3WSVA

Crystal structure of minor l-lactate dehydrogenase from enterococcus mundtii in the ligands-unbound form
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
312
Chain Sequence
MKKTSRKVVIVGTGFVGTSIAYAMINQGVANELVLIDVNQEKAEGLDGMAWGEKNVSVWSGTYEECQDANLVILTAGVNQKPGQTRLDLVKTNATITRQIVKEVMASGFDGIFVVASNPVDILTYLTWQESGLPASRVVGTGTTLDTTRFRKEIALKLAVDPRSVHGYILGEHGDSEVAAWSHTTVGGKPIMEYVEKDHRLEENDLTVLADKVKNAAYEIIDRKKATYYGIGMSTTRIVKAILNNEQAVLPVSAYLNGEYGEEDIFTGVPSIVDENGVREIIDLSITPQEKAMFHQSVSELKAVLDTVRLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An alternative allosteric regulation mechanism of an acidophilic l-lactate dehydrogenase from Enterococcus mundtii 15-1A
doi rcsb
source organism Enterococcus mundtii
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
total genus 100
structure length 312
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wsvA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3wsvA02
4BNKA 5I9MA 3AJRA 5TC4A 1WZEA 3KTDA 2OBNA 3PQDA 3RKUA 5DNAA 1ZMTA 1LI4A 3ZHXA 5G0VA 4UULA 1N9GA 4W7HA 4MP6A 3WG9A 2VRBA 1ZSVA 2LDBA 4BNFA 4E0BA 4E3ZA 1CEQA 4RVUA 2Y1FA 4GKVA 3JQAA 4EEZA 3LC7O 4NK5A 3SJUA 4BNMA 1BSVA 1J4AA 2PGJA 1ZK3A 5TX7A 2WSBA 4J91A 4UAGA 4UUNA 4BO7A 2ZATA 1VL6A 2XF8A 1XQ6A 3JYNA 4R54A 1B8PA 1RYEA 1UZMA 1CWUA 3G1TA 1EVIA 1GEEA 3H3JA 2Z1MA 4CM9A 4B8WA 1AE1A 1YDWA 3K30A 2Y0CA 3T4XA 5KCZA 4YQZA 3W6ZA 2HCTA 1K6XA 2VRCA 4TWRA 4MDHA 3JQBA 4UUPA 2DC1A 3OMLA 1DC4A 1A4UA 2ZQYA 5AXAA 4ZU3A 2ZYDA 3DWFA 1HLDA 3GDFA 2GCGA 3ROMA 4D44A 5ER6A 1UAGA 1PJ2A 4BNXA 1MG5A 3C1OA 2C0CA 5A9SB 3QP9A 5TRTA 2QZ9A 3AOEA 2DUUA 4XR9A 4M49A 4MVJA 2B83A 1JWBB 1GD1O 1HZZA 4CLRA 2YFHA 3ZHBA 1E1MA 1ENZA 2FR1A 5DBGA 3ZWWA 5IFLA 4E31A 5IZ4A 5KJCA 3U4HA 3RKRA 4Q3NA 3ZN2A 4RPGA 3JQCA 1C1DA 3B20A 4TZTA 3IMFA 3PWKA 3F46A 2NU9A 1XWFA 1D3AA 3JQFC 3OQBA 3UHAA 1DRUA 3Q0EA 3M1LA 4GMGA 3EY4A 3WQQA 2YHIB 1H0KA 5EQFA 1LNQA 2FN7A 3NYWA 4PG7A 5A1TA 3IP1A 4L9RA 3WGQA 3BTUA 3TFQA 3GH3A 3PJGA 2HU2A 3FR8A 3RUCA 3UCXA 5A5EA 4IUYA 2W4QA 2BLLA 4BO5A 2ZQZA 4GAEA 2YW9A 1HE5A 3PJDA 5DOVA 9LDTA 4CM9D 3WJ7A 3OHSX 1W4ZA 3LT1A 4E12A 5FYDA 4BGIA 1TI7A 5DP2A 3WFJA 1HDXA 3I9OA 4BNIA 4DBVO 3L4SO 4WNIA 4FB5A 3VZPA 3ZU4A 4IJVA 2VN8A 4P4GA 3KOUA 5EINA 1NQTA 2HQ1A 3BMNB 2YZ7A 1KEUA 3DBRB 3GAZA 4I5GA 2UUOA 3JQ9A 2FRDA 2DFVA 4K6FA 1E3WA 2CY0A 3GC6A 4I5EA 1S7CA 3V2HA 2GRAA 4YJFB 2ILTA 2J3JA 4PLZA 1LA2A 1MXHA 1AXEA 3EYWA 5F3RA 3DMYA 3HN2A 3TL3A 1JU9A 4LISA 4O6VA 1IOLA 1BXGA 4YJHA 4RZIA 1EK5A 3JQBC 5DT9A 1EE9A 4NR0A 3I5MA 1ZXBA 3WWZA 1PGPA 3D3WA 4Q39A 3ZWBA 3KXDA 1LDYA 4F6CA 2AEJA 3LT4A 2NTJA 1WMBA 2FOIA 3D0OA 3DZFA 3QWIA 2JL1A 3AU8A 3D4OA 5J23A 3OICA 4HFMA 2D1YA 1CF2O 1DAOA 3H9JA 4ALKA 4DBZA 5G0TA 5F21A 4FSHA 1A71A 2ZK7A 3ZDFA 1Q0LA 1XKQA 3RC9A 3QLJA 2R00C 4IMPA 5ES3A 1ZK2A 1MA0A 5F1OA 1WPQA 3TWOA 1F06A 1NPDA 1XCBA 4IM7A 3W8FA 1OAAA 1ZUD1 3DOJA 5FWNA 4QEDA 1ID1A 3NEPX 3QY9A 4PGFA 2Y67A 4Q3BA 3IJRA 2SCUA 1DC6A 1YB4A 3OECA 1LDMA 2C5EA 4DXHA 2JHGA 2EJWA 4XDZA 2EWMA 4DC0A 3PHHA 3CSDA 1IHYA 3I9NA 1FDUA 5JCXA 1YBMA 1HYEA 2FP4A 5IDXA 2I3GA 2W2LD 2JAPA 4RZHA 3SX2A 2HUNA 2NM0A 4ZICA 3QVWA 4YB8A 2VHZA 4QUKA 1GUYA 4IDCA 4NBUA 3W8EA 2JFFA 2VHVA 4PLWA 3U4CA 2X0JA 1NHGA 1ADBA 3GPDG 1IUKA 2HMTA 3DL2A 1H2HA 5DBIA 4PN3A 1NQAO 1IB6A 4EUFA 1FDSA 1QYXA 3PVZA 3VH1A 2NLOA 2VWHA 2FPIA 2Q2VA 5A04A 1B8UA 3TOZA 4YR9A 4AJKA 1IY8A 4NIMA 3FHLA 2OL4A 4XYLA 3FRJA 1QXSA 4I5DA 1Z6ZA 5JYDA 1EUDA 4CMGA 3UF0A 4JP3A 3QWHA 5IJZA 2QW8A 3DZBA 4D42A 4J1NA 4J16A 2DKNA 1PZEA 3KSZO 1HL3A 4YAEA 1PL7A 4E2ZA 1FMCA 1AHHA 2UAGA 4P4LA 1XU7A 2PH5A 3DHNA 2WTBA 4Q3CA 2HK7A 1G1AA 1F8GA 5TQVA 2ZB8A 2VHWA 1KVTA 1U3UA 4KDEA 4XRRA 2YHIA 3E9NA 1B3RA 4NI5A 4WCFA 4PRLA 5H82A 4LK3A 4NK4A 1Z75A 4B7CA 4RF5A 4R9SA 2ZCVA 4YDRA 5H83A 1B0AA 1P45A 2X9VA 3GVCA 3FNEA 3H7AA 4U8GA 1I30A 3KM0A 1HDRA 1KY4A 2EW2A 2JFGA 3BMQA 1O9BA 4DRYA 2GERA 5B37A 4IJWA 4E5YA 4OXKA 4CMCA 2ZB4A 5DCYA 1X7GA 1YH3A 5IN5A 4QO7A 4GVXA 4O0LA 3GNQA 3HFSA 4AJOA 4BNWA 3KYDB 2HMWA 3WDSA 2EP5A 4RDIA 4ZA2A 3MJTA 1EVZA 2P9GA 5KVQA 1TVEA 3GGGA 4RGBA 4J4TA 3PI7A 1H6BA 1TEHA 3DXFA 2CVOA 3K2BA 3AUUA 3TZQA 1WDMA 1LEHA 2ZJ1A 4Y8VA 4W99A 2OOSA 4DVJA 1E7RA 1ENOA 1JLLA 3ANMA 2RH8A 3BXXA 3V1YA 3UH1A 1MG0A 3UN1A 2BFOA 3QVSA 3B6ZA 3VZSA 3PTZA 1M6WA 3C1TA 3OSUA 1LUAA 3KYDA 3A06A 4DA9A 4DC1A 4FCCA 5LCXA 3LU1A 4A03A 3JD3A 4DIBA 4N5LA 2A9FA 1LLDA 3DDNA 1L7DA 1DO8A 3KLPX 3ICPA 4BNTA 4CV3A 3IUSA 5JS6A 3ZH2A 2VZ9A 4PVDA 4CM6A 1SB9A 3NDRA 4JBIA 4W6ZA 3VPFA 2AMFA 4CL3A 4EW6A 1QYDA 1LQUA 2V6GA 1YBVA 5AQ1A 3TF5A 4EYEA 1DLJA 1IPFA 3FNFA 4L4RA 5BSEA 1EUZA 4D43A 1V9LA 2CUKA 3ST7A 1GYQA 4R1TA 4D79A 1DIGA 2ZJ0A 3KSUA 1FF9A 3OJFA 3MJCA 1U4SA 5IXYA 1ISHA 4QSMA 1TT5B 1PQPA 3VKVA 1WXDA 4Q3EA 1CQJA 2ZYGA 3OETA 5TT0A 1O0SA 8ADHA 5KJ1A 4DPMA 5KVSA 3AK4A 1EBFA 1WNTA 3VVCA 5KVCA 1P1JA 2WE7A 3UCEA 2OUIA 4K1LA 3FWNA 1M76A 1P1KA 1L7EA 4R41A 4Y98A 3U09A 2IEDA 3H5RA 4J9VA 1U3WA 3U4IA 4MVJI 5COAA 4B4VA 4BQPA 4DMLA 5LC1A 1DHTA 2JFHA 4BV8A 1PJBA 2DBRA 1DIRA 1R0LA 1CJCA 1R0KA 4YJGB 2VOJA 4RPHA 4PG5A 1O8CA 3AW9A 3GY0A 3DZKA 4OSOA 4PRKA 4CM4B 3ASVA 5IZCA 3DB2A 2W2LA 3KUXA 3S1LA 5K6AC 4PLGA 2V6BA 5L7TA 4BS9A 4IDBA 3LT2A 4R5HA 4WUVA 3L07A 1R15A 3E82A 4PZEA 4BQRA 4QTZA 3WGOA 1NM5A 2BFAA 1KVUA 4QECA 3CMCO 4IINA 5JNLA 4C7KA 1P1IA 4J49A 3VTZA 4PLTA 3RROA 2GZ2A 1DFIA 2YV3A 3O03A 4R4JA 3RCBA 4WCFB 1C0IA 4HBGA 4GMFA 2RIRA 2EF1A 1Q2XA 2Q4EA 2EG9A 3D3WB 2ZB7A 1YS4A 4BNHA 3LC2O 4IPTA 4D7AA 4ZJUA 2AE1A 4I9NA 5TNXA 2C7VA 4IXTA 4BO2A 1ZXLA 3I4FA 3IDSA 5U4QA 3CZRA 3WTCA 3N58A 4PLPA 4J4HA 4D0SA 3ASUA 3WTBA 5JW6A 2O3SA 4TQGA 2YJZA 4FFLA 4FGWA 4URFA 4XB1A 5G0UA 4BHTA 1YXMA 4CR6A 2EW8A 1ZEMA 4IDEA 5LDHA 3AWDA 2RBEA 3DMTA 2Q46A 5H81A 1GZ3A 1CYDA 3N7UA 4B4UA 3SVTA 1HDGO 3Q11A 4GPD1 3IC5A 1ISJA 4N7RA 3K6JA 2HSDA 1TB4A 1XU9A 1E0DA 2V65A 3WR5A 3DONA 5CFZA 3DC2A 2PZJA 3ZWXA 1D8AA 2I76A 2AHRA 1F8FA 3UVEA 1R4MB 4WE3A 1HRDA 1LXCA 1IHXA 1PJSA 1T25A 1X0XA 4RPJA 2X0NA 1PTJA 4XRGA 3GAFA 4PFJA 3RUFA 1QRRA 1IYZA 4FQ8A 1R16A 3SLGA 4HX5A 3ZV6A 4G2NA 3PZRA 4WPGA 5A9SA 3O8QB 2BRUA 1R4NB 5THKA 2I9PA 3DFZA 3FPCA 3JQFA 5A3VA 1R4MA 4GGOA 4FD3A 4LGVA 4Z0HO 4INAA 4EUHA 4ESOA 5I9LA 5JMWA 3JQEA 3D3EA 4L8VA 1KERA 4N5NA 4GLOA 1DBVO 3WS7A 1E3JA 1YB1A 2YV2A 1YONA 1N2SA 3RJ9A 3NDJA 5DBFA 4DQVA 2G1UA 4R5MA 3ZI0A 4LRTB 4RVSA 2C2YA 3HN7A 4K28A 2VT3A 2AEMA 2RHCA 2ZTMA 3P19A 1UXKA 2Z1NA 5ENVA 3OIGA 2CNBA 1GPDG 2E82A 2IYOA 3ZHZA 4HY3A 3QWFA 2V6FA 1C3VA 1YVEI 2EGHA 4WCDA 1DJNA 3KLMX 4DREA 3CZMA 3LF2A 3I52A 4CLHA 2QYTA 2I3AA 4CM3A 2PV7A 3NGXA 2VOEA 1PSDA 3MTJA 2BI7A 3SLKA 1PS0A 2Q2QA 3NT5A 3WYBA 1H6CA 3R0IA 5KIAA 3SEFA 1WAMA 1EK6A 4MO2A 1DB3A 3WBBA 2HMUA 4LRSB 1DRVA 3M6IA 4AJLA 1Q7CA 2QZZA 4EBFA 1R12A 4IGEA 2DTDA 5TF4A 1A9ZA 3QWAA 3OJLA 1P44A 3I9KA 1I3LA 3O4RA 5FF9A 4NQZA 4BIIA 2NV6A 7ADHA 3I83A 1Y9EA 3IAHA 2VWGA 3ICCA 3PJFA 1AGNA 4TRJA 5HS4A 5JAZA 5JO0A 4FFOA 3ENNA 1XGKA 1YOVB 2EXXA 1VJTA 3B1KA 5JCJD 1E3EA 4ROSA 4W9NC 3VVBA 1SO8A 1YB5A 1E77A 1EMDA 3TOXA 3AY3A 1KVSA 1NVMB 1OMOA 2BFMA 4AJ4A 1GPJA 3Q6IA 4MVJH 3E48A 5EMHA 3ZW8A 5C7LO 1E7YA 4R16A 2NNLD 3EDMA 1E5QA 1YKFA 1MX3A 2X5KO 3ROPA 2ZB3A 1XELA 3OA0A 5L53A 5KJEA 1IE3A 3DZGA 2GF2A 4MJLA 3OIDA 1I3NA 1JAYA 1PQUA 4KTTE 4S3MA 3GG9A 3W8DA 1V35A 2EIHA 5IN4A 3JQAB 3F5SA 1N1EA 2RAFA 3H8VA 5CPFA 4GX0A 5TIIA 1GCUA 3ONFA 3VPSA 1ZFNA 5TT1A 2H9IA 4MKXA 1DC3A 1ZKMA 3TZCA 5C5IA 1GUFA 3PWZA 2PZKA 1PJLA 3GRPA 4CMAA 3W4IA 5JFOA 5T8KA 2Q50A 3I9MA 5A9RA 4GH5A 4IGFA 5T57A 2PKQP 1N92A 1G0OA 3PFWO 1MC4A 1NP3A 5AXBA 3X2FA 4JXKA 3GDOA 4E32A 2HRZA 4X54A 3UCFA 2GN6A 4AVYA 5A02A 4BUCA 3GVHA 4XIYA 5KNLA 5IDQA 5U9CA 3LF1A 3AY7A 5A9TA 1KEWA 3SC6A 2JD1A 2CZCA 4ZQGA 1JDJA 3V2GA 4BO1A 1U7HA 4WLVA 5BNIA 2R2GA 2RHRA 3P5SA 3RC2A 1B16A 1DJQA 4LVUA 2NWQA 4OGWA 4YCAA 3KYBA 1O89A 2EV9A 2NQTA 4G5HA 1I36A 5JSFA 4I1IA 4B3HA 3JQ8B 4OSPA 1BVUA 1SBYA 4KQXA 2Q4BA 2EKPA 4CMEC 1MC5A 4U5QA 4B7XA 3ADPA 4IDAA 2X58A 4XWYA 4HUJA 3QVTA 5DCUA 3GNTA 1XR3A 3PJEA 1P74A 4OH1A 1T4BA 1Y1PA 4EITA 2W90A 4CM1A 2GLXA 1B7GO 5BNFA 1PL8A 2A94A 1RM5A 1U5CA 4GBJA 1I10A 1OC4A 3GLQA 2Q1WA 1P0CA 3KRTA 4U0JA 2O2SA 4UUOA 3VPHA 3P7MA 2J8ZA 1N9GB 1ZW1A 3MWDB 5ITWA 1P1RA 1KY5A 4FGSA 1UXJA 2CVZA 2QHXA 4B79A 2E48A 4JJGA 4RPKA 4LMPA 2BELA 2A4KA 3GEGA 2IXBA 3F47A 4ZRMA 2PH3A 5CG1A 4HWKA 2D5AA 1MUUA 4WKGA 4J43A 4WLFA 4A26A 3HE3A 2NADA 3RBVA 2JD2A 4ITUA 1VRWA 2QIOA 1NR1A 3GDGA 3NKLA 4DLAA 2HMSA 1JQBA 5IDYA 4J1SA 1HSZA 4L4SA 5EL0A 4XQ9A 3QVOA 4R69A 1ZJZA 3V2UA 2EERA 1X1TA 3HHPA 4WLEA 1BGVA 1ZVMA 4NNJA 2GPTA 3L4BA 4ND4A 1QORA 3BMOB 4W82A 4FW8A 2V7PA 3AUAA 4TMFA 4CLDA 1BWSA 3GT0A 1T26A 4NPCA 4NU5A 3LSYA 3VKUA 4QQRA 1X7HA 1ZNQO 3HDYA 4A7PA 4NMHA 5C37A 1MLDA 2P91A 4EJ0A 4G81A 2HMVA 3PFFA 4WK6A 3RU7A 3ZNQA 4ZQFA 3RASA 4BKRA 4Y9DA 4A27A 1NVGA 3HSKA 3RBXA 5HM8A 4OAQA 1BXZA 1UP7A 4IJKA 4E21A 4FR5A 2B0JA 4PVCA 2VWQA 3NTRA 3B1JA 1I3KA 1H93A 1ZK0A 3S2FA 2VYND 4B4OA 3OEYA 4M87A 4DIOA 3E18A 1R0SA 1FK8A 1EVYA 1SB8A 4UEKA 3ZV3A 2PFGA 3JQDA 1SEPA 3VDRA 4CQMB 1PZHA 2TMGA 5L45A 2B37A 3OQ6A 4JJIA 3E5RA 2QG4A 3WGIA 3VOSA 4WLNA 4N54A 1H9BA 1LC3A 4R1UA 4CM5A 4RV9A 4XQCA 3BMCB 2PD4A 3GA0A 1DLIA 2GN8A 3S2GA 1E6UA 1Z7EA 1BG6A 4L75A 4BKPA 2WYUA 4TKMA 1QLHA 1OC2A 3O38A 4ALLA 5G4LA 1EBUA 2G0TA 2PZMA 5FEUA 1JTVA 3WLFA 4DLBA 3QHAA 3MWEB 3D5QA 4BMVA 2UVDA 2UUPA 1SPXA 5COQA 4ZGWA 4CLOA 4RO0A 3RAJA 5DULA 2ZYAA 4J9UE 5CEFA 3IOYA 4I5FA 1EFLA 1NFRA 4YT4A 2X22A 1VPDA 4YT8A 3C7CB 4FFNA 2J5KA 2LDXA 1SCUA 5TLSA 1UP6A 2NSDA 2J5RA 2CDAA 4TVOA 4CPDA 1UJMA 4CMIB 2DBQA 1VJ0A 3T4EA 1LTHR 1OFGA 2O7QA 4M55A 3WMXA 1LDGA 4II3A 2B5WA 4M8SA 4K9DA 4DGSA 3ITDA 2O50A 4LCJA 1PZGA 1HE4A 5DF1A 1LDBA 1IZ9A 1ZO8A 3D7LA 4BNNA 2X8LA 4D45A 1PQWA 3W1VA 2BH9A 3WOHA 4UVDA 1D1SA 3BAZA 3GRKA 4JGBA 2DPGA 1LSJA 1PJ3A 3TN7A 4AJHA 1W0CA 3WX0A 4YAJA 3HUDA 4IDGA 1YJ8A 3C1AA 4P38A 3TZKA 4MIEA 1I01A 4AJJA 5B4TA 4II2A 1I24A 2OP1A 4E5PA 4DYVA 4CV2A 3JQ9C 3MJVA 1A4IA 1UP4A 3ZWVA 1ENPA 3G3EA 3UAGA 2NU7A 3D4PA 5L51A 3INRA 2HJRA 3RU9A 3NV9A 1UH5A 1WWKA 2OGUA 4NBWA 3A14A 4WLOA 1WDLA 3AM3A 4KOAA 5THQA 2FPGA 4I9HA 1XG5A 4E2YA 2Q3EA 3X2EA 1X15A 2IEBA 1R66A 4ZVVA 4CMHA 4DL9A 5C7OO 2FPPA 2XAAA 2YV1A 1PX0A 3PHGA 5TGDA 3I6IA 3BIOA 2VHYA 5CDSA 2AA3A 2XPCA 4GL4A 2P9CA 4U6SA 1LC0A 4D0RA 1N8KA 1PGJA 2B36A 3FNGA 1GQQA 2EJVA 3GVXA 3ZNPA 4BB5A 2B5VA 4W7IA 4Y6PA 1S6YA 4YRAA 4AFNA 3ZGYA 3GZ4A 3KEQA 4KDFA 3FR7A 3HQ4O 2D4AA 1NYTA 1U5AA 2EP7A 5BNTA 2Q45A 4PLHA 4IMRA 1D7OA 3LYLA 3GHHA 4BO8A 1N5DA 3PPIA 3JV7A 4ND3A 1PJCA 2C5AA 3HDHA 5C7IO 2O23A 4CJXA 1QMGA 4KWIA 1P1HA 2EEZA 1TA4A 3OIFA 4J7UA 1T2DA 4CMKA 4E33A 1R4NA 3VH4A 4LSMA 1GFSA 4DYDA 4RQTA 4CQLB 5KJ6A 3DMTC 3PP8A 5TSDA 4M89A 2GN9A 3MEQA 1TT5A 1ZJYA 3HDJA 2BHLA 3V5NA 1XLTA 2I6TA 3E1KA 3RC1A 3DBVO 4JK3A 1HKUA 3WYCA 3HWRA 4QX6A 1NVTA 3OBBA 4JROA 4IZHA 1PZFA 4ND5A 5L95A 2B4QA 3IL2A 3ZV4A 1E5LA 1KC1A 3AUSA 5A03A 1KEVA 3PHJA 2NU8A 1XQ1A 1W6UA 3RBZA 1YO6A 1QG6A 2JJYA 3PDUA 5FFFA 3D5TA 1R37A 2BD0A 3AY6A 3PLRA 3DZIA 2NVUB 3PHLA 5JLAA 1LSUA 2I5PO 3QJ5A 4DQXA 2VYNA 4N5MA 4XGKA 3ANNA 4PLYA 2D2IA 3BHMA 4HADA 1LBEA 3K92A 4KTVE 1JW9B 5IDWA 1W8DA 1Z74A 2O2YA 5KKCA 1YJQA 3W6UA 1VSVA 1SOVA 1HETA 3E6AA 3CUKA 3GUYA 5EESA 1H9AA 2UV8A 3NT4A 3EGOA 2ZIZA 4GQAA 2JCYA 3WNVA 2J6IA 1SZJG 1DHRA 3PDJA 4GSKA 5DCWA 4OIMA 4P8RA 2NVUA 3BMNA 4XGNA 1E1LA 1BXKA 4YRDA 1B14A 1A7AA 1M75A 3GMDA 1PJTA 4LVCA 4L4XA 5A5FA 1EVJA 1A72A 2D59A 4WASA 2FR0A 2HK8A 3EVNA 2Y99A 1V0JA 5IZCC 1HDCA 1K6JA 1RJWA 4PLCA 2Y1CA 3EUWA 5GZ1A 3K2EA 3G1UA 1E3IA 1VE9A 4AJPA 4BO0A 4C4OA 1EEHA 2CSUA 2VTDA 1F0YA 1MXFA 3GNSA 4AJIA 4PG8A 4RF3A 4NFHA 2GD1O 1M2WA 4O63O 4WLUA 3UKOA 3U5TA 2BGKA 1GY8A 4XD2A 4MVJE 2IODA 1GL3A 1K2WA 4TVBA 2PD3A 2VYVA 1DIHA 4J6FA 4U7WA 4A0SA 3ITKA 2W98A 2X0RA 3E03A 3F9IA 3WGTA 5JAIA 2VZ0A 3AFMA 1P1FA 3ZNOA 5MGBA 2EKLA 1HYHA 3FD8A 4FFPA 3KHUA 4AJNA 2PWZA 4XX0A 4BKQA 1C1DB 4RCVA 1GCOA 4E13A 3WQSB 1AUPA 5ENDA 1UXIA 4L74A 3DZJA 4GX2A 3WYEA 4E5MA 5DN9A 3RIHA 1IL0A 1ADGA 3PYXA 5I7FA 3GK3A 3ZV5A 5EPOA 3ON5A 4BNLA 1BHSA 1Y8QA 2NACA 3ROQA 3T7CA 3INTA 3HDQA 3DAPA 2PD6A 3H2ZA 4BMNA 4AJ2A 1OOEA 4AG3A 1P77A 5JXWA 5KVVA 2P4HX 3N74A 2H1SA 2JHFA 1B2LA 1F17A 1Y5MA 4I08A 4P4NA 4XR4A 1PGOA 1VI2A 1J5PA 1XEAA 1GU7A 3OEWA 4CV1A 1U9JA 1VJ1A 1NR7A 1LRJA 3GR6A 4XKJA 1U2DA 1VM6A 2WYVA 5CG2A 3NDIA 1QLJA 1Y7TA 1ZIDA 3T7EA 1E92A 2YFQA 5KKAA 4O5OA 4QO8A 3EK2A 2VCYA 1KOLA 3Q9NA 1F12A 4RPLA 2C54A 5HTOA 3TNLA 3Q3CA 1HWYA 2C20A 4CL8A 4J1TA 4NJMA 5L4NA 4IQ8A 1NTOA 1U3VA 1ISMA 5GMOA 4XB2A 4GX5A 4YACA 2PGDA 1UAYA 2QX7A 1HDZA 5JC1A 1PJ4A 1RWBA 1WMAA 3BA1A 4YJDA 3FPLA 1KVRA 3PWSA 5A05A 1ISIA 1ARZA 2TMDA 4DPLA 4E6PA 1PIWA 3GFGA 3K73O 4J2OA 5EQDA 3U3XA 3E8XA 4Z9FA 3OQ1A 2Q1SA 3NTOA 5TS3A 1BDMA 4DLLA 3QV1A 1U3TA 1PJQA 2NU6A 2ZCUA 3MTGA 4D41A 5ILOA 4MP3A 4U0KA 3K31A 1T2AA 4OYRA 3I23A 1KETA 3HB5X 2PGLA 3JQ8A 3NRCA 3F4LA 1V8BA 3ZWAA 4BNVA 3BHJA 5T8KC 1ONNA 3PYLA 1QSGA 4Z0PA 3B1FA 4DIFA 3RUEA 5K9ZA 2IZZA 3I6QA 3H65A 2J5QA 1PWZA 3TSCA 3WGZA 4W4TA 4P22A 3H6KA 5F1PA 3WWYA 2OHXA 5DP1A 3C85A 4RVHA 5FI5A 3D1LA 3ANLA 4NDNE 4ONEA 4YEDA 1WZIA 3IKTA 5JDIC 4K6CA 4NBRA 4GLLA 4OKNA 1ZK1A 2VQ3A 1XYGA 1LSOA 1U7TA 4MVJG 2O3RA 3RQSA 3LLVA 5ADHA 2X7HA 3CXRA 4FOOA 4UVEA 1GQYA 3MOIA 1ENYA 4YWJA 3WGYA 2GGSA 2VUSA 1LSSA 3BMQB 5JAMA 2NTVA 3C7AA 3FBTA 4GSLA 2AQ8A 2DTEA 3FN4A 1XIVA 3CMMA 4JX8A 1KVQA 3A1NA 2PTGA 3U0BA 2VWPA 3I3OA 2BGLA 4IDFA 2JAHA 2OORA 3C8MA 3CE6A 3ORFA 4H15A 4TSKA 4TZKA 3TZ6A 3ZU3A 4D3FA 4YXFA 1BW9B 3F1KA 3OF2A 3F6YA 4XQGA 3QWBA 1IPEA 4GGPA 2VNAA 2FMUA 5JYEA 2JKVA 5L7WA 1DXYA 1CQIA 2WD7B 3WSVA 1LLCA 4R51A 3SXPA 2CF6A 3E9QA 2Y1DA 4N18A 2JCXA 1E7QA 2DFDA 1HF3A 2I67A 3UOGA 1BTOA 1RM0A 5DDIP 2BMAA 4NHEA 4CQLA 1E3SA 1PR3A 2W2KB 4ZN6A 3PQFA 2OMEA 2P5YA 3WMWA 5JDIA 2I65A 3KBOA 3WIDA 3VPXA 4JNKA 4CM8B 2GZ1A 4NH4A 2E6UX 3FTPA 1KS9A 2POQX 5F1KA 4MPDA 1WP4A 4JBHA 4XYMA 1GV0A 1NXQA 3ETEA 2YQ4A 3ZNNA 1A5ZA 1R6DA 1DEHA 1O6ZA 2W2KA 4GX1A 3AI1A 4PLFA 3CTMA 2HO5A 4ZQBA 4E2WA 4NJMB 1YQGA 3OA2A 4HFJA 3BYZA 2OBYA 1Y5RA 3R1IA 4KUEA 3BHIA 5ER9A 5G4KA 4IS3A 3GVPA 4ZQEA 7MDHA 4Z9XA 4PZCA 4RLSA 4A5OA 1EDOA 3LC1O 1WLYA 2D3TA 4D3SA 4DWVA 1SMKA 3CPSA 4AJ1A 3ETGA 4CM4A 3KETA 1UDAA 2XOXA 4CQMA 1A9YA 4JQCA 4OOFA 3P2OA 1HXHA 1RYDA 3K96A 3VHRA 2B69A 5EERA 1CRWG 5EN4A 4OKIA 1XDWA 4UVGA 2EKQA 3SBOA 1BDBA 1NHWA 1E7MA 2DAPA 4BO3A 3EZLA 4KWHA 1VL8A 1E1NA 2X86A 2BKAA 3OJ0A 2DPHA 4O1MA 2X5OA 1M67A 1D4FA 3WXBA 2ET6A 3AUTA 1E3LA 2NQ8A 3DO5A 5AOVA 4Y6SA 4CR7A 1QYVA 4MVJP 1YE3A 3HZZA 5CDUA 2E49A 3U49A 4YT5A 5HS6A 1NPTO 3V1TC 3EVTA 1J0XO 3HFGA 3DOOA 3K8ZA 4DTIA 4C7JA 1NAIA 1U8XX 2FWMX 1BMDA 1PEDA 3F3SA 3R3SA 4Z3KA 1H94A 2OFPA 4KQWA 1ZBQA 2X0IA 1B8VA 2VUUA 1CIVA 3F4BA 4FIZA 1T1RA 4IDDA 3U9LA 2Z95A 1V3VA 4R9RA 1T1SA 2H6EA 2ZTVA 3H9EO 1GQ2A 3G49A 1A27A 5HBRA 4TRRA 1F14A 1M66A 3MJSA 4NJOA 4MVJM 3RWBA 1KEPA 2A92A 3R3JA 4HKTA 4ZD6A 3WBFA 1Y6JA 5GZ3A 2GSDA 2Y93A 3OM9A 3EW7A 4AICA 2FSSA 1LRLA 4UUMA 4CMIA 1MP0A 1QR6A 3VZQA 1SNYA 2AW5A 3L6DA 2C82A 1LLUA 4GWGA 2E37A 3PXXA 1J49A 1OBFO 4ZRNA 2P9EA 3V8BA 1C0KA 4DMMA 2D8AA 2JD0A 3AOEC 2F1KA 2XXBA 3ABIA 1HZJA 4R1NA 4JIGA 1DRWA 5JE8A 2CF5A 2AG8A 3BMOA 2IE0A 2IRWA 4PG6A 2PKRA 1FDWA 3PLNA 1ADCA 4FJ0A 2HAEA 3L4BC 4KP7A 2WMDA 3RJ5A 1PS8A 1I2CA 4CM8A 4UVHA 1Z7BA 1IULA 5CHEA 2UDPA 1XHLA 4HV4A 2VTEA 3JSAA 4J4BA 3CH6A 4JN6B 2HDHA 4Y67A 1Q7GA 2NTNA 5A06A 1E3WB 2Y1OA 1VKOA 1HE3A 2VUTA 1QV6A 3GQVA 3ONEA 5T6BA 5DZSA 4PG4A 4JBGA 5L4SA 3F5QA 3ENKA 5TJHA 3DBRA 1WVGA 3B70A 5G4KB 3LK7A 4QXMA 4XEHA 5B1YA 1E6WA 4I9UA 1Q0HA 4RF2A 2P5UA 4WGGA 5COBA 1PR9A 1BW9A 5F5NA 4M1QA 2UYYA 2PY6A 4WJZA 3ZWCA 3G17A 2QYSA 1UZLA 4GVLA 1NQ5A 1ML3A 2G17A 1Y8QB 3FNHA 2W8ZA 4R1SA 1I0ZA 3VZRA 4E2XA 3ZU5A 3ZWYA 1YBAA 1X7DA 3DAGA 2C7GA 5L4LA 4JP2A 2GASA 4YPOA 1EFKA 1GR0A 1V3UA 3L9XA 4ILKA 2OXIA 2WWRA 3MCVA 2H63A 3F1LA 3IS3A 3KSDO 4NFYA 3WB9A 4BNJA 2P68A 1FJHA 2DT5A 2PA3A 3L0DA 1CETA 1QV7A 2VHXA 4YAGA 4YJGA 4OHUA 4JCOA 4MIYA 4CMBA 4B8ZA 3JD4A 4IBOA 2X23A 2GYYA 3GGOA 3HB4X 2GUGA 3UICA 1EQUA 1K3TA 2X1HA 3LVFO 1SAYA 1E7WA 2B4RO 5I7VA 3PGXA 4FOSA 1GTMA 1UR5A 4FPXA 1C0PA 3NAQA 3I1JA 1EQ2A 4BOYA 4WECA 5JC8A 2CFCA 5T67A 1LU9A 1P9LA 1ZSNA 3G0OA 1EUCA 4UEJA 1JAXA 3ADOA 3ZU2A 3I9LA 3NJ4A 1BRMA 4Y6RA 4BO4A 4Z6KA 2WM3A 4FS3A 3ULKA 3LQFA 1DPGA 3OFSA 1LDEA 4OXNA 3WFIA 3UUWA 4BL5A 2R00A 3ZWOA 4XZ3A 3M2PA 2JCVA 4PCVA 1TT7A 4B7UA 2GZ3A 3HG7A 3KVOA 4YAKA 3TPCA 1GZ4A 2RCYA 4OMUA 5BQFA 3ZWNA 2X6TA 2G5CA 1A7KA 3BTVA 5FI3A 4R01A 1G6KA 5JMPA 5ICSA 1RPNA 3JYPA 3K5PA 1HYGA 3AFNA 3PQEA 3WJAA 1DIBA 3H9QA 4ND1A 2DVMA 3GMSA 2EGGA 1FXSA 4MVJD 3PEFA 2WD8A 5JBIA 4RL6A 1V3TA 3RSHA 1DIAA 3VAZA 4LW8A 5I7SA 2O3UA 1XA0A 3JQAD 1O95A 4WOKA 4HXYA 3TJRA 3DHEA 2Q1TA 3H5AA 3JQ6A 2WJPA 5G2OA 3JYOA 3L6OO 2Y0DA 4EDFA 2I66A 4DPKA 1I2ZA 1H6DA 5ITVA 3UXYA 1RM4A 1H6AA 4ALIA 2B35A 5AXCA 1ADFA 3KYCB 3K9QO 4CODB 3ZCXA 2QQ5A 5JY1A 4OXYA 3FCOA 1U8FO 2DU8A 1M6HA 2FHSA 4BO6A 1HLPA 2O3TA 3TFOA 2IYPA 4WEQA 3O9ZA 4Q3AA 4WEOA 2J3IA 3JCZA 2CDBA 1P0FA 2P2SA 3P2YA 4R3NA 1LJ8A 4RQUA 1JN0A 4XYEA 2IDZA 3RUHA 1YDEA 3QE3A 3OJEA 4XYBA 3L6EA 2HLPA 3ZZNA 1I3MA 2IZ0A 1RKXA 4BNYA 1SC6A 1IZ0A 3LZ6A 2FZEA 1LLQA 4DUPA 4O59O 1EZ4A 5JY6A 4OL9A 2Y68A 5IXSA 1HE2A 1GV1A 4U6QA 5K0ZA 4WNCA 3E5MA 4IXWA 1ORRA 5I7EA 1K89A 1U4OA 1B3BA 2QRLA 1HDYA 4R68A 5MDHA 1B15A 1HSOA 4J90A 1U28A 2QRKA 3RFVA 1P3DA 3Q2KA 4YAIA 1QYCA 1UDBA 1DSSG 3VDQA 4FBGA 1QP8A 4EI2A 5T64A 1MB4A 2B4TO 4OJNA 5I9NA 2X9NA 4J7CA 1ZH8A 4Z9YA 3COSA 3WICA 1ULUA 2X4GA 2IXAA 3FBGA 2DTXA 4MKRA 5HA5A 2GN4A 3QSGA 3RUAA 5AXDA 2XXJA 1UUFA 2O4CA 3PHIA 2PLAA 4FC7A 3S2EA 2PZLA 1HT0A 1Q0QA 3CKYA 3RVDA 1DFHA 4G65A 1DOHA 5AVOA 4OO3A 1V6AA 4EEXA 4MKZA 4NZ9A 4EUEA 1GEGA 2A35A 8LDHA 4BKOA 3HJAA 3A4VA 3SJ7A 5K6AA 3VC7A 3QVXA 4AJEA 3GUCA 4IZIA 3JD0A 4TKLA 4YVFA 4RVGA 3STHA 2VT2A 3DBHB 4GWKA 4IJUA 1VKNA 2AQIA 3HNPA 4IY1A 4L0QA 3GFBA 5CAEA 1MV8A 1YL5A 2HKIA 3O26A 2WD7A 1TLTA 4J2HA 5G0WA 4K26A 3I9JA 3ONDA 4EGFA 3DTYA 2Y0EA 3GN1A 4CMJA 4IS2A 3CEAA 2Y1EA 2BF7A 3D64A 4FJ2A 4J0FA 3SC4A 3LLSA 2Y05A 5JDCA 1NX6A 1YQXA 2CVQA 5L40A 4BO9A 4RDHA 3JQ7B 4FFMA 3DBLB 4RLHA 5JPIA 1E6EA 4MIOA 5F5LA 1QKIA 4B3JA 2O3JA 2BI8A 2ZTUA 1ZK4A 2AQKA 3KO8A 5A3JA 2BGMA 1XSEA 3JQGB 2G76A 4J3FA 3FI9A 3TRIA 1LDNA 4Z3DA 5LDGA 4YRBA 3JD1A 4FC6A 4WOJA 4GI2A 1C1XB 1VSUA 3GF4A 3DZHA 2PR2A 2DUWA 4HNGA 4AL4A 1ZSYA 1HEUA 5T5QA 2CDCA 3TDKA 3Q2IA 3FF4A 3AI3A 4NBVA 2O4UX 3DTTA 3QRWA 3KB6A 3IUPA 4CQMD 3GEMA 1EDZA 4BVAA 3H3FA 3H2SA 3KZVA 3QA9A 4CLEA 4NBTA 3VPGA 1JA9A 1NWHA 2CD9A 3UFXA 1GDHA 1BXGB 1I2BA 4YJHB 1HDOA 4YYZA 1BVRA 2WDZA 3PZBA 2O7SA 1DAPA 1N7GA 1AHIA 4OM8A 1H2BA 3RC7A 2WYWA 3VH2A 4OQYA 1ONPA 1U1IA 2DQ4A 4L76A 3TL2A 3H4VA 1NNUA 1ONOA 3MJEA 3JQGA 1C0LA 3IKVA 4BMSA 1Z45A 4TRNA 2YY7A 1K0UA 4NFSA 5CDTA 4J7XA 1P33A 1VLLA 2PNFA 3HADA 1PGNA 1GAEO 4MOWA 4QFCA 1JKIA 1LX6A 4Q9NA 2E4AA 3C24A 2ZKLA 4ALJA 2C07A 2FZWA 4KMSA 3GEDA 1GUZA 1X0VA 1O94A 5IG2A 3H5NA 3CINA 1YRLA 1YWGO 1JKJA 1JWAB 3A9WA 4LCEA 3TZHA 3WNQA 5B12A 1N7HA 2PKQO 3INGA 3RFXA 4CR8A 1K6IA 5KTKA 1Y8RB 1P31A 4FFRA 1KC3A 2H5LA 1VC2A 4XDYA 3WLEA 5CP8A 4UREA 4PLVA 5G0SA 3EZYA 2GR9A 3PIIA 3DBHA 3VTFA 3EMKA 4Q3DA 2NUAA 3PGJA 5ILGA 3MOGA 2YDXA 1YL7A 4J0EA 3L77A 2FSVA 3ZWMA 1Z82A 1MFZA 4A73A 2OO5A 4BGEA 1L1FA 4EJMA 4YA6A 3Q1LA 4ZQHA 1X13A 3IIEA 4L73A 1YQDA 2J3HA 1NPYA 1UZNA 2RH4A 4BB6A 4CM7A 1PL6A 1WW8A 3JYLA 1KBZA 2VYVD 4H3VA 1Q7BA 4XJSA 4IIUA 3ZWPA 4FN4A 3WQRA 2YHUA 4HNHA 3NUGA 3QQPA 2DM6A 3FTNA 3V1UA 1W73A 3PIDA 4BNUA 2OZPA 4CLXA 1RM3A 1Y9AA 4F46A 4B4WA 3CIFA 3OH8A 1JVBA 5B4VA 1I33A 4JLWA 3IP3A 3AU9A 1YL6A 2EHDA 2YDYA 3NJ8A 4F45A 5BR7A 4XYGA 4YT2A 1Y8RA 2HJSA 2HK9A 2QRJA 2J3KA 4CUZA 2FR8A 3AI2A 2C29D 1KYQA 4XJTA 3DHYA 5CEJA 3A28A 1C14A 2Q2WA 4CV0A 1ZEJA 3MJ4A 1TXGA 2YYYA 3GHYA 4KZPA 4ND2A 4R3WA 4XQEA 3W4JA 1FDVA 4A2CA 3QW2A 2AXQA 3WGGA 3I4CA 3E9MA 1GYPA 1HTBA 4RJTA 1ISFA 3O8QA 5HWSA 1ZZEA 5I8ZA 4MP8A 1UXHA 1G0NA 1NFFA 4FDAA 5JCJA 1CDOA 2I99A 4CLRB 4LMRA 3DFUA 2GO1A 3LT0A 4MVJF 3H9UA 1NASA 3PK0A 3PYMA 2YUTA 1GZ6A 5GY7A 1X14A 1NWCA 2DBVO 4LSWA 3C7DB 4ZHSA 3EHEA 3UGKA 2AE2A 5B4UA 5CEEA 4XA8A 4BKUA 3GOHA 3DBLA 3EAGA 3ZHYA 3KYCA 3NT2A 4F6LA 4TROA 3R6DA 3IQDB 4IQGA 2GDZA 1U2GA 4J1QA 3DR3A 5BSHA 4NG5A 4M86A 1ULSA 2PK3A 4BGUA 1ZCJA 3DAFA 5JO9A 4QT0A 1SOWA 2VRCD 5JDCC 3DQPA 5C3MA 5AYVA 2FY8A 4MINA 3IJPA 1C1XA 1NAHA 3G79A 4BNZA 5CPBA 2DLDA 5BSFA 1WDKA 3BMCA 5KJFA 4HP8A 2O48X 4GKBA 1LQTA 1PWXA 5KOIA 1CERA 2NVWA 4CUKA 1E1KA 3D4NA 1MFPA 2C2XA 1OZAA 4FJ1A 1VL0A 2CMDA 3S2IA 1YGYA 5KWEA 3H9GA 1JKFA 3JQ7A 1PU2A 2WE8A 2C59A 3WIEA 1PS9A 3TQHA 3AM4A 1J6UA 3C3XA 4D46A 2OP0A 4E5NA 1O5IA 6ADHA 3KV3O 4HFNA 5L7YA 2AEFA 4CMEA 3NX4A 1GADO 1OI7A 2Q1UA 3RI3A 4TRMA 2Q49A 2Y1GA 1T24A 5U1PA 4CUJA 2VNSA 4KUHA 2NVBA 4UEOA 3AM5A 4IQ0A 3AOGA 1PGQA 3PRJA 4OQZA 4PIVA 3L9WA 3JD2A 4E4YA 3BTSA 4UVIA 3U4DA 3LDHA 5IAAA 1YOVA 3RUIA 2V6MA 2WEKA 5L9AA 4RF4A 1X1EA 3BTOA 1KIFA 4PZDA 3NGLA 1EE2A 1I8TA 5GZ6A 3GGPA 5A4DA 3JTMA 3GN2A 4HFRA 1I5RA 1DDOA 1T2CA 2D0IA 1ISGA 1GYRA 4OOEA 4EJ6A 2HRBA 4Z0TA 5DOZA 4M54A 3FWZA 4XIJA 6LDHA 4E30A 5BSGA 4KUGA 2IZ1A 3S8MA 2ZTLA 4H16A 4QFDA 3ZW9A 3DOCA 1DFGA 3GZNB 9LDBA 2X5JO 1NBOA 1SEVA 3DEYX 3GG2A 4BGVA 5EJ2A 1T4DA 2BFPA 2O3QA 2Q99A 1LRKA 4RVFA 4RVDA 5L3ZA 1Q1NA 1I32A 3VH3A 4DQUA 1E7SA 3W4KA 4B3IA 4LN1A 1NFQA 3ETDA 3Q9UA 1UXGA 2VZ8A 3QIVA 3GZNA 4JJFA 1N1GA 4XCVA 1DC5A 3BZUA 2DBZA 3MZ0A 1K5HA 2G82A 4RORA 5CDGA 5IF3A 1JVSA 3OJOA 3U62A 4YJFA 3KEOA 1AN9A 3OP4A 4W9NA 1NQOA 3ROKA 3NTQA 1UDCA 4BNGA 1Y81A 1B26A 4EZBA 5CDYA 4BV9A 4IIVA 4H7PA 4WCFC 4ALNA 5ICMA 5EIOA 2GNAA 2Z5LA 2F00A 2Y66A 4CLOB 4YQYA 4F3YA 5HRUA 3RUDA 3UW3A 2YQ5A 3EC7A 4YBZA 1D1TA 2D5CA 1AXGA 3GPIA 3S55A 1MGOA 3WSWA 4S1VA 5TJ9A 4ALMA 4ID9A 2P4QA 3M1AA 5JAQA 1ZMOA 3FSRA 3JYQA 3RFTA 4A10A 4D3DA 1QYWA 5BT9A 2AQHA 1T2FA 2AG5A 1Z73A 2R6JA 1T2EA 4I8XA 2X9GA 1FDTA 3WGHA 4YTEA 4XGIA 1H5QA 4E5KA 3M2TA 4NU6A 5I8WA 3GVIA 3RD5A
chains in the Genus database with same CATH superfamily
2P1DA 2C5HA 3RRYA 3K8YA 5EY5B 5AKKA 4QJBA 5JXJA 3ZY5A 4MPPA 4A8TA 4HGQA 3RKUA 2QMHA 3VC1A 1P2TA 4L28A 5G0VA 1JR3D 4V0ME 4UULA 3D6JA 4XB6B 1N9GA 2HCFA 2PXCA 3OOJA 4W7HA 5IJXA 3A2LA 4LNAA 4L8LA 1YR3A 2WMOB 4BNFA 1LF5A 4M0EA 4I4CA 1E3DA 4E3ZA 1YK1A 1OI2A 1UT6A 1CEQA 2QTVB 4CCSA 1V8FA 2R5WA 4GKVA 3F8TA 4DGQA 5EJIA 3LC7O 3HUTA 4DR2B 5G41A 1R0WA 4QREA 1BMFD 2YIVX 1RPJA 2PGJA 3RS5A 2W43A 1UC8A 5C7YA 2M6SA 3TTXA 2O0HA 2Q6KA 3ENZA 2IV7A 2JFWA 2PZ8A 1I3CA 1EQAA 1L4EA 3P0IA 1FW8A 5FOSA 1JFVA 1XQ6A 3SXJA 3DQQA 3EDOA 5FPKA 1B8PA 1RYEA 2NZVG 4XFJA 3ER8A 1DWQA 2PT5A 1EVIA 1GEEA 2FFBA 3A6ZA 4H7EA 1OXKB 2GBIA 4JL5A 4A2QA 1E8MA 1XMXA 3DVQX 4P5DA 3WYGA 2Y0CA 2B7CA 5KCZA 5FBVB 2HCTA 2VRCA 5A6SB 4TWRA 4BRZA 4OYHA 2QU8A 2ZJ5A 1VIVA 3M81A 4LKOA 3JQBA 4YRMA 5IUKC 3RAEC 2J3MA 4DV2B 4UUPA 5K3SA 3WZ2A 3DSRA 1CNMA 1ZISA 3MN1A 5AW4A 2ZQYA 2GBFA 1U31A 1TYBE 3M6LA 3QOXA 4TX1A 4AWAA 2ZYDA 2R66A 2Z2XA 2E6KA 1BMQA 4I2VA 4BQSA 3GDFA 2BHTA 4DB2A 1DMSA 2Z8YM 3ROMA 1CX9B 4QJ5A 1JIJA 3WKBA 3ENQA 4L9AA 1PJ2A 4WACA 1MG5A 4ENUA 2C0CA 2VCHA 3OOWA 2JDIA 4NZMA 1BEUB 3SQNA 3OEHD 3N2KA 1ZESA 4F0JA 2QZ9A 3PEUA 2DULA 2KX7A 3AOEA 2KBEA 4X61A 4LNUB 3UV6A 4M49A 4NATA 4BZZA 1LZKA 1W36D 2A9KA 1AU9A 1GD1O 4CLRA 1PLKA 2CBZA 2H2FA 2WVJA 3RG8A 1ENZA 1OTHA 1DRKA 4P3NA 1XALA 2OYCA 1M7GA 2ZRDA 4JLSA 3T5MA 3N2YA 1U7DA 3PFNA 4DLNA 3ROGA 5ALYA 3JQCA 1AA9A 3GLRA 1C1DA 4RHYA 2M2IA 4MULA 4TZTA 4U7PB 3DCYA 4L8FA 4ZOQI 4O2AB 3OT1A 4B33A 3QE2A 3SR0A 1D3AA 3JQFC 3C74A 1L5GB 2FW7A 3Q0EA 1DCMA 2D5IA 1ZGCA 4UM5A 4ZPJA 1TVMA 1LNQA 4LDAA 4P5EA 1USVA 4ENQA 1ACJA 3IOEA 3IP1A 3MQFA 2EBHX 2EL7A 4L9RA 4FDLA 3TW6A 3CU5A 1Z22A 3WADA 2EWVA 1Z0ZA 3BTUA 3TFQA 2IX3A 1ZI8A 3AL3A 5ICGA 4EATA 4AWXA 2HJVA 3IBGA 5F77A 1S2LA 4D5EA 5A5EA 2E85A 5JS8A 1RXWA 1L4NA 4GAEA 2YW9A 4QJIA 3OM1A 3P45A 1HE5A 1FSPA 2L0XA 2AEEA 4B5KA 1JECA 2ZBPA 4E2FA 4WADA 5FXMA 4M9XA 1VRVA 4DDKA 4RULA 3ZJTA 4DMKA 5IVIA 4B2YA 1Q50A 1ZNZA 2PL3A 5DP2A 5GVSA 2VT6A 1HDXA 4V03A 4CGYA 3KSMA 3WLQA 4BNIA 4DBVO 5BQ3A 1WOYA 4WNIA 4M53A 3TOVA 1R9GA 4IJVA 1AS0A 3TMKA 3I64A 2D2VA 3BL5A 4Z49A 1J70A 3TG2A 4HOYA 3T4PA 4HLUA 3KOUA 2LTAA 1DDGA 3CG0A 2H0QA 1W6RA 1Y4UA 2PSJA 1KEUA 3HB0A 1QTIA 3OC6A 4FMDB 1P18A 2AYXA 2ODAA 4NS1A 4XOIA 5FH9A 1DTEA 4Q3LA 1E64A 4K6FA 1HOTA 3OG9A 2O59A 4PONA 2CY0A 1EFHA 1NLMA 2ZWMA 4I5EA 2UUCB 1S7CA 3V2HA 3BD7A 2CHUA 4JYBA 4ZVNA 4PLZA 3EMVA 1LA2A 1AXEA 3QH4A 2JVJA 1V26A 3NIDB 1KI2A 1JIVA 1A9QA 3AP1A 2JFVA 4WHMA 3OZ7A 3EH1A 1N34B 1FCJA 1XUOA 1H8ED 4AM8A 2C57A 3BJIC 1XWWA 1G18A 1W4RA 1RZUA 4AYWA 1RXSA 2ORIA 4GRIA 5DT9A 1ECJA 4TT3D 4IGAA 2VYCA 4AUKA 1PGPA 3D3WA 1N5IA 2P5SA 4X85A 2E4YA 4N82A 4CG1A 5HIAA 4Q39A 3NTVA 4M8LA 1ULHA 1E2IA 4RVCA 3I8XA 1MT3A 4UHCA 3HC7A 1CUIA 5B3AA 4Q3OA 2NTJA 3DZFA 3ESQA 3VR6H 4FU0A 4HFMA 5KREA 3ZY4A 2Y1WA 3N70A 2KLBA 5G0TA 2OENG 1ZNXA 2I1LA 3QU4A 3OPYI 4MPTA 5EJFA 5T4EA 5LOVF 4X6LA 1XKQA 1Z0DA 1ZA2A 5EGNA 4KXLA 1KAOA 5CXXA 5GM2A 1ZK2A 1L5NA 3LQ4A 2WSIA 2HDNB 3TWOA 2QMYA 2ZIXA 1KSHA 6NULA 4IM7A 1OAAA 4C0BA 2QLFA 1UKYA 2FZ4A 1IIBA 3NEPX 2Y67A 1SULA 1IQPA 2ACWA 4IZOA 1T10A 4MV5A 3IJRA 4ZZIA 3JQQA 4WA8A 3IJEB 4OATA 4HMPA 1FXWF 2QTCA 4J8PA 2ZRHA 3OECA 3QNMA 4DXHA 4UE3S 1KFKB 1Q21A 3ISVA 2A0YA 2XMBA 4BLWA 5EWJA 2PSEA 3UTDA 2BAGA 4TN1A 1FDUA 1G8YA 1ZHHA 1YBMA 3JWHA 5H02A 4YRJA 5TDHA 4B6EA 2EJCA 5D1NA 3HR8A 3ZXUB 2W2LD 1OJ7A 2YL2A 2RKOA 2ZS9A 1N6RA 3C6ZA 4X8OA 1R2QA 3IBCA 3M3HA 1JBKA 1ZLYA 2XODA 1XVLA 1GUYA 2PUHA 3KFXA 1T13A 4QUKA 3SSOA 4E7OA 2RSLA 1O4VA 1ADYA 3HVHA 1P3JA 3ZEAA 3GPDG 4JC8A 4MQFA 3W78A 5DBIA 1PNRA 4NLLA 3ESCA 3L46A 1BXRA 3GZJA 4OG2A 3THWB 5JVDF 3JZFA 4ZKDA 1CHNA 4BMZA 3ACBA 2G9ZA 4KAXA 4B6OA 2HYIC 2WJIA 3D8SA 2GCIA 3KKZA 4WINA 3IBYA 3WYDA 4YAOA 4NE9A 4U7GA 5LYJF 1ACLA 4BB9A 1U1FA 2NLOA 5L3RA 4IYRA 3RVBA 2OXFA 4NDAA 2P65A 2WJGA 5HKLA 4O4IA 3TOZA 4NP6A 1J8MF 4AJKA 3AB3A 4XVCA 2XNHA 1IY8A 1EUQA 1N0HA 1HNZB 3FRJA 1M1NB 3MRTA 2A5FA 1J99A 2IITA 4GD3Q 1RJFA 3ND7A 1UL1X 4JP3A 3RTGA 3UZUA 1Q84A 4EHJA 4F38A 3EZ2A 1BA3A 4F3NA 1RWQA 2R25B 5ECYA 4MW4A 5IJZA 4D42A 4MWGA 4K5QA 2V7BA 1PL7A 1FLNA 2F6RA 2MTBA 1AHHA 1KE2A 1NMXA 3HKCB 2I1QA 1MPTA 4RADA 5KSWB 4E1AA 4P80A 3QF7A 2QR5A 4K03A 1QVWA 2OV1A 2PJDA 3PC6A 2H1RA 3COVA 4MZXA 4M0PA 1MQSA 3MWKA 4MQ4A 1G1AA 4YQEA 3C4VA 5T3UA 3KOZA 4IVRA 1V5FA 1Y37A 2VHWA 4KQJA 1W1IA 2WV7A 5CRIA 1KZ1A 2XMSA 2YHIA 3FYUC 3O8OA 4RGVA 3FMPB 1XYYA 2AOXA 5I47A 1HK7A 4NI5A 3D6FA 5LKRA 4EP1A 3ZOKA 3B3QA 2OWEA 4CEHB 5F52A 5F5XA 4RF5A 3UXMA 1HY3A 1EG2A 3QI2A 4R9SA 1AKMA 1OA1A 2ST1A 2FK8A 1UWCA 1B0AA 1P45A 2OXCA 3H7AA 4QPCA 2WHQA 3F7OA 1LFAA 3P5BA 3BMQA 4JVOA 2GERA 5IDVA 1SXGA 2JAUA 2VJMB 1PYDA 2X1MA 4TTIA 3QV2A 4E5YA 1X1AA 5A4KA 3QFCA 3C8HA 4C87A 1N0UA 5DCYA 1X7GA 1YH3A 1Z9BA 2H18A 5B5SA 3BULA 2P79A 4K3VA 5EUQB 1XTRA 3DOEA 5F2EA 3QPAA 3FGNA 4CIVA 2Z1DA 4JJAA 5BMVB 2BCGY 4W6QA 3WLRA 5IKMA 2YBDA 2NXCA 4FCVA 4DY6A 4NOLA 1TVEA 3GGGA 4RGBA 2Q4TA 4CF3A 1P2BA 3DXFA 3OZIA 2CVOA 2ZWAA 1WDMA 3KT0A 1LEHA 3SXUA 3VPDA 2ECOA 3OCVA 5D3MA 5CD1A 4W99A 3B7GA 2WUGA 3TR5A 1ENOA 1KZGB 1JLLA 4BCCA 3O7WA 4KAFA 4N76A 3JRNA 1IOWA 4ENTA 5IASA 1E2GA 2OYSA 3NIWA 4EJSC 4DLRA 5LLDA 1GDTA 3QVSA 3B6ZA 4QWWA 4C7BA 2UUAB 1L8OA 3PRHA 3MTAA 2OQ2A 1M6WA 2QG6A 2GJAA 3C1TA 3OSUA 3SS8A 1V16A 1L5QA 2XA2A 1IRIA 2ATXA 1SKUA 1Q1EA 4QBGB 3EPRA 3LU1A 1ISPA 2F3RA 1DI0A 2CVHA 4DIBA 5EMLA 3V33A 1PLJA 4IUDS 1ESMA 3KLPX 1DO8A 3ICPA 4BNTA 5KDOA 3IUSA 4PNPA 3VNRA 2E55A 3B1ZA 3PNKA 1CULC 2QVLA 4F2DA 5LQMA 1IDOA 5ALMA 2XNDD 3NDRA 4JBIA 2QBYA 2C9OA 3QVGA 4BBJA 4B7ZA 2V6GA 1YBVA 3OT5A 4MKIA 5AQ1A 2Q5FA 3GGCA 4BYMA 1AKUA 4H59A 3LLMA 1B0PA 2ORED 4H17A 4R1TA 3AIOA 5IKEA 4GR9A 3IVMA 3WLIA 4BUZA 3RK1A 1O6CA 1T0HB 3VZCA 2WI8A 1GTRA 4IIBA 4H7IA 4HQLA 3OJFA 1KAHA 5IC6A 3E35A 3Q8KA 2Q5LA 1TT5B 1UINA 2EZTA 2FUKA 4K6OA 4TKVB 4A2PA 1YAJA 2XE6A 3VKVA 2C00A 5CA0A 1GRNA 3SEQA 3IQEA 4Q3EA 3VNUA 2YWEA 3I53A 2OILA 4R9UC 3HLTA 4RTPA 1W7AA 2CK3A 2O2ZA 1G16A 3RF6A 1ML4A 3FPGA 5I9TA 3VVCA 3RKSA 1RWOA 1AGXA 2A3NA 1DQSA 2IYRA 4C7MA 3UCEA 3WGLA 2VPYA 1L7EA 1OIXA 1C9DB 2QN7A 2BEUA 3U09A 2D6FA 4J9VA 3U4IA 4MVJI 4UTPA 3PKZA 5HXAA 3AF1A 3G2OA 3OFND 2W58A 1DIRA 1XAGA 3G2MA 3UHOA 3KUDA 4P7JA 2BYTA 4LEIA 1CJCA 1R0KA 2YHBA 3VR4A 1SUAA 4YJGB 1P4AA 1NXTA 5E2IA 3T9CA 3DF7A 1C7JA 1O8CA 1TQ8A 1ZMXA 2FEAA 2ZR9A 2Z3WA 3GY0A 3GLHA 4RFVA 3ASVA 4MLZA 4XEUA 1SR8A 1UMDA 3VOTA 3RBAA 3ME5A 3T4UA 3S1LA 5AW1A 1GSIA 5JCOC 1C4KA 5AVQA 3RVJA 4F3TA 2XSZA 2UKDA 3OM0A 4HS9A 4F84A 3VKGA 4U2FA 3OIYA 3X1YA 4N3NA 5C3UA 3WGNA 3T1NA 3E82A 3K0BA 5CH3A 5LQNA 4X92A 2OHJA 1N9KA 4HLDA 1KFJB 1P1IA 4AUEA 4J49A 1TW3A 2FPIB 4RK4A 1RVV1 2WFAA 2YV3A 2WJ4A 3O03A 2VHCA 4KGDA 4HBGA 1BDJA 2GN0A 3TTSA 2XCIA 1L4HA 1Q2XA 2BOVA 5CLIA 2ZT5A 1KYIA 1XZEA 3QEMA 4PTZA 2DERA 2X9LA 1U3FA 4F72A 5CITA 4ZI5A 1E3QA 2ZYVX 3G9QA 2AE1A 4I9NA 4MUMA 5EEHA 4UUBA 5AVSA 2J9FB 2RJNA 3DBOB 3KJNA 3BRQA 3OE7D 4BVHA 4CKEA 1RRMA 3WTCA 3JWJA 4PLPA 3SM3A 3DL4A 4KE9A 2VXCA 4CIBA 4MO9A 5LL6P 2NZJA 5JW6A 1J8YF 4TQGA 3KQKA 3ZYCA 4QGGA 1BHQ1 4EG6A 1ZEMA 4IDEA 4PE5B 3AWDA 3N8DA 2VDWA 3GYBA 2QM0A 4JJZA 2OAGA 4FHZA 4EX7A 1ZR2A 2LW7A 1KDRA 3OF3A 3RDPA 3SVTA 3GEBA 1E59A 3DNMA 1F4VA 4QRDA 1ISJA 1TQHA 3K6JA 4N7RA 2WP8J 3VV2A 3WO0A 5A4MS 2XB6A 1MH1A 3L2OB 1LVGA 2V65A 2X2OA 2QUZA 3WR5A 3DONA 2ZYSA 5FPPA 3GWGA 2PZJA 1J5XA 1GLNA 4QARA 2VDMB 1F8FA 1MNQA 2OZVA 1OFHA 4OXQA 1T8WA 2O52A 3A6LA 4Q4AA 2A57A 4ETIA 1PLLA 1T25A 1YIOA 1V1MA 2IPOA 3D9QX 1PTJA 3GB9A 4XRGA 3GAFA 1QRRA 2HWKA 1IYZA 2IU4A 4H1UA 4HGOA 4WFIA 1KE1A 3FPFA 5JPDA 3H1TA 1NRIA 2JBWA 4WPGA 4KN8A 2BRUA 4URYR 1R4NB 5THKA 3JQFA 4J1TC 3S27A 2YY5A 5A3VA 1R4MA 4GGOA 4X9XA 2G1KA 3MUOA 1JIIA 1OWPA 4I36A 4JC0A 4ZMSA 5JMWA 1Q0UA 3L1KA 4FGLA 2P35A 2QX6A 1O9HA 1RAEA 1XTJA 4L8VA 4OB6A 2IH4A 5JBNA 2JEYA 1GFZA 1LBTA 3MGGA 1JFLA 3SC2A 1RC8A 2AD5A 3BJMA 4FYYA 4B48A 2D7JA 1GSAA 2I4MA 2JIMA 3E9CA 1YONA 4GR4A 4LXGA 4YP7A 1XFAA 3HRHA 5E6SA 1Q11A 2GPWA 3NDJA 5EJ5A 5KQLA 3BXEA 2G1UA 1L5OA 1ZC3A 1E2HA 4O2AF 4RVSA 2C2YA 2X8WA 2ZRNA 3U7RA 4RHEA 3VDMA 4IR7A 5J59A 3P94A 3P19A 1S4QA 1UXKA 3STUA 3OLXA 4I2NA 1ODCA 2CNBA 3TI9A 5KQRA 2NU6B 2B9VA 2PKWA 4WCDA 3E7DA 3C87A 5TMDA 2EG5A 5IHXA 1SU8A 1UPAA 2C58A 5E1OA 2PV7A 3NGXA 4Q4HA 1T36B 2Z83A 5H3LA 2BFCA 3SX0A 3DKPA 3WL6A 2WKWA 1ZGJA 5HKAA 1OUMA 1AUXA 1SCAA 3NT5A 3UPDA 5CDFE 1H6CA 4WKPA 5KIAA 3LWBA 2BKLA 5JZBA 1G8GA 1HI9A 3GXBA 4PO9A 3L1VA 1FFSA 1M5UA 4LYEA 3HK2A 1RE0A 4M0CA 1HE8B 1RWXA 3IT1A 1V2HE 4KLNA 1DRVA 1QAOA 4LRSB 2D2FA 2QZZA 4X1YA 2HA4A 1ZIYA 4JLAA 1QX3A 4OQLA 4ZAFA 1R12A 2IQ5A 2DTDA 5CX1B 1A9ZA 1ODIA 2XEXA 4LRUA 2F8TA 1M34B 4M8IA 2C9DA 4MW7A 3FW1A 4C6TA 2V0NA 1OWLA 1U2PA 3NVAA 3O83A 5B7PA 3I01M 4F4FA 4ED9A 1ESZA 1NOJA 5AK5A 1EG7A 4CNQA 1ECCA 5KDDA 2QIPA 2IH2A 3UWMA 2OG2A 4DRXA 5MFPA 4OL0A 2F3QA 1E9FA 3ILHA 5KYNA 1O95D 4G67A 1JAZA 1EINA 2F8LA 1N3IA 1AGNA 1EP2B 1XNQB 2W93A 5HS4A 5K01A 3FROA 3GCWA 1RYHA 5KOYA 3P9PA 4GM4A 2QVCA 4DOMA 1XCPA 4W5OA 1E2LA 3AESB 1BN7A 4X84A 3EISA 5G1NA 3B1KA 5P21A 1Z6AA 1VCNA 1NVDA 2HB6A 2QN9A 4W9NC 1PZNA 4K86A 3VVBA 1SO8A 4RJKA 4I55F 1YJCA 2VNHA 4G0ZA 4JJ4A 3NORA 1PJZA 1WKVA 1KVSA 1UK8A 3CN7A 1O6FA 1OR8A 1GZSA 2DQKA 4QG7A 1B42A 1QG2A 2W71A 1U2EA 2A9JA 3Q6IA 3R77A 5EMHA 1Z3CA 1E7YA 2CJWB 4D25A 4UHEA 3EDMA 1ORTA 4RH1A 1E5QA 1YKFA 2UZ4A 1L5MA 1X6VA 3AF2A 1T5HX 3P1JA 3Q12A 2ZB3A 1MENA 3L7NA 1XELA 4UNIA 2XRZA 2ZAMA 3PNVA 3VDNB 3DZGA 4NG4A 2WJWA 4MJLA 5LZ5A 1HQKA 1JAYA 1PQUA 1OWMA 3O3CA 4KTTE 2PKYX 4OJQA 4RD6A 3QW4B 4S3MA 4WZ6A 4G1VA 3GG9A 3KR0A 4QRHA 3V80A 3UGJA 1CQWA 1QS0B 3EEQA 1XKLA 1V35A 2HA6A 4O2LA 5IN4A 3JQAB 5B1EA 2DHDA 5H0IA 2BEWA 2QPLA 2FRDC 4E5DA 5KEIA 3H8VA 2FHPA 2FB9A 3R0JA 1YZGA 4BEJA 3QEBZ 4JU8A 3ICWA 3VPSA 3DDHA 2FKNA 4HQNA 5DMHA 1RAGA 4BNDB 4HDNA 1Y7IA 3P71T 3TZCA 4DRXB 1L3CA 1H85A 4POAA 4B81A 1PJLA 4AS1A 5JFOA 3W4IA 4RWZA 2QSZA 4HQRA 1BFDA 4UD6A 1OFTA 3NDPA 2IZ7A 4HH0A 2G9QA 4Q6WA 3Q8XB 1RP1A 3B60A 4WKOA 4S1NA 1Q91A 5AXBA 1QRUA 2GPYA 4XPZA 1EJ6A 3HL4A 1O54A 2HRZA 4M2LA 3UCFA 1PVVA 4HWGA 3CX3A 5A02A 1J9GA 4BUCA 1LI7A 3CX7A 3ABQB 2N47A 5IDQA 3JR3A 2H2AA 2IYVA 1GAXA 2YWRA 2QM3A 2WHYA 2V8BA 4CI0B 3PT5A 1JDJA 1M8GA 4BO1A 4C4PA 2FFAA 5AW9A 3HXQA 2X14A 2D2EA 1NL3A 2DZDA 3ETHA 4NC9A 4NS4A 3EVBA 2R2GA 3KUUA 3P5SA 4YP0A 1MDBA 1P2UA 5G1PA 4DMGA 4N3AA 1QO7A 2GBPA 4OGWA 4CKWA 2EV9A 1RC1A 2AKAB 2GH1A 2I80A 3DTVD 4B3HA 1JR4A 4OSPA 4L6CA 5G1OA 2I6FA 4G26A 3QA3E 3QYAA 4OA8A 2VDWB 3MFYA 2EFDB 5AW2A 2QUIA 4B7XA 2ZAYA 1Z62A 1Y9ZA 2GVZC 3UXEA 3RU3A 3KVRA 3V2IA 4RELA 2R65A 1L6RA 4U2CA 4YFYA 4ZMRA 3CVJA 3G7SA 3PJEA 1A8UA 3HNRA 4Q93A 1VYTA 1Y1PA 1AUQA 1Z13A 3DZ8A 2GLXA 1K8QA 1Y80A 3P27A 2A94A 3I6YA 4HJRA 4FINA 4BB0A 3A2KA 1U5CA 4ZU1X 1I10A 1OC4A 1HKHA 2Q1WA 3W7BA 2G9NA 1P0CA 1RBYA 2O2SA 1NF3A 5ARBA 2UYGA 5ITWA 4TL9A 2WPDA 2J9XB 2JGDA 1KY5A 3JPWA 4FGSA 2ENUA 1UXJA 2POCA 1QOZA 3GARA 4KMRA 4CG0A 1IVSA 4RPKA 3ZE8A 4G25A 4LJYA 2G5TA 2QMZA 3LXMA 3SKXA 3EEYA 2QUBA 1W94A 3A6DA 4L0MA 1DBQA 1ST3A 3KAPA 3QLUA 4XIFA 2IUUA 4KBGA 4DR3B 1DV1A 1RKBA 2C4NA 2I7DA 1C9MA 2ZJYA 4GR5A 4J43A 3NKVA 3HRKA 2IHJA 4BRWA 2IY8A 4CCYA 3OOYA 2JD2A 2YRXA 2IYZA 3NKLA 3NKFA 4ITUA 4JR0A 5EZYF 4BY9E 3P2EA 2EKDA 1DT5A 2QMQA 3ZDRA 5C18A 1ND5A 4XQ9A 3QVOA 1CP3A 3UA3A 1Y42X 4R69A 3V2UA 4MV1A 4F8JA 4H3HB 4P33A 4NKRA 1L7BA 4JVSB 1BGVA 2BWJA 1KMHB 3RVSA 3GJZA 1QORA 3BMOB 4TPKA 2DHCA 1KJ8A 4N12A 2AMYA 3F8SA 3AUAA 3GRRA 4HQFA 3VKUA 2JGRA 4R2XA 1CUBA 1X7HA 4M9UA 3V34A 3ZW7A 4JB3A 4OUDB 1MJFA 4FSXA 5C37A 1K3UB 3IUBA 3IUYA 4JLKA 2OT3B 5I01A 1YDHA 1GTL1 2NUPA 1XZGA 3L40A 2GESA 2YMLA 4WK6A 4E5SA 5FI0B 1J20A 3RU7A 2GJKA 1Q6ZA 3HCOA 3ZNQA 3DE7X 2OQVA 2AFRA 4BKRA 2OC4A 4W9MC 1NVGA 2JIRA 1BC5A 3GJRA 5M04A 5HM8A 3EVZA 1NUUA 1OTXA 4K9SA 1HT3A 4I66A 1BXZA 4FYKA 3R9XB 3LUFA 4LHWA 2J0VA 4X5OA 4DCPA 1I3KA 3AVXA 1QGED 2WPNA 3B9PA 1PT7A 3S2FA 5D7NA 3BIWA 4FFVA 1L5HA 1R0SA 1FK8A 2A9VA 5EE5B 4R40A 2PGNA 3EDYA 4IDNA 2TMGA 5IPFA 5K8IA 3TG8A 4AX4A 3TO5A 2B37A 3BB3A 5I48A 1I80A 4JJIA 2QG4A 4YUXA 1LTKA 1JFTA 3DKVA 4R1UA 3ORYA 3HJHA 3ZGOA 4RV9A 1CVRA 2G5GX 3BMCB 2Z3VA 2QTLA 1JHZA 1GL9B 3QG1A 5AHRA 3VOAA 3N2LA 3PF8A 2GN8A 2ZETA 3S2GA 1E6UA 4C05A 1RLMA 4DANA 4F92B 5BOVA 1L4FA 2WYUA 2Z98A 4HNSA 3K35A 5FPYA 1L5SA 1BX3A 1OC2A 4CT0A 2P69A 2Q5CA 1OFIA 1P4GA 4ALLA 6PFKA 2G0TA 4LJ4A 5UKDA 2PZMA 4YP5A 5LA6B 4UQLA 2O7NA 3P32A 2QVYX 3ZI7A 4DLBA 3PDIB 3QHAA 4OQXA 2ICAA 3H99A 1H8HA 3MWEB 4I7EA 4Z4GA 2OBFA 3DEKA 2EBUA 4DSNA 1ESCA 1UKBA 3K9GA 3LVBA 4L5IA 2AN5A 4AKIA 1XXHE 2ZYAA 5CXQA 4YPVA 2R5NA 4F21A 3FA2A 3IO3A 3PEVA 4G09A 3NEJA 1N5LA 3FUUA 1GNSA 2X22A 4YT4A 1VPDA 3FZGA 3FKQA 2C4VA 2X1VA 3L1JA 3O2NA 2Q2OA 3SF0A 5TLSA 1G38A 4HT3B 4QUDA 1KK0A 3RGWS 5KOJA 2XKAA 1PFYA 2V74B 3HFRA 3MJDA 4PF1A 4ZDIA 2DBQA 1GR1A 1UKVY 3V42A 3ZIDA 2QAJA 3N2KB 1LTHR 1TF5A 2YNMC 1OFGA 3Q10A 3SGLA 3EAFA 3GFPA 1FUYB 4GDMA 2FUEA 4EFDA 3MELA 1X9GA 1YS9A 2ONJA 1PZGA 3PI6A 5DNWA 2DLCX 2QN8A 5JFGA 2PJRA 5MN6A 1M2NA 3PSAA 2RG1A 2AR9A 5I51A 1PQWA 1F6BA 3DEHA 1H3NA 2XMCA 1DADA 4HRVA 5CT5A 3MMNA 3E05A 4JGBA 3RRJA 4C20A 2XZPA 2VNIA 3OEHA 3TKLA 2XJ4A 2WUEA 1PVDA 4DN6A 5F98A 1V3QE 1OB5A 1FEZA 4M7WA 4X20A 1XDDA 3SU8A 1UFOA 3P2IA 4O4JB 2Z2JA 1H9CA 1NZFA 1YZNA 5CT4A 3RFUA 2ZP1A 1U7ZA 2VPWA 2P2YA 5A3QA 3N6RA 2J08A 3VTKA 3TGWA 5CW2A 4CV2A 2P41A 1IG3A 2BC9A 3JQ9C 3QE9Y 5JFTA 3H8WA 1A4IA 1DBPA 1UP4A 2I2DA 1O03A 5LMNB 1P62B 4V0RA 3ZCSA 1H65A 1K75A 2O6HA 2NU7A 1HEYA 1RJGA 3BDIA 1QHEA 1CUUA 2ODPA 3LNCA 4B76A 4P82A 4YCDA 1G8SA 5TQ2B 3RU9A 3D54D 4FT2A 3TLYA 1DPFA 1XJ0A 3FYUA 1KKUA 2CLIB 2W2PA 4YMSA 5IAKA 2FPGA 5THQA 3SHWA 2FPRA 2IELA 5AKZA 2HHHB 5AKLA 2I33A 4C0SA 2IEBA 3SXUB 4ZVVA 1VLZA 5EXPA 1E9CA 2FPPA 2XAAA 1EWYA 2NSHA 4Y2VA 4ZO9A 5TGDA 3WLKX 3BIOA 2VHYA 1G20E 5GWXA 3KJEA 2BGWA 3U4MA 4EVRA 4JLVA 4UDYX 1LC0A 3UANA 4IIHA 3FNGA 1IJEA 4Q12A 4YMIA 2BE7A 1QU3A 3P9IA 4EIWA 4BB5A 3QOFA 4MI6A 4IWYA 4MITA 1S6YA 1Y8AA 1IBRA 5KNBD 4LY3A 4BMOB 3ZGYA 2PRSA 1WO8A 3T5BA 1MKYA 4PSAA 4YRLA 3ETNA 2WVAA 1XTZA 1NYTA 3GP8A 2CLHB 1CKEA 4UNQA 3ZHQA 4DWOA 1D7OA 3LYLA 3W5DA 3GHHA 1AHPA 3U48A 4YRCA 2W6MA 1KY2A 1J56A 2W6PA 1N5DA 2XNDA 2RHWA 2FV8A 1ZW6A 2WAOA 3R8XA 4DJJA 3C3MA 2O23A 4Q18A 3VBCA 2J07A 4CJXA 3T0GA 4POOA 2BGGA 3GUVA 3NCTA 2J7PA 3IQGX 4PR3A 1FUUA 1TA4A 4TL7A 4JHXA 3GLGB 3CB4A 2OORC 4D8TA 2G40A 2XIJA 3FZYA 4Q7JB 1VL1A 4C5AA 3DCNA 4RQTA 2YN0A 3DMTC 4M89A 3BBLA 4O4LA 1NXOA 3HDJA 5D2CA 3L7DA 2BHLA 4JI8B 2I6TA 3E1KA 1U2QA 5ALNA 5J3JA 1K68A 3RC1A 3ZWDA 4M9RA 4D5GA 1Z6QA 4KFRA 3WYCA 3BE6A 3HWRA 1NVTA 2GK6A 3T7KA 4KFTA 3UHJA 5HEKA 4LF5B 2RDMA 3A6EA 3D81A 3NNSA 4JROA 3OUUA 4GYKA 3NBUA 2Z8XA 4FR0A 3RARA 3R3XA 1CW2B 4ZIRB 3IL2A 1K7SN 2C8LA 3GFFA 221PA 4GEKA 5D3KA 4RTLA 1SWVA 2ZULA 4M3NA 2H4ZA 5FKJA 5A03A 3U80A 2XE8A 4KXFB 2OGZA 2NU8A 2YINC 5ALRA 1QANA 5IVKA 3GT4A 3E7WA 1YO6A 3PDUA 1RKQA 3DZIA 1ZHFA 2WYOA 4LOLA 3QJ5A 3KR2A 2QK4A 4DG9A 4LJ7A 4N5MA 5CD9A 4Q4LA 4EOGA 3AHIA 1I5OA 4PLYA 5TVKA 1ZIXA 1NJ2A 2YX1A 3N2EA 3Q7SA 4JC5A 2JZNA 2WHRA 3ELUA 4YS6A 2QMUA 4KTVE 2W70A 1JW9B 3REFA 1WUTA 3GRUA 3ZZ0A 2B3TA 4AECA 5HIKA 2O2DA 1FBTA 3LDAA 1TIPA 1YJQA 3DLHA 2OBBA 2VQDA 1SOVA 3C6BA 3LHKA 3E6AA 1SUSA 2QNIA 3OD1A 2YOHA 1I6MA 3LT5A 1H9AA 5EESA 2UV8A 4TS4A 2PGOA 5BY2A 3EGOA 4DA6A 2ZIZA 4OQDA 1SZJG 1DHRA 2PQ2A 1CP2A 4K8RB 3BSSA 4FZRA 4P8RA 4LF7B 1ANKA 4DUGA 3EG5A 2NO4A 2GJ8A 4YH1A 3B6MA 5LBUA 4YRDA 1B14A 1A7AA 7ABPA 4A0QA 5TEVA 1OZ0A 1KO4A 3MYRA 4TUYA 4WASA 4X8HA 4NICA 3HBMA 4OP2A 1BU8A 1UZUA 5AOAA 2KBFA 2Y99A 1JR3A 2ZPAA 4ZOLF 2RGCA 1HDCA 5ALUA 5IKXA 1RJWA 1HFEL 1TJ5A 3KV1A 3MD0A 3AUFA 5HBGA 4ZQCB 3K2EA 1U8UA 1QM5A 2ZJAA 5HMLA 3GCGA 1E3IA 1GZ7A 2ZIXB 3CNOA 3FCXA 4AJPA 3WA7A 4EFKA 3DO8A 2VCEA 3U3DA 1CVLA 4OJTA 2VTDA 3QYJA 3GROA 1F0YA 1JSCA 3RK4A 3ZJUA 3I2KA 2I1VB 3CF4G 4MQ6A 3QELB 1M2WA 4DLKA 3UKOA 3U5TA 4XD2A 4MVJE 1ZN2A 1GL3A 2V55B 2I71A 3DD1A 3PUKA 4L0CA 1ZVVA 2PD3A 1XJ5A 3NWPA 1QHXA 4J6FA 3GX1A 4U7WA 4XDHA 1EB8A 1S8AA 1HRKA 5LU8A 3HCPA 5JAIA 1JHAA 1PT6A 1RWPA 5ALXA 3Q85A 3TCNA 3ZNOA 7YASA 3W79A 3B8HA 3QFSA 1NJ8A 3FD8A 4GRAA 3TVTA 3VR6D 4M8NE 1KAMA 1BZYA 1MVOA 4DMCA 2PWZA 4EG5A 4XX0A 4KB5A 1OASA 1C1DB 1HFWA 2COKA 3FZNA 4GM0A 1JRLA 4UAVA 1GCOA 2GHQA 2J3LA 2G4CA 4EA7A 1UXIA 4Y2UA 3LBHA 2QX4A 2WILA 5LXTF 4XWOA 3IDAA 2UZ1B 1OIWA 4EPXA 3FKJA 1QIFA 2NYAA 3AUKA 3EOBI 4OHOA 2DLNA 5I7FA 1SVKA 3CIOA 1V8PA 2BJHA 2IIVA 2NACA 2RGGA 3BDAA 1MO6A 1N3YA 4J0KA 3ZE0B 3S40A 4AJ2A 2O8FB 2AMLA 1JPNA 1P77A 4AG3A 1R8QA 5EIAA 3N74A 3A7EA 2JHFA 4U3JB 1B2LA 1VPLA 3OPXA 2JZCA 4XR4A 1PGOA 1VI2A 2XZLA 1CSEE 2XUOA 4TXNA 1U9JA 4YMWA 3CRW1 1NR7A 1VFNA 4P7GA 1T0JB 5D6NA 3B7PA 3K16A 4P0TA 1W88A 2VPZA 4S35A 1P7YA 2W4MA 3NDIA 4M7RA 5CG2A 4ND8A 3NOQA 5L3QA 1PTJC 3DP7A 3H11A 3I37X 3K05A 5KKAA 3H4MA 2VCYA 1DAMA 4ZVQA 3BD6A 4XAQA 4YCJA 5PGMA 1W0KD 1R0CA 3IODA 2ORWA 4R8MA 2VZEA 1BEZA 5KB3A 2VJCA 4HYYA 5M34A 4NZOA 1JFSA 1PQYA 2XA9A 1W96A 3RT1A 1HWYA 4B43A 4BN4A 1DCTA 1PFGA 4J1TA 4NJMA 5L4NA 2PCJA 2XOKD 1USWA 3EIHA 1U3VA 1T34A 4XDGA 5EP4A 4HLUC 1C0EA 1ZMBA 4ZVSA 4BVLA 1XLVA 1RI1A 1ABBA 4GX5A 5TPWB 4DKXA 4BX9A 2PGDA 4D82A 3TEJA 5JC1A 3BUSA 3M9WA 4B34A 5EHGA 2RAVA 1RWBA 5B6JA 2NUTA 1KVRA 5HIJA 3PWSA 4A8JB 4B46A 3K0AB 1ISIA 1CD5A 2BMJA 1P75A 1ZH4A 2QLBA 4NWIA 4X7BA 3UJAA 1U2DC 2VHUA 3WB0A 1IBCA 1Z34A 3L06A 1RYFA 3BSWA 3GFGA 1DAFA 3K73O 4LXUA 1RQ7A 5EQDA 2QBYB 4AY2A 3E8XA 3ASZA 5K3EA 3HV2A 5BSKA 2QL5A 4BE4A 5CK5A 1YDFA 3U44B 3QV1A 3IVGA 3CUUA 2Y92A 3HP7A 2GFIA 4DNOA 1AQNA 2RGWA 1OXBB 3ZJYA 4KIGA 1KDZA 2WSSA 4IG4A 4U0KA 3FVRA 3RVQA 1QAMA 3KS9A 4EW1A 3AONB 4LXXA 4OYRA 3I23A 3VR2D 3EDCA 1KETA 3U9TA 3ZIUA 3F4LA 3BHJA 5T8KC 4DT1A 4UMEA 2AMJA 4HSEA 2OV3A 3P2KA 3W1WA 1C9JA 4MMYB 1GILA 2IZZA 1YF3A 3PHBE 4N0DA 3DTVA 1NM5C 2HSZA 3T5TA 3V9PA 2QL6A 2WFZA 3CW9A 3HL0A 5C35A 1F7VA 1PUJA 3WGZA 4P22A 5HJ7A 2YYAA 4MEBA 4UTOA 1ULTA 4Q9IA 5F1PA 1JDSA 3T5AA 5DP1A 2XT6A 3C85A 4RVHA 4W1SA 4WFJA 1RRPA 2C9MA 3KZXA 4ZXFA 2JIBA 4YEDA 1XD8A 2QD2A 4IHJB 4K6CA 3M4JA 5JJBA 3LUCA 4HGPA 4OKNA 1CUJA 1ZK1A 4GOKA 2QM7A 1XYGA 5HK9A 1KI6A 1U7TA 2NX2A 2P11A 1JJIA 1JLHA 1IHOA 1L6IA 4WK0B 3RQSA 4BQNA 4LF6B 4OYYA 2Z5VA 3LY7A 2RGUA 3OCCA 3QPUA 3MAJA 2JLCA 4Q9DA 3SZGA 2OFWA 4UVEA 1XEWX 3DG9A 4YWJA 1ZOLA 1YRYE 2E4VA 2PVSA 3BMQB 4TMYA 4ML3A 3EMBA 1F9AA 1Z88A 3FN4A 4OB8A 4BX2A 1XIVA 1ZRHA 2HBQA 2QTVA 4OMDA 4N9QA 4OYLA 2YHSA 5JBQA 1BQEA 2PTGA 3F6CA 2J9ZB 4BLPA 2W7TA 2BGLA 2JAHA 3B78A 4MWEA 4FEYA 3M5CA 3VHLB 1VHJA 4H15A 3ZQ4A 4D3FA 1A9XB 1PO7A 4F3RA 4REOA 1BW9B 4IRMA 4KXVA 1Q1AA 3WIUA 3F1KA 4KVFA 4D1YA 4M1KA 2XSZD 1VLVA 3NHKA 1BOOA 4JJ6A 2FMUA 1J0BA 2JKVA 4ZV9A 2HJ9A 5L7WA 1CQIA 1VCIA 3LRTA 2CF6A 2GD0A 4DCTA 2GI4A 5FUWA 5C8ZA 3TBHA 1O1YA 1Z5GA 2Q29A 4OBEA 1AKQA 2I67A 1BTOA 1RM0A 4CQLA 2R8RA 1SUCA 5FBHA 3PCRB 1PR3A 1JEYA 1VJCA 3EXG1 1MD9A 3CLHA 4PFKA 1W59A 3HA2A 3IQXA 4TOIA 1U81A 3L7IA 3PQFA 1F4LA 2OMEA 2P5YA 3E22B 4FD2A 5AW8A 1EZZA 2HC9A 3KBOA 5JDIA 3WIDA 1NSFA 1YZYA 3VPXA 1S89A 4JLOA 3T38A 4NH4A 3FTPA 4UMDA 3U1BA 1T5TA 3O6VA 2HREA 3CLRC 1X3LA 4MPDA 3K9FC 2PBZA 3RB8A 2QP3A 1A2KC 2PM8A 2YQ4A 4FNGA 3AFOA 1N5OX 3ZNNA 4DV6B 1A5ZA 3M3PA 1R6DA 2H16A 3O8NA 3ZLBA 2RI6A 3GEIA 3PNLA 3O3MB 1JQEA 3K4PA 4Q66C 4PLFA 4E51A 5J43A 2DFPA 3O4FA 2VJAA 1K7XB 1XMSA 4DKJA 4RW0A 1V4NA 2NW6A 4ANFA 4NJMB 2P2ZA 2NO5A 4E2WA 4H6WA 5J4VA 1ZD9A 3BYZA 4FDMA 5ER9A 2C7PA 3OE1A 2PX8A 3L7JA 4IS3A 4K6MA