4M7RA

Crystal structure of the n-terminal methyltransferase-like domain of anamorsin
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
180
structure length
180
Chain Sequence
DLGTENLYFQSNAMADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Anamorsin
publication title Crystal structure of the N-terminal methyltransferase-like domain of anamorsin
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4m7rA00
4PONA 4YUXA 4EMSA 1QYRA 3U81A 5EIFA 1NW6A 1NW7A 3RW9A 3M4XA 4U7TB 2BZGA 3VC1A 1VPTA 2EJUA 3LDGA 4R8RA 4FSDA 4PYMA 2IDKA 1KYWA 3M6WA 4BY9E 4C08A 2V7EA 5EKXA 4QDJA 4E2YA 3CVOA 4BLUA 10MHA 2P1DA 1N2XA 3FPGA 3FUWA 2G71A 1ZQ9A 4AX8A 1AV6A 2NXEA 2HR1A 5EEGA 1EQAA 3ORHA 3OZRA 3FUTA 3NTVA 2GLUA 3CJTA 4CWAA 5E2AA 3EGEA 1L9KA 3MQ2A 5K0FA 3OE4A 4X60A 3AY0A 5IKMA 3ANXA 4PGGA 1YFJA 3B3GA 5EEHA 5HIKA 2OB2A 1R8XA 2ZFUA 5KQSA 2PWYA 5EZQA 2O07A 1UWVA 3FTDA 5EG5A 4YMGA 2QE6A 3ME5A 3SMQA 4ER5A 3FUVA 1WXXA 5EHGA 3A25A 3E23A 4PCLA 5GM1A 3TKYA 2JH8A 1G6Q1 5DT2A 2WA1A 3M70A 1NT2A 5DTMA 4QVGA 5LQRA 2Q41A 3P2KA 4QDKA 1RJGA 4ER7A 3DXYA 1FPQA 2P3QA 3OZSA 3VC2A 4RTMA 3C6KA 1ZHFA 2G72A 1KHHA 5HFJA 5DM2A 3DUWA 3NWBA 4MQ4A 1BKYA 3B3JA 4EVIA 5BW4A 3BGVA 5HOQA 3LCCA 2VS1A 3TOSA 3BXOA 3NDIA 3P71T 3NWEA 4GC5A 2ESRA 3KPUA 3B7PA 4ER6A 3UJCA 2V74B 4QTUB 4RTPA 3A27A 4KDCA 3HA7A 5BXYA 2GH1A 3FRIA 5E1DA 4ZTBA 1RI1A 5CIYA 3FRHA 4JXJA 5FHQA 1M6EX 3G5LA 5LQCA 5T67A 2CMGA 2P8JA 2AOUB 3NVKI 2NXNA 2UYOA 3PS9A 3T7TA 3KPYA 4X61A 3TLJA 5K0JA 3HEMA 4R6WA 4C07A 4PYJA 5FHRA 1SQFA 3BT7A 2NP7A 2HNKA 1Q0SA 2OZVA 2IFTA 4PIPA 2YR0A 3FTFA 1X1DA 3S68A 4EK9A 1RJFA 4OA8A 2VZ9A 2C7RA 5CCXA 4P7FA 5CUQA 1NW5A 1RI2A 2VDVE 3JWJA 1NE2A 3CC8A 2UYCA 4M38A 1QAOA 5DM1A 1XCJA 4PGHA 5EHIA 2KW5A 3KR0A 5D1HA 5EVJA 3MGGA 2O06A 5FWAA 2IP2A 4HRAA 2AN3A 5E8RA 1YFLA 3TR6A 1VLMA 1FP1D 3PT9A 4H0NA 3SSMA 3HA3A 1F3LA 1SVUA 4KDRA 3TM5A 1SUIA 3K0BA 3LX6A 3MERA 3KQQA 3R24A 2FCAA 3O4FA 4PINA 4OX9Y 5T6BA 2FPOA 3FPJA 3BUSA 5FA8A 3KQWA 4PIMA 2O57A 1INLA 3FPEA 5LQJA 3HCEA 4PYQA 4BP3A 2Y1XA 4HTFB 5B1SA 1TW3A 3HCAA 3HM2A 5DTRA 5KYGA 3M33A 4OQEA 1D2HA 3KQYA 3C3PA 3DTNA 1V39A 3MTEA 3NJRA 4RTQA 3EMBA 2Z6QA 5FA5A 3SXJA 3EEOA 2ZBRA 3G2PA 1IY9A 4E33A 1T43A 3EVFA 4M36A 2XVMA 2ZIGA 4MWZA 5F2KA 2Y1WA 5GM2A 1TPYA 3UA3A 1P39A 2PVCA 4RVFA 1G8SA 2AVNA 2GB4A 2YVLA 3DH0A 4ER0A 2PX5A 4FT4A 4GOMD 4A6EA 5HIMA 3I9FA 5ERGB 8MHTA 4P58A 2ONZA 5EMMA 3TFWA 3O31A 2YX1A 4YUZA 3D2LA 3ELUA 2P40A 3A7EA 5LQNA 5FULA 4YV1A 3TM4A 2BH2A 2QRVB 3PFHA 3AJDA 1HNNA 5DRYA 5K0NA 4PYOA 1JTEA 4EKIA 1QAQA 1KPHA 2IDJA 3G88A 3GCZA 3LDUA 5DM0A 4WVLA 3GDHA 1JSXA 2G8NA 3A7DA 2ZBQA 4IV0A 2P7HA 5CM2Z 3KQPA 1DUSA 2OY0A 5D1NA 2C7QA 2JJQA 3OE5A 3ELYA 1XDZA 1EAMA 2BR5A 3TRKA 4CTKA 1WY7A 4QPNA 2JH9A 3GRVA 4CTJA 5HZMA 7MHTA 2YTZA 1YF3A 1FP2A 3FTCA 2HTEA 3R0QA 2ZWVA 4GOOD 4HG2A 5ICCA 2UYHA 1DCTA 3IEIA 4F84A 2Z6AA 4FT2A 4UOEA 3M6VA 1JG1A 1JR4A 4KRGA 5EC8A 3I64A 3DLCA 2ZIEA 3HCCA 4Y30A 4A6DA 2N47A 4RTKA 3UFBA 5CVEA 3X0DA 2IH2A 3G8BA 2JHCA 5DPMA 5JR3A 4ISCA 2YXEA 3DXXA 2B2CA 5DLYA 1M6YA 1P91A 2A14A 4C4AA 3SGLA 2EX4A 2AOTA 1HMYA 3HTXA 5KQRA 5CVDA 4HSGA 4EKGA 5C0OE 4AZTA 3DMGA 3UJBA 5U4XA 1X1CA 3NW9A 3KR2A 3G2MA 2IPXA 2FK7A 1G38A 3M6UA 3FUXA 2ZVJA 4MIKA 1RJEA 3EVBA 1I4WA 5CCBA 1XVAA 2GA9A 2OPBA 3R6TA 3TPZA 3EVDA 3VSEA 1JQEA 1ZGAA 3G89A 3C3YA 2PX2A 3FTEA 3JWIA 5LQAA 2I7CA 2NYUA 5E9QA 2AOWA 4PWYA 5K0CA 1Z3CA 1L3CA 5E1MA 3GRUA 5E9JA 4FP9A 1KPIA 3G5TA 3GRRA 4C04A 3LBFA 3KQVA 3LL7A 2C7OA 2EJTA 2B78A 2NXJA 5C9ZA 2ZWAA 1G55A 3LGAA 1O9GA 1JQ3A 3B3FA 1WS6A 3EGVA 3H2BA 4DCMA 4GF5A 5EGSA 5EMJA 4E2ZA 5DTQA 5HILA 3DMFA 3P9NA 3G2QA 1OR8A 3BGDA 4RTRA 3CCFA 4DZRA 5DM4A 5GOZA 5K8VA 2OKCA 3GO4A 1I9GA 5EQJB 4C06A 4QQNA 1Q0TA 3HNRA 3LCVB 2ONYA 3THRA 4YUWA 3GGDA 4LWOA 1QZZA 2ADMA 5F2OA 3GRYA 1L1EA 3HCDA 1JQDA 4BLVA 2ZIFA 3AXTA 4YV0A 1O54A 4L7VA 1KIAA 2PKWA 4E2WA 2R3SA 1PRYA 2QYOA 3BKXA 3PX2A 5DX0A 4IV8A 2QM3A 4RX1A 3LPMA 5G02A 3KQSA 1XTPA 4E70A 4AZVA 5KVAA 2P3OA 5CVJA 4R8SA 3DULA 1U2ZA 3L8DA 3P9CA 5DX8A 3V97A 1EIZA 1B42A 3ELDA 4GOND 1P1CA 1YZ3A 1YZHA 3GJYA 3UJ9A 5K09A 1SG9A 2VDWA 3CBGA 2G70A 1VP9A 2OB1A 2ZW9A 3NDJA 3UJ7A 1EJ0A 1BOOA 2GPYA 2H1RA 3BWMA 3EVEA 3HVJA 4DM3A 2AS0A 5M5BA 2EFJA 3SVZA 3ER9A 2WA2A 3P9IA 1X19A 5DX1A 3GXOA 1UIRA 3NVMB 5LQKA 4OA5A 2BR3A 3KQOA 3KQMA 3RODA 4E30A 9MHTA 3HVKA 4GQBA 2AN5A 1SKMA 1KP9A 4RTLA 4YUVA 2BR4A 3KR1A 3OCJA 3OU6A 3IYLW 5E1OA 2NP6A 1XJ5A 3PVCA 3QOWA 2PY6A 2PSSA 3CKKA 4MTLA 1KXZA 2ORED 4F85A 4RTJA 1FJXA 2PXAA 4X1OA 3REOA 3SSNA 3KQTA 4PYNA 3PX3A 3EVCA 5GP1A 5FWDA 4C05A 4RTSA 5JUWA 5DWQA 1FBNA 4M7RA 3A26A 4G56A 2CMHA 3E05A 3JWHA 2HV9A 2OO3A 5FTWA 1VP3A 3A4TA 4PYLA 2FRXA 1EJ6A 1Y8CA 3P8ZA 5K0LA 3I58A 3LCUA 1XXLA 1M0EA 2FHPA 1R8YA 2XYQA 1X1BA 5ICEA 2F8LA 5EPEA 3G7UA 1ZGJA 5DRTA 4AZWA 4U7PB 2B25A 5IH3A 3BWCA 2ZULA 4RV9A 3HVHA 3RIEA 2IIPA 2PWPA 3I5UA 3TKAA 1RI4A 5ICFA 1G8AA 2I9KA 2FYTA 3MCTA 4P7KA 3GWZA 4V0RA 3DP7A 1EG2A 3E8SA 2OXTA 3T7RA 3KHKA 3LKDA 3C0KA 1WZNA 3UBTA 2ZZNA 2K4MA 2XBMA 3SX0A 4R05A 4XCXA 2R6ZA 2I6GA 4YV2A 3P9KA 1WG8A 1NBIA 3MHTA 2OBFA 1VQ1A 4X63A 4IKPA 3UJ6A 3P2IA 3KKZA 2FK8A 1NW8A 3MB5A 2WK1A 4HH4A 4MHTA 2DULA 3TMAA 5E8JA 3GRZA 2AVDA 1UFKA 2E5WA 1KPGA 5K0EA 3ER8A 3F4KA 2CKDA 1VIDA 4QTTB 2LD4A 2CL5A 4K6MA 4PCAA 4HGYA 2ZBPA 3K6RA 4XUCA 3C6MA 2AOVA 5GIPE 5LQUA 4C03A 1NW3A 5C1IA 4DMGA 3V8VA 4POOA 3UZUA 4R6XA 1JG4A 1R74A 2GS9A 1WXWA 2PV0A 5E9WA 3AXSA 4CKBA 5LSAA 2IBSA 1VBFA 2O0LA 3PFGA 2AOUA 1KYZA 4FGZA 5HEKA 3BKWA 1PJZA 4GOLD 5EMKA 2JG3A 4OBXA 1L3IA 4RVGA 1IXKA 5FQOA 1XDUA 2XYVA 2YXLA 4FS8A 3KU1A 3BWYA 2PXXA 2PX8A 2ZTHA 4QPPA 5CVUA 2B3TA 2UZ4A 4E2XA 1JG2A 5KS2A 5LR6A 5T64A 4Y2HA 2ERCA 4PNEA 1AQJA 4GEKA 2YUIA 5DXAA 2Z6UA 4KVZA 5DSXA 3HCFA 4FSXA 2VP3A 3Q87B 1MJFA 1R18A 2HWKA 3BGIA 2IBTA 5H02A 1F38A 1ZKDA 3FYCA 1ZG3A 3LDFA 2PGXA 2YXDA 5E1BA 5FADA 5P8WA 4DKJA 2O05A 3FYDA 3WSTA 3GU3A 5FCDA 5K05A 1NV8A 2C7PA 3T0IA 3ELWA 3T7SA 3SSOA 3I53A 1JSZA 2P35A 5CD1A 1MHTA 2YQZA 1D2GA 4RSRA 5FQNA 4P7JA 2JHAA 1I1NA 4OQDA 3CJQA 4WXHA 4CKEA 5K03A 4FZVA 4HC4A 2B9EA 3OU7A 3VYWA 4LWPA 5FUBA 1O9HA 2QY6A 4X41A 4AUKA 4RTOA 4P7GA 3O7WA 5E2BA 5K0GA 3UJAA 5K0BA 2ZZKA 1P1BA 3EGIA 4IWNA 1KR5A 3ERCA 1XCLA 2GAFA 4HTFA 1TW2A 2PLWA 3EMDA 4DQ0A 2H00A 3P2EA 3FUUA 3QOXA 4DF3A 1SUSA 3GIWA 3BZBA 3EPPA 3OFKA 3TQSA 3UA4A 3HA5A 5GWXA 3HVIA 3SM3A 3E7PA 1YUBA 2AOTB 3LBYA 2G1PA 1H1DA 2XVAA 2ZLBA 3AWIA 2PT9A 2PT6A 2PX4A 3EVZA 3DMHA 2JHPA 4RTNA 4Z2YA 5DXJA 1ORIA 3DOUA 3R9XB 4HGZA 5EZSA 3OFJA 1VE3A 1QAMA 4YMHA 3PTAA 1ORHA 2ZZMA 4M37A 2NNWB 1R00A 3LSTA 3UWPA 2PJDA 1R6AA 1SQGA 3Q7EA 3PB3A 4LECA 5BW5A 2IGTA 4FR0A 1L3BA 1DL5A 2BM9A 5EMLA 5ICGA 2QRVA 2H11A 1VL5A 5BP7A 3BWBA 3DR5A 1NBHA 3ID6C 1BC5A 4GUAA 3M6XA 4QQKA 3UJDA 2AOXA 3QV2A 5HIIA 2OYRA 1XDSA 5EIWA 4B17A 5GINE 4RYLA 2PBFA 5DSTA 3P97A 4OBWA 4QVKA 4CKCA 3JWGA 3R3HA 4KWCA 3CJRA 4XUDA 5HIJA 2ZSUA 5MHTA 3PLAE 4GC9A 4PYIA 1QANA 1BHJA 4E31A 2DPMA 2NXCA 3DLIA 4PYKA 1G60A 4BP1A 1N7IA 3G8AA 1X1AA 4XUEA 3KPVA 3HCBA 4RWZA 2AZTA 4RVHA 2P3LA 3IHTA 4DCGA 4EQZA 4V0QA 4ATNA 2VDUE 3THSA 4BLWA 2AN4A 4E32A 4KIFA 2XYRA 3CGGA 4AZSA 3HP7A 1RJDA 3OPNA 1RI3A 5K01A 3FPHA 2ZCJA 1JG3A 3NMUF 5EOVA 3LECA 1N7JA 3B89A 3EVAA 1AQIA 4F86A 3KPWA 3MCZA 3GNLA 3MTIA 4RVDA 4CXMA 2IH5A 4LG1A 3KPJA 1JTFA 2IH4A 3B5IA 3MAGA 4NECA 2I62A 2P7IA 4KW7A 3OZTA 4ER3A 1AF7A 3EVGA 4GBED 5EKUA 4O29A 2CWWA 2HMYB 2UYQA 3EEYA 3KR9A 2EG5A 3OU2A 3DXZA 3G2OA 4KIGA 3UJ8A 3LHDA 5F2NA 3LKZA 1RI5A 4DA4A 1NV9A 1IM8A 2PXCA 3SR4A 1YB2A 2BM8A 2AR0A 5CVVA 3IV6A 2P41A 1D2CA 3FPFA 1NKVA 5GIOE 4YUYA 3FZGA
chains in the Genus database with same CATH superfamily
2R66A 3MGAA 4OMCA 1WDLA 1XTJA 1FUEA 3IUYA 4YT5A 2PRSA 4EO7A 3NBZC 1KC3A 3AERA 2BTEA 2EJVA 2V7WA 5C81A 3UMMA 1II0A 5BYKA 2V7EA 1WB4A 3ZQ4A 2FFJA 4F72A 3F49S 4MR8A 4IFEA 3NBQA 5BR4A 4DLKA 1DIBA 1PV1A 2RHWA 3C74A 3UAGA 1Q7EA 2R4UA 3BAFA 4P34A 1UIMA 4KNYA 3SJ7A 1AV6A 3IOEA 3VPAA 1NURA 2X42A 1KO4A 1HRKA 1WCIA 5COAA 2AFVA 4QTYA 2O5EA 3BRWA 4YACA 1XMPA 1Z5PA 1XA4A 1U9CA 3MQ2A 4L08A 3OLWA 1XCGB 1ZQ1A 3Q7PA 1F4VA 4PG5A 5DYTA 3HXMA 4U2FA 1M34B 4BO3A 1AS0A 1OGYA 4I14A 3DBHB 2P69A 4M60A 5BUQA 3KJFA 1NJ5A 2VNJA 4H7DA 1QHXA 2LR0A 1GPBA 1DKOA 1UJ5A 3PA6A 4R2WA 3TD6A 4G0UA 2P65A 1YJCA 4Z1MD 1YMVA 2ACEA 4GYYA 4KK4A 2FMTA 3A25A 1VHJA 4BEBA 2AL7A 4HQLA 4FFMA 2H06A 1SCKA 4UUAA 1DOHA 2FWMX 2MYTA 2QM8A 5DGTA 1MH1A 3V8BA 2CNOA 5JW6A 4F4FA 5JAZA 1V1JA 3OWHA 3A58B 3DVLA 1HI9A 1E3MA 1I4DD 5L6LB 1M6VA 3UANA 1Y4UA 1F1BA 1GPLA 3HJCA 3GLTA 4I8DA 4QQRA 2HJVA 5B6IA 5HKKA 1O94C 5E2IA 4ZEXA 1GNLA 5AW3A 1QZ3A 4AQDA 1CRWG 4GKBA 1HOXA 2WUVA 4EJ0A 2OUKA 4OB6A 5F64A 1S2DA 1GLGA 3EQ8A 3SF8A 2HCRA 1PV2A 3S2GA 1P2TA 2XTAA 2PKXA 4NENB 3A4IA 4IOJA 5FHQA 5AVKA 1SC1A 3PYLA 1RWMA 2GBGA 1JIXA 2X2EA 3RRNA 2DFKB 3T7TA 2GYYA 2OQVA 3U7RA 4HDAA 4ZQBA 3LDHA 2A5LA 5F7JA 3TQRA 4JHXA 3W2FA 1JG7A 2B20A 3OFSA 3SHWA 4NV3A 1MA0A 2O52A 1XRPA 3ZGVA 2W6JD 4B7ZA 4D80A 2C58A 4MIOA 2BRUA 2OZVA 1Q0SA 5ULLA 4M1WA 2PKRA 3FM9A 4Q4AA 4PIPA 5CK4A 4Z0TA 2XJ9A 5GVSA 1YZQA 4U2DA 2C42A 3SKYA 1E7WA 2PRKA 3NGMA 2DSTA 1U9ZA 5EZSA 4AS1A 3OIWA 4LF6B 2OAEA 3QHAA 3HR7A 1II9A 2HF9A 1YC2A 2N1MA 3AEZA 3O74A 4XSGA 2XCTB 1PZHA 1N5JA 2V7VA 4YJHB 5JS2A 4EPWA 3L79A 3MJVA 3NV9A 3NM5A 1VLMA 4ZGWA 1N1GA 3FX2A 1F06A 1VYHA 4FGSA 4G5YA 4Y0VA 4QM6A 2QX8A 3M4ZA 5CLIA 2YV5A 2ZQZA 4WTOA 1CQIA 3BCRA 3ZY6A 4QAJA 1Q57A 4E07A 3BUSA 4BAZA 4K6FA 4EABA 4TLDA 4G36A 5FBLB 4BKQA 4UAGA 5GV7A 4L5IA 3JQAD 1N6RA 3VVBA 4HNUA 5ITVA 3PNSA 3D2CA 3EMBA 5FA5A 3SXJA 4GPZA 1Z7GA 1SWVA 3JALB 4P3XA 3I61A 3PJDA 1XROA 2XUOA 2WTUA 4G5RA 2DHCA 2VT2A 4ZTUB 4ZZ1A 3IIJA 3C4VA 3DH0A 1CX9B 2IUSA 1E4OA 2ILTA 4NU6A 4ROTA 1QWSA 4XX0A 3KSMA 2ZYTX 5D8DA 2J08A 3J81A 2L2QA 2DR0A 1NPTO 3DEAA 2CV1A 1CDEA 2H2FA 2O8CB 3GEPA 2IHVA 4BNDB 4MJXA 4YS6A 3ENNA 2J5XA 4MRMA 1F4LA 3DKIA 1V1MA 3IJPA 2FZKA 3ROQA 4ZHQB 2C94A 3QM1A 1QO9A 1XTTA 3F0TA 2O1SA 2PT5A 4G4GA 2YIMA 2G0AA 4UU8A 5JH7A 5DLDA 2BY4A 1OWOA 1EP9A 2BD0A 1H4VB 4OXYA 4RD1A 2JLXA 4B4WA 2REXB 3JASA 2ZBQA 3X1YA 3K94A 3IA2A 2OY0A 3MPOA 2OENG 5KTMA 1BE6A 5TEWA 3WGMA 1ZK0A 4M9QA 4HF7A 3D81A 3AF4A 3ELYA 4GVXA 1AF4A 3R7SA 2GVZC 4OGWA 3TZKA 3TRKA 4PXYA 1L9XA 2W6PA 3JVUA 4QPNA 2BGKA 5KTOA 1WPRA 3GMTA 3BTVA 1IM5A 4LK2A 4JV5B 1JPNA 1XT6A 1IWOA 3L82B 2JLZA 2IYOA 1V1RA 2KBEA 1V16B 4WZZA 4LISA 3I64A 4BBPA 1P4AA 4EVSA 4R3NA 4EQ6A 1PS9A 2VEDA 3KYCB 3WKDA 2KMLA 2YW9A 4P31A 1PDOA 3T3EA 3GFTA 3IUJA 4PLYA 3UFBA 3V3TA 4KR9A 5H5JA 3G2HA 3WMXA 4MB0A 1P4RA 5PNTA 3CXUA 3I72A 4QX6A 1L4GA 1XJ0A 1Z5GA 2VPIA 1JAYA 3DEJA 4OP3A 3B6KA 2UYYA 3VTZA 4D9BA 2H1WA 4YO8A 3HTXA 1GPKA 2CF6A 2SECE 4MV3A 1XA3A 4N0EA 1XTBA 5CA1A 3ZHQA 1MKYA 5KTKA 3ETGA 1PT5A 1SG6A 2ZAYA 3NW9A 5TIIA 3TF5A 4WCFC 3AR4A 3GOQA 3AIMA 1DOAA 1PL8A 1Z2EA 3EEIA 3RTEA 4L3OA 5B3AA 3UGJA 2IYFA 5K3FA 4P6VF 4JASB 1I4WA 4PPFA 4TWRA 3CB2A 3C3WA 1IY0A 1P7ZA 2BOVA 2ODWA 3UK2A 5H59A 2AE1A 1OHHD 2V7BA 3EA0A 1OAOA 3S2UA 2HC9A 3KOUA 4EITA 3B9PA 4GOKA 1ZD3A 1IBMB 1J70A 4DV4B 1KI9A 2ZUSA 3GFFA 3AKYA 2EJCA 4K8OA 1WXGA 2FSUA 1V3QE 4O2BA 4FP9A 1WABA 5EJ2A 3DKRA 4YBRA 3LL7A 1U8AA 2CL7X 3AMVA 3GEIA 4ZCQA 3K09A 5BYJA 5C9ZA 4FFSA 5BSTA 4X3OA 4NYJQ 3R4CA 1O9GA 1JQ3A 2CVFA 1WS6A 2WUGA 2D0IA 3ASZA 3F71A 5DGCA 4UAJA 5HK9A 5CFNA 1J9GA 1BIFA 1P0PA 3KFXA 3IPXA 5DN9A 3SLRA 1JQKA 1EWKA 1YHYA 4KLZA 3ZCXA 4DYHA 4E2ZA 4YT8A 1JZQA 2X8WA 4K6GA 3R3SA 3VBCA 1IQPA 1ZD8A 1J56A 1PT6A 3AJRA 3CLSC 2QB5A 3KYDB 4F3YA 5JOQA 2QLLA 2IU4A 4FR2A 4B7CA 4LWOA 1E7RA 1KS2A 5KNBD 3KOXA 4I4LA 4PSUA 4QNNA 1JQDA 4YVFA 4M21A 4F4IA 5LWQA 2VATA 3GRAA 3ECCA 1UJCA 2IDZA 3HL0A 4Q1AA 1GTZA 3BK2A 1ZMXA 3W9YA 5DX0A 2B98A 3T4UA 1NI3A 1PNQA 3TQQA 1YB5A 4GNKA 2VHQA 1ABFA 1SRQA 1GTVA 3K3PA 4NV1A 3PVSA 4KPFC 4MZDA 1U2ZA 1D6SA 1XTRA 3AEQA 4KXNA 4Z4CA 1DTWA 1Y0BA 2WJHA 4LRQA 2UKDA 4MUJA 4P8RA 4XB6B 1YZ3A 1BG6A 4BP9A 2JFPA 4PX2A 2ZRGA 2X0IA 1A76A 1SXJB 3OZWA 3SAJA 1ZJJA 4F11A 1T4CA 1XD2A 2PCLA 1HY3A 4I55A 3ZWAA 4CKXA 1K0UA 4WLUA 2C82A 4J0HA 1RZRA 7GPBA 2BZ1A 3KQOA 4OU4A 4Q5IA 3W2IA 1F5SA 1YBAA 4LJSA 2R9VA 2Q4RA 3WVNA 3OQJA 2FI1A 3ZDAA 1GNSA 2HT1A 1C9YA 3RRJA 4JOCA 4ZV9A 3J80A 1I7PA 2IHKA 2XE7A 4BMSA 4L9AA 2PZGA 4W82A 3DVAB 5HBGA 2Z2ZA 3VAAA 1L5OA 3B9RA 3I83A 4QDOA 3P7MA 3I23A 2CNBA 1KEPA 3CT6A 3OF3A 3Q72A 3EZGA 4KN8A 4PTLA 1EUDB 3B1VA 3EWSA 4HUQB 4PGAA 1M2OA 2XMZA 1WDKA 4MROA 4XOIA 4ADSG 3TTSA 1JN0A 2BKVA 2JDIA 1U90A 2XUDA 1GKIA 2Q6KA 1G21E 1V8DA 3B3QA 3IQZA 5CFMA 2O0HA 4DY4A 2CF5A 2D13A 3V1KA 4MDFA 1M2WA 3QUQA 5FPTA 1GG9A 1OI3A 2QUHA 4FOPA 3A32A 3I2IA 2O3JA 1QH9A 4EPXA 1Y1LA 2HK7A 2CDBA 2C3PA 2ZUDA 3QVLA 5ARCA 13PKA 3U9TA 4AZWA 4MYDA 1IG3A 5L7WA 3BWCA 1G9TA 3HSSA 3T5BA 3SIRA 4CUKA 1FP4B 3DZKA 3DWIA 3NBAA 4IV5A 1RI4A 3FGZA 3KDSE 1EUCA 5FI1B 4Y7CA 3CR7A 4BECA 4V0RA 3T7RA 3CLHA 4I1YA 2WM9B 3PYXA 4XSVA 1Y5IA 4MMXB 2W6NA 1X9IA 4J1SA 1JG6A 5J4VA 1S96A 4H59A 4JR0A 3ZH9B 2IU6A 4K46A 2J9ZB 2WU1A 2YMLA 1S6YA 3LUPA 3UJ6A 1NUSA 1E89A 1T3SA 2PQ0A 4N39A 1XPOA 1JKMA 1IRIA 4LEIA 4KXFB 3O2SB 3AR3A 1QVVA 3T5AA 2ID9A 2Z8ZA 3R9KA 2BE7A 2J85A 2Z95A 5EVCA 1ZW1A 3ZHSA 3P5SA 1UP7A 2W48A 4OSEA 4XGKA 3E9NA 3G68A 5C8ZA 3L46A 1E1RD 2ZRKA 3CKLA 2HA2A 3FTNA 5K99A 5LQUA 1CEXA 2PUDA 3KWJA 2EHJA 2FR8C 2AG8A 1R10A 5BV0A 3UJ3X 3PFGA 2AOUA 3EIXA 5DOZA 3EXAA 1DAIA 1DXOA 1LBEA 3K5IA 5EJ6A 3FSGD 3PQ4A 1ESZA 3F47A 1EXDA 1TM2A 3WYDA 5ALXA 3BQMB 3EZXA 1XXHB 3EJWA 3OQVA 2J3JA 2R79A 5J63A 2YXLA 2GKGA 4KKXB 4CMEC 2DETA 2PXXA 2PX8A 3BM5A 4QYTA 4TUYA 4V0KA 4C6RA 4JKIA 3FNFA 4XKJA 1G4HA 2OC4A 1LBQA 4A5SA 1QB8A 1E1QD 1XTZA 2WIDA 4G23A 4ZU1X 5MN4A 3TL2A 4FSXA 2ZJ3A 1HNWB 2ZIXA 2ZRHA 3BFKA 1ZKDA 1FUIA 3FYCA 4FTWA 1N57A 4HK4A 3I0MA 4ZZ0A 5BSWA 1ONOA 5LZ8A 1D9XA 3LHKA 2PUGA 3BRQA 3PIRA 2POCA 1RYYA 1Z5ZA 2HMUA 5LLTA 1ACLA 4D4MA 1KMCA 3TSAA 5CD1A 2ZYHA 4TTQA 4LBZA 5I7HA 3BQ9A 1DO0A 2BGNA 3O4HA 3CJQA 3ZJYA 2J0SA 4XRGA 5EKDA 2R8RA 4EHLA 3DEFA 2FOIA 1F0YA 2CK3D 2ZT7A 1JT2A 3RS7A 5FUYA 3FOBA 3O7WA 1H1TA 4S1PA 4PC3A 2WSBA 1Z2CA 3LCRA 4DIOA 1DVRA 2DRIA 4LFBB 3U7GA 1IRXA 3F6CA 2O8BB 1FW8A 2WTBA 5AI8A 4IOKA 2RHMA 3O9MA 4HAZA 5I4CA 1KJ8A 4LHWA 3UXYA 3EPKA 5FNVF 3GH1A 3TLGA 1EFCA 2BSXA 3GG9A 3F3YA 4BN5A 4ENPA 3FCCA 4D8YA 2OXRA 3HA5A 3HVIA 4L9RA 1BU8A 1TIBA 1V11A 2GJ4A 2F62A 3BEDA 3LBYA 2AUNA 3V55A 5AXBA 3QUBA 4RXUA 5HF8A 3ZI4A 2VZLA 2JHPA 4JLSA 2DLNA 3QKUA 1SXGA 4G1MB 3RVPA 4EX7A 4QJIA 2XRZA 3A14A 1VRCA 1LI4A 2HLDD 4GRAA 2O4CA 2H1LA 4R0NA 1R00A 1ECJA 1FTWA 1VXOA 2I3GA 1MC8A 1OXKB 1UM9B 2CD9A 3N0XA 1ZPDA 3CF4G 3AFIA 2NZYA 3K6KA 1RMTA 1GRVA 1ITZA 4JBLA 5BP7A 5ALYA 3TIIA 4GUAA 4QQKA 1ZIYA 3W8EA 2ZRLA 5B1IA 1C0PA 1XDSA 3TMYA 2PV7A 1G6HA 1Z6YA 1JVSA 3CJRA 1MJGM 1Q74A 3WFJA 1QP7A 2Y27A 4ZI5A 2XQGA 3HJUA 3D6TB 1IBRA 2NXCA 2FPWA 5JLAA 1G3QA 5A3JA 4UU1A 1XTVA 1G3MA 2VRWA 2J8ZA 3OZDA 1J8MF 5BSVA 4BXOB 2PRZA 3TD2A 4RWZA 3KYJB 3WNZA 1ZN9A 3KSZO 1EFTA 4H15A 4E22A 2C8LA 3DMPA 1HTWA 2XVZA 5DKFA 1QCZA 1VKHA 1BWPA 3TNLA 1DWQA 4NOMA 2PMCA 4E32A 4IKOA 2VNIA 2R62A 4OQPA 4DCCA 3TSCA 5L6MB 3C6QA 2QRKA 1FFEA 1HKHA 5I47A 4DB2A 2E21A 1AGPA 1RI3A 2C2ZA 3EIWA 4OLJA 5K01A 3RV3A 4C3ZA 2VP9A 3CONA 3H75A 3TBFA 3NMUF 4MULA 2FZWA 2B6NA 3NRBA 5B58T 4D0LB 1LGYA 3O75A 1YASA 4BBAA 4F86A 2P9JA 3QX8A 3HZRA 1CUGA 4JENA 1LA2A 1SCUA 4KW7A 4CKWA 5AVYA 5H1YA 4X00A 1UP4A 4J7XA 3ZY3A 5KWJA 1P6UA 3HJBA 5FR2A 4Y0AA 4B7UA 4I4IA 4MUBA 2RONA 2G17A 3T7JA 3IIMA 4RZ2A 4WKCA 2OXFA 3CH5A 3LKZA 4NBUA 4WFJA 3D4OA 1HOTA 4YDHB 3UOAB 3B6MA 1ISRA 5G3ZA 1Y4SA 2DQSA 2YBDA 4HUTA 5IZCC 2YIJA 4PY2A 5ILGA 3E9YA 2QL7A 1R66A 1L4KA 1ONNA 3V2GA 5A1TA 5AYVA 2JFGA 1E61A 4B3BA 4EMSA 1XEXB 1WBJB 1X70A 1JXAA 2XYHA 3K0KA 2KLBA 3G0GA 4RZ3A 3TB6A 4HEA6 1Y8RB 4YDRA 1UDAA 2JRCA 1G5QA 3OCZA 3CVOA 1D1PA 3SEQA 4C5AA 1BJTA 4DB4A 3SQWA 4O3MA 3IDOA 5FF9A 1N2XA 2P78A 3KJHA 3RWMB 1V8FA 2QXYA 3WOHA 1BE1A 2EHDA 4HQOA 3A6EA 2VP0A 3IAAA 1TT5B 1TX4B 2DG2A 2RG1A 3K9QO 1NLFA 2DCMA 5DP1A 1L9KA 3S2SA 3OJOA 4CG3A 2HHLA 4P4SA 4OK5A 4EAAA 2QD1A 5E6UA 4BN4A 5MN6A 2C57A 1F2TB 2PG3A 1B0UA 5EXDA 2AF4C 1R8XA 4XPIA 5FBKA 2YMQA 3TD9A 3ZU4A 3ZCSA 5JT1A 3ZGNA 2X0DA 3Q7QA 3ZLJA 1Z15A 4KWIA 2HCTA 3PDJA 2EFHB 1EVLA 3GCDA 3TO5A 1E7QA 5GM1A 1KDRA 2NV6A 5EHGA 1MH9A 1CLEA 2QTTA 3QITA 3GJZA 4JYPA 2Y1LA 2HREA 2OD2A 2RI0A 2WA1A 2ZB7A 2AWNA 1VL6A 2VJMB 3WOVA 2HQSA 5AD1A 2GO7A 4LY9A 4UDYX 3KRTA 3EQ2A 3HCWA 5KMGA 1T34A 3CUKA 5A71A 2YWGA 1UPBA 3OQBA 2GN4A 2O5CA 4LJ9A 5AK6A 3D59A 5DM2A 1VCIA 1N5LA 2HYDA 5E95A 5IAOA 4YP9A 2A84A 5DOVA 4BNXA 3JAKA 1OOEA 2WSLA 3JQGB 4EY6A 4O4LB 1IUPA 3RVRA 4B81A 5KINB 3DBIA 2JIOA 3HZHA 1PJ2A 3J7TA 4D42A 5JRZA 3OZCA 1SCIA 1N2OA 2MSCB 3MOSA 5E9AA 3AZOA 4O4JF 3FRHA 4WNAA 4HNVA 1DX6A 3P94A 4CKBB 2JIBA 1KI7A 2CMGA 3D0KA 3IAM1 1AZLA 1C81A 5I7EA 1HURA 4TVBA 3H1GA 4MQEA 1Y6RA 1ML3A 1RR6A 1QYVA 2RJOA 2IHUA 3R6LA 4RVSA 1J22A 1U9IA 3PC8A 4WCFB 3SHVA 1KI6B 2R47A 5TQ0B 1M1YE 2QN6A 4TV8B 5BN4B 4UBJA 3ZBUA 1I2AA 2YR0A 5T5QA 1ZGHA 5EP2A 3B48A 4EKNB 1I4TD 3KOOA 4URUR 2QOEA 1NW9B 1QNFA 1HRDA 1ZM7A 4KWEA 1JWLA 2AMYA 3VR4D 5EHIA 1KJZA 1JEYA 1G8GA 3I32A 1HE5A 4O4HF 2M9MA 4OQNA 3L7MA 2O06A 4I46A 4ZO6A 1LZLA 2WMOB 4MS3A 3WNBA 1NVFA 4H0NA 4KQMA 1IAQA 2FR1A 2H4YA 1DSSG 3TLCA 4X71A 4WN3A 1RJWA 5AM2A 5GZ6A 3FCSB 1K8ZB 5BSMA 4UNRA 4OTZA 2AN1A 1XAGA 4R2XA 1JBKA 3ZU2A 5LQJA 3ZHTA 1POWA 3PWZA 1KQFA 8OHMA 1YJ8A 1HG0A 3IBTA 2WFLB 3HM2A 1BROA 4R2IA 5A9TA 1B6TA 1YMUA 4D74A 8AT1A 3QMWA 3NG1A 1EGMB 4GM1A 1ZVJA 1V39A 3MTEA 4RLQA 4B3FX 4ZJPA 4UKDA 4D9KA 2MSLA 4KI0A 5LJLA 2A1UB 4V39A 3ZWYA 4JVOA 2XVMA 4AURA 2PWAA 4H3VA 4RVFA 4AO8A 3Q0TA 4KXLA 1GVHA 5NULA 3RTAA 5DGHA 2Z83A 3EGXA 2PX5A 3CGWA 2J3HA 3I1IA 3I9FA 3K70B 2Q5CA 2I4TA 5B7GA 1UZUA 5IVIA 1JHQA 3D2LA 4HOYA 3W4KA 3ZYZA 1R15A 3M1LA 4ZVTA 2OXCA 1GPJA 1L4FA 1R64A 2H1FA 2R86A 3F8TA 3NASA 2J6HA 2QRVB 3OZBA 2V0NA 2FQYA 3R3ZA 4MNTA 3SX4A 4CM3A 3AF2A 4WZBB 4AYTA 5JYDA 1NN5A 621PA 4IVQA 3PXEA 1A72A 3WE7A 4I5GA 2C7QA 3ET4A 1XRQA 1XP8A 4WLOA 4NZZA 1XBTA 2OHJA 3A3KA 4KLNA 1L5HA 5A7GA 4XQ9A 1QIGA 1PNTA 3STXA 5HCNA 4BLTA 2E1RA 1Z82A 2JHGA 3CPSA 4IRUB 1ZGGA 2IEGA 3GRVA 1GRCA 3B2NA 5HZMA 4W9MC 2I6TA 3KHTA 2ZWVA 4AJOA 3D5QA 4UUQA 5KCMA 2W8BB 4JC8A 3T7DA 4D9GA 1XIVA 4UBIA 2AK2A 1BQ4A 2N47A 4RTKA 1UJ4A 1KP3A 1UWCA 4C87A 1VCNA 2XQKA 3TLEA 2G5PA 1A5TA 2UZ1B 3KD2A 1JDUA 3QELA 1KDVA 5BVGA 1AZSC 3T1HB 1GR1A 4HDCA 2O4UX 4AICA 5AW1A 1BDIA 1JHOA 1NXPA 2HIGA 3Q0IA 3L02A 4JI1B 2R8OA 1YDEA 1H8HA 3AINA 3ZDBA 2FRDA 4DRZA 4O2LA 2F4VB 4AN4A 2R8ZA 3RYHB 2CXRA 4F3KA 4JKYA 3KELA 1E3JA 5ALPA 3RSSA 1RBQA 1Q95A 1SJ9A 3RR2A 4DXHA 1RCTE 4OFWA 3B60A 3CNEA 1OU0A 1TEVA 2XDYA 1W0JA 2YNMA 1R6BX 3DC2A 1C4WA 4G89A 2GA9A 3WGGA 4IYRA 3KSDO 3N8HA 1ZWKA 4UDXX 4H7PA 2GBLC 1QTRA 1N2BA 1XHLA 1CVRA 2B5VA 4PHTA 5LQAA 5CB8A 5JU6A 3WL7A 4MS4B 2EZUA 4KNVA 2C95A 4Z99A 5IBRA 5KJEA 2LGJA 3LW8A 1GZ3A 2R6HA 2NU8A 3RSFA 3KQVA 4I5IA 4QRDA 2V58A 2PH3A 3LGAA 3B3FA 3EGVA 5BSRA 3VR6A 5JMOA 1WVGA 3X43A 1HQYE 1TCBA 1M34E 2XB4A 3A1VA 4LNUA 1GPUA 1WUYA 5CXSA 1PG5A 3ZXSA 1I1OA 4W1RA 3ZWVA 1OR8A 4P33A 1CUYA 1CBUA 2QNBA 1PFQA 3KUUA 5A4IS 2GCPA 2GD2A 2Q49A 4MPPA 4OP1A 4QQNA 1XZDA 4YUWA 4KBYA 1K3UB 1CHNA 2CLLB 2KB0A 2UZ3A 3QLUA 3MSCA 4IQGA 2VNAA 1HT0A 1JDBC 1PUIA 3PKZA 4TKVA 1LY1A 1Z62A 3BKXA 2Q4DA 3FFAA 1VJCA 3TX2A 4W7HA 1DQSA 4FB5A 1OXSC 1JIQA 2Y93A 1KZ4A 1QHSA 4IDQA 1K3FA 1P3DA 1SA0B 3AIOA 4Y9UA 3W4IA 4GOND 3UC5A 3ZLBA 3IDQA 3I2YX 4JEUA 4WADA 2CMFA 3JZDA 4NEQA 2EWVA 3N6VA 4RIHA 2AZDA 2FEOA 1XKXA 2FLWA 2JJ1D 2ZW9A 3SEAA 1QFSA 1DBIA 1EJ0A 1T3HA 3B13B 3FCXA 4YO7A 5L7TA 2ZATA 1ODTC 1IVYA 2ODBA 5KDOA 4WN9B 1LPNA 5BWOA 1MB2A 1VYVA 5IN4A 3BA1A 4G63A 3KQMA 2AFHA 3FCAA 3T8YA 2WJJA 9MHTA 4D4LA 3H2SA 4QYSA 1U1GA 1NF2A 1R0SA 2I4OA 1RVV1 3EODA 3TDNA 3UAZA 1WB6A 3SBOA 4ZI3A 5C7YA 5KPDA 5E1OA 3DVSX 1I2CA 2DQZA 3NHSA 4K9RA 2P9GA 1KETA 4YJ3F 4RTJA 1AGRA 1GYPA 3MWFA 3NHRA 4HGNA 2JHFA 3S44A 3QTBA 1QFZA 1VGRA 4PYNA 1XVIA 3NIGB 2B1JA 5LB4A 5JUWA 2Q6VA 5JY1A 3ZVMA 4X3CA 1J2TA 2NTNA 1BCSB 3NHWA 3O82A 5HF9A 2IUEA 3PHCA 5JZ9A 3M82A 2E4AA 2HDWA 5FB3A 3KB2A 4W8OA 4FS3A 2ATVA 2RAUA 3V7WA 5KCZA 4YJFA 4O1IA 4YMVA 5CDUA 2O50A 1S4QA 3IODA 4P36A 1ADGA 1JMYA 5EPEA 3KETA 4PPYA 2AXEA 3D3KA 1GFWA 5LP6F 2HA5A 4YRIA 1MW9X 1UKZA 5HTKA 2B5OA 3LCMA 1LRJA 4RIFA 2IHNA 4NRDA 3BRSA 2A9QA 2E18A 5CD9A 4JIMA 2FX3A 1A9RA 2ZE6A 2J9FA 3FDZA 1APBA 3R2JA 1CYDA 2A5JA 1KMMA 1VKZA 4XCVA 4YQZA 1J8YF 1F51E 2C20A 4ZEWA 3GT0A 1GA1A 4AJ9A 3N2GB 4IIUA 4PCUA 4WXMA 5FNVA 1UBMS 3WGZA 4B3GA 4CIVA 5U4QA 1ONBA 2FPXA 5REQB 2RAVA 2D8MA 1FB5A 4HYEA 3KVRA 2G7ZA 4BWYA 1KI2A 2WJ3A 4RJLA 5CT8A 4TSFD 2FK8A 2QHXA 3VOSA 3GNSA 2NZ8A 4P4TA 2NZWA 1XNRB 1E92A 1HDEA 2REBA 2W2XA 3ED5A 1KPGA 2DFLA 1SUEA 4U2CA 2MDTA 2ZJOA 1PW5A 3S7TA 1X80B 3V6LA 4ASUD 1YH3A 2Q8QA 4DG5A 4GMHA 5B36A 5C1IA 4X54A 4I4TA 1E6EA 4UU7A 1EE9A 2WPDD 4FBLA 3P0JA 2IBSA 4JVNA 1IB0A 4QYXA 2A0WA 4YRDA 2NU9B 4EP1A 4TKMA 4KGZA 2CYCA 2YXBA 3ZWDA 3ICCA 1QHGA 4M7OA 1Z0UA 4PTYA 4HBGA 5F1YA 2WKWA 4UULA 2ARKA 2QGNA 2I29A 3KU1A 1OROA 3ODGA 4B0OA 2ZTHA 1XZ8A 4KQCA 1UJNA 4N4AA 3JQBA 2WUDA 2PTGA 4YJGB 4RXMA 1C3OB 1O95A 3PWSA 4PLCA 3UV6A 4F1WA 4ZI2A 2H51A 4UTXA 5ADVA 2H4HA 2Y77A 2VP3A 2W6IA 3CRZA 3GCGA 1CQPA 3NAQA 4O2RA 3HYNA 3ESAA 3MK31 1BWQA 3DW3X 1ZG3A 4BV2A 5JPCA 4OLAA 3PD0A 5H9VA 1JYSA 3NHZA 1WL8A 1SFRA 4KMSA 3E61A 4ESHA 1Q0RA 1NM5C 1SCJA 3RSOA 3SHFA 3DZIA 2FJUA 3VH3A 1WP9A 2BJWA 4KB5A 1V5FA 2OYSA 1I1NA 4QPCA 3K0CA 3E3MA 1O1YA 3I5AA 4PLPA 3GP8A 3SPXA 1CRQA 3WMWA 1R9JA 2XDQB 1I2ZA 1D0VA 5IABA 1OW3B 1TGVA 3GARA 3OOYA 5LPNA 3ZWNA 1C1DB 2H4FA 4DV2B 1BKSB 3CWZA 1CF9A 1P1BA 4HUJA 1BCRB 2FNAA 4Z0PA 3VNRA 1BDHA 4WEOA 3L0OA 4N18A 3H05A 1S2NA 3LP8A 5CB6A 4C5BA 3V4SA 3MHPA 3TQSA 1OXVA 4D5EA 1IM2A 1Z3IX 4O33A 2OCAA 1OKKA 3CX8A 2QRQA 5ER9A 4BZWA 5JANA 1UBEA 3PQ7A 1P80A 2PT9A 2AG5A 2FWBA 3A05A 5D3MB 2WIKA 5EE5B 4L16A 5DW0A 1KJYA 3KSUA 5ALGA 2HEIA 4G09A 3G13A 3DE4X 1KOJA 4CLDA 1Q1ZA 2H7CA 3UWPA 2Y99A 2J6IA 4LECA 4MKIA 4KQWA 5A4JA 3JATB 1IHXA 1QOPB 3WAKA 3LPAA 1ORVA 4N7BA 2W6ZA 1CNMA 1Z25A 3D54D 1A8PA 4RQUA 4C0KA 5JD3A 5F1OA 5HIIA 3EF1A 4C0SA 3RK0A 3FY4A 4B3TB 5GINE 4WEQA 3VNVA 3N0WA 1E2KA 1C1XA 1KQOA 2IZ7A 3BXPA 4US0R 4Y2SA 4X8HA 4AW9A 4IXWA 4D92A 1OXMA 4OHPA 5I9BA 1E6MA 3JQAB 4ITUA 3WGTA 2V5AA 1R8QA 3HBNA 4MW9A 3FWPA 5B5SA 4NPAA 1GA4A 1U5CA 1BZYA 3AWDA 3MLAA 4HMQA 4BFCA 2P3LA 1II8A 3OLQA 2GDZA 1PN3A 1ZUNB 1WB5A 5D5HA 4BLWA 2Y9PB 3OOHA 3H16A 5FLKA 3AVOA 3GLGA 1SXJE 2XYRA 4AZ0A 1P9RA 4DN6A 3QJGA 5L53A 1CCWA 3JQEA 3OPNA 2OPHA 4P84A 4KQKA 1AMUA 3VTKA 4C7KA 1OE0A 5IF9A 4HYTA 3A04A 1A9SA 2ZTLA 3PNOA 3TSYA 4JYAB 2D5CA 2PUJA 2A4MA 2HJ9A 5AKYA 1ODCA 1AQYA 2QK4A 5TVGA 4QTZA 1AF7A 4DMFA 5BRJA 2VT3A 4IUYA 4L6AA 5EKUA 4ACAA 3D6FA 4CCWA 4CNQA 3OU2A 3KR9A 4GD3Q 4GPEA 1FYWA 2JASA 3G2JA 3QXHA 4LV5B 4FYIA 4DPLA 3DXZA 5I48A 3JY6A 1I94B 1Y37A 2J07A 4GRDA 4W5RA 1SXIA 2GPBA 3MMNA 5LB2A 4O4JA 1QH1A 1MLDA 5KDDA 2EBHX 4YY3B 2Q3BA 4R5HA 1GZSA 1R8SA 1RC1A 3GAFA 3K31A 3I2KA 3OKPA 4Y1RA 2PMKA 1MIOA 3OEHD 1V96A 4J1QA 4QLBA 4BNGA 1GT91 1FMLA 4QUHA 2L17A 1FXUA 3K9NA 4UBOA 1HA3A 1QYRA 2ISQA 4H1HA 2P11A 3FHJA 3F46A 1PL0A 4OHUA 3T5DA 4G07A 5J4LA 3QYPA 4R69A 1A7JA 1ZD5A 2WF5A 2PKEA 3IAS1 3O6VA 4YRCA 1JB1A 3TNJA 2D3WA 3VOTA 3TZLA 5IANA 1KYWA 3M6WA 4LMBA 3RYIA 3GLIA 1GR0A 4Q1VA 3KEFA 3DDZX 4BLUA 2DF8A 2YRFA 4MEBA 3FNHA 2YIVX 4OHBA 2BGGA 3BK1A 4Y0NA 4JNCA 5JJBA 1ZQ9A 3WJ2A 5EJ9A 3OZRA 1U0TA 2IA5A 4OQFA 2FMHA 1GPDG 3EMVA 1B8VA 2WSSD 4V0OA 4P38A 5IWAB 4ABYA 4FXPA 2JBAA 2PO7A 5IJWA 5EZYB 4OPMA 4PPQA 4IIDA 3SHTA 4KO3S 3C3BA 4QSMA 4CF7A 3FDIA 3CLRD 2HNAA 3I8SA 3QJ5A 5BN3A 5F23A 4HCJA 3TIGA 2X4LA 3QXGA 3VZPA 2GXUA 1NYRA 1N1EA 4XR4A 3C4JA 1K27A 2WFMA 2PFSA 1GV0A 1QLHA 4G8JA 3TW4A 3OAAA 3MT0A 2C7BA 1L8OA 3H5LA 4L72A 5LQRA 1C4XA 4AS2A 2O3TA 3MAAC 3K6SA 4JR2A 1G0NA 1O8BA 4IOMA 1CY1A 3JQ8B 4EARA 2V7TA 2VTEA 3ZWCA 1MNQA 1E9AA 3QWBA 5C52B 4F9EA 1ACMA 4RTMA 1GL6A 4GI2A 3EZYA 4NZOA 3P2JA 5F5LA 4MQ4A 5BW4A 1A69A 2EKLA 3ANYB 1A0OA 1Z45A 2GCIA 4KGVA 4YTEA 5L95A 1Y81A 1DGQA 5G1OA 3CBQA 4UVDA 4UCXA 3HVUA 4BMXA 4IXTA 3CH7A 2ZIWB 3NHPA 4KUGA 2E9SA 5BSUA 3ZY5A 2NXNA 2X2FA 5KYYA 4KPEC 1JDVA 1ZR2A 1IBKB 3BRWD 1XQVA 5CDFA 5BORA 3MW8A 3ZUPA 1NVKA 2DLCX 1USUA 3L8CA 3OO0A 3JU3A 3T3MB 2P2SA 5C5IA 2YWBA 5DCUA 2JGFA 5FI3A 4ZPJA 1XALA 1DEHA 2GN0A 3NHFA 1R3DA 3V3KA 2VYQA 4L1KA 4EZBA 5L4NA 1L5RA 4OLBA 5DI3B 4Y2QA 3FTFA 4JCOA 4N5HX 5JDCC 4DMHA 3RFVA 1LCIA 1NBME 1QQ5A 5AVVA 1NE2A 4CL3A 1JI0A 1MTOA 2OVFA 4BNTA 4BJHB 3U4DA 4NCHA 4F6RB 1QAOA 4U3JA 3OOEA 3UF0A 1LI7A 2JLBA 2PH1A 5PGMA 4J0IA 1RYFA 4BNWA 4CR8A 2VAMA 1OFTA 1OBCA 3VC7A 3K0FB 2WJVA 3I04M 1C8KA 2IK8A 3LT0A 3PWTA 5DBIA 1EK6A 1ULZA 1TCCA 3OT1B 5MF6A 4LDJA 4KDRA 1SUIA 3K53A 4CT4B 4ENTA 4ND6A 3PQEA 4PINA 2FUEA 2FPOA 1PDWA 3U26A 4FYYA 4QVIA 3DV0B 4XSHA 2OV8A 2CHGA 3AHHA 4LZWA 3EGCA 4HTFB 5CX1B 1AKYA 2HUPA 3HCAA 5B1SA 1QG2A 1D4OA 2OHHA 4L15A 2O8VA 1WKVA 4RTQA 1YRYE 1DIRA 2FFQA 4IIXA 1P1HA 1JDBB 1CUSA 1Z5NA 4LXTA 1F48A 3MFQA 1SQSA 3QLVA 5ESRA 4PNPA 2G3YA 1IZZA 1TB4A 2AVNA 2VAPA 1UPFA 3PT5A 1DMRA 2VRCA 3DKVA 1LLDA 4ER0A 1ID8A 3EXFB 4S12A 1GQYA 1SC4A 5TARA 1VG8A 2HY7A 2R8PA 4ZK6A 4M88A 4PYRA 2VZ0A 4QDTA 2QZ4A 3H9UA 4CG2A 4YCLA 3ILYA 1T0JB 3AB8A 3EZNA 3HNPA 3ZVKA 3TPCA 2PR2A 1ACJA 2XKJE 1TAHA 1E7MA 2QTGA 2GRJA 4YI3A 3CWCA 4OQ4A 1CEQA 3DCIA 2I1VB 1QAQA 1YD7A 2NU6A 4RA6B 1L5NA 4NXMB 1PIWA 3RUCA 3LVBA 2C8KA 1XZMA 4WVLA 1TLLA 1H5QA 5HMLA 1ZJZA 3LK6A 1KK2A 2SICE 2JIDA 2IEYA 5IAAA 4MUNA 5FORA 1NFRA 4MUMA 2WTXA 1CS4C 2DWQA 4W9NC 4A10A 1ZNZA 2OQIA 1SKYE 4WFIA 3PCTA 5D00A 1FXWF 1Z2DA 4YRGA 4OLHA 1NVTA 3F5DA 3OQ1A 4GOOD 3B9QA 3RTBA 5LZ9A 1NNSA 3IEIA 5LIPA 1SXQA 1D7AA 1SN7A 1U8CB 2B34A 4TMWA 2IITA 2WWWA 3FNGA 3INGA 1IOZA 1GLVA 1JYFA 4A6DA 4KPYA 4UHKA 4UVGA 3G1TA 3UBMA 5CVEA 2CFCA 1AK2A 2V3VA 3PQ6A 1VSBA 4DANA 1WSDA 2V0GA 4ZKDA 3U3OA 2VSQA 2AZXA 4A36A 2C3YA 3ZBPA 1Z4NA 3CEPB 3JR3A 1CY0A 2A14A 4DSAA 4Q9JA 4GMDA 2AOTA 4G9GA 3OKAA 4NE2A 4AULA 2GGSA 3LC1O 2RHHA 2PNFA 3CLVA 3E48A 5CVDA 3ZJUA 4OJTA 1OFHA 3UJPA 2V7UA 1QH8A 3SKXA 5U4XA 4KFSA 2OCXA 3EIOA 3U37A 4ARZA 3C3CA 1XD9A 3CTPA 4CETA 2V7GA 1ZOSA 1CP2A 5IX8A 3M5DA 4JJFA 4ZI7A 1IJBA 3SJAA 3MRSA 3OEYA 4ZIRA 5CEJA 3KQLA 3DWEX 2FXVA 3DSRA 2RGBA 1FNDA 3DAOA 4IMPA 4GQAA 3USZA 1MAUA 3HBAA 5FTKA 3VKVA 1KQPA 1C0KA 3IOCA 3I34X 1YQ9A 4RABA 5HSGA 1L3CA 2P6NA 1H42A 1PX2A 4LTMA 1NATA 4BNIA 1O6BA 4HQ6A 4MV9A 3LYLA 521PA 5CDSA 1CY6A 2VA8A 2IT1A 3RF7A 3WQHA 3CIOA 3JARB 2EZTA 2YYSA 3SZLA 5K03A 4AN1A 3K0AA 1TYDE 4RJKA 5KNDH 3L18A 2VP4A 2ZRMA 2WDPA 3RUHA 3OF2A 1ZZGA 2OUIA 2W2OA 3SYTA 3O94A 4CV3A 1Z2PX 1ULHA 1JKJA 3PGKA 4FEAA 2HU2A 3W7BA 2XGJA 1OC4A 2A4KA 2NSHA 2QG6A 5CJ2A 5DM4A 4ESVA 2YZNA 3IB6A 1VLLA 2EGUA 4XFJA 1NQ5A 1BYIA 5IEBA 4M1MA 4AJIA 3FA2A 3COZA 3OX2A 1HQDA 3PPXA 5BQOA 3A37A 4CV2A 2R6GA 2Z8YM 3X1WA 4OK3A 1UXGA 4XDHA 1WDMA 3OCCA 4PANA 1PJAA 5DMXA 3PQFA 5AUQA 3I52A 2DVMA 3CNHA 3ZN2A 2GHIA 1Y9DA 3F3MA 3KOMA 1T8PA 2ZUEA 4RC9A 4JLWA 2CLHB 3AF5A 3IURA 2QRZA 3Q4GA 4DJTA 2RK4A 2G83A 3TR5A 2PZKA 5I5EA 1Q1QA 3EVEA 3M49A 4QHTA 5JZOA 2V55B 5EXTA 4MK4A 1X19A 2C84A 4ZMBA 1PK8A 3RS3A 5JC8A 1S2IA 2A5GA 3PXBA 3G5UA 3A1EA 4MVJH 1OTXA 4XJVA 3UCEA 1WOMA 1FW6A 3DOHA 3EZ7A 4D3XA 2O8NA 1ZJYA 4ZJYA 1SXHA 3OTWA 4IAOA 5AJHA 4DEYA 1EXMA 3FOFC 2EBUA 5I45A 1CFJA 4X20A 5KX5A 2WV7A 3KWMA 2XA2A 4FZJA 2E55A 2IZ6A 1B41A 3I9JA 3PFFA 2ZCUA 4PSVA 3SKVA 4EJMA 3G85A 2DMRA 4AMVA 2UVQA 3TBHA 4JJ4A 4OLFA 2A0XA 3C3EA 1VLZA 1Y5LA 3A4MA 1M72A 1BGXT 1JNXX 2GZSA 3A4TA 3F5QA 3HYTA 4IDEA 4Q16A 5G0UA 2HUNA 2B7BA 1I24A 2GPAA 3AKDA 1JAZA 5IDVA 4BX9A 2R7LA 3I58A 2WQ7A 2RE8A 4KRFA 2XYQA 3AM3A 5K7SA 3GFBA 1PYDA 2XKAA 1D4FA 1JEEA 1XKLA 3AUXA 3BE6A 3LBAA 2O7RA 3QIAA 4UAUA 4W7IA 2QYTA 4JQSA 4BWVA 1QZXA 2F7SA 1T13A 1N0WA 4POAA 5KNCA 3R20A 3VPBA 2Y6UA 3JQ7B 2XYGA 2WHXA 4JCCA 4RSGA 3TG8A 2RGXA 5HKBA 1TMGE 3PLRA 4NU0A 4X6LA 4BJ3A 3CURA 4D0NA 3I9V1 3L4EA 3RTGA 1JKXA 4EI7A 5LA6A 3GWZA 5IHPA 3DP7A 4BGIA 3FB4A 3KHKA 1MGPA 1QIJA 4CF5A 4B3MB 4W9RA 1RZRD 1OX4B 3VBEA 4R1LA 3FOCA 1DXYA 4RM3A 4EYEA 2ODTX 3DE3X 1R6XA 1FDRA 3H83A 1A96A 2LVBA 1DLJA 4L51A 3FPLA 3HHPA 1ZUIA 4IH4A 4XDZA 1Z5OA 4KN6A 3N6XA 3JXEA 1UBOS 4GZ6A 2QVXX 5K0EA 5TVKA 1DHRA 1WMBA 4QZVA 1EVEA 4XVRA 1BWRA 4IWXA 2IVZA 4UXHA 3CFYA 4LDQA 3GLVA 3K6RA 3D3WB 4XUCA 1U7TA 3DD1A 3O2QB 1A04A 2E4VA 2OAGA 1H5UA 3D2AA 4KFTA 5C32A 1H69A 2FN9A 3FWZA 2JDID 3ZV3A 1TCAA 5HKLA 4U7DA 2C97A 1T8UA 4U2EA 1WXWA 3AVPA 1XJWA 3AXSA 4OFBA 3SMVA 2Q9BA 3V8MA 4WZBE 5ECDA 2WIBA 2OCPA 3TTTA 3L6EA 4PE5B 4TX1A 3DFIA 1WIWA 2GJAA 1AUQA 4NMLA 3HUEA 4IY1A 1MRSA 5FKJA 1OI2A 3IESA 3F6EX 4PG7A 5COBA 4ZTZB 5CFRA 3OE1A 3AF1A 2DX7A 2OZPA 3KZVA 1D2MA 2XOXA 2W6OA 3M0EA 3O84A 3KBBA 4HZUA 4Q4JB 5KS2A 3X1DA 1GCAA 5LCXA 5C35A 2M1XA 2OV6A 3ADPA 1TZCA 3PV0A 2WFZA 2AG0A 2YXDA 1T3TA 2GHQA 3O3MB 3WSTA 4YRJA 2CCKA 4IQ0A 5K05A 3ROZA 2CBGA 3BIXA 4ZVLA 2ZM6B 3EE6A 3I53A 4QOHA 1I5OA 4NSNA 1CLUA 3AY7A 4L0CA 1CUHA 2NAPA 3KLPX 2QP4A 4HWKA 4Q3LA 3VR5A 4CKEA 1NOKA 5DNAA 3LRPA 5SY4A 1R4MA 4JB0A 4CDGA 1GAXA 1YR6A 2ZE8A 1VG1A 2ENWA 3OT5A 2QTVB 4FCWA 2OO5A 4X41A 2WF6A 1I7DA 4UPEA 2C59A 2EIHA 2GEUA 4HJXA 3H11A 4QGHA 2JAXA 2ZYGA 3AJ9A 1G9XA 4M86A 4XYBA 1V7ZA 3LLMA 4YC7A 4IJVA 2IJGX 4OKIA 1LC0A 2EQAA 4YAOA 3W6OA 3HXPA 2X2PA 2GWRA 2BEWB 2LUOA 1NVXQ 3C97A 3OFKA 4L02A 2COUA 5FIUA 4LJ8A 5KOHA 2QL5A 4EL0A 4INAA 3HRIA 2JB9A 1Q5PA 3C7AA 5LYYA 1JHRA 3KL4A 5IXJA 2XCUA 3AY3A 1DIGA 1YR1A 4QELA 2V8BA 1QRAA 5F9HA 4XM0A 1O6FA 1QS0A 1IN7A 1URPA 3HFGA 3TZBA 1LF5A 5DXJA 5B64A 3AETA 1ZH0A 2DB3A 4KIUA 2KLHA 2O2SA 4C7OB 4M8NE 3S55A 1Z8DA 5BSEA 2ZZMA 3F98A 4G3XA 4QFMA 2PJDA 3RIYA 1SQGA 3FN4A 2QX9A 5IDQA 5KQPA 2CXSA 1L3BA 3U4QA 3IQDB 1OT5A 3KZCA 5H82A 2LZ0A 4J29A 3P9SA 3BWBA 4NY1A 5DU2A 4TZ6A 1XFDA 4CFSA 5AI0A 1ANKA 1JT9A 2NAFA 3A6HA 4DBZA 2E87A 3OJ0A 4CKCA 4EHAA 1WY5A 4OL0A 3JWGA 5HIJA 2CXQA 4O63O 1Z06A 1EK5A 4OHXA 3QBJA 1SHLA 3HO8A 4I6GA 4PYIA 3KQNA 1XRJA 2XF8A 2ZU0C 3EPLA 3W05A 1RAGA 1RQ2A 4I1VA 3D3QA 5KYTA 2PIAA 3DCJA 3HCBA 1GUFA 1U11A 1NG9A 4RVHA 1BS1A 3ZLVA 4BIMA 4XAQA 5JEEA 5K8IA 4Z54A 2W83A 4LZOA 3IHTA 5I4IA 4J1TC 1IPFA 1C7JA 4AXXA 1RWOA 3RD5A 2GSDA 1MENA 2ZP1A 4AK9A 3N2ZB 2BMWA 2P8SA 1ADJA 1E1CB 4HFNA 3D3EA 4OXRA 5DWQA 4M1ZA 2AYZA 4MR9A 4P3KA 3H4TA 2IXDA 2YHIB 4ZHSA 4C9BA 5JNRA 2O0KA 3OA0A 2HW8A 1JG3A 2AWOA 4HNQA 4MVYA 4PGMA 4RVDA 2XZPA 4B3SB 1ND5A 1MB4A 5LLDA 1L7AA 1XDDA 2ZG6A 4LY3A 4D97A 2ATEA 4ZOLF 1JFFA 3CLRC 2X0FA 1AXEA 1SUAA 2W70A 2BKAA 3D8SA 4FOOA 4HLNA 1W4RA 4KR6A 2QLMA 1WHTA 4E5VA 1CB7A 3NWJA 4MYHA 4FQ8A 1DT5A 3NHMA 1RYEA 2FSSA 5CVVA 2AR0A 4C4XA 2KWIA 3L0SA 3DR3A 1NUQA 1BRMA 2WSYB 4GW3A 3NH6A 4AUNA 2QTZA 1GDDA 2MR6A 3ZXIA 2ZSEA 2AMVA 3ZCTA 1L7BA 5HUHA 1N6OA 1JA9A 2I2XB 3FKJA 3KT6A 5CXQA 1FFDA 2JL1A 2P75A 3K9HA 4G0NA 4WOKA 3M6MD 2IZ0A 2BZGA 2UUBB 1FVFA 4C3OB 2HRRA 4WXPA 2AC7A 3A1NA 4PYMA 1ES9A 1HE4A 1Y3DE 3TR0A 2PK3A 2XTJA 3KJIA 2WJWA 4J91A 5IC6A 1F3OA 5TEVA 4D4HA 5CPBA 3R8FA 2Q1UA 3DBRA 2VH5R 2XITA 4YROA 1IMOA 3ABOB 1W19A 4ENQA 3MXOA 2P5YA 4C7MA 1Q12A 5KJFA 4LYDA 4J43A 4GEGA 2GK7A 4UEQA 4RD6A 4QAQA 2EKQA 1FDOA 3C15C 5HIKA 1Z83A 4GOJA 5IT9A 1USVA 3CM0A 2MYNA 3P0RA 5IEJA 2JGMA 1ZITA 1RP1A 3SZRA 1UWVA 5F4ZA 1GCOA 4XXHA 1DQNA 5JCZA 1MJHA 1KJQA 1K7XB 2I67A 3NGLA 4TS9A 4LJ4A 1I7SB 3O8NA 3SXPA 3P9PA 5GADl 4M3NA 2Q7OE 2Z2IA 2CHEA 1ZR4A 4V0ME 4B4DA 1IUNA 3ICWA 4JY7A 4S05A 1P5ZB 3K35A 2VA9A 2QU8A 3MBOA 4GYKA 2OFWA 4PBSA 1E79A 1SQ5A 3I6BA 3HR8A 2I2WA 4WCVA 3T5GA 5AIBA 1MW8X 4LYEA 1YRBA 1QM5A 4X44A 2A0KA 4RY8A 4U02A 5HFJA 1E1KA 2FPGB 5DNUA 1Z6AA 2X4GA 4D3SA 3AVXA 1BKYA 3JD0A 3QLEA 4I5FA 1TNDA 3TOSA 5K45A 1XU9A 5A1JA 1SUCA 3W3AA 1IJEA 4LYAA 2IXBA 5JMWA 2L69A 3R3VA 2FA9A 4EW1A 3KQUA 2QTAA 1J2JA 3PC3A 4FX5A 1TTQB 1VI5A 4Q24A 4ZTBA 5KDLA 1XV5A 1T3ZA 3G5LA 4FIZA 2JFXA 1TZMA 4IIYA 1HSZA 1M8FA 4DVGA 2H9IA 4HAYA 1A77A 1SUBA 1ETHA 4FC7A 1CE8A 1HQCA 5J59A 4KE7A 1K5HA 2ZJFA 3PICA 1YRLA 1C7RA 1E5LA 4HQ0A 2BRUC 2IYUA 1F14A 1NNUA 1YQGA 2JFYA 2NO5A 2QQGA 2XB6A 5KEIA 1Q1NA 4UBNA 3AG5A 4NL4H 4DC0A 3OY2A 3NBXX 5ITZA 1ZXLA 1FXWA 3QE9Y 4C14A 1HC7A 1RJFA 5AJZA 5A62A 4N7JA 1XQ9A 5G0VA 4MMZB 1NX9A 2VHVA 3BN3A 4FWBA 2UYCA 3P2OA 4IDNA 1GADO 4CQLB 3NJ8A 1TF5A 2CDCA 4AD8A 4MPJA 2FV8A 2GAIA 1FP1D 3RE1A 5EWMA 5IMSA 2O2YA 3W78A 4F5DA 3BMCB 1OCEA 1WJGA 3LX6A 4ZO9A 3N8GA 3ZXYA 4RSHA 2AN9A 2LNDA 3VU9B 2I7VA 1M1NA 4YXFA 5EL0A 1INLA 1V9LA 5EJIA 3V1LA 4BLOA 1W29A 1NJ2A 3DDUA 4PYQA 5A3SA 3CZPA 4H4EA 3V33A 3OECA 1PZFA 1TCVA 3LRTA 1C8BA 1I32A 2Q50A 3QV1A 4RFSB 2R6AA 1YAJA 4JIGA 1H94A 3LWBA 2DPHA 3PG5A 4QU5A 5F2KA 3ONEA 4AS3A 3AVWA 2FGKA 4HYQA 3QPDA 2BF4A 3BOSA 3LT1A 4A1OA 2A3NA 3LC2O 5J2UA 3KYBA 1T3GA 1DBRA 1CZUA 3AR2A 3DMTA 3HYLA 1CUIA 3M2PA 2YN0A 1FYXA 1N0HA 3A4NA 3QVOA 4L5BA 3TFWA 1MFPA 4RYDA 1ZSVA 2G07A 5AFSA 3ELUA 1UF9A 4KVFA 5DYNA 1MJ5A 1EB8A 5LWHA 1QMPA 5A9SB 3ZNQA 2I0FA 3DDWA 5IBCA 1KO7A 4QJ4A 1KRHA 3O83A 4M0DA 4D7AA 1C50A 3FMOB 1F6BA 3AL2A 3A7DA 3OZEA 5EE3A 3R8CA 4WESB 1RQNA 3HUTA 3HXOA 3A1WA 1KI1A 1FFSA 1K8QA 1QGAA 3I6QA 2HCJB 4UVHA 5C4IA 4WOCA 1ODIA 1VKJA 3NC1C 2D1FA 2QQ5A 3OT4A 2JFFA 4DLUA 1MC1A 3K9WA 2O1EA 5AHKA 2XTNA 3RC1A 3U7QB 2BFPA 3D6JA 4K9SA 3FGPA 1QX3A 3TECE 3JQCA 1Y8AA 4GRIA 1EZ4A 2YMPA 3WI7A 5GVRA 1B3RA 4P98A 4JJ7A 1JPUA 3SE0A 1P2SA 4X1YB 5KC9A 2ZGVA 3ESCA 1XPJA 3T1YB 5CW1A 5TX7A 4CXMA 1TU4A 2YJTD 2I6QA 1X7ZB 1E2PA 4FK8A 4BX3A 4UXIA 1P91A 4LWZA 1TM7E 4WINA 1YR8A 4QRHA 3TCKA 3N05A 3MYYA 3AQIA 4FFBA 4TL6A 2BUAA 4C2UA 2H4JA 3LM8A 3ZYCA 2P67A 4BPRA 4CF3A 4PZLA 3LNTA 4HS9A 1DAOA 1LBTA 3U7JA 2HWUA 2Q1WA 4QT4A 5T7BA 4GGOA 3GT4A 4HAWA 4WKBA 5IJ9B 4DS3A 5ARBA 1RAFA 5C31A 3G2MA 3I9MA 1F0NA 2WR8A 3W8DA 2R1VA 3TOZA 4G2TA 2Y66A 2N46A 1JFVA 1JQLB 3AOGA 3O03A 2HD4A 1FTYA 1TE2A 4N3CA 4BO7A 3A3NA 1FL9A 1X13A 4RANA 3FTEA 1F2UB 1YRAA 1FDUA 2AFIB 1GQ2A 1Y80A 2VF4X 4FQ5A 3C98A 2AOWA 1H1LA 4PWYA 1T0BA 4TV9F 2IC5A 2AH5A 2FJ0A 3IH5A 3L5KA 3Q1KA 4XRRA 5DHTA 3WQQA 2R85A 3U40A 1A4IA 3TCNA 5DP2A 4UNQA 1VCOA 1J33A 1JECA 2ZWAA 3FMIA 4YWHA 821PA 1QNLA 2PMFA 2CEKA 5L8VA 1ZCJA 3GN2A 1ZOPA 1OLSA 3FMPB 3RJMA 4MUFA 5HKOA 3HG7A 1UWLA 1W581 1FMFA 1M3SA 4YMUA 3FAZA 2Z2JA 3GO4A 1FSGA 1MQ9A 2R7KA 4QICA 2ZSBA 2A1IA 3IOYA 1Q0TA 2ZDGA 3HNRA 5IUKC 1RE0A 2CLOB 3GH3A 1WKCA 2IE0A 2R44A 4CM8A 3X1MA 4YJ2F 1L1EA 1H8HD 3ESQA 1XZPA 3PU6A 4N0DA 3STHA 3H87A 1QRTA 2P9CA 3O92A 4EECA 3N0RA 1SCBA 5G2OA 1XDGA 5D7NA 4Z0NA 4AUEA 2IV7A 4ZT5A 5KVAA 4GX0A 4GSKA 2BI8A 1F8GA 2R00C 5KJCA 1E2BA 3EXHC 3TUIC 2F8TA 2YNMD 4I1UA 4E0BA 3W2GA 4EFKA 1PFVA 4F4CA 4QULA 4AY5A 1VP9A 2VPTA 2Z3VA 1Q7CA 3A2MA 4RHXA 5CH3A 4PN7A 5DTIA 1QO0A 3GVIA 4JJ8A 5DTJA 3BH0A 4FFVA 4OIFA 4MWGA 4Q18A 5EQFA 4PQYA 3W3ZB 1EUYA 3T9DA 1PR5A 3HVKA 4Y9DA 1Y1SA 4P86A 3U17A 3VR6D 6LDHA 4DDTA 3H86A 4LNHA 3F96A 2NVUA 1JEQA 4JXXA 4CIYA 3QX7A 4LRTB 3QOWA 1QHHA 3E5NA 3RSCA 1UDXA 3T1TA 3RAPR 2ZRFA 1FX0A 3VV3A 1G8HA 4URYR 1VDZA 4KLRA 1Q7GA 4EIWA 2O48X 1XRLA 3B6EA 1FC0A 1YHNA 2OO3A 2Z5GA 1JH8A 1I3CA 1UOEA 2X8JA 3E03A 1T15A 1NZFA 5DCLA 3VISA 4UQLA 2FRXA 4GPTA 1M0EA 2EGHA 1JL3A 1XXLA 2XUFA 5T4BA 5ALUA 1UFQA 1SVSA 2FZ5A 2PRJA 2PGNA 4NNOA 2BE9A 2EXXA 2VKQA 3HN6A 1ZBQA 5M7EA 1E8DA 2YYYA 3O38A 1JPJA 4EMTA 2ZJZA 2XB9A 2O14A 3LA6A 1PJQA 4FEYA 1IUKA 4F9TA 4RV9A 2GXAA 4XCQA 1WPQA 5ICFA 3QF4B 3K9FC 1G8AA 4KR2A 1M2FA 3W1VA 5AHOA 2ICAA 4OHVA 1X7XA 2YHSA 4QHYA 2IW3A 3HVRA 4KITB 1GJRA 2XBMA 2XWJI 3REGA 1L7PA 1GFZA 1YT5A 1UC8A 2DUWA 4J03A 2EDCA 3UAOA 4B80A 1ZHOA 3RUFA 2BELA 4L78A 1Y7HA 2Q45A 3KKZA 4JBIA 4TTSA 2X22A 3NUGA 5CFPA 3ORQA 4CLOA 4C2TA 1VKOA 1OREA 2G67A 4Q7QA 1H0RA 2OHVA 2C04A 2DULA 4F91B 2X6TA 2GI4A 4FGWA 5CXXA 2IPLA 2W43A 1IUOA 3RWOA 3IR7A 1WVIA 4BUCA 2PGIA 3N8IA 4J4HA 1Z4JA 4B87A 5AOCA 3RKRA 4Q9NA 2YWFA 1JIKA 3UZUA 3ZW8A 1UPTA 1RE1A 1Y42X 2A30A 4IG9A 3ENKA 3H6KA 1TM1E 2P9ZA 3VH4A 5LSAA 3KQKA 3GQBA 3ZHOA 5IF3A 2P4UA 2DWUA 3CF2A 5HEKA 3NHJA 5IVKA 4R81A 5F76A 1PFKA 3U80A 1K9VF 4A8JA 1GPNA 3OVMA 1W76A 4JP2A 5A0TA 1RXSA 2XYVA 2EVWX 3A1SA 4CGZA 4WX2B 5BN1A 4EA9A 3D1VA 3IUBA 2GR9A 4NCIA 2DCUA 2WUEA 1T0IA 5DXAA 1NR7A 4ONEA 1C7EA 4NCJA 1R18A 1DV1A 3WNQA 1RYHA 1A4UA 1N5IA 2JZOA 1V5GA 3AYXB 1QOZA 1YGYA 3MCVA 1Z33A 1SZJG 1JQBA 3QXSA 1P45A 4MLPA 4X9XA 1QUEA 5HMMA 1KOLA 2YY5A 2E4WA 4Z53A 4RSRA 4RZIA 2HA4A 1QF7A 3AZPA 1EE2A 2HXGA 3Q8XB 4ZEOA 4BO2A 3KFLA 1YMQA 4IGIA 4F45A 4YRRA 5MN5A 2FFBA 2QL6A 4GWKA 3OSUA 4GWGA 4TS4A 3P4UA 2FF7A 1Y6QA 3EZLA 4HDMA 2VF2A 3ZIDA 1FNCA 2ZZKA 2C4VA 4IWNA 3BFVA 1KR5A 2Q6LA 5C46F 2G6TA 3LHIA 5C7IO 1TW2A 4WZAE 3PI7A 1U8EA 1G1AA 3WYNA 1FUUA 3JVEA 4Q9IA 2JK0A 4AT1A 5IYZF 4FQ7A 1V35A 1S8OA 4QYIB 3UA4A 3QSYA 4L2IA 5DK6A 3VTAA 1C3JA 3AM1A 1Z39A 2G1PA 1ZOOA 3B52X 1BXGA 1V4NA 3KEGA 1KBQA 4HDSA 4B3CA 4A4DA 3I01M 4MV1A 4ZEMA 1CY2A 1R37A 1VB3A 2DR3A 2BFCB 2YJNA 1EU1A 2Z1DA 3OLXA 1O95D 1G42A 3FYHA 3GLHE 4FXOA 3C8HA 1QAMA 4KL8S 4KMOA 4CG1A 3NVDA 4D9JA 5FO0A 3ZX4A 3WYGA 2W6ID 4A5OA 5BW5A 2ORIA 3HL4A 1F20A 4P5DA 5ICGA 1M5TA 2FXIA 1L5YA 4ESEA 4H3SA 1YHZA 5IVDA 4C4RA 5EJ4A 1OXXK 1LSJA 3HXKA 3JYPA 3GPIA 2C00A 4HEJA 2C5EA 3FUCA 4V03A 1MVOA 1FDTA 4QT0A 1MJGA 4CNBA 1CJKC 5C18A 2WJ6A 2JCXA 1HDYA 3IT1A 2P9FA 2A7QA 2VHZA 5BUCA 1P61B 4GC9A 1HKUA 1ULBA 4EJSA 1JI3A 1LRLA 1NNI1 2NV0A 4IO1A 1LXCA 3TYXA 4CIWA 3STVA 3RNLA 1E7YA 4R3UC 4LGMA 3DM9B 3OPYI 2X5OA 5DCYA 4F0JA 3IIKA 4G4SP 3UUEA 4CMKA 1TK2A 5FUVA 3ROPA 3SOPA 1BDMA 1XP5A 1UBRS 2FW8A 2J9XB 2Z6VA 3ZZUA 4DJEC 3IP9A 1IULA 1KO1A 3GHYA 3KB1A 3BMNB 3LO5A 3ZCPA 1OKKD 4ZQGA 5T6MA 2NUTA 1NHWA 4B0PA 2OCLA 4TRNA 2HAEA 2BFDB 4EH1A 5BWMA 5JCPA 4YFVA 3NBMA 5TV2A 1Z4IA 4OAOA 1JJAA 1DELA 1M1UA 3I1JA 2O8DB 1FQJA 3D7NA 3WZ2A 1JTFA 1NFFA 4ZU6X 4ZZ3A 1TCUA 1PWZA 2FW1A 2P7IA 2VZ8A 2JGIA 4F12A 1GDTA 1KZGB 4FHEA 1AZTA 1Q77A 2IY8A 3KTOA 4WW0A 1U2RA 2Z98A 5AP9A 1XMJA 5B1YA 7REQA 3IQIX 2C4MA 2MSEB 3KJGA 5BRNA 1Q7TA 1YO6A 4DSTA 1QP8A 2DPLA 3CISA 3HBFA 4E3WA 1L4BA 1NV9A 1KZYC 3L0CA 4FOLA 1N8NA 3NATA 2UV8A 4NZNA 3V42A 4OHWA 3T34A 2H1CA 4X6XA 4YT4A 4ZYZA 1H0HA 2NQ8A 3JZIA 3OQPA 4WNYA 3RVQA 2OG2A 2P41A 3ORSA 4WJLA 1T5OA 3EWAA 4R1UA 3IEUA 1P60A 3IKLA 4AP6A 1CIVA 4YUXA 1BFUA 3MGCA 1B1CA 3AFMA 4NICA 1PJLA 2P9HA 3CXRA 3K7EA 3GGJA 4GUDA 1QWOA 4UUBA 5ETJA 3G9UA 3RBAA 3Q15C 3THXB 1BO6A 1HK7A 5L3RA 2CNDA 1I3LA 1QJ4A 4AP9A 2IDKA 4CIAA 4CFZA 4QEDA 4OMUA 5ALNA 4C08A 3ZIUA 4B82A 5JQWA 1X14A 2ZUFA 3NGXA 10MHA 3OQNA 4XX0B 1DIHA 2H7VA 3VYRB 1EP1B 5BQXA 1RWKA 3S2FA 1LX6A 2NXEA 3D02A 3JV7A 3FVRA 3ILHA 3QYAA 3O21A 4IKEA 4M76B 3DTVA 2BFOA 1Z38A 1JDSA 1YQUA 2GLUA 2ST1A 3CJTA 4UM5A 4RHEA 1NA5A 2AI3A 3G0OA 4W1PA 2E6UX 2X0JA 2X5NA 1M2VA 1T2DA 4UREA 3V8EA 2RGNA 3HK2A 4C2AA 1L5ZA 2BGTA 3KVOA 2QT0A 5EEHA 1S3SA 3HKCB 4CCAA 5JH7B 1V6AA 1YFJA 2J7PA 4FFOA 1QYXA 2ECPA 1R27A 1USGA 1NHGA 2WP8J 4KO8A 3V4VB 2B82A 1D0SA 1RRGA 2BGWA 2HMWA 4HGQA 3ZY4A 3COSA 5I4BA 2QRPA 2W98A 2XSZA 2CB9A 2PWZA 2WWXA 3I28A 4PCLA 2JH8A 1A4XA 3GWGA 4TXLA 1P0FA 4O2AF 3IFSA 1IFXA 3I0ZA 4QVGA 3UMGA 2IYNA 3PUYA 3OM9A 1ILEA 1Y7PA 1V1RB 3KJNA 2ONKA 4H31A 1YBHA 1MX5A 2A88A 3ZE2B 4EG0A 4R7TA 1LS6A 2OCBA 4QO7A 3VR4H 3I05A 1M6NA 3DUWA 3PC4A 4INOA 1XCPA 4Q9KA 4EI8A 4URZR 3NDIA 3M3PA 3CKMA 2A57A 3TGLA 2VUTA 2ZAOA 3Q9LA 4WV3A 3R7LA 5B7PA 4DR5B 5A6SB 1JIVA 2YS7A 4K87A 3QP9A 4MUEA 1XMIA 2BPOA 1GQQA 2PM8A 1M6WA 3UW1A 4U5XA 2JW5A 3F5FA 3D0OA 3P9XA 3K30A 1J0DA 1ESEA 1CQXA 4UM8B 4H60A 1BXZA 3LUHA 2B99A 5CA1B 4LRWA 5IJXA 1KERA 1NW4A 1O03A 1TMYA 1Y5MA 2AXQA 4LGYA 3LPDA 3SC3A 4EY7A 3EFEA 3G9TA 4HWTA 2FUG1 3DTYA 3EIEA 1N4AA 1LC3A 3FB1A 3K0SA 1T2UA 3AJEA 1TK3A 2PZEA 4OU5A 3NHUA 4GZLA 1BH2A 2ZJ1A 3L77A 4R16A 1N7GA 5DISB 3D31A 3T9CA 5KSZA 4EO9A 2QVCA 3CEHA 4LRYA 1Z07A 1A9YA 5KYWA 3JWJA 3OUUA 1TUBB 5LVAA 4UTOA 5K4HA 4X0EA 4ZCPA 1E3WB 3AC0A 2IV2X 5LYJF 1E63A 1E6KA 3OAAD 4M38A 2C92A 5D7BA 1ZJ5A 3KR0A 3IVXA 4RMNA 5MFZA 1ISHA 4TZ0A 1XEFA 2X58A 3PXUA 4MUIA 4HRAA 5J43A 4WT7A 5K5EA 3B1JA 4HNAB 5HPYB 5JDIA 3MSXA 2CC2A 3JSAA 4RNCA 3R7WA 4DR4B 4RK5A 3ZHYA 2X8LA 2XODA 1X0VA 1GGMA 4DDMA 1MVNA 2HMAA 5FA8A 3AUTA 3IP5A 4I2NA 5DTEA 3WO1A 1NPDA 4BRZA 4M6WA 3K05A 3T41A 3HLTA 1NVVQ 1S7GA 1POXA 2A0UA 3QNWA 3JTEA 2GZ2A 4GPBA 4YLEA 5DI9A 5SZJA 2IYAA 4GKAA 2GNPA 2ANCA 3NFRA 4JYBA 3WX0A 4I3FA 1DWPA 2EZ8A 1Y98A 4BC0A 2VZEA 4RDCA 4IGEA 3BMOB 4BZQA 4E88A 1P39A 1SIOA 3N2NA 1VSUA 3UQYS 3OURA 1DTWB 4JKOA 4Z3DA 4TV9A 3IXMA 3BL6A 4N1AA 2P30A 2WZQA 3EXHB 2QLBA 2NVWA 2ONZA 4HAOA 3DM5A 4WWHA 5JCOC 5KHLB 3RC7A 2BF7A 5JROA 3C5EA 3TTVA 1RWNA 3A7EA 5FAKA 2FDRA 3GNQA 3GXBA 4R9RA 4CG0A 4YV1A 2Z56A 3W1EA 1LVUA 2QN9A 3CVJA 3I92A 2FN8A 3PFHA 2IU0A 1CR6A 1YDWA 3BE5A 2PA3A 4FONA 4LYJA 4TLLB 1W35A 3WL4A 5IMBA 3GGGA 4RAQA 3KXLA 2Q07A 4OEHA 3C7CB 3M9LA 5CM2Z 3S29A 1BWSA 2DH5A 5EWJB 5IN5A 4BLRA 1PJ8A 4JN6B 4YJ2A 1ZRHA 1MHTA 3FVQA 3C6BA 4UJ3A 4KFCA 1ARZA 1JHVA 1CUUA 1U28A 2H1HA 3V6MA 4HRVA 3C6YA 3URMA 3G49A 1T6BY 2H7YA 4MPTA 2IYQA 4ZRNA 3RSQA 2PQ2A 3SYLA 5JNSA 3FTCA 2F59A 1QKKA 1HH4A 3AUKA 1C9NA 5DHFA 1H0SA 2JA2A 5FBHA 1JHZA 4FT2A 2JCGA 1F6WA 4P08A 4ZAZA 2E5LB