4M7RA

Crystal structure of the n-terminal methyltransferase-like domain of anamorsin
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
180
structure length
180
Chain Sequence
DLGTENLYFQSNAMADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal methyltransferase-like domain of anamorsin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Anamorsin
total genus 61
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4m7rA00
3KR2A 4IKPA 1VP9A 1I4WA 3PX3A 3B3FA 3QOXA 3B3GA 3TMAA 5T64A 1NV8A 2FRXA 3HCEA 4OBXA 5DTQA 4F85A 3M70A 2C7OA 3KPUA 3LBYA 4CTKA 3TKAA 3L8DA 2PY6A 4R05A 4DM3A 5E9JA 2BM9A 2Z6UA 4E31A 1NKVA 4FT4A 3A27A 1F3LA 5DX8A 1BC5A 4AZVA 2ADMA 3OPNA 1NW3A 1MJFA 1KYWA 3R3HA 4CWAA 5K0BA 3G2OA 4BLVA 1JG3A 2QRVA 1NE2A 2YUIA 4FP9A 3FPFA 3OZSA 3FTDA 4PWYA 1O9GA 1BHJA 2BR3A 2AOUA 4U7TB 1JSZA 5CVJA 5E9QA 1YFLA 4HGYA 4XUDA 1JTFA 5LQKA 1Q0TA 4RTKA 4QPNA 5DM1A 2YVLA 1JG4A 4X63A 3T7SA 2YR0A 2NXNA 1ZGJA 2Q41A 5C9ZA 2OY0A 5FADA 1INLA 4OBWA 2OBFA 3SM3A 5HZMA 2XBMA 2ZLBA 2NP6A 4AZTA 4RTQA 3SSMA 2ZWAA 4ZTBA 3G2QA 3UJDA 1NW7A 1G60A 2O07A 3P9KA 5KQSA 5E8RA 2B25A 3KQTA 4LWOA 4C04A 4DMGA 5ICGA 5CIYA 3B3JA 2H00A 2B2CA 2QRVB 5GOZA 2V74B 3C6MA 5FWDA 1DL5A 4DQ0A 3GRUA 3KPWA 2E5WA 3EMDA 1XTPA 5ICFA 4L7VA 1KP9A 3KPVA 4XUEA 2EG5A 4IV8A 4YMHA 3IYLW 5GIPE 4M36A 3LCUA 3BWYA 2IDKA 4JXJA 1L1EA 2FPOA 4E2WA 3F4KA 4KRGA 2PX8A 4WVLA 5FA8A 3HCCA 3NTVA 5DRYA 3FUWA 2PWPA 2PLWA 4LECA 5C1IA 3DMHA 3OFJA 3KQMA 1L3IA 2Y1XA 3DLCA 4CXMA 2BH2A 3MTIA 4KDCA 4YUXA 5E1MA 3HVJA 3HA7A 1EG2A 3O31A 4E2XA 1ZKDA 4EK9A 1D2GA 2ERCA 3EGVA 2DPMA 2JHPA 2PXXA 4HGZA 5H02A 4HSGA 3V8VA 1HNNA 4PYJA 4GF5A 4ISCA 5FUBA 5KVAA 2P3QA 1XCLA 5LQNA 5EMLA 1ORHA 1QAOA 1X19A 3KR1A 2NXEA 2PX5A 3DXZA 4PYIA 2HV9A 5EVJA 2ZZKA 3AJDA 5D1NA 5HIJA 4DKJA 5EZQA 4KIGA 3MCZA 3LDGA 3PB3A 3LBFA 5LSAA 1IM8A 1T43A 1NV9A 1VLMA 3FPEA 1SKMA 5DXJA 3BWCA 3OU7A 2AOTA 3KR0A 5K0JA 3UA3A 3T0IA 5E2BA 4CKEA 4MWZA 3LX6A 5MHTA 1G6Q1 5DRTA 3UA4A 2YXLA 3BGDA 3IHTA 2XVMA 3ELUA 3A7EA 3NWBA 5CD1A 3C3YA 4HTFA 1X1DA 3OU6A 4GEKA 5DLYA 1L9KA 2HWKA 4Z2YA 3MAGA 1ORIA 2VZ9A 5GP1A 2GPYA 1VP3A 5M5BA 1NBIA 1AQJA 3RODA 1SG9A 5DT2A 2VDWA 3TRKA 2LD4A 4PINA 1XDUA 1PRYA 5HEKA 4PCLA 3R9XB 2G72A 2I7CA 5DSXA 4YUWA 2GLUA 2IH5A 3HA5A 1WXXA 5DX0A 5DM2A 4GQBA 4AZWA 3DLIA 4MTLA 3WSTA 3KQSA 3NJRA 2ONZA 1N2XA 1O9HA 2G1PA 1HMYA 3NW9A 5F2KA 3P2KA 4A6DA 5KYGA 3HCBA 3HVKA 1R8XA 2B9EA 1VBFA 2BR5A 2JH8A 3SSOA 4A6EA 1YUBA 3EVDA 3P9IA 2NXCA 3BGVA 3JWGA 5DX1A 3BWMA 2R3SA 5EEGA 2GB4A 4EQZA 3HVIA 2IBTA 4YV2A 4F84A 4YV0A 5FA5A 2XYQA 3JWHA 4C03A 1V39A 1I9GA 1XDSA 3BKWA 3RW9A 3ID6C 2I62A 2O06A 5ICCA 2ONYA 1UWVA 3A4TA 2JJQA 3MGGA 1JG2A 5EGSA 2BR4A 4PGHA 3M6XA 1YZHA 3CGGA 3ME5A 3OFKA 5LQAA 4PIPA 2PSSA 4AUKA 3O4FA 3CVOA 5FULA 4RVGA 3LKZA 4HH4A 3I64A 4RTJA 4P7JA 1UIRA 4FGZA 5EEHA 4E70A 4RYLA 4RTRA 3HVHA 4X1OA 5EHGA 3I58A 3HEMA 1FBNA 5FTWA 3UJ8A 4OX9Y 3GRYA 5FQNA 3A25A 3GGDA 1FJXA 3KQVA 2ZBQA 4NECA 5C0OE 1FPQA 1DCTA 2PWYA 3FUUA 3P97A 1OR8A 4R6WA 5P8WA 2C7RA 3EVBA 2IGTA 5CUQA 3THRA 1JR4A 2CWWA 1RI5A 5FWAA 2GS9A 4M38A 5K0LA 5U4XA 2HTEA 4C05A 5DTMA 1VIDA 3GIWA 3P9NA 5FHQA 1VL5A 3TLJA 4ER7A 4GOLD 1EIZA 4R8SA 5CVEA 2PT9A 4P7FA 3UZUA 5K01A 4XCXA 4ATNA 4B17A 4P7KA 1XJ5A 1KIAA 2OYRA 5K09A 4E33A 5JUWA 5T6BA 1P1CA 3EVEA 3FUXA 4GC5A 5T67A 4C06A 2G8NA 1JQDA 2P7HA 4RTOA 2AN5A 3GDHA 5CCBA 3AXSA 2IH2A 1ZG3A 3FUTA 2CMHA 3DMGA 5IKMA 4PYNA 5K8VA 5CVDA 3FRHA 3GCZA 4P58A 3LSTA 4RV9A 1BOOA 1QAQA 4FSXA 4FT2A 3TPZA 4RTMA 3OU2A 4IV0A 1O54A 1F38A 3I53A 3CJRA 2IP2A 2HMYB 3G2PA 2B78A 3M33A 4KW7A 4WXHA 3R0QA 3DP7A 3TQSA 1EAMA 1UFKA 1ZQ9A 3B5IA 3BKXA 2WK1A 4HRAA 4ER0A 1VE3A 1VPTA 2ZWVA 2ZIFA 3KQQA 3BXOA 4E2YA 2AOUB 2CKDA 1M6EX 2QM3A 4LWPA 3BUSA 1DUSA 3P9CA 4OQEA 3ELWA 3G8BA 4FSDA 2EX4A 4DCMA 2P41A 2AOWA 2JHAA 1YB2A 2AZTA 3GRRA 2AN3A 4PYQA 1XCJA 5DXAA 5DM0A 1RI4A 2GA9A 3KKZA 4PYOA 2VP3A 3SMQA 9MHTA 5EKXA 1QYRA 5HFJA 2PBFA 2CMGA 3KQOA 3OZTA 5EKUA 2VDUE 1D2HA 1TPYA 5GM1A 3EEOA 2UYCA 5E9WA 5EMJA 5FCDA 5CM2Z 2YXEA 1EJ0A 1FP1D 3MHTA 3FTEA 1G8SA 1KPIA 1R8YA 1I1NA 1SQGA 3DOUA 2P40A 1QANA 2IFTA 1SVUA 5ICEA 2ZFUA 5K0CA 3GU3A 5HOQA 5DPMA 1P39A 2UYOA 4PGGA 2XYRA 4GUAA 2UZ4A 1MHTA 1X1AA 3EMBA 4ER6A 1M6YA 1KYZA 2AVDA 2ZIEA 5EC8A 5GINE 5EIFA 3PLAE 2OKCA 3M6WA 4RVFA 3NMUF 4E30A 3KPYA 3VSEA 2P3LA 3Q87B 2NXJA 2PV0A 5GIOE 1P1BA 3TM5A 1NW6A 2KW5A 2GH1A 2HNKA 2EFJA 1R00A 1QAMA 3MB5A 1Z3CA 4FR0A 3P2EA 4UOEA 4YV1A 1JTEA 2ZULA 2P1DA 3TOSA 4H0NA 5EG5A 4GOMD 2AOVA 3GRZA 4RVHA 5K0NA 1RI1A 2ZVJA 2K4MA 4PYLA 4CKBA 4YUYA 3B89A 4PYKA 4EKIA 4V0RA 3EGIA 4G56A 4HTFB 3FPHA 2A14A 3E8SA 5K0GA 2Y1WA 3LCVB 2ZBPA 2ZBRA 2AVNA 4GBED 2PVCA 1JQ3A 5F2NA 1AV6A 2P8JA 5KS2A 2WA2A 4ER5A 2PT6A 3FPJA 3MQ2A 5E8JA 2R6ZA 3NVKI 1TW2A 2PJDA 3DR5A 5FQOA 1KPHA 3AXTA 3DH0A 2ESRA 3REOA 3HA3A 3MERA 1IY9A 3NWEA 3ORHA 4KVZA 1P91A 3PS9A 3CCFA 1RJDA 3T7TA 3ER8A 3TKYA 4DF3A 5K0FA 4M7RA 3G89A 3NDJA 2QYOA 3KR9A 8MHTA 3CJTA 5EOVA 1SUSA 1XXLA 4PYMA 5D1HA 2Z6AA 1WG8A 5EPEA 2FYTA 1R18A 3ELDA 3B7PA 4LG1A 2YQZA 3EGEA 3KPJA 2V7EA 3G7UA 3P8ZA 4PONA 5CVUA 5EMKA 5EHIA 2I6GA 3FZGA 1SUIA 3EPPA 3FYCA 2N47A 4RTPA 2CL5A 3ANXA 3BGIA 1EJ6A 3HCAA 2OXTA 4BP1A 5KQRA 2XYVA 4DZRA 3BZBA 2JHCA 3GWZA 1RJGA 2YX1A 2IH4A 3K6RA 2YXDA 4EKGA 4F86A 3KHKA 2IBSA 5B1SA 5E2AA 1H1DA 1KPGA 3SX0A 3EEYA 4GC9A 3GJYA 2C7PA 2JH9A 2ZSUA 4FS8A 4QVGA 1JG1A 2EJUA 3M6UA 3PVCA 4PIMA 1NW5A 4O29A 4X41A 5EQJB 2NNWB 1AF7A 1NW8A 3CKKA 1SQFA 3DUWA 3IV6A 3LGAA 4OA5A 3LDFA 2QE6A 3UJ6A 3HTXA 4CTJA 3KU1A 1TW3A 3UJAA 3V97A 5GWXA 5HIMA 10MHA 1G8AA 1WXWA 5HIKA 3HCFA 2AOXA 2P3OA 3SR4A 3UJBA 3U81A 1NT2A 5DSTA 4P7GA 3M6VA 5E1BA 3THSA 2OO3A 2O0LA 3LPMA 2XVAA 4KIFA 3VC2A 2H11A 1PJZA 4QVKA 4R8RA 2QY6A 5BW5A 1L3CA 4MIKA 4V0QA 2UYHA 2BM8A 2O57A 4PCAA 3FPGA 3EVFA 5IH3A 3ER9A 3GO4A 1KR5A 2YTZA 2NP7A 3SXJA 3E23A 4AX8A 3UBTA 4EMSA 2ZCJA 3E7PA 3IEIA 3FUVA 3QV2A 3LECA 2ZW9A 3PTAA 2PKWA 2AR0A 2ZZMA 3M4XA 1B42A 2OPBA 1R74A 4X60A 5DTRA 5BXYA 3D2LA 1XVAA 1ZGAA 4RTSA 3UWPA 1RJEA 2PXCA 4QPPA 3LDUA 2DULA 4Y2HA 3G88A 4C4AA 2VS1A 4QQKA 2OB2A 3OE5A 3A7DA 1Q0SA 3OZRA 4QDKA 3RIEA 4EVIA 2FCAA 3JWJA 1XDZA 3PX2A 4E32A 1FP2A 1G55A 3DXXA 2FHPA 5EIWA 5F2OA 4E2ZA 4U7PB 3LL7A 1X1CA 1JQEA 3UJ9A 4BLWA 4RSRA 3BT7A 3HM2A 4BP3A 3P71T 1N7IA 2P7IA 3HCDA 3PFHA 5GM2A 3S68A 3I9FA 5EZSA 3LCCA 3DXYA 3TFWA 5BW4A 5K03A 5DWQA 3VC1A 3PFGA 4XUCA 4RWZA 3TR6A 1EQAA 3HP7A 3KQPA 1AQIA 4RTLA 3X0DA 2AS0A 3P2IA 5K05A 1RJFA 5LQJA 1WS6A 3GNLA 3C6KA 4KDRA 4QQNA 4Y30A 2AN4A 2H1RA 5CCXA 5BP7A 3BWBA 3KQWA 3MTEA 1QZZA 2VDVE 3UJ7A 5E1DA 1L3BA 2FK7A 4DCGA 4MHTA 2UYQA 2OB1A 4RX1A 2IIPA 3O7WA 2FK8A 3OCJA 1YFJA 1YF3A 5FHRA 3MCTA 4HC4A 4RVDA 5E1OA 2P35A 2PXAA 4GOND 2B3TA 4RTNA 4BLUA 1U2ZA 3FRIA 3FTCA 5CVVA 5ERGB 3FYDA 3G5TA 3K0BA 3CJQA 5HIIA 4PNEA 2GAFA 3SVZA 1Y8CA 2HR1A 3AWIA 4OA8A 2IDJA 3QOWA 3SGLA 1R6AA 3Q7EA 1KXZA 4FZVA 4QTTB 5LQUA 1N7JA 1BKYA 3OE4A 1X1BA 2ORED 4ER3A 2PX2A 3UFBA 1RI2A 2NYUA 5LQCA 4X61A 5K0EA 1M0EA 3FTFA 4QDJA 3A26A 3HNRA 3R24A 1KHHA 3EVAA 3T7RA 2G71A 3JWIA 4YUVA 5LQRA 1VQ1A 5G02A 4GOOD 2JG3A 1IXKA 5HILA 7MHTA 2G70A 4IWNA 1D2CA 1ZHFA 3G2MA 3PT9A 4M37A 3H2BA 3ELYA 5JR3A 2IPXA 2F8LA 1NBHA 3KQYA 4MQ4A 1WY7A 3TM4A 4C08A 4DA4A 1G38A 3NDIA 4YUZA 2O05A 3LHDA 4K6MA 2OZVA 1RI3A 2AOTB 5EMMA 2BZGA 2EJTA 2ZZNA 2ZTHA 3G8AA 3I5UA 2ZIGA 1WZNA 4QTUB 3ERCA 2PGXA 3NVMB 2I9KA 3GRVA 3E05A 3EVGA 4C07A 3DMFA 2Z6QA 3AY0A 3LKDA 3R6TA 3DTNA 4CKCA 2C7QA 5LR6A 1YZ3A 3CBGA 4R6XA 3G5LA 3C0KA 4KWCA 4POOA 4YMGA 3EVZA 3VYWA 4BY9E 4HG2A 3CC8A 4AZSA 5DM4A 2PX4A 3SSNA 3UJCA 3C3PA 3DULA 3GXOA 2WA1A 1JSXA 4OQDA 3EVCA
chains in the Genus database with same CATH superfamily
1KO8A 2OHOA 3ZE7A 4DAEA 2FJ0A 1KL7A 3QI7A 4DQKA 1PK8A 2EQBA 1UJ6A 4BFLA 1Z47A 4B4OA 2XGOA 2QN6A 2VJBA 1LJ8A 1W0JD 5HIAA 1XL0A 4GVPA 4YAKA 2QN3A 3FM9A 3VR4D 1HOTA 3BX1A 3MZ0A 2PY6A 2RHGB 4WX2B 3R5SA 3D8TA 4I4NA 5FLEX 3RFCA 1V8DA 4ZOEA 2BKLA 3ZCXA 4UU8A 4EW2A 5BN1A 2EQ5A 2PZKA 5KYWA 2Z1DA 2QMYA 4RLHA 5FWXA 4D0LB 3M5DA 3ORQA 3KTDA 4P4UA 4R98A 1SVNA 5TSDA 2ZREA 3SX4A 3VO1A 5B3KA 3IX7A 5KOJB 4K6KA 2ISCA 3UVEA 2QG9A 3ZNOA 4TTTS 3MELA 1VPEA 4HNAA 2GDJA 4PSAA 2JLAA 4O2BF 1C3LA 1G2OA 1YR1A 3H3FA 5F5XA 2IQ5A 4RTKA 2A88A 4IWYA 1V7PC 3F9RA 5DFAA 3CVJA 1O5IA 1ZL2A 1PV4A 1JDTA 2A2ZA 2Q41A 3PI6A 5EFOA 1GM5A 1CULC 3CE6A 1XV5A 2PJRA 4IVPA 1W8DA 4YJGA 1NMZA 1FQJA 2VHTA 1TA4A 4X9XA 2IEGA 5I7FA 4KWIA 5G1OA 4XVUA 3W8NA 5B7QA 1GIAA 3TH5A 2H2IA 1W48A 1T2NA 2V4MA 2VNHA 2WIAA 3E9RA 3SQOA 1PR5A 4ABYA 4CF3A 1GZSA 3WHPA 5GQSA 3OQJA 4LY0A 1XTPA 3C70A 3H2JA 2EG5A 4FXPA 1YQXA 3OFSA 3QWBA 4O2BA 2Y0DA 2QX6A 1J99A 2JFQA 2A92A 3OQPA 1XDGA 3M3PA 1WXQA 3SG0A 5HKLA 4CMEC 3NTVA 1JQ5A 4J0QA 2A6PA 2ZSKA 1QP0A 4FTWA 4OOFA 1NPTO 3I05A 2Y1XA 5EWMA 4IGIA 3CRVA 3ZGLA 4U39A 5BSKA 2G9ZA 2EEZA 2ZRFA 3C3AA 3GA0A 3OFNA 3KZXA 3U3JA 5K0ZA 3FVQA 2HLNA 4EK9A 1D2GA 2WQ7A 5E6UA 3CZQA 3ZE0B 1ML4A 1PJTA 1NYLA 5G4KB 4EG1A 4XR4A 1VYUA 1UBOS 5HK9A 3EZGA 4GI1A 4LC9A 4RPIA 5JAQA 3RADC 4K6HA 4S05A 1Z6YA 4TSRA 1RXCA 1G5IA 2GFIA 3B1XA 1QSGA 5CDSA 4C2BA 1KBOA 1X1TA 5EVJA 4XJVA 4D56A 3A9UA 2FEAA 2WUDA 4ZVNA 3TQIA 3I28A 4BRZA 1PW7A 1XD8A 4RZQA 2AF4C 4RSGA 3TLCA 3LT0A 4AWBA 1T1JA 3DT9A 1K8ZB 1OCEA 4KREA 2CXUA 1GSIA 4FYWA 4ZIRB 1WHTA 1FEZA 1AZLA 1YZYA 2LNDA 4Y1RA 1DX9A 4EYEA 2L0XA 3CUVA 2BGUA 3IEPA 2RGDA 3K2QA 3B1WA 2FMHA 3FJOA 5L45A 1E8DA 1NBIA 1P0MA 2FZWA 3GLTA 4ILEA 1UOQA 4XIYA 4ZOLA 3AUKA 3FI9A 1SG9A 4E4TA 2I9PA 2YZMA 4HDRA 4DWVA 3R3JA 3O26A 3CEHA 2VJOA 3DFIA 1QH8B 2F3PA 1KE1A 1SRQA 3LUPA 3R9XB 4FX2A 1C9MA 1MIOA 4YUWA 4Y6RA 5BR1A 5AK5A 3ZHXA 3N3AC 5KEIA 2PU7A 4FCTA 4P4SA 5DX0A 1PR2A 2VQDA 3KSBC 2J5BA 4PCVA 1XRSB 1MORA 3IQXA 4ADSG 2V4ZA 1SBNE 3FMIA 4M1EA 3WISA 3GLIA 5DV9A 3SDSA 4KPYA 1P3Y1 3JWEA 2QK4A 1OLXA 1YASA 3ILYA 1N9KA 5ITZB 3VHRA 4LOJA 4D4JA 4HZUB 2VT3A 1WMEA 5EEGA 3IR6A 2EGGA 5T4BA 2XQFA 4DARA 2HQ1A 2JHFA 2YOHA 4RF2A 4WKBA 3RSLA 3BFJA 1MFPA 5D3QA 2IYRA 4V0ME 1J20A 2HCJB 4K9MA 5EFZA 1UKCA 4URHA 1L7MA 1XA4A 4L4YA 1QKIA 3MBKA 4GXQA 2XXAA 2ONYA 5KYNA 3EZ7A 1UANA 1ZM2A 4X94A 1JG2A 1C0PA 3HADA 2HH9A 4PBRA 1H9AA 4YAUA 2H2AA 3ME5A 1G9XA 3JR3A 5TMDA 5AO9A 4JVLA 8ATCA 1YHZA 5KQGA 3G0OA 5JDCA 4RHCA 1HFWA 3BCUA 4I36A 4NC9A 5FBQB 4HH4A 4LPSA 4ME6A 2RG7A 4KLNA 4XCVA 1NXWA 4C5AA 4B44A 5I51A 5KNDA 4XVRA 2QMZA 3DE0X 3ZDAA 4C0QC 4V2IA 4URFA 4BXOB 2IEIA 3UK7A 1ABFA 4WJKB 3W8EA 4BVJA 1RVV1 4JYAB 4P1ZA 2XMQA 2DERA 1KEWA 1EFTA 4V38A 1HRKA 3NI2A 1CNFA 5EUBA 4OI1A 3HNPA 3LVRE 4FU0A 3I01M 3N7UA 4MPTA 5P8WA 3TTXA 3VU3A 2ZRNA 1SNYA 1W88A 4NY1A 1XU9A 5IU6A 1OGIA 1RHJA 2C97A 2CHGA 4X44A 3V1YA 3PQ5A 4M38A 1TEXA 4C21A 1O6GA 3G9XA 1PNQA 2CV1A 3P9NA 3QNUA 2I87A 1J7KA 1Q91A 4FBLA 1U0GA 1SBYA 4W1QA 5EZYA 3SHVA 3EHDA 4DUGD 2GYVA 2ZRPA 5AHWA 5J43A 4GO1A 4Z9FA 2V9PA 1Z4QA 3JY6A 3R6GA 4KYVA 1UBNA 1SD5A 2G40A 4NFYA 3WB0A 2R8YA 1FFCA 2O8NA 2JPDA 1MXHA 1RZRA 3IBCA 1L8AA 5FFFA 3FUXA 1P2BA 4P34A 4C06A 1WB6A 2F1JA 5EIOA 3PVSA 3WLPA 4PZZA 5LP6B 1QVAA 1XSEA 2HJGA 3BXPA 4MEBA 4RL6A 2C59A 5AW3A 2J4DA 1YO6A 1SVMA 3FY4A 1GOTA 2E4WA 2WKRA 3C8DA 4QFDA 5FD8A 2YZGA 4B33A 4L95C 3IPCA 4BFXA 1ODKA 4ZGGA 4HFJA 1BIFA 1THGA 1MG5A 4EG3A 3OKPA 4TX1A 5HHTA 4PM4A 4TRRA 2ABWA 2FN4A 3BRSA 3ZV7A 3DLHA 3BWVA 5BVGB 3PRYA 1K88A 1HE4A 2HRBA 3LQ4A 1M2NA 4C20A 3IQEA 1VPTA 4HFNA 5HQ3B 4WESB 1CDZA 2XDAA 3PDUA 3PUZA 4JITA 1FDWA 1WD5A 4DVJA 4LWPA 3OHPA 2IKQA 1PR0A 1H6CA 4YASA 3IS3A 2C7RA 1FFBA 4DCTA 1XCJA 5JQGF 2R4TA 3UK0A 2VP3A 2OAP1 3FNGA 3G0DA 4CL8A 1FFYA 2J31A 3H86A 1H66A 2FP4A 3JQ6A 3WLTA 2RH4A 4BQPA 1S7CA 1O08A 2ID4A 3KVYA 2WF5A 1H2EA 3Q0IA 1UDBA 3VPXA 4BMZA 1G8MA 1DAGA 4AI6A 2M98A 4I55B 1ZIDA 5E9WA 1PJSA 1CHNA 1HE3A 5K45A 2QGFA 3ZWKA 1KPIA 3UK6A 1YACA 4MO9A 4G1BA 4U9IS 3ANSA 3H5AA 4GGOA 1TAQA 4PSKA 3ICOA 1SCAA 4NESA 1JR6A 3D6VA 1NSYA 1JX6A 1T25A 2PVPA 1I7SB 1OGJA 2UZ4A 1I3OA 1OBCA 1P7WA 3WMEA 4GI3A 4ER6A 4Q4DA 4WOKA 4ZI3A 3D8UA 1Z2OX 2QTAA 4TKLA 5K1ZA 5TJHA 2VVTA 3M6WA 4YDQA 4YFYA 1QBKC 1CJCA 1Y3CE 2LZ0A 2HCBA 3KJIA 4I8IA 3OX3A 4LTDA 2PV0A 2JIOA 4YROA 4MQLA 3QKRA 3ZU3A 3F49S 3HRHA 3KAPA 1ZUD1 3P2EA 2B9VA 4ZVRA 3LQ2A 4D97A 4YV1A 4H60A 1LTHR 2QUJA 5CDFE 3PGJA 4IM7A 4LOKA 1UT5A 4TWAA 4RVHA 3TIXB 4OHFA 2I4IA 2ZJFA 4XD2A 1DTWA 1QTNA 1R9JA 1WDTA 2NU7A 2W2VA 1KQGA 1I2ZA 3TGWA 1A4IA 4GPTA 2DSNA 4B3XA 3FPHA 5DYTA 1S3GA 2VDMB 5FL7A 1W5SA 3VDXA 3OEYA 4EJMA 3CU5A 1NI5A 3TW0A 4RDXA 3THXA 4OQPA 1FIUA 3UV6A 1VXRA 4R0MA 3LQKA 1ZI6A 3NVKI 1GN8A 5TB5A 2WE7A 4IL5A 1R27A 3ORHA 2P9YA 4YV7A 2AMVA 4JCCA 4PZCA 3SJBA 1UXOA 1RYBA 3HJUA 5EA2A 1PT7A 4NICA 5K0FA 3VVBA 2XNHA 4KACA 4MCIA 1J8MF 4YEDA 5C52B 4KFCA 4JODA 4FCWA 3P9QA 3A9WA 1AKYA 4H18A 2ZYIA 4QJ5A 3U49A 4PTLA 3TR5A 3ZLVA 1ZJYA 3HWRA 4FD3A 1AGPA 3KOMA 1DKQA 1ETHA 2XCOA 1BJTA 3FMVA 1ARZA 1LBEA 3K2EA 5CU7A 4B4DA 1MAWA 4DE5A 2WZQA 1I7QB 4WNCA 3H97A 5LBUA 3JQ7A 1ZUWA 3PWSA 4EPTA 2TS1A 2EAUA 5AW7A 4HPWA 2C4MA 5K3EA 3A1DA 3CRQA 3DDOA 4IVRA 2E21A 2XKKA 1ENZA 4IEIA 3KHKA 1MV8A 3GBPA 1G6OA 1PO7A 4EGSA 4ED9A 4BQOA 4JA0A 4ZOLB 3F4BA 3K1AA 2RHTA 5HA5A 5I7AA 1RYNA 3EZ2A 4UVHA 4K88A 2AMLA 1RTTA 1NASA 3HYLA 4HAOA 5D86A 3A2NA 4RMNA 1JHYA 4EF5A 4X1KB 5HZGA 2QZSA 1THZA 4JKIA 1X87A 2AG5A 3D8HA 4QASA 4BKRA 3GFFA 3QH4A 1N6OA 4PTZA 2IYZA 4LOIA 1ZIXA 2OQRA 4AP9A 3ZCUA 3B48A 1Y33E 2IRWA 4UDYX 3GJZA 1OB5A 2JFVA 4NQZA 5IN4A 2MYPA 2JJ2A 1Y98A 2ZSAA 4MMYB 4XUGB 3WL8A 3WGUA 1XVUA 3D31A 4BAUA 3ZH2A 4JUFA 2A5LA 2AUNA 2XMDA 1K6JA 1LLFA 2H8GA 3QLVC 3N6VA 1WB4A 2W0MA 3TL6A 4KIFA 1FY2A 4DLAA 4XDZA 3NBAA 3EGCA 4R8RA 1YS2X 1U5AA 3L0OA 4V0QA 3OJ0A 5IVIA 3SEFA 2CJFA 4R71A 1OX4A 1Z9BA 2HRDA 2A8YA 3CN7A 4MB0A 5TF0A 3QLVA 3JR7A 5K6AA 5DDIP 3OZCA 3F1LA 2AFIE 1K08A 1DIGA 2GHIA 5ALMA 4ZEOA 2P2LA 3JAWA 2ROQA 2ZW9A 1K0UA 2J3QA 2V96A 3FDFA 2ZZMA 3IBGA 1E3TA 3RC7A 1FVHA 1EVJA 3MPUA 2OPBA 2Z2IA 5GZ1A 3D2LA 3QKWA 1ZGAA 1XJWA 2VXCA 2GUGA 1V7CA 2AZ4A 2H1WA 3WV4A 3QVOA 3OQIA 4K86A 1YVUA 4BVGA 3ZXIA 3RRMA 1R15A 5FTLA 3L0BA 1LA2A 3RIEA 4C5CA 1U3VA 4OHVA 3K0KA 1P8JA 3OCWA 4NSNA 4H2DA 2HWXA 1VMAA 2WUEA 4RA9A 1FP2A 4R9UC 2NU6B 1OX4B 1ULAA 4MP8A 2GK4A 3V4RA 2ALJA 2ANBA 2V5UA 3L07A 4Q39A 4A2QA 4QA9A 3M83A 3FKSA 2RB4A 5DI3B 2DFKB 1LGYA 1AHHA 3TIVA 1BA3A 2WHEA 3KUUA 4V39A 4QLBA 4Y2YA 1WETA 3SHWA 4XUCA 1JZTA 4RWZA 5I7VA 1KJNA 3B7GA 4TXNA 4UDNA 4EA8A 3QXGA 1WKCA 4FNOA 2NV6A 4KDRA 4YALA 2PRIA 1VPWA 4I5IA 1CNEA 2JGRA 4HBGA 4NBRA 3S8EA 1QZZA 3QX7A 1JKJA 2BKVA 1W85A 1U11A 1IZ9A 1JIUA 1VL0A 4O4HA 2DUNA 1LY1A 5E1DA 5LB4A 1ZAKA 2QX7A 3T8YA 1MG0A 2W8BB 3R3ZA 4CCWA 1KZGB 4FYYA 4FEGA 2ON6A 1OT5A 3WMXA 2XCRB 3G2NA 5FHRA 3HHPA 2DE0X 2V59A 2CVOA 2PXAA 4IIGA 5UKDA 4BO8A 3E3MA 3IUSA 4PLGA 4BLUA 3BWEA 5ALYA 3PHJA 4Z3DA 4QGBA 6YASA 4YLYA 1Y1PA 4EA6A 4ZN6A 4CR6A 3UO8B 3SVZA 2QVGA 3SXUA 4CM6A 4F9FA 3JQAB 1QK4A 1B6TA 3OTHA 4U2BA 4O4IA 4ERNA 1QRSA 2BFBA 1REQB 2A1TS 4UU7A 3WYGA 1MUUA 3PNSA 5JXGA 2D13A 1VG0B 3ZY3A 4XKJA 5AK3A 4X1IA 1X70A 2GJ8A 4W6QA 3L7JA 3Q7TA 1ATIA 3K0CA 5EE5B 3OX1A 5CFNA 1ADCA 5JEDA 1LPMA 2XHEA 3B1FA 3H18A 1W88B 1MO2A 4Q1AA 1X80B 3H6HA 4ND5A 3N59A 5AKJA 4DDTA 8OHMA 1NKTA 3O2NA 5BSEA 3F71A 1SULA 2WTAA 1JN0A 2VJMB 3DM9B 4KTTE 4XR9A 3PT9A 3HUTA 5AJUA 3I5XA 2CEAA 4X6LA 5EJ9A 1J9GA 4UBMA 5IABA 3GLFE 2ASEA 4DUYB 5G2OA 2C7BA 3B2NA 2P6OA 1PKEA 2DXIA 3E70C 4YUZA 1J22A 2JIRA 3B2EA 2G9VA 3WG9A 1VZ2A 3ZY6A 3EYAA 5HWSA 2HXYA 3HPQA 3ZU5A 5EHNA 1XHEA 1WZNA 2D1TA 1WZIA 2Z08A 3KZVA 3K8ZA 3DVQX 3TVYA 3REQA 1PZEA 3UMJA 3NBKA 4EBBA 2POQX 3DMFA 1FMJA 4M1SA 1LUAA 1POXA 3HI6A 4LHZA 3TDNA 2EZTA 2BE7A 1WSDA 4HNRA 1I7NA 2NZJA 2UXCB 2F9MA 2EATA 2MSEB 2BKAA 3IAFA 2HSZA 3H7AA 5AJWA 4BFVA 2ZJ0A 4N6OA 2AJTA 2Q9AA 4CT4B 2BD0A 4EG0A 4NFSA 4F21A 1EHCA 4L9SA 3SHOA 4B7ZA 4F4HA 4XTCS 5LBIA 2ZWMA 3SSNA 3EIHA 3DULA 5LNK1 2OD7A 1K75A 4C6RA 1Y1LA 3GZTB 2EZ9A 2I6UA 1E0JA 3MSXA 1EX9A 4R2LA 1F8XA 1Q22A 1Z0SA 2CBGA 3AVPA 3FHLA 4L07A 4RY0A 1EUDB 1W6RA 2ZATA 2GHTA 4QOSA 3IRUA 3VH1A 3HLKA 1OFUA 2H9AA 3LZCA 2AFVA 3B9RA 3VPCA 3RB8A 2HU8A 4NU6A 4DQDA 2IX3A 3RYCA 2P5TB 3OPNA 4J7XA 1NW3A 2QPTA 4Z1OA 4O4HB 1F1BA 1X8XA 2ZP1A 1JG3A 1JIXA 3LV8A 4M9QA 2IU3A 4Q5IA 4WY8A 2PHZA 1OPXA 3AF3A 4A91A 3K73O 2HYIC 2AH5A 3T94A 5F23A 1A9XB 3H2ZA 1C0KA 5FI3A 2R65A 4BO5A 1FSZA 4D8WA 3WL4A 4JNCA 1CRWG 1NG9A 4GZ3A 3O4RA 2BUAA 4F2DA 3P26A 2EKZA 4BFYA 1D09A 4DJFC 3GPCA 5IJ0A 1M8PA 4X63A 1Q6ZA 1TLLA 2CLSA 2IF2A 1JEQB 3MUFA 4IILA 4K1LA 2OFPA 3LBIA 1VCNA 5A6SB 4MIEA 1KFKB 4B34A 1JFLA 1GV0A 1XZBA 3EUFA 3JQ8A 4GPZA 3F6EX 4S3MA 4BCCA 4QQ8A 2JEYA 2GF9A 4AJKA 4B32A 5A5FA 2VTBA 3KT8A 4BECA 1TB4A 2XDWA 3IALA 4LC0A 4Y9RA 2X4LA 3HXTA 5FTMA 3C6MA 4UDXX 1NR7A 2Q3LA 4B71A 1W581 2AC7A 1YDEA 3BFKA 4A15A 2QPAA 2Q9UA 5FUWA 3S29A 5JVDB 1MR3F 1L4LA 1ZCAA 3DHEA 4O4LA 1GY8A 4OJNA 5I7EA 5PGMA 1VRVA 2N46A 5FI0B 4BNKA 1KY2A 3I2JA 1NVFA 2MSWA 1GCAA 3I76A 3DMHA 4FOSA 4LVNA 4FHCA 1HK7A 1CERA 3BMNA 4YPVA 1KETA 3HU3A 2FPLA 3KJNA 4G84A 3LY7A 1WUYA 2ZI6A 4G24A 4TKUA 5FI5A 4J3NA 3V8VA 2CE7A 3EGVA 2JHPA 1RPNA 2ECQA 4AP5A 3KXKA 3U3XA 1VM6A 4YQFA 1QFXA 3HH8A 1DCFA 5FUBA 2ZIXA 5AI0A 4DLLA 3WL7A 2G82A 2BLNA 3DEKA 4RS4A 2MU1A 2QM8A 3D3QA 5H4GA 2HV9A 1W44A 2CDCA 1DG3A 1L9XA 2QMQA 3T54A 5H3CA 1RQNA 3NOXA 1T43A 4ND6A 2ZVQX 1MW8X 1SO8A 3CQ9A 1B8PA 1GCIA 2FSGA 2J3HA 1E3SA 2OWDA 3DDSA 4HDSB 4QOEA 2PRJA 4QRDA 2E89A 5CGZA 3BGDA 5EINA 4OXQA 2F3UA 2IH4A 3RVPA 3NHZA 3WAJA 4LYFA 4RXUA 2AQKA 1X1DA 2D1RA 2LTAA 2VWPA 4GEKA 1X7ZB 2HWKA 2JFUA 3EW9A 4KR7A 5GP1A 1DKUA 4BRSA 1XAHA 4EGCB 1VP3A 4L4SA 5M5BA 3NP7A 3O90A 4DADA 2G83A 1AQJA 2EW2A 2W43A 2CV2A 2BEWB 1OC2A 2Q6VA 2V8OA 3KE9A 4HMOA 1IEVA 3QTLA 4J0KA 3OQOA 4MH0R 4ZI7B 1QHIA 1FYXA 2BUCA 5A02A 1W36D 2QRQA 1OX5A 4IP0A 1EX7A 3EQZA 3WBKA 3OSZA 1ZJ4A 2VEOA 4I1RA 3ZD8A 5FWXB 4UMEA 3AFMA 4CCYA 3IL2A 5IKEA 4MTLA 2F2TA 3R0IA 1JR2A 3UGJA 3BXZA 2WYVA 4LV6A 3VR5A 1F4PA 1AX9A 1XLUA 5CFMA 4CQMD 4GLFA 3BFPA 4ZANA 1V48A 1OOEA 3HCBA 4C2UA 3W90A 3ASVA 1GLNA 2B9EA 4BBZA 5C32A 1NVVR 5KNCH 4F56A 3PQ2A 3OPQA 4FYHA 1C9JA 1G3IA 3DBLA 2WFAA 1SXGA 4FWIB 3X1MA 5EWJA 4TRMA 1YZKA 3L6OO 3S8YA 1E99A 4TWJA 5L3QB 2W6PA 2O8DA 4MUHA 4XQGA 1CUXA 1FNSA 1LQTA 1W2WB 1NBMD 4M54A 4AQYB 1D8AA 5EJ4A 3E9QA 4JJ8A 1NU6A 1MN6A 2DUJA 1VLLA 1Z2PX 4NCNA 1YNOA 4IIDA 4TQ9A 2JJQA 1BXZA 2GBPA 3LYUA 4LQCA 1DC4A 1FX0A 1QCZA 1P2TA 4L28A 3KT6A 5DHAA 3WKDA 4C9BA 5MN4A 4MV0A 3E6AA 1ZK1A 2HLDD 4BMNA 2PSSA 2OFFA 1GGKA 4EY8A 3C48A 5JI3E 2DQZA 2DT5A 2JA1A 4AULA 3BH0A 5G0VA 2GRJA 2XUDA 1KFCB 3RF6A 3CR7A 4KOEC 1C80A 2O5EA 1UJCA 2GSDA 1JH8A 3TUZC 2HEIA 2Z2JA 2G63A 4YPOA 3SM9A 1XD9A 4YJ3B 2QPOA 3LGSA 4RF3A 5AJYA 3KQVA 1AV7A 2FN7A 2VHEA 3RBZA 5F78A 5AVUA 3GPLA 4MB6A 3A32A 1D6MA 5K3BA 1CJKC 1U1FA 4L6AA 5JSYA 2JCSA 2NT3A 2IYPA 3ABRB 2VO1A 4CV2A 4KBYA 3GIWA 5HUQA 4QECA 5BV8A 3KVRA 5DEOA 1J2RA 1IEWA 1MB3A 1P9NA 3N8DA 1MEEA 2OZKA 1GG8A 1PG0A 2B34A 3IERA 1FK8A 1TDJA 3KUDA 3U7QA 2X5NA 2CUZA 1MA0A 1NLUA 2XUGA 4N5HX 1BHSA 1ZC4A 1WVMA 3EG9A 3F0TA 4LZZA 3OLWA 2JFZA 5E4JA 1K5HA 1CV2A 2GESA 1DMRA 4KITB 1E6LA 5CCBA 4LHXA 3DOHA 3HMKA 3FLBA 1PF7E 2A9JA 5LNK6 4TYYA 3ZS8A 2QMHA 1BOOA 5IBCA 3QITA 4INZA 1S2MA 3B1ZA 1FB5A 4C3ZA 4Y2RA 1WZEA 4OUDA 1Z4NA 1PGQA 2NPIA 4RQTA 3WYNA 4MVJP 1CKEA 2W22A 1W73A 4IO1A 2JZNA 1EAMA 5AI9A 4W8HA 5A0TA 5AOVA 4Z3OA 2QTFA 3ZGZA 1DJLA 2VF8A 1B2LA 1M6EX 1G0OA 2W37A 3CG0A 4JEIA 1P2GA 1P4SA 2ET6A 3NHAA 4L16A 3V8NA 2QUZA 1MP0A 2XITA 2VZLA 2YN2A 3TZCA 5IF9A 1QVRA 1IN5A 4MYDA 5BRAA 3ZD7A 1IBCA 4EDHA 4B09A 4ZMBA 1JSCA 3N1UA 1QYRA 3ZOZA 1WU7A 1NVUQ 2R6AA 1LKZA 2VRNA 2NU9A 2ECKA 3VOBA 4MROA 1SKUA 1TPYA 1H9CA 1DT3A 5G1PA 2FMIA 4URUR 5D5PA 2UYCA 1E3EA 2JAQA 3PL1A 1BWPA 1HPLA 4KQJA 2G6TA 2HQRA 2BFFA 3JVUA 4OK6A 1A4XA 2HF8A 2F3RA 2SECE 2UUCB 2XI4A 2Y1OA 4M99A 1IZ8A 5CVTA 5K0CA 4UCXA 4KNYA 4OQQA 2NTJA 4FYVA 4TS1A 1VHQA 2Z95A 4YS6A 4EJ0A 5EI5A 2ZJ2A 5TF4A 2CBXA 3ZKWA 4HVCA 1PS0A 4C6HA 1T5OA 2XMBA 3F8TA 1F8YA 3VR6H 1ZH8A 3BVPA 2UUOA 1H05A 3NKVA 1PSDA 3K8YA 3PQ7A 4HYEA 3ESCA 7MDHA 2J4FA 2JAXA 3BJIC 3LSYA 4KH1A 4EVRA 2WUFA 2EVWX 2WD7B 4Q1FA 2D59A 4DQUA 2YNMA 4BXOA 1KIFA 4JGGA 5CBPB 1JTEA 2NV2B 1JAHA 3TD2A 1ZNYA 3TOSA 1NM5C 1J5XA 1ZYUA 3L0PA 5EYPA 5K0NA 1TQ2A 4WT7A 3V48A 1XMIA 4MW9A 4JVSB 4ZYLA 4AF8A 2Q3BA 4C7JA 4W9MC 2PKQO 1BH6A 3IB6A 4GNKA 2BMAA 2Z4TA 2ZAYA 4ZZ3A 5AICA 4CIBA 3NH6A 5IVPA 2ZQYA 5FORA 4W5WA 3DB2A 2LPMA 3UC5A 4ZGWA 3CX7A 4RMGA 2WA2A 1TA0A 1YBHA 3WGQA 5C1BA 4MLCA 3A6KA 4AWAA 5ARCA 1FL9A 5FQOA 3EXHC 2NUAB 3OIDA 2X5XA 3NWEA 1K7YA 5TMBA 1B1AA 1ECCA 4UHEA 2QI9C 3CCFA 3TXYA 4EY4A 2EP7A 1TZCA 1KJWA 2FE4A 1V3QE 2ZJYA 3IMFA 4PLWA 4EPYA 4INOA 4LYAA 3NIFB 1TCVA 4TLCA 3G1TA 4AECA 3NDJA 1JWLA 2VT7A 1JU4A 4HEA1 4DLBA 3AR6A 4ZOBA 1XTIA 2JJYA 2OHIA 1GKLA 3AONB 1R9NA 2X0JA 1G3MA 2GVZC 4G67A 1DXYA 1LQ2A 1XTVA 2IZ6A 4WEQA 4OI4A 5L3RA 4BLOA 4HSEA 3G1WA 5IZCC 1KWKA 2H7XA 4N3AA 2FZ5A 1NUSA 1SUIA 1Q20A 2QZ4A 4FE7A 3RPEA 3IBYA 4MA0A 2XGMA 3TQRA 4NBTA 2CL5A 3GDOA 4HB3A 5JJKA 3KYIB 4EA9A 2IOYA 3SXPA 1U5BA 4XQCA 2RB5A 4EI7A 5C31A 3QU9A 2YRWA 4OU5A 2XB9A 3W06A 3GCXA 4KVGA 1GG9A 3BA6A 1RJGA 3VH2A 4XE5A 4PVDA 5BNFA 1Z5VA 3NCTA 2YWCA 3PUKA 4Y0NA 4JGBA 1U0TA 3UJHA 3GJYA 3RBXA 2C7PA 2JH9A 3NS7A 3KZOA 2GR9A 1PFUA 4NG5A 4BZWA 2BVNA 5IJWA 1UXJA 3IV6A 3DWEX 3L05A 4OA5A 1SHTX 3LX8A 4UOQA 1T3HA 1GN9A 2QUBA 1C30A 3IR7A 3UJ6A 2EFHB 3HDJA 3R5FA 2WYHA 4YJKA 3OA0A 1VSQA 3DDZX 1JHRA 3LVFO 4FD2A 2AG0A 4M7OA 3OWHA 2PWAA 5I01A 4BRWA 1WEKA 1OAAA 4K9PA 5YASA 3DFFA 5JI2E 4FIDA 5CK5A 3I2HA 2H16A 4R54A 4CQJA 1M1XB 4LQDA 1NN1A 3RYFA 1Q7BA 2ZITA 4MRMB 3VR4A 3WGVA 1L3CA 5BW5A 3ZK9A 3TBFA 1X6VA 4DG8A 1SD2A 3S1AB 3D8NA 2DR3A 4Q9NA 2IVFA 1DOZA 1WCV1 2C3UA 3TIFA 1GL3A 5LQDA 1C8VB 4G9GA 1VSTA 1SXHA 3TO5A 2NN3C 5AMXA 5H7XA 3U7EB 5K6TA 4MR9A 1FQWA 5D2CA 1WZ2A 1WSAA 2XMCA 3E7WA 3PQ4A 1MAHA 1BXRB 4FOOA 4RZUA 4A16A 1QDEA 2Z5LA 4PC1A 3RRBA 5KTTA 3N75A 4DUZB 2YOFA 4GZ5A 4Y2HA 1AUPA 3RSZA 5AQEA 2W2MA 3HXLA 1PYOA 3A7DA 1J7JA 1RKUA 3UK1A 4B3BA 1IPEA 3VMFA 2HT6A 1QZUA 3PX2A 2ZM5A 3RUAA 1C8LA 1EVEA 1GCOA 4Q7JB 1J1IA 1KZYC 3KHSA 2WU3A 4HNQA 1KDPA 1TM2A 1ZMBA 2CEKA 1Q77A 2RG1A 3ZHZA 3U16A 4YAGA 2XTMA 5JVDA 3LT1A 4QOJA 5DCUA 2R8EA 4HD8A 4HVAA 5L6LB 3ZIUA 3I9FA 2ZSJA 3VH3A 4OFZA 1JU3A 4I9FA 4WNIA 2IUUA 4ZZ1A 1U7TA 4F9EA 3ETLA 3HLYA 2A33A 5GJWC 3UMFA 4RD2A 1QFSA 1RWKA 4IDEA 2F3SA 1CVLA 4UJ5A 2AS0A 4E14A 3BBLA 3C6KA 2G07A 3C15C 2FGKA 1UINA 4L3WA 4LRTB 1RM0A 4UUOA 5JWHA 4FCCA 3S2FA 4XJXA 4REMA 4XD7A 1TT7A 4D43A 5AW2A 2C5LA 2I6SA 5EE0A 4MRAA 5ELMA 1K4MA 1E62A 1M2FA 3MINA 3A11A 2QN2A 3GV0A 2O2DA 2PGIA 3LBNA 2IIPA 3MSCA 3WA7A 2AD5A 2VDLB 1YE5A 2P30A 3IVGA 3DZFA 3AP2A 1FDTA 4DGQA 1ES9A 4OV6B 1QTRA 3T3DA 5ECYA 2ZJ1A 2VP5A 2HR1A 2AJDA 4NL4H 1OJLA 5E6RA 4TVKA 1TK3A 4O63O 5C8YB 4NBKA 1BWQA 4Z8XA 2ZEJA 3AEQA 5IHXA 2OHVA 3HMQA 4QTTB 3OX4A 3RJ9A 4ZK6A 2PM8A 1WDKA 3V42A 1ZXLA 2VLIA 1UOPA 2A5GA 2ID7A 3GP3A 4X61A 1DSSG 1ZWLA 2J9ZB 2C1EA 5EJ8A 1GPNA 3QVKA 3QPCA 1GZ5A 4NKRA 4OXNA 4S1WA 3HB5X 5EXTA 3UHAA 4CIVA 4UD2A 5I7HA 2IP4A 5JCZA 2G4VA 4BP9A 5ICSA 2C2YA 5BSFA 5KQPA 5C51B 1NVVQ 2ZYTX 4DZZA 7YASA 2IPXA 3LVQE 1NBHA 1O9BA 4HDOB 4B3TB 4J3JA 2HA0A 2H54A 4YGXB 2ZVPX 5I8ZA 4EI8A 4F96A 1DAFA 1JHVA 3CX8A 1LV7A 1Z06A 2EFEB 1QC5A 1A72A 3NHKA 2XYHA 1TCCA 3RVMA 1Z63A 1PEKE 2AOTB 4YP6A 2RGNC 4L6IA 2C5GA 1G7CA 2XCUA 3FCAA 4DRZA 1U80A 4BFUA 1BDJA 3SHTA 5GVSA 1BW9A 2ECPA 3GG2A 2Q3JA 1E9DA 1YS6A 4X6YA 1II8A 2OOKA 4G5YA 4RVUA 3WDLA 3EH2A 4AD8A 2NQ2C 2HPAA 4NCXA 4X7MA 4W4TA 1KAEA 1LDGA 3VPDA 1O96A 2QSYA 1PSWA 1JSXA 2AI1A 2HFJA 3C7AA 3IUEA 3VYSB 4CQMB 4MYSA 1UAGA 3STVA 1NNLA 1XKXA 4PAMA 5L7WA 4RCVA 5BMOA 2B2NA 3UH1A 4QG7A 1GGMA 1S8NA 4ETNA 2ZSEA 1VYHA 4MUXA 4BIMA 2AZMA 3PFFA 4OPMA 3PR1A 4YMUA 2X2OA 3DMDA 1O94C 1E7RA 3U5TA 1W36B 2XXJA 2SICE 3CVXA 3U4IA 2L18A 4I6GA 4LDZA 1OREA 5DGDA 4A0QA 3HK2A 4B4WA 3TLAA 2I7DA 3PC2A 3GZ4A 4BV3A 2LP4Y 3B38A 4R1UA 3BERA 3N58A 2EW8A 3FA2A 1PNOA 1BE1A 4RC9A 4N0MA 1D5WA 2P67A 3PENA 1B0AA 4ESEA 1KSJA 3A1UA 1E9AA 4F4UA 5LQKA 2FFQA 3SDBA 2W8BA 2J7KA 5CCEA 1JDPA 2WJ6A 3L06A 4M60A 1ZGJA 3G0CA 4R5MA 5E3HA 2V7TA 3SYTA 1QHGA 3SM3A 3CG4A 5IDYA 2RDMA 4WUTA 3LUBA 1WXFA 2NP6A 2X22A 1WR8A 5DBEX 1CY7A 4RMIA 1FZQA 4C3UA 4DV6B 1T4GA 2B25A 4V2UA 3B6ZA 4NS4A 4UVEA 5E2IA 1NRWA 2B2CA 2AYXA 2OLKA 3LCMA 3PPYA 4YRZA 4LFAB 3ZU6A 4QYMA 1I4DD 1K06A 2HYDA 4A2CA 1MVLA 4PHTA 1JH9A 1ND6A 1WLYA 3ZDDA 3CEMA 1G7TA 3OMLA 1FMTA 2HWUA 3RVLA 2VUSA 4IV8A 3PI7A 3HRKA 5F9HA 3ASUA 2HJSA 2RHCA 3BXHA 1XEWX 2IDKA 3F5MA 3SSAA 4HVLA 5KTMA 1A95A 2MSDB 3NBUA 3SR4A 5FA8A 2W71A 3TN7A 5HKKD 1V1MA 4YLEA 1YQDA 1P62B 1EWVA 1WULS 3HS3A 4Z4GA 2CUTA 1YQGA 2BH2A 2JI4A 1L2TA 3L6EA 3FWZA 3LLMA 4KDCA 4OSEA 1SIWA 2EU8A 2HPVA 1EG2A 4GDFA 1EVKA 1ZKDA 2WJWA 4LISA 4CN8A 1PV1A 1D0SA 1SKBA 4AXXA 3ELBA 3WLMA 4ZAYA 5IVKA 2AMYA 1OFGA 5KJCA 3NEYA 3KAJA 1K6XA 4ISCA 2PRYA 4QODA 4CPDA 3HVRA 1BN7A 4L5IA 3EIXA 1XCMA 2JGEA 1VHDA 4PFJA 1QAOA 2PMCA 4HRXA 1SU6A 1P7ZA 4Y2JA 1ZVVA 5D1NA 1Z4KA 3AMVA 4L8WB 5EZQA 4KIGA 4JMLA 4E03A 4WNAA 3LBFA 3O83A 4Y9UA 1BDBA 5LL6P 1SKMA 1FBTA 1NVWQ 3AHGA 4G85A 1GUBA 4IRMA 1GSAA 2X2PA 3FPKA 2WE8A 3DEAA 4Z0PA 2BGWA 2Z5VA 2B20A 5SYMA 1QF6A 1KGDA 5AYVA 2V7QD 3KWLA 2HDNB 4KL8S 2I4RA 4OF4A 4BEJA 4IHJA 1U28A 4ZO8A 1DXHA 5BN4A 2VQEB 1CZOA 4P6VF 2RKOA 5KINB 4XEUA 1RXUA 2GPWA 1EVIA 1SXPA 3U09A 2GNOA 5L4SA 5IUNC 1N2JA 1YE8A 2VUUA 4ZJZA 4BCDA 3HYCA 3FNEA 5JQWA 1GZVA 5AHXA 5I4IA 3LE8A 2P5SA 1Q14A 5I7UA 3H1BA 3H2IA 3QEMA 5B12A 2JATA 3ZQJA 1M7BA 5EIAA 1ZK2A 3K0FB 3NQ41 1E1NA 1L5GB 2GLTA 4TXHA 3GDGA 121PA 2CNBA 5IASA 1PVDA 2WY2D 3AP1A 3W1WA 4LCBA 2XT0A 1X8KA 5FJIA 2XUOA 2C3PA 1Q7RA 1U9ZA 3HCOA 5KJEA 1R8XA 4ECEA 2BR5A 1M1YB 4IDFA 1E6KA 2HK8A 1VCMA 2YY5A 3VJMA 1E0DA 1H1TA 3FHOA 2H0AA 1SHZA 2IBTA 3QE0A 3TLKA 1Z5UA 4G6ZA 1D03A 4CL3A 2W5UA 3ZX5A 2J3DA 3PPXA 4M2LA 2UZ0A 2C9YA 3BB1A 4C03A 4CCSA 1MMFB 5I9TA 2D1YA 3R5XA 3DTVB 3GLGE 5BSVA 4IPTA 5ECDA 2YL2A 1LWOA 3U1TA 1NTOA 2BR4A 5FPPA 3R3VA 1U0NA 4F12A 5G3YA 1PR1A 2AG8A 4EABA 3IAS1 4LWZA 3JCZA 1Q7TA 3O4FA 3N07A 1C4OA 5D6NA 5FULA 3SC2A 4DMMA 1F2TA 2PZLA 2Z1NA 3IJEB 4LYYA 5TR9A 4DJAA 3WQRA 4F9TA 2PKRA 2Z2ZA 3BHNA 5CD9A 1GPBA 3O8QB 4RIIA 4DPMA 2C2XA 4N39A 4RTRA 4E46A 4Q1CA 1TJ4A 3ND9A 1G8PA 1DIAA 1SB9A 2DH6A 1FYEA 1FBNA 1T4CB 3O9VA 4F3NA 4MQUA 2X5OA 1JEOA 4OIFA 3QFSA 4O2RA 1DQSA 4CKBB 2FSSA 2VHXA 4NECA 2PH7A 1IH8A 1L7DA 2DSTA 3FUUA 2EP8A 3MK31 4QJ4A 1N77A 4DHWA 5KTSA 1OWNA 2B94A 3PXGA 5A7HA 3V1KA 4MZDA 4LY3A 5GONB 3RYCB 5U4XA 2M1XA 2Q0XA 3VYRB 5DTMA 3WIDA 3FWYA 4MQEB 2Q5LA 2VPQA 4PNHA 4GOLD 3GLVA 4KPUA 2CCJA 1QTIA 1SVSA 2WDPA 3AZQA 5EJMA 3F6SA 4GD3Q 4NP6A 3AR4A 4GDMA 3K4QA 2QAGC 2QD5A 1IOZA 2GJ4A 3ENQA 4NBLA 5JUWA 5LYJB 4K2HA 2P0YA 1NMSA 3B5EA 1ZRSA 2OSVA 3GDHA 1J4AA 3ND6A 4EI2A 3D2AA 4RIEA 5B2ZA 3ZGXA 1XC7A 2VTVA 4RTMA 4LJ4A 5C5CA 2ZDHA 3N6RA 3L92A 2JKZA 1GXSA 1VGVA 3A28A 4RJ2A 2VNAA 2C42A 4MJ7A 4MGKR 3QUTA 2C8JA 3KQHA 2L17A 1A96A 5B53A 1US8B 3SLRA 3TQSA 4BGUA 2E3JA 1KP3A 1DIRA 1NC1A 1ZQ9A 3OT5A 2GFQA 2GTPA 3BXXA 5DI9A 4ZAVA 5AXDA 5IAKA 3U4GA 2X42A 4U6NA 4BTVA 4E6EA 1V9LA 1XJQA 2RBEA 2VAXA 4C6TA 4ZK2A 3ELWA 4DCMA 2C99A 4V0MA 1S2DA 2C58A 3MGBA 5BT8A 1RZVA 7MHTA 2W2KA 2P1ZA 2J45A 3JRNA 5LJIA 2HADA 3A1EA 4RVSA 2FEMA 2YFHA 2REBA 4PFSA 3JSAA 3TNJA 3DKKA 3F47A 3ZS9A 4ZVTA 5FLYA 1ONPA 4RU1A 4D26A 2PKYX 3O93A 1GPDG 1YAJA 3DBRB 3EEOA 1HRDA 3CHYA 3NCHA 1CUAA 3E9NA 3M5WA 1WY5A 5M2QA 4FYXA 3U13A 4LJKA 5TE9A 1QWSA 4A82A 3ACDA 1RXWA 1ZGBA 4ZDWA 1AIPA 2BI8A 2HNAA 5FR2A 3U0BA 2P78A 2FEKA 1NYRA 1J8QA 1Q11A 2HCRA 4KO2S 1W49A 4P36A 3LLCA 4P3NA 3VTAA 5EUMA 4A8JB 2J7PA 1GL7A 4GUAA 2GJ9A 2B30A 4JD5A 3RGGA 4ZJPA 2CJWA 1T1IA 1W0CA 3OPYB 1LK0A 2FW7A 4EY3A 3PLAE 4X24A 3OEHA 3NEAA 3R5HA 3JALB 3SOPA 4G2NA 1CY4A 1T8TA 2GI4A 3AVYA 1MRSA 5CR9A 3KWFA 2VDOB 3MB5A 1ZN2A 1WCYA 1QAMA 1A8UA 3W8DA 3C3BA 3WLKX 1LF5A 4AJPA 5BSRA 1MXFA 1QH0A 5J58A 1JMVA 2E6UX 1RKBA 2HA6A 1QGZA 4KXVA 3QJ5A 1DKMA 5JD5A 1U3FA 3F9IA 4KN9S 5CYGA 1IEXA 5BQOA 1XZHA 5A4JA 2HHCA 3W9SA 3UTDA 1IU9A 1E2BA 3D6TB 1E1CB 1J09A 2KMLA 4UFNA 3MQ2A 3FPJA 4JUDX 1L7NA 1ZOLA 2X3UA 4KPGA 1JFVA 1GKUB 4CKWB 2CJXA 3IV7A 4KGDA 3RVJA 1PHPA 3K5IA 3SQWA 2AEEA 3AG6A 2CWDA 2PKQP 2X86A 2E4UA 4MX8A 4PO9A 1AE1A 1E1MA 4CHGA 3CJTA 5IAAA 1XXLA 4ZVKA 2ZIZA 3AVTA 1CF9A 1V25A 3P52A 1DFHA 4HQFA 5L3QA 3EF3A 4B7AA 1GTSA 2A30A 4DLUA 4YHBA 4R3UC 4C4SA 5P21A 5EMKA 4DMKA 5KI6A 4N3CA 2H8KA 3C14C 2ZUBA 4EUHA 3QUQA 4YC7A 1HV8A 5KTPA 4ID9A 3UHOA 4EUEA 3AW8A 4FBMA 1REQA 4AN4A 4IZ6A 1FFXA 1ZJZA 3VZCA 5ALSA 1GYQA 1YBMA 3SNKA 3UAXA 4CMKA 5I9LA 3RTDA 1MBZA 2XF2A 2FXIA 3GL9A 1IQPA 1NXVA 1AVTA 3GWZA 3U44B 3WI7A 2WF8A 1I0ZA 2CVZA 1DQPA 2GAAA 4LBYA 2BFCA 3ANLA 5G1NA 1KPGA 1MOQA 5C53B 2W6ZA 3OOWA 2G5CA 4QVGA 2WF7A 1KAOA 2HB6A 1KS2A 3H0CA 4MI9A 1XXHB 4DNOA 4X95A 1OH5A 1HF3A 1OYOA 1M7GA 4V3BA 5EQJB 2GHQA 5AW1A 3WP1B 1FC0A 1LBSA 1HGXA 2NUPB 1O4VA 2NU9B 1K7FB 4HXYA 2VTDA 2X8LA 4JXZA 5F7OA 3V97A 3IOYA 4EWLA 4R7GA 1QDLB 4LXQA 1N5JA 5JFGA 4A03A 2C96A 1TMOA 4ISBA 2XV1A 3IQWA 1J25A 3JD3A 3EFOA 4JBIA 4M9CA 4PPQA 5JROA 3ADCA 4PSDA 2A7XA 3WXBA 5CYFA 3ZJYA 1L5SA 3OLXA 5LMNB 5GV7A 2BFMA 4NNPA 3IA2A 2IZZA 3EX7C 3N8NA 4ZZ0A 2OO3A 2V7WA 4H08A 3A0RB 4LN1A 5EKTA 1IAQA 2R2AA 3ZCTA 5BR7A 2WPDD 1XEAA 2GMWA 1E6EA 2ONKA 3WY9A 3K0AA 4KXNA 4MXDA 4FLFA 7ADHA 2UKDA 3ESYA 3GEDA 4NJMA 5DK6A 1WUHS 3GUCA 3Q98A 2OG1A 3UBTA 1SXJE 1ZD2P 1ZR2A 1NKSA 3H75A 1I94B 4FBGA 2OYSA 3TUIC 3J7AC 2DFLA 1EFRD 1E64A 4I2NA 3GLIB 1C2YA 3PYMA 3WLNA 1EM6A 3AL3A 4KXUA 2R48A 3ZV6A 3B3QA 2IHKA 2XNKA 1KOFA 4CG3A 2DULA 3DZDA 2RE8A 2PLNA 4BGEA 1E1KA 3MMXA 5B58C 1E0SA 1R0WA 3QNWA 1OH7A 4OFXA 1KFEB 4DBLE 5DHPA 2IY7A 4E09A 1XCOA 1IB0A 3LU1A 4FOTA 2BUBA 1R64A 2Z1MA 4MOWA 5J47A 3LL7A 4E7OA 3S81A 3NHWA 4L5JA 1G2PA 1WVGA 1PFWA 2XY4A 4TL7A 4KQGA 4PPGA 4GBMA 4TYWA 4PAQA 4KWEA 1W1IA 2BW0A 2PLAA 2PZMA 2XNDA 4NBSA 3KXDA 4UUMA 5DWQA 3S8MA 4DC0A 2H4JA 4QO7A 4I50F 1YH3A 1RTKA 3TW8A 2IYWA 4N9WA 5D85A 4KG7A 4QJIA 1WMAA 9GPBA 3L8EA 1Y4DE 1AG9A 4G8CA 2J6HA 3L7YA 4WKCA 5SZIA 4RD4A 5BP7A 1O89A 1APBA 4WZZA 2QDXA 1I51A 2AHRA 1KC1A 1E1QD 4YRTA 1KOJA 4JSYA 5ESXA 3OG9A 4ENRA 4E5MA 4OGWA 4DSNA 4PGFA 2I5PO 4EKEA 1SVKA 1A71A 2QU8A 4C1NA 3OCJA 5EIXA 4LNUA 1E2NA 3W5SA 4B7CA 1A98A 2IU0A 4EYOA 1DDGA 4XA8A 1D9XA 5ALWA 4PNPA 3ITEA 1YS9A 3X2EA 4YRLA 3ICWA 1UFRA 3P9RA 1Q1EA 2OPHA 3M9LA 1VIMA 3UANA 3JZMA 4HVTA 4DIFA 4LE0A 3WL5A 3CN9A 3ETNA 3FDZA 5LIPA 1U8AA 2HIAA 1M75A 4JLKA 5LDDC 3ZOKA 1QQ7A 2O0HA 5LQCA 5HKBA 4FPXA 3ZY4A 3OAAA 3NYQA 3PFIA 1UMCB 3EVAA 1P3DA 2J3JA 1D07A 3LCRA 4R51A 4URVR 1NNSA 3H2BA 4RTSA 3KQYA 4K9QA 4DDVA 1NQ5A 3G6KA 2R47A 3GRFA 3OTWA 3TUJC 4JQCA 5C1PA 1KI2A 4JFAA 3CKLA 2YXNA 1BWRA 4K6MA 4QGFA 1CP2A 3FJYA 3HB0A 3D54D 4Q4LA 1Q1QA 2NGRA 3VVMA 1MTOA 3N2YA 4Z4HA 3H0KA 2QW8A 3JD1A 1HZZC 3GRVA 3HA2A 4BASA 1YRWA 1SG0A 2XJ4A 4IYJA 4ZOAA 4TKVA 5HZKA 5KBYA 1E18A 2GZ2A 3AERB 1JLRA 3CPSA 3IPLA 4DYDA 2V5AA 3KKOA 4FKZA 2PIDA 3GPIA 1U0SY 4JLUA 1XVTA 4O4IF 1OLUB 3RAGA 3EZXA 5DGTA 1K1EA 2O54A 1ESNA 2FGJA 4WK6A 1N6HA 1JI0A 3E5NA 5JS2A 4Z86A 5D51S 4ALNA 4ZV9A 2EZ4A 3NT4A 5FO0A 4IJVA 2ZIAA 2EERA 3B3GA 4JJFA 2XT6A 5KOYA 2PS0A 3IUMA 1TRHA 2FRXA 3G02A 4OBXA 4Q82A 1RXSA 1XZCA 4IDAA 4R1QA 1EUDA 1FJ2A 1NBOA 4IDDA 4ZCLA 3T7EA 4WCFA 3OIGA 3F2VA 1V4BA 2PAAA 1NX6A 3H8VA 3QBJA 3LMKA 3R44A 2BM9A 4ZU1X 1XF1A 4U4AA 1B3BA 1CUHA 2PCJA 3I2GA 3CNLA 4JLBA 2H7CA 4ODIA 5DLEA 4PZEA 5DBFA 2IZOA 3P5SA 2G6BA 2WMOB 3ZX4A 4UUAA 4EZBA 3RRZA 3OZEA 4N03A 3FPFA 1MC4A 4YP1A 3L6RA 1EFCA 1CVIA 2PX3A 4KCGA 1RQXA 3HACA 3KB6A 4UREA 5KVSA 4F6CA 1JSZA 2IH2A 2FOIA 1Q0TA 3PXDA 3VTKA 5DYGA 3WSVA 3PEYA 1DAKA 3FHCB 3UMVA 2R1UA 1JE1A 2NO0A 1N32B 4LMAA 5CLFA 1QO0D 5T6MA 3W9BA 4B85A 3ED5A 1ZSNA 4DOMA 1UJ5A 4MS4A 2F8SA 2HJHA 3U1VA 1U7UA 2FPRA 4EBFA 4CMJA 3AHCA 4GWLA 4KC0A 1OI3A 4URYR 2X7HA 2AFIB 4QNRA 2JFNA 2W2OA 2J33A 4IDHA 4CRWB 1VG1A 4Q4AA 4N40A 5BYAA 4RZSA 3QKSA 4K87A 2XUPA 1YC2A 4BMYA 4QU5A 3AJEA 3HYNA 2E5WA 5ICFA 4XYLA 3Q2IA 4E4RA 2GXQA 3KELA 4HL6A 5DCLA 2HGSA 4IDBA 3RVSA 5K0SA 1Z5GA 4N82A 1T1EA 1L4NA 1G66A 2W2LD 1BFKA 3CIFA 3ETEA 3A4MA 3FTPA 4JJKA 2AD1A 1IOWA 2BE9A 1LI5A 2PLWA 1J2JA 3BCSA 4LECA 4LZWA 1T1GA 1V11A 2OV3A 3ICPA 1EHYA 1YIDA 1E2DA 2LE0A 4IDNA 5KNBH 5C4GB 4GT1A 4ZGBA 4WZBE 3AKZA 3ER6A 3JVEA 3G0IA 4FGUA 3S2ZA 4XPIB 3TSWA 3W6PA 3O31A 4E2XA 3DBHB 3LUGA 4QEZA 3T0GA 1OT3A 2ERCA 1TVCA 2GM9A 2X9LA 3D4LA 3GUYA 3JAWB 3ZQKA 2RJ3A 1I2DA 3OJCA 2BZ0A 3T4PA 1E66A 3C41J 3CF0A 4EH1A 1QPBA 5LQNA 4QUGA 2GAOA 3C8HA 2QKYA 3O9ZA 4HDNB 3RYHB 3T5BA 2WQ6A 1ZFNA 3GPDG 5A9TA 3LDGA 2HSEA 3QI2A 1XEXB 3LOQA 1II8B 4A8PA 3S7TA 4L5YA 2B4QA 3L7KA 3I61A 5FBHA 3DE3X 3UA3A 3SEQA 1VFPA 3LNTA 4YCLA 4B2PA 4ND3A 4D9KA 2G67A 1MGOA 3QXJA 1N3BA 3BDAA 5HPYB 1OXVA 1L8XA 1UBHS 2X5KO 5CD1A 4JWKA 3SVLA 1MQ9A 2Q8QA 2VCEA 4Z2YA 4BB5A 2P79A 2BEVB 3ND7A 2WJJA 4D02A 4RJLA 3JATA 4N3GA 2FFRA 1QUEA 2BFCB 3C24A 4NYMQ 5JC8A 1GJRA 3BRCA 4QU9A 4HMQA 4YRSA 3ZZNA 1AKUA 2AUTA 1UC9A 3N2ZB 3UV3A 4MQFA 1E2UA 1MGPA 1P60A 1YFKA 2H51A 2O6LA 3QWIA 3RABA 4FYIA 2G72A 5IWAB 2NZUG 2QXUA 1C3VA 4JIGA 2VHWA 3QIAA 4GQBA 1BD4A 4X91A 5MF6A 5FV7A 1KMNA 3KLNA 3D2BA 4MW6A 2NO6A 3NWPA 5IT5A 5JVDF 3ZWXA 2Y67A 5K4HA 1XN1A 2V55B 5FOSA 3CLSD 1XMQB 1QGUB 4CKXA 2HA5A 3ZJTA 2YNMD 3BICA 3BHIA 1TADA 2UVPA 3EDOA 3FN4A 1OLXB 3PC4A 4ZQHA 1QIJA 3FVWA 4WERA 4IVNA 3GBVA 2B35A 3DLTA 1E7WA 3CLHA 1KEEA 1WCIA 2ZGVA 3AK4A 5JISA 2JCVA 4O4IB 3ZLTA 3FD8A 2GPBA 3LXRA 4HN2A 1ESMA 2VR1A 4UULA 4BU0A 1QDUA 4CFYA 1N5LA 3KM0A 2O06A 4M98A 3WNCA 5D7BA 2Q8NA 5HUJA 3KBBA 2QV7A 5T4EA 1IONA 4PGHA 4U7WA 1T34A 3QVTA 4DCUA 1X86B 3IJRA 1V9CA 1W5EA 3IXQA 1CC1S 1RMQA 1RHUA 1XKLA 3EY9A 2Q28A 1D7OA 3TS1A 4X5OA 5KC8A 4B82A 5DK4A 3H17A 5KHAA 2LUOA 2PQ6A 3GRKA 5DKFA 5MGBA 3M89A 4O25A 3RTBA 4OXRA 1FP4B 1LPSA 2OBYA 1P80A 4MGIR 3B3AA 1AZWA 4FWTA 1TUIA 2IXFA 2FFBA 5JG7A 1CUBA 3P9SA 1NURA 1XVIA 2NYVA 2YWFA 1L4MA 1XZPA 1DC7A 3GNSA 2OKGA 4PLVA 2PWYA 5FUMA 1OR8A 2BFWA 5IT0A 3Q4GA 4MWDA 3RS5A 1QLJA 1XEXA 4JBGA 2GS9A 4WKOA 4XQ9A 1R12A 3AJ9A 4CQLA 5F3WB 2MYNA 4LZNA 3UQZA 4TXLA 3EK2A 3U17A 1IDOA 5C2JB 3SQMA 4Z4QA 1UF9A 3CNNA 1UBEA 1A77A 5KDLA 5CVEA 2PT9A 3UZUA 1MF7A 2GASA 2GZDA 2N3ZA 3R5JA 4NMXB 4WMLA 5BMVF 4ASUA 3TNFA 1ZLYA 5BPHA 2WC1A 3KJXA 5JY1A 1HOXA 3OCVA 4RK6A 5CITA 3IKTA 4JK3A 1LPNA 2PAFA 3C5EA 2P7HA 3DBOB 2VF2A 1NBAA 5ILQA 5SY4A 1G17A 2R1VB 5B4UA 3EOBI 1Z7EA 4KO1S 5DNEA 2M6RA 3HZZA 3UOWA 1KKLA 3W7BA 4MV1A 4KZKA 2B1RA 1DDIA 1OLSA 1WSWA 2AEMA 2FR0A 2JFXA 2ODPA 4D3DA 4KR3A 4YP7A 1Q44A 1B7GO 2WG0A 1A5ZA 3G2PA 2VRWA 1MPXA 4NBNA 2WILA 2HRZA 3NIGB 3P2YA 3RT1A 3DAPA 3QWFA 5ERYA 4B6JA 5AM3A 3QE9Y 1SBZA 2JD2A 2QHXA 1WX1A 2QTBA 3JZIA 4UHJA 4UKDA 1N6PA 1KJ9A 2HQSA 4UXHA 3O8CA 3QFRA 1XNRB 3OP4A 2P5UA 1A7UA 3BUSA 2M6LA 4IHJB 2QLBA 3E22A 3MJDA 3Q7RA 2B5VA 1HX7A 2GEUA 3R75A 2QT1A 2X0DA 4YRAA 3BEOA 3ROQA 1RI4A 2GA9A 2APJA 2J48A 1R8QA 2AX4A 1A97A 4GPIB 3ZHVA 4L3OA 4MRNA 4ZXPA 3W1EA 1EWKA 2I2BA 3GA7A 3GQVA 3UCXA 3RAFC 2DETA 1X8JA 1XEFA 1BXGA 5F1KA 2I8CA 1JPVA 3R7SA 2ZRCA 1MRZA 5BXQC 3JAKA 4CM8A 1R8YA 1JALA 2BHSA 3QU7A 2NAPA 1I4TD 3R09A 4HV4A 2EX0A 4JP2A 5TC4A 1E1QA 2RAPA 3OLYA 1TM5E 2YC2C 3WTCA 5CB4B 5K8CA 4B4KA 3PFKA 1XO1A 4WLOA 1IXSB 2C95A 2ZIEA 3CLUC 4FGWA 2H52A 4F6LA 4W8OA 5IHPA 1ZD4A 3GJ0A 3U4DA 1T5SA 3ITDA 1Q21A 3N39C 3VSEA 5D87A 3OZDA 3TM5A 1Y3BE 3OQ6A 2Y6VA 3EMKA 3B6EA 5DEIA 2YW2A 2GX6A 1X7YB 3RIYA 5BWNA 3COVA 2PL5A 4GOMD 4YJFB 1HM5A 4B40A 4YUYA 1F2TB 1YVEI 4UBNA 3T7KA 4V0RA 3EGIA 4EKIA 5J1SB 3ZWVA 3OAAD 2R68A 3I1IA 3ZWWA 5JCOA 3EPJA 2CLMB 3LCVB 4JR2A 3KEMA 4LBWA 4TV8B 2VSQA 1DLJA 5G0TA 1L7RA 1N2IA 1P4HA 1T2VA 2XW6A 3TF5A 4ZYXA 2J3LA 3KXIA 1PJ8A 1E3LA 2JGJA 4HX2A 4MLDA 4ER5A 2ILVA 2XTAA 3QMMA 4EA7A 2XPCA 2XWQA 4Q3LA 4QU0A 2O2SA 1EWTA 4RKYA 3ISVA 1X7HA 1IZ7A 5BQ3A 4AU1A 1T6NA 3GFSA 4ITRC 1ACMA 1IUOA 1GTG1 5BQFA 1VG9B 1I3CA 5ALLA 1YSCA 8MHTA 1JLLB 1MPTA 2AEFA 1E98A 3BE4A 5CH3A 5IT4A 1CG6A 1AB6A 2R8BA 3EGEA 3GGSA 2J67A 1RWPA 1M66A 3F5FA 1TIKA 3UMCA 4ALIA 1NAHA 2GO7A 1OZAA 1UBFA 2W93A 3ZCSA 4W63A 3M82A 5KVQA 2JBAB 3DOCA 1QRAA 1X0VA 2Q6IA 4WL0A 1H22A 4XWWA 1B2RA 4OQ4A 4WN3A 2VHQA 2X0IA 1ENYA 4NENB 2DCUA 1TKAA 2Q3DA 3HKBA 1DBWA 3DL0A 5ALIA 2O50A 3RUPA 1AO3A 1JR3E 3PZRA 3RVOA 1EQUA 5FPKA 4J0DA 3GPBA 3EEYA 1OLUA 3U7JA 1QOQB 3H8SA 4CTOA 3MT8A 4M7WA 1ZDMA 5SV2A 1JG1A 4Z4FA 1T5TA 3PWKA 4IQ0A 4O29A 1JE0A 3CLVA 3CKKA 4GI2A 3EFEA 4Y2SA 5C1OA 1RRKA 3BMCA 3P0RA 4CKWA 2BJHA 2GZ1A 4B3HA 2ATCA 4CTJA 3F78A 4EFMA 2A94A 3NANA 2QT0A 3OIYA 2EL7A 4GKVA 4DWOA 4ESHA 5IK2A 1TTTA 5K3SA 4DA7A 1W4CA 3AUXA 4KV7A 4EO7A 3WKCA 3VPFA 4BGDA 1N92A 2HMWA 4KXQA 4LTMA 2AOXA 3VPAA 4W6ZA 2EFDB 3UEOA 1RAIA 2OV8A 2QRGA 2OMEA 1RC8A 4LJLA 4OQYA 5EZYF 3V4LA 2XVAA 2VK1A 3AF4A 4XOUA 4AIIA 2AFHE 4CMHA 5CURA 2IYEA 2WRZA 2ZWPA 2IIVA 3INNA 5IH3A 1TUEA 3F3KA 1W94A 2JIMA 3EXIB 2NP7A 5CA1F 2OM2A 3MA0A 1E92A 2FQXA 2HJVA 3MNFA 5G41A 3T4EA 5CB4F 2ZCJA 1VKOA 3E7PA 3HZRA 4FJ1A 1FFGA 3SAJA 4BPRA 5C3MA 4H7HA 1ZR4A 3K2BA 2I2WA 4C1BA 2YVQA 3DMTA 3FOBA 3JQQA 4IJ6A 5FIUA 3MWLA 3FWNA 3C7KA 4A9AA 2LKCA 4NFHA 5B58T 5JH7B 4EG8A 1B8UA 5B6IA 3MJSA 3LDUA 3QF4A 3ROFA 4C4AA 2O7VA 3ZVRA 1QH8A 5A4MS 2CLOB 1I1HA 4I6JA 3IHKA 4RKFA 4IIJF 4BATA 3JWJA 2PNJA 1ZOOA 1JDSA 5LZ5A 4UNQA 3NUGA 3W8FA 1Y4SA 4OHPA 1G55A 4WBXC 1CEYA 5DXFA 2NUBA 1UDAA 1RZRD 1KVTA 2ES4A 2W2XA 3OE7D 1L5WA 4LNHA 1UEIA 4XCQA 3T4UA 2WWFA 3WICA 1XMSA 1JLKA 1QM5A 1T36A 4D4MA 4XXHA 3OCZA 1QJCA 5CFLA 2P2SA 2W2KB 3QSGA 2R7KA 1QQTA 1GRVA 1SCQA 1B1CA 2NIPA 1IM5A 1NQOA 1JXQA 2XUIA 3JZFA 4CDGA 5M29A 1D1TA 5K05A 5IBPA 3Q2OA 3LLUA 3OZXA 3QPVA 3R7LA 5AKHA 5CCXA 3KQWA 1CR1A 3AHEA 1VKJA 2DY0A 4IO0A 4Q0MA 3I12A 1MJNA 1VSUA 3SJCA 4IIEA 4I6EA 3D6AA 2CUNA 3MJFA 4DNPA 1L4FA 4YMIA 3VDQA 3H2YA 4F7WA 1OZHA 2OILA 3NBXX 1QLHA 4HOYA 1ZI8A 2BP7A 1B3RA 3DWGA 2UVPB 3R5TA 4R31A 2WD9A 1YU6A 1V9SA 1SHLA 1PZMA 1QYCA 1V5IA 4BKOA 1KGSA 2I3GA 3KKPA 1M2VB 1Z6AA 1WQ4A 5K4GA 3DDNA 1KS9A 3K0HA 2AB0A 4YB8A 4XOIA 5JD6A 2NPFA 5CXXA 3HL4A 2R84A 1IIBA 2FETA 2PKCA 4NZYA 3ZWNA 2YQ5A 4IVQA 4KE6A 4IQFA 1D04A 1T4MA 3HV2A 4FFBA 2NYUA 4WINA 2QP4A 3T3PB 5T3YA 4Q34A 1M0EA 3QEKA 5FPHA 3BGWA 3L6UA 1QH9A 4G2TA 1CS4C 1XE3A 3C3WA 5AW8A 2HPHA 3EXIA 3CUTA 2QX4A 2F8LA 4I9GA 1T0HB 4DV0B 4Z4IA 1Z6TA 3FWKA 2WKSA 3OTQA 3PXAA 4KK4A 3NHYA 1P45A 4JL8A 3EPLA 2SHKA 1SXQA 2IZ1A 3PQ6A 1QV6A 4MARA 1YOVB 2VHYA 2ZZNA 3PUHA 1NFQA 4GRDA 3E7XA 5CGQB 2D5CA 1UK8A 1XRMA 3N0RA 3ZDZB 3LKDA 1LLQA 2H1HA 4B76A 1T8RA 3MEQA 4NULA 2YHAA 5LR6A 2WAXA 3CBGA 3CB4A 3R9KA 3G13A 3AO0B 1LCIA 2WSSD 4I4IA 1WW2A 4EQ6A 3L0DA 3STYA 1BQEA 2PX4A 2J08A 3GDFA 3GN1A 1IRIA 2B0JA 3F7NA 4DSUA 4OQDA 2XODA 4Q7EA 4EG5A 1I4WA 3C6XA 1QG6A 3B3FA 4X7RA 5GJCA 1E5QA 3LDAA 1ZIPA 3OPXA 4E1BA 1WMFA 2C9CA 2IWHA 4BS9A 4B3GA 3Q3IA 3TCNA 4UVDA 3CZ9A 1H8HA 4BX8A 2IYSA 1JU9A 4KAFA 3UUFA 1E5DA 4PAGA 4NZOA 2O14A 5I8PA 3EF1A 1FA9A 2RK3A 4ZV7A 3RBVA 1NKVA 3IVXA 5B3JC 2P0EA 2XEXA 4K9OA 4OGKA 1K7CA 2HF7A 1XL1A 3O47A 4TV9B 2X0FA 2XT9A 3URMA 3VVCA 4Z7OB 3KQLA 5AD1A 4TPKA 5K0BA 4ZDJA 4DT1B 4OH1A 2OC9A 2QRVA 3PFBA 4BMVA 1NMQA 4Z2AA 5JC1A 5JZ9A 2DMRA 4UHCA 1PUIA 4ASUD 1H69A 3OI7A 1XZEA 1ZN7A 4AYXA 2NM0A 3DONA 2FVYA 2NSHA 1RD4A 2CXQA 4GX1A 3CLTD 4REQA 4HGYA 4JYMA 3O8RA 3GFPA 4N5DA 4NYMR 1M54A 2ZSDA 4YONB 1WVIA 1ZWKA 2O7RA 4BN0A 2QF7A 1XCBA 1PFYA 4IIHA 1EA5A 3D5QA 2PL1A 5C9ZA 2CVPA 4KR0A 2OY0A 2RK6A 3D0RA 4W5OA 1X1QA 5IMSA 1Z8FA 2F64A 4AZTA 4RTQA 4QX6A 2NQ8A 3KT0A 4G5XA 4F3YA 1NPYA 2XTZA 2XXAB 3N74A 2ZE7A 1R4ZA 1KVUA 4ZPJA 1E32A 1YIOA 1EP3B 4JVOA 5IDVA 4CF4A 3HCWA 1DO8A 2WP0A 1OBOA 5TVKA 4DQ0A 1E4VA 1WPXA 1W59A 4XFJA 2PT7A 4ZVUA 2Y77A 3UY4A 4IH9A 1A9XA 1ZZGA 1DG9A 4Q24A 4YJFA 4A1FA 3IYLW 4C6SA 3H1AA 3U7HB 1FYVA 1ZI9A 2EL9A 4HQRA 3V5NA 4TV9A 2VA8A 1P5ZB 1NRXA 3HCCA 4DIOA 1DQRA 5U4QA 1D0IA 4ZVPA 1KU0A 2D4AA 4WWHA 4D45A 1F7UA 2CGEA 2VDRB 2RCNA 2XCIA 1TZ2A 2Q6KA 3WKBA 1H8EA 2AYZA 3WQBA 3PPWA 4D9CA 3VV3A 4F3TA 3AHIA 3Q3JB 3UFXB 2ATEA 3G23A 1JYFA 1Z33A 2SCUA 5FB3A 4DCPA 5DYIA 2EBWA 1LLUA 4WXMA 4BFWA 1CJUC 1NUTA 1ZICA 5F77A 1O7JA 2C88A 3RNOA 1A8QA 1K8QA 2J9FA 2C1ZA 4ZHQB 4BO3A 3DLPX 3HDTA 3SCZA 2PGOA 3HO6A 4YT4A 1PX2A 1KQFA 1TOAA 3C45A 3FOAA 4L2IA 1HE1C 3ZZ1A 2YXLA 3TE6A 1GO2A 4Q3NA 3A7EA 1ZUNA 5A9RA 3G2KA 3GRAA 4IY1A 1TAGA 1IZ0A 3ST7A 3GLRA 4EF6A 4WE3A 4CV1A 3D5EA 3PIDA 4ROSA 5ER9A 3W6OA 5IULC 4P92A 3R74A 3A04A 2VDWA 1C2TA 2YN4A 1BCSB 1G98A 1TD1A 2WU0A 1PRYA 2J9FB 1W46A 3DUFB 3HB1A 1ZITA 2V58A 4WW0A 2V0GA 3TLGB 2IPMA 3CE9A 1ECLA 4QZVA 4IOMA 1Q0HA 1ZNQO 4IFEA 3ZWCA 2WWVD 3WSTA 1Y3FE 3VNRA 1G21E 1I6WA 1NBWB 5BT9A 3VNSA 1N2XA 1DEXA 1TJ3A 1V5EA 1VHLA 4R7TA 3WOVA 3RRNA 2BCJQ 1E89A 1XTUA 5JCOC 1ODJA 2Z6VA 3PJGA 4TL8A 3CZ5A 5I47A 4M1KA 2F9FA 4LBVA 4QVIA 1N7GA 4GQAA 4D46A 4OMDA 4M8IA 1UBRS 1E20A 2Z0MA 5FL3A 1E3WA 1EVQA 1ZBQA 3DUFA 3NBMA 4M7PA 2W2QA 4BEBA 1J06A 4PXSA 2B82A 1WD7A 4UTZA 5K9ZA 3DMPA 4OHXA 1TQ4A 2G9RA 3WDSA 2RHMA 3OFKA 4CG2A 1Z16A 4RDIA 4B46A 4HB4A 2A9RA 2AE1A 2DY1A 1VGRA 2G3YA 4TKVB 3IEXA 3MS4A 5I9MA 1H2WA 3TSZA 5TVGA 4ZQCB 4NPCA 5EEHA 3LHKA 4JQSA 3CLTC 4I7EA 1GA1A 4HN9A 1TMGE