2J85A

B116 of sulfolobus turreted icosahedral virus (stiv)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
Knots found
sequence length
117
structure length
117
Chain Sequence
GKVFLTNAFSINMLKEFPTTITIDKLDEEDFCLKLELRLEDGTLINAIGHDSTINLVNTLCGTQLQKNRVEVKMNEGDEALIIMISQRLEEGKVLSDKEIKDMYRQGKISFYEVWHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STIV B116
publication title A New DNA Binding Protein Highly Conserved in Diverse Crenarchaeal Viruses
pubmed doi rcsb
source organism Sulfolobus turreted icosahedral virus
molecule tags Viral protein
total genus 24
structure length 117
sequence length 117
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08960 DUF1874 Domain of unknown function (DUF1874)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2j85A00
2X4IA 2J85A 2J6BA 2J6CA
chains in the Genus database with same CATH superfamily
1XU7A 2GNAA 1VDZA 2EIXA 1UT5A 4IXDA 2GH1A 4ECAA 3KNZA 1E2DA 4YUVA 3GLKA 3IIIA 3O3CA 2XOEA 5FIUA 4YIHA 5FPKA 3X1KA 2OORC 3N6RA 2C5AA 4FFPA 2ZIXB 1KY5A 5A0FA 2IF2A 2I1VB 5A02A 1FNCA 2BCEA 4XE5A 1CRQA 1DCFA 3TE7A 2X8AA 2VRBA 3DBRA 3EY4A 3THYB 3JRXA 4RZSA 2HHAA 1P2DA 5I9TA 3UHPA 3RD5A 2J9YB 4US1R 1Z33A 2DF8A 3R2JA 3MUOA 3NWJA 1T29A 5EFZA 3OFKA 4I50B 2FEXA 1JT2A 2CXUA 3OIYA 1MO3A 3NU1A 4R84A 2OAP1 1KQGA 4DIKA 4ED9A 1K27A 3A3YA 2V54A 2VZ9A 4OHPA 4BQNA 1UZUA 3F98A 4BQQA 5BWCA 1RHJA 1K0UA 2WPDD 3EOAI 1M73E 1C4OA 1B8PA 2OVBA 3PWZA 3MJHA 4RFSB 5DO9A 1EGAA 4BFZA 2ZM6B 1CR0A 4IFEA 3MD0A 1D8AA 3GNTA 3D8UA 3G5TA 4OFZA 2GDJA 2PNJA 3O9ZA 4UCWA 2C4NA 4DR4B 4KFCA 1QH1B 1NBOA 4P08A 2VJLA 4MVWA 2BMDA 2ETVA 1C81A 4OFBA 3D8SA 1W29A 3IR6A 5JCXA 3AR7A 4IV0A 3C1UA 4ZVTA 1HLGA 4YAJA 3EVEA 2UVQA 3ZW7A 3QVGA 1CIVA 1VG1A 4B84A 2FQXA 4A0HA 1JVBA 4KIJA 4QUGA 4X6UA 1LU9A 4HEA1 4CMBA 4L75A 4U7TB 1A9YA 5D8DA 5KKNB 3UOGA 4IM7A 4G56A 2AYXA 3FNQA 5FL7A 4RJTA 1BVRA 2ZANA 2XYHA 3BH0A 3AOEC 2Y1GA 2NTJA 1RFGE 1XVTA 4ZPXA 2B8EA 1RAHA 2ZPTX 4Z7NB 1ZQ9A 2VQ3A 3LV8A 1UOEA 1SH7A 4UFOA 5D84A 2IYZA 2D1YA 4KYIB 3IV7A 4KQIA 3RQIA 3RVOA 1JNYA 1LGYA 2EQ5A 1P9LA 5FJIA 2XOXA 1YQDA 3CM0A 4L5BA 5CXXA 3W4JA 2XNKA 1IHUA 3B8HA 4DMUB 4I1RA 2PKCA 2O8EB 3ZY2A 2G28A 3MC1A 3VM6A 4XIGS 3G9TA 1EJ6A 4FZRA 5AVOA 4CMEA 5EWJA 4DARA 3K73O 4R3UC 2GHRA 4AG5A 5TEVA 5D6NA 4AB1A 5HQJA 4E31A 5FJJA 1T5SA 1WCIA 3GDHA 4RHXA 4AO7A 4X6YA 4N01A 4NBNA 2RK3A 5A3QA 5JDIA 1UANA 4LAFA 2HDHA 2GJ8A 1SA0B 2SKCA 2BL4A 2B36A 4MUKA 3V8EA 5BSGA 4DYDA 1EXVA 1H2YA 1RLMA 2JAOA 1NC1A 5HDBB 1MJ5A 3V7WA 4YASA 5IYZB 5E2BA 3RIXA 3TQSA 2PLAA 2GQ0A 2BKAA 1NQTA 2P9ZA 3KOMA 4BNYA 3EPLA 4M9XA 3ANTA 3ZIUA 3CNNA 5AFSA 2BI4A 2ZTMA 4P0PB 3PUZA 4GOXA 2E4UA 4XIFA 2Q2QA 4OQYA 3EQ6A 3QELA 1L5QA 2DKFA 1HEIA 1JPVA 2TS1A 2Y1WA 3RUHA 3MELA 2OQRA 4QYIB 2VHJA 4W6QA 3LVRE 1XMOB 2IHYA 1HH4A 3PIRA 4JB0A 4BFCA 1ESZA 5KWJA 4I14A 1W5FA 4FB5A 4EG4A 1L3BA 4CUKA 3SSOA 4EUKA 1JDJA 2AF3C 4XJVA 1C7EA 2A0UA 2F48A 4CKBB 5AWFC 5AHKA 2VP0A 3ICCA 5C31A 1X9GA 4OQMA 2CXPA 4RO0A 5COAA 1L6RA 1RM5A 3EBPA 1NRXA 1YU9A 1IEXA 4J0IA 4KE7A 1EEHA 2BC9A 1JFRA 4RF4A 4AZ3B 4G67A 1J5EB 2PX3A 3JQEA 1MC5A 4LJLA 5DB4A 4CF5A 1QWSA 3BTUA 4V38A 1A27A 1C8BA 3GVXA 3WXBA 2EWWA 2PXXA 2P4QA 4ZYXA 3FOFC 1R2QA 3LHFA 1P5FA 2Z09A 3IR5A 4Z9YA 4GVPA 3RS5A 3DONA 3DA8A 1N2BA 2BKUA 3ORFA 5AK0A 4WBNF 2YQZA 4XB6B 4OX9Y 1O87A 2WWXA 3OX1A 1O03A 4H0FA 4ND8A 4P3PA 5ENZA 5JWRA 4BO5A 3IO5A 1E1CA 4P36A 3F96A 5B55A 2O2IA 3DCIA 5FB3A 1W5EA 2GEVA 3RLFA 4OIFA 4DRXA 3EPRA 4ZT4A 2IHJA 1AKRA 2ZJZA 3BSSA 4H59A 4L50A 2P4UA 4DV1B 1JEYB 4DDMA 1FYVA 1XDZA 3T4UA 5JHHB 5CIYA 3Q8WA 2AEEA 3DT6A 4TL9A 3WB9A 1QRTA 1XALA 1E4OA 1N9KA 2ZVPX 3T9AA 4HAVA 5FCDA 1G8HA 1PV2A 4ZV7A 4M9CA 1M1XB 1RI2A 5CVEA 2AK2A 3B6EA 3RKSA 4EGCB 5GM2A 4LOHA 4FOSA 3FNIA 2ILVA 1ISJA 2VFAA 1ZRMA 2R65A 1M2JA 4JDUA 2WM2A 2AMLA 4Y6PA 1P1HA 2Y76A 4PRKA 1KEUA 2PL5A 3CZQA 4GR5A 5DX1A 3ODPA 4RK7A 2C96A 5EJFA 3N2GA 2WVJA 3JZIA 1YAHA 5BW6B 3VPCA 4E15A 4HDOB 4Z9BA 2WWYA 2JLBA 2G82A 2ZSDA 4MIKA 5ECGC 4AZVA 1LRLA 4FCVA 4IOMA 4RGBA 4WESB 2QAGB 3PUWA 4KLZA 2GZRA 4ODIA 4NU0A 3WNBA 1E7MA 2GK4A 5B57C 4V0KA 2I2CA 4QO8A 5TVGA 1MH9A 3JQ7A 3MJCA 3N75A 2UV8A 3L7IA 1T9GR 2JBHA 1BS1A 4HQ0A 1TCAA 4EG6A 5SZIA 4LE0A 2JIDA 1ZXLA 5ECDA 3EAQA 4F56A 1M6WA 2QTFA 1E5DA 1I33A 1QHNA 1T0HB 3NDPA 5ALMA 5K8IA 4XPIA 1ZDMA 2LDBA 1MRSA 4XX1A 5DI9A 2DM6A 2EFGA 4NATA 4U7GA 4J0EA 4QPNA 4WFJA 2C8JA 1FFDA 1AZWA 3C8ZA 1TFRA 5J63A 4DR1B 1VL5A 1T9DA 1JFSA 4WD3A 1TMYA 1XRQA 2AOUA 3EVDA 2WC1A 3K5HA 3P27A 4I9GA 4YIKA 3SNHA 3TECE 1JBKA 2R7AA 4EY3A 5E4YA 4QOGA 4JXZA 1X9IA 2F9LA 3HXOA 1AV6A 2DG2A 4UZFA 3CNLA 4CL2A 3UVEA 4JYPA 2OBNA 4B8WA 4EYOA 4OP3A 3U3MA 1P62B 2YWXA 1JQEA 2QQEA 3LY8A 5CUQA 1ND5A 2LCFA 3OCYA 2BI7A 4N65A 5ADHA 5FBLB 2HJGA 2OC4A 1NLMA 5C8ZA 1BXRA 5JXHA 3WLKX 4F84A 5AT1A 3C24A 5ELMA 5FFMA 1P7YA 1NBMA 1WAMA 2ODPA 1I4DD 2Y0DA 2VNJA 2CVZA 2PT5A 2WNIA 4QBFA 4ZVLA 4B2YA 1DE0A 1PE0A 4MA5A 4EARA 1P4SA 2IPOA 3R3VA 2OD7A 2XODA 5JAZA 2FZCA 5B1EA 1NW8A 3TSCA 3PHCA 1V95A 2IYQA 3IPCA 3N3BC 5SY4A 2IZZA 3HCBA 3CF0A 3OEHD 2KB0A 3QXXA 4QE3A 5E1DA 1QMPA 2V9ZA 4O08A 2ORYA 3DBVO 2K87A 3ND8A 4I5IA 4OXNA 2I2DA 1QPGA 5KJCA 1N3IA 2KYRA 3IMFA 3V55A 2FMHA 3LBFA 2I4TA 1ZHHA 4P8RA 4FEYA 2C97A 1J9ZA 1KETA 1Y5RA 3EDRA 1VA5A 2PVCA 2W2MA 1ZA1A 1GR0A 2AFIE 4KAFA 1ZEMA 3N9IA 1NHGA 3AHJA 2FPPA 4R0NA 3ROFA 1KGSA 3VR5D 1TW3A 3I3SR 3L4JA 3W2IA 4GNKA 2XDWA 2YNMD 1SWWA 1WCV1 2BBOA 5CJPA 5F3RA 3CRNA 1FF9A 1ZUNB 3GIWA 2WWHA 4DEVA 4JEHA 2DHDA 1T8RA 3TQOA 3PE6A 3C97A 1D6SA 1L5SA 3AVOA 3RVLA 5K2OA 5A3RA 3MGCA 4NP6A 1QTQA 1XP5A 3FFWA 1AUPA 2I0FA 3LM8A 3SCZA 4KQCA 1GNPA 1F14A 3OP1A 3KB6A 4FZJA 1NASA 1QQ6A 2XT6A 3W8RA 2YC4C 4X0EA 2QRQA 1M54A 2CLDX 1IPEA 3FYDA 3P96A 4I1SA 4NMLA 3HY6A 2EZ4A 3WP0A 3ESQA 2NZYA 2BEVB 2GKOA 1HGXA 2A0XA 3DJYA 3GFVA 3HRKA 4FN5A 5C8YA 1RWXA 3ZVRA 4HNAA 3VPBA 1J8YF 1XLTC 3IEVA 1K9SA 4X1IB 1S1CA 3GHYA 2BF7A 1CQZA 1P19A 1DCTA 4J1NA 1SXGA 4I19A 4PF1A 1XAGA 4ZV9A 2WSLA 3HGQA 3IVMA 4KKVA 3OE4A 5KQSA 2EKLA 3V2GA 3LL7A 3OIGA 4BQRA 4XWGA 1Y42X 1H5UA 3JRNA 1SVOA 4ENQA 3WLEA 2J6BA 4J3NA 3EZXA 1K5GA 4S24A 5EE0A 1RM3A 2Z1NA 2H1HA 4MI9A 2J09A 3ZWXA 2CHGA 2ZS7A 2VYCA 4DMMA 4CMIB 3NKLA 1GSAA 1M2GA 2VDJA 2O2ZA 2O8BB 1RYYA 4QPDA 3W5CA 4UAJA 3B3JA 4ZT2A 4JI1B 3V1YA 4YP6A 1JR3D 5FRDA 1Y4ZA 2XDQB 1NXPA 4MR7A 5DE3A 1KOGA 3DP7A 4INAA 5FORA 4QD3A 2AI3A 2XQFA 4II7A 1N8NA 2X5JO 3PUYA 1NWHA 1FS6A 4MV7A 2Y6UA 1ZGGA 3F71A 2CY0A 4EJSB 3ESAA 3BWMA 4MKZA 4LQLA 3UW1A 3BQ9A 1K63A 4Z3OA 2A8YA 4LZOA 2V7BA 3OZUA 4GEGA 1ENOA 2Q1TA 4MGEA 3LG2A 4D2IA 3GYBA 3P0HA 1G2IA 4XR9A 1KYTA 2AOTA 2WJWA 4RESA 3Q0IA 3QKTA 3VZDA 4LVCA 2YWGA 3PQ8A 4DLVA 3LDGA 2GJ4A 2I3DA 2ZI4A 4HD8A 5IANA 4B73A 2RGNC 4KO8A 1O1YA 4G5RA 3T7RA 1QV9A 3GRRA 1L5RA 4CM5A 4YUWA 5B64A 4NCBA 1SOWA 1YUBA 2OZLA 4LY9A 5CLFA 5EIHA 1JHUA 1OXKB 4Q9AA 4WKCA 4EW6A 3DLHA 5FYDA 5FHRA 3ZXXA 1B3RA 3RV4A 1EVIA 5C9ZA 4HYYA 3OPQA 3GO4A 2H54A 2ZZNA 3CSSA 2VOEA 3HDHA 3NT4A 2ZUTA 4ER0A 1EE1A 3RYFB 3JQBC 3HE3A 3T3DA 2ZDGA 2VA8A 1TYDE 4M0FA 5AH0A 1C14A 4H7PA 3TNJA 4XRGA 1JZQA 2PDAA 4ABYA 1NW9B 1A8IA 1A95A 4AZTA 3VFDA 2IYNA 4OLJA 2XBUA 1MHPA 2Z5FA 3T61A 4OB6A 1MT3A 1J2TA 1X1DA 1PKEA 2TRSB 1ABEA 3FMOB 4OJMX 3EX7C 4K0KB 2GF2A 1ZAKA 4BWYA 1UXOA 1TZBA 2D4AA 3HXQA 5DNWA 4HDKB 3AETA 3PFIA 4BKPA 2OZVA 1XP8A 2QV0A 3E7DA 2OV3A 3IP1A 3V1UA 4E0BA 3PUXA 3RUAA 4B3MB 3CEAA 4F3YA 2Q4BA 1NNEA 5EESA 3OBIA 3E4DA 1Y37A 1YQUA 1UOPA 3USES 2NSHA 4NEQA 3QXSA 1CUIA 3I1YA 3P26A 4C21A 3SXPA 3T6KA 4MLPA 1WEKA 3HUEA 1SHZA 2NTNA 2ZJ5A 3I5AA 1S8AA 4PLCA 3ZHUA 1KZ7B 2OSBA 5AHXA 1SC1A 3FDXA 1JLLB 3IBYA 3GFRA 3M82A 3H2ZA 1K7FB 4D4KA 4OU4A 2VJMB 1TF2A 5CB6A 1XA0A 3H04A 3KFXA 4P5EA 1FSGA 2GEFA 2ZI3A 3H7IA 3ZS8A 1AKYA 3T9DA 3HJRA 2OYRA 4DUGD 2AQIA 1PFQA 2I54A 3DPUA 1JIKA 1I51A 1NFFA 3K1YA 4EVRA 4Q4CA 3KJQA 2D8AA 4PZAA 4FMBB 1X3SA 2OHFA 4LK3A 5DOVA 4DJFC 3P2OA 3DZJA 1YNSA 2Z2XA 2APJA 4KFSA 1M75A 1GFIA 1Z25A 3AEKB 4ARUA 3NV9A 3P2EA 4HGNA 4GM4A 2XIQA 2I6FA 1QK5A 3I2IA 5G0WA 2ZSIA 4NCJA 5HIMA 1H05A 1GLNA 2GARA 4ZI3A 4MYUA 4LJYA 1GL9B 4IJKA 2OCBA 5GV7A 1Z9BA 3M3PA 1Q1QA 3HBAA 4JB3A 3RAPR 3AGPA 2DR0A 1W34A 5TGTA 4AAYA 3FN4A 2C5BA 1IBKB 3EXEA 5FTJA 4EFLA 3EWIA 1OXMA 3ZDYB 4G6ZA 4LDPA 1MORA 1QTRA 4LV5B 1OI4A 4MGYR 5GV8A 4EJFA 2CNNA 1AK1A 4H1HA 3RRXA 3WGKA 3NDIA 4MYTA 2FCAA 5AUPB 5IARA 2CC2A 3GUCA 1IOLA 5IPFA 4PRZA 1G64A 3QKSA 3STWA 5BOVA 3QNWA 1J39A 4DQXA 1P3Y1 1RAGA 3JWPA 4UTNA 4LBYA 4YC7A 4E4TA 4YCCA 4OI4A 1UUFA 4ICIA 4RSRA 3QVTA 3GGGA 2O14A 4E5MA 1I4EB 2CXNA 4DA8A 1O3YA 2HTEA 4R9VA 1W30A 1CZKA 2WEKA 5DNUA 5HZHA 3BGVA 4U3JA 1VIMA 1KSHA 3ILHA 4G63A 1ODJA 1CERA 4JCOA 4E5PA 3G0DA 3HCFA 3I2JA 2WICA 3N0TA 3NBKA 3UMVA 4X91A 5EFOA 2WA2A 1JLKA 1XMJA 4GICA 2X1VA 1NWCA 1EFRA 3Q3CA 1BRTA 5CM8B 1F0YA 1QXSA 1L7PA 1T2EA 3AVQA 4KXVA 2XLBA 3JR7A 3VMFA 2YIVX 3COZA 2QRUA 1CDOA 3DVAB 4G4SO 2V0GA 1L8LA 4OQDA 4PU0A 1G5HA 2H2WA 3H0CA 1ZM4A 3UV6A 2CYBA 3AW8A 1EVZA 3EIXA 2QPTA 1XDUA 1LQ2A 2ORIA 4ZVKA 1F48A 1ZONA 3DZBA 3TB4A 4CMCA 2C1XA 4HUQA 1BZYA 2EP7A 1RQXA 2QTWB 4GBGA 4UU7A 3UCEA 5HGXA 2X8BA 4TVBA 5KJ1A 2XUDA 1AD2A 1AT1A 2YRXA 1RAAA 3LLUA 1R8QA 1BX1A 5LUBA 1NW5A 1ZRSA 3RK1A 2BKEA 1GEEA 1WSAA 1SB9A 3HY3A 3VI4B 3AQ4A 4EPVA 4HLQB 4MZDA 4IH1A 3UUWA 4MQEA 3EZGA 1UIRA 4C07A 3KCNA 2O8NA 3TO5A 1CIJA 3FPAA 1OAOC 2Y3IA 4QGFA 5EWMB 5SY6A 5FBVB 3D7RA 4IAOA 5TSDA 4DV6B 3UOAB 2IUUA 1DC6A 1MC8A 2PBFA 1GU0A 1T36A 2ZK7A 4OYYA 4D57A 2DPGA 4FNMA 3D2CA 3W5VA 2QN3A 1T5TA 4BB9A 3A8TA 4B3GA 1C1XB 1DT3A 2RGAA 4FYIA 4ZGWA 2XMBA 1P2VA 1M7GA 1TAQA 1JVSA 3K72B 3ML1A 4Q3OA 1Y4DE 2B21A 3GPBA 3NUZA 1GPKA 2PWBA 3RVMA 3IJ5A 3TL3A 1LSUA 3ROTA 5DT9A 3HU1A 4JYCA 2BFEA 2E4ZA 4N39A 2QE7D 4QDTA 2B9VA 2AW3A 2XGJA 3OZ7A 1NONA 2IHNA 4LJ4A 5AVSA 3HSKA 2Y68A 5EJ2A 5F7XA 4CR7A 4CU5A 5K3BA 2Q41A 4DBZA 5LQNA 5FA5A 3K32A 3VR1A 4BLOA 2HCBA 1UAAA 4DB2A 1MDBA 1XTBA 2VDOB 3VDXA 2FCRA 4DDHA 5ECYA 3I9MA 5EYPB 1KP9A 2ZREA 3UJHA 2CUNA 5CYPA 2HU2A 4OKNA 4B83A 1E6EA 1HT2E 1MABB 2JLQA 2NZ8A 3QY9A 2XAUA 4LYDA 1H4TA 4GYKA 4MW5A 5CH8A 4YRKA 4Q9JA 4KACA 4P84A 4YRTA 3PUJA 5IULC 4TLBA 5INTA 2GN9A 3GLGA 2X7XA 3Q3JB 2BBTA 2PH7A 5IAOA 2JARA 3ETLA 5JSQA 2OL4A 2P77A 1EFAA 3ONNA 3G68A 1T4CB 4M98A 3E8SA 1K88A 1XJ0A 2J3IA 2XWQA 2ABWA 1EFVA 2HMWA 1O95A 3WLTA 3SVTA 4O3MA 2FSVC 2Y4OA 3L7LA 5ULLA 1XHLA 2O5VA 1S3GA 3OC0A 3KL2A 3MRVA 5DWQA 1WF3A 4HEJA 4QTZA 3D7KA 5TE9A 1FMJA 2G1AA 5DF1A 4A6DA 3LCUA 5CLLA 1AE1A 4JB2A 2YN2A 3GPIA 4WXMA 3INGA 3R9WA 3IQXA 2Z4TA 3PUKA 4DEYA 2WTXA 2H16A 5JH7F 4N7RA 3VH3A 1XLVA 5FBZA 1RBZA 3RJTA 3NHBA 1WZIA 2C20A 2WFAA 3NOXA 4UULA 2C9BA 1QZ3A 1UODA 3O90A 1YS6A 3OE7D 4OQEA 4TMXA 1JDBB 2ORED 4FGLA 4PAOA 4XGKA 1RQRA 1UADA 5E4FA 4MLZA 4YCDA 5EPEA 3QEMA 4JC0A 1QP8A 4DIOA 3K9BA 5JQGA 2AN9A 3PXCX 3ZJTA 4LOJA 5T8KC 2DHRA 3ER6A 2J1LA 5DPMA 5EGSA 3T7IA 2XQJA 1C30B 1MW9X 1YRBA 3SE0A 4G36A 4HWPA 4LECA 3PQ3A 4MMXB 4R1SA 3D4PA 3ZV4A 1OFUX 1VFPA 1RIIA 1U8UA 3A4TA 1AB6A 2GERA 1W6UA 4QDOA 4BX8A 1Q6YA 1LVHA 2QAIA 1WXEA 1X1QA 1GQOA 2R9VA 3NEYA 4NYJQ 4QLOA 4X00A 2DHQA 1DX6A 2Q4DA 1NE7A 2OHVA 3DZCA 5J9FA 1XPOA 1QF6A 2IYXA 1E2JA 2GPWA 3KR2A 2X6QA 1WKVA 5FAXA 1J8DA 4KPFC 1U2SA 3EGXA 3ZBTA 4ZOLB 3V2IA 1YTUA 1KFCB 2WZBA 2YJZA 5IWAB 1FDOA 1H69A 3KDAA 2IS4A 3WY9A 3ILXA 5ICMA 4XIYA 1BWRA 1Z3IX 4K6CA 4ILKA 4ZQEA 5EUCA 2P9QA 1ZINA 1SC3A 1YKSA 3LUFA 3ZHXA 2NP7A 1BHO1 4P86A 2G4VA 4PZ9A 2FPWA 3AG5A 1P0QA 4MV1A 4O8CA 4NE2A 3RK0A 1MENA 2CFRA 2I76A 2X3YA 3GARA 3LUDA 2IYWA 1PL8A 3ELBA 1BSVA 4K6FA 1ZH4A 1ZKDA 2AZ4A 2G5GX 2H1FA 3Q4GA 5ALNA 4EMUA 4EMSA 2FX5A 3PDIB 4FWIB 2NT4A 3E4CA 4HVAA 1BCSB 1LSSA 3O21A 2RE8A 3BWVA 2ZRAA 1YC2A 3LLCA 5H3LA 3F2IA 3KXIA 2Z95A 4MP3A 1ZI9A 4W99A 2GPSA 1ZUIA 3R7WA 5LB4A 2QROA 1PVOA 1O97C 3PP8A 4MAAA 3ONFA 1JR4A 1D4AA 4JBWA 4W8OA 3V3KA 4DVGA 1XU9A 2AG6A 2I03A 4UMEA 2YR0A 1S8OA 2QG4A 4V3BA 1GG8A 4XWWA 3U7HB 1KAGA 1PEYA 4H4CA 4QQ8A 4CMGA 5ALTA 3HB5X 3RC1A 3H9EO 3RUEA 1PG5A 3UMSA 4D3SA 1SBNE 2YHIA 1IONA 1LK7A 5DLYA 1G17A 1XPJA 1NJ5A 3HNOA 1W8IA 3P5BA 4IIXA 4JJIA 4KGDA 5E7MA 1ULZA 2B99A 3WKAA 3FSRA 3DZIA 3GGDA 1E4YA 2B7LA 1COWD 1RP7A 2EX1A 3RSGA 3RT7A 4BZQA 1J56A 3WISA 3O8LA 4J2TA 4B80A 3W5UA 1ZOSA 3LKBA 1UBMS 1XL0A 5AOBA 3RSOA 2OYSA 3MWKA 4G0ZA 4B81A 4E5SA 2OHXA 1FYWA 3PFNA 4D97A 1TCVA 3SR4A 3MAJA 3QVGB 4UVDA 2J41A 4ZRNA 3CRQA 2PYZA 1TCBA 4HLUA 5F3DA 4LXIA 1KYWA 2N9UA 1BU8A 3M5CA 4ND4A 4UATA 1ORDA 3WSTA 2PTGA 1IZ7A 1XUOA 1H8HA 1PJAA 3D4LA 3ITDA 2ZGVA 2WFLB 4MVCA 4F4IA 4JGGA 5BQ3A 3PRJA 5KQGA 3QPCA 2VP2A 2JB9A 2J9GA 3O91A 1UM8A 4P31A 4PYKA 4QVKA 2W8BA 2DERA 3AU8A 3LY5A 3LYLA 5AESA 2ZKIA 3L7MA 3QPVA 1T5HX 1M1YA 2B61A 4B6EA 4NKRA 1ZU4A 1YQWA 2BELA 5AW7A 4WXYB 3QZUA 3L7NA 2ZU6A 1VLZA 2WTEA 1HYBA 1ISPA 2LR0A 4YA6A 5F9MA 1GPDG 4G5GA 3GRFA 3PV0A 4Y0VA 4YCSA 3RIHA 2W2OA 3TCNA 3P4XA 2GEUA 4Z0NA 5IVDA 2Q46A 3L41A 4BCCA 2X0IA 3NC0C 1VG8A 1IN7A 5DTMA 3HR8A 3DQPA 5AW2A 2P68A 4XQCA 1OA1A 2ICAA 2IODA 3EPPA 1KJ9A 4U7HA 1R6VA 5G0VA 2BF4A 4R1QA 2QD5A 4C3UA 3CF6R 3GA7A 3KQUA 2WG2A 1H0SA 4F2PA 4YMGA 3KAPA 1V4BA 3JQ6A 1GG9A 1UC8A 1TJYA 3BL5A 3HXLA 4XM1A 4EYKA 2QMOA 3H13A 4J1QA 2XSZA 1U1DA 1WX1A 1R16A 3KXKA 1FQOA 1U0JA 2W2KA 5EKXA 3BUSA 3CYFA 3RRBA 1WXXA 3L7BA 3FNHA 2JHGA 4PBTA 1B6TA 3Q3VA 1M7HA 3QELB 4MUIA 1DIOB 1Q84A 4Y1EA 4PHHA 1BFDA 3T1QA 4PGMA 4ZOAA 3PC7A 3ZUPA 3A04A 1PR4A 3EPJA 2B30A 1PGOA 4A8HA 1R0KA 2ZOSA 3EFBA 3EWSA 1XKTA 5KNLA 4I3HA 3K7EA 5H7XA 3AJ8A 1KEVA 2COKA 2WABA 4NG4A 4U7DA 1NV9A 3KD2A 4EKEA 4DC1A 1AMNA 1XCMA 5JXGA 5FUXA 2AMVA 4LUCA 1NFQA 1LS6A 2GILA 4F4JA 1DQPA 5C8YB 4Q3EA 2R7MA 3DZ8A 3UW3A 1ZD4A 2HV8A 4BC1A 1E2FA 1P1CA 3FNEA 2A59A 4S1TA 3WLNA 1CJTC 4AP5A 2J6HA 3T7JA 1M34B 3BGOS 1NUPA 1EUQA 2ENUA 3QVVA 4FOPA 2BKLA 4JUFA 1QBKC 1V3QE 3U2QA 1FVFA 1NBMD 4HP8A 2GLXA 4BO8A 5B5SA 2F1OA 3JALA 4KN6A 4FHGA 2ZDHA 1D04A 4U1RA 5M34A 3QHAA 2YYSA 2NO5A 1O94A 3DC7A 3TZCA 3UHFA 5JTTA 1ZMOA 3KHTA 4FSDA 4QVIA 4ND8B 1PWZA 4WCVA 4LSGA 4OKIA 4PZUA 4RD0A 2NU7A 3KV1A 1E1CB 1YIOA 1FDRA 2HMSA 3R5XA 4MI1A 3UNXA 4S35A 1N5OX 4ZARA 3H75A 1M67A 5TX7A 4AQYB 1Q7EA 1O08A 2CFIA 4QDKA 1CYEA 2WJIA 3SC2B 5B1HA 4DV3B 3WK8A 1IQUA 3D6FA 3G89A 2JD2A 2ECOA 1C5KA 5C5IA 1X9HA 3V42A 1XRSB 5JLAA 1KEEA 2JLYA 3W8DA 5JNTA 1I4LD 3E2PA 3KKQA 3L4KA 2BTQA 5JRJA 1UOOA 3FHCB 3PDCA 3RVSA 2QS9A 3O8QA 4WZ6A 1PJ8A 3G8DA 3EMVA 2W6QA 4B2IA 5E8JA 4QLAA 1MO2A 4QIHA 3VVMA 3AKEA 4KUGA 3HFSA 3KKMA 1SG9A 4RUKA 4WVFA 2R751 4AYTA 1B73A 5CK4A 5DGDA 4PC2A 3WNZA 2QVCA 4P80A 1C9NA 3OZXA 1NULA 3VKUA 3N2GB 3WI7A 3C7AA 4K2AA 3WOHA 2GAAA 4PVCA 4E2XA 5COBA 1JQLB 4QQNA 2NADA 2D5LA 4M86A 4HNSA 1A96A 4BFVA 1Z83A 1GN8A 1R88A 2JZNA 2XMGA 3W2EA 3IIJA 3DFKA 5BMVF 2R6JA 4MICA 1UK9A 2F55A 4RANA 1TM2A 3OETA 1X7XA 4IHKA 5A5DA 4WGFA 1IY0A 3N8DA 2VP6A 3DSRA 1L5GB 2IKSA 4RXUA 4M1EA 5CA1A 4MQMA 1WB6A 4PN3A 3M4JA 4MJ3A 1ZRNA 2IOYA 4OUKX 3FPSA 5J2UB 2PL9A 3RC9A 2ZDQA 4MV8A 4XPIB 3U7QA 5JEDA 2H0AA 2JI8A 3P0RA 4IL5A 3AL3A 1X13A 1X1EA 3LDHA 1ZM9A 2QENA 5J4VA 2AR7A 2Q2VA 2ZAIA 1OA0A 3N0RA 5CH5A 2BE7A 2BVNA 3PNSA 4IG9A 5EP2A 4MDEA 3JQAA 3QVWA 3R3SA 4B3TB 3B1WA 3E22A 4QSHA 4WKNA 5FI5A 3I9NA 1ILWA 1I24A 1EUCA 2FOXA 1LY1A 1UFVA 4Q4JA 4TMKA 2H1CA 2NXNA 3OD5A 4E30A 4G0VA 1R66A 5GZ3A 2GNOA 3TMYA 3GUUA 4JBYA 4CF6A 7MHTA 5IT9A 1VL2A 4FX2A 3AH8A 5CNJA 3NONA 3PQFA 1VIDA 3I39X 3M8KA 5AVZA 4J3JA 1TTTA 2B25A 2O3TA 2PD6A 2PZAA 3CZAA 3IELA 4GYWA 5JJBA 1G9SA 5LOVA 3KOWA 3KQMA 4GBED 1BXRB 3IAUA 3KHUA 5JASA 2B5OA 1PO7A 2NU8A 3HBLA 2RGYA 2ZB4A 2Z58A 1WP4A 2AQHA 1G3IA 1UBOS 4GI5A 4EI2A 4LK2A 1K8RA 1JEEA 1JHYA 3LCJA 1WZ2A 1KBOA 5GOZA 4C7KA 1SELA 1Y9ZA 4M4SA 4EITA 3UM9A 3L0CA 3KO8A 4K28A 2J0EA 1HYHA 4AWBA 1R6TA 2M9MA 4F5WA 5FUYA 2PRZA 3TMAA 2CL6X 5B7GA 4G0MA 1GUYA 5ALVA 2F4NA 5DDIP 1UK7A 3PD7A 4DY4A 4RL4A 3JVDA 4B6JA 1BKDR 4B6OA 1F2TA 5LIPA 1GGJA 4YLYA 1QZTA 2AC7A 2AUMA 5IM4A 2QZJA 2RCYA 3QKWA 4MYDA 1W19A 3UWSA 3C1OA 3DCNA 4YT5A 3NTOA 4J43A 1G4AE 3X2FA 4A0RA 2CBGA 5ALIA 3WAKA 3QXJA 3CNEA 1RLOA 2MSKA 3N58A 3NH6A 5JTUA 5CG1A 2EHJA 3OZBA 4TKZA 1G21A 4XUDA 3I4FA 5JCJD 1V48A 2I6GA 1M2EA 4LZZA 2AUNA 2G06A 3NG1A 3OPMA 4RQUA 2WD8A 2B94A 3UN1A 3CJQA 3ESDA 1BGVA 3RI3A 1J06A 1E98A 2F3TA 2NSJA 3DH0A 1N2HA 4HDAA 3QI2A 4JBHA 3PK0A 4EJ6A 5LQUA 4EI7A 1XD8A 1XTPA 2L2QA 3PR1A 4TZKA 2A84A 4ARBA 4D9IA 4TN1A 4FEEA 5TMPA 5ICEA 4Q1VA 3WFIA 1MEEA 1WS6A 2JFFA 2YJ5A 4KW7A 1YL6A 1N4AA 4DJAA 3D6VA 4AURA 1IFXA 4F3CA 1HNWB 3QE4A 5KVQA 1M76A 3KDPA 1UAYA 4RKQA 2OCAA 1ZJ4A 3K0HA 4P5PA 4EPXA 2VVTA 1NF8A 4HNAB 1NF2A 5K3CA 1G8AA 3P8ZA 5BSVA 3TBHA 1G16A 3R5KA 2W2PA 1PWYE 2GZMA 3X2EA 1PQUA 4RGYA 4HX9A 3U44B 3WZLA 2X3FA 4JY7A 1TEZA 1A76A 2IH5A 2XITA 3DNFA 4MWEA 5FF9A 4HB4A 5IAKA 3PVSA 5CFMA 2VTEA 4M36A 4WK0B 1E1MA 1K7YA 4ZCTA 4PZZA 2PAFA 4GX2A 1KH2A 2DFVA 1LBIA 3D6JA 3DZGA 4K3UA 1ORWA 2JFVA 4CCAA 4B6RA 3D3KA 4D9KA 1A9SA 2BGIA 5KINB 2FSIA 4HZUA 4O4JF 3CF4A 5A5VA 4LCJA 1IXYA 1N7GA 1IG0A 3FPBA 2BEWB 1L4GA 4B48A 5IJWA 1OWMA 1GPAA 1W8DA 1SRQA 1XF9A 3SIWA 3K9WA 5JAPA 5FWXA 3RU9A 1U1FA 2OBYA 4ZEVA 1LXCA 4HGYA 2O2CA 1AQIA 2B1RA 4M46A 4MR7B 3ZY5A 2QUAA 4HDCA 2QL5A 4P1ZA 5KWVA 1UKCA 1ZCJA 2HT6A 4NCKA 1TT5B 3F9CA 3KSRA 4WNAB 4RSMA 1WNTA 4BZWA 1JKXA 2Z2KA 4HNGA 4TXMA 1ZOIA 1QQ5A 3QUAA 4AG3A 2BM8A 4NG5A 1L4HA 4R81A 4HDRA 5CM9C 2OCPA 3BE6A 3FOCA 1FU4A 3MGAA 2H4XA 4X1KA 5KU7A 1C9EA 4DCOA 4MTLA 1THZA 2NVOA 4Z6KA 3BSYA 4ID3A 5TC4A 1K7SN 1JN0A 1X87A 3GJXC 3DTVD 1ZR4A 4EABA 2PSDA 4EFMA 3AI7A 4G1UC 2VUUA 2AIRA 2H51A 4W5WA 3BDAA 2B3DA 1T1IA 1X7WA 2BCGY 4HG2A 5E38A 3K3PA 3ZQ4A 3FNFA 1W35A 1IZ9A 3UFBA 1RXUA 4M21A 5JVDA 4POAA 5LZ5A 4F0JA 2A7QA 2DHEA 5AI6A 4G1FA 4L78A 4N5IX 4DLBA 2YKGA 4TSKA 2D7DA 5BPHA 2FFBA 5K1ZA 1HQYE 1EFRD 3A9UA 1JDUA 2X1LA 2XOKD 4PQGA 3G79A 3AWDA 5KYUB 4P38A 5T41A 2GAJA 2B8JA 4X20A 4U2GA 3EOBI 4LOAA 2V03A 2WKWA 1ODKA 3NM6B 3PL5A 4FBMA 3KL4A 2HSJA 5LP6F 1GPWB 4IHJF 2Q2OA 1JR2A 2PTHA 1VGQA 2RHCA 2YN0A 3PJDA 3RUDA 3ZCXA 3TPZA 2EAUA 5F9HA 4UNIA 5JI2E 4MCJA 1FSPA 2FMKA 2PX0A 3ORSA 1XTZA 4JJ6A 1RMQA 1ZIXA 4R2WA 2GS9A 5EIOA 5C46F 4KWEA 1Z6GA 2IPMA 3D8RA 5GONF 4Z4FA 3NTXA 1L7MA 3L8GA 4GSLA 4N5NA 1N6KA 1U0EA 2GBCA 2D0OB 1FUYB 2ID4A 4FIZA 4GMKA 4ZANA 2G5CA 5IDVA 3ZX4A 3D0QA 3BFJA 3L0IB 5K6TA 1NR1A 4L6IA 4RDXA 3OQMA 3A70A 1YJBA 4DC9A 1Z6TA 4TUYF 4AS2A 3C3JA 4A2PA 4R8RA 3ZPXA 1BW9B 1T2VA 4JA2A 3C6ZA 2O0KA 1RVV1 2D5CA 1G6OA 2VDVE 1UXKA 3RRJA 1V5WA 2JEOA 3PEVA 3UAOA 5F23A 1N36B 3IIMA 4K9KA 1IHYA 4EIWA 1QV7A 4ZYLA 4IZOA 1JLHA 4PPYA 1U3FA 4MROA 3S2SA 5B4UA 1C3JA 1NFRA 4ZC8A 4B47A 1JU4A 4NF2A 4KXMA 3RUCA 1QLJA 5FWYB 2WUEA 4CDGA 1TKAA 2BMVA 3RRYA 4NCXA 4Q7EA 4D0GA 4ZZ2A 2RHTA 3V7NA 2OD9A 3O0TA 5I9BA 3NBAA 2W4QA 3A32A 3Q9SA 5DYGA 3KQPA 5J23A 1FU8A 2DETA 2FP4B 4PZEA 5IUJC 2OTCA 4DPKA 3B7PA 4UJ5A 3IJRA 3QPUA 1U11A 2W4MA 2ET6A 3FUXA 1AF4A 1H2AS 1CY4A 4E88A 3KAJA 3GRCA 4B3FX 1OLOA 2BLNA 2JBWA 3QMVA 4JMLA 2VYFA 5B1SA 3T3EA 3LUJA 2L69A 3E5HA 4GQBA 3O5AA 3UAXA 4YS6A 5TJHA 4ER5A 1A9QA 4DNPA 1SXPA 1RMYA 3MMSA 1E6UA 3EXEB 4KKXB 5LQDA 1KK0A 3VHQA 2ZSKA 1TU4A 4V24A 2ANCA 5IT0A 2JLUA 4DFDA 1JB9A 2WIJA 1DWPA 3VJLA 3LA8A 1RJWA 4GI1A 4JKYA 4UOEA 4LI3X 3QTBA 3B7GA 4HEA6 3MMXA 4ZQFA 3ZW8A 5J58A 2UXBB 3NCHA 1P7ZA 4LHXA 1OAKA 1PDVA 3B36A 2O05A 4A2QA 1PUIA 4FDMA 2ZRLA 5IEJA 2AN1A 3DTVB 1O95D 2BSAA 1HE8B 2A78A 2WFMA 2YVAA 1NA5A 2QV7A 2FU5C 3COPA 4GPD1 4NU5A 5AICA 4A5OA 1IIBA 2IZOA 2ZP1A 5THKA 3D59A 3NTLA 4U0JA 5K0CA 1DRKA 1LTQA 2H07A 4LPSA 2O6HA 1DADA 3GBPA 4EUSA 2Z9DA 4U3JB 4S05A 3K53A 3BE4A 4PICA 5EGNA 2W98A 4F06A 3AVVA 3PHIA 1V3VA 4P7GA 1ZIPA 1F8GA 4UE6A 5JWHA 1UZMA 3TGLA 1Q7GA 3RYCA 4YHBA 3W6UA 2WR8A 1KVRA 3W9BA 2B0JA 1XTSA 4Z54A 4M1KA 1DRVA 1O58A 3RFTA 3CEHA 4S2EA 5CHYA 3V6MA 4NMMA 3AERA 2DUWA 3OZRA 3KETA 3RT1A 5EIAA 3N05A 2JD0A 4O6VA 1O9GA 4WE3A 1MV5A 2HLHA 5DYNA 1NJ2A 3SXUA 4RTSA 4AY4A 4O4LA 5BR8B 2OZEA 4EVIA 2EU8A 1FFAA 1LDMA 2BFDA 5EA2A 4I55A 1N9GA 3Q7PA 5KAPA 3VR6A 2H5LA 3DQZA 2PUBA 3H7AA 4FXPA 1YE8A 2P9GA 2RH8A 3IPAA 2G7ZA 4IDPA 5ALLA 5BQPA 4DSUA 3INNA 1Z38A 3KT8A 2YYYA 2XGSA 4HUQB 4ON9A 2XNCA 2ECPA 4URUR 4UVHA 2R6GA 2JJMA 2P8SA 1DHTA 3KTOA 4MUNA 2Q5JA 2QX9A 2B7CA 5CDYA 2DY0A 1IM5A 1FB5A 1G2QA 3CR8A 3N8HA 5TF0A 1USGA 3IDQA 1CC1S 4FUTA 4XFJA 3ZJYA 5LFAA 2GJ9A 5AKHA 1U2EA 3ZY4A 3MPUA 2O50A 2I1LA 4MQEB 4ROSA 3LHSA 2OXFA 3PJEA 4UM9D 5HEKA 1LNSA 3GV0A 2H65A 4TWZA 4CV2A 1XVIA 1Z5OA 3WL3A 2NYUA 1OKKA 2ZWAA 1CUYA 1T36B 2HU7A 2PJZA 2GFQA 2FUNB 4G1EB 4FK8A 3UJDA 4E32A 2X0KA 3PFHA 3G6WA 3WRXC 2AFRA 2VPPA 3AFMA 4FNOA 4V2UA 3EF1A 2ZBEA 4MGHA 3CUTA 3KSZO 5HSGA 4YECA 4LC1A 4AUNA 5LXTA 4QAJA 4TKUB 2FQYA 5EZYF 2PZFA 2QUZA 1L8XA 2BFEB 2IP2A 4RHEA 4RZHA 2EJVA 5D1HA 2AQ8A 4CCSA 2Z5GA 3VJMA 3TD6A 1EM8B 2EGHA 5AK5A 5JO0A 2BHSA 1SKYB 3V1NA 4PNPA 2JFGA 4URXR 2DBRA 4ERXA 4OLHA 3ACCA 3QWHA 4ZVUA 1ZWKA 1V1MA 2IYRA 4JSTA 2PMKA 3IVCA 4W1RA 4OM8A 5D2CA 5LMZA 3BHMA 3BFPA 2GA8A 3L43A 1VL6A 3L8EA 4KVGA 3SFZA 1K5DA 3NVAA 1R6BX 1ELOA 1P45A 2XBLA 3HJBA 5HWSA 3QPAA 4MV5A 5C7IO 3E9NA 5KYTA 2ODWA 1LBQA 1KTIA 3NHJA 1LTHR 3I83A 4UHFA 5IJZA 5CMLA 5ITWA 1B7GO 2RKBA 1ECCA 2OORA 1NR5A 5IVIA 4WUVA 1V35A 1X1BA 1KGDA 3B85A 3UGQA 5I8PA 3GLGB 5IKEA 3QVMA 4YBZA 2ZJ7A 2WHEA 1I9GA 1RWNA 2IHBA 2WMOB 3FPGA 4QYTA 4BKOA 1B3BA 4MPDA 4B9AA 1Y63A 1BH2A 3T0IA 1EFVB 3ELDA 1F6DA 4BVLA 2F17A 2XKKA 1XZBA 1XOIA 1XNHA 1VJRA 4CTKA 4F9FA 2JLZA 3JYNA 3HB4X 4JS0A 3GLUA 3D0KA 3RWMB 2AFIA 3FCEA 2ZAYA 4JL6A 1BD4A 1G6HA 4OQZA 3KXDA 3MCAA 4J7XA 1RRPA 2G5TA 3OJOA 2PLFA 1H8HD 2HJHA 3NBZC 4HQNA 4R4JA 3IIKA 4IKPA 4G4SP 1EVQA 1SU6A 4EKDA 3AFHA 2BWJA 5I4BA 4PFSA 4DA7A 1GA4A 1TZMA 2DP4E 4R54A 3L0PA 3CCCA 3KQSA 4V2IA 1UEIA 5ALPA 5JQGB 4B4VA 4L6CA 1L7EA 2I5PO 2D59A 3EQ7A 4IJVA 1HV8A 1TKBA 2YHBA 4IDDA 4R9NA 3HUTA 3V34A 1VB5A 1ZGAA 5LDGA 4BIMA 3W5BA 1TVEA 5AI4A 4LWPA 4O4HF 3GRYA 2XTMA 5ADVA 2NO6A 121PA 3VTKA 3FDFA 2ZQYA 4ZT6A 3AOEA 4GO1A 1MQAA 2OCXA 3EHEA 4R1TA 1Y7PA 2VHZA 1QOQB 3AHEA 1UXGA 2X8JB 3OHPA 4U2KA 3PDJA 4LDNA 3V33A 4K6KA 3ZZTA 3PPVA 1MZPA 3QOWA 4EELA 1FVOA 4R1MA 1LLCA 3HKBB 2UZ4A 1RAEA 3ZK9A 5I6DA 1NJGA 4GBMA 5MFPA 1UBFA 3EGXB 4RVCA 3ZLVA 4EKGA 3ZGZA 4UM9B 4ZK6A 4ZKDA 4I2VA 1N0WA 2J0VA 3DVRX 4HQRA 1H6DA 4V0QA 1HTBA 1I2MA 1KI3A 1NZFA 1QRDA 2A5JA 2XSZD 2A30A 1JDVA 2OBMA 4Q48A 5KDLA 4BMPB 4FLMA 3KKPA 4JYBA 4KMRA 2CSUA 5ES3A 3WTCA 4E70A 4I5FA 4Z3KA 1Y6RA 3L18A 4K1LA 4R2MA 4Z99A 1R6DA 2AFVA 1JTFA 1XN1A 3FSJX 4RYLA 1KY4A 3JWHA 1Z8DA 3E7XA 3IAFA 2N75A 4EDHA 4IIJA 3N2ZB 3V4PB 3MOGA 3TZLA 5KNCH 4Y2PA 1J70A 1JJAA 1F1JA 1QTNA 2PKWA 2IXBA 1Q17A 4HSGA 3U5TA 4FFBA 1KSGA 4GI3A 4N7BA 5SZHB 2H5EA 4IDNA 4KQGA 4L74A 1JZTA 3QLVC 1XF1A 1J1IA 1D5WA 1TZ2A 1PBTA 2DSTA 2XNJA 3I6QA 3JD4A 3KZOA 3O8OA 4UAUA 2QRJA 3I8OA 1IHPA 3U19A 5DYWA 2ZYSA 3RADC 5EKDA 2QUBA 4NENB 3RB8A 3ZWPA 2NACA 1ESDA 3KKZA 2BZSA 3O8BA 4RMIA 4MUFA 1DCMA 4ZCQA 5JD4A 2PQ2A 1IJKA 1ZVMA 4RY2A 4RFVA 1UDCA 3NHUA 1NQ5A 2WSSD 1E4VA 4AF8A 4UDYX 2VAMA 3WWCA 4M1ZA 3R3WA 2VCYA 5EJ6A 2JW5A 1JW9B 3C2QA 3WMFA 1O94D 3N7TA 3SX2A 4RHYA 2JATA 3HBFA 1G0NA 5F7JA 3IDZA 3G2QA 3OLZA 5B7PA 1KVTA 4C20A 3ND5A 4MVJF 2GBLC 4I1UA 4ZEWA 2FGKA 2AKAB 4LZJA 3GI1A 3AF3A 3OLCX 4LJ8A 1HEUA 1DC5A 5LQRA 2DKOA 1PBNA 1Y1RA 3GD5A 4GKKB 4B3XA 3MWLA 1K66A 1QS0B 4GX5A 1RKXA 4FD2A 4LJAA 3RSSA 1T91A 4WTOA 3VYRB 4BV8A 3AKYA 1VLQA 2VJAA 4KX3A 1K6XA 1ZK4A 4D3ZA 2P91A 4HI0E 1ZGCA 5HFNA 2O23A 1BWPA 1JSXA 1L8OA 1KHTA 2ZTHA 4JVNA 5CLIA 1QDUA 1Y1QA 4TPKA 4D9FA 1GPNA 2OXRA 2L18A 4U9HS 1QP0A 2V7PA 1N6IA 1OTXA 1QH8A 4RHTA 8ADHA 4LZAA 3C8HA 3AHDA 2NU9B 1SHTX 5K45A 2WE7A 1N2OA 4H0CA 5AW6A 4OO3A 5BW8A 3VNBA 3GLSA 2IRWA 2ISQA 2XGOA 1NI4A 3BZBA 3DHVA 5CHEA 3S7ZA 4AN4A 3T3IA 2Q3HA 3GJSA 3NTUA 5DM70 4X84A 2Q3LA 5HKLA 3O4RA 4Y1FA 2IC5A 1DEOA 1DKUA 3UQZA 5JSUA 2B2NA 4OL0A 3PKZA 4PVDA 5CDFE 4I8XA 2I9PA 4L7QA 4KIUA 3TJZA 5CR9A 2ZUFA 4EUHA 1FNMA 5BP7A 1YDGA 2G67A 2D6FA 3MJRA 1HOXA 1V37A 2QVBA 2RHBA 3GT4A 1AKEA 3R23A 2R6R1 2YFYA 4RV5A 4GXQA 3FFBA 4P7KA 1XU4A 5EP4A 5U1PA 1E3EA 4UKDA 2VEDA 4K8RB 4F9GA 4FCCA 3IP5A 2GYVA 2LW7A 1VI5A 3EDMA 2HM7A 2W2KB 4UUNA 4ALMA 4BRUA 4AI6A 1UR5A 2GVDC 3L92A 3CSDA 3H87A 1UPFA 1T5BA 2M6RA 1W4ZA 3ZE7A 3RNLA 1C9DB 2GZAA 4W8GA 4WEOA 5HTKA 5L4SA 4KR6A 4DA0A 3TIFA 3EUWA 2WIFA 4A2WA 3B5EA 3DEFA 3R24A 2WILA 1PGJA 5LA6A 2IZ6A 2WHYA 4BO1A 1L4YA 4P3YA 3IILA 4WI1A 4ER7A 3VO8A 1XEWX 2YRWA 3CR7A 2OY0A 1S3SA 5LZ4A 1GILA 1LQUA 2UZ1A 1GDDA 1OV6A 1VIVA 1S9DA 3M2TA 4PR0A 4A91A 4GM1A 2WJZB 2OV2A 3PX3A 1DB3A 4FYKA 4M7OA 2P9FA 2RJ3A 3H5NA 3RRNA 5A6VA 2DSNA 3NGXA 3IQDB 1J9EA 3FPLA 3U81A 4JT4A 1FU7A 1ZC3A 2Q0QA 4ZO4A 1XEFA 3JALB 1RHRA 1XD9A 4LRUA 1Z2EA 2P5SA 3GZ4A 3T9EA 3MUFA 4ZOBA 3S8YA 4TS4A 5DHQA 3U49A 3OOHA 3OPVA 5TB5A 1UWCA 3G8AA 3HSSA 4NV1A 5FV7A 3GAZA 3AR5A 4MW6A 2NU7B 3OJFA 1YHYA 1JXQA 4Q03A 4D4GA 3EQZA 4DWWA 4DJ5X 3FCYA 2NNLD 2HYIC 1D0SA 2A3RA 3E81A 3IAM6 2CBZA 1XJWA 3WLMA 1SXQA 4ZHQF 5L95A 5IAAA 4S0XA 1Y4AE 2I4RA 5I5EA 2PGIA 1QNLA 1JSCA 1SUEA 3NHMA 4LYGA 4KOEC 2F1JA 1KEEB 4V02A 4N4AA 4QG3A 2JFWA 4H17A 4ZYTA 4WBNB 2BTQB 5FYQA 4A5SA 4DZZA 1G8GA 2VPYA 1Z07A 3IP6A 4WBXC 3O8QB 2I8AA 1QUEA 3QF4A 3KPUA 1OREA 2P9YA 4TTJA 2GD6A 4LQ4A 4DLYA 3DV9A 4O4IF 4CKWB 3KTFA 1SCIA 1CS0A 4RQBA 2ZIZA 1UL1X 3H83A 4W1SA 2SBTA 2EW2A 1P0IA 3WGQA 3Q8XB 3QKUA 1UT6A 2DT5A 4U5QA 2PSHA 4X60A 2XCSB 3O1LA 5K5EA 5K0LA 3F7NA 3EW7A 3FYSA 3H9CA 3K5IA 2UDPA 3KUKA 4L5JA 1IRXA 1ZMXA 5GVRA 3VXKA 2ZR7A 3MTBA 4LHEA 2R1VA 4FT2A 4C08A 4FFSA 4C5BA 3W8FA 4MRVA 1KKLA 1KS2A 1ZNWA 3KUUA 4NNPA 4Y9DA 3V1TC 1RMTA 4PINA 2I4LA 3WLRA 2XCOA 4V3CA 2CNBA 4XH9B 3ZTYA 3W7BA 4JD5A 2DH5A 3D02A 3SG0A 1X7XB 1IOVA 2XB6A 1ECPA 2YMPA 1DQZA 4NZYA 3FGNA 5CA1B 5JFOA 3S28A 2M32A 1WETA 1Y3CE 5ALXA 4NSNA 3EXIB 5J5CA 2C77A 3I92A 1RWVA 3DMHA 3K94A 3U7QB 4GL2A 4MVJM 1OXVA 2WTNA 2GFHA 1SZPA 2XY4A 3IVGA 4P3NA 3E9MA 3UXHA 3I37X 4WHMA 3FTQA 4MQBA 4PLHA 3VNAA 1N2CA 1C3XA 3OLVA 1L5HA 2RHJA 4YMUA 3HB1A 4A1OA 4C06A 3HB7A 4I1YA 2XWJI 2RGCA 3E22B 5F4ZA 4BNWA 2HIAA 3SJCA 3W6PA 1XLTA 1XVAA 4R1NA 3FKSA 1H2WA 4IR7A 4JITA 4PV7A 1H8EA 1Q91A 3E7WA 4HTAA 1TPYA 4F8EA 4J0DA 2DTDA 1UWLA 2HA5A 4QNRA 1YZNA 5HILA 2XPCA 3P94A 4HQOA 4KI7A 5AKZA 4JP3A 3NYWA 3EAFA 1RLIA 4ZCPA 5LOVB 3IKTA 4WUTA 2OMEA 4K3VA 1VE6A 5D3ZA 2RGGA 3BWBA 5KTRA 4MRRA 5DK6A 3DNMA 5KREA 4XUGB 2NU8B 1IPFA 4ITRC 4E5VA 1M8GA 1M66A 3PENA 5IBQA 1SVNA 4NBSA 1MVLA 3A9TA 4LMAA 1RE0A 2WU8A 4OJTA 1R8SA 1I01A 4TYMA 1AS3A 1CR6A 2J85A 2GAOA 1POXA 4N5LA 4TQGA 2GLUA 1D4ZA 3A9SA 3O26A 3RS7A 1T3TA 1L5FA 3F8SA 2IP4A 2QMUA 5CNMA 4K46A 2PXHA 2YRFA 2QJFA 4J75A 5E3HA 2YCBA 1M83A 5NULA 4WZZA 1CZRA 1Y8RB 1ULSA 1XN4A 2AKYA 1FFEA 1JX6A 3UAYA 4EO4A 1J0DA 1QG0A 3F4LA 4IV5A 1PJBA 4JA0A 2AXPA 4FE7A 3NBQA 3OURA 1JQ3A 1O5TA 3OQJA 1F2TB 2VDPB 3NYIA 2PA0A 4TQ9A 2PU7A 3W5IA 6ADHA 4I2NA 1TM4E 4G0OA 4D8UA 2HQSA 5FBRB 3PWKA 4ARVA 2NUBA 1ZI6A 2POCA 3EF0A 1YH3A 4J0GA 2FMUA 4HWKA 3DUFA 1A4XA 5HS6A 4QGGA 2PFGA 2G83A 3VDNB 2F8SA 4U00A 2GR9A 4KX5A 4F2HA 1XEWY 4N0PA 2RGNA 4LF4B 4XJSA 2RGEA 10MHA 1G21B 2QX7A 3LF2A 5BURA 1P75A 3OM8A 4TV9A 1WJGA 5T67A 3HXPA 4INJA 4YO7A 5EIEA 5FWDA 3GGJA 2FWRA 5BVGA 3KB8A 3CUEF 2F43A 2I29A 2FK8A 2AL7A 2REQA 4B35A 1P2SA 1U5AA 3DHEA 4C5AA 3K9FC 4JI4B 1P18A 3VR5H 2YBEA 1J20A 1ENPA 4MITA 5CAEA 3JQBA 5GOTA 2OBXA 1U6IA 2RIRA 5FTWA 3RC3A 4NBRA 4IYJA 4TMWA 3UH1A 4HAXA 1PG2A 4K8OA 4BNNA 4L95C 3RCBA 3KLMX 1H9AA 3GJ4A 3L8YA 1Z7GA 1OH5A 2RHDA 4PN7A 1ZG3A 2IU4A 3SHWA 3FPFA 5CFLA 1LSOA 2FWNA 1JP7A 2XHZA 5B4TA 4EW3A 4G2TA 5AJYA 3NFYA 1W4AA 4G85A 1N0UA 1E3SA 2XTJA 3D4IA 1F1BA 1P6XA 4BB6A 3QK7A 5ESRA 3F6BX 5JNSA 1ZLXA 2FUG6 2PKEA 3ZIDA 5KNBA 1KZ9A 2P2NA 4HX2A 4JU8A 3W7VA 1OZGA 3ABQB 4RZUA 3ZVLA 4B3DA 4EYGA 2WWTA 4EWLA 4NYIQ 1YI0A 4W6ZA 4Q9NA 3P2YA 2XT9A 4E5DA 2J31A 5T64A 3G7UA 4R2KA 4F9EA 1XQWA 1BDHA 1M2WA 2I55A 4G9EA 5FWXB 4YJHB 1ECLA 1NJ1A 1GCOA 2C2OA 3RV3A 4X93A 1EFTA 3EISA 5E3JA 3LBNA 3VPGA 4BMSA 5DW3A 5EUQB 2H2GA 3ZWQA 4AMVA 1M8PA 3CGWA 5FNVA 4AKSA 3PZBA 4N5HX 3NGLA 3DVQX 4YEDA 2R97A 3I9LA 3SQLA 2FMTA 1RHMA 3QPDA 4BZXA 2FFRA 3KALA 3L77A 3LC7O 3RBXA 5AJVB 1XJCA 5KSZA 1DDIA 1CUUA 3DB1A 4TLAA 1CEXA 2VKTA 4OK6A 3X1MA 1XT6A 1HE4A 5AJHA 4QZVA 2A2ZA 2O0MA 2R8RA 3WWYA 2GN6A 1X1RA 8OHMA 5JNWA 4FR5A 3REQB 1IXRC 1SXJD 2P5TB 2Q6TA 3HUDA 3HA2A 1EVJA 3M6UA 1MEJA 4S1NA 5FQNA 4AIRA 2F6RA 2QP4A 2D0PB 1T0UA 1JL3A 3M4XA 1T13A 3FWPA 1X7WB 4M55A 1WMAA 3BFVA 4PRLA 1A0OA 5G40A 1DKRA 1DAHA 3B1KA 5BSRA 3OOYA 1UPUA 1Y9DA 1PZFA 4MJLA 4EJSC 1I94B 1DC8A 3CONA 2AMJA 5DLEA 5JVDB 3VZRA 5KTYA 3BXEA 2IXAA 4ZVPA 1NBWB 4J91A 1ACLA 3CLHA 1TU0A 1QX4A 3KQHA 4NNOA 4LOIA 1ZN2A 3N2NA 1RYZA 1SC9A 4XA8A 4X20B 3RUIA 1JQDA 1XZFA 2WG0A 4LYEA 4URVR 3N87A 2Z8XA 3OUZA 2AR0A 1OBOA 2AH5A 2Y93A 2X0DA 5CH3A 4NJOA 1GG5A 1GV1A 3R7AA 1IOWA 1TJ5A 4A03A 1QONA 3VR6D 2VF7A 2YXDA 5LPNA 1Y1PA 2JCGA 4PLTA 4YY3B 4JWKA 5K0FA 2UUAB 3UJNA 1N3LA 1L4NA 3U26A 2AR9A 1VPVA 2WQ7A 2DPLA 1YQ9A 1WXDA 1DX4A 3NP7A 1BJKA 4MVJP 4E5KA 4M7WA 2OG1A 2C95A 1E63A 4IIDA 1EG2A 4UVIA 2HHJA 5HQ3B 5BPFA 1B23P 2C0PA 3VVCA 1GVHA 1HLPA 2F2TA 1L7QA 4ZICA 4Q47A 2QNIA 4BMYA 2R3SA 1IMOA 1GEGA 2WU3A 5HKKA 1NYLA 1UFRA 4N8DA 4WCFC 5BYBA 1A9RA 1NN5A 4YQYA 1KDYA 1EX6A 2PMDA 1I6KA 5B1YA 3SBXA 4NOKA 2Z1MA 3NR2A 1GGHA 1RQ2A 1OLSA 3I9FA 1CU1A 1VE3A 2QTTA 4TKLA 3AKZA 4AD8A 1HNZB 1XNJA 1XZJA 3LUPA 4BNZA 2VF4X 1J42A 2XQIA 1WSBA 2WJ4A 4ETIA 2PVPA 2VYVD 3W9YA 1VJ5A 3D7MA 4XVHA 5JCJA 2IYYA 2FJ0A 1O6BA 3D7NA 3GUZA 4MLDA 2O8FA 3U3RA 2BJHA 3PFGA 5CVJA 3T34A 3TI9A 3RWOA 1A4RA 4JT2A 4LBZA 4DOMA 5I7SA 4ESEA 1QIGA 2G25A 1PR6A 5C7LO 1JJ7A 1G4UR 1T5IA 4JLWA 5L40A 1RRMA 3WGHA 3L0SA 1EZZA 3MMPA 4OPMA 5A7GA 2GZHA 5REQA 4Q9LA 4DF3A 4E5UA 4DLWA 2VQEB 1OAOA 5A3SA 3ZZ1A 5EJ7A 4WY2A 3NORA 5G02A 4CU2A 2X5NA 4LNUA 3TKAA 3ZR4B 2R8XA 5DVZA 2Y99A 5C3MA 2V1XA 1O0SA 4YRPA 4RTKA 1C7RA 2GJSA 3DXYA 1Y82A 5LD2B 1VMEA 2QI9C 4R6WA 2A0KA 4HWRA 7ABPA 1XPUA 2OO7A 3I4LA 1JPJA 1S9HA 3HU3A 3QU5A 5DCLA 2QVYX 3K1JA 1HFWA 3WK5A 3IOEA 2EERA 2KBEA 1D03A 1UDBA 5EXXA 3VDQA 1RM4A 1FRNA 1OI7A 2HJWA 1SXJB 1YZUA 4R83A 4YJFA 1QYDA 3A2KA 2ZJOA 1GTG1 2P6MA 3HVJA 1SU4A 3IJEB 4H77A 4LOLA 4TWIA 1Q7BA 1SNYA 5JCOC 1DARA 2UU9B 3SZLA 3Q6IA 1VZ2A 2VZEA 1GLGA 1WUYA 3MFQA 2XF2A 3COWA 3L6CA 4PSDA 2CZCA 1OTHA 1RYHA 3QYPA 5A4DA 2PFSA 4NABA 3REFA 2NU6B 4FR0A 4H08A 4NJMA 5ETJA 4ZWNA 4J0QA 1AM4D 4HNUA 5BRJA 3KKEA 2G77B 1IUPA 3LSTA 3P0FA 3NVDA 3KSAC 5A9RA 3IE1A 1C7IA 3AERB 4R1LA 3TOZA 2AV6A 1E2NA 4N18A 3R0XA 4EFDA 2X4LA 2MSEB 3ISVA 3REOA 3O84A 5LNK1 2BFNA 2FSVA 3DTNA 4YQZA 1GAEO 1JXMA 3FF4A 3HO6A 1XV5A 2PT9A 4O4LB 4QODA 3LHKA 3T5CA 3L01A 4MW0A 3KP1A 3UUFA 2BFDB 3C5EA 4I55B 1N9GB 3WV5A 4BVFA 1CY1A 2H9AA 1SIWA 2V7EA 3KEFA 2VI5A 4X61A 2VNKA 4KJXA 5LYJF 2F3QA 1KKUA 4IFIA 5DHTA 3DZDA 1U2DC 1FSSA 4TTIA 3RKRA 5B30A 1KU0A 1K75A 3DKRA 4YPVA 5J4HA 1Z08A 3DV2A 2Z3WA 1AXGA 4PX5A 1LPOA 1R10A 1Z2CA 3TZEA 2FEAA 4C6TB 5CD1A 2YIMA 3ZIAA 4H6XA 3AUJB 1M2OB 5LBUA 3PNKA 5T8KA 1IULA 2Z3ZA 4JR2A 2HBQA 3BFKA 1OMOA 3NETA 4FHDA 4RK5A 3G13A 1OXSC 1L5VA 1YASA 5DIZA 3WMEA 4NBVA 5L3SB 1UKEA 2B4RO 3EG9A 3A9RA 4TLEA 1KNQA 4KGXA 1JG3A 2B4AA 3TM4A 3GFSA 5ALDA 5JFTA 5P8WA 1YL7A 3DV0A 1Z22A 4C7JA 2CJXA 1D2EA 2OUIA 4UVEA 3OHMA 3T1HB 2YYAA 4ALJA 5LXTB 3SMQA 3N53A 2X5XA 4B85A 1HDEA 3M49A 2J9ZB 2YMLA 3TXXA 2WBLC 3C41J 5DGTA 2Q3BA 1SHUX 5IF9A 2V97A 3UWKA 3O8CA 3H05A 3G0CA 2DECA 5B12A 1Z06A 2ZXEA 3CVVA 4LFBB 3ITKA 4N9QA 5T6BA 2GGSA 1V1MB 3NFRA 2ZW9A 3PICA 3DE4X 4LXQA 2QTAA 2QQFA 3B6ZA 1GPYA 1YOBA 1N77A 3A6HA 4BNUA 1CQPA 1KI9A 4KZPA 1WBDA 4GE3A 1XCJA 4FGUA 4ZOEA 1MR3F 1WQ4A 3R6TA 3FHJA 3J7TA 4MS4A 2SECE 1QJ4A 2DTXA 3BWXA 1I36A 2BGWA 2I78A 1KSJA 4RTMA 1HX7A 2GBIA 3QA9A 1ECGA 1CUAA 1ZWLA 2FWPA 4MJXA 2K5UA 4PZDA 5IJXA 1KQOA 3EIOA 2VLBA 3LQ4A 4CM6A 1CLUA 4G23A 1FP1D 4BNMA 1U0NA 3WTBA 3TOCA 3LCVB 3PEFA 4LDJA 3B9PA 4LZWA 5FBWB 4NOMA 4G41A 3ZLBA 1V26A 3HJAA 4YP0A 4RCZA 1H42A 4J4BA 1N1EA 4U6SA 4DC0A 5LMCA 1AX9A 4N0EA 1DX9A 2HLDD 4GOLD 1VI6A 5TS3A 1VA4A 4GP6A 4EHJA 4YI5A 3EVGA 1FP4A 3OEEA 3N5KA 2Z0MA 1Q7CA 5LQMA 1NOJA 3PLNA 4V0NA 1I2ZA 2BDUA 4BLWA 4RPKA 2NWQA 3PXUA 4QBIA 3G2PA 2YV3A 3KE9A 5L9AA 3L04A 4F60A 1Y9JA 4YMLA 1WM1A 4BMZA 1WV0A 4FYHA 3KWMA 2VHUA 4OBEA 1XFAA 1FDIA 2IYUA 3GEDA 2C94A 3VSBA 4P4LA 2OCDA 3E8MA 5EG5A 5SV2A 1K08A 1V1RA 3KQTA 1UMCA 2V5VA 4PFQA 1E2IA 1BE8A 2BFCA 2FB9A 2QRZA 3E1SA 5JADA 3H1EA 3A0UA 1YXMA 1T35A 3W4IA 2V7XA 1EP2B 3L07A 2RHMA 3AVXA 2FX2A 3SSAA 4FYYA 3WB0A 3VAYA 2ZRBA 2BM9A 5IJ0B 5JH7B 2J5BA 2OFOA 2Z5LA 4P7FA 2CJYA 1DKLA 2C4UA 3G9ZA 4F2WA 1OE0A 1ONNA 2J8ZA 2QD2A 1PUXA 4R2HA 4NAVA 2PGNA 4PTYA 1V5GA 2D4HA 3HCPA 3TW8A 3WLOA 2PWZA 4EK9A 3ZD8A 2DBYA 1D09A 3D4NA 4FYJA 3ZDAA 1MNQA 2C99A 3Q1LA 3O3NB 1LC3A 2ZBFA 2QJTA 5LU9A 4MYSA 3WJ1A 4OTZA 1S2LA 1QIHA 4ZI2A 1H0KA 2EWVA 5CLQA 3ORYA 1OVGA 4XX0B 5EHXA 1Y9EA 2XMRA 4IO1A 2Q0XA 3AG6A 3JARA 2JAHA 3C5VA 4UU8A 5KMGA 2ID9A 4KG7A 1FFGA 2F8LA 4MMZB 3AJ9A 4IIJB 3QYAA 4QFBA 3DLAA 1E96A 1OGIA 5JAQA 1S0UA 4RZQA 1CTQA 1DJOA 3C3AA 5GP1A 4HDNA 4ZIRA 2V5AA 1NMXA 3O74A 4RIFA 2CSXA 1AQ6A 3K8QA 4BV2A 2ZT6A 2QBYA 2J3KA 1AA6A 2UVDA 1RBMA 1NVVR 1OLXA 5H3HA 5LQAA 1BE0A 3GVCA 2OM6A 2ATXA 4MS3A 1KSFX 4RD6A 5KJFA 3ETCA 4FW9A 4KQFA 1JQKA 4TV8A 4QEKA 5L7WA 4CM8A 4IINA 3UMGA 5KTSA 1Z17A 1YRAA 2YFQA 4JL8A 1T3LA 3GDGA 3I9OA 4D3FA 5AM3A 2MYNA 2YUIA 3DAYA 1YZKA 4XYEA 2HEGA 2N46A 2FH5B 4ZAFA 3TLJA 3HABA 3QW2A 1QUFA 2C7BA 2R79A 2ZROA 3NHKA 1P29A 1YJ8A 3SQNA 2FQQA 4WFKA 1VRCA 3G02A 4CEHA 2QN7A 4D81A 1PK9A 1QK3A 3AHGA 4E51A 3T7TA 2FPXA 1ZOOA 3BYZA 3NT2A 4L9SA 4WOKA 5JNUA 2W6OA 2XB4A 4FXOA 1QPZA 1Z73A 3C6YA 3HV2A 2HIMA 5F73A 3WKDA 1W9MA 3RS0A 3U13A 1KFJB 1XX6A 3DVSX 4M0CA 3UATA 3FIJA 3EFEA 2PLWA 2Q9AA 3HEBA 3ZEAA 1I6LA 3OPYA 3Q72A 3TX2A 1R18A 2Q5CA 4J6FA 5KYWA 3WVNA 2VT2A 3DCJA 2NN3C 3IP7A 5DHFA 3ZWAA 5HS4A 3FETA 3JQ8A 3T54A 1CJVC 3EZLA 5AW1A 1PGQA 1QH8B 7ADHA 3PA6A 5LMUB 3T3MB 4YAEA 1ISGA 2ZJAA 3JSXA 1NPDA 2DBZA 4MQFA 2JFXA 3BC1A 1ZUD1 3T3OA 1Q0PA 3QBJA 3NJ8A 3HL4A 4J90A 1JR3E 4LHWA 4YO8A 1NI4B 1CJSA 4YRZA 4JHXA 1UZNA 2O0LA 3UT6A 4JC4A 3KK0A 4ND3A 1IK6A 4KN5A 3EZNA 3SBOA 1L9KA 2LUOA 1Z3CA 3C3YA 3PNPA 1GL3A 4QM7A 4QARA 1YCFA 3GGSA 4HWGA 1SVUA 4AMYA 3HL0A 2PGOA 1PK8A 2QDXA 2W2TA 3TX6A 3CLUD 3NPAA 2QN2A 4U5XA 4GE0A 4W1PA 5IDXA 4FOTA 2QRVB 3SNKA 4J3FA 3WBBA 4BS9A 1N7HA 4NZPA 2R25B 5IC5A 3U6BA 1XAJA 2EFDB 4TLCA 2H9YA 4JX8A 2V6GA 4UUQA 1QYVA 2HMUA 3VTZA 3WQRA 2XQVA 2QUJA 1TIBA 5CT4A 2V55B 3UJ9A 4FBLA 3QYFA 2ZVJA 4BXOA 1R64A 2PNFA 4WOCA 4NBUA 2EATA 1BD3A 5JC8A 3DEZA 4MV0A 3BMNA 3D64A 4OJKA 4Q3DA 1NG1A 1F4PA 3O2QB 3SZUA 5MN4A 3FVWA 4A9AA 3GK3A 1Q3HA 4E5NA 3ESBA 1JE0A 2O4UX 5ALQA 2FV8A 4QDUA 4M7PA 4ZMSA 1YR6A 3L1KA 1LX6A 5LA6B 4Z5XA 1TO6A 5EIXA 1VOTA 1KJIA 5JLJA 3ICWA 1PHPA 5IMBA 2GRUA 1DTSA 3CE6A 5HX7A 4UQPA 2PKXA 2WV7A 1M1NB 4KV7A 4N3BA 2PZBA 2C98A 2PK3A 2CN1A 4OHFA 4R6XA 5T4EA 4TXLA 3N2EA 3IR7A 5BR7A 5G1OA 5BYJA 1G5IA 1HFKA 5DLQC 1XRMA 4E14A 4WLNA 4D9NA 3QX3A 4RHCA 1PFWA 1PSWA 3G1UA 5L7TA 4G5YA 2ASVA 4E5YA 4ENTA 5JWOA 2G0TA 3DF7A 5HBGA 5CB8A 2CLKB 1NXOA 2RAFA 2IYPA 3BGWA 4PNHA 3RIEA 4AJ4A 4BX2A 2E5WA 1DEKA 1SPXA 2IU6A 1Y48E 4JIGA 5I01A 2HRZA 1JAXA 1UPCA 4IRMA 4UBKA 3JPWA 3ORQA 5EZSA 3USZA 4LDZA 4PXYA 5JSFA 1SJ9A 3CTPA 1RQNA 4WXEA 4ZVOA 4B6FA 1LI7A 4QXMA 2VUIB 1P80A 5CXQA 4YRSA 1X7YA 3DOIA 1I7LA 4RHUA 2CHFA 4S2UA 5EAIA 6GPBA 1ORTA 5AR1A 4E46A 1ZK1A 3SLKA 3R74A 3FPJA 4MWCA 2HYDA 3MAGA 1ODFA 3QUCA 3ICEA 2BM1A 3DGEC 4K05A 1CK4A 3A4YA 3KDSE 1HDGO 3OWOA 1XRRA 4D44A 3HCRA 3QF4B 4Q4DA 2OZKA 2R8PA 3EB9A 3R8CA 4B7ZA 1CS0B 1K97A 1OI3A 2GX6A 4Q1CA 1R4NA 3A1DA 3WK7A 3VA7A 1K5HA 4OI0A 1O7JA 1CZHA 5A2GA 1DOAA 3U7IA 3G6KA 4PS0A 3SOZA 4GHWA 1JIJA 1FFSA 1UJ6A 3QH4A 2L42A 4MLCA 4G0UA 3EPHA 4TVOA 3JQGA 1E1LA 4QUDA 5FOXA 2JCXA 3V2HA 4QSMA 1ZN8A 1YHZA 1C0IA 1N2ZA 2HZ7A 2XKJE 4JBIA 4DYHA 4KE8A 4LRWA 1MB3A 4KQJA 4ESVA 5K8VA 3TQRA 3LPDA 3TK1A 5CD9A 3ZJVA 2QRLA 1P73A 4D25A 2ZIGA 1DBQA 3UANA 1HDRA 1LJLA 2OK8A 3TAUA 3FM9A 3T9CA 4EKIA 5JS8A 1MQ8B 4UBNA 5ISMA 2RBKA 4WK6A 1JV2B 2XMCA 1YZFA 2RGDA 4I08A 4MPPA 2ENWA 5KNBD 1O6ZA 1IVSA 3A2LA 4UXJA 3GMDA 2QLMA 4TMZA 3OE1A 3CB2A 4J29A 1N2CB 2QUKA 4TV9F 1L5HB 3D1VA 1V2HE 1W4CA 3GL9A 4B3BA 2YASA 3P9NA 3PYMA 4LGVA 3ZTTA 2HMVA 4W5QA 4NXNB 3STXA 1PLLA 4QUJA 2BTEA 3G2MA 5D51S 3FPCA 2ZRPA 5BV1A 1B42A 4J07A 1BVUA 3ZWDA 1YA6A 5F21A 3GLIE 5BWBA 3QF7A 1SBZA 1VRVA 1ZL0A 4NE7A 2EFCB 4JJAA 3H4MA 1A5BB 3PFCA 1OYWA 4JKIA 1YHNA 2VHYA 4GIBA 1FPQA 2YWCA 4RVFA 3KLNA 3PXAA 1LI5A 2ZBUA 5KU1A 4H6PA 1YVRA 3GEMA 1UDAA 1TW2A 4IW3B 3G2LA 4IVRA 1NC3A 1U7WA 2CYCA 1G3RA 1AGRA 3OEYA 3OQNA 3TIIA 1CNEA 2G8LA 3CF2A 1YZHA 1WIWA 2WLSA 4L3VA 1P7WA 4O2BF 1OX4A 1QQ7A 3QLTA 1U7OA 4D9HA 4Y2JA 3AF6A 1QHGA 1C0LA 2HWYA 1RC1A 1AXEA 2IHZA 4JAVC 4UDNA 3RHSA 2J7PA 5GZ1A 3U4DA 2A1TR 3MTGA 1PFKA 1ZEJA 2WKRA 2EG5A 2Y2UA 4LYAA 1PT9A 3PNQA 4ZO9A 5GPBA 1VSBA 3FZGA 3IULA 2X0JA 4A6PA 4JZKA 4A36A 2NSLA 4MTCA 4HN2A 3ZW9A 2AC2A 3KLOA 4Y6QA 1X19A 3KVVA 1EWVA 3V4LA 1Y98A 2H06A 1IU9A 4TTTS 5JHGB 4HS4A 1RWWA 2VPWA 3P45A 5DRTA 2D1RA 1E18A 3E9DA 2ZQZA 4BMOB 3NDBB 3HPQA 4EG5A 3DKKA 2QTLA 4RYDA 4R2XA 5BN4A 2VDUE 3KSUA 4IVQA 4G1VA 4BWFB 4GBJA 3DUFB 1VP9A 3BICA 3I2GA 1E64A 1M0EA 2AI2A 3N3AC 4HH1A 4RU1A 2VQSA 2Y2VA 5DMHA 1VE9A 3MTAA 5IW8A 5BT9A 4FQ7A 3UYKA 1JAIA 1EFKA 4LHVA 1QGUA 3GRZA 3NV7A 3U16A 3KHSA 4NCHA 3ASYA 3BIJA 2O5RA 3ED1A 5BVGB 2QKYA 2R68A 3ETGA 2REQB 4J0CA 1L7NA 1JEDA 4NX2A 1CY0A 2Q3EA 2IXEA 1E1NA 4NY1A 4PG4A 3TYXA 2C29D 2JJ2A 3ABSB 3KJXA 4LE1A 2NNWB 4XCVA 2G1PA 4IZHA 5CAEB 2FMXA 3LUCA 4LJSA 1GG2A 3QXGA 1FQJA 2HBYA 1YJQA 1Z16A 3E5NA 4PBRA 5HKKD 1C9YA 3I64A 3OF3A 2JGAA 3RF7A 1EUDA 3HJUA 3GYGA 2OOSA 3UT0A 5JATA 5C32A 1JIVA 1ONSA 1RXEA 4FINA 4IX1A 4PPNA 4F1JA 1B8NA 2ZI6A 3T0GA 1UJ4A 1RWPA 3TNDA 3BREA 1SBQA 3HY4A 3DGFC 4C22A 2GAIA 3CH6A 4HMQA 4LXYA 2FG5A 5GQSA 4FDVA 1E9DA 2CLHB 4X64B 1Z0JA 2GRJA 1H1TA 2GYYA 1QG4A 2WJPA 3MLEA 3WOVA 3NDRA 4CLEA 4WXHA 2YY6A 2XNSA 3HCOA 3KS9A 2CVFA 5LBTA 2C1ZA 1T6YA 1FDTA 2BGJA 2DQZA 4J94A 3TRDA 3KSDO 4UUPA 4YT8A 2PO7A 5LDHA 1XCBA 5FTNA 5FOTA 1EDEA 3Q3HA 5JJCA 5K0SA 2QDKA 1IY1A 3GFPA 3MVEA 4FYWA 5EEGA 1QR2A 2IH4A 3LD9A 4ITVA 1V39A 2Y1DA 4D8YA 4I6JA 3UAWA 2MYPA 4PZCA 1NLUA 1SUCA 2R00C 2R7LA 1O54A 1TQ6A 5MFZA 2ERXA 4R2JA 2OB1A 1EBFA 1KK2A 1ENZA 1PV1A 3OMWA 2OPHA 3ZDZB 5CFRA 2D62A 4KK3A 1JZSA 2GHIA 4OGFA 3F6RA 1LLFA 1MJNA 2QYOA 2Z8YA 4OQFA 4EY7A 2VP5A 3I05A 1Q0HA 3BF7A 1RWKA 3UMRA 3O4VA 1QVWA 1GRCA 4FKBA 2HO4A 1A8QA 3H5WA 4MQUA 2XZDA 4HQLA 4QNMA 3WQQA 4GKBA 4Y2RA 4FGZA 5BQFA 1EIWA 2B82A 1A9TA 1CRZA 3N07A 5LQKA 2O6LA 1O5IA 3C6XA 1NPTO 4P9NA 2VKQA 1BDJA 1GYQA 1SU7A 5CEFA 1U5BA 2WINI 4RZ2A 4NEHB 3NAZA 2EGUA 4L0CA 5CM2Z 3M9XA 4X90A 3RK4A 1YMVA 3PC4A 1XCPA 3ABIA 1E3WA 2H08A 1RACA 4GRAA 4CM9A 4OMUA 1LA2A 5HQTA 2I71A 1ZSNA 2X4DA 5DYYA 1NUSA 1OU4A 5IF3A 3LTNC 3ADKA 1YACA 1JSLA 1RIFA 3QFRA 5K4AA 1LF5A 5TQJA 1V8ZA 3A3NA 1CE8A 1VSUA 2ZIEA 3H1BA 1P8JA 1K9VF 1GFWA 1MZVA 2DHCA 1WXGA 3DL2A 3N7UA 5LZ2A 4YK7A 2W37A 1PS9A 3A9CA 4ND7A 3VHXB 1NN0A 3Q2IA 4IGIA 2TMYA 2Y6VA 1XKQA 3MWDB 4QPZA 3T1OA 4B46A 4J0KA 1T9HA 4IEFB 1JRLA 3ZWBA 5CDFA 1M6VA 2BW0A 2HRDA 1KC1A 3NM4A 1TD1A 3WGJA 1J0AA 2C42A 1GTRA 4UBLA 2OEPA 1YF3A 5IZ4A 4FYXA 4CJXA 2FX3A 4JFAA 3CNQS 5JS6A 3KYBA 4JC8A 4UD2A 1GNSA 1B74A 1SC6A 3ZDRA 1QHYA 1M34E 5BSWA 1R5JA 4QHSA 1ZCFA 2FLWA 4DWOA 3PX7A 1I0LA 4MS1A 2NZWA 1E8MA 5CP8A 1YKGA 5D85A 2YW9A 5LP6B 4YCJA 4YWJA 4FWTA 3P9XA 2OFXA 1H2EA 3LX6A 1L4BA 3E3NA 4NBKA 3FFTA 3TKYA 1QGYA 4B0OA 1MTOA 2CK3A 3WNVA 1LI4A 1E2MA 3MIIA 3NBXX 5HJEA 3GJYA 2J0UA 2W93A 5LR6A 1FYEA 3L8FA 1P5JA 1H93A 5IG2A 3JQPA 2XZLA 3C6BA 3PYLA 3OP4A 1NIPA 1QORA 5HYVA 2VYND 3SR0A 1ZMTA 2O8FB 3QVLA 2J32A 2P9CA 2CXXA 1VIYA 2H1VA 1POWA 1S4MA 2WKPA 4YMWA 5LP1A 3I0NA 1XWIA 2IV3A 5AM0A 2O2DA 4P33A 5JBQA 4KPUB 2CCGA 3G9UA 4RKYA 4UEWA 4Q9DA 3K71B 2ACWA 2A1UA 4EB6B 2PRIA 2CL7X 4RMNA 5AXCA 3WHIA 3B13B 2VXOA 5ADWA 3KOUA 3VR4A 3LCCA 3OA0A 4Q1DA 4WWHA 4TMVA 4KXQA 4TS3A 5REQB 2Q29A 3RJMA 4Z0PA 2J3LA 2RGWA 2W70A 2PUCA 4QGHA 1ZM2A 3L6BA 1OF1A 3OH8A 3TZHA 5T6MA 4LXHA 1J24A 4RY9A 1ITZA 2PPVA 2H7XA 1USVA 3PIIA 3S4YA 1NVFA 1XE3A 1YZGA 3VSEA 3Q98A 4MJ7A 3WGOA 2WTMA 3AY6A 4OQLA 3WRXA 4UW9A 2FQ1A 4DB4A 4UHEA 4I66A 4MWSA 5CVDA 1DEHA 3BAFA 2FGJA 1PU2A 4P4SA 3L7KA 3OT1A 1EE9A 1R8XA 2LE0A 2WLTA 4U39A 2VK1A 4KXXA 4NQZA 1N2IA 2Z4RA 2OV8A 2PZJA 2ZT5A 4R8SA 3LJKA 4FFWA 4IEIA 4WQMA 2VH5R 3SR3A 1NJSA 4B44A 3RFUA 4KO1S 3NIWA 4DV5B 5AI0A 2V74B 4UTVA 5KTNA 1UJ2A 1HT1E 4ILEA 1N92A 1D1TA 3R20A 2XCRB 2H7YA 1W2HA 1O97D 2XEXA 1UPXA 3H5LA 4WL0A 3HMKA 3SZ3A 3TKLA 2RC6A 1GCAA 3VPHA 3ZE9A 4Q1FA 3FCSB 2I4MA 3KE8A 3IALA 3K2IA 2QVZX 1V5IA 3NHAA 4BMDA 5IN5A 2FTKE 4BNDA 4F4FA 3OEED 4ZQCB 4M0KA 2ZI9A 4GZMA 1BCRB 1R0YA 2I8CA 3L7YA 5CNIA 3NGMA 3VU0A 3GZJA 3VZBA 4F86A 3SHVA 3UXYA 1OC4A 4G0PA 4RGVA 5KSWB 5JANA 4DG8A 4CMHA 4URFA 2ROQA 3ENWA 2XVZA 3N2YA 4Z4GA 3O03A 1RRGA 2P4EA 3QI7A 1VKZA 4W82A 4CMKA 4U2FA 3BH7A 4LJRA 5KSPA 2C9CA 2C1EA 2PVSA 4P58A 1NVDA 5AVTA 3EDOA 5K3EA 2KPOA 4B6GA 3ETJA 3LT2A 2FHPA 1V0JA 4F38A 3AF5A 2HRRA 3KEMA 1QFYA 1S2GA 2QMYA 4M0EA 4GC5A 5BOSA 2F00A 4YGXB 2EKZA 3NB0A 4HQ6A 5B53A 4B87A 3OSUA 2DT8A 2JH9A 1R0XA 3L1VA 621PA 3WSWA 1NBME 2R47A 1YOVA 3FBWA 2AYYA 2Z98A 3CKKA 3MOSA 4BU1A 4DV4B 5JS1A 3AI3A 4Z4IA 5KQRA 4KSBA 5THQA 3K5PA 4TYQA 1P72A 3S2IA 2RB4A 2C54A 2IYSA 1IC6A 4FNAA 2I1QA 2CFCA 3T4PA 3C6QA 2NTYC 4HR7A 5K0JA