 5G0SA 2Q99A 3RBXA 2QW8A 4WJZA 3GDGA 2B36A 4J16A 3DZBA 5FF9A 1NTOA 5BT9A 1ENOA 1X0VA 4Q3DA 2ZTVA 3UXYA 3B70A 4RV9A 4HBGA 2SCUA 2VUUA 1DPGA 1NX6A 2EJWA 3NRCA 3PZRA 4TKMA 5KJCA 2O3RA 2PGDA 1ZNQO 2O7QA 1DAPA 3ZN2A 1MXHA 1YL5A 4WNCA 5CP8A 3PHGA 3ROMA 1BG6A 4RPJA 4LSWA 1A9YA 1NQOA 4GSLA 4NK4A 1YKFA 1I2CA 4OXKA 3WYBA 3JCZA 2GN4A 3WNVA 2FWMX 3G49A 3L4BA 1ADCA 4IDAA 4WNIA 3CTMA 5F21A 4ONEA 4CLEA 4E0BA 1B16A 4J1QA 4PLPA 2ZTUA 1V0JA 2EXXA 2OHXA 1XHLA 1IPFA 3JQAB 4F6CA 4FB5A 1ZO8A 5CDGA 3BMQA 4BQRA 2DBRA 4HX5A 1U3UA 1HDYA 4RL6A 1KERA 3W1VA 4MPDA 3PJGA 2VZ8A 4Q39A 4YJFA 4DREA 5AXCA 4NJOA 1I30A 4B3HA 3GT0A 3RAJA 1V8BA 1PGNA 1ZUD1 2GDZA 5ER6A 1PZGA 5TLSA 4PG8A 3RD5A 5KVVA 4EEXA 4BNXA 2O3TA 3AW9A 2CNBA 4XGKA 3RSHA 3GPIA 2FZWA 1CYDA 2X22A 1Q1NA 2DQ4A 1P44A 2BHLA 5TX7A 1E1NA 2CF5A 3DOOA 3FHLA 4D42A 2VCYA 3AUAA 4BV8A 4UVIA 2TMGA 4KDFA 4A2CA 1Z45A 1LEHA 2VWQA 4CUKA 4J3FA 3PK0A 1HL3A 3A1NA 4PFJA 4L9RA 2VYND 1GADO 4AJNA 1VLLA 2FN7A 4RLHA 4U6QA 3RC2A 1DXYA 2DFVA 5DNAA 1GZ6A 5TS3A 1GDHA 3HFGA 1R4MA 1I2ZA 3K96A 3RUDA 5TSDA 3RC7A 3JV7A 4J4BA 4YA6A 1KETA 4H7PA 1P3DA 5THKA 3OFSA 3H2ZA 2Q3EA 4MO2A 1TLTA 1YJQA 2YDXA 3HDHA 1YRLA 2PZKA 4E2XA 3JQGB 1GYRA 1B8UA 4K9DA 2YQ4A 1Y8RB 1B8PA 5DOVA 4XKJA 1NWHA 1R0LA 1Z7BA 2HRBA 2VNSA 1HSOA 5TJHA 2G76A 2GASA 4PG6A 4A27A 2AW5A 1CQIA 1XCBA 3F47A 2IXBA 1P1IA 3DBVO 2HAEA 3OH8A 2V6BA 4BNGA 2HMSA 2IRWA 3ICPA 2BGLA 4IDDA 3F3SA 3V2GA 4QFCA 4G5HA 1TA4A 1XR3A 1IB6A 2JAPA 1Z73A 4GX1A 5IZ4A 4LRSB 2DUWA 2GSDA 1KOLA 3ZCXA 3TJRA 4WPGA 5DZSA 2OFPA 3PQEA 1I3NA 2QZZA 2BGMA 3AK4A 4EBFA 4PVDA 3SC4A 2YQ5A 4R5MA 4ALKA 5ADHA 5DF1A 1HLPA 2P68A 1X15A 3KBOA 2NLOA 4DIOA 5ILOA 2AQ8A 2WSBA 1HEUA 3QWAA 1LSUA 3BMOA 4Y98A 3N74A 3W8DA 3BYZA 3CZRA 1K89A 3U3XA 1QV7A 1GU7A 3JYQA 2DAPA 2GF2A 3EY4A 2C29D 3KHUA 5T67A 4B8WA 1ZSVA 2VYNA 3GGGA 1JAYA 4BNUA 5KVSA 2NWQA 3TN7A 5G0VA 1EBFA 3ZWCA 1QYXA 1ZH8A 5I9MA 4BKRA 4BGEA 3C85A 5TC4A 4MVJE 2IYOA 4MP6A 3ZNQA 3DO5A 5L4SA 3GHYA 3AUUA 3QSGA 4A7PA 1N8KA 1P9LA 3IC5A 1BXKA 1PSDA 1V9LA 2VHVA 3BMQB 1H2BA 1NXQA 3WGHA 3I9JA 2P5UA 4KDEA 4YJFB 5KKAA 5DP1A 5JC8A 1GZ3A 1NAIA 2NQ8A 3RIHA 1B26A 4EYEA 1BDMA 1OI7A 4YRBA 1LDYA 1I2BA 5THQA 4D79A 3HJAA 2B5WA 3FNEA 3QVSA 5JPIA 1E3SA 2PY6A 1JKJA 2OP0A 3EYWA 3JQFA 2HK8A 2YZ7A 3RFXA 1IHXA 2ZYDA 4HY3A 2FMUA 4W7IA 1I0ZA 1KC1A 5F1KA 1AHHA 2ZJ1A 2I3AA 2VHWA 3FR8A 1X7GA 4FPXA 3PVZA 5CDTA 4HUJA 2DKNA 3I9LA 2EIHA 3SBOA 1LDNA 3S55A 1R4MB 3ASVA 4BKQA 3AFMA 2BFOA 2JAHA 1M66A 4CMJA 5I9NA 2BRUA 2Q2VA 1KYQA 4Z9YA 2A4KA 4U5QA 2WM3A 4HWKA 1YQGA 4RPKA 4Q3NA 4IBOA 3WICA 2ZTMA 3D5TA 5JCXA 2VOJA 3EW7A 5A06A 1LSOA 3MCVA 1W4ZA 2PGJA 3JQBC 4XZ3A 4PCVA 2W2KA 5BR7A 2OUIA 4J90A 4EITA 1XLTA 3LLSA 4CLOA 5BSHA 3WYEA 2B5VA 3PP8A 4PLGA 4OIMA 1LBEA 2Q1WA 1XWFA 4N7RA 4D46A 4QEDA 4R51A 4CM9A 1C1XA 1YB4A 4HV4A 4YBZA 2I3GA 3OP4A 1GAEO 1H2HA 4L8VA 4CMHA 5L53A 4RPGA 3ZHYA 3WJ7A 4XIJA 4RJTA 5COAA 1UAGA 4PLHA 4B4UA 1G6KA 4DWVA 2JCYA 1DC4A 3PHHA 4D3FA 5BSEA 3P2YA 4NBTA 5HA5A 4BGIA 4CR7A 2ZCUA 5CEEA 4EI2A 3M2TA 5HS6A 1UAYA 4NBRA 5DOZA 4MVJH 4DIFA 1CRWG 2UYYA 4TWRA 1Y9EA 4CJXA 3FNGA 3L9WA 4EUEA 3HDYA 3EDMA 1HETA 4E5PA 3ONDA 3K30A 4J9UE 4HNGA 2FR0A 3EMKA 3A9WA 4R69A 4U0JA 4PN3A 2YUTA 3ICCA 3BMOB 1Y7TA 3JD3A 3NDJA 4ND5A 4O6VA 7ADHA 3WOHA 1HTBA 1ZSNA 4FFPA 4EUFA 3BIOA 4L73A 2HJSA 2EF1A 3EC7A 2ZB8A 3MWDB 2G17A 3RC9A 2CMDA 2DC1A 2Y1FA 1W6UA 2YYYA 2FPIA 2Y1GA 2D0IA 5L7TA 1S7CA 4GGPA 1SEVA 3MJCA 3KB6A 1DIBA 1ZSYA 4FCCA 4BKPA 4EDFA 4ALNA 5KIAA 2QYTA 3O9ZA 5H82A 3BHMA 1M2WA 4J91A 4YTEA 3G0OA 5TF4A 3VKUA 3WS7A 4YB8A 2CUKA 3Q11A 2W90A 2VUTA 2E82A 4NH4A 3OJ0A 4GX0A 4DC1A 5KOIA 1OBFO 2GGSA 1KY4A 1HXHA 3AY3A 4Y8VA 3ZGYA 5B4VA 1KEUA 4XB1A 2QZ9A 3GVPA 3HN7A 1KY5A 1HDOA 2HJRA 1PWXA 2AHRA 1XGKA 1FK8A 3FTNA 4CLHA 4Z9FA 4R9RA 1RWBA 3OEWA 2FR1A 5JYEA 4R4JA 4DQUA 5F1PA 4IMPA 3C24A 3G17A 5L4LA 4E5KA 1E7QA 2GN6A 3FTPA 3QV1A 5DBFA 3DONA 5I7FA 1MFPA 4WCDA 3RWBA 3WFJA 4YR9A 1PL7A 3ZW9A 1K6XA 4ND4A 3AOEA 1DIRA 2Q2QA 3HDQA 4IMRA 2ET6A 3U09A 3VVCA 1C0PA 1S6YA 3E5RA 3GC6A 1ZXBA 4GBJA 4E5NA 1M6WA 4ESOA 2PNFA 2EWMA 2YDYA 3PJFA 1SOVA 5F3RA 1I10A 5CHEA 3QA9A 4HNHA 4OGWA 4S1VA 3RBVA 1HYHA 5G4KB 3VZSA 1FDSA 1SZJG 2PH5A 3DXFA 1GQQA 2YV1A 1KS9A 2AQHA 4MJLA 3GPDG 3C7AA 5BNFA 4I5GA 2FOIA 4KUEA 1C3VA 2Z95A 1LSJA 1A4IA 1YWGO 1GCUA 2ZK7A 5FEUA 3U49A 4OQYA 1A7AA 1DB3A 5F5LA 3ZZNA 1EE2A 2Q45A 4ILKA 3W8FA 3Q2IA 1Q7GA 4CV1A 4D43A 4HFJA 4GGOA 2PZMA 4CUJA 5KVCA 3RQSA 3O4RA 3P2OA 4ALIA 4FOSA 2P9CA 2W2KB 4BNFA 2QRKA 3ANNA 4WUVA 2IEBA 4ZQHA 1E5LA 3ETEA 4UEJA 3U62A 2IXAA 4I5EA 3KZVA 1C1XB 4FBGA 3KM0A 1TVEA 1WMBA 2J8ZA 1UZLA 3E5MA 3GZ4A 3DZIA 5KJ1A 4Z3KA 4GKBA 1ONNA 5KJEA 3VTZA 2AEFA 2GERA 4DTIA 1CJCA 4M87A 3FI9A 2HK9A 4O5OA 3RI3A 3DFUA 5A02A 1LRKA 2DBVO 4GX5A 1FDUA 4JXKA 3WIDA 1R15A 1HDXA 5AQ1A 3U4IA 4XRRA 5T6BA 5JAQA 3IP3A 3ASUA 2JFGA 4CV0A 4TZKA 4YDRA 2FP4A 3NEPX 1VM6A 3KV3O 3FWZA 4JBHA 6LDHA 1PJ4A 2C5EA 5JW6A 1ZBQA 1MFZA 1E7RA 3O26A 3WSWA 3JQ8A 5A3JA 2GZ2A 3QIVA 3FRJA 3MWEB 3JYPA 3OETA 3WGTA 4YJHA 1VKOA 4YQZA 5CPFA 3ZDFA 4CMAA 5A04A 4NMHA 2DUUA 3PTZA 1UR5A 3INTA 3H5RA 3PGJA 4Z0HO 1Z7EA 4IGFA 3WXBA 1T4DA 2F00A 3WWYA 1EQUA 2WYUA 1ARZA 5F1OA 2JCXA 4FOOA 4D3SA 5CDSA 4BO8A 3O8QA 4E2ZA 4BNIA 3QJ5A 4AJEA 3AUSA 4E4YA 4AL4A 2NM0A 3UHAA 3NV9A 1BVRA 1K2WA 1NASA 1ZIDA 3VH1A 1NBOA 4UUOA 4BO3A 3KYCA 4YT4A 3UF0A 3NYWA 3VDQA 1H0KA 2AQIA 4RO0A 2PZLA 3EK2A 2FSVA 5KVQA 4W7HA 3I1JA 1PGPA 4M86A 3ITDA 2AE1A 4HADA 1DBVO 4FGWA 1WP4A 4GMFA 1JA9A 4NJMA 1P1JA 1EZ4A 1HE4A 3IUPA 4XYMA 2DT5A 3EVNA 4GAEA 3V5NA 1HWYA 5G0WA 2ZJ0A 5DBIA 4KP7A 3F46A 5EERA 1D1SA 4LN1A 3LVFO 5IF3A 3LSYA 2XF8A 1VI2A 1X13A 2Y1EA 3W4JA 4ZVVA 2NADA 3IP1A 3OQ6A 4DIBA 3JQBA 1I01A 2CVOA 3OJOA 5G0UA 1TB4A 1QMGA 1F0YA 4EW6A 3PFWO 3GQVA 4BNKA 2AEMA 3E03A 3RUEA 1U3TA 1HF3A 4BO6A 1MB4A 3K92A 1HRDA 3G1TA 1ULSA 3GF4A 1VSUA 4JN6B 1LDGA 2ZYAA 3DAFA 1SOWA 2D4AA 3O38A 1ZK2A 4ZGWA 4J6FA 3S8MA 4PRLA 2I6TA 1PIWA 1W73A 1YB1A 2X0JA 3WX0A 4N18A 4IUYA 1T2EA 4XYBA 5FYDA 1VKNA 3OQ1A 3E18A 4M49A 4HFMA 4II3A 2OXIA 3JYOA 4Y6SA 4B79A 1TXGA 3V2UA 2QIOA 2V65A 3MTJA 7MDHA 1OOEA 4NBVA 2UV8A 1X7HA 3Q6IA 1PS9A 4H3VA 3L6EA 2X9VA 4UAGA 5JCJA 3GVIA 1EBUA 4WEOA 3R3JA 3GEDA 1ADBA 1PR9A 2X0IA 3H9EO 3I9KA 3INGA 2R6JA 4FFLA 4CODB 4BS9A 4YWJA 2W98A 2H1SA 1LDEA 1E1LA 1G0NA 4DUPA 1DOHA 4K26A 4B4OA 2VZ0A 1GUFA 4K1LA 4L4XA 2VHZA 1R6DA 2YHIA 4QQRA 3S2EA 4C7KA 1SEPA 1ZVMA 4BNHA 3T4XA 3JQGA 4P4GA 1YDEA 1MV8A 2X5KO 1V3TA 3QHAA 3NT2A 4YJHB 5IJZA 4W6ZA 5EINA 2Y68A 3VZRA 1ULUA 1NR7A 4HKTA 1BRMA 2BGKA 2NUAA 3ETGA 3RUHA 1VJ0A 3ZWNA 3I52A 3E82A 3O8QB 2EW2A 3D1LA 4A10A 2X9NA 1M75A 3QVXA 2GLXA 4ALJA 3IJRA 4R3NA 3ZWWA 4AJ4A 3TZCA 9LDTA 1EQ2A 4FFRA 1AGNA 1E7SA 4R1UA 4XA8A 4CV3A 3E8XA 1E5QA 4DQXA 1Y81A 3Q9UA 4IJVA 3KYCB 5IDXA 2QRJA 1NPDA 3GFBA 5B4UA 3OJLA 3STHA 4EJ6A 5TIIA 3EZLA 2BFPA 4RZHA 3DZFA 1SBYA 2WE7A 2IYPA 2ZB4A 3QVTA 4IS3A 1MA0A 3UW3A 1VL6A 4E21A 1GYQA 4NJMB 1DAOA 2BMAA 1LXCA 1WMAA 3EGOA 4BB5A 2J3HA 5BNIA 1DFIA 1TI7A 2J3JA 3GVHA 1SB8A 4CM8B 1Z74A 5KNLA 3AY7A 3CSDA 2BFMA 4RORA 3PPIA 1AXGA 4MP8A 4JBGA 2JFFA 4CR8A 3VZPA 1A4UA 3S2FA 1ONPA 3JD4A 5KTKA 1O94A 1BXZA 2UDPA 2ZB7A 4R01A 3LQFA 2P4QA 1T4BA 4RPLA 4WLFA 5LDGA 1F8FA 1YJ8A 1BMDA 2EP5A 4IZHA 2H6EA 3OJEA 3ITKA 1YBAA 3GEMA 2HU2A 3ZWMA 4RF2A 1XQ1A 1JWBB 3FBTA 3GRKA 1UP6A 4DYVA 4MVJD 4EGFA 3NKLA 4CQMD 4XRGA 5JY1A 1T1SA 3A06A 4I9HA 1EK5A 4UVHA 1W0CA 3UVEA 1ISJA 5TGDA 3FSRA 3GVCA 3KLMX 1NFQA 1JWAB 3DB2A 2AG8A 4AJHA 4GKVA 2NACA 1CQJA 4CQLA 1E3JA 1IZ0A 4BNYA 1EK6A 4CL8A 4YAKA 1EVIA 4YXFA 2X0NA 4ZA2A 1EVYA 1T25A 4YYZA 3QWBA 3TRIA 2POQX 5U4QA 3PI7A 1K6IA 2UUOA 2Q49A 3ETDA 4UEKA 1XKQA 4XIYA 3WGQA 4H15A 2GZ3A 2BLLA 4CLRB 4AJIA 5AOVA 5IDYA 2DTDA 1YL7A 2J3KA 4WOKA 1Q7BA 3ORFA 4R68A 2C0CA 3K9QO 2XPCA 1ISFA 1O95A 1DSSG 5I9LA 3D7LA 1F17A 1I3LA 3VHRA 5HS4A 1ZMOA 1MGOA 1OZAA 2B37A 1GZ4A 3K73O 4CMEC 1ENZA 4DLLA 4ZQFA 1LLQA 2JCVA 3FCOA 2YHIB 3K6JA 3W8EA 4J49A 1L1FA 3JQCA 4IXTA 2WD7A 3UCXA 5FFFA 2FPGA 4OAQA 4RVGA 4CR6A 2TMDA 2CDBA 2PD4A 3AOGA 3H9JA 1WZIA 4YACA 2IDZA 1P74A 4OMUA 1B8VA 3D64A 4MKXA 3N58A 1X1EA 4I5FA 4A73A 1U3VA 1OAAA 3LZ6A 4FN4A 4IJKA 1JW9B 2P91A 3WB9A 1SC6A 1R66A 4IZIA 4N5NA 2EHDA 4QO7A 4QUKA 4XB2A 2EKLA 1IHYA 1DRWA 1DFGA 1H9BA 4QXMA 2JL1A 3HB4X 2C7VA 4YJDA 3TOXA 1GUZA 2EW8A 3H65A 3GUCA 1LLCA 3W6ZA 3ZI0A 4D0RA 4D41A 1YGYA 1WDMA 3GNTA 1YONA 4FS3A 4BO1A 2C7GA 3BZUA 1HYEA 1PR3A 3C7CB 3ONEA 2D3TA 2GYYA 3NTQA 1MG0A 2Y67A 4JJFA 3AU9A 4ZN6A 4CLDA 1V35A 4JX8A 1XSEA 2A9FA 1Q7CA 3BTVA 1I32A 3L9XA 5IN4A 4A5OA 3NT4A 2VOEA 3VPFA 1Q2XA 3DFZA 3TNLA 2PH3A 3F1KA 3ZH2A 4ZJUA 1CDOA 4R3WA 1VL0A 3ZWYA 1ZXLA 4BV9A 1NP3A 1UP7A 4CV2A 1UXKA 3INRA 3KTDA 1IUKA 5B4TA 2PKQO 5TQVA 1Y1PA 4GX2A 5GZ6A 5FI3A 4PZCA 1NPYA 2VWGA 3KSDO 3UOGA 4TRRA 5C7IO 1ZJYA 3IMFA 4NK5A 2GNAA 2IZ0A 4TRJA 5HBRA 5HM8A 1JAXA 2NTVA 4HFNA 3NT5A 4BO9A 1IPEA 2V6MA 3A28A 4TVOA 4CM6A 5JDIC 1QP8A 1U1IA 1BDBA 2QQ5A 4FFMA 4CQLB 3WDSA 4JCOA 3SJUA 3ABIA 4F46A 1GD1O 3GN2A 5COBA 2EV9A 1O89A 3RJ9A 4GSKA 1I33A 3EUWA 1YO6A 3I6IA 3SX2A 3DMTC 4W82A 3OEYA 2DTEA 2X9GA 1Y5RA 4GWKA 3KSUA 3DAGA 3ENKA 1I8TA 4XJSA 3I4FA 4CMCA 2X5JO 3KETA 3I9OA 4J7CA 2Y66A 1UH5A 2OO5A 3HADA 4E30A 1U5AA 5G4KA 3WMXA 3NTRA 1AXEA 1QRRA 2HQ1A 5COQA 4LRTB 4EJMA 4YPOA 3GDOA 4MKRA 5L9AA 3GH3A 4FR5A 2ZTLA 5T5QA 2WD7B 4LCEA 1VPDA 3VC7A 3ZV6A 4BGVA 3LT0A 3JSAA 4DLAA 1WNTA 3L77A 4A03A 1ZCJA 1ZK0A 1QYDA 1SO8A 3WFIA 3IOYA 3JYLA 5CFZA 4TROA 3B6ZA 2PA3A 3HUDA 1PTJA 4CQMB 3C8MA 3PLNA 4J1TA 3CH6A 1P77A 2BFAA 4LVUA 3A14A 1ISMA 3SLGA 5EL0A 5ER9A 1O9BA 5C7OO 1H6BA 1P0CA 4HP8A 4DPLA 1LU9A 1E3LA 1JDJA 1P33A 1ZZEA 3LT1A 1AE1A 4ZU3A 4UULA 1E6UA 1DIHA 5DN9A 1A72A 2VN8A 3NJ4A 1UDBA 5ICSA 5DCUA 3I6QA 1HYGA 4Q3BA 4M1QA 1C0LA 4W9NC 3L6OO 4L76A 2R00C 4X54A 3ROQA 1ORRA 1KVTA 3AI1A 2D1YA 4PVCA 1Z6ZA 1GV1A 1GEEA 1KVRA 2GN9A 2VWHA 3BMNA 1WPQA 3H4VA 3LT4A 4Q3CA 4XD2A 2ZYGA 3ZHBA 3X2FA 4WOJA 4TRNA 2O3UA 3CXRA 1FDWA 2W2LD 1F06A 1V3UA 4ZQBA 5ENDA 4A0SA 5JLAA 3WQSB 3KRTA 1P1FA 2AE2A 4BO5A 1FMCA 3WGOA 2P4HX 5H83A 2BH9A 1DIAA 2B4RO 3VVBA 3ZV5A 2FPPA 4NFHA 4OXYA 4RF3A 3Q9NA 4JLWA 1UZMA 4WKGA 1YBVA 4Z9XA 3F6YA 5ILGA 1PX0A 3PQDA 2E6UX 3CINA 4RZIA 1EFKA 3TZ6A 5KJFA 4R41A 3MEQA 4JGBA 5T57A 2G82A 1G1AA 2A94A 1ZFNA 2B83A 5ENVA 1NVTA 4DC0A 1GPDG 3K2EA 3QVOA 3T7EA 3H5NA 4JNKA 2WTBA 4ID9A 3UFXA 4D0SA 5K9ZA 3Q2KA 4R5HA 3B1JA 1IOLA 5JDCC 4BNTA 3WGGA 4DVJA 9LDBA 5GY7A 3WIEA 5JMPA 1P1HA 1B15A 1EEHA 2Z1NA 1TT5A 1UDCA 1C0KA 1NQTA 4UVEA 3DR3A 1T24A 3ZU2A 3I3OA 3NUGA 3WNQA 3RCBA 3O03A 2CFCA 2O7SA 1HDZA 3ONFA 4D7AA 1YE3A 3DZKA 1H9AA 3M2PA 4XCVA 5EIOA 3CMMA 2OGUA 4RF4A 3MOIA 1MC5A 5EMHA 3OIFA 2OBYA 4CMEA 1ADFA 3PHLA 4XR9A 5ITVA 3K2BA 4GMGA 1H6CA 4PLZA 3GR6A 4NI5A 4P4NA 3I9MA 3QVWA 5CPBA 3W4IA 2VRCD 4CMKA 4IJWA 4B3JA 3WJAA 4Z6KA 1F14A 4Z3DA 1D1TA 1N7GA 3KYDA 2EJVA 4PLVA 4BO4A 3OA2A 4XYGA 2W2LA 3KYBA 2NQTA 3KUXA 5EQFA 2ZQYA 4PZEA 2UUPA 4WLUA 3ZWXA 3HDJA 1FF9A 1KEVA 3PRJA 2PKQP 4OHUA 1LA2A 1ZJZA 4LMPA 1JTVA 1XELA 2HK7A 2ZKLA 4RVHA 1KIFA 2NV6A 1XG5A 2E4AA 3DTYA 3FBGA 1LLUA 3MJSA 3DAPA 1LRLA 1PGJA 2I76A 2RBEA 1F12A 2D5CA 4NPCA 2HUNA 1R37A 3JQEA 4K6CA 3RUFA 3RASA 4LK3A 2YV2A 4U0KA 3VPGA 3F4LA 4YRDA 3MOGA 4R54A 4AJ2A 3F5SA 1LC0A 4GH5A 3JQ7A 2EEZA 5JMWA 3E48A 2ILTA 3ZV4A 2PTGA 4ZRMA 4IDCA 3BMNB 4BKUA 2RAFA 1NPTO 2ZIZA 3ZU3A 5KJ6A 1ZK3A 2VZ9A 3QWFA 4CMGA 2PFGA 2P2SA 2V6FA 2EERA 3T4EA 4BMSA 1QG6A 4DGSA 5H81A 2WYVA 4L75A 1O8CA 1I24A 3GY0A 1JKFA 2C07A 2Y0EA 1EUZA 2CZCA 3KLPX 3GFGA 2RH4A 3EHEA 1O5IA 3D3WA 1YS4A 3ULKA 4DYDA 2R2GA 3PGXA 4UVDA 4KZPA 3FN4A 3GEGA 1YOVA 4WLOA 4BQPA 1MC4A 2DFDA 2VRCA 3GA0A 5CDYA 2EKQA 5JO0A 1DDOA 1HDCA 1DEHA 1K0UA 1RYEA 5JDIA 3H9GA 5JYDA 3TL3A 3LDHA 3JQ9C 4WLNA 3GOHA 2CY0A 4D44A 1KVSA 5CDUA 4ND3A 4Y6RA 1SCUA 2GCGA 3NDIA 2J3IA 1CEQA 3QQPA 3WMWA 2PWZA 1DC5A 4YT5A 5EN4A 3LC2O 1OFGA 3Q1LA 3DMTA 4CM5A 3JQDA 1PQUA 2EGHA 4NHEA 5A1TA 4CM7A 3OHSX 3OQBA 4BNJA 5C3MA 1Q0HA 1MLDA 3PIIA 3U4HA 4DL9A 2HMUA 4GLLA 4BIIA 4PZDA 2OMEA 4UUNA 3PHJA 1TT5B 1U4OA 3PFFA 1H5QA 4DQVA 4BGUA 4KWHA 2O3QA 3KXDA 3AU8A 3SLKA 3DOJA 1LTHR 3WSVA 2X6TA 3ZW8A 4FSHA 4J7UA 1YQXA 1E3WA 2Q2WA 5ES3A 1H94A 4M54A 4XYEA 5EESA 3H3FA 4AJ1A 1A71A 2PLAA 1E0DA 4DPKA 3H5AA 4HXYA 3WLEA 2CD9A 2O23A 3ZWAA 3WLFA 4YQYA 1I5RA 3FD8A 2ZQZA 4J7XA 4CM8A 4IIVA 2Q50A 5A3VA 2O48X 1DRVA 2QRLA 2RH8A 4RQTA 4RVUA 2EP7A 2D59A 3OA0A 4KTTE 4MVJG 4XQEA 1OMOA 2Q1TA 4CMIA 3KYDB 4BO0A 1X14A 1OC4A 2VYVD 2ZB3A 1FDTA 4BHTA 1B3RA 4FJ0A 3TZHA 2I65A 3RFTA 1N2SA 5LC1A 4TRMA 1VSVA 4GQAA 1RPNA 5A9RA 1PS0A 1PJBA 5LDHA 3CUKA 1QYCA 2IEDA 2VNAA 3NGLA 2C82A 4WK6A 2AA3A 3RFVA 4WCFC 4TKLA 3B1FA 1LLDA 4PGFA 1JLLA 1R4NA 1RJWA 3OSUA 4CM3A 4MP3A 5JAIA 5HWSA 4FC7A 4BO2A 5L7WA 1QSGA 4W9NA 3ENNA 3L07A 3H3JA 1I3MA 1BSVA 3QLJA 5A03A 2R00A 1O0SA 4MIYA
chains in the Genus database with same CATH superfamily
3WYAA 3I4CA 4B7AA 2G1KA 4LQDA 3OT5A 3SC2B 4KOAA 2M9MA 3TUIC 3O2QB 2PSEA 3LA8A 1X7ZA 5CT9A 4CG0A 3NM6B 4CT4B 4EHBA 2Q5EA 3AVQA 3GD5A 2XT9A 5AK4A 1G8MA 3RGGA 1VHWA 5B6PA 1R8JA 2FSGA 3R7LA 4CGYA 4UBJA 4KXQA 2WLSA 5H1YA 1RZRA 4F6LA 1A8PA 5HPYB 5LJIA 1LS1A 4JYZA 3WGKA 2F9MA 4WKOA 2IWRA 2WYWA 2RGDA 3WO0A 1HE3A 1JN0A 1O6ZA 1QH8A 4V39A 4FQ7A 5CX1A 1DLIA 3CUSA 5DASA 4JOCA 3T7AA 5IG2A 2FN3A 4RPHA 1ZITA 4K5QA 1GGJA 1Q74A 3HCOA 2C4UA 1XTUA 2RK4A 4GI1A 3L82B 3D3WB 3E9EA 3L43A 4V1CI 1N6OA 2GFIA 4YJKA 1A9OA 5AK6A 4FFOA 4OM7A 1GQRA 1T6NA 4HATA 4J9VA 5FBVB 1YOVB 3IIEA 3RODA 5PNTA 4ZOCA 2GFHA 2CJYA 3Q2OA 4WQMA 5JLJA 2GPTA 4OA5A 2H7CA 4R8RA 2RFLA 3MD9A 3WGYA 3PEFA 3JAKB 5JO9A 3DAHA 4KV7A 3NWPA 4WMLA 5FBHA 5K1ZA 3SZRA 1U9IC 4LJRA 2F3PA 1AF4A 2O2DA 4LMRA 4Y2RA 3AVVA 3WHIA 5AKZA 2PRZA 2ZXFA 3L0YA 4JJKA 4GLOA 4RZQA 1VL1A 2AOUB 1SCUB 4QL3A 1E2GA 1L8AA 1MJGM 2QP4A 1P6QA 1TNDA 1UPFA 3AFIA 3O9VA 3OURA 3PQ5A 4NFLA 2EX4A 3DQQA 1H1TA 4XLLA 5EE3A 4NCKA 4E07A 4MB0A 4JQZA 5JDCA 1YFKA 2OCXA 1VRWA 2XMBA 5IBPA 5CCDA 4KQFA 2P9ZA 3NTXA 1M34A 3B1KA 4RH1A 3SEAA 4X00A 4LGVA 1YVDA 4DNQA 3VNQA 1XNQB 2GO1A 1T2CA 1OXBB 1TK9A 3G7SA 4E1VA 2JS7A 4EOGA 3TZKA 4G0OA 4MHSA 5MN5A 2C3UA 2WK1A 4JVSB 4C6SA 1G66A 3JAWA 4HLNA 1ST3A 1Q21A 1XQVA 3D0OA 2J9ZB 4GGMX 4BL5A 5FOTA 1XIVA 1H0SA 3NHFA 4R1TA 3RAFC 3TF5A 4QO8A 1QLJA 2RDMA 5FBWB 1E3WB 1I3KA 3GWZA 1Z4OA 2EFEB 3UICA 2I54A 3GXBA 3KJEA 2XCRB 2ID9A 1PFKA 4HBZA 1Q0QA 1TM7E 2PKXA 1IJBA 1GKUB 2WWRA 3FPLA 4ITUA 2FEKA 3B9RA 3GYBA 1FFXB 1I4TD 3TQHA 4EJ0A 5JBQA 4KTVE 2RGEA 2JIZD 4WN9B 4YDSA 3T7SA 1RAEA 1KI1A 3PRKE 4PV7A 1W0JD 1QMPA 3PUIA 2OEPA 4BNNA 3MXOA 4IDPA 4W5JA 1KI4A 3K4QA 5CTJA 3QE4A 1GR0A 1GLGA 4LXIA 1IMOA 4FTWA 4O63O 4P5EA 3ZTWA 1XDGA 2V4ZA 2I9PA 2ZUSA 4M7PA 3F4BA 3HBFA 3B3QA 3G85A 4R71A 5FR2A 3A1UA 2VJDA 2EQAA 2GM5A 2V7XA 4BP3A 4NIMA 4WTOA 1ORVA 2D2VA 3CVYA 4HDNA 3BHJA 3U3DA 2PTHA 2VKTA 2IYYA 4KFUA 4U3JB 4EO7A 2H48A 2UXBB 2XOKA 1WKVA 2WHEA 2ZG6A 2VWPA 2OORC 3G2MA 3LYLA 3MJRA 5JE8A 4YAWA 1C8KA 3H8JA 1VLZA 3DBLB 5SY4A 1E3EA 1Y80A 3RTBA 1R4NB 3PPVA 2BCGY 3OIUA 4TLCA 2VHYA 2FQXA 5K2OA 1FFYA 5BQ3A 4BXOB 4FCWA 4AP6A 2ZE5A 4G5QA 5D87A 5F98A 2PUHA 1M0WA 4F4UA 1EVJA 3GG9A 1U9JA 2PRYA 2V7WA 4E4RA 4I6EA 3LHSA 5AXBA 3VTFA 1YQDA 4TMVA 1DMSA 2ZRMA 4BEBA 1IULA 5FP0A 4PPQA 5GQSA 3YASA 3E7FA 4ND2A 1U0RA 3ZHRA 3TW8A 1J2JA 3EEIA 1V37A 3L1KA 3D2LA 3FPCA 4O0LA 4BE9A 3E9QA 4H6WA 1HC7A 1AF7A 3V6LA 5JAUA 3W5DA 4L4RA 5ESDA 3EPPA 2HLHA 4Q24A 5EOVA 5KYUB 1CWUA 4JT9A 4O1IA 3FJ1A 1FC0A 4NYMR 4TGLA 1NXXA 3RLFA 3OICA 2GXAA 3WTCA 5JXGA 3M1AA 4OSOA 4GIBA 1G4HA 3FUVA 1L4MA 1LNQA 1DJQA 1A4XA 2QUBA 2ECPA 4ZVQA 4BN4A 1ZR4A 3NHBA 2E6KA 4IHJF 3OTWA 4TWZA 1HV8A 1H2YA 5EY5B 4AG3A 2G09A 4BN0A 1AQIA 3BFJA 3L46A 4CCYB 3W2IA 2F1KA 3SBEA 3NH6A 3FM9A 3JQQA 1BW9A 3WL7A 1Z5UA 4MI9A 5ITSA 2FE4A 3I28A 3Q7TA 2E2WA 3R7WA 3W8RA 3VISA 1XQ9A 1OBVA 1U28C 5CEJA 4CEIA 5JXWA 1OZGA 3ANMA 3P2KA 2X0RA 3ADPA 1QYWA 1RQ7A 2HUPA 4W1SA 5CEFA 3UVEA 1O97C 3DD5A 4XR4A 3MPOA 3RS4A 1KO8A 4KFTA 1Z33A 4MYHA 1NC3A 4O2AB 1WDKA 4OG2A 3QEMA 4FZ5A 4P3OA 1R6TA 3GUYA 5D1HA 2W70A 5KCZA 3EXG2 2B35A 1NMQA 1GVHA 2R8RA 2W37A 1DJPA 1OI4A 1JJAA 1XYYA 4GR9A 1WPGA 1HM5A 3EGXB 4HEJA 4Y2YA 1E7YA 4JT2A 5HTKA 3TOSA 3TUJC 5IT0A 4R1SA 4OYLA 3VH2A 3Q6MA 1TTQB 4KMMA 1VG1A 4C5CA 4I4TB 1V11B 4KRYA 1KPIA 3M4ZA 2CYCA 5I7VA 4JIMA 2QX7A 2R44A 1Y6JA 3UHFA 2QUZA 3ET4A 4CUZA 3QLUA 1O6GA 5LP6C 5TMPA 4CF5A 2ES4A 1SG9A 4QYIA 1KBOA 5P21A 2HR1A 4LC0A 2UZ0A 3H11A 4XM2A 5A3QA 1O8BA 4DXAA 3EY9A 3ZDYB 2EP8A 1COZA 5KNBH 1SAYA 1CPYA 2C2MA 1QNFA 3CV3A 4ZARA 1F0NA 2HO5A 4QGHA 4LQ4A 2O5RA 3RAEC 5FI5A 2P62A 4RX1A 2G04A 3TSCA 1E32A 4Y2QA 2C7RA 2FNAA 1PLKA 3ISJA 2WPNA 3GLHE 2PUTA 4XGNA 5GZ3A 1NVVQ 3U7HB 3R6GA 3TZEA 1CUSA 3K35A 3F74A 3VZQA 3VO9A 1TL7C 5TEWA 3DCIA 5AW0A 5B3LA 2FJPA 3ZE7A 3THYA 2RD2A 2Y2VA 3AWDA 1VE6A 1L1EA 3A6DA 1QWSA 2Y1OA 1WDWB 4TXJA 1HNNA 4V0NA 1J2UA 5HX7A 4P54A 3TMYA 5CHYA 3PYLA 3ECCA 1NGSA 1XDUA 2M2IA 3DEJA 3DBHA 1QF7A 1TVCA 2HC9A 5BWOA 3BD9A 3UK6A 1KDOA 1WXWA 3TJZA 1KFJB 5GTDA 2JEOA 3GDFA 5FTLA 1DP4A 1W8DA 4HFRA 2VDLB 3AHCA 4URFA 4MDHA 5CVEA 1M8KA 3OESA 4WCFA 1NAHA 4ZRDA 3RM3A 3T7CA 3UMGA 2UVPA 4C4XA 3RC8A 2JJYA 1H4QA 4UHCA 1DGQA 1SC1A 5LBTA 3UMVA 4QVIA 2E4WA 1KNQA 1R0YA 5CM8B 4I9UA 5L7YA 4EGQA 3G02A 3UYKA 5FA8A 5CUQA 3CX6A 4LISA 4W1PA 1KJ9A 2R1VB 3HXKA 3CYFA 4GP7A 4HGNA 4B8ZA 2WF7A 4N4AA 1Z08A 1NQAO 4DRZA 4IHJB 2H7XA 3O8RA 3KYIB 2UXDB 3IAM1 3EVBA 2PUGA 1YZKA 4CM9D 4UEKA 5ICMA 2OK8A 4HG2A 4BAZA 1GHTA 4TUYF 3IL2A 2O3SA 1A0OA 2WKQA 3DDWA 1DJNA 5DFAA 5CG2A 2XUFA 4BNWA 2MYUA 4PXSA 3NBUA 3DHYA 3O4JA 4MUIA 3IV9A 2IXEA 4AYXA 3EG9B 1WXDA 5ALUA 3KKOA 2VQ3A 3KQNA 3PDWA 3T9CA 4TWBA 4KMRA 1QO0D 1ZMXA 4KXFB 3OP1A 5JECA 2ZUBA 2GUGA 3EZNA 2IEYA 3EXG1 4LYHA 2IOHA 4F3YA 2WP0A 4XAQA 3U39A 2YWXA 5CYFA 4AKSA 4IXDA 3V8QA 4LZZA 3QU7A 1M2KA 5EUQB 1TZKA 1C3EA 1OFTA 3FE2A 1EHIA 1CJMA 4ZRNA 5T8KC 3RBAA 4YCCA 5HIAA 2JEZA 4UCXA 2X86A 3K6KA 4EDHA 4FC6A 1PJCA 3FB4A 2I2WA 2XJ4A 2B3DA 3LM8A 1V3VA 1LVUA 3OM9A 5L6LB 1CSEE 3GJ8A 4IIFA 4ZCPA 1QQ6A 2WSLA 2QMYA 3CVOA 3QYJA 5LZ5A 5CLJA 1GG5A 2VT3A 4FLEA 2NVUA 4HTAA 1EGAA 2DEUA 1Z0ZA 2OZPA 3NALA 1B8NA 1R2QA 2MSKA 1E9FA 1XL1A 2Y0CA 4QC2A 4OP1A 1RRVA 3LRTA 2A1UA 1DKMA 1S8AA 2N9UA 3GUZA 2D2XA 3OFVA 4LMAA 5ICCA 4Q19A 3KQTA 4K9MA 5JSZB 5H4HA 5P8WA 4BNZA 4M76B 1B1AA 4U7WA 3MJDA 2RGAA 1MF7A 4D5GA 5BMOA 3CNQS 4Q1CA 3DBRB 3IVGA 2UUAB 4OMDA 3BCSA 4NNPA 3UO8B 5MDHA 4FHGA 1QQ5A 4ZO8A 1EE9A 2CLIB 2FI1A 4ZI7F 2IYXA 1JMVA 4QUDA 2GHTA 1NU6A 4FQ8A 1ZNYA 5F73A 1C1DA 2OUKA 3KZCA 2BKLA 3DYBA 2J6BA 2GK6A 1UFRA 1X1DA 1CUAA 1CZKA 1U9YA 1WJGA 3D1JA 3FKSD 3F3YA 3JAMA 2XYGA 1T35A 3JR3A 3USZA 2JGDA 1RCUA 1TFUA 4HVTA 1E3DA 3KUUA 4OL9A 4J0IA 3LC7O 2XQKA 5E38A 2PJDA 2DUJA 4PLTA 2YVAA 2XVXA 2ZRDA 1C29B 2K7ZA 4OLHA 3ZOKA 4EZIA 3KPVA 3DTVA 2J9FA 5ULLA 1W88A 3V8BA 2JFUA 1M2JA 421PA 2PUAA 2PMDA 5J23A 2ODQA 4FILA 4LIPD 1E18A 1Z06A 4AP5A 5AJHA 3RSGA 4C2AA 2GFQA 1XTJA 2B4QA 3CIFA 3PKIA 4IQGA 3T61A 3I05A 3UXHA 2ZLBA 2ZYWX 3GZNB 4LTNA 3HLKA 5AICA 1GGNA 3P9YA 3GRPA 2O2YA 3PQ4A 1T4MA 4EF4A 2X58A 1LCIA 4WA7A 3DOCA 4JOQA 1ZGJA 4HWRA 1ZISA 3SICE 2WE8A 1D2HA 1R10A 2EZTA 1X87A 3B6KA 2AX3A 1VZ2A 1Q1AA 3CN7A 3PZBA 3SDBA 3ZWOA 2I67A 4FZRA 3EF0A 1S4MA 3PC8A 3M6IA 4FD2A 3RVRA 5KWEA 1UKBA 2DH6A 2EBWA 3THSA 4F9FA 5LYYA 3AEQA 3VR5H 4X64B 1L7BA 3SZLA 1SUIA 4QFDA 1A27A 1QYRA 3IUEA 2XAAA 3KO8A 2D7DA 1KYYA 4IDNA 1K3FA 3D7MA 4N6GA 2NO5A 4KI0A 3TG2A 4Z4FA 3II6X 3MPUA 5BWMA 4NG5A 2Y93A 2Q62A 2JD0A 2ZWPA 3PQ7A 5D84A 4E08A 1CZNA 3W78A 4DEXA 2QMOA 3TE6A 3B6IA 3K1AB 2G36A 2W58A 3BOSA 4H3KB 3HSSA 2H8GA 3GT4A 3O8BA 5HW0A 1KI7A 5BW4A 2CVHA 2C2GA 2JCSA 3WSTA 1QAQA 4RVFA 3G1WA 1HURA 3R9IA 2H4ZA 3W7AA 4WOCA 4JT4A 4F5ZA 1PAUA 2I2FA 1M6VA 2VHTA 4MW1A 3KQMA 1MO2A 2JGKA 2NU7B 4DADA 3LQRA 3I2HA 5JROA 4IIDA 2HXGA 2COKA 4Y1RB 3QSYA 1MVNA 2Q5FA 2ANCA 4BYMA 1EI9A 1FDIA 4EKYA 1XCPA 3FMOB 5FWYB 2Q1UA 2XTAA 2AEEA 4FDAA 3RW9A 1O54A 3G3EA 1NM5C 2IXGA 4OO3A 2I2XB 2BMFA 1T2NA 4GS5A 2D2IA 1AMOA 2C2OA 4P53A 1NLUA 4OJNA 4ZXFA 4NU5A 3TIGA 1QRTA 4LBWA 1GV0A 5EPOA 1T0HB 2YOHA 1Z4NA 2G71A 2XMZA 2O57A 1OTYA 3UK2A 2E48A 2DVMA 2WWFA 2B4AA 4B6SA 1A76A 4PCUA 4U9UA 2ZYUX 4ENVA 2DBQA 3WKAA 2CCKA 4WEQA 4UZEA 5KNCA 4ZI7B 1U11A 3OKFA 3PUKA 1XWWA 2AEJA 1LSSA 1QXSA 2PWBA 5FI0B 4KGDA 2B3TA 1T1EA 2IXTA 2H2IA 4OKNA 4RMGA 3TRFA 2NU6A 4B7XA 2ZQ5A 3P2IA 2PGOA 3STUA 2HSGA 3ZGZA 5FQOA 3OT1B 4J0GA 2PL5A 1I36A 3JTEA 3VSDA 3SE7A 3QE9Y 4K28A 4MROA 1XZNA 3PEEA 4KR6A 1ONSA 1Z39A 1TCCA 2PMEA 4BAUA 1QHFA 5B7GA 2Q21A 1N0UA 2PKRA 3OQMA 3KE9A 1J7KA 4M83A 2NYRA 1BGVA 2ZRJA 5CK4A 4ZDKA 1TQDA 4WKBA 2BGTA 3PYMA 2B2NA 2V5AA 2YY7A 3LCMA 2WTXA 5I7SA 2B2XA 5DYYA 1PU2A 4WZBB 4MZXA 4IKPA 3DW3X 4Y6LA 1RVV1 1Q1GA 3ICQB 4OQDA 1ZOPA 4B8YA 2IHZA 3H99A 4ND8A 4M8SA 1L7AA 2ZZMA 9MHTA 2V1UA 3MWLA 1PJ8A 1M2OA 1YMUA 1UK7A 1DRUA 2IYFA 3NWBA 3WGNA 4WWHA 1KE1A 1QFSA 4KX5A 1L5QA 1PQ4A 4QT0A 1MP0A 1BDJA 1P7WA 3GLGB 2Q46A 1RKUA 4ILEA 4NPHA 3DZCA 4JOBA 1NXTA 1Z38A 4P93A 3TFQA 4BX2A 3AHHA 4C7MA 4OXRA 1Z3IX 2ZSUA 4BATA 5FA6A 5J4HA 4FYHA 1AM4D 1P8AA 3GUHA 4QX6A 5CXXA 4TSKA 3T3PB 3VU9A 2NTNA 4G86A 2BI7A 3A4NA 5DCYA 4B4VA 5LOVA 4GR4A 3FOWA 1SXPA 3PXEA 3LBAA 4B6QA 2BEJA 5FWAA 1KVQA 2GZDA 3EPLA 3IE2A 3UGJA 5DEOA 4BRZA 1QVVA 1QGUA 1OCEA 2VK8A 1FXSA 2QN2A 4RGYA 2BI8A 3O5AA 4BE4A 1P2SA 4JI5B 1F1JA 1MU0A 1J09A 3L7MA 4IX1A 4BAGA 1C30B 1GCAA 2R1TB 4LWOA 1A96A 3NDBB 2J4CA 2G77B 1I13A 3M0EA 5EIBD 1UOQA 3RNOA 4DPMA 3FDIA 4NYIQ 4OSEA 2RI1A 3OFND 1SVKA 1KI2A 1UWCA 4JBYA 1F9EA 1ND5A 3I6ZA 4JJ8A 5FLYA 3W6PA 4EQ6A 4Y2SA 2D62A 4OP3A 2YXDA 5B6JA 1KO4A 1E1YA 1GTZA 3NOXA 2CXNA 1TJYA 3QGMA 4PNPA 4ZT4A 1X7WA 3ZIUA 3D4BA 1D3AA 3ZHZA 1T5SA 1E4YA 3NNNA 4E5VA 4LNUA 5KNDD 1UKVY 1X92A 3W0LB 4BNMA 2D8AA 1P9WA 3EVTA 2XKJE 2VTEA 1ZEMA 3SXPA 5JFGA 4DUYB 4WCVA 1QO7A 1SCIA 3NWEA 3VDRA 5J58A 5KWIA 4OHOA 4JC0A 1UJ5A 4D81A 3MJFA 2J0EA 5DCWA 4UAJA 1ZQ9A 2RGCA 4YJ2F 3BD8A 3QFSA 3F7OA 4KK3A 2XGGA 4F9TA 1U1CA 1G2QA 5ILQA 3DE4X 3AF2A 4HVAA 1V6CA 4CM1A 1N9GB 1GQOA 4Q4AA 1VGQA 1Z62A 3DEAA 3VPDA 5DP2A 1HT0A 3ZIAA 2VRBA 1ZGHA 2WPDA 4KWIA 4I9FA 2XV1A 1OAOA 3OUZA 1KZ6A 4EYGA 1RTKA 2FKAA 5EE5B 1HL7A 2R8XA 4EUNA 1EFCA 2RIRA 1BXGA 3LOPA 1DAIA 4LKOA 5IH7A 1P7ZA 1PVVA 2RKWA 4IV5A 4JMPA 3NOVA 1AZSC 3N0WA 4LJYA 3W77A 3VMFA 2K2QB 2YCBA 2ZPAA 4S3MA 2WAYA 3TR6A 3L3BA 2LXNA 2GAFA 3HO6A 4TM8A 4E03A 4C05A 1FP1D 1XALA 3NRJA 2YNMC 1B0AA 3K8ZA 2J5KA 1E1KA 2XOXA 1DXQA 1FFSA 1JQ5A 5AHRA 3WRXC 3PVCA 1KWKA 4NBUA 1H5UA 3GRVA 2GN8A 2WJWA 4FR2A 2KB0A 1PNVA 2Y2UA 3O3MB 5GIPE 1IOWA 4B4WA 3I45A 3RHFA 1RYYA 1JBQA 2HRZA 4N5IX 4YWHA 4PHFA 4RJKA 3ZS8A 4DRXB 4NCJA 2Q1XA 3VBCA 5JVDA 1QZTA 1RJFA 2G4LA 5JISA 1AUPA 5LP6B 1X8LA 2IY7A 2XVMA 3PFNA 1OIVA 3C3MA 3CURA 3W6NA 4ENPA 1L4HA 4O1MA 1CERA 1MGPA 2R65A 3KUKA 5CH5A 1GXSB 3D3KA 3DZJA 3TECE 1GTVA 4HNRA 4KE8A 5JXJA 3G23A 2JLQA 5SY9A 1JQJC 1ZRNA 4EFMA 2Z8XA 3FFWA 1TQ8A 2WUFA 5D3MB 3SBDA 5EJ4A 2AT1A 2PAFA 2J3MA 3Q3VA 4KLZA 2E55A 3URKA 3QVJA 5A05A 4LF6B 2IE0A 3DO8A 1G2PA 1E79A 4CE6A 4EZBA 3HK2A 1Z5NA 3F9IA 4M98A 1QHGA 4QU8A 3L8GA 3R7BA 4MRSA 4IQ0A 3I83A 3B5EA 1IWBB 3ZHXA 1XLWA 4BRSA 2H54A 2WTUA 3G7UA 2WD8A 3BZBA 5MHTA 2JG3A 2JLVA 2P2NA 2ZCVA 3HI6A 4HLUC 1WDLA 4RSGA 5DXJA 4E33A 4HPWA 3FTCA 1Y3CE 4LOHA 2JJ2D 2ZJFA 4CHTA 4IVRA 1DG3A 3K9GA 3RYCB 1M67A 1UPAA 2DM6A 3CCFA 3JWJA 3W5IA 3GO4A 1TTTA 4YROA 3THOA 1P2VA 4JOSA 4CM4B 1UT6A 3H5TA 1UZNA 3IBFA 5TRTA 4DAOA 3QNWA 2CDNA 4LHVA 4Q48A 1GTMA 4XUEA 4TTJA 1XRNA 4JLUA 2FQYA 4PLFA 3GLUA 3TSOA 2V0CA 4C3ZA 4D96A 1X7XA 2BEVB 2CLSA 4MQ6A 5FJJA 2YXBA 3B6EA 2YV4A 1G3RA 2C2HA 3QFRA 4JB0A 3W4KA 4M6WB 3D7SA 1C7FA 1CZHA 4MLZA 4Y6PA 4G5RA 2RC5A 3AEKA 2H7VA 5HE8A 1TEHA 4YJ2B 3TBKA 4BGDA 2UU9B 3R1IA 3BK1A 2WIGA 5GGYA 3GEBA 1LDMA 3BA1A 5GAJA 3WKCA 3FMVA 2G07A 3WLTA 2CLCX 4F38A 5JZBA 4K6GA 1XQYA 2CV0A 3EH1A 2ZRBA 4FXPA 3FNIA 2IX9A 3K0EA 5FBKA 1RVDA 1J49A 3JQ8B 4DLRA 1EEXB 1XXHB 4RA9B 4PONA 1ZC4A 3A6EA 3V1TC 1CUDA 2Y1XA 2R6R1 3QX9A 1U9CA 2BRUC 2Y1CA 1HDRA 3GARA 4N82A 2I6UA 5HTOA 2PMFA 4N12A 1XFDA 3JASB 1M7HA 3MB5A 3JYNA 5AIAA 3KSRA 2DWPA 1GRNA 1USUA 3DOIA 1RJDA 3KXKA 1JZQA 4RXMA 2OCPA 3CLRC 3WBBA 4UHDA 3TTYA 4PGAA 3HZHA 1EFVB 3I6YA 4UDYX 1SVIA 5BN5B 1U0HC 1VOTA 1YS7A 3V8VA 3Q8MA 4JR1A 4LF4B 1COWA 4B46A 1WVGA 4IUBS 1XHEA 5E9JA 5FPPA 3WV4A 3UH0A 2EFHB 3RRMA 2GPAA 3T94A 4LYGA 2H18A 4B3IA 3ORQA 2W48A 1GG9A 3DHNA 2O19A 4QICA 4R1QA 2IBSA 4MV6A 2RJ3A 3WTBA 5LYJF 3VPXA 3IAS6 3WFZA 4KEAA 3RU3A 1W52X 3K71B 1AA9A 1NIPA 1NI5A 2QW8A 4WJZA 2X1VA 1DELA 4J16A 3DZBA 4FHDA 3AVPA 2J3QA 4IIXA 2H1VA 4Q3DA 4QQNA 3UXYA 3I6MA 3ND7A 2SCUA 4UE3S 1DPGA 1NX6A 2EJWA 2A9KA 4TXNA 3DYIA 3G2LA 2YIVX 3O4VA 1MV5A 2VXBA 1GNQA 5FBQB 1DAPA 1G18A 4R8VA 3LY7A 2R79A 4WNCA 4GE3A 3ROMA 1BG6A 1ORTA 3L8CA 5AOBA 4H1TA 5K45A 3GA5A 1NQOA 4GSLA 4BUZA 4MARA 1TQ4A 1YKFA 4JEMA 2WIJA 5HKKD 5J4VA 3M6VA 2OGTA 1PR1A 3WYBA 3PJRA 3WNVA 2FWMX 1N3YA 2PMCA 5EWLA 1SBZA 5FO1A 4AMUA 4DFDA 1TJPB 5AW8A 1E9EA 3QVKA 4U7JA 3L4BA 5FEMA 3KCNA 3L7CA 5F21A 4UBIA 1A8QA 3PEUA 4YX9A 5K7SA 3ADBA 1J00A 4MR7B 1YCDA 2WWHA 4E0BA 1B16A 3HBMA 4J1QA 3EUFA 3K0KA 1V0JA 2GK4A 4US0R 2R3SA 5DHAA 3KQYA 1PDVA 1DXHA 2I7VA 3CZ5A 4FMBB 4BQOA 1M7BA 1S01A 1Z0SA 5CDGA 2NT3A 2I29A 5BWCA 1H9CA 3HEAA 4HX5A 2WWXA 1QHHA 3RRJA 2JB9A 5TEVA 4Q9KA 2CXTA 3QXGA 4CXMA 4DREA 1F60A 1QVWA 2BEWB 2GHQA 2VJCA 3HP7A 5AXCA 4NJOA 1I30A 1V7CA 2PS9A 1TU0A 2RK6A 3ED5A 2GK7A 3GT0A 3RAJA 4C0SA 1PZGA 1RXUA 3MRSA 3VKGA 1Z2OX 4M7WA 4ZK2A 1CKEA 3MQ2A 5C8YA 1VIMA 5KVVA 1GARA 4YLEA 2QSYA 3AZPA 3CEPB 4ZYUA 4AG5A 5M34A 1ISSA 1CYDA 1N3IA 2XEDA 1Q1NA 3K09C 3VOTA 2VATA 4UQLA 2ZSIA 1KXJA 1FVXA 1Y48E 4MO9A 2DR2A 3NBAA 3ESBA 2JIZA 4D42A 3AUAA 3KOMA 5EQJB 3KKZA 4A2CA 1NF9A 4BFLA 1T5OA 1ZN7A 1DXOA 1TJ3A 3KL4A 4PFJA 1V39A 1XDBA 4PPNA 3L04A 4P6VF 4D9BA 4L9RA 4ZDJA 3E4DA 4RE5A 1CIJA 1CNFA 1F6WA 3CKLA 4FXOA 4AJNA 4B6GA 4C89A 2FN7A 4D1YA 1DXYA 2AFRA 4YCMA 2DFVA 5DNAA 5TS3A 1SHZA 4PSUA 3E05A 3HFGA 1I2ZA 1XOIA 2AUNA 3RUDA 1MAUA 2YS6A 4J4BA 1VMDA 1WR8A 1QP0A 2HDWA 3UQYS 1MNAA 3I6BA 1GPKA 2Q3EA 3MLEA 1TLTA 1YJQA 4E2XA 5CB8A 2C42A 4IVNA 1E59A 2H0RA 1JG2A 5CW1A 3HCEA 4CIBA 5LYJB 4A15A 1W2GA 3MSCA 4XKJA 1H4TA 2VNSA 3G8DA 2G76A 1D9ZA 3M82A 2DECA 2GASA 3MRTA 4NH0A 5EEHA 4F96A 3GPLA 1FVOA 2ORYA 3UTCA 3FCYA 1NQWA 1W48A 1HFJA 5DM0A 2MU1A 5CH8A 1I3CA 3PC3A 4J76A 1P1IA 4MGEA 1Z12A 5HFNA 3QJYA 1HNXB 2HAEA 4NENA 1KOGA 3ZWDA 4GDFA 3AIKA 3PFBA 4E51A 1DIOB 3IVRA 3NFYA 3F3SA 4TWJA 3R75A 1NXVA 5TXGA 3BFVA 2C04A 4HDSB 4TTVA 4G5HA 1CC1S 4ZOAA 1IB6A 1XPRA 4DR6B 4OMCA 4KQMA 1MX1A 3M4NA 3P2MA 4RIIA 5FUQA 2F55A 4QDOA 2C78A 2XMCA 2XJ9A 1UQTA 5MFZA 2J87A 2PFKA 2DUWA 2G25A 1KOLA 5E3IA 1GG8A 1JR3D 1K8ZB 1PP4A 2CMHA 2R6FA 4QGSA 1Y8AA 3AF0A 3PHCA 4YCBA 3WADA 4ZDIA 1I3NA 1VHJA 2G83A 3NBKA 1DL5A 1HO3A 1B23P 1ZM2A 3N28A 3VNAA 4PVDA 3H17A 5GM1A 2YQ5A 4JYCA 2MINB 2QAIA 4EB3A 1UKYA 5BWLA 4N3GA 4UM8B 1FW8A 2OZEA 3J80A 5EZ6B 3KBOA 4KIJA 1AHPA 1RXIA 2Q4RA 2WSBA 2ZWIA 1GKKA 3L0PA 1N5OX 5LQNA 1IONA 1DX4A 3JX9A 4XB6B 4LS3A 3ELDA 1C80A 1K89A 1I5OA 3IJ5A 3U3XA 3OKCA 1QV7A 3KHUA 2XADA 1UPXA 4JH0A 3EY4A 4UM5A 4B8WA 2CHGA 1ZSVA 1W9HA 3TL6A 4BNUA 2WUEA 1SC3A 2QWXA 2WHRA 3IEPA 2NWQA 4S2UA 4ETWA 4R8SA 5H3CA 5A5GA 2IYRA 1EBFA 4MUEA 4HJXA 3IBYA 3GCXA 1ZH8A 1JDZA 4W63A 3S8EA 4XI9A 5C1OA 1XMVA 3R5HA 1HYQA 2I03A 5D3ZA 2ZM5A 3Q8XB 5ECGC 3SK0A 1UBNA 2OB1A 2WFZA 3MWFA 4MP6A 3W79A 5L4SA 2Z6QA 2ZSHA 1JSRA 4WK4B 4A7PA 1NQXA 5HQ3A 1N7JA 1N8KA 1BXKA 1U8ZA 1KFBB 2VHVA 2WWTA 2V54A 4P86A 4WNAA 3UANA 3WGHA 1UM9B 1ECGA 1G4UR 3FCUB 4F9GA 3KIPA 4JI8B 4UEQA 2FPMA 2J85A 4X8MA 2E87A 3MSXA 1ZM9A 1NJ5A 2YIDA 3G0DA 4UQPA 2NQ8A 2D7CA 2LVBA 3L5KA 3OQHA 1B26A 3IXLA 1T8PA 1Z2EA 4I36A 5D7NA 5EFOA 1JT9A 4IIEA 2BONA 2O8EB 1VP3A 1P39A 3FETA 1WCIB 2MMGA 4YRBA 2QS9A 4EJSA 1LDYA 3ZLJA 2O2IA 1TU3A 2L82A 3OJWA 3QPCA 4W1QA 3FNEA 5JPIA 4REQB 4ED9A 2OP0A 1E62A 3BGSA 3VU8A 2ZJOA 3EYWA 2FFQA 2AI1A 3JQFA 3L84A 3TTWA 4RBNA 2HK8A 4AT1A 4BFZA 4UAUA 1IHXA 2DF8A 2JAWA 1ZIPA 1I0ZA 2NUTB 3U3MA 1KC1A 4D57A 2SECE 4YP7A 2ZJ1A 4KOEC 3DKPA 1T2UA 2CFSA 3RWOA 4JEUA 3FR8A 1QKKA 3WYDA 3WYFA 1S2GA 2OWDA 4UU0A 1A9RA 4FPXA 1DUVG 1WPRA 3OZXA 4RPCA 3HNOA 3ZTTA 1JS1X 3U3ZA 5CDTA 4RXUA 1J0EA 3SQOA 2FDCA 2EIHA 1RWVA 3EQZA 3NHAA 4U4AA 4AMVA 3CZ9A 4EHFA 4HDOB 3KQKA 3FVTA 3NU1A 3JRXA 1HDIA 1X1CA 5FUXA 3AFMA 2CBGA 2BFOA 4DSAA 1M66A 1FNSA 1ORWA 2CVFA 3DVQX 3PX3A 1EHCA 1KYQA 1HORA 1JAIA 3H1EA 2GN0A 4R9VA 3UUFA 3HJFA 1NUHA 1W46A 3AB7A 4XQ0A 1Z4QA 3IMEA 4LOJA 3T3IA 7YASA 2QQGA 3QEJA 1T6YA 2RAPA 2VOJA 1WVIA 1QM5A 2VP6A 1PFYA 3E35A 1NYQA 3MCVA 4XUCA 3ER9A 3AHJA 2W2KA 3LX5A 4EITA 4J90A 4DA8A 2CJXA 4CLOA 4X3CA 4PLGA 4BZQA 2WR8A 4YO8A 3TYXA 2Q1WA 2WOOA 2JBAA 3NOQA 4XIIA 1JDPA 4D46A 1RXVA 1OVGA 4KJZA 4CM9A 4ZZ1A 5AJVB 4BPBA 2I3GA 3HXTA 1GAEO 5ADWA 3V4LA 4RJTA 5I3CA 5COAA 1UAGA 2ZJ2A 4V0KA 3VHQA 3X1ZA 3ZU6A 4KV9A 2F48A 2MYTA 2O1SA 4RJ2A 4D8YA 5BSEA 4AY2A 1BU8A 4C29A 5AKIA 3IRVA 3SF8B 1JH8A 4AUMA 4Q12A 5K8LA 3AHFA 4R2LA 5HS6A 4YLGA 2ZDHA 4KPFC 5PGMA 1QO0A 1FU4A 1NBHA 1RWXA 5DOZA 4DIFA 3H18A 2UYYA 4JJ6A 3L9WA 2A67A 1GZ5A 1AUOA 3OQJA 4E5PA 1RXCA 4U2EA 5ADHA 1KP2A 3RJZA 5DGTA 4R69A 3EMKA 1SXJC 4PN3A 4U0JA 1OX6A 1D5WA 2WSIA 3BMOB 3QE0A 3ZK8A 1Y7TA 3JD3A 3LWBA 3NDJA 4LX0A 3MFQA 3QNUA 4RK1A 1YU6A 1I1QB 1ZSNA 2HJSA 2BIFA 3EC7A 3MWDB 1AHNA 2ZB8A 4JLJA 1XRJA 2G17A 3RC9A 2XE7A 4RLQA 1W6UA 1ZICA 2FPIA 2P11A 1FRFS 2YYYA 4FEGA 4DV1B 1UADA 5E4YA 4GEKA 2LR0A 4EDFA 4FCCA 4GXRA 3AJDA 4W8HA 4BKPA 5H82A 4R7TA 1SCBA 1TZMA 3SFTA 4DLTA 1A9QA 4CU2A 1LW6E 4IVPA 4AZ3A 2XBUA 1R5OA 4MICA 1VI6A 4P4SA 2C9BA 4OLAA 1SXHA 2VUTA 1UJ2A 2AVDA 2ZULA 3OLXA 1VLHA 3NBQA 1M2HA 1E20A 1PT8A 3EVZA 3I2YX 1UBTS 3OJ0A 4RZUA 3V1KA 3RS3A 2C7OA 4AF7A 4EY3A 4HDRA 4X1KB 1HLGA 1KEUA 3LAWA 4MS4B 1C3OB 1FYEA 3V7NA 1LW7A 1G5RA 1HDOA 1OGYA 1PWXA 5K3EA 1NMZA 2OXRA 1XGKA 1VL2A 1DJOA 1T13A 1YCHA 3KJNA 1B6RA 4WZBE 4OHZA 2FZCA 3V48A 4ERXA 4QRHA 3AFHA 1KR2A 1O9HA 1NKTA 4OLJA 3OEWA 4DV6B 5SZKB 2Z4RA 3T3HA 1LK7A 1TM2A 2OD2A 1PG0A 3K53A 3N8KA 3G17A 1QUFA 4LNHA 4CDGA 3FKSA 3KEMA 5AD1A 3GLGE 4AURA 3RVPA 1MFPA 3L7KA 1U0TA 3WFJA 2GNPA 1PL7A 1GVNB 2IPOA 4LZJA 2OT3B 2CL7X 4ZO7A 3AOEA 5AJZA 4NESA 3RRXA 1TZJA 3EIOA 3JVIA 3OZSA 1HEIA 4IMRA 4YMVA 3L7IA 3W7VA 3C43A 1Z29A 5EPUA 5FLKA 4GYKA 3I09A 3GC6A 4E5NA 3B1ZA 4GBJA 3W2HA 2Y1LA 4N40A 3RYHB 4O4JA 2H1HA 3LUFA 2PNFA 3GP8A 1V2HE 3CISA 1I10A 3JRNA 1K86A 3BE8A 3H84A 5FCDA 3A9VA 1UFKA 2WVHA 3OOHA 5DYIA 1EM8B 3O8OA 2JEYA 4X5OA 1DEKA 5FUMA 1KAEA 2E85A 4GL2A 3C7AA 4CFSA 4XW2A 1M10A 4I5GA 4AM8A 2Z95A 3RSQA 3BHNA 1A4IA 2NZWA 1QH9A 1T5IA 4X97A 2B8EA 4XTCS 3U49A 1DB3A 2FP3A 5F5LA 5I48A 4LF5B 3ND9A 2WHXA 4I9GA 4Y9UA 3GLSA 4D43A 3DFFA 3KJFA 2XNJA 5E6UB 2CD7A 1PYOA 2ZU0C 3Q5GA 3TX6A 5CA1F 1NW8A 3W9YA 3OZDA 2R5FA 1FDRA 3OIYA 1JDVA 3ANNA 2AC2A 3CRVA 4WUVA 3S6JA 3VI4B 1QF6A 4FE4A 1E5LA 1ESMA 1W47A 2PBZA 4PCLA 1ZI6A 4Q4CA 1ZONA 1GP2A 2NSLA 4RJIA 1TGYA 2IHYA 4HH0A 5A3SA 4EVRA 1N33B 1HFEL 4LRYA 1C1XB 1UZLA 1VBFA 4PF1A 4RIEA 2ZIXA 3FGOA 2RKBA 4YH1A 1TQHA 4CTNA 5BSVA 3ML1A 3Q5EA 4K6KA 1PX2A 2AEFA 4O4LA 2EVWX 1HRKA 3MC1A 3FI9A 2R9VA 3W2GA 4DM3A 4LXXA 1P4JA 4PSVA 2PH1A 4FCTA 2E0IA 1GL9B 3B3JA 3PFGA 1MJ5A 3PCRB 2C7QA 2W00A 1FNDA 4NF2A 1A9XB 1FDUA 1US8A 1H69A 3BC1A 3WIDA 2XKBA 1G17A 4N0PA 3RTAA 1M1NA 2P9BA 4JELA 4P82A 1I1OA 4L0MA 5AQ1A 3KEGA 3RT7A 1S96A 4Q9LA 3AWIA 4AMYA 2Z9BA 4EYQA 3ASUA 3N5CA 3SC3A 1A8SA 2IP1A 1TCAA 2N3ZA 4WKPA 4ASUD 1W49A 5M04A 3L4JA 3KV3O 1AKTA 4PYJA 1II8A 1NJGA 1O95C 5B3KA 1PLJA 3BWXA 4BKMA 1B2RA 5TPWB 2F59A 4P3XA 3Q4GA 1NI4B 4M1TA 3CU5A 2IIPA 4EGCB 1XN1A 1IXSB 2ZBEA 3H4TA 1IB0A 1DCMA 4IO1A 2IEGA 4JKOA 1N2CB 4DQDA 1DWQA 3QIVA 2XQVA 3ZDAA 2G9VA 3NYQA 2VSXA 1UFVA 3DH0A 3U1VA 4B9EA 1VKOA 5TMEA 5CPFA 3ZDFA 3SFVA 3PT5A 4NMHA 1ZN9A 3LL4A 3Q9SA 1J0DA 2QPTA 1ZL2A 3SS9X 1LF0A 3IP6A 4EFKA 3H5RA 2C9YA 3LFUA 1CZOA 1QS0A 1T8UA 2AUTA 2VG8A 2F00A 1NSYA 5AI0A 4O3MA 5F1OA 4J03A 3L7LA 3WK8A 4BO8A 3QHPA 1UQUA 1Y3AA 4I1YA 3S1AA 4E2ZA 5KSOA 1A95A 3EH2A 2IHKA 4UHEA 2XMRA 3HUFA 3QJ5A 4OQEA 3IDAA 1U0NA 1CNMA 4BYGA 2IZ6A 4AL4A 4BFWA 3DVAA 3TSYA 3L8FA 4JL6A 1U99A 4LOKA 3ENWA 4I3HA 3EWIA 4MX8A 3VMMA 1J1IA 1BVRA 3O4FA 2JLAA 1NASA 1ZIDA 4IP0A 1JIIA 1NQUA 4MRRA 4QDTA 5JASA 4DNXA 1BNCA 3AFOA 1E2EA 3QE2A 1PKXA 5JPDA 3TSAA 2XUIA 2WHYA 5ALPA 3C5VA