4M7RA

Crystal structure of the n-terminal methyltransferase-like domain of anamorsin
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
180
structure length
180
Chain Sequence
DLGTENLYFQSNAMADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anamorsin
publication title Crystal structure of the N-terminal methyltransferase-like domain of anamorsin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 61
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4m7rA00
2AOTB 2HNKA 3JWJA 2PJDA 3B3GA 3A4TA 5EMMA 4EKIA 1UFKA 3BGIA 3F4KA 4GOND 2ZWAA 2OYRA 3OZSA 3NDJA 3DLCA 3C6KA 3NDIA 4HH4A 1WY7A 3SX0A 3AXTA 3GO4A 4FZVA 2ZIGA 3GRRA 4E30A 4P7GA 4YUYA 3TKAA 4C03A 2UZ4A 2I62A 4QDJA 4IKPA 5CUQA 3KPYA 5BXYA 3G2OA 5KQRA 2C7RA 3O4FA 2Z6AA 2GH1A 1NBIA 2G71A 2YTZA 1TPYA 2YQZA 2ZWVA 3P9KA 2BM9A 4OX9Y 4OBWA 3FTFA 3KR0A 3OFKA 4X61A 5CCBA 2AOXA 4E31A 1R8XA 5HIKA 2C7QA 2FK8A 3NTVA 5K0GA 2I7CA 2I9KA 5EHIA 2P7HA 3C0KA 5HFJA 3B3JA 5EZSA 1KYWA 3RIEA 3DLIA 3MAGA 3TKYA 1AF7A 3UJ6A 4RTPA 3EEOA 2FK7A 3LDFA 1N7JA 2VDUE 3GJYA 3H2BA 3P97A 5FHQA 1ZQ9A 2PX5A 3NWBA 3PS9A 2BH2A 1L3BA 4C04A 2CKDA 5DRYA 4MTLA 3HM2A 3BUSA 4AZWA 2ZTHA 2FYTA 2ZLBA 3Q7EA 1B42A 4UOEA 2R3SA 5EGSA 1KIAA 1M6YA 2P3LA 3HVHA 3TQSA 2IH5A 3NVKI 3OFJA 4MWZA 1U2ZA 4Y2HA 3FPJA 4EKGA 3FYCA 2IH2A 3GDHA 1BKYA 3HCFA 5E8RA 3A7EA 4C07A 3PX3A 3AY0A 2PXXA 4GEKA 5E9JA 4RTQA 2Y1WA 1AQJA 3KQVA 5LQNA 2EG5A 4Z2YA 3Q87B 3MHTA 2EJUA 3UA3A 1L3IA 2ONYA 3NVMB 3NW9A 4PINA 3KQQA 1FP2A 1ORIA 1RI4A 4GC5A 2E5WA 5DWQA 2AN5A 5T67A 5K0BA 3QOXA 5F2OA 3FUWA 4RVFA 5BP7A 3M6VA 1Q0TA 1G6Q1 2PBFA 3EVZA 1O9HA 4AUKA 4X63A 3FTEA 2QYOA 3KQYA 2DPMA 3OU2A 4PYLA 4QVGA 4YUWA 2AOUA 1AV6A 1Y8CA 5FWAA 3T0IA 5FADA 3FPGA 3LHDA 2B3TA 1SUIA 1ZGAA 3E7PA 3HCBA 5ERGB 5F2KA 3BT7A 3UJ7A 3KPVA 3JWGA 4YUXA 2JHAA 2NYUA 3JWHA 5E2BA 1IXKA 3EGVA 5HIJA 5EKXA 1XCLA 3M4XA 3CCFA 2H00A 4GF5A 4X41A 5DXAA 4PYJA 5KYGA 1JR4A 2BR4A 2B25A 3GGDA 2C7OA 3G8BA 1G8AA 1VPTA 2B2CA 1L1EA 2PGXA 5E8JA 1H1DA 4M36A 1SG9A 2NXEA 5GM1A 3EVDA 1JQDA 1EQAA 2VDVE 3LCVB 1KPIA 3DXYA 4EQZA 1IM8A 2AOTA 1FPQA 3GU3A 5DT2A 1ZG3A 5HIIA 2KW5A 3M33A 2I6GA 3DMGA 3LDUA 4OQDA 1P1BA 3DXZA 5DX0A 2ZULA 4GQBA 4QPPA 4PYKA 4CXMA 5GWXA 5LQKA 3QV2A 1XDUA 4RX1A 5E9QA 2AVNA 2QY6A 3R6TA 3CJRA 4ATNA 3DOUA 2G70A 1RJEA 1OR8A 3FUTA 4X1OA 4ER7A 1M0EA 3B3FA 3OE5A 4FSDA 2Y1XA 4E2XA 3FPFA 4PCLA 2ERCA 1ORHA 5C9ZA 2IBTA 1G8SA 1R8YA 4PONA 4NECA 3UJ8A 4E2WA 4YMGA 4E32A 3BGDA 5FWDA 10MHA 4RV9A 1SQFA 2IPXA 5GM2A 4RWZA 3CVOA 4PCAA 3C3YA 3OPNA 5EHGA 3ER9A 5ICFA 4C05A 2ZZKA 1XVAA 1XTPA 3BKWA 2WA2A 4LECA 1I1NA 3PX2A 3PFHA 3JWIA 4ER6A 2ZIEA 1XDSA 3FPHA 3VSEA 3LCUA 1KR5A 5DTRA 4PYQA 1WG8A 5P8WA 5CCXA 1NW5A 3E23A 4DZRA 5EMLA 2Z6QA 1JG2A 3I9FA 2HWKA 2P3QA 5EC8A 5K0JA 3MCZA 1QAQA 4HC4A 3G89A 1YUBA 4M7RA 3TOSA 2HV9A 1MJFA 2FCAA 2GB4A 4DQ0A 2NNWB 3UBTA 2OB2A 5DRTA 4F85A 3NMUF 2OY0A 1RI1A 5D1NA 1AQIA 5FQNA 4YUVA 4DF3A 3DULA 4M38A 3EVAA 4DMGA 4PYNA 2K4MA 4ISCA 5FCDA 5KQSA 4QTUB 4CTJA 3MERA 2AOVA 3OZTA 2YXEA 5CM2Z 3ER8A 3EGIA 3NWEA 4KW7A 4FSXA 3G8AA 2N47A 3P2EA 5EIFA 3KQPA 4P7FA 4R8SA 3AJDA 2FHPA 5K01A 1KPHA 8MHTA 4AZSA 1EIZA 1HNNA 1R00A 1V39A 4RTKA 1NBHA 1UIRA 2OPBA 4FT2A 3KQOA 5EIWA 1G55A 2P40A 5D1HA 1VP9A 1D2GA 3RW9A 1WS6A 2PSSA 3LX6A 3PLAE 1YZ3A 3HA5A 4KIGA 4XUCA 4CWAA 4HGZA 3IYLW 5E1BA 1D2CA 1DUSA 2FPOA 5DX1A 1JSZA 4DA4A 1KHHA 1VLMA 2CMHA 5K8VA 4H0NA 2OXTA 3ELWA 5DXJA 4E2YA 2HMYB 2IDKA 1NV8A 3GXOA 5DPMA 4ER3A 3THSA 5K0CA 3HCCA 3MTEA 3P9IA 5DM0A 1SKMA 1NE2A 3HVKA 1RI3A 2XYRA 5LQJA 3ELYA 2GPYA 2YUIA 3P9NA 3ORHA 1R18A 1X1CA 3KPJA 3BGVA 1SVUA 1JTEA 1I9GA 2OO3A 2R6ZA 3PT9A 4C4AA 3M6UA 1DL5A 3B5IA 5K05A 3S68A 4OA8A 2AN4A 4AZVA 2NXJA 2G72A 4AX8A 5K0EA 4RSRA 5ICGA 5LQAA 3UJDA 5E1MA 5K0NA 2ADMA 3BZBA 4HGYA 1Z3CA 2PV0A 2OBFA 2IDJA 2BR5A 3EVFA 4E70A 5H02A 4BP1A 3UFBA 2AS0A 4OQEA 5BW4A 5GINE 3OE4A 2QE6A 2JJQA 1O54A 3FUXA 3HCEA 3K6RA 1NW7A 3EVBA 3G7UA 4FGZA 4WVLA 5FTWA 2PX2A 4PYMA 1FP1D 2PY6A 3P71T 3PVCA 4RYLA 3G5LA 5DM2A 1VIDA 4R6XA 9MHTA 2ZVJA 3P2IA 3PB3A 3LCCA 3I5UA 4M37A 3R0QA 3A7DA 1JG3A 2YVLA 3C6MA 4E33A 5ICEA 4DCGA 2ZZMA 3HA3A 3KQMA 2BZGA 1ZKDA 1XJ5A 2Z6UA 3ME5A 1INLA 5GIOE 4QQNA 5EG5A 3R24A 4IV0A 4V0QA 2UYHA 4RTOA 3IEIA 1I4WA 1TW2A 4R6WA 4YUZA 2VZ9A 3T7SA 5E1DA 4KWCA 4DKJA 4RTMA 2HTEA 2VP3A 2YXLA 3I58A 2VS1A 5LR6A 1WXWA 1X1AA 5GOZA 1YF3A 3ERCA 3TFWA 3G2PA 3DMFA 3FTDA 3E05A 4HRAA 4RTRA 1SUSA 2YXDA 2CWWA 3ID6C 4GC9A 4IV8A 4KDRA 1QANA 2JH9A 2PX4A 4EK9A 2B9EA 3FRIA 3DMHA 2O57A 3EPPA 3FZGA 5EVJA 3IHTA 3UJBA 2F8LA 3HVJA 1BOOA 4PNEA 1NKVA 2H11A 4RVDA 3FPEA 1X1DA 3KR9A 5E2AA 1QAOA 4POOA 1JSXA 3LBFA 4ER5A 2DULA 1KYZA 3GRYA 5U4XA 3D2LA 4RTSA 3LDGA 4FP9A 2PX8A 4P7KA 4U7TB 2FRXA 3GCZA 5EEHA 5C0OE 3TPZA 1IY9A 4KDCA 3G2MA 3U81A 2QRVA 2O05A 4QVKA 4JXJA 3SGLA 3I64A 4EMSA 5LQUA 2GA9A 3DP7A 5JUWA 1T43A 3KQWA 3RODA 4GUAA 2ZCJA 5FULA 4F86A 1F38A 1VQ1A 5HEKA 3SM3A 5CIYA 3LGAA 2PWYA 3P8ZA 4V0RA 2EJTA 5HILA 2AOWA 4PYOA 2XYQA 4O29A 3LKZA 4P7JA 5FA5A 2IH4A 3C3PA 4U7PB 3T7TA 3HEMA 2HR1A 5IKMA 4MHTA 3MB5A 4G56A 4DCMA 3NJRA 1EG2A 2ZSUA 3OCJA 3G2QA 1Q0SA 1PRYA 2AN3A 2P7IA 4C06A 4PGHA 2H1RA 2VDWA 3FRHA 4XUEA 5CVUA 5EEGA 5HIMA 5K03A 3THRA 3GRVA 4QDKA 3GNLA 1O9GA 3OU6A 1QZZA 1EJ0A 4YV1A 3PFGA 1TW3A 3G88A 2O06A 5DM4A 3UJAA 3A27A 2CMGA 2QM3A 1N7IA 1JQEA 3I53A 3M70A 1N2XA 5CVDA 5E1OA 3PTAA 5EPEA 2PT9A 1X1BA 2QRVB 2V74B 2P3OA 1P1CA 1EJ6A 3GRUA 1RJDA 3KR1A 1MHTA 3LBYA 3EVEA 2ZZNA 3UWPA 2WA1A 1SQGA 3LECA 4A6DA 2XBMA 1XDZA 1VP3A 2O0LA 4LWOA 7MHTA 2OZVA 2AZTA 3LL7A 3EMBA 5DSTA 2NP6A 1F3LA 1RJFA 2JHPA 3HA7A 5G02A 2NXCA 3V97A 4KVZA 4E2ZA 1FBNA 5FHRA 5CVVA 3SVZA 2G1PA 5F2NA 2XVAA 1L3CA 3GRZA 1KP9A 2YR0A 2NP7A 4HTFB 2PT6A 3TMAA 1KPGA 4QQKA 2ONZA 3SSMA 2C7PA 3UJ9A 3T7RA 1X19A 2AR0A 5B1SA 3FYDA 5CD1A 3KQSA 1QYRA 2BR3A 3GWZA 3VC1A 3CC8A 2CL5A 3EGEA 2IIPA 2PXAA 2XVMA 5EMJA 2LD4A 4FT4A 3BXOA 4LG1A 3VC2A 4AZTA 3HNRA 1M6EX 3FUVA 2JHCA 4XUDA 4Y30A 4CKCA 5MHTA 1BC5A 5E9WA 4YMHA 3UA4A 1ZGJA 1XXLA 1QAMA 1RJGA 3GIWA 4XCXA 1BHJA 5K0LA 1VBFA 2G8NA 2P1DA 1P39A 5FQOA 1P91A 3HTXA 3OU7A 3TLJA 5C1IA 1WXXA 1JTFA 2IBSA 2YX1A 3AXSA 5HZMA 5CVEA 3CJQA 5DTQA 3LPMA 3HCAA 3SR4A 5EKUA 5LSAA 2P35A 5DM1A 2ZIFA 1NT2A 4YV2A 5EOVA 4PGGA 2ZFUA 3SSOA 4BLWA 4PYIA 3QOWA 2P41A 3L8DA 2JH8A 3HCDA 3M6WA 4BLVA 3BWMA 4X60A 2GS9A 3BKXA 2NXNA 1NW8A 1PJZA 2A14A 2PXCA 5DSXA 5CVJA 5DX8A 1R74A 2ZBRA 3SSNA 5K0FA 2Q41A 3BWCA 2UYQA 4RTLA 4BP3A 2XYVA 2WK1A 1VL5A 4RVHA 2UYOA 5GIPE 5FA8A 3R9XB 2ORED 1JQ3A 2PLWA 3EVGA 1RI2A 1NW3A 2PVCA 2P8JA 3KU1A 3ELDA 3P2KA 5EZQA 3B89A 3CJTA 4HSGA 2GAFA 3A26A 4R8RA 2AVDA 4FR0A 3R3HA 3KR2A 4ZTBA 3V8VA 3M6XA 1JG1A 1RI5A 5LQRA 3B7PA 3DH0A 4RTNA 3VYWA 5DTMA 1D2HA 4MQ4A 3ANXA 5GP1A 5ICCA 4RVGA 3MGGA 3DR5A 4WXHA 4F84A 1HMYA 2IFTA 3SXJA 3CBGA 4EVIA 1R6AA 3REOA 1DCTA 3LKDA 4CKBA 2OKCA 3KQTA 4OA5A 4PWYA 3TR6A 4BY9E 3WSTA 1UWVA 3UJCA 3EVCA 3SMQA 1G60A 4PIPA 2GLUA 2V7EA 3CGGA 3DTNA 1EAMA 3MTIA 4P58A 4QTTB 3KKZA 1NV9A 3OZRA 5BW5A 1YB2A 2ZBQA 4IWNA 4CTKA 4GOMD 4A6EA 2B78A 5T6BA 2ESRA 3EMDA 3KPUA 1L9KA 5JR3A 3DUWA 1FJXA 5T64A 1ZHFA 2OB1A 4R05A 3IV6A 4L7VA 1JG4A 3E8SA 4KIFA 3TM5A 4MIKA 3MQ2A 2EX4A 1YFJA 1KXZA 5KVAA 4K6MA 3TRKA 5DLYA 2JG3A 3O7WA 4HTFA 5IH3A 2ZW9A 5EQJB 3KPWA 5FUBA 3TM4A 2ZBPA 3DXXA 2PWPA 3O31A 3LSTA 3KHKA 3FUUA 4OBXA 3P9CA 2PKWA 4KRGA 4BLUA 3HVIA 5KS2A 3BWYA 2AOUB 1WZNA 3FTCA 5EMKA 3UZUA 4HG2A 5K09A 3A25A 2EFJA 4PIMA 3ELUA 4YV0A 3MCTA 4LWPA 4B17A 3G5TA 4QPNA 4C08A 5LQCA 3EEYA 1YZHA 1VE3A 3K0BA 4GBED 5M5BA 2O07A 3X0DA 4CKEA 1YFLA 1G38A 1NW6A 3HP7A 3AWIA 1XCJA 4GOLD 2UYCA 4GOOD 3CKKA 5HOQA 2IGTA 4DM3A 4FS8A 4RTJA 4ER0A 2BM8A 2IP2A 3BWBA
chains in the Genus database with same CATH superfamily
5T57A 2XUZA 2PJDA 3HJRA 3KDPA 3GD5A 3T41A 3CLRD 3IBCA 4FEEA 4RCVA 1Y5RA 1JEEA 2ZJ1A 1MN6A 1XA3A 3HN6A 1QQBA 4OJQA 2PKQO 1IC6A 2BBTA 3GRRA 5JJCA 3FOEC 2F8TA 1R64A 1WCIB 1NMSA 3FFXA 3VZCA 1EP2B 4IDEA 1XN4A 4BNZA 4C3UA 5A71A 3OT1A 5AKLA 4FCTA 4I99A 4NJEA 4OHYA 4IJWA 4UDYX 4YRDA 5JZVA 4FWTA 2PX6A 4OBWA 1QIFA 3K70C 4NMWA 4DYHA 5CK5A 3URKA 3IVAA 4F3KA 4D9IA 4XWKA 3ON5A 2CLSA 5BWOA 4ZD6A 4MMZB 3UKDA 5JY1A 1N78A 4A8JB 5A3QA 3L7JA 1RQGA 2H7VA 1QTRA 4PG5A 4OUDB 3U31A 3LHIA 2B2XA 2D2XA 1FNMA 3ABSB 3IOEA 4HATA 2FPRA 3F8WA 3IP7A 4PO1A 5K6RA 1JDNA 2ISQA 4GM4A 4MTLA 4UNNA 2BDEA 2QVGA 2PKYX 1V1RA 2VPWA 4BWYA 4AO6A 1KJIA 1SUPA 3WGNA 3FZEA 4I9NA 1XAIA 4EUNA 1YNSA 2JANA 2VQDA 1QORA 3AK4A 1SZDA 3Q7EA 4KE9A 4MSUA 4KSBA 4OV6B 4DC0A 3FPCA 3ANTA 2ZSHA 1E64A 3HDVA 1QLHA 3QE4A 2ACVA 1X92A 3UAYA 3MELA 4LI3X 4WN9A 2B8WA 1BKYA 4I55B 4KQ2A 5JQGA 1NVDA 2AJDA 3RSSA 3W78A 4C07A 2X7JA 1CUXA 4NMHA 3QLJA 3T5CA 3T3DA 2ZWIA 4GEKA 2Q50A 4UUPA 4F1KA 1QYIA 1VIVA 2OV6A 4IIBA 4O4IF 4Y2PA 5BY2A 2YIJA 2OORC 3AM4A 5LQNA 3JQFA 3T7EA 4OYRA 2P69A 3GJ4A 1U8UA 4ZYVA 4FR2A 3H2YA 1ZJYA 3W5CA 2FW8A 1G2IA 1W94A 3SKVA 5I8PA 2QLBA 1UH5A 5F1OA 5JNRA 2QQ5A 4RM2A 5K4GA 1V41E 1FMFA 4CM4B 4KXMA 4GBGA 1PJAA 1UPFA 4A03A 7REQA 2P4SA 3DHYA 4NL4H 1O9HA 1SWWA 4OAQA 1K4MA 4F60A 2ZYWX 4E13A 5CBPA 1QFYA 1C3LA 1AV6A 2EKPA 4H6WA 1OBOA 3OC0A 1GV1A 1JKMA 2RIPA 3A4VA 1XL1A 4HLUA 1VA5A 1Y7IA 2AMYA 2IELA 2R84A 4C6RA 4OG2A 5H4HA 3BT7A 1C0LA 4NPHA 1Y4DE 2OZKA 1MB4A 3QIVA 4IJMA 1Q44A 3I1FA 3L1KA 3G3EA 1HE8B 4LZZA 1GPYA 1JR4A 1QZTA 3OH8A 5DULA 1G8AA 1F8YA 1VPTA 5CTJA 3VYSB 5A2GA 1WSWA 5I9SA 1KI9A 1XTJA 1EFKA 2DYKA 3EVDA 2FOLA 1FZTA 3WNQA 3Q3VA 4EEZA 4BLSA 2X13A 3V4PB 2Y68A 1IHYA 5A7FA 4EI2A 3K70D 3LFTA 4ZT6A 1SG6A 4PPNA 4QJIA 3R7SA 3H2KA 4OFXA 4KUHA 5BNWA 3ZD6A 5CH5A 4ATNA 2AXQA 2C31A 1OR8A 3FUTA 3QJGA 4QREA 3NM4A 4R71A 1ZC4A 2FAXA 3OE5A 1G5HA 5JJLA 1VHTA 3E5NA 2CJPA 1A9RA 2JKZA 4Q3LA 3MILA 4ZREA 2VUIB 4E4TA 2XT6A 4KH0A 4UHHA 1WU8A 3UJ8A 2I54A 4QPZA 4ADSG 1EVJA 2FN7A 1HTWA 1IEVA 2PZ8A 4OXKA 3NALA 1R0SA 2WMOB 1L7AA 1PFYA 4P34A 3B6EA 2AJTA 2DC1A 4G63A 4BL5A 3FYUC 4DBLE 3KZVA 5HA5A 3ENQA 4L22A 4OQLA 2EEZA 1KIFA 1Y3IA 3JWIA 4LI0A 1YACA 3BVPA 2CZQA 1GUBA 1ZKMA 3G23A 3OVMA 3K1YA 1JSLA 1JIXA 1NW5A 3F9RA 721PA 4G0PA 3I83A 3K5WA 3L0IB 2HWKA 1EXMA 1EFRD 1CUAA 1JILA 3FB4A 2ON6A 3EDQA 1RRFA 3R9WA 3L02A 2O54A 3AG6A 2GB4A 3Q4GA 1VFPA 2IK8A 1K3UB 1ZMBA 4RPCA 1JB1A 4DF3A 3RFTA 4DMGA 2RHRA 4ISCA 1S96A 1Y3AA 3M3HA 2O5EA 1JXAA 3PDUA 1EUCA 2QVBA 3AZPA 3G8AA 5KQPA 5MN6A 4DIBA 4RFSA 2OD7A 2WM2A 5DNDA 3GI1A 3ZHTA 1JHVA 2BKEA 3LBNA 1KAMA 4O1HA 4UTNA 4FMDB 4IIJF 4YAUA 5KCMA 1G55A 2VVTA 4UW9A 4G8CA 3RW9A 4R0MA 1GNLA 4FE3A 3PLAE 3F2IA 1EINA 1U0RA 1OV6A 2OZEA 3FYSA 3IYLW 4YHBA 4HNVA 3A3KA 3HY4A 3TSWA 3T1YB 5AVUA 3ROMA 4V3CA 2I2AA 5AYVA 3RAPR 1PBTA 4DLUA 2OXTA 4E2YA 4ZHQF 2V96A 3C8DA 2B4AA 3DE2X 1U2EA 4AY3A 1JLSA 1XXHA 3IA2A 5A04A 3R5FA 4WA7A 2A9KA 3H9QA 4PZPA 4XW2A 4RDXA 3CW9A 3IVRA 1P1FA 2XUDA 4M8NE 4KDEA 4NWIA 1J4AA 1HYHA 4YP7A 5B3JC 3ELYA 4KXXA 4EVSA 1R9MA 4OMCA 4V0SA 2QX4A 3KPJA 1B0AA 1JTEA 5D5PA 3PXUA 3WLPA 1T35A 4E4RA 1GL9B 3EXHB 1SM4A 1COWD 1A97A 1ADYA 2GN6A 2ZTUA 1LD3A 3UCEA 5HG0A 1QOPB 3ICWA 1UMDB 4OD0A 1I14A 3WMXA 2C4NA 3OMWA 5J58A 1GCGA 1P7CA 2CLOB 3RE1A 1BX0A 4NMXB 2XNDD 4GI5A 1CUGA 2GZ2A 3ANLA 3ET5A 4LNUB 2H08A 1CY0A 1MO2A 3QU2A 3M6LA 4M0DA 4NBKA 4QFCA 5CM2Z 5AI9A 4YJHA 3UGTA 1WCXA 1YDGA 2JFUA 3R5KA 4O5OA 5CW1A 3TLMA 3P71T 3PVCA 1Z2CA 2XV1A 2XBUA 1IHXA 1O57A 2X5KO 3WMRA 2ZVJA 3WS7A 4Y2YA 2ZM6B 1Z28A 3KEQA 4URWR 2X0EA 4DMLA 2OFPA 4MXDA 4ODIA 4CMCA 3LVQE 4ZOCA 5KWJA 1EBFA 3CNBA 5TQ0B 3IEMA 3KVRA 2D2FA 1KMHB 2JLYA 3ME5A 1VRCA 1YQQA 2C2WA 4II7A 5C5EA 1MRNA 1K6XA 1M7HA 1HSZA 1T1SA 2VJAA 4B7CA 2CC2A 1VC2A 3ILVA 3OTIA 1X1AA 4A2WA 1MHPA 2R7AA 3W4JA 1JE0A 3NRBA 4RL4A 2HK9A 1UDRA 3G85A 3PQ5A 3GLIA 1GNTA 1GCUA 2XTMA 2WFAA 1TA0A 1J5EB 1JVSA 2B9EA 4XPIB 5IXJA 3O03A 5MN5A 3DMHA 1Q12A 2R8PA 4AXXA 3KB2A 3WL3A 1QO9A 4QPCA 1AB5A 1DJLA 3CSSA 4Q9IA 5IBPA 1P9LA 3S4YA 4N4AA 2OENG 2PMDA 1QAOA 2BGLA 1W4BA 2ZB7A 2DH5A 3GRYA 1ILEA 3LKVA 1TQ6A 2NZYA 4UM5A 2XAAA 1XTSA 4P7KA 3ZNNA 2PL5A 4RTSA 2NPOA 2E4YA 1UC4B 3DDWA 3EA4A 3L01A 3K0AA 4INJA 3WICA 3L0SA 3MVEA 4FEGA 4RE5A 3E81A 2GHTA 3N8GA 4QVKA 4CM9A 1R66A 2O0HA 3VMFA 4L5IA 1B26A 3DP7A 4IICA 5TQ2A 3CEAA 3MAJA 3PUZA 1M2JA 2Q3LA 2POQX 1PUJA 1E4YA 1F38A 3R20A 2B8NA 1EX7A 3M4NA 3KETA 1XR3A 3DHWC 2JIOA 4TYNA 5KAPA 5IDQA 4K9NA 2QSZA 1Z5WA 3IRUA 4Q4AB 4O29A 1AK2A 2IITA 1V1MB 3LKZA 1Z0SA 1KF0A 7ADHA 1RPZA 4Q00A 4RDIA 5ALYA 4ALJA 5JZMA 4N8EA 3LDAA 3OCCA 3PL1A 1KNXA 5GGXA 4F38A 3TQRA 4KI7A 3RVPA 3O4GA 5AM5A 3BXHA 4E51A 3LLSA 2W2QA 3DBVO 1PRYA 1V11A 4UD6A 1E4OA 1RC0A 4DCNA 1DWUA 3NC0C 4W9RA 2OBLA 3WKAA 4BCDA 1FRFS 1T8PA 2Z9BA 4LVOA 4NZNA 3WFZA 1L4MA 2CW5A 3B82A 5CK4A 5CVDA 1QF6A 2J9FB 4J03A 2PT9A 4UEJA 3TW0A 2QRVB 4D3FA 5CLIA 3VVCA 4AP5A 1XPOA 3MFYA 3G6KA 2V7VA 3BH7A 2HFJA 1BRMA 3DGFC 3B13B 3V42A 4YMLA 2C0CA 1MQ9A 3L7MA 4YMUA 3A37A 1RRMA 4W5HA 4W99A 1QHXA 3HA7A 3V97A 3TFQA 1M2OB 3KHUA 3WL6A 3DM5A 1JAZA 1KEWA 2PYDA 1P5JA 1W88A 1UKAA 1KPGA 2IZOA 4QQKA 4DEXA 2I91A 4ND5A 4IVPA 1X19A 2HJHA 3IR7A 1KYXA 1ADCA 3JD1A 3DDCA 3EMKA 1V6SA 1Z7BA 5AK4A 4A73A 2KX7A 5FYQA 1LLDA 1ZDMA 3HH8A 4GIBA 3OZBA 4PQEA 2Q2WA 5CFNA 3EIOA 1E3JA 2Z09A 2O6LA 4AZTA 3EEIA 3OO0A 3NOXA 4HYYA 4N12A 3I1IA 4W9NA 5ELMA 4HBZA 3IDQA 3TKLA 5KUTA 3ESAA 3FNBA 3PFIA 1CRPA 1QWSA 2UUPA 1N75A 2BMJA 5DWVA 2MU1A 4IUCS 5HKOA 2V7TA 3MMZA 3OIGA 2J6HA 2JBHA 2ZCUA 3LPMA 4DLKA 1R0KA 1EFPB 4KO8A 1BSVA 2VSNA 3GVXA 1CB7A 4QXMA 4ZVOA 4OHBA 5A2QA 3QX9A 3VO8A 3VU1A 2I1WA 1PNRA 2QTWB 4PN7A 2JGLA 2C3UA 1XZLA 4ZZIA 1SA0A 3I30X 1YR8A 1YI1A 3AIIA 1WXQA 4JQSA 3BKXA 2OKGA 3SSNA 1A3CA 5JU6A 4KI0A 3MLEA 1GVNB 5PNTA 1O96A 1CIVA 2LCIA 1P0QA 3TB4A 1G7RA 2OOKA 1RM0A 4YFYA 4A3SA 4JYZA 4KN5A 2ORED 2P79A 1J6UA 2OGSA 1LBSA 4NNOA 3ZE0B 1Z22A 1XLTC 2AG6A 3ZG6A 4E5VA 1DAGA 4F11A 1CFZA 5F7XA 1NNUA 4YRSA 4N6NA 4XGQA 1FMCA 1W5BA 1W48A 1S8NA 1SVSA 4JQOA 3K9HA 3GLFE 2TSYB 1B2LA 1SB9A 1ZOPA 3ZS8A 3GB9A 3HYLA 5EHZA 2FPWA 5I7FA 3MGGA 3E4DA 3GNSA 2IFTA 1IN7A 1EK2A 1S2DA 2JARA 3MS7A 3RQIA 3HXMA 1QBGA 3C74A 3NHWA 1WULS 3DVAA 1DKMA 3TR6A 4OA5A 1M72A 3LOPA 3LQ4A 1EDZA 4GX5A 1KRWA 3QEJA 1L7DA 4PRKA 2QVYX 1WOYA 2Z5LA 1LVUA 4KPFC 1K7EB 4C4PA 5IDWA 4K6HA 4NU0A 5JH7A 1IHOA 1ONSA 5JECA 1NMYA 3A3YA 4L8VA 4A9AA 1DJPA 1WW8A 4Z6KA 1RCUA 3S3TA 4W9MC 3WZLA 1S2IA 4FNAA 1RWKA 5IK2D 2MSLA 1DRUA 3NV7A 4P80A 3A70A 3N0XA 2J9YB 5BSTA 5T6MA 4EKNB 1QSGA 3QE9Y 2OQRA 5DTIA 1NSFA 2OB1A 5ES4B 1P8AA 1SG0A 3OJWA 2MMCA 1EGQA 4XM0A 1FA9A 1K5GA 1PF7E 2ZU0C 3PK0A 4Y2TA 3UWSA 4AWAA 5AW3A 2YW2A 3MIZA 3R4VA 4R54A 5AHRA 2XHZA 1SUWA 1ZX1A 1D4ZA 3E4CA 3EZ6A 3NXKA 5K3AA 4MS4B 3S2IA 4AKSA 1AA9A 4NR0A 3VGPA 1ZJZA 2IT1A 3CB4A 1HX7A 3HGQA 3CPHA 1RTKA 4L28A 4V2UA 5AJWA 4DVGA 2A0UA 3HFRA 5A5GA 1YE8A 4J90A 5AVYA 4K2HA 1XRJA 2ECOA 3L5OA 3L8ZA 4IIXA 4KFCA 5CDYA 4XB6B 3KB6A 5BW8A 1DC3A 3DOFA 1SXIA 2C1XA 1GRCA 3QSYA 2BHLA 3EG9A 5DK6A 1YULA 3FGNA 4B3XA 1NYTA 1XF1A 1U9ZA 2AW3A 2CLEB 1UT8A 5A3JA 2D5LA 3DBRA 2JZOA 5EWLA 1YDEA 3CH4B 2G9UA 5A3SA 3ZD9A 1FW6A 2IHZA 4AKTA 4YJFB 2O07A 4NBLA 5ES3A 2RE8A 1MAAA 4YWHA 5JSZA 1Z2AA 2Z08A 4Q3NA 4BO1A 1E3DA 2VXCA 4O63O 1QXSA 3FOAA 3ANSA 4TL7A 2OV3A 3KT6A 5E4JA 1JR3E 4RD3A 2HNKA 4G5YA 4B43A 4AUMA 1NBMA 2JFQA 2BEWB 1ZEMA 2WYVA 1SCUA 2Z3VA 4NLLA 1NNSA 1WY7A 2F1OA 4Y2XA 2HRZA 5DYWA 3SX0A 3OIFA 2WIJA 2PXHA 1E2FA 1P4GA 1R5BA 2JD1A 1QH1B 1SXGA 3L0PA 2CYAA 4I9UA 4S12A 1LRLA 5KJCA 1AK9A 3HUTA 2BTEA 4PC1A 1IBSA 2OM2A 2FQWA 5H5JA 3PHBE 4MULA 3JAKB 4EI7A 4AJLA 4F04A 2QSUA 5BSMA 4IBOA 4ZEOA 1E5QA 4KNYA 2ZUTA 1DKUA 1W29A 2JGFA 3ZYCA 4QGSA 1D1SA 1CQIA 1TVKB 2YINC 1EDBA 2QRHA 2A58A 4J1TC 4LE0A 1PVDA 2YV5A 4MMYB 4UHDA 4RPLA 1JNYA 1GG8A 4HWKA 1IY0A 2ARKA 3OLZA 3VZRA 2VHEA 1EFHA 1KJZA 3LDFA 3E3AA 2V4MA 3KZXA 4P92A 2CV0A 1N7JA 3OA2A 3BIXA 3QBVA 1JN0A 1BQEA 1QQ7A 2WAAA 1NQAO 1ZQ9A 2GCGA 3E8XA 2AF4C 4DQXA 4EKEA 4XLZA 1N6IA 1FQWA 4MEBA 5COQA 5BV1A 1TO1E 3A1CA 3SC6A 3D3JA 4Q9HA 1WP9A 3THYB 2Q6KA 2XYHA 2EKLA 3CY6A 4ZFNA 3VZQA 3DKRA 4QOEA 4OBBA 4UE3S 1U2ZA 1CUZA 4OGWA 4NRDA 3JALB 2FPGB 3CRNA 1TZMA 3GDHA 3NIWA 4UAJA 2LCQA 3B6MA 2W2LA 2XJ9A 4IIVA 1QQTA 2A94A 2VYCA 3ZY3A 3LO8A 4L5CA 1M8GA 4P81A 5JTUA 3VKGA 1ZI9A 1Q95A 4Q4JB 4BS9A 2GK3A 1E7MA 1EDEA 1MO5A 1M75A 3GCXA 4DW8A 1NC1A 1QUFA 3T99A 1YR9A 2Q1WA 4WW0A 4QQFA 1CVIA 3MA0A 3DZGA 2BFEA 3L3BA 2LNDA 1LBTA 1WCV1 3EY4A 2IUFA 4LVCA 4WFIA 4PG4A 2GBLC 2VAMA 1J23A 1WMDA 5AXAA 1Y8ZA 5B3AA 3OU2A 2DBZA 4YUWA 1P1KA 3Q6NA 6LDHA 1NOIA 4FOTA 3L4KA 5FH9A 3PGJA 2Q62A 4KACA 3T9AA 2BGMA 1VJ5A 4CL2A 4U7DA 3EOZA 1C9NA 1N2CA 2C78A 1XTBA 3IVGA 3P9XA 5DBEX 5AM4A 4G6ZA 1AOXA 1B1CA 3KB1A 1WKBA 4N6OA 5KIAA 2VDMB 1KMIY 4NABA 1NVTA 3DPUA 1U7WA 2PGXA 4URHA 4C14A 1T15A 3CVYA 4TGLA 4EQZA 4N8DA 1UDAA 5AVZA 5A4FS 4RY2A 2HOQA 3BB1A 4NFLA 4RADA 3N2LA 3ZE1B 1ZGGA 1J06A 2OCDA 3ZU2A 2AD1A 1WUYA 2NACA 3LCJA 1BQ4A 1KDOA 4R3WA 1LWOA 2H92A 4HLCA 4WIAA 1KI3A 5B3LA 3C43A 5HRUA 4DBLC 1G8GA 1BN6A 2E1PA 2G70A 3IIMA 3OCXA 4PVDA 3MINB 1ESDA 5EP1A 3T1VA 3B3FA 2J5XA 3GFBA 1LFDB 1G8FA 1QFXA 3DWIA 3RRNA 2D1FA 2C29D 3O26A 3STWA 2AN1A 4NZMA 4YA6A 2AXEA 1EFUA 2R8YA 2A88A 4MUNA 2HSWA 1BDBA 1HDZA 1TFRA 3G8YA 4UULA 3GT7A 3RK4A 3SYTA 4P4UA 1G21B 2B4QA 2NZUG 4R7ZA 3TDNA 4E32A 1VHJA 2WU8A 1KZGB 1TKRA 5CT8A 3RARA 2XRZA 2BTQA 3LK6A 4OL0A 1DIOB 2QRNA 3AW8A 4KE8A 4QU9A 4UCQA 4B35A 2XCSB 4X5OA 3RJZA 2FPIB 3KYJB 4NBSA 3R9KA 3UTCA 3V32A 2QNRA 4KYUA 4Q4HA 3EPRA 4UNRA 1KOGA 2CDCA 1K5DA 3UAZA 4IIGA 4TKLA 5EIAA 2Q49A 1C50A 3SCZA 3JQ8A 4FDTA 2LCFA 1GWNA 3U3RA 1J22A 3FPHA 3CR3C 1NA5A 1ENPA 1PFUA 1G19A 1UXJA 1HEUA 3ZXIA 4RIGA 3QE0A 1ODKA 3I9FA 3V2HA 2WFMA 1HQCA 3GK3A 1YUBA 4F56A 1RBZA 4G4IA 1DBVO 1RQ7A 1V4NA 3H0EA 4H59A 4DQ0A 4RNDB 1DAOA 2OXIA 2JAXA 4YUVA 3RSGA 1AQIA 4R0NA 2QLJA 1IBMB 2XNKA 2J67A 2B20A 4WPGA 2EKBA 3CX3A 3MD9A 5LDGA 4MPJA 4M6WB 4WY8A 2E4AA 3LWBA 2N47A 4YH1A 3QHPA 2BFNA 1U0BB 4O4JF 1XTZA 3C3DA 3C48A 4A91A 5BVHB 3BDVA 1P6XA 4OCZA 1HNNA 1PJ4A 4G5GA 4WUVA 3IP6A 1RJ9A 1QOZA 1YUMA 2KLHA 2P9QA 3E18A 4JVNA 3RBAA 4K9RA 1C9MA 3O21A 3PQ2A 4H7PA 4MEJA 2CEAA 3SBDA 4DJFC 2PLNA 3DV0B 3JX9A 2BISA 4V38A 4K8RB 2EHDA 1JSCA 1NF9A 3N74A 4COOA 1GAWA 1AUPA 2IYXA 4V0KA 4EF5A 1F9AA 4ZICA 2BI8A 1QBKC 4O4HB 4RH3A 3SJCA 2TMDA 1CZUA 2F43B 4ZCMA 5FORA 3ZY6A 3TGLA 4BGEA 2VEDA 4MS1A 4IF6A 3FJ1A 2Z8ZA 2QRMA 4HPXB 3F9CA 3QEBZ 2D13A 3RHZA 5FWAA 4WY5A 1H8HD 4ABTA 4IVNA 4N9QA 1P2VA 3BGWA 3S5JA 4I4LA 5F78A 2OO3A 1M6VA 2R6ZA 2WW8A 3QLVA 4AD8A 3EIUA 3F67A 1E1YA 2HYDA 2PT7A 4X7RA 1FYXA 1F2TB 3PVSA 3TEMA 4E08A 1T0BA 2R11A 4RS3A 3DAYA 2GAJA 1ZD9A 3PIIA 3WSVA 1JFFB 5K6TA 1UKBA 2YBEA 3RYHB 1I7QB 4PSCA 3OE4A 3L4JA 1T0HB 3VZPA 1KI8A 1MXFA 2I03A 1QIIA 1XO1A 4OP2A 5BPHA 4RYLA 1C0PA 1JIIA 4F9GA 2ZUFA 1B8PA 2Y1CA 4IJVA 3JQBA 5FLKA 4OSOA 3PB3A 1YZFA 1M1YA 4MQ6A 1T29A 1I0IA 2GVZC 2ZJYA 3VU9B 1NWHA 1P81A 1XA0A 3AC0A 3HA3A 3KQMA 2G9RA 4FK8A 3RASA 1OXTA 2X41A 4D9KA 3JQEA 3FE2A 3H11A 2AI1A 2IEDA 4PSAA 2JFVA 1JTVA 1UJCA 4QRIA 5IKEA 4R6WA 2HSJA 1S7CA 5E1DA 2QUIA 1U0TA 2EQAA 2VP3A 3LYAA 4YCDA 1ZRNA 1PKEA 4MP8A 5FEMA 3TFWA 4AJ2A 1GP2A 3CPEA 4OF4A 4DWOA 3SZOA 5L4NA 4PN3A 3LHSA 2NAFA 1JG7A 2FZLA 1U7DA 5TF4A 1AQNA 1C0IA 1UOEA 2ZUBA 1QJCA 2ASVA 4C9BA 4CTOA 2I7VA 3JQ6A 1FFXA 1UFRA 3CLSC 3IHTA 1OB2A 2YVAA 2KMLA 1OI7A 2J08A 3FZYA 1X1DA 2DETA 1IJBA 1KAQA 3LP6A 1JSXA 4HN9A 2FQYA 4ND3A 1C3OB 4G81A 3PR3A 1UC8A 3HSSA 4IJ6A 3GMIA 5A9RA 3U13A 5ICMA 5TXGA 5JFGA 5JVDB 3ZKAA 1OYYA 1Z2EA 4OXYA 1O5IA 3ZGXA 4CV1A 1IY9A 1QQ6A 4CR6A 1JXMA 3OQHA 3G9XA 2YVQA 2QV0A 5E2IA 1W85B 3I64A 1C1XA 4ZEXA 2PWZA 1YCHA 3AOEA 1HE5A 3B36A 1T43A 2WD9A 3IODA 4FYYA 5DXFA 2I2DA 1D09A 3ROXA 4WZZA 5JDIA 2A2ZA 1DKOA 2JJ8A 1DO2A 3AF6A 1ZRMA 1KKMA 5FOWA 3U5TA 2I71A 3MLBA 4HDMB 1FTWA 3BWXA 4HGOA 5FBZA 4PGAA 1E1QD 1RWBA 2MSCB 3KLBA 1UCFA 2VHYA 4ZZ0A 3PKIA 5ER6A 3HEMA 3UUFA 2PRYA 4DRYA 1UC9A 1K6IA 2H4ZA 3P45A 1KC3A 4S1PA 1L5GB 3TSAA 4RA6B 4UFNA 4QXQA 3OCJA 2WYIA 3HO6A 4ROTA 4C06A 3SZRA 3NHPA 4TZ6A 4L6IA 2QLMA 4XQ0A 5ALOA 4Q7MB 2W2XA 4ZYLA 1O9GA 1XEWX 4ZKEA 1UJMA 2YV1A 4L0QA 2LW7A 4Q12A 3EDCA 4BTEA 4QASA 3NWJA 2BFBA 4YRTA 2J4CA 3LUJA 1CE8B 1X1BA 4L6CA 1R6VA 3BIOA 1XAGA 2E4VA 3FF4A 3K94A 4NC9A 3HV2A 4F96A 4YRRA 2ZZNA 1C4WA 1USWA 3H86A 4QDTA 5KTMA 4HUQA 3OZVA 3ET4A 3NWPA 2EX0A 1EP9A 3HZZA 2C7GA 2XB2A 3I9V6 2JBWA 3L7YA 2PEZA 3WRXC 3OF3A 4BUZA 3WOVA 1THMA 4UXIA 2NXCA 1A9TA 2XD9A 3ZVNA 2Z5GA 3GDOA 2D0PB 2DR2A 4R7TA 1NBWB 2A78A 4DMHA 4ENSA 3RAFC 3PXAA 1BW9B 3IQXA 3N87A 5B1SA 2VTEA 2B30A 3M2PA 4WA8A 2XGJA 5M34A 4WDQA 1P18A 2BKUA 3F46A 4QQ8A 4U00A 1RYHA 5G1PA 5T3YA 3EGEA 4O2AB 1SU8A 2UVQA 4FX2A 4MW2A 5B2ZA 4MVJI 4UD2A 4KO2S 4E03A 3VKHA 1HQYE 2BMFA 3E0QA 5MHTA 3CLSD 1THGA 2AT1A 2C2YA 3Q5DA 1MOQA 3WE7A 3AJ9A 4EFDA 4E46A 4YRPA 1AMOA 2I7DA 3BMQB 5CLQA 1Q11A 4F2WA 3ZE7A 2G8NA 4LBYA 3DFZA 1G8KA 2JRLA 2FKNA 4QO8A 1BE8A 1L6RA 3RFXA 1NDQA 1C8LA 2ASEA 3FH0A 2I76A 5CBKA 1RLTA 2W11A 3DL0A 2IS2A 1G3UA 1QUEA 4TVOA 2FN8A 3PGKA 1NT2A 1RKUA 3IPRA 2QP3A 3QIAA 1V48A 3T9DA 1U9IC 4BVBA 2GJ8A 3ZVKA 3EW9A 1X7DA 5GJWC 1W4AA 2CV1A 3H5OA 4KK3A 1RYMA 2DBVO 5DX8A 1KORA 4OHOA 3KS9A 5BWCA 2I2CA 3NTQA 1TU4A 3PC4A 3ILXA 4O2RA 1KEEB 1FSSA 4R1TA 4NJEB 1YQ9A 2WU1A 4N03A 1YZUA 1Z13A 2F3PA 2YMLA 2W6PA 2G80A 1H2RS 3HY6A 2WWIA 3MJEA 1UFVA 4MINA 5ALXA 3F0TA 1RAEA 1VG9B 2LV8A 1ZVVA 2GEFA 4YRAA 4L4SA 1XN1A 4ZQHA 1EAYA 3GLTA 5EAIA 3RUEA 4Z1OA 4FR0A 1NN3A 3M6XA 3WMEA 3L82B 3TRDA 1J56A 1GL7A 3DE0X 3KYCA 3N58A 4IXTA 3QLUC 4GLJA 5IMBA 5CB4F 3DZ8A 2SBTA 4I1YA 2O14A 1Z82A 3A32A 2WDPA 4BFSA 3ADPA 4EVIA 3Q8KA 1ZR2A 5AVVA 1V1RB 2VYVA 4MV3A 1QB7A 4YI5A 3CEJA 4MO2A 5IKPA 1T3GA 4U6NA 5MFZA 5DP1A 4ZEWA 2I1LA 3RUPA 3UGJA 5FBWB 1MZPA 1I0ZA 2V7EA 1KKLA 3CRMA 3BHJA 3HS3A 4M1ZA 5T8KC 3I09A 3KKZA 4KGXA 4KQ1A 1CR4A 4MKXA 3SIWA 3OZRA 3J80A 4P3XA 3LUAA 4WN9B 1JNXX 3AFNA 1SUCA 3JPWA 1XMIA 2QXYA 5JQGB 3HBAA 3AT1A 5JARA 2G04A 3KPUA 1AKNA 4BVJA 2GESA 3DUWA 3OM0A 2FRDC 1M5RA 1UBSB 2NUAA 4NBUA 1ISMA 4W1SA 2YKGA 2V9PA 1S6YA 2GPWA 2JIQA 1UBGA 1QMPA 1UBLS 3QELA 3TNJA 4IR7A 3IVCA 4Q37A 4QEDA 3TLBA 1LDEA 3OC6A 4X1IB 1ECJA 3VMMA 3ZHUA 4JOCA 4G0NA 2AXNA 1HETA 2B5WA 3QFTA 4C3ZA 2DMRA 2HIMA 5ENVA 2W48A 5FUBA 4OIFA 3DXXA 7REQB 3A1UA 1ZK0A 1DXQA 3CUVA 1U3GA 3NTOA 1LTHR 2ZYTX 3V8PA 4ANFA 2IU6A 5CBPB 2DERA 1G21E 1WZNA 3U9LA 1ACLA 2R2AA 3F1KA 2AQKA 4I6GA 3UAOA 1B6RA 4AF6A 5LQCA 1VE1A 2J0QA 1NM5C 3JWPA 4KPYA 1WMSA 4PAMA 1YFLA 2OK7A 1JLMA 1M5UA 1NW6A 2C9BA 4QNNA 5AK3A 2QROA 1NXXA 2Q0SA 2YWXA 5LA6F 2GYVA 4D8UA 5KNCH 3M83A 1T4GA 1T3ZA 5HOQA 1K7CA 4A15A 1VECA 2X76A 4F5ZA 4Z54A 3HM9A 1YBVA 2NSHA 5KINB 3JASA 1G16A 2XCUA 3RTEA 1M54A 2IYTA 3F4KA 3F1LA 4YQFA 3DLCA 2ZQYA 1FBTA 4EYEA 1YZQA 1EPUA 3WYGA 4X9XA 4P7GA 3UPDA 2ZSAA 3A58B 4F4UA 1QCYA 4KTVE 4DABA 3G2OA 1US8B 1H3EA 2GH1A 1UUFA 5D8DA 4XQGA 2OQVA 3QBDA 3SE7A 2CBGA 2CVFA 4JQCA 3W9YA 1OV4A 3C3KA 5IABA 3RU9A 1DFGA 1WZ2A 4QDUA 2C7QA 3SC3A 2G1UA 4Q3DA 2AHRA 2P6OA 4MR7A 1P4SA 2NMVA 2F1IA 5J5CA 4Z9FA 1G5PA 2OSBA 5HFJA 1V95A 4ZVRA 4YAJA 3GLGA 4NV3A 4U2KA 2X0DA 2OBNA 4ZVSA 1A9OA 3TRJA 2HY7A 4G86A 3ZD8A 2G9ZA 4RSMA 1A8SA 3SWWA 1Z0FA 1RHMA 1OAAA 3TDKA 3H1BA 3LRPA 4Q0MA 1EGMB 1XVVA 1DKQA 2X8BA 3EXHC 3LUPA 4HYEA 5C53B 2PRKA 1YCDA 3RRMA 1X86B 2V0NA 3T7AA 2ODQA 1CJMA 2YW9A 2ZTHA 1D0IA 1T5LA 4OHCA 4XSHA 5E4FA 3I92A 3W4KA 1W4RA 1X8KA 2PZBA 4FOPA 5JSKA 2R3SA 3ZVRA 1O4VA 5DMHA 1U7XA 1KQ3A 2ZB8A 1EBBA 3BFPA 4TWAA 1WPGA 4RORA 2HLDA 1RQPA 2AXPA 4MYTA 4U2BA 4EKGA 2IL1A 2X2EA 1X87A 1AKTA 1JDBC 5FO1A 1EUCB 3AY0A 1RIIA 4G26A 1VJTA 3C8HA 1A76A 1XNGA 3NEYA 4H1VA 3DJFA 2DH6A 4BAZA 3NP9A 4RFSB 1GZUA 3MS2A 4P3PA 4B83A 4UM9B 1TTTA 4QUJA 3A4NA 1O58A 2J3IA 2OCGA 1IZ0A 1JR3D 4EIWA 2ZI7A 5D5QA 5BN1A 4F9TA 4X3OA 3LI2A 2CXSA 1K92A 3NVMB 3B9BA 3SLRA 1HORA 1LFAA 3L8HA 3QM1A 4HDSA 1D8AA 3NQ41 4L5JA 5EIEA 5KTRA 2GD2A 1E1KA 1W34A 5LBUA 5ERYA 3Q9LA 1KDTA 1NI5A 5CNJA 5LB4A 3SPXA 3TPCA 5LOVA 4ENWA 5JH7F 4JUDX 2JD0A 3VR0A 2UUAB 3GEEA 2HCRA 2PBFA 3OIVA 5C1BA 5I8ZA 3S99A 1HNXB 2XQGA 2X2FA 4D80A 1E3QA 4H27A 1RRGA 1Q2XA 2AOUA 2WSIA 3FAZA 3B6JA 2PBLA 5JCOC 2WUGA 3RHFA 1OYOA 3ACCA 2EF1A 1XXHB 2UVPA 3JWHA 621PA 3OX2A 5LXTB 5TPWA 2QP9X 1B8VA 3ZGVA 3JRNA 3I28A 1S3IA 2ZOSA 3BWDD 5G3ZA 5IVPA 1AGPA 4IH1A 2JLCA 1WP4A 1X13A 3D4BA 3QE3A 4OUKX 4U7HA 1WUJS 4ZANA 3SIRA 4YX9A 5B4TA 5D01A 3WLSA 1YJ8A 4DIEA 2H9IA 3JQCA 4HQ0A 2AOTA 3DAOA 4UBMA 1ZG3A 1HFWA 3DMGA 3CBQA 3USES 5CFRA 1OBHA 2CMKA 4WGGA 5AI0A 2ZI6A 4M89A 4LZPA 3CSDA 3ZHOA 1CXZA 2FMXA 5EE1A 2P68A 3ULKA 5KYYA 4JJAA 4XRGA 4LHSA 3TJZA 3GZTB 4YJHB 3PGMA 1JXOA 3WFJA 4DLSA 4S24A 4FPXA 3FSEA 2QN1A 2ODEA 3GA7A 4LJAA 4X54A 5DN6D 1Z0UA 2EXXA 4EUSA 4JEUA 5ICSA 5K9ZA 1QNLA 2VIIA 1RWWA 5M04A 1P31A 2ZKIA 2FFJA 1ISFA 3UENA 4RV9A 2J6BA 4FYIA 4H0CA 4RWZA 3VR1A 2Z58A 3KKPA 4GLOA 3RUCA 2C7RA 1J42A 4YIHA 4PPQA 2FF5A 2V97A 3PT5A 4GL4A 5IWAB 3TL2A 5K3OA 1WB9A 3D4PA 3N0TA 4BV9A 1V43A 2XE8A 3MPOA 4BDSA 1T4CA 1PCXA 5CVTA 1Q92A 3NEPX 4WBXC 3CVVA 1Y37A 2C82A 4UCXA 2HT6A 1VMDA 2VHVA 3ZWDA 5AVRA 1OFVA 3GLIB 4K05A 3QFHA 2JFFA 1CBUA 2IHVA 4N40A 1J8FA 2NQ8A 1E7QA 4TN5A 1RWVA 2YJGA 1C41A 3GEHA 1QTIA 1ZRSA 2FCAA 1QTQA 2A35A 3DXFA 1WW3A 4RIIA 3O93A 1QC5B 2IF0A 2VK2A 3G5MA 2WHXA 4ZI5A 4DBZA 4ZJYA 4H7JA 4HDRA 2DSTA 4A5OA 2KWIA 2YXEA 1NPDA 3EXG1 1WMFA 1N0VC 4HB3A 1RRVA 1DUVG 1MUUA 3K0AB 3Q41A 4LK2A 1PV2A 2WIDA 3P4YA 1OSNA 2YXBA 3F6YA 4G25A 1G2PA 1GNQA 4MRAA 1R00A 1YZVA 5IRCD 1V5FA 4REQA 3R6GA 1KQNA 2YWGA 5EIWA 1C8BA 2DHCA 3EZFA 5TQ2B 4XVRA 3GFRA 3GPLA 4ZJZA 2DPYA 2RARA 3PRJA 4C2AA 4FCVA 4XH9B 4LQDA 4DV3B 3TAUA 4GR5A 1JAHA 3DMTC 4IS3A 4MGEA 5GGYA 1XPRA 3O2QB 1XHLA 4UE6A 4YK7A 4GR9A 1NDUA 2XSZA 1LPMA 1GPMA 1TYEB 3B1WA 3ETNA 3ND8A 3PD1A 5GJVC 3S7ZA 4OJMX 2GWHA 4DTIA 5K8VA 3BWVA 3H1AA 2WF7A 3JYLA 3NI2A 2VTVA 4E5MA 4G36A 5I5GA 1IK4A 1WY5A 4WUTA 5A0FA 3FWPA 1FLAA 4QC2A 1RBYA 3OFVA 2JI7A 4JIMA 4CI9A 1DAKA 3HV0A 1VMIA 5TC4A 3I34X 5LQJA 1V11B 3C4JA 1Z5PA 1ZJJA 1LF5A 1NN0A 1UMCA 4B4DA 3NFYA 1VL0A 4KSCA 4RPGA 2IYSA 4FCWA 3B5IA 3H5WA 4E2FA 1E4VA 1J8YF 2K5UA 1SMKA 4O25A 3RUFA 4QNMA 1OXKB 4YAOA 4ZT3A 1ENOA 1CDDA 2BGJA 3BHMA 1LV7A 2DTXA 2QVZX 2OHVA 4XIIA 4I7EA 2A3NA 5AICA 5FX2A 3TSYA 1SVMA 2IDJA 4DT1A 2C8KA 3I9LA 3QPDA 5GPBA 1XZFA 2PO7A 3CE6A 2AS0A 5ALZA 2I6FA 1E2UA 3UFBA 4EHKA 5BW4A 2JJQA 3U48A 1DAPA 4YGYA 1XNHA 3H3FA 5L9AA 3ZVMA 4OM7A 4E5SA 1L7EA 2SNIE 1EB9A 4I4TA 6CHYA 1B23P 1JF8A 1JMYA 3ZIAD 4ND6A 4Q3AA 4X6XA 3KOWA 3INNA 5AKYA 3EF3A 3A7DA 3QUBA 4BASA 1M1UA 2DHEA 2IEGA 3Q5EA 1CRLA 4E7OA 3KZCA 2A5JA 5H59A 3KTDA 3R7WA 3HCNA 4FFWA 1JKIA 5LU8A 1V2HE 4RTOA 3U7QB 1XZAA 3P19A 2VZ9A 3EX7C 2XT9A 2VF2A 3H2HA 5BNFA 4XDHA 4DQVA 2BKAA 2HMVA 4IGIA 1KZ6A 3FR8A 4EMBA 3G2PA 3WWCA 2F1JA 4WASA 2X3FA 1OFIA 1SUFA 1HXHA 4M46A 4RIFA 2CWWA 3IEUA 4FMDF 4Z86A 4HRVA 1VL6A 2YJ3A 3OOHA 4HOYA 5TB5A 4CGYA 2C5HA 1KZ9A 1XD8A 2C4UA 1UKCA 2FDXA 1W2WB 3EAQA 4LV8B 4TRMA 1ZITA 4IDDA 4Q9KA 5EVJA 4CU2A 1IJEA 1QGYA 3V2IA 2R6DA 3DD5A 3ZI7A 4CODB 5HQ3A 4LOAA 2O3SA 1USGA 1XFAA 1WCWA 3L4BC 3RVMA 1SA0B 5I4CA 1ZIDA 4AY2A 1Z2NX 3IE1A 4CIYA 3N7UA 5T5QA 2WVHA 1KP3A 3IVXA 3FB1A 3F6BX 4XJSA 1O96B 2WAXA 3PCXA 4B71A 2RK4A 1PBNA 4ZAYA 1CD5A 1SVNA 4CT4B 4B7ZA 3PTZA 3A2MA 5ESDA 3P26A 4WLEA 2QJTA 5K45A 4CM5A 5FBVB 1BYUA 2IYWA 5F51A 3U60B 2MYTA 3QUCA 3RODA 2P6RA 2CLHB 2QL7A 4NP6A 4BQQA 3CCBA 3SYRA 3OUTA 2PR2A 1NVFA 2COEA 1T2DA 1CUYA 1GPKA 1QE5A 4INZA 2AOWA 2BV3A 3O4VA 4RAOA 1XZGA 4FU0A 4H1HA 1DADA 1AKQA 4R2LA 4OHZA 2FF7A 2HPVA 2OBYA 4A6XA 4CTNA 2FP4A 2HR1A 3MB5A 1GCAA 3MTAA 1ZD3A 3FCAA 5AKKA 4C7JA 3DVAB 2PKEA 3FCEA 1LPNA 3R7BA 1R6TA 4OQPA 4V24A 4O2BF 4F92B 4TTAA 2BFWA 5LD2B 3OU6A 5JH7B 2EU8A 2NO1A 1GFIA 3SEFA 3UJAA 4QARA 4Y6LA 1JX6A 1C9KA 1KXJA 2E4XA 2EGGA 2OHXA 5E1OA 1S7GA 2JBAA 3RSOA 4LGMA 1EGVB 2NM0A 1TLTA 1OWOA 4NCXA 3G0GA 2VBCA 2GZ3A 2VF7A 2DKNA 2O7RA 4MR9A 5KI6A 4BC1A 2V6GA 3LBYA 1D0SA 4F8EA 2J0SA 2R1TA 3LECA 4A6DA 2WZCA 3AB3A 3WI7A 3AEYA 3D3EA 2HDWA 2YWFA 1TA9A 1FXWF 2OZVA 2FEMA 2IHBA 2J1LA 2YDYA 4BO0A 3W1WA 4D8YA 3ZDDA 2CUKA 4L85A 5K51A 3NRCA 3TX2A 3CUWA 3V4SA 1V47A 3HB9A 4MW7A 5DVZA 4BQEA 3IIJA 1LLCA 1GG2A 4EPXA 1BWSA 4CCYA 2EHJA 4UU8A 2JH3A 3DKIA 3PUJA 4FXOA 4WXEA 5DGDA 3V6LA 1D3AA 2RGEA 1Z6QA 1MENA 4FMBB 9ATCA 4BIMA 3LQ2A 5JD6A 3THWA 4OM8A 1B41A 1RHRA 5H4GA 1ZNYA 3V9PA 1IZYA 3EG9B 4ISBA 2EDCA 2H6EA 4TS9A 4RW0A 4UMDA 5CXSA 3AIMA 3SOZA 5LMNB 1ZNXA 4RF2A 4PBSA 4U8GA 3DAPA 1U3WA 2B4YA 1MRZA 5K3EA 3RRYA 3W3ZB 4U2CA 1MPXA 1TC1A 2EG9A 4F85A 5LQMA 1SZCA 3HTXA 1A1SA 1U2TA 1EKXA 1VL1A 4QUGA 3S2UA 1Q57A 1F0PA 4H6PA 4MVJG 3UM9A 1V8BA 4URFA 2QGZA 5DTQA 2NU8B 3L46A 4CDMA 1KY5A 2VHUA 2VDKB 2H2DA 3AHEA 3MK31 4RMJA 2H4JA 2FMKA 4BMDA 2ZUCA 1KEPA 3SZ3A 1J0DA 1O95C 2H3HA 3GLUA 1CY7A 5FBHA 4EAAA 3ZI0A 1VIAA 4EGCB 3SQMA 1NMEA 2H18A 1N8SA 3L2OB 4LMPA 5GVRA 3V1MA 1XK7A 4NVRA 4CF6A 4KO3S 4OB7A 1KS9A 3RIGA 3T38A 2DQZA 2O23A 3ZWOA 4XRRA 1DDOA 3BF7A 1YRBA 2R00A 3ND9A 3V4RA 2V03A 5JSUA 4MMXB 2EDAA 3FHLA 4K1XA 1JG6A 3U3OA 5DHAA 2CNOA 1Z15A 2W6ID 4TVBA 4Z8XA 3R74A 1UAYA 3MWJA 1DFHA 4F93B 3NX4A 4YAKA 4G0UA 1BFDA 1DBWA 1CQIB 2KJQA 3P5BA 1TEVA 4HP8A 1ZL2A 3BJIC 5GONB 5I51A 4OGFA 4N3AA 2VP9A 1ZC3A 1ZOIA 2FSGA 4Z9BA 4NCNA 2AG8A 2ODBA 2RAFA 4LOIA 4FOSA 4MQ4A 4CFYA 5ICCA 2PKQP 2WPDA 4KWEA 3ESDA 2Z98A 3DEFA 3IBSA 4ASUD 3CW8X 1RT9A 1UK7A 3I9OA 4GSLA 3TZQA 5A6VA 4ACBA 1QIMA 2JL1A 4D56A 4URVR 4YCMA 3YASA 3WA6A 3UHOA 4BY9E 2RK3A 4IFEA 3B1KA 4YHHB 2QTRA 4J0HA 3MBKA 4PXAA 4TZKA 1XXHE 2EFEB 2HRBA 4GE0A 4PIPA 4X90A 4DMFA 1EAMA 3UT6A 2CXRA 1K8RA 1ISGA 1ZH8A 3RFUA 2VDLB 5BW5A 4HQKA 3K32A 1JKFA 3F7NA 1LNZA 2R7LA 4DMMA 2XQIA 4C5BA 4FXPA 2I7XA 3GVIA 1P9RA 2D2IA 3EMDA 1Y1KE 2IU4A 4OFBA 3N3BC 2I1QA 3V7UA 3W05A 4BMYA 1GL3A 1N3BA 2X5OA 5G0SA 1VHWA 3C6QA 4AC9A 1FDTA 1E18A 1ZJWA 1C1DA 3AEUA 3AO0B 1I94B 3RJ5A 3M89A 2NVUB 1CQJB 1HQDA 1NJGA 4KYVA 5LJIA 5DLYA 2JLUA 1XI2A 4K46A 4XYLA 1KK3A 5KWEA 4HTFA 1SD5A 1HM5A 2BFEB 1B93A 2I0FA 2Z5VA 4YJ3B 3USCS 2E82A 1SU6A 4JVOA 4OBXA 1Q17A 2FMTA 2E49A 2CNWD 3NS7A 3OJLA 2YY6A 3T5TA 5KS2A 4Y9DA 4B32A 3RKUA 2BM1A 5AVWA 4QQRA 3QG1A 1ULTA 4PIMA 5FUYA 1LH0A 2VZLA 3E8MA 4YV0A 3B1XA 3T5PA 1N2CB 1O95D 4CDRA 1YZHA 2L17A 2VL7A 4U7JA 4MW4A 6ADHA 2CJWA 3H97A 3OURA 1N0UA 5BSEA 3HVRA 3WLOA 3BCSA 1H2BA 3C70A 3E9QA 3Q7TA 3VV3A 2PO5A 3MUEA 4HRXA 1REQA 3GLIE 3HFSA 1L4FA 4QAJA 4DLXA 3RANA 1NTRA 1WHSA 4ZCQA 4E5NA 1H69A 5EMMA 2X4GA 1FL9A 2DF8A 2DCMA 1IBKB 1NVVR 4K86A 4EGAA 3A6ZA 3NDIA 1UM8A 4EG6A 1K86A 4G5OA 3T3NA 3QXXA 3Q11A 4MYHA 1L5NA 4LJ4A 4BE4A 2BJVA 2HA3A 1ISIA 3D31A 2I62A 1P7PA 3C1AA 1Y3BE 3IKJA 4M1YA 4OK5A 4QX6A 2HREA 2JCGA 4W1PA 1H23A 4I5GA 5ALIA 3DV9A 4CE6A 4BZWA 5DZSA 4X64B 3SQLA 3P9KA 2JLZA 1LA2A 3AY3A 2MHCA 3EE6A 4NK4A 4DYVA 5JAMA 2YYSA 3DKPA 3E2IA 1ZP6A 2C03A 2PJRA 2HSEA 2P9BA 2P7HA 3QNWA 2BTQB 4HXGA 4MH0R 5P21A 3DVQX 3G79A 3WJ7A 2CVZA 1MX3A 3SKXA 3RC1A 2WD7A 4D9NA 4LF4B 3C8UA 3UUWA 5U9CA 3OSUA 4UNQA 4Q4HB 1CJBA 2P2NA 3H2BA 4QTZA 2V1XA 2I3AA 4CIBA 4JROA 3FHOA 3JQ8B 4U2FA 4YROA 2MR6A 5AKHA 1NJ8A 4DMKA 1TJ4A 3CG4A 3WNZA 4XGKA 1PJ8A 3HM2A 4HH0A 4MYSA 5U4QA 3WWOA 3DOIA 1FVHA 3DOEA 4UZEA 1WWKA 4GXRA 3VXKA 1RXSA 4G5SA 4IIJA 1IWBB 3JSXA 3H3XA 1OZFA 3H87A 4X8OA 3SLKA 1FU7A 1ZL0A 3MM4A 1U5BA 2WKRA 5JZOA 2EL9A 4Z4GA 1Q14A 1U9CA 2XW6A 5J2UA 4DSUA 1ESMA 3F3YA 3RROA 5CJPA 4AO8A 1RIFA 2QPOA 2PKCA 2BMAA 4BNDB 1GGNA 2YUTA 3EXAA 1LVGA 1PFGA 1DZ3A 2BRUC 4JZKA 3KQVA 4TMTA 5CNKA 5F64A 4Z2YA 6NULA 4EW1A 5BN3A 4WGFA 4ZHQA 2NO9A 1A2KC 1RJ9B 1XZPA 1YVPA 4N41A 3VHXA 2MSNA 1KEZA 2GR9A 1LK5A 2FZKA 2YH2A 3HWX1 4UZSA 3JYHA 1CUDA 3C1TA 4I4NA 5B6JA 4ZVLA 4QG3A 1U4SA 1WB4A 1TRHA 3JZIA 5K8TA 4L0CA 4KREA 2WINI 1G6Q1 1GR0A 1RZVA 2QN2A 4TSRA 4Y3UA 1MT0A 2UXDB 2QNBA 2FWMX 3LPCA 1SUBA 3MJSA 2XB8A 4IP0A 5IARA 3VO9A 3RG8A 3OEED 3T94A 2IHJA 4DMUB 4EX6A 1GTSA 4MUJA 2MINA 3OMXA 4JLPA 1AGXA 2GN4A 2H4XA 4AS2A 3GEIA 2Q0XA 4MS1B 1SRRA 3EGVA 2CL6X 4BJ3A 2A84A 3M4XA 4ARIA 3KYIB 3ED5A 3KAQA 2DFTA 4JR2A 4HYTA 1VKOA 4Q18A 3W6OA 2FLVA 2YIDA 1UPCA 1E5TA 3GBPA 1UR5A 2ZYIA 1M6VB 4LRWA 5AHWA 2Y67A 4ZV4A 2VT6A 4F91B 4PANA 1JAIA 1B7GO 1IM8A 1GIAA 2B3DA 3IP8A 5HIIA 4KLRA 5EHXA 3M33A 1DBPA 2TMGA 4D8TA 5AUNB 5EQFA 2Q6LA 3MCVA 4MQEA 2OAEA 2OV2A 3C87A 1LBQA 1AXGA 1XDUA 3HDTA 5EZ5A 4B8WA 2HRRA 4OLAA 2AVNA 1TMYA 3CJRA 3CV3A 3KSDO 1CUJA 1DIAA 2CXUA 2GF9A 2FQ1A 4GBJA 3L6EA 5LP1A 4D6XA 1FFEA 2ZPAA 4RVOA 2PAFA 1G7CA 4F3RA 1CW2B 4BQFA 5C9ZA 1AG9A 4LGCA 2IBTA 1OI2A 3QOFA 3C97A 1T3HA 1I1QB 1RC1A 4QOJA 4WOJA 4LOLA 4CDNA 1OZHA 2I3ZA 3GUVA 1TVCA 4GUDA 1KJYA 3IAM6 5FA6A 1CF2O 3UCFA 4D9CA 10MHA 4LJRA 3FR7A 3GNQA 1QYWA 2IP1A 3IXLA 1N2IA 2WJ6A 3AVOA 1JHAA 5EHGA 4C0HA 1Y9ZA 3M5CA 4ENQA 4JP3A 1WDLA 1YKFA 4ZU1X 3QVOA 4IILA 1Y63A 1I4OA 2HYIC 4P0QB 4P54A 3LC1O 3MMPA 1EWRA 3RUIA 3NC1C 2E4UA 1T6NA 4B48A 4LYYA 4GEGA 3M2TA 4TWRA 5LN1A 3AVPA 1XQ1A 1Z74A 1LB1B 2WIAA 4FDUA 4RXUA 1M76A 2ZIUB 3CX6A 3JYPA 5DTRA 4F9FA 2PWAA 1EGAA 1Y3DE 2HCFA 2WF5A 4LJLA 4MRVA 4RGBA 2JEYA 2PD6A 1FFXB 1GRNA 4H4EA 2R7KA 3UBTA 2XXJA 1H66A 4AN0A 1T8RA 1RM5A 3M1YA 3FYTA 2BBWA 4ZIRA 2EP8A 1FTSA 1SIBE 3B70A 1KMQA 1JQJC 3KLMX 3OEHD 3DO8A 5CFMA 3FMPB 3HYCA 4RFLA 4KQXA 2E3JA 3AI1A 5JSQA 1YRAA 5LU9A 4M9SA 3H84A 5AO9A 2Q7XA 1N8KA 4X20A 5FPSA 2MDTA 2VR1A 3IRVA 4R51A 4P2GA 2Z1DA 4EB3A 2XB4A 3DO5A 1C1XB 4C0KA 1VP9A 2VP2A 3VNVA 1OUMA 2VYND 3E1KA 2O3RA 2VP6A 2C83A 3ABQB 4K3UA 1YZ3A 1Y5IA 4M7PA 1Z8NA 1ZMOA 1F8UA 1D2CA 1NPTO 1UXIA 1YASA 3IDZA 3QI2A 4RD1A 3VAAA 1GUFA 3HE3A 4ZCPA 1KL7A 2Z56A 3OX1A 2VPYA 3L6OO 1YIOA 1EFRA 1Z35A 3FOBA 4BNGA 1E5VA 2XGMA 1A9SA 4QXPA 5ALUA 2QX9A 3TI9A 1YT5A 3UXMA 4KTTE 4RPJA 4B1FA 5DM0A 4U6SA 1N8NA 2RI1A 4B5LA 4GMGA 3AU8A 1NYRA 4LC1A 4K03A 4MUYA 4WKGA 4LXIA 4URZR 2ST1A 4MDYA 4YPVA 5AJTA 3LT5A 2XYRA 2ZAMA 1Y7HA 1KAGA 4LY0A 5A6SB 4IEIA 2L69A 7MDHA 3BGVA 3BHIA 3QVUA 1PR0A 5B6IA 2UAGA 3AR5A 1I9GA 5KNBD 3IBGA 4B80A 3JQDA 4EX7A 3QEOA 1JFRA 5L45A 3BSSA 4RY9A 3IALA 4AZVA 2KBEA 3IUYA 3ICEA 4MWTA 3QYPA 4BJ1A 1DRVA 2ZUWA 2WTAA 3V33A 2BFBB 1U11A 4LA4A 1T36A 1Z8DA 3LWZA 5FOSA 3UFXA 3P2YA 1OKKD 4C0SA 3P9YA 1EHCA 3FVQA 2BIFA 2VSXA 2YXNA 3QKIA 4TLDA 1VPEA 4MPRA 4KVGA 4HUQB 3W3AH 1NBME 2QZ9A 3DB1A 1T9BA 2BOVA 4L0MA 5FTWA 1SCDA 3RRJA 1HYGA 4RXMA 2IDZA 4J0GA 5JJ5A 1PX2A 3IT2A 4JR0A 1Z0ZA 4M37A 3R6LA 5EA2A 3D7NA 4RZQA 1UFOA 2WHPA 3L18A 5A1JA 5MGBA 5A4KA 2BZGA 2IIBA 3QX3A 2PMBA 5I7OA 3Q98A 4D8XA 3HN7A 5BNIA 4AJJA 3IPCA 4G0XA 4PLHA 2BHSA 5J40A 3AVVA 2BEVA 1O0SA 1I4WA 3PCRB 1KA9H 1XC7A 3ZWAA 5CT5A 1P2TA 1S2OA 2CF5A 3E82A 1BJKA 1COWA 2D3TA 2H16A 4Y0VA 1Z63A 5GOZA 2E37A 3GDGA 3KJXA 4Q01A 2YYYA 1PO7A 4I9FA 4M9RA 3GYGA 1CV2A 2YHIA 1OI3A 3ZGOA 1QANA 1WXFA 2XNDA 4BQRA 3C6BA 2XE6A 4UEWA 1QGZA 1KZ4A 1SKYB 1KDPA 2WSBA 4YV7A 3ZTWA 1F6BA 4LXHA 1OXMA 3RJ9A 2FCRA 1KK0A 1B15A 5E4TA 1R4NA 1X7XA 1LQ2A 1OQAA 2CLCX 2CUNA 2IQIA 5LUAA 2FPKA 5CDSA 2FNAA 3FYUA 3IOBA 4JLJA 5JEEA 4TL9A 3KX2A 4QUDA 2R47A 4JDUA 3U4QA 1P3Y1 4FYWA 2ZRCA 1GARA 3DZFA 1EVEA 1UOPA 1EX6A 2DG2A 2NZXA 3EPHA 3GGSA 3DWGA 5FBLB 3LT2A 5CM8B 1KQPA 1BD4A 3EDRA 5C5CA 2ZWOA 2X1HA 5DHUA 2ZQ5A 3ASYA 3NJ4A 5FFFA 1HG0A 2FJUA 2BSXA 2WE8A 3PUIA 3LUDA 4FJ1A 4W5JA 3U6KA 1YR1A 1VQ1A 3Q9NA 4IH9A 1LV8A 2V7UA 4Y1RB 1WXGA 3JPYA 5HEKA 1N2EA 4EO9A 3P8ZA 1FRQA 2H2IA 4CUKA 1LCIA 3ZGLA 1ILWA 2XADA 3DF9A 2WDZA 4AG3A 4BGIA 1FIUA 4C7MA 5K8UA 3WKDA 1K7YA 4NV1A 3WKEA 3VJMA 3D6UA 4PZEA 2REBA 4AY6A 3JQRA 3NJRA 4Y2VA 3ZU6A 1EG2A 2VHXA 1EM6A 2ZSUA 2FUNB 4IFIA 3IUPA 521PA 4BP9A 2VDWA 1BYIA 2QLTA 3TEJA 5K03A 4GU5A 3I62A 3GRVA 1Z5GA 3H2GA 1KZ7B 1WV0A 4M1SA 2FZ5A 2GVDC 4P31A 1PZMA 1N2CE 1PT8A 4XZ3A 1BXGA 4J3NA 2VZ8A 2H06A 1Y48E 5H3CA 2XKKA 1DV2A 2QX7A 1YOVA 3LUBA 1N2XA 4NU8X 5C8YB 3LT1A 3TBHA 4BX0A 5EPEA 2IEBA 3K92A 5LMCA 2DY1A 2YHSA 1DDIA 1XG5A 3R76A 4MJ7A 2AG1A 1W36B 1K9VF 4RL6A 3PKJA 4TMKA 1W9MA 3EVEA 2OCLA 5AHOA 2WA1A 1SQGA 4G3XA 1Y5NA 3JYNA 1I7SB 4LXUA 5DBFA 5B3JA 2R8XA 3C3WA 3NAQA 3IMKA 2P6PA 4IRXA 2C57A 4WNAB 4UEKA 4EJ6A 4L9RA 4K1LA 1RJFA 1IK6A 1ZK3A 1APBA 4D25A 2G4VA 3I04A 5DGHA 2FFAA 3G5UA 2GCIA 4G4GA 2PEYA 4JHLA 2RG1A 4OHWA 1ONOA 3RWBA 3I0MA 4ZAGA 2AR0A 3FYDA 3GA0A 1X70A 3KU4A 1FLNA 1QYRA 4QELA 4B82A 4HGQA 4MIYA 4YWJA 1Z5ZA 2R85A 3AKDA 2PGDA 3CMMA 3A11A 5EMJA 2Q6TA 2C4KA 4DE5A 1DIGA 1L5YA 2GF2A 3DVRX 1OX4B 3WISA 4Y30A 2O5VA 5JCXA 1ZCZA 4ARZA 1VHQA 1XKQA 4RO0A 2YWJA 4DLLA 4YMHA 1OZGA 1TI7A 1V6CA 3C3AA 3IAS6 4HZIA 1RWMA 4ZQCB 2HDHA 3PYLA 2BI7A 2EQBA 3HB0A 1P91A 1XMVA 5AP9A 5EHNA 1V45E 2ZIWB 3F47A 1Y7PA 2O4UX 1QIKA 1RAFA 4II2A 5I4KA 5C8DA 4K9KA 3B8HA 4CF3A 3I4CA 3BL6A 4BNKA 1OTYA 1G42A 2PSDA 2R1UA 3BMNA 3L1IA 2BWJA 4MYUA 3JASB 3X1YA 3QOWA 4DILA 3JYOA 3AY7A 4FNOA 3BWMA 1ACMA 3IO3A 4MDEA 2CCJA 2FDRA 4KXLA 5CYOA 4CV2A 4LV5B 1PJZA 2NTYC 3OCWA 4BEJA 4I3HA 1PT9A 1QHIA 3CNQS 5INTA 5JRZA 1I0LA 1XTQA 4PPGA 4JLNA 1Z18A 3E27A 1OLUA 4Q3CA 2IPOA 1V7QA 2PMKA 2EFYA 3FTNA 3QVWA 4Q39A 2WQ6A 1FYWA 2WG0A 5DHTA 1NYQA 3EJ6A 3BCUA 1ZZEA 2GFHA 2EJCA 3K5IA 4MR7B 3B3QA 2R8EA 2QUKA 3U7GA 2NQTA 4JFRA 4TYPA 2FZEA 4ZTBA 4D3ZA 2LDXA 3GLGB 2L18A 2EC5A 1ZO8A 1H8ED 1EUYA 3SQXA 2G0NA 4N7MA 3PNSA 4P98A 1IZZA 2CFSA 3AZOA 3NATA 2QW8A 4G8JA 1T9CA 4C2BA 5FR1A 4LRUA 4QJ4A 1G41A 4CL3A 2G63A 1VXRA 1MV5A 1YR6A 2GT1A 4NBRA 1QGED 3FCYA 4PWYA 4MA0A 2OL4A 3G9TA 1E2BA 4AKIA 1DXOA 2BDUA 3FUCA 4QHTA 4CG0A 4K6GA 1T9DA 2GLUA 4C21A 2J4DA 2IPMA 3RPEA 3CWQA 1D5WA 2I99A 2GFIA 4Q1EA 5CDUA 2J6CA 4JYPA 4B84A 4FHGA 2ESRA 3OUUA 1QG2A 1H65A 2L42A 4H1TA 4XOUA 1ENYA 2R8ZA 2P62A 1T2AA 3BOSA 4LW8A 3T5BA 2LIVA 3TM5A 3F7TA 4NI5A 5BRNA 1YQEA 5AIBA 2JGAA 1X9GA 3T5AA 3IKVA 4HDSB 4EY6A 2R86A 3TRKA 3AB8A 5HCNA 1D2EA 1H6BA 1UZLA 5BVGA 3H8WA 2WHRA 4OFZA 3QFFA 1QVRA 2XCIA 4N0EA 5LOVB 2VXYA 2J32A 1GTRA 3O31A 1I30A 4Z3DA 2XNHA 1NP6A 5JO0A 3HEAA 1ZH2A 3SQWA 1M1YE 2JA2A 2ZP1A 1DT3A 2AOUB 3FA2A 3PDWA 5TGZA 3PNOA 1T8UA 3OM8A 4EZBA 1SH7A 4N0MA 1ZFNA 1HT3A 2UVPB 2V7BA 4I6EA 1NC3A 3AGQA 4H2DA 4P82A 2VA8A 4PHTA 3GUYA 5KWVA 2DQ4A 5IK2A 2PZLA 2ZM5A 4U63A 4CKEA 3QMVA 3BIJA 4QTXA 2FU5C 3NRJA 2ZAOA 3NNDA 3RFFA 3ZWPA 5CFOA 1KI7A 3V7WA 2NTEA 4GOOD 3UXEA 1J39A 1UQTA 2IV3A 3VPCA 2BM8A 2MYNA 3BWBA 1WKVA 1KAEA 2AOTB 5TS2A 4CIWA 4LF7B 3QVJA 5IXSA 4MV6A 1JFSA 4L2IA 3AEKA 4HNRA 2JFNA 1MG5A 3C6KA 4RE6A 4COKA 4A27A 1H2ZA 5L53A 4P4SA 1EWKA 1M8JA 4QDJA 4RHYA 2ZR8A 1C3XA 1J0EA 1O89A 1W87A 4GZ5A 1T0PA 4DSOA 3KR0A 2BSQA 1KE1A 4KLAA 1BQ3A 4JI4B 2B1GA 2HH9A 2RB4A 2XEDA 5FTNA 3ROFA 4QJ3A 4I4CA 3MT7A 4LKRA 3B9PA 1P3DA 4KOEC 2F3TA 5E7QA 3U3JA 4ND4A 4A8PA 4CLOA 1FLDA 4ZRNA 3WIVA 3FD8A 4YCSA 3EEOA 1XRSB 1NTOA 2VDUE 4NXMB 4QWWA 2I4IA 4DUZB 2CLDX 3MW8A 4V0LA 4XLTA 4KMMA 5HXAA 1JJBA 3SR0A 3BF8A 5HX7A 3COSA 4PC2A 1Y9DA 2IQ5A 2Z2IA 3EPJA 4HAZA 1M1NA 4X6LA 1XLTA 5MF6A 1TZCA 3ZE6A 4O4JA 5AVTA 3ROQA 4YP9A 5I7UA 4JC4A 3VI4B 4TXHA 3FIJA 1KQGA 5L40A 2RHCA 3N1UA 2P3LA 5IDYA 3R8FA 1Q1ZA 1H4TA 2BONA 1HT0A 3ZU4A 3E22A 3FHTA 4Y2UA 2C95A 1VYUA 1DC6A 3OPQA 3V8MA 2IH2A 2H1IA 4CF4A 1XQWA 4HDRB 1KOLA 3K8ZA 4WLOA 4Y0NA 3SJ7A 1JALA 1GPJA 2K7ZA 1K8XB 5B1HA 3A3PA 4TQ9A 5JTTA 1A7KA 1ZS9A 3COWA 4WY2A 4RTQA 1DHTA 1GNRA 2PH5A 2Y1WA 2GRAA 3ADKA 1QK5A 4YIKA 5D2CA 2GM9A 3DFIA 3WAJA 3KL4A 3TLCA 1RYYA 1KTIA 2GHRA 4REQB 2WAMA 1V3QE 3NVDA 2WZBA 3K0EA 1UFQA 3RFVA 4HRYA 1NXVA 3NW9A 3QVTA 1KK2A 3KQQA 3PE4A 4EH1A 2A4MA 1NVKA 1MTOA 3RVDA 3TTTA 2HB6A 2NWQA 5K0BA 5C5IA 4ZZ1A 1L5VA 1WMBA 2C4WA 3F7MA 3EIEA 3L7KA 3BTOA 1TCUA 3T4EA 3K09A 1P5HA 2Q5FA 2QP4A 4HJXA 4M53A 1Q0TA 1IEXA 2HQBA 3NKLA 1C9DB 3HC7A 4DIMA 1P4JA 2QTMA 4BMNA 2EX1A 3T0IA 4CG2A 5L3QA 2A3RA 2M2IA 2AWNA 5C80A 1QVZA 2N0SA 4LSMA 3OOWA 3TZ6A 3ZBPA 3DMDA 2HK8A 3A1FA 3I4FA 3OZWA 3OY7A 1Z75A 1H2YA 2XUFA 4CM9D 5LWQA 1S4QA 3F2VA 3L5KA 3SEAA 3P0RA 4JVSB 3SXUA 2VP4A 5AOBA 1Q0UA 4FE7A 1UMCB 4IWYA 4AQDA 2Z8XA 3UMYA 2CB9A 4H60A 3KTAA 1KO1A 2G25A 3FVVA 3TZEA 1TJYA 2FWBA 3D3WA 1JQDA 5JWRA 2OAP1 1U1DA 4J07A 2MOKA 3UMMA 1SHTX 1JYFA 5KSWB 4Y9RA 4YDRA 4NCAA 5NLLA 3NDBB 4D3SA 1K8ZB 1VXOA 3DFKA 1SKYE 2OO5A 4IFTA 4OXNA 4XJTA 1QX3A 4XI9A 4CCWA 1U98A 2FHSA 3A9WA 3K53A 3AR3A 3EBLA 1ZK2A 4S3MA 1AUQA 1FU4A 5I9IA 1Z34A 1WEKA 1JDTA 4FTWA 2O2CA 5LBTA 2ZAIA 1PZEA 2FFQA 4I4TB 3BK7A 3GGPA 1S2NA 4HDQB 4HDCA 4F5EA 5BR4A 1FUYB 3HRKA 2YJTD 1POXA 4TM8A 3SR3A 1WETA 1G8SA 4WCVA 3T7CA 4WZ6A 4NULA 2WJIA 3ND6A 1NFFA 4QDOA 4DPKA 3R7WB 1C1YA 3QA3E 1U3TA 4POAA 2SHKA 5A0VA 3OPNA 3GHHA 1C81A 3AUYA 1OT5A 2I34A 3FMIA 3HDYA 1XVUA 2YRFA 1F1BA 2ZZKA 1VJGA 3JD0A 3G13A 3QV1A 4JJFA 4MQFA 1H2WA 1OREA 2XB6A 3VDQA 2RONA 4KNWA 4CCSA 4E09A 2VPXA 1E2DA 1BIFA 2W2OA 2WJVA 5LD2C 2RHHA 4EEXA 3VPSA 4IDNA 4ER6A 1DX4A 3R7NA 1XZQA 3P0HA 3GP3A 2FR0A 2OFOA 5EXTA 5FOVA 1J9EA 1MLDA 1Z37A 2YVKA 3E23A 3W2FA 2C94A 2C77A 5TARA 1CC1S 3B78A 3PUXA 4OB6A 3GPIA 3QXCA 4M99A 2BLLA 1E2JA 2W4IA 3NBFA 4ID3A 2G77B 4LYDA 3VR6A 1YZNA 1UINA 5HQ3B 1V71A 2JIDA 2OY0A 1U04A 3I5MA 4BNNA 3WQQA 1CS0A 5HS4A 4M1TA 5COBA 4YLYA 4C4XA 1X3LA 1F6WA 3FMOB 2RGBA 3PXDA 4WLFA 4BOYA 3A4IA 3EGIA 3NHUA 2ZCVA 4K9LA 4QYSA 1C7JA 3RIHA 2EIHA 4W1QA 2P2ZA 3M81A 4URUR 4D96A 3QFCA 3FNQA 5LXTF 4AZSA 3WYBA 3QYJA 4CYMA 4TTVA 4D7AA 2W2MA 1ZD1A 5JMWA 2WT9A 3OP1A 2B21A 3A3NA 4FQ8A 3UMFA 3DAHA 3IOYA 4XR4A 2CNNA 4PNPA 2I65A 3K71B 3V8QA 1KKUA 1WS6A 2B4TO 1TU0A 2PSSA