4BB0A

Structure of a putative epoxide hydrolase q244e mutant from pseudomonas aeruginosa, with bound mfa.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
297
structure length
295
Chain Sequence
DPLLPGFDYLTLHTSAARLRVAVKGSGPPLLLLHGYPQTHLAWHRIAPRLAEDYSVVLADLRGYGESRALDGADYSKAALARDQLETMGQLGFERFAVIGHDRGARVGYRLALDHPQAVAAFVSLTVVPILDNWAAVNKVFALNAYHWFLLAQPYDLPERLIGADPEHFLDYTLRRMAQGRDIYHPQALESYRRAFRDPAVRHAMCEDYRAAVGVDADADQADRDAGRRLQCPVQVLWEERPYAAGQHPLEIWKTWAGQVEGAAIGASHMLPEDAPDAVLEHLLGFLASHREALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROBABLE EPOXIDE HYDROLASE
publication title Structure of a Putative Epoxide Hydrolase Mutant
rcsb
source organism Pseudomonas aeruginosa pao1
total genus 115
structure length 295
sequence length 297
ec nomenclature
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bb0A00
2QMQA 1VA4A 4UBLA 3W9UA 4GECA 1MAHA 4UBKA 4JH0A 1X2EA 1ZD4A 1A8QA 3I2IA 4HRYA 4X95A 1HPLA 4EZIA 1MO2A 1E89A 4WFIA 3E4DA 4BZWA 2VTVA 1R50A 5LYYA 3SX4A 4AN0A 1N1MA 3O95A 1XQWA 1CUBA 1THTA 5AK6A 1PV1A 5DNVA 1JU4A 4WY5A 1PFQA 3D3NA 4YASA 5AKZA 2IITA 2YASA 3R3YA 3F96A 3GELA 4Y2VA 4EHBA 2XB6A 3FLEA 3STVA 5JD4A 3DNMA 5SYNA 4BE9A 4PV7A 5FKJA 4CCWA 4DSAA 2WHPA 1XZCA 4I3FA 3PE6A 5ALYA 3VKFA 3GUUA 1MNAA 1JMKC 4DGQA 3O4JA 5SYMA 2X8BA 4UBNA 2WJ6A 3WWCA 1XZDA 1EK1A 2ZJ6A 3SC2A 2Y6UA 4EY5A 5ALUA 4W1RA 3I6YA 4U2DA 4UFNA 4EBBA 4GI1A 4AMYA 4QDTA 4CCYB 3PUHA 2WUFA 2Z3ZA 3I6ZA 1JJIA 4UFPA 4BCBA 4QWMA 1FJ2A 2HU5A 1ODSA 3E3AA 5T4HA 5C8XA 5IVKA 2JGFA 4RGYA 4INZA 2YH2A 3BE8A 3MUNA 4AB1A 2XQIA 1CUEA 1QJ4A 3HEAA 4UHFA 4TVKA 1W1IA 1K8QA 1EH5A 5AI6A 2IIVA 4DNOA 1TRHA 4XVCA 2HADA 5DYTA 2OPHA 3V48A 3C5VA 3IURA 3G02A 1AX9A 4WFJA 3WK7A 4HVTA 1XZIA 2CKMA 3DQZA 1K63A 1VXOA 4WDRA 5HCUA 4D9JA 4MQLA 4PSUA 2XUJA 1XZHA 2WIKA 3BIXA 4NMWA 5AM1A 5K3EA 4BC1A 5CT9A 2WUDA 4N5HX 1EB9A 2GYWA 4K6HA 5DWDA 3F98A 3STUA 4YK7A 3PF9A 1XZAA 4EUSA 2Y2VA 4KRXA 5I9IA 1F6WA 2DCMA 2FX5A 2AJBA 1YS1X 3BDVA 1G42A 4X92A 3W04A 1ZGCA 2ZVDA 4G4IA 5AK3A 1EB8A 5ALQA 3BIWA 4B7ZA 1CEXA 3WK6A 2J4CA 4K5QA 1SCIA 1C7JA 5ALKA 2K2QB 4XJVA 4ZV7A 5KREA 2VT7A 4X00A 2HRRA 2OXEA 3L1HA 1W76A 4Q3KA 4J0JA 1ZD5A 4DMHA 1UZAA 2JEYA 1CUSA 2B9VA 5ALWA 1YB7A 5LLSA 1B41A 4GLBA 1CUZA 1YS2X 1XLWA 1QIIA 2VA9A 5K3AA 3ZWQA 4BATA 1CVLA 4IQ4A 2HU8A 4KAFA 4B82A 1CQZA 2V97A 1XROA 4E46A 1YCDA 2XDWA 3AZQA 3A2NA 1E8MA 4S0XA 1ACLA 3K6KA 3I2FA 1XRPA 1R9MA 1GKKA 3WL6A 2XUDA 2QS9A 5EIHA 5ALLA 3HRHA 1LZLA 2WIDA 1XZBA 1ORWA 5AI5A 5LZ7A 1U2EA 3DEAA 3E0XA 1XZFA 4EB0A 4DMFA 4GWLA 1SFRA 2QZPA 3BF8A 3IULA 2QRUA 1ZIYA 2XUOA 1W6RA 3ANTA 1P0QA 2HIHA 1C4XA 2WKWA 3FLBA 1CUCA 4XIIA 3C70A 1XRMA 1O6FA 1CUYA 2I3DA 3GZJA 1LPAB 1LBSA 3WK4A 3FVTA 3ESCA 5H3HA 5BOVA 1QLWA 2XUKA 1F0PA 4NZZA 3FAKA 4AN1A 4Q1VA 5AHXA 4X90A 1CR6A 1DQZA 2GZSA 2WQZA 5CH5A 3W05A 1QIHA 4BCCA 1JI3A 1XZMA 3JWEA 5LZ9A 1ZJ4A 4Q82A 3M81A 2X5XA 3TJMA 2PX6A 3PFBA 1MNQA 1D07A 4MXDA 5BWBA 1KU0A 4C4YA 4C88A 3WWPA 2ONCA 3G9UA 3OURA 3DL7A 2PU5A 5CH3A 5AH0A 1LPMA 4AQDA 3ESDA 4IH9A 4AXBA 4U2BA 2B61A 2IX9A 5DJ5A 1GPKA 4N8SA 4Q34A 4ROTA 3D5EA 2OCKA 4CI9A 3OPMA 4BDTA 2HFJA 4FHZA 1BE0A 2QOEA 1UOOA 5AKXA 1QTRA 3RLIA 2WLSA 3WZMA 3HJUA 5JADA 2O2HA 2QJRA 1TCCA 5DYWA 1YAJA 3STXA 1LPOA 5A2GA 5FLKA 2JEZA 3DS8A 4KAJA 1XRNA 3ESAA 2EDCA 4U2CA 1CRLA 4LIPD 2HU7A 2ZYIA 4OB7A 1T2NA 5JZ9A 4FLFA 1JMYA 2QT9A 1U8EA 2PL5A 4DNPA 5AKIA 1BEEA 1GQRA 4P93A 1CUFA 2H7XA 4BRZA 4CG1A 1AUOA 5K3DA 4BZZA 4KE6A 4HRXA 2YXPX 3FYUB 5BWCA 2E3JA 2Z8XA 1LPNA 4UFOA 1Z68A 3QMMA 1CUGA 5CTAA 2R11A 3OOSA 1FFDA 2CBGA 3G9XA 5AM2A 3PICA 4QNNA 2XUFA 4EA6A 3QBJA 4X94A 1KU6A 5E4YA 2BCEA 2WFMA 4B9EA 2XMQA 5C8ZA 1SCQA 4KYVA 3BWXA 5ALNA 3DLTA 1XQVA 1YAHA 5LZ5A 3NWOA 5KWIA 1VE7A 4IHAA 4QDXA 5LZ4A 3N2ZB 4B85A 2OGZA 4QLOA 1B6GA 3BDIA 3C8HA 2WHQA 2JGIA 3L1JA 2WIFA 5IVIA 2WIGA 2I03A 2R8BA 1CUXA 4B83A 3H2KA 3DYIA 4K2AA 2XUIA 5JZSA 5A7GA 2PPLA 4MWSA 4E15A 4CIAA 1YA8A 3R40A 1P0IA 4WCVA 1BCSA 3G0CA 3LIPA 4DLNA 4MEBA 4KE8A 3HZOA 1EI9A 2V9ZA 1FFAA 2RI6A 4BP8A 1C7IA 5AM3A 3P2MA 1SOMA 5EIEA 5JIBA 1YASA 3H04A 4Y7DA 4AO7A 4BTVA 5ALIA 1BU8A 5F4ZA 3S8YA 3C45A 4G4GA 1FFCA 2RGUA 1NU8A 4G8BA 4WY8A 2EEPA 3A70A 1LLFA 3U1TA 1XZGA 5LIPA 1MX9A 2VATA 1RYYA 2Z3WA 1L7QA 4B84A 2H9YA 2PUJA 3BL8A 5ALMA 3F9CA 1G5FA 4U2FA 5AOCA 4JUIA 4FBMA 1JJBA 3C6ZA 4W1QA 1XKLA 1DWPA 1QOZA 3ESBA 2JGEA 5JZBA 1XLUA 3VXKA 2FJPA 3DCNA 3DYVA 4PO3X 2OQVA 2PSDA 1WCYA 3O0DA 4ZI5A 3QPDA 4BAZA 4PW0A 3I1IA 4LKOA 3PI6A 4P9NA 4UBJA 2BJHA 3G9ZA 2VJBA 1P0PA 4UHEA 1BRTA 1R88A 3V1KA 3WZLA 2ACEA 1MU0A 4RE5A 5JAPA 3WKEA 5FP0A 4LXGA 3JYHA 2JGKA 4BVJA 4HS9A 5HK9A 4B6GA 1G4HA 4X6XA 2FJ0A 1XKTA 3T52A 4HXFB 3ZPXA 3GFFA 5HKAA 3MGAA 4Y2RA 4J0DA 3AJAA 2H7CA 3QH4A 2BUCA 2JGMA 2HL6A 1CUIA 5KBYA 5LZ2A 4KEAA 4EY6A 1EXWA 1CUVA 2OG1A 3ZLUA 4MQMA 2XQJA 2AXEA 4LXHA 3WYDA 1H2WA 3R3XA 3EF3A 4KJXA 3IDAA 3AIMA 3ZLTA 3K9BA 2RIPA 1Q0RA 3WJ2A 3ICWA 2BUBA 1IUPA 5HF9A 1AC5A 1K6EA 2HA2A 1HLGA 2JGJA 2YYSA 2BGNA 1NU6A 2PSFA 1OCEA 2XLCA 5KWJA 3H2JA 1XZJA 4Y2PA 3HACA 4F21A 3QYJA 1O6GA 2PBLA 3UMJA 3BJRA 3VDXA 4B81A 3GBSA 4G8DA 1ORVA 1DT5A 1G66A 5JAHA 4ZGBA 1AZWA 5EGNA 4NS4A 4O08A 3WL7A 4ITVA 4B0OA 1VXRA 3I6MA 2RHWA 5ESRA 3C6BA 5HQ3A 4M0MA 5AJHA 4N8EA 4TPKA 4FWBA 5EHNA 1DX6A 3B5EA 1YA4A 1W75A 4HTAA 3M82A 5IKXA 3GA7A 4HZGA 4MWTA 4HAIA 2XI4A 4HXEB 3G8YA 3QMWA 3I28A 3ILSA 3ZLVA 3STTA 3WKBA 5DTIA 5AOAA 3NGMA 1XRQA 4OYYA 1WHSA 3JW8A 3D2CA 1JKMA 2PVSA 2ZJFA 3D2BA 1UKAA 4TGLA 3C8DA 1XRRA 3D0KA 5AM4A 4BE4A 3H19A 2ZSHA 4QDOA 1UK8A 2QKYA 3UUFA 2HA4A 2I78A 1XFDA 3WQHA 4OB8A 1R9NA 2OCLA 2G63A 3I2JA 1TCAA 2WTNA 4BVLA 1EHYA 1USWA 3HLKA 1WB6A 1TQHA 3Q0TA 4AO6A 3VISA 3RM3A 1VOTA 2VAVA 4FLMA 2WG1A 2XMBA 3H17A 1YB6A 4Y2XA 1EDEA 5HKBA 2QTBA 4I19A 1X70A 2O7VA 2WHPB 1EVEA 3VVMA 2RHTA 5ALFA 3AZOA 4N5IX 2J3QA 2AJ8A 5LKAA 4J0CA 5K3FA 5AM0A 1N5RA 4G9EA 4E11A 1YSCA 1DWOA 1Y7IA 1DWQA 3WA7A 2HFKA 2WHRA 4YPVA 5AM5A 2ZYHA 4GDMA 2Y6VA 4X85A 3WKDA 2W22A 2JF0A 2HM7A 3E1GA 3G9TA 2CUTA 2BFNA 1Y7HA 1ZI6A 2WG2A 1I6WA 3F67A 1A8UA 4BAUA 1P0MA 1QIEA 4GEGA 3LCRA 3R3ZA 3FNBA 4UBIA 4UBOA 2DHEA 4H7FA 5T4BA 4KACA 1IZ7A 4QZVA 2C58A 2PSEA 3H2GA 2OGTA 4C87A 2W6CX 3VVLA 3FVRA 4AZ0A 1QIDA 2VJCA 3Q8WA 5HF6A 5JATA 4DM7A 3GROA 2OQIA 2VQ6A 3DL4A 4BYMA 2HRQA 3DD5A 4DSZA 2OCIA 4CIBA 1F8UA 4Z49A 1BN7A 5DYYA 5LZ8A 1IUNA 3SK0A 5JAOA 2VJAA 3VJMA 1ZGBA 4A23A 2WFLA 4A5SA 3C5WP 3T4UA 3NUZA 3HC7A 4Y2TA 4OYLA 4M0FA 3C43A 1YR2A 2C5GA 2WM2A 3NOXA 1UXOA 1GKLA 4X97A 4ZXFA 1K4YA 4QA9A 5JD5A 3O4HA 3FYTA 2ROQA 5CXXA 5EFZA 4DIUA 2B20A 1UKCA 2OAGA 3FOBA 2VT6A 5ALZA 3WL8A 1VLQA 4UHCA 3WMRA 2HA5A 2G4LA 3RKSA 3WI7A 1THGA 1MX5A 1VJ5A 3B12A 5AK4A 4FBLA 4QWWA 1S8OA 5LKRA 2XUQA 4ZRDA 3QVMA 3HYSA 3KD2A 3HXKA 5ALJA 4C4XA 1F0NA 2WIJA 4FTWA 5EHZA 1HKHA 4B80A 1E8NA 4YX9A 3DKKA 3IIIA 5DTJA 4Q05A 4UUQA 1OXMA 3ANSA 3C6YA 5E2IA 3PDCA 2WG0A 4AO8A 2VEOA 3DKRA 3X3HA 6YASA 3SWWA 1MJ5A 3BF7A 1H2XA 5ISMA 1ZJ5A 3HABA 4WFKA 2ECFA 2GBCA 1AURA 3M83A 4AZ3A 4C4ZA 1XQXA 4FNMA 5DLPA 3CN9A 4F60A 3KDAA 1ZI8A 5I7UA 3R3UA 4DMKA 1J2EA 3HSSA 4J0HA 2VAXA 3D59A 3IUNA 5CT5A 4EY8A 5CMLA 5DNUA 1R3DA 2BAGA 1ZIXA 3QPAA 3FYUC 3EQ9A 5A7FA 4MJ3A 2OLEA 2DQZA 2D0DA 4UBMA 4LHEA 3WIOA 2VJDA 3R3VA 4I4CA 2ZJ7A 1ZOIA 1XRLA 1ISPA 1CPYA 1GPLA 2XQKA 3H1BA 2CMFA 1XZKA 2DSNA 4KR0A 2GZRA 4C6HA 3G0DA 3WA6A 2C0QA 1ODCA 4V2IA 4X71A 2WFZA 5BV7A 1EX9A 2NW6A 5AKLA 1U4NA 2XMCA 1UK6A 1QIFA 1QGED 4BTLA 2JIDA 4F0JA 4H7JA 4ARAA 5JYCA 2D5LA 4RNCA 1IVYA 5JAUA 5AI8A 2WUGA 4QE3A 5ALGA 1QFSA 2BUAA 1CUDA 1DTEA 5ALTA 3PFCA 1UT6A 1QIMA 5A7HA 5HZGA 2FUKA 3WK9A 1VZ2A 3V1NA 4XWGA 5CXUA 5A71A 3IA2A 3DOIA 4CCYA 3QM1A 4G8CA 4UHBA 1ODTC 4P92A 3IUQA 5K3BA 1XZLA 2ES4A 3KWJA 2QR5A 1XQYA 3D7RA 5ALSA 1MX1A 2OCGA 3VJKA 1LPBB 2XUGA 5D7BA 4L3WA 4J3JA 3AILA 1FFEA 1A88A 4X6YA 4EY4A 4X6UA 2ZYSA 3V1LA 3DJYA 4IH1A 4BC0A 1QIGA 5LP1A 4BRSA 3OM8A 1GGVA 2C4HA 4WJLA 1LBTA 1VA5A 2HA6A 5JARA 2ACKA 5EHXA 5T4EA 2G5PA 3B3QA 3BXPA 3UUEA 1DU4A 4C01A 1KEZA 2O7RA 1PJAA 1SC9A 3H0CA 1TCBA 4UHDA 5FPQA 2GBGA 1WPRA 5ALRA 1TIBA 5HFAA 3EQ7A 1R4ZA 3O4GA 4J03A 4KE9A 1UKBA 4M0EA 4ZV9A 3G7NA 1QTIA 4IH4A 1UFOA 2XLBA 4KE7A 4H7KA 2JBWA 1JJFA 3LIIA 4PSCA 2WILA 5JANA 3I2GA 3OTQA 4PF1A 4JNCA 3LLCA 4OCZA 1HL7A 2H7YA 4XX1A 2AJDA 4PNZA 3FSGD 4U2EA 1GXSA 1GPNA 2C5FA 2DFPA 5CURA 4FKBA 4GHWA 2XMSA 5FDFA 4J7AA 5AP9A 4ARBA 2C7BA 4OU5A 4OUKX 2O2IA 1EDBA 2CZQA 2XQFA 1BEZA 5I8PA 3PUIA 3FCXA 1EDDA 5AKKA 2XE4A 1WHTA 5AK5A 1WPXA 4QDUA 4DNFA 4Y9SA 1UK7A 4A16A 3IUJA 2GBFA 1CUJA 1E66A 2LIPA 1H2YA 4FFWA 4Y2UA 3FCYA 4LYDA 3WWDA 3TEJA 4LXIA 4Y2YA 4H7EA 4W9RA 3I2HA 4J0IA 1IUOA 3AIKA 4W1SA 3YASA 3O4IA 5CH8A 5FRDA 5AI4A 4Y2SA 2X76A 4X3CA 2CJPA 2QM0A 2ZYRA 4QEKA 5HK8A 1CUWA 4K6GA 5AO9A 1ETHA 3WK5A 5AKGA 4B0PA 2WJ4A 3V9AA 4P08A 3WKAA 3M3DA 3I1YA 2V98A 3ICVA 4MYSA 3KWFA 2QXUA 2HA7A 3H2IA 1UK9A 4OSEA 2WTMA 7YASA 3WK8A 4JYMA 4PQEA 5AKEA 5FPPA 5A6VA 2QVBA 3KXPA 1CLEA 3STYA 5K3CA 1QO7A 2DHCA 4MEAA 3CCBA 3ED1A 2GYVA 4WDQA 3QZUA 3IBTA 4C89A 2ZSIA 4L0CA 4Q3OA 2WU3A 5FV4A 1UWCA 2XT0A 4CG2A 2XMZA 4E14A 2UZ0A 2WSLA 2DR0A 4RPCA 5D6OA 1W4LA 1BS9A 4AMZA 2XQGA 4DMCA 2JGLA 1EVQA 5ALVA 3O9MA 3AIOA 5AI0A 5ALPA 1EK2A 3F97A 1XLVA 4EY7A 2XUAA 5FOQA 3KOOA 1XZEA 4K6KA 3D2AA 1JU3A 3EBLA 5E4TA 1NX9A 1E3QA 3HI4A 4JYPA 5CW2A 4AX4A 3V1MA 3R0VA 5E4JA 1HQDA 3W9BA 3A2LA 2J3DA 2HHAA 4U2GA 2Z8ZA 5CRIA 4OPMA 3DDUA 1Y37A 1CQWA 1FSSA 3R41A 1MTZA 3WWOA 5C8VA 1VKHA 3IB3A 1K5PA 5D3ZA 4OB6A 2Q0XA 2VSQA 1T4MA 4H18A 2HA3A 3VJLA 2CEKA 1EINA 3H18A 3ZI7A 5ALEA 4W63A 2QJWA 1Q83A 1W52X 1WB5A 5CT4A 2RONA 4N8DA 3H2HA 3WJ1A 5AICA 3G0GA 5ALDA 1TKRA 3TRDA 5EHQA 1MAAA 3FYUA 4OD0A 1JT2A 3CXUA 5J3JA 5T4FA 4G1FA 5AIBA 1ZI9A 5IVHA 4FNGA 5AI9A 3LP5A 1WM1A 1QZ3A 3U0VA 2O2GA 4G9GA 4MYDA 4GBGA 4H35A 2HDWA 1U65A 5A62A 1GQSA 1DX4A 2P8SA 3WYNA 2HA0A 2H1IA 3QMVA 1DQYA 1QIJA 3IUMA 5JASA 1MT3A 3D4LA 4H0CA 2PM8A 1ZICA 5AOBA 5HQ3B 1H22A 2XMGA 3FSGA 4GXNA 2PSHA 3F8SA 4FOLA 3IVMA 4LYEA 2V96A 5AIAA 4BVKA 1J1IA 1L7RA 3WIBA 1HBJA 1M33A 1QE3A 4IO0A 4L72A 3CN7A 5JD6A 4DYHA 2WU4A 5FXMA 2AJLI 4RE6A 5ALHA 4CFSA 4BP9A 3LS2A 2I3ZA 2PKYX 3A2MA 5AKHA 1SCKA 4FDMA 2DHDA 1BROA 1HDEA 4FLEA 4BB0A 2RAUA 1LPPA 1A7UA 2XMDA 3L1IA 1EA5A 2Z5GA 2EDAA 3C6XA 4F5ZA 5C81A 3OG9A 4KAAA 1OILA 2PSJA 4CG3A 4ETWA 1BN6A 3EQ8A 3DOHA 2XMRA 5FUMA 3STWA 3EIOA 1CUHA 1E8DA 3FWHA 4ZWNA 4Q3LA 1DINA 3FBWA 2PU7A 3I2KA 4QLAA 4PSDA 1MPXA 4H7IA 1X2BA 1ACJA 1QONA 5K3FB 1IZ8A 1J07A 2Y2UA 4FFVA 4QDZA 5D3KA 5CBKA 5HF8A 4J0GA 4H7DA 5DNWA 1MN6A 3H1AA 1A8SA 4L9AA 4DTCA 1BCRA 3C87A 3RARA 1CIJA 2OGSA 5CT6A 1WOMA 4B9AA 3WWEA 2BKLA 1N8SA 3G0BA 3AZPA 5AKYA 4ZREA 5K5EA 2WJ3A 3WKCA 3PF8A 4HXGA 1Q0ZA 4G4JA 4H77A 2B4KA 3CCCA 1QIKA 1TAHA 1CV2A 3MVEA 4BDSA 3MUOA 1LZKA 5EIAA 1R1DA 1UOPA 2GYUA 4FMPA 1JFRA 3QPCA 2C0PA 3O9VA 4JEIA 4X91A 3FLAA 4GW3A 4KRYA 4Y2QA 4G5XA 3W06A 2BGRA 3WLAA 1AMNA 1RWQA 2AJCA 1IMJA 3QITA 4BAGA 1ZD3A 1DT3A 1CFJA 1Q84A 4X93A 1VZ3A 5HFNA 3BJMA 1WB4A 2WFLB 5JALA 3AFIA 3S2ZA 5CT8A 1UOQA 2J4FA 2CB9A 1VE6A 1J06A 1H2ZA 4UHHA 3R3WA 5ALOA 4UPDA 1CUAA 4BBZA 2OAEA 1AGYA 1QFMA 2QUBA 3A6ZA 4W1PA 4X7BA 2G5TA 3N0TA 1H23A 3W2TA 3AINA 1GT6A 1AQLA 4H7HA 2VF2A 3WL5A 3G0IA 2QUAA 3OC0A 5EI5A 2XUPA 2GBIA 1LPSA 5AKJA 3AUKA 5YASA 5IVDA 1CUUA 1N5MA 4OU4A 1FFBA 3K2IA 4DNQA 2DQYA 1AKNA 1LNSA 4Y2JA 1RP1A 3ZV7A 1QO9A 2ORYA 1L7AA 2PUHA 4BCDA 5HF5A 1ZD2P 2WUEA 4NVRA 3RK4A 2QXTA 5C7YA 2XUHA 2Y1KA 5IH7A 1LGYA 3KSRA 3TGLA 1E5TA 1GZ7A 1TK3A 5ALXA 4J0KA
chains in the Genus database with same CATH superfamily
2ZI6A 3LL7A 5DN9A 5K8IA 1EEXB 4UBLA 4UEKA 1RPNA 2WJVA 4LY3A 3LBFA 3ONVA 4MW9A 4I14A 1RQ2A 1MAHA 3ABRB 4QGHA 2INGX 1C1DA 2D59A 1JQKA 1ZD4A 4RHFA 1J8DA 1G6Q1 1SC3A 4LE1A 2FZCA 2VP2A 3BQMB 3GCGA 4HRYA 3P4XA 1TCVA 2NTYC 4LHYA 4WZAA 5TC4A 1R0YA 3DL2A 5CM9C 4JB0A 4PBSA 2FDXA 1L6RA 3LWZA 4X1KB 2NYVA 4RK4A 5IN5A 4EZIA 3JRWA 2DUNA 4B3JA 5EOVA 1R10A 4Q24A 3E4DA 3KZXA 4JLJA 1ZGZA 1S3IA 3ZX4A 5LYYA 2AFIA 3D6NB 1G8SA 2SCUB 4S3MA 5ERYA 1EXDA 3NMUF 4MJLA 3QENA 5I7WA 3MJSA 1DC4A 4HMQA 3O2NA 4TZ0A 3SSNA 2V8BA 3DTVA 1IWOA 3B9QA 3HH8A 3AL3A 2D00A 3I9OA 3G0HA 1PFQA 4JITA 3GLQA 1RXCA 1YHNA 2VSOA 1YS6A 3AX6A 3RSLA 4B8YA 1TTQB 3IA7A 4YRNA 3ODPA 1RWBA 2D3WA 5I8WA 1Q0LA 1B14A 1F5SA 4F6RA 3T15A 3HTXA 1RJEA 2GN0A 3RUEA 4CHGA 2FRDA 2IYZA 3DPIA 1BX3A 1HE1C 1HEIA 2OO5C 3DNMA 3EEBA 3IEIA 1ITZA 3PNVA 3QVJA 3C97A 4BNKA 1U5BB 2J33A 2ZJ0A 3X1WA 4BE9A 2RGXA 4N3GA 2GHIA 4PV7A 3ETEA 4GPTA 3DFFA 4O2AA 3TIXB 3NO4A 3CJRA 3VNUA 4XCVA 4EF5A 3QXHA 4G2TA 1KEEB 4BPRA 3I3OA 4TS4A 4MCHA 3AU9A 3J80A 3MCVA 1LU9A 4DE5A 1IWBB 3F78A 2QLTA 3KJQA 3HU2A 3A6KA 5K05A 4I3FA 4K0RA 5ALYA 1TQ8A 3U81A 4H9GA 2PJRA 1FF9A 2CK3A 3VKFA 3GUUA 1GKIA 3WNDA 3MM4A 1SVOA 1K3FA 1FX1A 4DGQA 3DJFA 1WMDA 3ZY6A 1LTHR 5SYMA 5IFKA 4UBNA 1S9DA 3PX7A 3RAJA 2BMWA 3T5AA 3R7SA 4F3TA 1PTJC 5KWVA 3IVXA 1D0VA 4FGZA 5FD8A 4JQSA 4EY5A 3ZE7A 1PSWA 2X0FA 4YHHB 4EUHA 3I6YA 4RTMA 5IUJC 4B4OA 4JBLA 4EJFA 2IHZA 3LFHA 4OGKA 2EWMA 2ECPA 4ZA2A 4B3BA 4UFNA 1WZCA 1JZTA 4GI1A 3SKYA 2O8BB 3D4NA 3TRJA 1BWRA 2JK0A 3JQDA 2BGJA 3DMRA 3PUHA 2WUFA 5IM4F 1QX3A 2NYUA 3FUTA 4RO0A 3TB4A 4AC9A 2IYVA 2G67A 2R5FA 3PYXA 3E7DA 4YMHA 3G2PA 2AMFA 5JMPA 1JJIA 2A1TR 2TMKA 1TU3A 1UFQA 3GW8A 2VDKB 4DDKA 5AVQA 3AQIA 5GONB 3LHDA 3EPJA 1DBPA 3K0BA 4GM1A 5A5DA 2ZRAA 3M6LA 3L1UA 4QFCA 3A32A 1ODSA 2HWWA 3E3AA 4Z54A 1RQRA 4TLMB 4GI7A 4G85A 3EUAA 4JT8A 3ZXUB 5C8XA 2WNHA 5J2TB 5IVKA 1N7GA 2V4MA 1CVIA 4TVSA 4DSOA 3VPGA 3DMHA 3R7BA 4HVCA 2R8EA 1PL8A 5K99A 3NOQA 1H1LB 4LGVA 3BE8A 3SF8B 3Q88A 3NIGB 4EABA 4AB1A 4HZUA 1NLMA 1QJ4A 4POAA 1UEIA 4P81A 2A9PA 2HREA 3PHLA 4UTOA 5KHAA 3OT1B 2RE8A 4KNVA 4INOA 3DV0A 4M38A 4RYDA 4EHKA 3T5CA 1WU7A 1F6BA 5G4LA 3HNPA 3UN1A 5LL6P 2SKEA 2Y0EA 1E79D 3GZTB 2FPIA 4ND2A 4R0VA 5G0UA 2IUUA 3A7DA 4ZI7B 2O23A 2J5BA 5CVUA 1MZVA 4HQ6A 4ACAA 1YQEA 4I1OA 2HADA 4MP6A 5DYTA 3UPTA 1T2UA 2Y9PB 3G02A 3LPMA 4XLLA 5E6UB 4OJYA 1ZJWA 3WK7A 1BWSA 2W48A 4EFKA 1FLNA 3E27A 2Z6UA 4FWIB 2ZI5A 1CF4A 4HVTA 2C3PA 2O1XA 4OHPA 4CL0A 4QJBA 1TT7A 2QTNA 3E9EA 2CKMA 4KVGA 5A05A 3SSMA 5AHWA 1EQUA 3KZKA 1K63A 1E0JA 1LQ2A 2A78A 2Z2XA 2IEBA 1MABB 1PR4A 2ZKLA 4WDRA 5MF6A 1D2HA 1JH8A 1I51A 2ZVPX 3HPQA 3GCXA 4D9JA 1PVVA 3USZA 4WERA 3EG9A 1BKDR 1BXGA 1W581 3UT5A 1W85A 4HEA1 4F71A 2FSGA 2HIGA 1NAHA 5K3EA 3ZEAA 4YTEA 1A9SA 5FIUA 1E2IA 5FTNA 3UG7A 4BO2A 4CUZA 3GLIA 1KR5A 2QZZA 1Y8AA 4IDQA 1AE1A 1JVSA 2A2ZA 2VUIB 3EAFA 4C05A 1WA5A 1G3RA 2IIPA 2Y1FA 3FDFA 2IF0A 4QSHA 4MRRA 3MHTA 3L84A 5BWNA 2KLBA 5IASA 1XZAA 4HK4A 2ZAOA 2G9RA 5FI5A 4BFTA 4EUSA 2RCYA 1UWLA 3ZGVA 2DCMA 2ECQA 4FCVA 3B78A 3IOYA 2X8JB 3LVBA 4I9HA 2BBOA 4Q7MB 1P1IA 1YB5A 2AJBA 3DAYA 3L8DA 5F76A 1FS6A 1JQLB 1AM4D 2QPOA 1KDVA 3BDVA 3NTVA 3NZEA 4PYIA 2ORVA 3IT3A 3QUSA 3NEYA 3N07A 3FMVA 4X92A 1VG0B 1ULHA 3K8YA 3TI7A 3W04A 3ERCA 3CBGA 4DA6A 5DDIP 2ZVDA 1DAEA 1HE8B 4DJFC 2ZDHA 3NV9A 1F14A 3NONA 4EENA 5SY6A 1HFEL 1D6MA 1I24A 3MT0A 4JQOA 5A4IS 2WPDA 3WJ7A 1VLVA 2XDYA 2H18A 2QGNA 4G0YA 5C8YF 5FOXA 2PUTA 2QG4A 2J9FB 2XPCA 3NJRA 3WK6A 2ZM5A 4K9QA 2DFDA 1PG5A 1FQWA 4R4JA 4W5WA 5EHGA 3SGLA 1KTIA 2XHEA 4YJKA 3VZPA 1OXSC 2XA2A 4Q4CA 4NYMR 3A04A 3H1EA 3IQEA 2YDXA 3LP8A 3NYWA 4KQMA 3VR5H 4HLUA 4AX8A 2Y77A 5A4AA 5BVHB 3MUFA 3RS9A 1T8TA 2Q1UA 1RVDA 2WC1A 7GPBA 2HRRA 2OXEA 2OD9A 1DJPA 1FUKA 2A5LA 3OIYA 4FD2A 4J91A 4Q3KA 5J59A 4IF6A 2GM4A 1U90A 2JLCA 3IUSA 4J16C 3VR4H 3U26A 4N01A 5GZ6A 3ZGYA 1IBKB 2GD1O 4HLQB 5ECYA 4AUMA 4CKWB 4IQ0A 3G82C 5KSZA 4B3CA 2Q49A 5J4VA 1Y0BA 1YB7A 1J97A 4I5GA 4PQYA 1JL3A 1GZ5A 2GHQA 2VDUE 4KN5A 4I55B 3KSUA 4GLBA 1CUZA 1N2CB 3P5SA 1YS2X 1XLWA 1KO8A 4KK3A 1E2UA 4D3FA 3O93A 3ZGNA 2VA9A 1DXYA 2HRZA 3KT0A 1K6IA 1S2OA 1P17A 2XGOA 4J4BA 3UHPA 3LNTA 4JBHA 4KAFA 1W4ZA 4LCJA 3UMVA 1NFFA 1E5QA 2I4MA 4B82A 5CITA 1Z4IA 1CQZA 4LJ4A 3H75A 3L1VA 4JEUA 3BG5A 1Q0UA 1I4WA 4WOJA 3O0TA 3NVDA 4FS3A 4XB6B 4XB1A 2XDWA 5FPHA 4E46A 4EKIA 4A1FA 3ZBTA 2W4IA 3AZQA 1YI8A 4W5NA 5DRTA 3SP1A 2EYQA 3M4NA 1Y7PA 2X1VA 1GUBA 2YV3A 4HF7A 3DXXA 3H5RA 3H5OA 1ZH6A 1BDBA 5JVDF 2PCLA 1QHEA 4C3UA 1XRPA 3BOSA 1JHXA 4RHYA 1YTUA 3FNRA 1WSAA 1OFIA 2EZUA 2OSBA 1A9OA 3N8IA 1C1YA 3NWBA 3L7BA 1ZOLA 2JRCA 1FYEA 3P2YA 4O2LA 1XLTA 1GJRA 2G88A 4O4LB 1P81A 3OTGA 4WESA 3TZLA 2ZE6A 4DLVA 4JLDA 2V6BA 2EW8A 4JUAA 2O3SA 3HDVA 1ZUNA 2W2VA 3BE5A 4XDHA 1LZLA 5JDCC 5CDUA 3SZGA 3ZUPA 3Q8LA 4MVJA 1XZBA 1D6SA 1BH6A 1IHOA 1K8YB 1ORWA 1EFPB 1TIKA 1XXHB 3FIUA 3GGJA 3HFSA 5FQOA 1RHMA 3P7MA 3ZCVA 4F9GA 2GA8A 4RLHA 1U2EA 1AF7A 1OGJA 2WP8J 3GFVA 1Y6RA 3ADPA 3BORA 5KTPA 2EZ9A 5BPFA 3VHQA 1MEEA 3FDIA 2NXJA 1Y3FE 4QYMA 2H4WA 1OR8A 4DA4A 1HXHA 1M3SA 2FOIA 5F52A 2FLKA 2BONA 2QZPA 2VUSA 4GWLA 4PAQA 4P8RA 1Q3HA 2OWDA 1A3CA 4KITB 3CSSA 4CXMA 1T4GA 3EDMA 2Q3FA 3F8TA 4M8LA 5T8KA 3T3GA 4DQXA 5COQA 2EJVA 4XYGA 3AETA 3FTNA 3MGGA 4TTAA 1W87A 4W8GA 4XIJA 1YZVA 1Q1GA 3NXSA 2E82A 2I2AA 5DCUA 3V8NA 3SQNA 1E2KA 1D2NA 2WKWA 4ZQGA 3EZ7A 4XIIA 4HNGA 4E5YA 4LDNA 5ESWA 1GPUA 1VG9B 4BUCA 3GLGA 2CFCA 1CUYA 2R8PA 2JGDA 2UZIR 1NTRA 3FRJA 4CLRA 2E37A 4MEJA 3H87A 4IGAA 4CU2A 4HGQA 3AFHA 5BMVA 3FVTA 4MWBA 1UC9A 4J7UA 4J9VA 1O95A 2OOSA 3ES9A 2H2DA 2EAUA 3MINA 1NM5C 5H3HA 3WGMA 3WSWA 2M6SA 2EZ8A 5K0ZA 3LGAA 2Z2JA 4FFSA 1N36B 1QLWA 1D4FA 1Z73A 2GCOA 3S7TA 2FK8A 4KPFC 2QRVB 3SYRA 3F74A 4D4MA 3GXBA 4QTXA 5KDDA 2ZZMA 2M2IA 3GUHA 3Q3IA 4G84A 1TPYA 1MB0A 2IEAA 1FQOA 1URPA 2X42A 4MYCA 4YCSA 3FAKA 4M9RA 1TZKA 3C7KA 5AHXA 5HFJA 2XZDA 5IKOA 2OQ2A 3V46A 2WJWA 4NBVA 3OT5A 1ZO8A 3GL9A 1W5AA 3U3OA 3RV3A 1B0PA 1CR6A 4EPRA 2GZSA 2P9BA 4B74A 1CJUC 2X1LA 4NFYA 2WQZA 3NGLA 4HMOA 5CH5A 1R8SA 5J9FA 3W05A 4D74A 4R16A 1D4AA 1JI3A 3M6WA 1DLIA 4RA6A 4BNZA 4EI2A 3W5DA 2PAAA 3HJCA 2BH2A 4QATA 3ENQA 3ZIAD 1H05A 1TYCA 1ZJ4A 2LV8A 2VO1A 4WI1A 3U4HA 2BFCA 1YCGA 2LDXA 4MB6A 4XVRA 1NVUQ 4O6VA 1VMEA 1A77A 1MNQA 5MN6A 4R0NA 4MXDA 3MG9A 4TLCA 1NXTA 2QJOA 3GRAA 4MRNA 4RQUA 2VHVA 5BUZA 1T4BA 3U3DA 3WWPA 1TUBB 1WZIA 1XA0A 4BASA 2Z6AA 3FCEA 3GY0A 3KLMX 3OZIA 5I47A 1NVMB 1ULSA 3T9DA 3EZNA 4YAWA 1TM5E 1O96A 4MS4B 4KXFB 2R8RA 5DBHX 6REQA 4JROA 3FCAA 1O0BA 1RWPA 1V5WA 1OX6A 2Z2ZA 5CH3A 4RACA 1LDYA 4FX5A 3KJEA 5AH0A 3UICA 3ESDA 4AQDA 1KTVA 4EQ6A 1A9XA 2IOYA 2PX8A 4U2BA 1DAKA 2VHYA 5KCZA 4C0SA 1Z2OX 2XNHA 3CGWA 1TMOA 1LC3A 1T15A 5BN3A 5FPKA 2FZEA 5BUSA 1XDGA 1CFZA 1ISMA 1NQTA 3JR3A 2D3TA 1CWUA 3A1SA 3A4YA 3DT8A 4KXWA 4XJXA 1A4UA 1V8PA 2HFJA 2HLDD 1RTKA 2HZBA 2W5UA 2CXUA 2ZIXA 3JASA 2V45A 3AHIA 3QJGA 4FHZA 4UNRA 3I8XA 2D74A 4LY9A 4Q93A 4ZVQA 2IOFA 5WRFA 1QKKA 2HPAA 3LCVB 4QTZA 4EW3A 2IEIA 3KJFA 3AEXA 4AECA 3AOEC 5EUBA 4O4HF 5G3ZA 1T0PA 4X64B 4PYJA 2FE4A 2PH3A 2VDPB 2OILA 5AKXA 1QRDA 4CPDA 3T9AA 2R9VA 3RLIA 1R16A 1M6NA 3N0RA 2WLSA 1NBEA 2WD7B 5CJPA 2XD4A 2G5GX 3O31A 1OWNA 1M2GA 1GY8A 3WZMA 4R71A 5L40A 4G24A 3LZDA 1FUIA 1R7RA 3ENVA 5GMOA 3EARA 4K6FA 4X1YA 2R85A 4NPHA 3ABOB 4GOKA 2XH8A 4IZ6A 4BFLA 1NPTO 1TCCA 1RT9A 2G9NA 3NH6A 1OIWA 3OCJA 3OPQA 3JQQA 3UTCA 2VNKA 5GGYA 4LMRA 3ZJTA 2CV1A 1Q1EA 2W2TA 3F5FA 5DOVA 1KARA 3EEIA 4DLZA 2OHGA 1P7ZA 4BLUA 5A2GA 5EKTA 3PG5A 2OCDA 2H4XA 4JEMA 1O5OA 1VI6A 2W2KB 3NT2A 1M5RA 5E1MA 3DW3X 1Y6GA 2VXYA 1SBIA 4Z2YA 4TXMA 1EVIA 3X2SA 4OB7A 1WS6A 3Q3VA 4M9XA 4TV9B 5CVDA 1S7GA 3B7GA 5ICGA 2Q4OA 2F1RA 3EEYA 4FLFA 4BEBA 1E79A 1VKNA 2PFKA 4NZNA 4CI0B 5D1NA 3RSQA 1MAWA 2FW8A 2C9BA 2YJ6A 4DNPA 4F93B 1Y48E 3PSHA 4HDKB 5AKIA 4RKRA 4BKMA 3GLFA 1VPDA 3EWNA 4G0VA 3D4BA 1X9HA 3FVQA 4OI4A 1TGVA 4CG1A 2OD7A 5BQOA 3TNYA 2J6BA 3DEZA 4TS3A 4BZZA 4GPD1 1KMHB 2LKDA 3B1YA 4C9BA 2O54A 2BELA 3U7QB 1G7RA 1GZHB 1Q57A 1K7CA 2GTHA 1T6BY 2YXPX 3DTNA 3FYUB 3JQFA 3R7AA 3SBDA 4QJIA 3WG9A 1SB8A 1LPNA 2OYRA 5KVQA 5EUMA 5JANA 5KQGA 1IQRA 4MTCA 3MYRA 3I61A 3IAXA 3FMGA 4ZIRB 3GLFB 1HDYA 2X2PA 4FKMA 1JG3A 1EESA 3JTMA 2JJYA 1JRLA 2IHKA 3C0KA 1R6TA 3M6UA 1P0FA 5LM3A 2GZ1A 5JSKA 3V8BA 3OESA 4L8YA 3M6AA 1W9MA 4D8YA 2W93A 2WM9B 3PICA 2ODWA 1VJ0A 2OZVA 3VMFA 2X40A 4UM5A 1V1RA 4OJTA 3QBJA 5I45A 4MVJG 3IUBA 2QG6A 1IC6A 1KU6A 2JH3A 1XA4A 4XA8A 5G0SA 4ZC8A 2BCEA 1A1VA 3V8QA 4B75A 2E4ZA 3OQHA 3S40A 3U3MA 2XMQA 5BY2A 1HLPA 1OXXK 3ZVRA 4KIFA 3TUIC 1QS0B 3D3QA 1XCMA 1V6AA 2OGWA 2VHCA 1ODJA 3JAWB 3LQRA 4CDGA 2YHIA 5L51A 3DLTA 5JBNA 2HF7A 1XAHA 3RS2A 1IE3A 3B53X 4GT1A 4DG9A 5LZ5A 2ZXEA 3VPHA 3O75A 2AFHE 2DY1A 2POCA 1VE7A 1RFLA 1ZN7A 2ZT5A 4QDXA 1MC1A 1UDBA 3L0BA 5KWIA 1V6SA 2IIBA 3N2ZB 4HXYA 4Q9AA 1RXYA 4QLOA 1B6GA 1FP7A 2P9JA 3FYDA 4N7MA 5ERGB 1FNBA 3FPSA 2O0LA 4Z7JA 4IFTA 2QTAA 3SHQA 2ZQYA 4WX2B 1RRPA 3AESB 1MOQA 1OXVA 2QD2A 4J2OA 1DL5A 4KO1S 2WIFA 3CURA 3PUKA 1DXHA 1K3UB 5I7HA 4QYWA 1ZH8A 1ZXBA 2I03A 5CFRA 4OJKA 4XOIA 4PPNA 4O8ZA 4O25A 2R8BA 3ACBA 3DMFA 2BFPA 3O8LA 1PTJA 4PYKA 4DLKA 4URZR 2CCKA 4HAYA 3GFTA 3K05A 1R00A 5IDYA 1GRRA 3R6LA 5M34A 1I32A 5H8WA 3TW6A 3QW4B 4RPKA 3W1EA 2JGRA 3LQKA 1YRWA 3E5HA 5EESA 3F4KA 1DV2A 5FBHA 3Q3HA 5FB3A 3HVUA 3KJXA 1TVKB 1W73A 3GJ5A 4CIAA 1NRXA 1KI9A 2G3YA 1A9YA 5IKEA 4YRPA 2PX4A 1N7IA 1D0IA 4ZO7A 1Z7WA 1V8DA 3RVPA 3G0CA 5F98A 1VHQA 3PUXA 1WUKS 2RBGA 1EI9A 4YJ3A 2WDPA 2ZBDA 3NBXX 5HILA 3IAHA 4P34A 5BSVA 5B4TA 1CYEA 3GQVA 3HCOA 4PX5A 3ITKA 3QIAA 4KN6A 1R4NA 5EZYA 5JIBA 3EBPA 4P2GA 5D2CA 3SSOA 4ZOLA 3V6MA 3PC6A 4DPMA 4QOJA 4D6XA 1W2GA 4AO7A 3K5WA 4GVPA 2NVUB 3ND8A 4QTYA 5E2BA 4ID3A 1C3VA 3KFLA 3PNBA 5BYKA 2IK8A 4NU5A 1PZHA 2HUNA 4HTFB 4YMWA 4EZEA 1PFVA 4FDLA 1XPUA 4JB2A 1KYWA 4G8BA 4HAOA 5AQ1A 5DM70 2C82A 1XNGA 3WGGA 1TC1A 2MR5A 2PS0A 1RXVA 1EVKA 4NESA 3T9BA 3D6JA 2QZ9A 1AN9A 4N47A 1YVPA 4HFNA 3WLJA 4BIIA 1P1BA 2OOKA 2VH5R 3AW8A 1P75A 1N6IA 4NENA 1JNYA 4AJIA 4B6FA 4QAQA 2R1TA 1U63A 4GG1A 3RUFA 4DJTA 1GEEA 4TMKA 3K70B 4M87A 4I4TB 2NUTB 2HSEA 1EBFA 3KQVA 3UK6A 3M70A 4BNWA 5BV8A 1HOXA 2O6LA 2V5AA 1YDHA 5EIOA 1Z5VA 2ZK7A 3L4SO 2P4EA 3RTGA 3UMMA 3UEOA 3U6KA 2O8FB 3D5TA 1JJBA 3RI3A 1KDTA 1QP7A 5IJAA 5HMMA 2P9EA 5DHQA 1CQPA 5KQSA 3KVYA 3HXOA 1PL0A 4OQPA 1JEEA 4Q1AA 1DWPA 1QOZA 1T0IA 3RC1A 2JGEA 3OZTA 3I9JA 2OHVA 3QVGA 4FS8A 2GXSA 2B9EA 4HQRA 3R7WA 1Z6GA 1MORA 2G6BA 2EGGA 1RC1A 1UANA 2EX4A 3I53A 4DEXA 4TWIA 3W2EA 1G17A 1Q12A 1P31A 2OB1A 3EGEA 1HTBA 3K9LA 4KBYA 5JSYA 2OV6A 1ZKDA 5EP2A 1K89A 4YXWD 1P77A 1E4EB 1NDHA 3QPDA 4WN9A 3RRMA 1ZL2A 1Y4ZA 4BAZA 3MHPA 5AJTA 1JR3E 4KXLA 3UAOA 2C8JA 4EJ0A 3FPAA 1E96A 2J8ZA 1ZIOA 5KJ6A 4P53A 1P7PA 2NG1A 3QJ5A 3FF1A 1G21B 4NE2A 1KH3A 3H7AA 5A0VA 4UEJA 5IC5A 5LXTF 4C3OB 3OEHA 2PRSA 4P9NA 4IOJA 4UBJA 3W06A 3W5UA 3KE8A 5HTKA 4DS3A 1NMZA 1V8FA 4TMVA 4ENVA 5CAEB 3CRVA 1VCMA 1MGOA 2QT0A 3WMGA 4LMPA 1CRWG 1T3TA 3WX0A 2WF6A 3IVRA 3P45A 1JPUA 2JGNA 1R27A 1XJWA 4NHOA 2DFNA 4XB2A 2GETA 3HXPA 1I6LA 4URYR 3PHIA 3UFXB 3WYAA 5JAPA 2FZ4A 5K4AA 1UPAA 4HYEA 3DE0X 4P83A 4NNJA 2F2TA 1TL7C 2D2VA 3LG2A 2YZGA 2JHGA 4C7KA 1U80A 2EYUA 4PCUA 4RKEA 1XCJA 5B2FA 1GR1A 3ZIAA 4YUVA 3GUYA 2ISCA 3PYLA 2JA2A 1SKMA 1WZ2A 1PLJA 1Z0ZA 3E9NA 1U2DA 3A1UA 4LHXA 1U0NA 4L9RA 4HS9A 4MKIA 4RQAA 5D5HA 3B9RA 5D87A 4DLLA 1HYEA 4QDJA 4ZVTA 1XKTA 3DLAA 2BHTA 2IXTA 2YWRA 1TO2E 3QELB 5DULA 3GOHA 1E9CA 2QIPA 3VHLB 4ZHSA 1GNVA 1ESZA 4J16A 3ZQUA 5JAMA 1PW5A 2O57A 4J4HA 3P2OA 3QQPA 3DKPA 1D4OA 1EWVA 1OBHA 2IUYA 2MMCA 3ND5A 4Y2RA 4EFLA 4EYSA 4F6CA 4FM9A 4IVQA 1SCJA 4UEWA 4J0DA 3VU8A 2JGMA 4MI9A 3MC1A 4YI5A 3RB8A 1I3OA 3ZKAA 2V7TA 4U6QA 2RK3A 5IABA 4RJ2A 4GVXA 4XWOA 4UUPA 2E5WA 2AHOA 1CU1A 3LQFA 4NG5A 4IPTA 1NKSA 2WJPA 5LZ2A 3L7KA 1T91A 1R9GA 4KEAA 1N2EA 2E87A 4LZAA 2CNWD 3HDTA 4EY6A 2BRUA 3V7FA 1WV0A 4O2BF 3ZLUA 1LH0A 2YZKA 4C0WA 2NZWA 4MQMA 1XXLA 3S1AB 2C42A 2PYIA 1AD2A 4HUQB 4JN6B 1BQEA 1IY8A 4A8JA 3R3XA 3EF3A 5KSYA 3E1KA 4J75A 3E3NA 3HS3A 3IDAA 4X6LA 1CSEE 3WY9A 1QDEA 3Q6IA 1TXGA 4J7CA 3HLTA 3IOBA 1K6XA 4ALKA 4BLTA 1TZMA 2P62A 1G19A 2WABA 3DA8A 1E6CA 1E58A 1IUPA 1KRHA 2CXTA 3HBMA 4K6MA 4M86A 5K1ZA 4DJEC 4DDVA 2VSYA 1AZSC 1ZM2A 2R6R1 2W83A 4IUCS 2B98A 2JGJA 4MDYA 2B1RA 1X7WB 3N2KB 4P5DA 2LGJA 2BGNA 2C2HA 2HJVA 5IXSA 2QV7A 3ZCQA 1NU6A 1PD1A 4OJMX 4B3FX 3OIDA 3W77A 1P2UA 3RFXA 5GVSA 1ZKMA 3KOMA 2VNAA 1U8FO 3GMIA 4FNAA 1MBZA 4PIVA 1KSFX 2G0TA 3MCWA 4OMFG 5FUBA 5I7FA 3GARA 2VG8A 1JSCA 4R69A 1JW9B 1IPFA 1OQAA 4MS1B 1LV7A 1JLKA 4ZI2A 3R0QA 1O0SA 2OK7A 3DO6A 3PC2A 1PSZA 2PGDA 1XN4A 1HYGA 2VTKA 4L0DA 5CVEA 2FMKA 4KJZA 5E6RA 5DGDA 1OFUX 3QVTA 2X9GA 5D3MA 9ABPA 4G8DA 2HUPA 3BGIA 2PUCA 3K1TA 4LNHA 2O5EA 1OFVA 1GARA 3ZV7A 1C3OA 3RGWS 5JI2E 1IJFA 2DYKA 4MDEA 1L1RA 2OUIA 1H4VB 5KOHA 4PVDA 2YRFA 2IC5A 5JMOA 5EZSA 3LY8A 4Y67A 3A27A 1Z38A 1Z33A 1QP8A 3OPYA 2RHWA 4JP1A 2OPBA 3C6BA 4DBZA 2UVDA 1JKJB 5AJHA 4Y6QA 1LDBA 2Q4RA 3KK0A 1IXZA 3LPAA 3HM9A 2CVHA 1W1WA 2Z58A 1NM5A 3ROKA 1DX6A 1EP2B 1KYTA 1NP6A 3B5EA 3BA1A 5DHUA 1L7PA 4GAEA 4NECA 3WGKA 4GP7A 5REQB 4F11A 3KTAA 4HTAA 4HNUA 4KQJA 5EG5A 3IT1A 4QBFA 2X15A 4HZGA 1XP8A 2NQTA 1SIBE 1PZMA 1TAQA 1VIDA 1ZNWA 2BC9A 3H2SA 3KFVA 5CHYA 3V2UA 4ENTA 1XDDA 4HAIA 1RRGA 1RXIA 2PV0A 4ENSA 2YZMA 1S2DA 2H48A 3KJGA 5FHRA 2X8LA 1P2VA 1TLLA 1UM8A 4HGNA 3T1NA 5JS6A 3L7IA 4D26A 3GOQA 5GADl 4UE2A 3ZDXB 2QL7A 4C0LA 2F3QA 2V54A 4YO8A 2AOVA 3AF3A 3PYMA 2R48A 1ATIA 3EDYA 3FUWA 5J1SB 2QE6A 3LBHA 1O3YA 1JEJA 4Q7JB 4H1WA 2XYHA 3NHZA 4MHOA 1WDKA 1YJCA 3ETNA 1QWSA 1J49A 4DVGA 3ADKA 1PR6A 2IYTA 2X4DA 2WKRA 4BRUA 4D25A 3FR7A 3LRXA 2RARA 2F3SA 3NGMA 4RTOA 10MHA 4EVSA 1YKGA 4PZAA 4GQAA 4RV4A 2Q1WA 3KHSA 1WLSA 4FYHA 3JW8A 5J5AA 3D2CA 2ATCA 5KNBA 4HNTA 2D1RA 1WUIS 3QV1A 1C1DB 4HKTA 2O07A 5HDBB 3MQ4A 2ZJFA 4CQMD 2GFHA 3H0KA 5AOVA 1UKAA 4E1AA 1NHWA 4WZAB 4ZAYA 1XRRA 3SXPA 5BRJA 3UATA 3D0KA 3TVYA 2HLPA 1SUWA 3CWZA 3H19A 1FNCA 1EPUA 2GJ4A 4UTPA 1TUIA 6NULA 1Y6ZA 3IQZA 2HA4A 2YNMC 2I78A 2VXBA 2ZRLA 4UQPA 1XFDA 4B0PA 1OYWA 2AFIB 2HWKA 2R1VA 5G3YA 3TRFA 3WQHA 5FNZA 2O2YA 2PGAA 4BNLA 2PY6A 3K0HA 3L7AA 1VHTA 4PC6A 2ATVA 1PV4A 5K7SA 5KUTA 1C0IA 4AKSA 1VIVA 3AF2A 2EIHA 3DTVB 3PNMA 2W37A 2D06A 4MA0A 3HLKA 4DCJA 4LJ5A 2PUFA 3N2LA 1FP1D 3VISA 2BBWA 1CDDA 2XUZA 4ECEA 3AOEA 7MHTA 4GS5A 2HPZA 4RX1A 4JT2A 4ARSA 4DAEA 4Z4FA 4F6RB 3LT0A 3RHFA 3JWGA 1YC5A 4L15A 4RGBA 3UXEA 1J9ZA 1PK9A 1OIVA 3FVWA 2W2PA 4TV8F 4Y2XA 5KVCA 1IN4A 3V4FA 3U4MA 3B2EA 4UU1A 1GP2A 3AM4A 5I6DA 2QTBA 4CR6A 4O2AB 3D9QX 4AROA 1QP4A 5I3CA 3MERA 1KERA 1UBMS 1CJVC 2OV2A 1X70A 1KC3A 1M34E 2ID7A 2AN1A 2O7VA 2YKGA 4LHVA 4MGKR 4QRIA 5DIFA 2ZB2A 4R1TA 5D6NA 2PKCA 1KO7A 1P5HA 2RHTA 3CH6A 2NSJA 2WBLC 4LV6A 1KNXA 4Q1FA 4S1WA 2QL5A 1NLZA 3AQ4A 2PXHA 3JVDA 2JB9A 2XY4A 1B8VA 4J0CA 1N5RA 3T0GA 5AW8A 1KI7A 2IYFA 1M6VA 3WFZA 4RTRA 2VJLA 1G60A 3JD1A 4YIKA 3ORFA 3TI9A 3FW1A 1OWOA 4KIWA 1Y7IA 4ZO4A 1ORRA 2WK1A 4BQRA 1J7JA 2RGCA 1LVGA 4TLLB 3RFTA 2PKWA 1K2WA 4BJ1A 1TIPA 1C0PA 2VQFB 5EA2A 2ZYHA 4GDMA 4N6GA 5IUNC 3LSTA 1VRVA 1KA9H 1OZFA 3HP4A 5B7GA 2RGWA 4RV5A 3H9UA 4PICA 1YZGA 1QHGA 3E1GA 2FWJA 2G82A 3IPRA 1ZI6A 5IMSA 3E7PA 1W93A 3F67A 4TKMA 2FW7A 5EWMB 4W6ZA 3E35A 2JI9A 5FUVA 3OD5A 1RBYA 1U99A 2SBTA 4EPYA 3N8GA 3P71T 3OM1A 4M7RA 3CVWA 4UPVA 3M7IA 3A1CA 4L8FA 4A3SA 5CD9A 2ZIFA 5TXGA 3LCRA 1S02A 2AR9A 1P18A 2H8GA 2I29A 5TF4A 4TQUS 5JASA 3ZLJA 4RNDB 3W5IA 3NVKI 4O4JA 4YAFA 4TRNA 3TOXA 4BNDA 3IAS6 4GMFA 4UBOA 1ZAYA 3A6PC 5T4BA 2ZTUA 3IRVA 2ZUDA 4EAAA 1IZ7A 3L0ZA 3A05A 4YXWA 1BJKA 2QWXA 5AESA 5JDIC 5MFZA 3X43A 4QFDA 3OJEA 1PZEA 3P26A 4IHQA 3SC4A 3W5SA 2JLRA 3HADA 4HZUB 3ESRA 1VBMA 2W6CX 3MNFA 3EYWA 2YHUA 3SHFA 4AZ0A 2E2WA 1QIDA 3I83A 1E2EA 1WNTA 3DV0B 3Q8WA 2QRZA 3U16A 2ONZA 3ILVA 4WZZA 5HF6A 2FPIB 2AOUA 1LQUA 2B37A 5JXWA 2HSDA 3GRPA 4BYMA 2QMYA 5J5VA 1P80A 4C0XA 1KDPA 1L5LA 2FLWA 4GC5A 4LOHA 4GE3A 3K0AA 4E13A 5HE9A 2Y0DA 2JHCA 5T7BA 3DOUA 4GLFA 4L8GA 2Y0BA 3OY2A 3T5GA 1EXVA 4CEHA 5IAKA 4RDIA 1JAHA 4YONB 3WIVA 4ARVA 2J32A 2A5FA 3NDPA 1I7PA 5KYUB 3WGHA 3SK0A 3I1FA 3R5XA 2X5NA 5EQTA 4A4DA 1G98A 2VJAA 1P1RA 2BJVA 1IH8A 2PJUA 4QUBA 3C3CA 5A71A 4PAOA 3TLCA 3ADBA 2OHFA 1ZGBA 4LOLA 3M4YA 5CHEA 3ROPA 3HGQA 4ZV4A 2GX6A 3T35A 3T4UA 3I92A 3K8OE 1S96A 2QRHA 3N75A 1IM8A 1SOAA 4PLTA 2YNMD 4G1MB 3EG9B 1Z0UA 1BXGB 1YD7A 4OHVA 4COKA 2M98A 1W85B 1LVHA 1PK8A 3L6UA 1E6EA 3AEZA 4RSRA 4G6ZA 1L8AA 3UJCA 1J5EB 1GN8A 3ML1A 3V8MA 4EKEA 2AA3A 1ZHOA 2D62A 2E4XA 5B58C 3GLIB 2BFFA 4R05A 4QPZA 1E6MA 2B2NA 2JI7A 4HLNA 1GKLA 4X97A 3P96A 3S5UA 3THYA 1EGHA 5JD5A 4Y1RA 3RUCA 4CGZA 1O4VA 3IP9A 1RABA 5C1BA 3L0IB 5TS3A 4JI0B 1F12A 2B20A 3I73A 4HATA 4R9SA 5LQUA 2CNDA 4E2FA 2VT6A 4UHCA 3B70A 5IDVA 1OREA 3KVOA 4ED9A 5FPTA 3WI7A 3EGIA 2VZ0A 3EC1A 4L7VA 3VQTA 1KQ3A 3M33A 3RIGA 1MO4A 3O1JC 1OUMA 2CNWA 2HCBA 3HY3A 4BLWA 1J7KA 3RVQA 3WBKA 5I9MA 1F3OA 1DQNA 1Z75A 2J09A 4H15A 2J3JA 3W3AD 4OGLA 2JKZA 2PG3A 1HG1A 4QWWA 4DY4A 3DNFA 1KMCA 1PGNA 4ZJZA 3IOEA 3A1DA 5DEIA 2XUQA 1WEHA 3SQOA 2FGJA 1RQ7A 2XKAA 3KD2A 3M6VA 2JJ1D 1NBWB 1V8OA 4NDAA 1FTWA 1YIAA 2WIJA 4BYGA 4GZ5A 4GKVA 1SXGA 2IZOA 3N39C 5EHZA 2A84A 3TSCA 1UBOS 2WWTA 3ELWA 5T67A 2IBTA 4N9WA 3R24A 3IH5A 1BTOA 4UD2A 2QW0X 1I4TD 4YCCA 4UUQA 5ICSA 3OBBA 1JLLA 1ZUHA 2P7HA 4J43A 3WRXC 1G4AE 1NULA 1Z83A 4EA7A 2JIRA 2Q45A 5CIWA 3UT0A 2DBZA 1U1FA 3PDCA 4Q19A 5JJLA 1E0AA 3JAKA 1UBUS 2Y27A 2IHJA 3OZ7A 3IPLA 3O91A 3CB2A 3TDMA 4CHTA 1T5HX 1T29A 3HCWA 3LWNA 1T9KA 3CNBA 3C41J 1K9VF 1T9AA 5BMOA 3TTYA 1V43A 3G5TA 2X58A 1ZGAA 2Q9UA 1MJ5A 3GVXA 1PRYA 4IEEA 1YRAA 1DRJA 3I0MA 5CLLA 5LDDC 4X20A 4WFKA 1QQBA 3CR7A 1LSJA 2CT8A 2N3ZA 4PPFA 1KOGA 5JRDS 4EHAA 4X45A 2ZPUA 1GQYA 4C4ZA 1H85A 1XQXA 2XCOA 4FNMA 2EP5A 4K46A 3FNGA 4H08A 5K8JB 2O52A 3BZBA 2GJAA 4ZEVA 3QOFA 3L79A 3M1AA 1XZNA 3E9MA 4DMRA 1HQCA 2IHUA 2IPAB 3OZGA 4L5YA 1KI1A 5K4HA 3RJMA 2WB2A 1X1DA 3R3UA 2IYLD 2PT6A 5G1PA 5B37A 1RKBA 4IILA 1U1IA 4BV3A 4D82A 1VFPA 3NGXA 4G5FA 4KTTE 2IH4A 1JHDA 3HG7A 1VHDA 4LJ6A 5CT5A 3IP8A 1FDVA 1YL5A 2R7LA 4ZEXA 4OFWA 2FSFA 3QUBA 1WXQA 2Y1WA 3I9V6 1RKQA 1YWGO 4GEKA 3LYLA 2B69A 3QPAA 4K3VA 2RGYA 5KTOA 3AWIA 4L3OA 1T2FA 4WESB 1RI5A 1P6UA 3BH6A 4RVHA 5K6RA 3C5HA 3LXUX 4MJ3A 5FHQA 2PUEA 2DQZA 1L5WA 2LCFA 1ZUNB 3N6XA 1LB1B 2O3UA 4JK3A 5K6TA 3TDNA 3C8UA 1NSFA 2F3RA 1KZ9A 2RH5A 4JMLA 4EGSA 1YZHA 1E1YA 1ECLA 1VHJA 5CLFA 2IOFK 3QP9A 3UENA 3USES 3WGNA 2PKRA 3CJTA 3KM0A 4L5BA 4NWIA 3U4AA 5DH9A 1Z9BA 1I7QB 1ISPA 4ZT3A 1CPYA 2O9JA 3BULA 4AF7A 2B94A 3I04A 4WNAA 1SR8A 2N75A 4P82A 4KP7A 1RACA 2CMFA 3OH8A 2GFIA 4C03A 2H54A 1JAYA 2E1RA 3T54A 1HQKA 1ZC4A 4BKRA 1XKXA 2F3PA 1T0BA 1SVKA 2GILA 2ZJ1A 3AETB 2DFKB 3CYFA 3OX2A 4ZMSA 1KZGB 1PP4A 3OA2A 4WFQA 4AIIA 2H07A 3PD1A 4WZ6A 4DV5B 2J45A 3MWFA 3LKVA 2WFZA 4TX1A 1E9SA 5HZHA 3GLGB 3KJNA 4GX5A 1RXSA 3GQBA 4OQXA 2JGDB 4CQMA 2XMCA 1ZOSA 1GO2A 5PGMA 4CLRB 2BLNA 3EA4A 2FUCA 2RGDA 4KW7A 1UK6A 3UVEA 1QIFA 3G2NA 3OCZA 5BP7A 4I66A 4OBEA 3I0NA 5BMVB 4OXQA 4WADA 5G53C 3X1KA 1W5EA 1AB5A 2CLLB 3MINB 3KIPA 2XGSA 1N2SA 2RGAA 3GRUA 3NHLA 2O2EA 1A5ZA 5JAUA 2GCOB 1OYYA 2B8NA 3MMSA 4MMYB 4P3XA 5IYZF 3RH0A 2WUGA 3QFHA 3LGSA 5F9MA 1Z4MA 1GADO 1OAAA 3DHYA 4JT9A 3VOAA 4F84A 2BUAA 2V58A 4MQ5A 1PGJA 3B1XA 2HJGA 1YZYA 2Q07A 1DTEA 1GL6A 1QHFA 3AT1A 5A9TA 4TZTA 1H6DA 1SK8A 2QGZA 2XBUA 2BLLA 4M9CA 3VYVA 1QIMA 2GJ9A 4E08A 1L4KA 5KYUA 5A7HA 5HZGA 1A2QA 4B17A 3V4ZA 4QEZA 1VZ2A 3V1NA 4I1YA 4L3VA 1NA5A 3QE2A 5CXUA 2DJIA 3KXIA 1AHPA 2C5SA 4NU8X 2ST1A 3D0OA 4CCYA 3DAOA 1N1DA 3RADC 2ZSAA 4RA6B 5EAIA 4AU1A 1NVEA 4C43A 4BQFA 1DADA 3OCXA 2O2ZA 1E63A 2FHSA 3RBZA 2C8KA 2BFCB 3RNOA 2R2AA 3KZCA 4XIYA 4YALA 1LDGA 2ES4A 3IMEA 3KWJA 4NULA 5DTEA 3ZN2A 5B30A 5CG1A 3P2JA 1EP1B 3GJZA 3TBFA 4ZCPA 1XQYA 2GEBA 1WMFA 3D7RA 1MX1A 1QLHA 2PLNA 4CWAA 2OCGA 2V1UA 3AG6A 1GM5A 1F2UA 1I0IA 1DUVG 3AU8A 1EWQA 2QMOA 5D7BA 1O96B 3CSDA 4J3JA 6REQB 2H59A 2JATA 3TTXA 1A9XB 1CRQA 1JXOA 4EQ6B 1PHRA 1VQ1A 1CZRA 1HI9A 1A88A 3C6KA 4X6YA 1LF0A 3TOZA 4HYQA 1ZNXA 4DYVA 4X6UA 3H8WA 1G5RA 5EXXA 5J43A 1JV2B 3ZE9A 1DLJA 1JDBC 1VL5A 5BN3B 3DJYA 4IH1A 2QLBA 1S4QA 1DMRA 1QIGA 3BEOA 4GOMD 4JNKA 3WYBA 1FTSA 1DC3A 1DOAA 3LC2O 3Q9SA 4FZ5A 3ANYB 5CVTA 2OECA 2WJIA 2ZIXB 3GVIA 3LLSA 4HQKA 5L3QB 2EBUA 2H0QA 3JASB 4JJ6A 2HJSA 4RD3A 3RHTA 2WSIA 1IZZA 4IIJF 1T8WA 2HA6A 5DU2A 3TQQA 2Y1OA 5L4SA 2ACKA 2UUCB 2I4IA 4D3ZA 5TX7A 2CXXA 2QMHA 2VF8A 4TMYA 4UATA 3AM3A 2G5PA 3QA3E 2WYOA 3B3QA 3T3NA 2Y71A 3PSAA 1PKEA 4RIGA 2FWBA 1JS1X 4HDAA 1DU4A 3LPNA 2BMDA 2XIJA 2FZVA 2GN1A 1FLVA 2CZCA 4UTNA 2O7RA 3T5PA 1VSBA 4WLVA 2OBYA 3IXQA 4X1YB 4D8WA 3SR4A 4IDOA 3SYTA 5D84A 4JJKA 2FCRA 1SC9A 5EKXA 1TCBA 4UHDA 1I14A 2DKOA 2Q4EA 1JG2A 4WEQA 5JRZA 5LNK6 1RHJA 1TIBA 2GM3A 4FYVA 4LZNA 4P32A 3RVLA 1X15A 5F78A 5DO9A 1R6UA 2PDAA 4XR4A 3GIDA 1P7WA 1H2EA 1QSGA 5FWDA 2X22A 4RZIA 3QEAZ 1PG0A 5L6MB 4KLNA 3FTDA 1I3KA 1UKBA 3P0FA 4QTTB 1GNQA 3R9KA 4DADA 1UKVY 2C97A 1YT5A 3L77A 4F97A 4TKLA 2VAWA 1PR5A 3EIXA 4UKDA 4FYKA 5BNFA 4BZXA 1P45A 1ZK0A 3KQPA 4K03A 3S2SA 2FEWB 4KE7A 2YY7A 2HDNB 2AX3A 2QMUA 3OT4A 2V0GA 3DG9A 3OJFA 3MRSA 1WKCA 2JBWA 1RE0A 4B5KA 1DRVA 3PEWA 4PZLA 1UZLA 1R4MA 3PC8A 2ZI7A 3FZEA 1Z7BA 4YCAA 3I2GA 5TQVA 2BMJA 3RAGA 221PA 1ISFA 1KP9A 1RPAA 3RRZA 3SDBA 4FGUA 2ORWA 3EHEA 5EJ6A 1BG6A 3KHKA 2J3HA 4MIOA 4MVXA 3VPXA 2AZXA 3C5EA 3UH0A 2BZSA 4F8EA 3IEVA 1PUXA 5DF1A 2LBPA 4LF5B 5CX1A 1EAYA 2BE9A 3QE3A 3OTHA 1CNMA 4XFDA 4RJTA 5ES4B 5LMUB 3ZY4A 5F9HA 2P4QA 1T1IA 1YQWA 3DZHA 1P2DA 2AJDA 1P9NA 2D2FA 2HSGA 2YBDA 2ZRPA 3U37A 4U2EA 1UC5B 2VF5X 2XB9A 4NE7A 4PC3A 1N78A 1M8PA 2PTGA 2YFYA 1UXGA 3ED5A 3GNLA 1C8VB 3O8DA 4H16A 5GQSA 5BQ3A 4NFSA 2XYQA 1Z7GA 2Z09A 3VH1A 2FX3A 1GPNA 3I6BA 3PC7A 4RW0A 3REQA 2DFPA 4JQYA 3TZCA 2FPSA 4JJ8A 4FKBA 3E18A 1FU8A 4D56A 3L3BA 3D64A 4TZKA 4ZVOA 2QEQA 5HRCA 1NQVA 1N6KA 3OHPA 2A3RA 4RH1A 4LZPA 1V1RB 3GFSA 1YR7A 4LRWA 5KTMA 1T6YA 2CZQA 2AHRA 2MYTA 3HSYA 2RI0A 2Q29A 4EARA 1YRLA 3ENZA 5IBCA 3MOIA 3PT9A 1SQSA 3E9CA 1WUJS 3LA6A 3IBCA 1M6HA 4O1HA 2ATEA 5HGJA 1IIBA 4ZT4A 2BZGA 1UC4B 3SD7A 2L19A 1HTTA 3KB8A 2FAXA 3TXXA 3ZE1B 3KNZA 3P4UA 4YRGA 4Q4AA 1YDFA 4AJKA 2HBYA 4HP8A 4D4JA 3UK1A 1G55A 4HVAA 5T41A 5L7TA 4Z9YA 5BOSA 1H0RA 1ZLXA 3GLUA 3KZ1E 1Z8HA 3FGPA 1XF9A 3G1WA 4LC0A 4PLZA 5AK5A 4EO7A 1NAIA 1ISJA 4XYEA 4ZD6A 4KQIA 3ZWDA 2JJ1A 2QN9A 1PWEA 1K7YA 2GPTA 1VPWA 1TA9A 2OCPA 1G2QA 1SN7A 2DQKA 2ONJA 3ZNQA 5AW7A 1UKEA 2AQ8A 4AMVA 1Z0SA 3ANMA 3E9DA 1CNEA 4BP1A 1XEXB 4BO5A 1CJTC 4B7AA 2LIPA 2VRBA 2ZRDA 1H2YA 2VQSA 3GEEA 3R8XA 5LOVF 1AT1A 3T3OA 2PRKA 3IO5A 1VCIA 4Y2YA 4H7EA 3EXHB 2X4IA 4RETA 3ZZ1A 1R5JA 1H8HD 1R0CA 4R68A 1UP4A 1AS2A 1BKYA 3H9QA 1J9EA 3SLGA 4ES6A 2JLYA 4N6OA 3T7CA 4V0MA 5J1TB 2GO7A 3AIKA 2Y92A 2PD4A 2R47A 3OAAD 4YP7A 4ACBA 5HS6A 1J2UA 1NKTA 2O8VA 1P72A 4W1SA 1PV2A 3OTOB 3URMA 3O8BA 1DJQA 2GOYA 3GJYA 1LW7A 4XWKA 1PT7A 3GLHA 3VZSA 4Y2SA 1AA9A 4LAFA 4YJ3B 2B8WA 3I6IA 2XCUA 3NR2A 4YRBA 2EQAA 4YDSA 4YRRA 4F4HA 5LCXA 3M49A 5D01A 1YFJA 2CZGA 5EZYB 5E0OA 1R4NB 1X80A 3A3PA 1KQOA 4ZOLB 5AO9A 4X3PA 4LTMA 2E5LB 4DV3B 1CG6A 1KAQA 3WK5A 5JDIA 1BWQA 2XDQA 2WJ4A 2B36A 3E70C 4LYFA 3AI1A 1QAOA 2FTKE 3NC1C 3V9AA 4A8TA 3CW8X 1X1EA 3NTXA 1G3QA 1V11A 3WKAA 4B40A 1Q0PA 4KPEC 1E4YA 1P9OA 1ESEA 1RHUA 3TVDA 3V6LA 4ICIA 1GUYA 1MB9A 3NHMA 3VOBA 2VJPA 4NYJR 2I3BA 2Q8NA 3ZWVA 5JSHA 5AW0A 1Q0SA 3MILA 5MGNA 5EKDA 4TT3D 5EQJB 3U4DA 3UB3A 1UMDA 3I3SR 4ZCLA 5DYGA 5ICEA 1QV9A 4DBLC 2VTBB 1PT5A 3AC0A 3A4MA 2Y68A 4NENB 2PZLA 4X8HA 3WGIA 2XHZA 2W70A 1RXWA 4E3ZA 2R1TB 4JYMA 4WZBA 1GQFA 1Z2CA 2G77B 1RYHA 1EFHA 2ZTHA 4F4FA 5CG2A 4Q9DA 2VI5A 5DM2A 5FPPA 2BEWA 3HJAA 3I2YX 4HQNA 3LBNA 3SC6A 3H6KA 3ZQ4A 4EVQA 1A2OA 4BE7B 4R8VA 4R2IA 1MXFA 3KQMA 3PC4A 1NJ8A 3I30X 1QO7A 1RAIA 4BQOA 3SE0A 3CNEA 3CCBA 1K27A 2GYVA 4KN8A 1XL1A 2C2MA 5HJ7A 2VF4X 3TIIA 2RKBA 3G88A 4LJ8A 1PFGA 1SA0A 3VYUB 5A0TA 3E9YA 1XB2A 4K1XA 1P33A 2YUIA 4PQGA 4BZQA 3PXAA 1UWCA 3QVGB 4WW0A 3S8EA 3R7WB 2MSLA 4KPUA 5IT5A 3CX3A 3K2BA 1PEDA 3SBXA 3VSEA 5CK5A 5JSQA 1JYSA 3GCDA 4Y2GA 1GUDA 3R5SA 4CG2A 4MDFA 4IGKA 3WGTA 4NATA 1KYYA 3DC2A 4UEOA 4CQJA 4YT8A 1W4LA 2ID8A 5EXSA 5HP4A 3P9XA 3BM5A 4WN9B 2AW3A 4R6WA 4XFKA 4DC9A 2BJWA 4AMZA 3E61A 5CFOA 4ODIA 4L5CA 4AJJA 4ZXPA 4RHEA 5H7XA 2QM7A 2X13A 3IODA 1A50B 2YXBA 1XZPA 5K8TA 3NI2A 4A6EA 4X41A 5GOZA 4NQRA 4QBKA 2IOHA 3UK7A 1XLVA 1BS2A 2XUAA 3HLYA 5CTJA 2J3LA 3V32A 1U3GA 5C5DA 1ZD8A 3MFYA 3TH5A 1E9FA 1KKMA 1O7JA 1W0KA 4XUEA 1YUMA 4K6KA 2PMFA 4LNAA 3Q4GA 3C48A 1XAJA 1JU3A 3IR5A 4H3VA 3EFBA 2EF0A 2AE1A 2GLTA 1B2RA 1VIAA 2QZ4A 3OE1A 3EBLA 5L3RA 2DP4E 1U11A 4TSFA 5E4TA 4RMHA 3EFOA 5H1YA 1NX9A 1ONSA 1SCBA 3O3CA 3CC8A 1KIMA 1U6JA 5C31A 3UY4A 5CB4A 2HCFA 2VYND 2B35A 2H92A 3T3HA 3WQRA 4V1CA 3I5XA 3IKVA 1HNWB 5TJ9A 2CJFA 5BVGA 5A3RA 1QHNA 3HGTA 4MIEA 3AKEA 3MS2A 3WLQA 3WRXA 1VL6A 3A2LA 3FMFA 4B6QA 2IHBA 2J3DA 2HHAA 1E7WA 4A73A 5IF3A 3ZVNA 1ILWA 3GUVA 2DPMA 4FN4A 1DAGA 1EJ6A 2VWGA 1KC1A 1N2BA 3WV5A 1KJ9A 2BISA 5CRIA 3LX5A 2ALJA 4OPMA 2AV6A 1Y89A 4DF3A 4F72A 1CQWA 1ADCA 2JARA 3K8QA 1XTSA 4L76A 4EYEA 1XJCA 1U5CA 3H5VA 1NR7A 2BMVA 3LX8A 1B23P 4BV2A 1WZNA 4EH1A 2OFPA 2OXCA 3M0EA 4HZIA 2GXQA 4LF6B 3ICQB 2EHJA 2Q6IA 1S7CA 3A8TA 2QN3A 4MROA 4PR0A 4ONEA 1NW3A 3FFBA 3AGPA 2Q3DA 4JR0A 3EDOA 2IYEA 2AI3A 2GEJA 2HA3A 3D7LA 2GARA 3H8JA 5H02A 3RS5A 3BERA 1ZBDA 2AG1A 1EINA 1SCDA 2KI5A 3A6JA 2UUAB 2R1ZA 2C3MA 2PEZA 4D4KA 4GMDA 5D7NA 4A8JB 4LF8B 2ZRIA 3VSBA 3L41A 2IXEA 3T4EA 3LHKA 4MKHA 5F4BA 4LISA 1W35A 2ZR9A 3H2HA 5EJAA 4A8HA 1GV1A 3NDJA 4JIMA 4PINA 4DKJA 1ZH2A 5AICA 4JKYA 2H17A 3U1VA 1HT0A 3RANA 4MUGA 1MAAA 4OD0A 3KQQA 1OAOC 1TB4A 3U09A 1DJOA 3G0OA 5J3JA 4E4YA 1ZSNA 1L7MA 2HMAA 5GP1A 3IHLA 1AK1A 1ZI9A 3V4OA 1RWNA 1XQ1A 1IEQA 1PJ8A 1XN1A 4Y1FA 2I3GA 4Z86A 3KKMA 3HB0A 5D8DA 1I7SB 2C1ZA 4QFMA 4I8XA 4FFRA 4IW3B 3SIXA 4F4JA 2ZROA 2IZ6A 3PDHA 4DWJA 1GA4A 1TJNA 4YO7A 1DO2A 2JH8A 2LZ0A 2O2GA 3AF0A 2EBFX 1QG4A 4FFOA 1NOKA 3LP6A 4GBGA 4H35A 5E6RB 7AT1A 1NOJA 4BNJA 4H59A 2COEA 3IS3A 3RC7A 3TAXA 4DAOA 3O82A 1YU9A 2P65A 5D3MB 2QSUA 4ZOCA 5A62A 2GDJA 4OHXA 2VRNA 1DX4A 2P8SA 2Q0SA 4R81A 5KINB 1NASA 2HA0A 1LF5A 1QIJA 1YZTA 5KOHB 5AFSA 2EARA 3VDQA 3AXSA 4FPXA 2PM8A 2QW1A 4HWSA 4NK5A 3MWJA 1VJ1A 4G0PA 4Y0AA 4D0NA 1OIXA 3DCIA 3OPYB 1ONBA 2GN2A 2RFLA 4W6QA 3ABIA 4NBKA 1XTZA 4DV2B 4JP3A 1FXSA 4GXNA 1SD2A 2PVPA 3F8SA 3SFZA 4FSDA 4FOLA 2JLSA 5HZKA 3U1BA 4ZCTA 4MITA 3VA7A 2N46A 5HKKA 3KTAB 2V96A 3T4PA 2Z83A 4CL3A 4B3DA 2YIVX 4BVKA 1EE9A 1SIOA 4R1SA 1XTPA 1L7RA 1DIBA 2GWRA 3PQ6A 2P9TA 3C6MA 5JFTA 3CZCA 1G3MA 3HJGA 1M2HA 3NETA 4NCIA 5DXAA 4DR7B 3OCVA 1B8UA 4IYJA 4QHSA 3MJRA 3T0IA 4Y18A 1GHTA 4L72A 3QFTA 3DL0A 3H9BA 2B6NA 1CZLA 2P2SA 2W9XA 1QHYA 5JNSA 4J3NA 1BZYA 3AI2A 2XDAA 2CVOA 1BVYF 2WU4A 3L40A 2F90A 3QI7A 3HCRA 4RE6A 4ND6A 1N3IA 1V4NA 4D42A 2R4UA 2RK6A 4LKRA 4NH0A 1YDGA 4JL5A 3LS2A 4D0RA 3O7WA 1E7YA 1FIUA 4CM3A 4CV3A 4II2A 1C4WA 2FNAA 2JLXA 5EZ5A 5BYBA 3A2MA 3AUFA 3ZNNA 3JVUA 4FDMA 4CTMA 2FETA 5JOQA 3K96A 4GUAA 4MKGA 5DNAA 4IG4A 1N0IA 2BR5A 4R9UC 3WGZA 4JZKA 3JY6A 1EFRD 1LPPA 3HA5A 4AJHA 4ER5A 2XVXA 5FWYA 4MV5A 1OLSA 1U7OA 1QFXA 3KZVA 4CDMA 2J3MA 2BM8A 4WXMA 2JFYA 1DQSA 1N5DA 2GAAA 5G0WA 3A26A 2PPVA 1P1CA 3AI3A 4BPBA 3ULKA 1EA5A 1UINA 1RR6A 2LVBA 4TS1A 2Z2YA 3D6TB 4DQLA 2R1VB 4QGSA 2D54A 2Z5GA 5JNWA 1RPTA 1HFJA 4LDQA 5IKPA 1PJ4A 2XRZA 4D97A 1ZCZA 2LW7A 1DAFA 4RSHA 5CDSA 5LD2C 1WSWA 4KI7A 1UOEA 2BGMA 4RF2A 2F1JA 2JLVA 2YVAA 3MWLA 1RPJA 3NYQA 4UVIA 5BSHA 4A82A 3OG9A 1GTVA 1GGFA 1IHUA 1W34A 3I58A 1I5RA 3NNDA 5EPEA 1C9KA 4LYGA 1OW3B 4CU5A 1JGTA 2PMEA 2DBYA 1K08A 1BGVA 2XYPA 4GI3A 3EDRA 3EIOA 1CUHA 2J87A 3CMMA 4QG7A 3BFKA 4FBGA 3EYAA 2ZVQX 1J0DA 5F35A 4Q3LA 4L5IA 1LSOA 3LQ4A 3TZBA 2QY6A 1FQJA 2IYNA 2PU7A 3CPEA 3FY4A 1CR2A 5MGBA 2GEKA 3H1TA 3I6QA 4GYYA 3PNKA 3BXEA 1R6XA 1DEKA 4UNQA 3UKDA 3GDGA 3WGYA 3REFA 2DETA 2IHTA 2NZVG 3EF0A 2WINI 4F9FA 1ZN2A 3TE7A 4DLYA 1HG0A 4HNVA 2UYHA 5BSMA 1ACJA 3CH7A 3OQBA 4C4AA 3GGDA 1N8KA 1WCWA 2AWOA 3ZBQA 3UJ6A 2GLXA 3NEPX 3W8EA 1J21A 1DO8A 4DUYB 4LY6A 3BH7A 1M6VB 3RT7A 1J07A 1BD3A 2Y2UA 3AB3A 4JBNA 5CBKA 1QG0A 1SU6A 4JSRA 4TWZA 3E2PA 3QWHA 4J0GA 4Q3AA 5EMHA 2AKAB 3OCUA 4H7DA 4S1NA 2ZI9A 4UM9D 3ZE0B 1RC8A 3M5PA 4ZVRA 1S6YA 3LQQA 4PSAA 3Q9NA 2B7BA 1KOFA 2VDWA 5T5QA 2BP7A 4Q1CA 1LLCA 5JR3A 1L5FA 3HDJA 4P6VF 1EZ4A 3DBHA 3X44A 4IDDA 2XCSB 1ZMBA 3G49A 1P2TA 2R5WA 2JIZA 1I0LA 3ETCA 3IMFA 4OXXA 2BKLA 4QYIA 4RJIA 2DAPA 3KKQA 4R7ZA 4TTSA 1N8SA 4EMUA 5EJMA 4Q48A 5LB4A 5AKYA 1UWVA 1OH7A 4EZBA 5GJCA 1DIOB 2OV4A 1JLHA 3DKIA 9MHTA 2B78A 2C94A 1YI0A 2D8MA 3CNLA 3P27A 3Q9UA 5K5EA 4G0XA 3ZDFA 3EZ9A 3REOA 2EBWA 2OORA 4EPXA 2G80A 3WLRA 3H3XA 2VP9A 4R31A 3DTTA 2FXIA 4JVNA 4O4JB 3RJ9A 4BNDB 1XJ0A 1RZUA 4ZALA 3RJZA 1TAHA 4YRFA 4FVTA 1CV2A 2Z98A 3CF0A 1HK7A 4BX8A 3RVJA 1J1UA 3DW1X 3ORYA 4RVGA 1DELA 1XGKA 3MUOA 1GNTA 1LZKA 1R0KA 1ZHHA 5EIAA 3H8SA 2Z43A 4MQ6A 4GQIA 3ONWA 3BRQA 3QLJA 3U44A 1R1DA 1UOPA 3IEUA 2FSUA 1P7YA 3GVCA 4PTZA 3JR7A 2VUUA 4AZ0B 1D4ZA 1PJ3A 3ORHA 3CS3A 2UZ1A 4XGRA 1CQJA 1DC6A 1ECBA 2AOUB 1LV8A 1HE4A 4JEIA 4X66B 5JHGB 1I4OA 4CZ2A 4GX2A 1MR3F 3CLUC 3UGKA 1Z0FA 2IPOA 2QSZA 4GW3A 4G5XA 4HFRA 1U3WA 4PO8A 5HBGA 1Z6XA 2BGRA 1EKXA 1T9GR 9LDTA 2NZXA 3K0AB 1AMNA 3GEMA 3D02A 2NO0A 2P0EA 1H2RS 4CEHB 1P7VA 5JZMA 1GILA 1TJYA 3TWOA 1EAMA 1DG3A 1AKVA 1F1BA 1Q95A 1Q84A 3GT7A 4URVR 1FDUA 4BBAA 3GA0A 4K1LA 5HFNA 2CHUA 1WB4A 1P9WA 3TMKA 1DIAA 4KMMA 3BTUA 1YZ3A 4J1TC 3EEQA 5KVVA 4YUZA 5JALA 4A7PA 3N2IA 4NAVA 1AMOA 2YYAA 2YVQA 2P6NA 7REQB 1XNJA 3N6VA 2X9NA 1HSOA 3D0RA 4QBGB 1G3UA 4FQ5A 3IR7A 1ODLA 4U02A 1KORA 3QU2A 4IY1A 4ZOEA 3WICA 5DN6D 2BFFB 3NHSA 1ZM7A 3QOXA 1L4UA 4U5XA 4HH1A 3ROTA 4ALNA 3ZHUA 4BLRA 3CJQA 4KGVA 3THYB 3DEKA 3CNHA 1BJRE 3R3WA 4QHTA 3RS0A 1VSUA 5EP3A 4DY6A 4N39A 4Y1RB 4KDCA 1DOHA 4KVZA 1QR2A 4BBZA 1KMIY 3KKKA 4YJDA