2J85A

B116 of sulfolobus turreted icosahedral virus (stiv)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
Knots found
sequence length
117
structure length
117
Chain Sequence
GKVFLTNAFSINMLKEFPTTITIDKLDEEDFCLKLELRLEDGTLINAIGHDSTINLVNTLCGTQLQKNRVEVKMNEGDEALIIMISQRLEEGKVLSDKEIKDMYRQGKISFYEVWHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords STIV B116
publication title A New DNA Binding Protein Highly Conserved in Diverse Crenarchaeal Viruses
pubmed doi rcsb
source organism Sulfolobus turreted icosahedral virus
total genus 24
structure length 117
sequence length 117
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08960 DUF1874 Domain of unknown function (DUF1874)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2j85A00
2J6BA 2X4IA 2J85A 2J6CA
chains in the Genus database with same CATH superfamily
1CRLA 2E1RA 2WSIA 4FD2A 2GZ1A 2DQYA 3RGGA 2YWEA 4ZOQI 2UZ0A 4U9IS 5JYEA 4I8IA 1T36A 3IALA 3IXMA 4UTOA 3RV3A 3W2IA 4JVLA 1K7CA 1MA3A 4MUAA 1KOLA 1JSCA 5CK5A 1L7NA 2QAIA 2EL9A 1R8QA 3BCSA 4IJ6A 5C0OE 2WOOA 4FE4A 1T6XA 4HNAB 1G2PA 4YVFA 4G0WA 4TMYA 1OASA 3CMCO 4WLOA 5KSPA 2Q29A 3CF6R 1L1FA 3TD9A 4B83A 4RNCA 1AKEA 1C7EA 2FWRA 3WRYA 4C5CA 3ACCA 4R71A 5C5IA 2Z5FA 4MVYA 3RVLA 3G2OA 1Z4OA 1FIUA 3Q5EA 1A50B 4CQNA 4B4WA 3O93A 5CH8A 3LUPA 2C4MA 2MWMA 2J7PD 4NU8X 3PC8A 1MGOA 1P5RA 4RZIA 2ZFUA 1KWGA 3BT7A 3DFZA 2AXQA 3LLMA 1CUYA 4OBEA 5DGHA 1BJRE 3OTIA 3R3YA 3S1AB 3JD3A 4J7AA 3KYDA 3QSGA 5IYZF 3RUHA 1X1QA 3AYZB 3PBKA 4BNDB 3F46A 5IABA 4PZLA 2VQFB 4XE5A 2YV4A 3DO5A 2WHPA 4QUGA 4B73A 1YB4A 2C95A 2Q4RA 1EK1A 2BFOA 1JLKA 1U7OA 1VCNA 1XKLA 2RARA 2HZBA 3GLTA 4RK7A 4XDGA 1PR6A 5A5GA 4H60A 5EJ7A 2PE5A 3ESCA 1QZ3A 3ANTA 1EFPB 1BDMA 4GAEA 2WICA 5EIXA 2O6HA 1N7GA 1ZICA 4MUXA 4QGGA 4R8VA 4U8GA 3ORFA 4XIFA 1UJCA 1CYEA 1SQSA 2P1DA 1O58A 4P3KA 3K2BA 3I1FA 2X9GA 4K6FA 5I7WA 4RTKA 2IOFA 2H4YA 2A7QA 4DSNA 3RTGA 3RG8A 3NJ8A 1E6LA 4MPPA 1PR1A 1YQUA 4CEHB 3T3EA 2HRZA 4H7KA 4G26A 4RD0A 4Y98A 2I6FA 5CNMA 4FZJA 3K09C 3DBHB 2V54A 1PJAA 5CTAA 2YV3A 2DTDA 4WBNF 4RSHA 4YRRA 2D13A 3WR5A 2GFHA 1QQ7A 3FDJA 3MRVA 3J81k 3Q3CA 4RSRA 1GTVA 2JLQA 3U37A 4LNHA 3D1JA 4BP1A 1U2PA 2R66A 3AJ8A 4OKIA 2CFCA 5LLTA 4FMDB 3H83A 4QBFA 1EG7A 2Q27A 2RDMA 3FA2A 2ZUEA 4GMXA 3Q6MA 3F96A 1T3TA 1QH8A 3PNMA 4MYHA 3BREA 1Z5OA 1O2DA 3GXOA 1SB8A 1E3WA 1WXHA 2RGXA 1AM4D 3U3MA 2D7JA 2PGXA 1KMCA 4PBTA 3IUEA 4NZPA 2GASA 4I46A 1R9GA 1JEAA 1ISFA 1Q7GA 2NT4A 3LPCA 3PDUA 5EQJB 4V1CA 5KTMA 1IOWA 1CK4A 1QHNA 3OQBA 4LI3X 5AK4A 3TSCA 1QHHA 3RAFC 2VYND 3DZJA 4IMPA 4DXDA 1IB6A 2XZLA 2F59A 4FHGA 3BFPA 4KACA 3V4OA 2XMPA 1E4VA 2JGKA 3MA0A 5FTMA 3P9RA 2BEKA 1C0LA 1M66A 1YJCA 2EYQA 4M0LA 3I9MA 5GAJA 3RHTA 4QUAA 2GVDC 4J0FA 5M5BA 2PS9A 1GQRA 4YP9A 4AX4A 2IX3A 3D3EA 4Q4HB 2GN0A 5C8YB 2E18A 1M34B 1ZAYA 1ZNXA 3W3ZB 1XCBA 4BLTA 4P0PB 3WTBA 1B0PA 5CX4A 1X14A 4M1TA 3Q8KA 4JSTA 5F76A 4GE0A 1AKUA 1WMDA 1XA4A 2PXCA 2ZUSA 4IHJF 4JB0A 1FFXA 3UWDA 4BMDA 4I5IA 3BBPA 4LJYA 1LJ8A 1YDWA 2HSJA 4OQNA 2YIMA 2IOQA 4URFA 4Q05A 4RQTA 5EJAA 3PLRA 1OXMA 2F1JA 2JGJA 1VPEA 3QELB 4HUQA 1VKOA 3VOTA 1DJQA 4MROA 1VJRA 3O4VA 1QWSA 1ZMOA 1NQWA 1D5CA 4JMPA 4WY5A 3V2IA 3ZQKA 4CMGA 5LZ9A 4X0EA 1L5KA 1C9JA 1MQSA 1PZEA 2GPWA 3N8HA 3I12A 4ZMRA 3E03A 4JC4A 4ZYWA 5BN4A 4ZEWA 3FR7A 4FDLA 4N01A 2IW3A 1RPAA 3ZQ6A 5CAEA 1U7PA 2G9VA 3G0GA 3RSSA 2CNNA 1EI9A 3G5UA 1DLIA 4RKYA 1AS2A 3X1YA 1R5OA 4B31A 2E48A 4F04A 4C1NA 1GYQA 2QD3A 3W6NA 3VR4D 2VF5X 2AMJA 5JAMA 1PT9A 5D84A 5JYBA 4B47A 1X1AA 2X5NA 3EPPA 4G8BA 3J7AC 4RM3A 1L5OA 3I0MA 4JYCA 1NN3A 4AJHA 1H69A 2HGSA 4MW4A 4C29A 5LXTB 5DYIA 1JE1A 2ZJYA 2CJWB 1Q2XA 2ICAA 4D9JA 4OB8A 3T41A 4CL8A 1BNCA 5KYVA 4NYIR 4JI5B 2KI5A 2P6NA 3ETGA 1TVKA 3ZW7A 4AYTA 4PGHA 1T6NA 3IP3A 3K16A 2ZJ0A 4OKNA 5HIAA 4CF5A 5ALHA 3SHWA 5HF6A 2YBDA 1D7AA 1XALA 2QN8A 2D8AA 3QVUA 4ODIA 2P7HA 2V98A 4IDPA 5E3JA 3SIWA 1DKOA 2D00A 4BV2A 1DE0A 2IPOA 1G8MA 3HB5X 4PW0A 4LYFA 5BWLA 1U4OA 4WDRA 4BQRA 1A8HA 3FVRA 2BH9A 2R8BA 3RIGA 2VPYA 4ESVA 2AC7A 4LY0A 5DXAA 3SK0A 5JD5A 2Z8ZA 2OHFA 1LTKA 4D26A 4LE2A 4JIMA 4PZEA 1A1VA 1ZUNA 4FCVA 4NEQA 1QE0A 1R0XA 4OHKA 2JEYA 2YV1A 1NW6A 1PE0A 1XKQA 3PHCA 4GPIB 4F86A 1GPYA 1KK0A 2QZPA 4ZGGA 2GF9A 5IH7A 3TB4A 2B1RA 2W6JA 4J0DA 3GRVA 1UBOS 4X8MA 2OG2A 2CL5A 4CKCA 4EY4A 1G3RA 4OH1A 4MB0A 4FMPA 1H5NA 4MA5A 4AIRA 4CF6A 1LU9A 3T5AA 3L8HA 5CGQB 1LQTA 4J0GA 5I9NA 2XGSA 4XD2A 4F9FA 1GD1O 2J3LA 4E3WA 4IMRA 3PRJA 5H3LA 3EIUA 3HYLA 4M8LA 4X8LA 3ROKA 4QICA 1FUEA 2VXYA 1XVVA 2X2PA 2I91A 2X0IA 4UNPA 3OVMA 1A5TA 2P67A 5ICFA 3NVDA 2KX7A 4HC4A 2RHMA 1S2NA 1QANA 1UPAA 2P1RA 1T1SA 1F5NA 5D2CA 1WSAA 4YCAA 2H2HA 5FBHA 4BC0A 5LD2C 2BOVA 3IFSA 2ZCVA 1EFVA 2LP4Y 4FR5A 4XASA 4DTIA 2L19A 4BNZA 4YXFA 3DXZA 4NDNE 2M32A 2F43A 1YZLA 1EK5A 1VSBA 2PZBA 3BQNB 3UJDA 4AG5A 1CVLA 1THTA 2EGGA 5BSWA 3KLMX 1FYEA 3N2GA 5JQGF 1GAWA 5K5EA 1YAJA 1Z5NA 3CCFA 4HRXA 2DUNA 1I6LA 3VR6A 1M6EX 1ZK2A 1FDVA 1SCBA 1HZJA 1PJ4A 5F7ZA 3VSAA 3WZLA 4HB0A 1QH0A 4JGIA 3WRYC 5BN1A 3KNZA 3KR9A 2YHBA 2DFTA 4YRPA 1TAUA 2GHIA 3D7SA 3PC8C 3IVXA 1XTPA 1K5DA 5DFAA 4O1IA 1ESDA 2ZREA 1TEXA 3TLJA 3V3TA 2IEGA 2FX3A 1P1KA 2WLTA 3K9BA 1IHPA 3L6EA 4U2FA 4GMFA 4U4AA 2OCYC 3CWQA 3PEWA 3OQHA 4XTCS 3GRKA 4P0QB 1C0EA 3UFBA 2EFHB 4BKOA 2BMWA 3TLAA 1D2AA 4CLXA 1V8FA 1Y1KE 4FHDA 3HBMA 2QNIA 5JWHA 1GSAA 4JHXA 5EKSA 4ZALA 1QAQA 5JJBA 5ITZA 4KR7A 3U61B 2JLCA 3GNLA 1W2GA 3E5MA 4GEKA 3UUEA 4AW9A 5F3WB 4LYJA 2IDZA 4KIFA 1EB8A 5AH0A 1BMFA 5GMOA 2Q0HA 3UW3A 5KU7A 5BUQA 2YZ7A 1B6SA 1MT0A 4WCFB 1QPBA 3AJDA 4KSCA 3VUEA 4JI4B 3ICQB 4Q4DA 3ZWOA 1I7NA 1Q11A 2JFGA 2QXUA 4JJFA 2IHNA 7YASA 3LWZA 4IV5A 3HDVA 3JQAD 1A1SA 3TUZC 2PVSA 1JDBB 3P5SA 1HDXA 2JFFA 4H1UA 4FUQA 1YRBA 3KXIA 1FDRA 4XCQA 1DI0A 3VAYA 5DIFA 2IU0A 3WYNA 3ZCUA 3RYTC 1E2DA 3T15A 1F6WA 4DY4A 3I53A 4F7DA 5ALWA 1KXZA 3LU1A 4FJ0A 3WFIA 3S1SA 3DHNA 1RQ7A 4RVHA 2QVLA 3OQNA 1TLTA 1PL0A 1F8XA 4OK3A 5DHTA 4XYLA 5K4HA 5J2TB 1BG6A 3IODA 4F6LA 1QVRA 2D5AA 4HAZA 5TSDA 1EPUA 2OPBA 4EG7A 4WIAA 1LX6A 5E6SA 4ZJYA 2QRZA 3A6FA 3CZCA 2V45A 4Z0TA 1QX3A 3A1SA 4KQJA 2AOVA 3TCXB 2QPAA 2DETA 1RP1A 3U1VA 2P8JA 2XSZD 1K8QA 3EA4A 1EE1A 1HYEA 1TA4A 4NATA 1EXVA 1EUYA 1AZWA 1ZK3A 4B80A 4HNSA 4BATA 2EGHA 1JIVA 2ZWPA 4OQEA 5IMBA 3V7YA 1N6OA 5CM8B 1CR6A 5JMOA 2GAAA 1CTQA 2Q7DA 5B7GA 1YE8A 1Y3FE 4LHYA 4NAHA 5C8VA 5JSHA 4Z9XA 4WZBE 2ABWA 1BHJA 4PAQA 4CKYA 4PU0A 1EVKA 2Q50A 4FE7A 4LBWA 4TTJA 4ZVKA 2YJGA 1XQ6A 2YWDA 4E1BA 4L95C 3W6PA 3IDFA 2EF1A 3RYFA 1ISGA 2C07A 3UA3A 1YIAA 1DIRA 3IESA 1I6KA 2YRXA 2ZB4A 4P7KA 1Z45A 4AO6A 3IR7A 3JASA 4A16A 1I0LA 1NX6A 1B73A 4U7DA 1EXWA 1L8QA 2HX1A 5JAZA 5JNLA 2PFKA 2XDWA 4C6TA 3UV6A 2XDQA 3EB9A 2JS7A 1VJ0A 3ISVA 3R6DA 4P32A 4R8LA 1U2DA 4M9ZA 3TFWA 1GQSA 2VJNA 3KG2A 4OX9B 1J8QA 2NQ2C 2WKPA 3HUEA 5KMGA 3CX8A 3JQ7B 4PNHA 3F3MA 2KW5A 1YTLA 3ZEAA 5JDCA 4AF6A 2IXFA 3N0WA 1Y3DE 4W6QA 2IXDA 3TZKA 1E32A 1XZQA 1XQ9A 5HJ7A 2L18A 3ECSA 1GKIA 1I32A 1KAQA 3CE6A 1NJ6A 3E27A 5L3SB 2J3HA 5CM9C 1QH9A 1GNPA 1S02A 2OCBA 4WJLA 1IHDA 4LGMA 4S1PA 1F5SA 4Q48A 3Q9NA 3I04M 5E6RA 2OQVA 2OO7A 2GPYA 4FYVA 4RDXA 2IYUA 1KO5A 1OH5A 1OWPA 1UPTA 1ATZA 4D3FA 4EHAA 5CDYA 4M0UA 3PV0A 5EWMB 3W9BA 3MWDB 2AMVA 4IDCA 2E4YA 1R8XA 3DTTA 1P81A 1V8PA 2Q2OA 5C34B 4N41A 5CFNA 2Q6LA 5BURA 2PN1A 4WXEA 2WWIA 4U2BA 2BMJA 5TEVA 4MDEA 4HDSA 4FEAA 2FJ0A 5CIWA 2HMSA 1Z8FA 3UKJA 1N0IA 3JD4A 5JXJA 4HTAA 3SZOA 1U2RA 1O87A 1EK6A 4BKRA 3NDBB 1YDFA 1U0JA 4G9BA 4XPZA 4P4LA 4PNPA 4I9GA 4MVJA 3I62A 4P4NA 3L41A 4FCTA 4BO7A 4K6MA 1BRMA 4D8YA 4MDYA 3A3OA 3FPLA 3OM0A 1ODSA 3Q3GE 1KYTA 1U4NA 3L0OA 1M1ZA 3KVNA 5DX1A 4AN0A 2Z5LA 5IBRA 2AVDA 3VOAA 2V03A 1YCFA 1CSEE 2GJAA 1G5PA 1N1MA 3BKXA 2CVFA 1OLXB 2FPWA 4G4SP 4JLPA 2WIKA 2B8WA 5TT0A 1BMDA 3FDIA 1U3DA 3K1AB 3IJ5A 1L7DA 4G4SO 5F21A 4CMIB 1KYXA 1AIPA 1Y4AE 3NHBA 4H3HB 1VLJA 1Q1QA 1QOZA 2PLWA 2BSXA 1MO5A 2D1RA 4XWYA 3KT3A 2FHPA 1EDDA 2I3BA 2FWJA 2Q4DA 1OFGA 2CLDX 2ZWOA 1G3MA 1KJNA 1W1IA 3KUUA 2O14A 3KQTA 1R3DA 2R1VB 2RGAA 4MIEA 1CPYA 1E8DA 2VR1A 4PG4A 3SR4A 2R1UA 1PWEA 3HUTA 1R4AA 2IQ5A 4DJFC 2L0XA 4M60A 1KU6A 2VJQA 3G89A 3SIXA 5AKYA 5GIOE 2V7QA 3OJLA 4PR3A 4MW9A 3RANA 1P2DA 3AM4A 4GVLA 2MSKA 5BQ3A 3ER9A 1FSPA 3H2JA 4WN9A 2DE0X 2BTOA 1QHFA 4JROA 5CVUA 3SGLA 1U6IA 4GIBA 5ADWA 5AJZA 2HYIC 1FTNA 1H1LA 3CSUA 1NP6A 2AI2A 1MVNA 4L8YA 5HZHA 4MQFB 3GZNA 3TD2A 2QD2A 2O4UX 4NICA 3ZE0B 1HEUA 3E0XA 4WADA 4BL5A 3K6SB 3U1BA 4ARCA 3R5XA 1KDTA 2Q49A 2PX3A 5HOEA 3K0FB 3RD5A 4X92A 2FZVA 2IIPA 4KRXA 2ZYHA 1OI3A 2C9DA 3PPYA 3QRWA 4MEAA 1JAZA 3FNQA 1FS5A 3WSWA 2QD4A 2GHRA 2JIDA 3ZCTA 4DIEA 5EHZA 3QXSA 2BFDB 3TRDA 1OFUX 2RMKA 1QAMA 2XAAA 2JGIA 3ET5A 3UCXA 5HOQA 4A15A 3ETCA 4GLFA 4AI6A 3JQRA 1W76A 2CXSA 1PTJA 4Q1FA 3JAWA 4K03A 1QQBA 3RVNA 2B98A 1SQ0A 2FNAA 3PD0A 1X7YB 2G17A 1TX4B 1KMNA 4N48A 4RK1A 1Y33E 1NFFA 5G0SA 4CG1A 2PLAA 3K70C 4DYHA 4P98A 1RC8A 3JR3A 4R2HA 1IH8A 3NEPX 4TUYB 3H9QA 2AF3C 1C9YA 1CERA 4WHMA 4FNMA 2E5WA 3DP9A 1F51E 2BV3A 2F9MA 2V7UA 4DA8A 2IYVA 1L7QA 4WCVA 2AXEA 4L4ZA 4TX1A 1TCBA 1TE2A 4PINA 3D7MA 3HL4A 1GAEO 2G9QA 3VO8A 5IJ0A 4DQXA 5LQRA 2JLUA 3T3OA 3SC4A 2AUMA 4R1PA 4PCUA 2BMFA 1PW5A 2ZKIA 1YGPA 5ITSA 1TMGE 3K3PA 4DIUA 1ZGHA 2O5VA 3RBVA 2P30A 1BFUA 3RUDA 4IJQA 4L4RA 1B00A 3HXTA 4NOLA 4G25A 1RKXA 1AQLA 5AVKA 4EMSA 4OF4A 1BGVA 1PTKA 2EVWX 3K92A 4OHWA 5EWLA 3WGGA 3SHOA 4TYPA 1TW2A 1ES9A 3QIVA 2HXSA 5E3HA 4TLBA 1T10A 4HDQB 5I9MA 4BAUA 3K0AB 4EKNB 1T13A 2JIQA 5EKDA 2AX4A 3EXFB 4G5GA 4HH3C 4B6RA 1KPHA 1NNSA 1T9HA 5JNUA 1TZJA 4BX8A 2LRHA 4IDHA 2XWSA 1U3WA 2PXAA 5L53A 3EYWA 4M37A 3TQTA 5CHEA 1M6VA 1DEAA 3OX1A 2A5GA 1GPKA 4JWTA 4NY1A 1PR3A 4WA8A 3NG1A 4ZPJA 3M9LA 1C9NA 2NU6A 3LQ2A 4IEFB 2P90A 5B1DA 3H2BA 2GEFA 1YK1A 1T4CB 4ETWA 1KC3A 1XNHA 2FSIA 1NMXA 4KDCA 4HB2A 5A71A 4L7VA 3UKOA 4M9UA 4YRFA 3EIXA 3S2IA 4PYJA 3GT0A 5CU7A 3B1WA 5DXFA 3IA2A 3MCZA 1XQVA 4C6HA 2E5LB 4OHYA 4MWCA 3G8AA 5DLQC 1UK7A 2FZEA 4W63A 4UM8B 1P4AA 3OJFA 3IUNA 9LDTA 2AG5A 3FYSA 5IYZA 4WERA 3KYBA 1XK6A 5TB5A 1XF9A 2N75A 2Y1XA 1GR0A 3AHJA 1KGSA 5EFOA 4P08A 4CN9A 1CUIA 1JF8A 1M2JA 4DLTA 3IA7A 3UKDA 4US2R 4LFCB 1GAQA 3DW3X 4NENA 4G84A 3CEPB 4FGKA 4IIBA 1DRVA 2VLBA 1SVSA 3AVOA 3DDOA 3CNNA 4KO2S 1SHTX 4R2XA 3VNQA 3K2EA 4KLRA 5KNCD 1Z12A 2ZYDA 1LBQA 1S8FA 3GCXA 1NMYA 1QDUA 3H1GA 2Z3VA 2Z6VA 4L0DA 4OK6A 4QUEA 3X1XA 3TF5A 5HDQA 2HDOA 1EIWA 2IV3A 3DTNA 3M6IA 4WOBA 3PEEA 3S5JA 4TT3D 4OQMA 1U2DC 4MWBA 2J4CA 3UXEA 4G0ZA 5G4KB 3ONVA 4QD3A 3QFSA 4U8HA 4WBNA 3G2JA 4J75A 5KVCA 1SXJE 3PEFA 1L6RA 3HADA 1KR2A 1X15A 3NUGA 3Q8XB 4DRYA 4EVIA 1WBDA 3TX6A 3C8DA 3PLAE 1T2VA 3LT2A 1CD5A 4RACA 3MTQA 4DDTA 1F38A 2JGRA 1JP7A 1QVZA 3DGFC 4L6CA 1SXJD 2QN1A 3BJRA 1LSJA 4UZSA 3FZNA 1NT4A 4ZZ0A 3EPRA 3U40A 5EERA 4NBLA 4A5SA 1KHTA 1Q7EA 4N1AA 2OCAA 1H6DA 1WMEA 2A0KA 3LUCA 2QR3A 3IIMA 4DXAA 1Y63A 2NP6A 5L51A 2OFOA 1EWQA 1A98A 4YMUA 2C92A 3CIOA 4E0BA 4YRQA 1S89A 2WDPA 3GT3A 3EFOB 3HDGA 3T99A 4DRXB 3ZKAA 4E5SA 4PSUA 1CZOA 4QC2A 4X93A 1AGPA 2BISA 4ENQA 4KIUA 5KPDA 4ADSG 4AKEA 4J90A 5K6AA 1TZMA 3ICVA 3MCTA 2H4WA 4HFRA 4F91B 1Y4ZA 3DDWA 2J1LA 4I9NA 4KOEC 2CF5A 3D2BA 5JARA 4R54A 5DM2A 1IQ0A 4IAOA 1NJGA 2NTNA 3R7NA 3Q4GA 1SU7A 4Q1AA 3B51X 1P8JA 4RVUA 3ZHZA 4TZ6A 1ISJA 1I0IA 4ICIA 4QJBA 3UK6A 4BLSA 2R6GA 3WYBA 4IHJA 2DY1A 3IIKA 3FYUA 1NG1A 3CGWA 2ETVA 2QQGA 3FI0A 3TIXB 1FDTA 2Q4EA 2WWHA 4QQ8A 2VZ8A 4QLAA 5CRIA 3OZTA 2RG7A 1WSWA 4OYHA 4P7GA 1R0LA 4ND1A 2BJHA 2CLFB 3NFYA 2HQSA 4R83A 3EDMA 4UVGA 3AP2A 2C7BA 3QI2A 1K8XB 4A0RA 4BVFA 2I80A 4BGDA 4O2AF 3JVIA 3OQIA 2VQ3A 4R9VA 4XYEA 3MCUA 1UMCA 4DR2B 3OP4A 5A9SB 4B82A 3PGXA 1DUSA 3T06B 4Z5XA 3UJ9A 4FTWA 4YC7A 2DWPA 3NQ41 3RS0A 2GZSA 2HV8A 1FL9A 1UP7A 4WK2B 3QHPA 1D1QA 1TMKA 3KSRA 2BT4A 1VPVA 1WV0A 2B4TO 1XYGA 1NQVA 4L3OA 3TFQA 2AMLA 4KFCA 5FQOA 3DAYA 1E0KA 4JOQA 4LOAA 1WO8A 3O3NB 3OIDA 4X3PA 1CVRA 1G5HA 5CTJA 4F5YA 4Z49A 1KNXA 1ORTA 4AX8A 1YZHA 4MSUA 4XCVA 3E7XA 1AVTA 1SB9A 2YWHA 5ICGA 4MUNA 1Q0QA 3AFOA 3B1YA 2I1VB 4R6XA 1UDXA 2VPWA 4WXYB 3D0OA 4RKQA 1YS2X 4BWYA 2VTDA 2F7SA 5IJXA 1YMUA 1NRJB 2VYFA 3AUJB 1LVUA 1YE3A 1ZBQA 5AM4A 1CJMA 3WGIA 3HKCB 3ZQJA 3A05A 3HA7A 1XCGB 5EIEA 2J3MA 4G0UA 4ZU3A 4ZCQA 1E1NA 3GK3A 4BQOA 4X41A 5CXXA 2WJ3A 1X9IA 4RKEA 5F3DA 2Z58A 3QF7A 1Q0ZA 4ZYLA 2IXAA 3L01A 1GCOA 3BF8A 1NULA 1VSUA 2IH4A 4AJKA 1BHSA 2Q4TA 2EU8A 4ND5A 5K0CA 1PTJC 4JBNA 2ACVA 2J5RA 3SR3A 1PUIA 2VP3A 1DELA 1Z18A 2QDKA 2ZE7A 3LIIA 1EGHA 2CBGA 3QFFA 2VAWA 3HSKA 3MJTA 4FHZA 2PRKA 3BRCA 2Q4BA 4RABA 2H1IA 2PY6A 5AHWA 3VC3A 3ESZA 2QRHA 1XRJA 4XIGS 3GLGE 2HTFA 3EBPA 1L4EA 3W3AD 4IXNA 3GFQA 3RYCB 4FE3A 4UBJA 5IAGA 4AMBA 3UWSA 2FOLA 2Z57A 4JI0B 3ZK7A 5K0SA 4BFYA 2MTBA 1J33A 4CMJA 1C2YA 2ZIVB 3G1UA 4B44A 1M2GA 3KXDA 3P9KA 3M6XA 4HNVA 5SY6A 3FTEA 1K8ZB 1WUJS 2IC5A 3KP1A 4EEZA 3B5IA 3MF4A 1EX1A 3C48A 1QO0D 3EFEA 2Q7OE 4CKWB 4F8YA 1E2NA 4GLOA 4XIJA 1B6TA 2BEVA 4YH1A 4Z9FA 4BQQA 4BZPA 5I01A 4J1QA 1B0AA 2A9QA 1CP2A 1KJIA 2DQZA 1ZINA 1YO6A 1G4HA 2EEZA 1VIMA 3OPMA 4ARIA 5KTOA 1BFDA 2PS0A 4MUIA 2JGNA 4RTMA 3ZLVA 4FZ3A 3B60A 2J6HA 3GWZA 3LF1A 4G86A 4UCXA 1YB7A 1H85A 1QFXA 3IRUA 3L0SA 1DKRA 1CULC 3ZDXB 5KVSA 3AR3A 1W44A 3GJRA 1W4RA 2VBGA 4G1BA 5SZIA 1S2OA 1RSZA 4NJOA 5JYDA 3L8GA 1EQAA 1ZL0A 1JHMA 2Q5EA 3C14C 3PPWA 4XAQA 3D5TA 4UTNA 4ZP1A 4RE5A 1H4QA 5BW5A 4K3UA 1N36B 1QR2A 5LYYA 5JQGA 2CHEA 3RNOA 1HT3A 1W4ZA 3DYIA 3H9CA 2X8LA 3EVEA 1K5HA 2O7SA 3WVNA 3DMRA 3G1WA 3X2SA 2B7BA 4PF1A 4DOMA 2XUIA 1OGJA 4FLMA 2GZ3A 1GUBA 3D7KA 2VNKA 4BO3A 1CUGA 1E1RD 3IS3A 3GP3A 1YMVA 3V8VA 3B3QA 2C4VA 1S2LA 4JT2A 3N2KA 2P3LA 5ICCA 4DM4A 4RFSB 1YRLA 2EOAA 5FUXA 1DKNA 4MW0A 4IGIA 5F1OA 3N75A 1H9BA 2CNLA 3UMJA 1I1HA 3RI3A 1AMOA 4M2LA 2V65A 1JHPA 1IG3A 2OBBA 3K96A 3WGJA 3G68A 4BMCA 3O90A 4UCWA 1KIAA 1UJ2A 1VE9A 3FWHA 1R9NA 2VXCA 4EENA 4XB1A 2ANCA 5K3CA 5CNJA 3TAXA 4H7DA 1QK3A 3IQEA 2BEWB 5JCJA 2O7RA 1DWQA 3KHSA 3ONWA 4M76B 4O63O 1TL7C 3ZE2B 4YT4A 3PDIA 3AF6A 2FPGB 3FTDA 2PUVA 3ZDZB 1G3QA 4NV1A 5A06A 1JVSA 2AG1A 1PJRA 2ODTX 3PZRA 5BN5A 2DM6A 3O75A 5LMCA 1SELA 1HA3A 3BRWA 3BK2A 5KJFA 4RKWA 1I4DD 2Y93A 4XTRA 1H2XA 2QROA 2TYSB 1EGMB 1VKRA 4JJEA 4EA8A 2PD3A 4BO5A 2VP4A 5C5DA 5B37A 1XTBA 3UFXB 4R4JA 1EDEA 2PSSA 4JP8A 4L9RA 3HZOA 4ZQCB 4F60A 4A2QA 1GEEA 4KMSA 4KQCA 2BD0A 4PLHA 1E2GA 4FYPA 2YYYA 5EI5A 3KQPA 4Z9AA 3DBRB 1GZUA 2J87A 4GGOA 2CEAA 3U4GA 3X0DA 1JFFA 1ZNWA 3EG5A 3TXYA 3O8OA 4PZAA 3CVVA 5DT2A 1WV1A 4G41A 3D6AA 4CE6A 1LQ2A 3GD7A 2ZJ6A 1HLDA 3E8XA 3R9XA 5F35A 1E2UA 4H4DA 2AJLI 3AR6A 3DAHA 1P2SA 1O94D 3NHWA 1F0PA 4N54A 1AGNA 2QMQA 2H57A 3FSRA 2OA0A 4CT4B 2QX7A 3HEAA 4CLOB 3EY9A 2CVQA 1QHSA 3IUPA 2XRZA 3G5AA 4U9UA 3E2IA 1ZJZA 3B20A 1JDPA 1EBBA 5K6AC 4F2DA 3N6XA 3ZJTA 1W5EA 5JCPA 3U5TA 3CEJA 4NEHB 3H8JA 2C7VA 2C1XA 1TM2A 3ICWA 1ZONA 3FCYA 1MQAA 1R9MA 1BDBA 3E61A 1UODA 1ZS9A 3K73O 4IZOA 5D87A 4D3XA 5BWOA 1ECGA 2CJPA 5MHTA 2BMAA 2BBWA 4MS4B 2QE7A 5FWYB 3L8DA 2YBEA 4GI5A 3AF1A 2GN6A 2PIAA 5E9JA 3VGJA 821PA 3VA7A 3QX7A 3PUHA 5FLKA 1MX5A 3NATA 3JQPA 1RHKA 3FYUC 3HCOA 4J3FA 1ZK1A 1APBA 3NANA 1GDTA 1CZHA 2FFJA 1KBQA 2YJ5A 3RSFA 1L7VC 1R5NA 5HS6A 5KYYB 2JI8A 3HM9A 1SNYA 1A95A 1CQPA 2WM2A 2FDCA 4JQZA 4BTEA 2OFFA 3O1LA 1NN5A 1W29A 2OV6A 4E6EA 2NTYC 3DKIA 3UT0A 4M9RA 4KBFA 4YJFB 2AF4C 5FFMA 1Y7HA 4M83A 3E58A 1HLFA 2H3HA 2WT4A 3RSGA 2ZJOA 3GJ3A 5DTIA 4CDGA 3UJBA 1QGUA 3AFIA 1G8AA 2E55A 2YNMD 4KK3A 3WGLA 4QARA 5JUWA 4W5JA 1OE0A 1SC6A 3NPAA 1YJXA 4Z0PA 4YREA 2WAAA 2H16A 4B0PA 1RAFA 3H5IA 3H8WA 5LQDA 4I81A 3GAAA 1EFRA 2QSZA 4S1VA 2VAVA 3F49S 2OZKA 3HY4A 4JMLA 5DZSA 3G9ZA 1TMYA 1V3UA 4YMWA 1Y1LA 3ORQA 1TOAA 3G8BA 3KT8A 1COWD 3PJDA 4XRRA 5ED4A 1DTWB 1YF3A 1NBOA 4HAOA 3L8ZA 3GPBA 1G7SA 3LLCA 5TV2A 3V1LA 4PYQA 1FNNA 1U8UA 1ZIXA 2O2SA 3P9PA 1I6MA 4O8CA 4W6ZA 1Y8QB 3LYAA 5AJXA 5ALQA 1SD1A 1E6KA 4QAQA 2WPDD 3KHKA 5HQTA 1KEUA 1P5HA 5ENZA 2XCOA 1QGDA 2O50A 1RJWA 2I3GA 2XB6A 4PLVA 3ZE9A 2VHYA 4QUJA 1DJLA 3ZJ5A 3HNOA 5BW4A 1MG0A 5ENDA 3B3JA 4ZAGA 3SQDA 5A4AA 3U19A 3J80A 3KVRA 2OB2A 5KNDD 1VE5A 1QK5A 1XV5A 1Z26A 2XRFA 2HMUA 2Y9MB 3O95A 4HVTA 4OYRA 4OJYA 4B5KA 4EHNA 3I6BA 1QH1B 3IOEA 3L82B 4TZTA 1OXBB 2IY9A 2XGOA 4NYIQ 5G4LA 1E9FA 3VHXB 1G41A 2CYAA 4N3CA 2SKEA 2G88A 3PF8A 1D8TA 4QEZA 3KLPX 4CMEA 4BVGA 3UTDA 2WVGA 4EK9A 1PCXA 4ZGBA 3E2PA 1T5BA 1OT5A 3MYRA 3M1YA 1MXHA 1C3XA 2WSSD 4DLXA 2HC9A 1WQ3A 3ANLA 4YMTA 4PWZA 1ESEA 4U02A 4XB6B 1CEEA 3FMIA 1SUCA 3IQFA 4J2HA 2DHEA 4CL2A 3CF2A 2O19A 2RGGA 1G63A 1RJFA 2FEAA 2PXHA 2QAJA 3IUJA 3K30A 3KYCA 2B35A 3OCXA 3TZQA 4EA9A 2IEAA 2FW1A 5E4JA 3HXLA 4P33A 4UFOA 2EFYA 5LIPA 1Y0BA 4B9AA 1Z4MA 3CW2A 1CQJA 1QONA 1EX9A 2FSGA 2PWAA 1Q57A 2VQ6A 3QXHA 3NBMA 3RR2A 3VU3A 3RQSA 3LHIA 4ZT7A 3WC4A 4BP8A 5KINB 1WXQA 1E3DA 1GU0A 5JCXA 2C3MA 4H0CA 4ZT6A 4J3NA 1XDBA 2BGJA 4Q16A 4EH1A 4HNQA 3RUIA 1BXGA 4YLYA 4LJRA 1BKSB 3GIWA 2VPIA 1TUBA 4BZQA 1AJEA 1L8LA 3WKBA 3G0HA 2VNJA 4BLWA 1I13A 4MLPA 5IEBA 4KXVA 4FGWA 3CWCA 3R77A 5EXPA 1IK6A 3FTFA 3P2YA 1U80A 5C31A 1TQHA 1H6AA 2OQ2A 2GOYA 2JCSA 4RIHA 3QUQA 1C3OB 2AE1A 1TKRA 3RYIB 3PNPA 1SPXA 1U0NA 2ZWAA 4M8IA 3RM3A 2XGJA 2XBUA 2HNKA 4RD3A 2YVAA 3VYUB 2CMFA 4NOKA 3U7HB 4B7XA 1A7UA 3EARA 1ZW1A 221PA 4TQ9A 4NPCA 4F5ZA 2P9EA 1AX9A 1W36D 1DEXA 5IKPA 4KAAA 3HJRA 2FQQA 2WMNB 2VYCA 3HFGA 4CM8B 1QYXA 3H75A 3OD1A 2HCRA 3PGLA 2FP3A 4L8WB 1YR9A 2IYLD 4CNQA 2JJ2D 4OGWA 2D8MA 4FZRA 3SYLA 2DB3A 2QTVB 4LDJA 3RIXA 1V5FA 3H1FA 4LDAA 2YVKA 4XFKA 7MHTA 1UH5A 4MQ6A 5K0JA 3AY7A 5HF9A 3VNVA 3FUXA 3V4VB 2Q9AA 3EXAA 1XLVA 2DTXA 4CIYA 1CR1A 5IZCA 2HWUA 4UCFA 3R4VA 1ECFA 4CV0A 4WECA 3ZD7A 1GA1A 1O0SA 4LTDA 4D80A 1DMRA 4Y7CA 1FX0B 1YQEA 4YGYA 3DM9B 3AKZA 1K8YB 1KTVA 2I99A 2Y0BA 3ECCA 3JW8A 1XBTA 1B8NA 3R7FA 2K2WA 2ZULA 3VU1A 1QMPA 1C3JA 1KETA 1SBCA 1ZIYA 2C2XA 2IIBA 2IU6A 2JH9A 3QTBA 3UMMA 3EIQA 5EUMA 1HE3A 2I2CA 5AK3A 4C7JA 2ZSFA 1EVLA 2ZW9A 5DNUA 4NNOA 4X1IA 4KE6A 1QFZA 3F3KA 3FIJA 1CU1A 3HKEB 1KU0A 4ZHQB 3NMUF 3CVUA 1VA4A 2YV2A 3GJXC 2RBGA 3Q1KA 3DEIA 1FUUA 4BBPA 4A0QA 3ORYA 4LNUB 3U7EB 5LWQA 2W90A 4B6PA 1NU8A 4R9RA 3U5ZB 3I1IA 4WKCA 1XZHA 4DLSA 4RZQA 2AQKA 3PTZA 4WZBA 5M7EA 1NBHA 1TC1A 1U99A 1QRUA 3MHTA 1URPA 5CB0A 3PJRA 4JI7B 1ONSA 2BC9A 2OQRA 4PZ0A 4PFKA 2WQ6A 1JDUA 3WDMA 1I7SB 3SVLA 4CU2A 2FPMA 4PX9A 4ZVVA 1OH8A 4HHEA 5C8YF 2B8JA 1K3TA 2R44A 4G4IA 3K71B 3VO1A 2C83A 4UBLA 3QEAZ 1X8JA 3WKCA 4F6RB 1PSWA 1U9CA 3TOXA 1E7MA 2Q9CA 4I1YA 4F1KA 5J4LA 1D5WA 3BX1A 3IRVA 4ER7A 4F93B 3I9FA 3AXTA 2VG8A 4DVGA 1R7RA 1X7HA 1FJHA 1KK2A 2UZIR 1IN6A 1J2UA 1E99A 3V8RA 4DBZA 4Y2SA 4MCAA 1UCFA 2XTMA 3OZEA 3G0BA 4G37A 2W2KA 3F4LA 1G9SA 1QO9A 3F5SA 4A2WA 2H2GA 2YHUA 5BWNA 4I99A 3WDLA 4TYYA 4O4LB 1DDOA 1GZVA 4O3FA 5DKFA 2B0CA 1ZGZA 2ADMA 3RFXA 3B2QA 3O7WA 3DBIA 4EG0A 1R3UA 4B4VA 1PW7A 4N3GA 1KQOA 1BN7A 1SURA 1KS9A 1PU2A 2FFBA 2Q8PA 2Y3IA 2YC2C 3WADA 1ZJJA 4EUSA 4IR7A 5AD1A 4GPTA 5CJ2A 1JAYA 4H1TA 2WMOB 2B83A 4W99A 3RJMA 5I7HA 2BFEB 4MAMA 5LFAA 1SMKA 3BQ9A 4B1FA 4MPJA 5LQMA 3IEUA 1ZD1A 2XECA 1OV4A 1ZDMA 4BO1A 3OLQA 1ZSNA 1NNUA 1Q15A 2SECE 2WZDA 3DVQX 3NC1C 1NLFA 3EGXB 4ZMBA 3P97A 2ZR7A 4TKVB 1L1EA 1VI2A 2GNAA 5CFMA 2V55B 2C2WA 3E35A 2L2QA 5GQSA 3R7BA 5DISB 1YQDA 1LS1A 2W2PA 4IVQA 1VE6A 2CNWA 4C3OB 3IELA 1SK8A 2ES4A 4N7BA 4P35A 1GG8A 2ISQA 2YJTD 4XYMA 3LM8A 1W8IA 1X74A 2QT0A 2V7EA 1Y9DA 2H52A 3KU1A 1QV7A 5DHSA 2JG3A 3WGUA 5DGDA 5TJHA 4EDHA 1R6BX 5HJ2A 1XWWA 1VKNA 2Y6VA 3FIUA 1JXMA 2AB0A 4ZAZA 5FEMA 1NHWA 2I1LA 5CDFE 5A05A 1XZIA 3WMFA 2O9JA 3W5DA 3NO4A 2HMYB 3KVYA 5I9SA 5IVPA 3ER8A 1B8VA 2ODBA 2CXNA 3ESDA 4BKMA 1G64A 4Y18A 4QUKA 3BJMA 5IVDA 5C3MA 2PJDA 3GOQA 2XMCA 2B4RO 3UN1A 1O9HA 4KRYA 2GTPA 1E5VA 4QQRA 1LH0A 3MB8A 1TYBE 1OZGA 4Y2RA 1X7WB 4BEJA 4DCVA 4II3A 4Q66C 1X7ZB 3TFOA 2WRZA 3GJ6A 2C61A 2VSQA 2WIAA 4JL6A 1WS6A 1NQTA 2W8BB 4IDEA 4Q1CA 3NKFA 3CPHA 1OYWA 5EIOA 5IHPA 1PHRA 2NSHA 2HT6A 5BQFA 1IATA 4YI3A 4OUDA 1KEPA 5FL7A 3DYVA 3DDZX 1T5IA 2C5BA 5TMDA 1DRUA 3KRTA 4Z7QB 4UDOA 3WIDA 3EF1A 1RM4A 4BGEA 1JNYA 4M21A 3GG2A 5KYXB 2QX9A 3FPHA 4NG4A 4QASA 3I2JA 5HQ3A 3FRJA 5EMMA 4BDSA 4W5HA 4V3CA 4JP3A 1VHWA 5IANA 1E9EA 1RWPA 1Y4UA 4CEJA 3BCUA 5D3MA 3IVMA 3V1UA 4JBGA 4CV1A 4EI8A 2ZM6B 3DL7A 4ZPXA 5FORA 1ANKA 1XJWA 1T2UA 4DLNA 1PZFA 3R3SA 5L8VA 1QQ5A 2Z1DA 1VYTA 3NC0C 3PI7A 2DJIA 4RZHA 3RVDA 3E70C 1OJLA 4ZAVA 2PTGA 2Q0XA 4BVLA 4CMEC 2H8GA 4F3CA 2RBKA 5BMVF 2OO5A 1NWHA 4IWYA 1ST2A 4JJ6A 3WHPA 1EK0A 1I6WA 5T64A 5KNBD 1DCMA 4CNBA 1M9NA 2Q5QA 1OFUA 2HDWA 3P7MA 2I55A 4DCGA 5TS3A 3W90A 5KDDA 2DFVA 2DH5A 2WJ6A 2P69A 2QMHA 3Q8WA 4O2AA 3REGA 4E3ZA 2H63A 4X20A 1UBEA 3KZVA 3B3FA 2GLUA 2HJ9A 3I34X 4V24A 3VR2A 1NI3A 3GWGA 3B9PA 4HAYA 1JHZA 2QNRA 5ALUA 2G4VA 3LC0A 2BL4A 2I7TA 4HAIA 4KIJA 4NBSA 4INAA 4C6SA 1JN0A 2AJCA 4KUHA 2W00A 3QTTA 4UBKA 4MUMA 1ZD9A 4GOJA 3BSSA 5DDIP 2NG1A 3ZNPA 1SM4A 4CCYB 5FBVB 1BXRB 5KYWA 1BA2A 1EG2A 1QTIA 3AR7A 1N78A 3OCJA 4Y6GB 2X8JB 4B3IA 4NRDA 4FPXA 5FF9A 1JS1X 3EX7C 3EXEB 5EZ5A 1P5ZB 3UHOA 1UIRA 1II8A 3OPYA 1U1EA 2NVWA 3WV4A 2X7XA 4YJHB 2YS7A 3PQ6A 3RSQA 3SZRA 2MINB 4ZU6X 1C1XA 3LPNA 1XTUA 2GXQA 5FV7A 1SGWA 1XDDA 3SXUA 6ABPA 1V1MB 3DE3X 1KEZA 2FFHA 2X13A 3MOGA 2ZS9A 1A27A 3PJGA 2JFUA 2VK8A 4HSGA 4UE6A 4ND8B 1QIJA 1WOMA 4PX5A 3W4IA 1L2TA 2PUWA 3KZNA 4BNUA 3MD0A 1U90A 1EAMA 2KQUA 2DYKA 3BULA 4M1QA 1ZWLA 3G5MA 2B94A 1SUWA 4KDRA 4Y6SA 2CFOA 2CHUA 3VC2A 4HMPA 3NB0A 2Z4RA 4ZTBA 3UOAB 1SZDA 3HKDB 4JY7A 3L1IA 4FMCF 1ZI6A 4J91A 4E5VA 1AOXA 1WUIS 1AZLA 3AO0B 1HFJA 4M1SA 1XNRB 2AZ4A 3NAGA 1CUFA 1FRVA 1TYZA 2ONJA 3T3DA 1N34B 1DBSA 2EQ5A 1K4KA 2M6SA 4AAYA 2D4AA 1XZJA 1M8JA 2QZ4A 5DOZA 5FFFA 3X1MA 5A4IS 3BGWA 1EP1B 1EBFA 5JE8A 2SKDA 3TM4A 4DLYA 3GFPA 1LPAB 2FPXA 1ZN8A 3BOSA 2AI1A 1W47A 4B35A 1ZVQA 1KK1A 2PBRA 2E1PA 4RIGA 4HF7A 1QPZA 2FN8A 5IZCC 3TG8A 4OYYA 5JV5A 1QIGA 4OMFG 1IWBB 1X7XB 1XZDA 1Z6TA 2KM1A 3NHAA 2OM6A 3ZGVA 2QTHA 3FMGA 3LY7A 1F4VA 1ZMXA 4AZWA 4I4IA 5DTJA 2DX7A 2BFMA 1GSIA 1JZTA 3VHQA 2ODQA 1CJKC 4K1LA 3RREA 1E9CA 1WHTA 4RCZA 4RJIA 2ZBUA 1FEZA 1JT2A 4UDXX 4ZOCA 4B6QA 7ABPA 1JTEA 2JJ1D 3A1FA 4J94A 2YY6A 2WD8A 2PQ2A 3RVJA 1SWVA 5B58C 3K9GA 4O1MA 3EZ2A 1TXGA 1XU4A 4KLZA 4UU0A 5IUKC 1YACA 4B7CA 2A9VA 5THXA 2CL0X 4EUNA 1LVGA 2B5VA 3OZRA 5AKIA 4BNWA 1D8AA 3EF3A 4Z3KA 5I51A 1PQUA 5DNYB 1X1CA 2QLNA 3KSBC 3DNMA 3JQGA 3HC7A 2G28A 4WESB 1GNSA 2YCBA 4CG2A 1YQGA 4KXWA 3R76A 3DNFA 4O2BB 1I4LD 2GN4A 2WK1A 2ZTSA 3DD1A 4OGFA 4WBSA 4YCCA 1FUYB 2DOKA 5TE9A 1TF7A 1VKHA 3TMKA 4PCVA 4AJ1A 1X8KA 1ORHA 2QRNA 3QMMA 3BWVA 4EY7A 2JCGA 3LYUA 1NUTA 4PX3A 4ZOLB 5EGSA 3FZYA 3ZHQA 3MBOA 5ALEA 5M29A 1VMKA 2DFDA 3HFJA 4PZDA 1DXHA 2VJMB 3R4CA 4MPTA 4RHTA 2JJQA 1JDNA 1XC7A 2V6FA 4FEYA 5ECYA 3IDAA 1JXOA 3AIMA 4GOKA 1GQYA 1VCIA 4UTVA 5INTA 1AA6A 4OM7A 3NDRA 3Q3IA 1JAHA 4TKLA 4YAJA 1SXJA 3NX4A 2WA2A 2JFZA 1KMHA 4F9GA 3RSOA 3D4LA 3AZPA 4EI9A 4DJJA 5KTKA 2X0KA 2RK4A 1CUJA 3RK4A 3Q41A 4IIXA 4BLOA 1NNEA 1UJ6A 4L9SA 1TLFA 2R1TA 3SM9A 3RJ5A 2O5EA 4FJ1A 1NJFA 3C4JA 1M3SA 4K6KA 2ZR9A 1G5FA 3BC1A 3OIFA 4N39A 5FBQB 3PZBA 1RVV1 4I3FA 3VSBA 4DW8A 5DLEA 4DWOA 5HDBB 1UF9A 1YB1A 3SYMA 5MN5A 3RS8A 4R68A 1E6CA 3FW1A 4KR6A 1NBWB 1U3TA 3RABA 4BY9E 1N5MA 1NBEA 1CQIB 1ZGJA 2MSDB 2CZCA 4C7KA 5EZQA 2EHJA 3ETLA 1XCJA 5FBKA 5E2IA 1I3LA 3RTDA 2IT1A 3LPMA 2YFHA 1LV8A 2Q0QA 3KL2A 2F3PA 3MQ4A 5TQJA 2BYTA 4BPRA 1UBCA 4BWGA 2W48A 1HEYA 3RRFA 2I2FA 2ZIXB 1M8GA 3GVPA 3RW9A 1P1IA 4MR8B 1AKQA 2EJVA 3KQLA 2GD6A 1QYIA 3HJAA 3TTTA 1E0DA 5LQSA 3FCAA 2XUJA 1BTOA 4KGDA 3NTQA 5GOZA 3WB0A 1U2TA 2O8EB 1JW9B 3ZBTA 3KJHA 2BTQA 1KSJA 4F0JA 3QVGA 2QG9A 3RC3A 2DPYA 3BBLA 2AA3A 1LNQA 4HFMA 1KL7A 1KDVA 1J25A 3L07A 1DT5A 3T3NA 2H0QA 4HWOA 4IICA 1XNGA 3C7DB 3FNEA 5K3BA 2APJA 1MJNA 3FUWA 1G2OA 2CC2A 5ALFA 4OV6B 5ARCA 1P17A 3KEQA 3EISA 3PENA 1QFMA 1YR7A 4Y30A 1N0WA 1ILEA 3FVVA 1Q1ZA 1X7DA 3G2LA 1Q7CA 5CJPA 3V1NA 2GUWA 5JIBA 4B85A 4LHWA 3THXB 4FGZA 3AJ9A 3U3ZA 3GFFA 5HUQA 2MOKA 1RAHA 1N5JA 1F0NA 2X19A 2YJNA 3OAAD 4J7XA 4LOKA 3KQUA 4X63A 4B3CA 1BQ3A 4AUEA 1TIKA 1CETA 4KVFA 2VCHA 2IU4A 2X8BA 1PGNA 3VO2A 1JIIA 2OHGA 3PG5A 1BCSB 2YHIB 1H0SA 1X0XA 3AB8A 4UBNA 4Z7OB 2REQB 5A4FS 3P2IA 3W0LB 1J0BA 2WSYB 3PFGA 2NU9A 1N9GA 3M0EA 3W8EA 3M8KA 2GETA 2QLLA 3WGQA 3L84A 1QIMA 3HVKA 2UVPB 3QVLA 3ZD8A 2H06A 1AMNA 1JHQA 4KMMA 1Z83A 1CDDA 3F9IA 4L5CA 4E5UA 3CVWA 1LDNA 1QVVA 1ZNQO 5C4GB 3W2HA 2WAMA 4EKYA 5ALKA 3V4RA 1MBZA 1NYQA 4CVNA 3UXYA 5CA0B 3LNCA 3QX8A 4WK4B 2C1ZA 3VPFA 1OXUA 3QPWA 1XGKA 4GZMA 3VRHA 3KZKA 2NTJA 3M49A 1CUDA 4H27A 2OO5C 4LE0A 2FP4A 1OWNA 1FP4B 2H48A 4ND4A 1TIPA 3T4EA 3OFNA 1U5AA 4QDOA 1GG2A 4QJ3A 3QEOA 3JD1A 4KR0A 4FYHA 3AERA 4ZI5A 1Y5RA 4ACBA 1U9YA 1YRQA 3OJ0A 4QWWA 2H00A 4XUCA 4MWSA 4EFKA 3W3AA 1OX5A 3Q6IA 3DVSX 4X1KB 2QN3A 2A0UA 4X61A 5G1OA 4JKYA 3H4VA 3ZTWA 2ZAOA 4G1VA 4YMVA 5JI3E 4KNYA 4PANA 2Y67A 2BHLA 1YI1A 4EEXA 2VLIA 2ECOA 4B33A 3GLGA 3B8EA 1TT7A 3ZDDA 4BQPA 2JLVA 4GZ6A 1HRDA 1QF7A 3QA3E 5HFJA 4E5NA 3JD0A 3D1VA 3BMQB 3TZHA 2PUAA 3IV7A 2XTNA 4UUAA 5F3RA 1GZ4A 3PD1A 3IX7A 3D8RA 3BHMA 4X66B 3ILXA 2JASA 2AE2A 1F2TA 2DJ5A 4ZJZA 3BKWA 1JHYA 1N3BA 1OFHA 3BXGA 2EL7A 4Q3OA 4KPFC 3CF4A 3TTUA 1HL3A 1SK9A 2GZAA 1X1SA 4DIBA 1W6UA 3PNKA 4NH4A 4PGGA 4F4CA 1HR0B 4PQFA 4U7GA 2RGYA 4HEA6 5ALVA 1K68A 1M1NB 4EUKA 2PUCA 1XL0A 4KDEA 4C4XA 1OBFO 1Q95A 3W5VA 2XA2A 1OFVA 1T1GA 2ZQZA 2YV5A 3N7AA 4AS3A 3VR6H 2JAUA 3CKKA 4ZTUB 4RY0A 4DF3A 2VUHB 2ZXFA 4JLBA 3ZHOA 4BEVA 4M46A 4ZYYA 2CXOA 2PZMA 5FPQA 4JJ4A 1XU7A 5DBHX 3SQXA 1SQFA 5DM1A 1RTTA 1KO1A 3EUEA 3I39X 4ZZIA 2H5IA 3KV1A 3SLRA 2XCRB 3CH6A 3FVQA 4BNGA 1A9QA 2D1SA 1ICIA 2J8ZA 4W1RA 2JATA 4CTKA 1UBNA 3VZCA 3FMPB 4KG7A 2FWBA 4WN3A 1I14A 3HL0A 3PDWA 5BQPA 1Y9ZA 5FO0A 1U8XX 2W9XA 3UY4A 5GTDA 4H7HA 2ZZNA 5KTTA 2QORA 1MX9A 1XKXA 4DTCA 2ZTMA 3FVWA 1QF9A 4KCGA 3RWBA 3PQ2A 4EGJA 5IT5A 1XJQA 1CR0A 4RPHA 5LBUA 3V00A 3FUVA 2PLRA 13PKA 4IY1A 3GZTB 1EYZA 2GEKA 2AFIE 3L0ZA 2A94A 2NVUA 2ZWMA 2ORVA 2GZ2A 4EB8A 1R4MB 4QGBA 1OI7A 4MQMA 1MN6A 3UNXA 4FKMA 4RM2A 2H65A 4J0IA 1JSLA 4GUAA 2LNDA 1EFDN 2JJMA 1KA9H 3LHSA 4YBZA 3BMCB 4CKZA 5B1HA 3OTOB 3C7CB 3SS7X 1HY3A 3AUYA 3L7AA 5DX0A 4S04A 3ZYZA 4G5XA 5DN6D 4OX9Y 1EK2A 1AXGA 3LIPA 2X77A 3PITA 1JEYB 1PFYA 2C2YA 1M0WA 1YOVB 4L76A 2R25B 1KNQA 3QLEA 3O0TA 4EELA 1YR8A 3WLLA 2OP0A 3LCMA 2R00A 2CDCA 2H3EA 4KO3S 5G3YA 4E2XA 1CIJA 2VDJA 4BQSA 4DY6A 3MOSA 1F12A 3JTEA 1DRWA 1SOVA 2AUTA 3OEYA 2CLKB 1N9KA 1XZEA 1O77A 2HHLA 2NV0A 1SXJC 2WJHA 4XZ3A 2Z2IA 2JVKA 2EW1A 1E63A 3U6KA 3T4UA 4LMPA 1NBIA 1J7KA 3D2AA 2JK0A 5H0IA 4M7WA 2HOQA 1OXTA 3I01A 1FSGA 3JWJA 10MHA 3OU6A 2RG1A 2GYUA 1DUVG 1MUUA 2EFEB 2LE0A 2XXAA 2A0WA 2GQ0A 3QUSA 3HXOA 2HRRA 3BD9A 2REXB 2JLRA 4GNRA 3JYOA 4M88A 5LA6B 2BM9A 3JYHA 3CTPA 4E5PA 5C2JB 1ZOSA 2O2ZA 1KZHA 4HH4A 1Z6ZA 2I6XA 3IHTA 1BJTA 2XWJI 3O4IA 4YIHA 1ABBA 3QVKA 4TV9B 5DHAA 4Z1MA 4WNYA 2VJOA 3C7TA 1OILA 3E18A 3KWMA 3LQYA 1U28A 3GBSA 2P2NA 5BRNA 1Q0PA 3GJSA 2I4NA 1ZM2A 1D2MA 3OC0A 3ROFA 4O29A 2J9FA 4PYKA 2D5IA 2H0AA 3PL1A 3SIRA 1Y6GA 2DSTA 3PPIA 2HK6A 4B79A 4YYEA 4BMNA 4D92A 1YVUA 4KYUA 4ITRC 1Y1SA 3CG0A 1GJRA 2RKWA 4F2HA 3EPJA 3BFKA 3DFUA 1JEEA 3G9QA 5J40A 3OJWA 3AVXA 4MUEA 2PFGA 1VLLA 2QIOA 1N2JA 2VJDA 2MMGA 1TM4E 4IH1A 3HXMA 1K63A 2DP4E 4XA8A 1SJ9A 4GWGA 1JFRA 5AT1A 3DE1X 3RF7A 1GGFA 2HA3A 2GCNA 1TYCA 2CNDA 2W93A 2YOFA 1LD3A 4EKIA 3ELDA 3WLAA 3O4GA 5LD2B 5T4BA 1VOTA 2XWPA 1VQ1A 1T36B 3GJTA 3CNQS 4FX2A 4RS4A 4C4AA 5AR1A 4JVSB 4G0NA 3G17A 1NBME 3RLFA 2IBTA 1WL8A 1B3BA 4OP3A 5DB4A 2FG7C 5A0VA 3AL0C 3EBOA 3ASYA 1KVTA 1USIA 4BJ6A 5JZVA 5LBTA 3L0YA 1COWA 3TTXA 3VDMA 1NN1A 1C7RA 3GP8A 4XSVA 1LRKA 1NBMD 3ZWKA 1V5IA 4CIDA 1VHJA 2C9MA 3ES9A 4LJ5A 2XODA 2OD2A 4MRSA 4EGCB 4C01A 2DWOA 3RVPA 1QDEA 2DPHA 3NCHA 2CFIA 4KV9A 3ZWNA 3OQVA 2HHAA 3QW2A 4LG1A 4QNRA 2VRWA 1BVYF 4XYBA 4C0KA 2DLNA 5I7VA 3TJRA 3L5OA 4CM9D 2EBFX 2CLMB 2QJWA 1N2CB 2C4KA 2FRVA 2XUHA 3KYDB 3W1VA 4DQDA 5AJWA 3DMPA 4EW6A 3SM3A 4BQFA 2BGLA 2OM2A 4W5TA 3U6BA 2IDKA 3FPCA 4HS4A 2I54A 3KOZA 2W83A 3K5IA 2WHPB 3FFTA 2ODPA 3RS2A 4BO0A 2W11A 2WUGA 2XXJA 4AJ2A 2CJWA 4UAUA 3WI7A 3H5NA 1DAPA 1SH7A 1KVSA 1VLHA 1WXEA 3BGDA 4WWHA 2F2TA 2HNBA 3ND6A 4WOJA 5DASA 1CJVC 3VI4B 4HS9A 2P9HA 1MF7A 3UWOA 2LZ0A 1H4SA 4GR4A 1FBTA 1CUAA 3A9SA 3DQZA 4ZT3A 4AUNA 4ENTA 1L1RA 2FPPA 3K9HA 3I5XA 3MS7A 3B38A 2H6EA 4HB3A 2H2WA 4KQKA 2QQ0A 1ZA1A 3OQ1A 3KALA 4G8CA 1TZCA 2KLHA 2FE4A 2P3QA 3E23A 3FOBA 4GSYA 3JRNA 1DBPA 1TRHA 3AGPA 3N8NA 2GT1A 2ILTA 1RYYA 2IXTA 3EWNA 4OK5A 4Z8XA 3VSCA 4GOMD 4PZCA 3WP1B 1ZX1A 2RI0A 5KUTA 4Q7QA 4ZIRA 1I7DA 1O6ZA 1QH8B 3PKIA 4A8JA 1VC2A 2A8YA 3IYLW 1E3WB 3U17A 3IKMB 5CD1A 1VJTA 1SXQA 2DQSA 2I4MA 1ORIA 4RGYA 4EEKA 2HBYA 3QKRA 5DT9A 1POWA 5F33A 3L4SO 3COYA 1E1KA 2JLYA 4WLUA 3ZR4B 1CJCA 1QHHB 3VDNB 2CUTA 1DHRA 3FWYA 2QUHA 2DKOA 3CKLA 1MENA 1ONBA 4O1HA 4GOND 3JQCA 5CHYA 3K20A 4MI3A 1L9XA 2W6CX 5CBKA 3I1JA 2ZQYA 4QDJA 4U7FA 2CV2A 4C0HA 3LCRA 1BDHA 3GJYA 2M6RA 1IZ9A 4LJ8A 3TCKA 3C3PA 5BMVA 5CITA 2YXEA 1GLVA 1KFCB 1WWKA 2VAPA 4IWXA 4TYWA 3F47A 3DWIA 1KE2A 1LK0A 4P4TA 4HEQA 5I8WA 4AJOA 1QLJA 2O23A 4KRFA 1FFXB 1ZNZA 1UWCA 5C5EA 5KREA 2GF0A 4YQFA 4NZNA 4V0OA 4CM6A 4LV5B 1VJ1A 4DDWA 3HZHA 4LNAA 3SEZA 2WWVD 2CMHA 2WIDA 2WDZA 4HD8A 4HLQB 4HUQB 3V4PB 2Q41A 3LBAA 3JAMA 1CR4A 1E79A 1Z0FA 1DSSG 3RVSA 5DWDA 1XP5A 2FW9A 5JDIA 5FLXA 2MDTA 4LYAA 4OFBA 3TGWA 4BMOB 5EJ4A 1OH6A 2VO1A 3PWSA 1ADJA 2GBGA 2ILVA 3AB3A 3M81A 3NT4A 4CMKA 1H23A 1S9HA 2GCPA 2HSDA 1GTL1 2B21A 1PV2A 2OKGA 2YYSA 5CAEB 1G3IA 1R4ZA 2OHIA 3R09A 4LK3A 4Z4GA 4HXYA 1RM3A 1GG5A 1L6IA 1U0TA 1RRKA 2HRBA 3WWZA 3I28A 1JLMA 2TMGA 1HPLA 2WF5A 2ADFA 3IP8A 4P81A 4EATA 4GPAA 3H6GA 2D0PB 3AHIA 4E33A 4YV2A 4RLQA 4XUEA 2FTKE 2K87A 4E7OA 5A4DA 2BRUA 3H2KA 3RUPA 3RJZA 1AS3A 2YS6A 1KVUA 1J97A 4NOJA 1U63A 6ADHA 3QX3A 3KTFA 2I2XB 2A5FA 4C2AA 1RAGA 2CFTA 3TTVA 2PV7A 3QU9A 4KXUA 3LRPA 1MAVA 4YB8A 1U1GA 2NZJA 4UPEA 2G80A 2D62A 4CI9A 4DQKA 1SCQA 3T95A 5GV7A 1JWLA 2BKEA 3G79A 2W6NA 4ZZ2A 3EULA 1QWOA 1TVKB 2AOXA 3R7DA 3SJAA 1YFLA 1UINA 3KBBA 3QUTA 4TWRA 1T3GA 5LL6P 2O59A 4JUDX 2O2YA 1AHHA 3O8LA 2R85A 4CTNA 2ASEA 4EKDA 2L42A 1DJPA 1A04A 2O20A 3A32A 4D2IA 1T2CA 2Z08A 1NI5A 2PAFA 4MXDA 5EG5A 2XUQA 2YW9A 3UMBA 3MGCA 3RAEC 5B30A 3UGKA 2PGLA 2HU2A 1LBHA 5TEWA 1JLLA 1UMKA 2LKDA 5B1YA 1OMOA 4PXSA 1O97C 4R40A 1FNCA 3CNHA 4WNAA 2AQHA 3YASA 2CE2X 4HGOA 3PC6A 2PKEA 3AT1A 1S4QA 3FYTA 3GJZA 1TQDA 3IMEA 1ZUNB 3I23A 3E15A 1Q6YA 4H0NA 5A2GA 4B3DA 4RW0A 4QODA 4CG3A 1V5WA 3HY6A 4U00A 3DKPA 3IMGA 4JODA 4G8JA 4P3PA 2E37A 3VU9A 4AN4A 1E66A 4L27A 4BFCA 1N1EA 5BXYA 4AP6A 1PWZA 1UUFA 1Z33A 1V16A 1GZ3A 4DEXA 4CKCB 1U28C 1W5SA 2RH8A 3KJIA 2BR5A 1IM5A 1YZFA 4RPCA 4P9NA 1ZESA 4BUZA 3DAFA 4JJGA 1W19A 3CO0S 5EIFA 1O0CA 3H5OA 2UKDA 5AXAA 4QXPA 4HQ6A 4CZ2A 4N8EA 3ELBA 2JHGA 5JJKA 1KYYA 3P0EA 2X40A 1JILA 2XV1A 3JV7A 1TVCA 1A2OA 3I9JA 4RXMA 3HDTA 5JPIA 2QTTA 4QT4A 4N8DA 5FADA 2IUUA 4RYDA 1LRLA 3W34A 4ASUA 5AHRA 4D9IA 1K7SN 5JAUA 2DBRA 3UXHA 1H0KA 1A7KA 3MLEA 3Q12A 2JIOA 2HK7A 2VATA 3GRCA 4KIWA 4OA5A 1FQKA 1JPNA 3K9CA 1UMDA 2QTWB 2FPSA 5F77A 1OIVA 5CDFA 3THRA 1WA5A 2R4QA 2Q6TA 2F43B 3I8XA 3MCAA 3N7UA 3ZU4A 3D4NA 3L4BA 5EJ5A 3FWNA 1QO7A 2VRCD 2GJ8A 3AQ4A 2QX4A 4LHEA 3NWBA 3UHPA 5KJEA 5LQCA 3N2GB 3WKEA 4K9NA 1IAQA 2C8KA 3H2ZA 2OAP1 1IXRC 1A5ZA 1AF7A 3BL6A 4GKAA 1T8TA 1OPRA 1ZJYA 5M2QA 3K70B 4RLFA 5B36A 2OESA 5KOHB 2I9KA 5K8UA 2AN1A 5HUHA 4EVSA 1A0OA 1WMSA 4ZCMA 3H6HA 4RD2A 3AH8A 2FAXA 2WU3A 3NBQA 5F5NA 3LSYA 5I7AA 2AD5A 1N0VC 3UJPA 3DZIA 4UASA 3ADKA 1OA1A 1PAUA 1EP9A 4BECA 3T35A 5CFLA 3I6QA 3NTVA 3R5SA 4IUYA 2G8NA 3G9XA 3KUKA 4HDMA 3DTYA 1AHIA 1BMQA 1A7JA 1MRNA 2Q3LA 5EN4A 3Q11A 3Q0IA 1LZLA 1W0JA 4MQEB 5T67A 3CA8A 2H2AA 1T24A 3MBIA 2XRMA 5ITZB 1E4EA 3N74A 4RULA 1UZLA 5G0WA 2P77A 2CB0A 2FZWA 1Z2EA 2N1MA 4XJSA 3QNMA 2C4NA 1ECJA 3K2QA 2IWRA 1SHLA 1V9SA 4EF4A 3ZZNA 3QITA 4S2EA 2WWWA 3M9WA 5DN9A 4KXFB 1G8JA 4BMPB 4NS4A 2Q21A 2XMRA 3MWEA 4E14A 2BM8A 3EPKA 1ZIDA 3C8HA 3HYTA 3WLJA 2GRJA 1W4AA 4RX1A 5EJFA 2QRPA 1JZQA 1SUDA 4DLZA 7GPBA 4BXOB 5I8PA 2Z6AA 2DH6A 3B6ZA 5BXQC 1AB6A 2CMGA 2XYVA 3GGCA 3HVJA 6REQA 2ZETA 4GBGA 2WF8A 4K6OA 1Y6RA 1XVUA 3AEXA 3GGPA 4JT4A 5EUQB 2PKRA 1YZYA 5J1SB 1CUUA 2X6RA 3C3WA 4KODA 3WGNA 3EXG1 4FI3F 1GRNA 5AKHA 4B87A 1U5CA 4IXWA 4I2NA 5BNTA 3A14A 3G13A 4HGPA 1V26A 2Y1EA 1TD9A 3NIDB 1CHNA 1BX3A 3B13B 3K1AA 4H4EA 1M33A 5D00A 1P9OA 1TUEA 3O2JA 3ZZUA 4CIXA 3GGJA 1G55A 4B3HA 1E3QA 1TM1E 2F1RA 2X3FA 2CXQA 1F20A 3HR4A 4RE6A 4IDQA 3RARA 4A8JC 3BGIA 5HEKA 4NONA 4C7OA 6NULA 1Z3CA 2FSPA 4OHUA 4FFNA 4C21A 1JSZA 1HO3A 5E6SB 3GOHA 4FBGA 3ZWYA 1Y82A 3ZI0A 1KJ8A 4G4JA 3EZFA 2JIMA 5HSGA 4AJEA 2LDBA 2R4UA 3F97A 4KAFA 2QU7A 3P0RA 4QDTA 5ERGB 2HJVA 2W4QA 3GVXA 5EPOA 3R3WA 4IEEA 4ZA2A 3OFJA 3SYRA 4OB6A 2ZYGA 1E4OA 4TRNA 2PX5A 5C8XA 1YR1A 2AKEA 1Z0JA 4RCVA 3RVKA 3MGAA 3SYTA 2JLWA 2JEZA 3H04A 1NXOA 2ZRFA 4L0CA 3C3CA 5H81A 1IHOA 2RHTA 4D43A 4EHDA 2XJ4A 1RACA 4DJTA 3A4MA 3U7GA 1VPDA 2VF7A 5AI8A 2ID7A 4A23A 5K3FA 1DIGA 3H0EA 2VH1A 1XCMA 1VECA 4KH1A 4N5DA 3RYFB 3DEFA 4UTRA 3IEMA 2YWJA 5IC4A 2ZUUA 1H8EA 3JASB 4DA4A 2JFXA 4LXHA 3VBEA 1AT1A 1P8AA 2W6OA 2YFYA 3RVBA 4GICA 3HGQA 3DOHA 2XDQB 5DNDA 3IJPA 5C1OA 3FPGA 4FW8A 3LP5A 2B5WA 2C0PA 4MV7A 3GYGA 4W1QA 4ONEA 1P1CA 1RRCA 2QEQA 1U9IA 2VUTA 1BH6A 2CHFA 2VH5R 3D6JA 1D09A 2ZSUA 3STUA 5KMGB 4NNPA 5JDIC 5JAPA 4MQUA 1HKUA 1US8A 4FOOA 4W5QA 3JVEA 3OUUA 1F8UA 3DH0A 4NJEA 2QSUA 4QL3A 3MWYW 4YJKA 4GYYA 1ZN7A 1DHTA 1V9CA 2W98A 1HLGA 3WJAA 4AP9A 5LWHA 3PNSA 3BD7A 4QXQA 3TYXA 3CLUD 3AVYA 1SKUA 3U0VA 4CIAA 3AESA 1N2GA 4GWKA 4LBVA 4CIWA 1RPNA 2PCJA 5BSVA 1C0IA 2C96A 3DAPA 4BRSA 5E6RB 4Y9UA 1NDQA 1DNPA 4H0FA 3JARA 3DS8A 3SC3A 4GOLD 2EC5A 2RHLA 1XMSA 2VHEA 1M67A 3IT3A 3QEJA 1MFZA 3HBJA 2BRUC 1DWPA 4IWNA 4OU4A 4F45A 5LKRA 4L28A 2B9EA 2XKAA 1ZM3A 3DEJA 3H5RA 3GUCA 3PIRA 2X0FA 3DWFA 5ALDA 2PCLA 2VJPA 3BS4A 1YHZA 1BKYA 1FP7A 3EUWA 2NSJA 3T3MB 4XARA 2IQIA 5FUMA 2QGNA 3AG5A 3EYAA 4JELA 4AYXA 5AI5A 3U7RA 4HDSB 1G4UR 3V1YA 1UFKA 2CL6X 4MRPA 4F9TA 2A58A 4N4AA 1ZH0A 4MI6A 1VL8A 3D43A 3H42B 1E59A 3IV9A 3R3HA 4IQGA 2FUKA 1KAOA 4CMAA 5AW6A 2HF9A 2FUEA 3F6PA 1PJBA 4GHWA 4YA6A 2HFJA 2DUUA 2HXGA 3LY8A 4INPA 4ZVRA 4I08A 5A5VA 5AVSA 1R5BA 3KR0A 3IT0A 4LN1A 3AONB 3WLMA 3R7LA 3SNKA 4KGXA 1XFDA 4KZPA 1VP3A 1FRFS 1OGIA 2NZXA 4FBMA 4PQRA 4KXMA 5COBA 3ZHBA 3CXUA 3JQ9A 1SVWA 5AXCA 1GNTA 1NDHA 2D7CA 2P9CA 3G0CA 1BVHA 3QKSA 1SCNE 4J6FA 1UMBA 2ROQA 4DA7A 1T3ZA 1NIJA 2IOHA 3GHYA 3LVRE 4AMGA 1JG7A 1NC3A 2CK3A 3G9UA 2J3DA 4J9UE 1RJGA 2VDWA 1LA2A 5CT6A 1QP7A 2ZS8A 2F62A 4LC9A 1TYAE 2RB5A 4FZVA 3WJ7A 4D97A 1RLIA 3PJEA 4HAXA 4C0QC 5J43A 5JNRA 4CGZA 2VJLA 3HV0A 1KAGA 3CX3A 3EMKA 3CB4A 3GFGA 3MJVA 4IRUB 5K3AA 3E5RA 3W79A 4D57A 3UGTA 3OOWA 1VYVA 1OGYA 2LKCA 5HPYB 3QIAA 3CB2A 5FO1A 1ODFA 2G1PA 1W85B 2XLBA 3WIEA 4AZSA 5DYTA 2H4XA 4QUHA 4RJJA 4PNZA 2G5TA 2WNSA 4H59A 2VQEB 4P4SA 4TQGA 1ZN2A 1B6GA 2I67A 4HWKA 4WN9B 3USES 1IWPB 3EWSA 1RBMA 1P91A 1Z4LA 4HH0A 1H1LB 3CUEF 3NM4A 3EDYA 5JG7A 1NE7A 5BQ5A 3T5DA 3P2EA 1UZUA 3GZNB 1A9SA 2HW8A 1ADGA 4YQYA 2X22A 1O95D 4JNKA 1G21E 3C8ZA 4X85A 2W2MA 3SIPA 1GPJA 2XB8A 5CVEA 2XZTA 1GAXA 2XE7A 4UBMA 2COUA 1PLLA 3M9XA 3AF5A 3O4JA 3PNOA 4TVOA 2OSVA 3ICPA 2B4AA 1KJZA 5B1IA 1ONOA 2VDUE 3S2FA 2D74A 5FBLB 1RP7A 1UPFA 3DGEC 1JFLA 2BH2A 3RKUA 3VR4H 3Q9SA 3DPSA 1FYWA 2AJ8A 2P5UA 4C4TA 1J2JA 3NCTA 3U3XA 3L4BC 1XIVA 3B1XA 3CKMA 1OIXA 3OESA 5FCDA 3PT9A 3OU2A 2PNJA 3VTFA 4S05A 3JAWB 3RVRA 1NKSA 5HX7A 2NMVA 3CLTD 4UU1A 2XYQA 1D2RA 1NU6A 3AU8A 3OZVA 3ZCPA 4QOSA 1H2BA 5IVKA 4WASA 4P7JA 1XRMA 2I7XA 3O8DA 2ZIGA 4X5OA 1IPFA 1RYNA 4FKZA 3A27A 4MWOA 1EUCA 3OBBA 4RXUA 3KB6A 4C4ZA 3KJZA 3QXGA 4IJ5A 4LBYA 1DARA 3RV4A 3WIOA 3WIVA 4ZRDA 1NLUA 3RSCA 2DCMA 4F4IA 3NWOA 3S40A 5DLYA 2B6NA 2WYHA 3EUFA 3BTOA 4WKNA 5IJ0B 3ZGNA 1E2MA 4M1MA 1USGA 2B2NA 1N5OX 2G72A 4YN3A 2OC9A 4M98A 4QDXA 3PTAA 5H4GA 3PI6A 1MDFA 1IJFA 1E77A 1NW3A 4A0SA 5F2NA 2DU8A 3H2SA 2FZKA 1X13A 3NR2A 1GGHA 1R9JA 4Y1FA 5AKEA 2PGJA 3LXUX 4ZODA 1WPQA 3FUCA 3LKDA 1EVZA 1UK8A 3LP8A 3JRWA 4H16A 4JX8A 1ZITA 2PS1A 4BLRA 2AW3A 4OQYA 1XMIA 4CODB 1XA3A 5SYMA 1HDRA 1DJMA 1T8RA 3HHEA 1VHQA 4QJ5A 3U3KA 5EWLB 3ZV6A 1M76A 2ZJBA 2P5YA 1RZ3A 3P4YA 3V9AA 3EC7A 3RHFA 4DUGA 4CETA 1H2RS 1NR7A 3W4JA 3S8EA 4TMZA 3CUUA 3SOPA 2GN2A 2JL1A 1GG9A 3QKWA 4G5RA 4IZ6A 1JR3E 1PG5A 2QVYX 2GVNA 2W2LA 2X76A 4Q6BA 1PX0A 2QUJA 3SU8A 4LOLA 4C0XA 2DLCX 2Y2VA 2JZOA 1MNQA 2HA2A 2Y27A 4Q18A 1A76A 1P2GA 3CISA 3FSGD 2PYZA 2O5CA 1NI4A 5JXWA 1M6VB 2CFSA 3HVIA 1S3IA 4JZKA 4Q7KA 5CW2A 4HNUA 3O8RA 3C8MA 1XN1A 4BE7B 1XPOA 4Z4IA 2NU6B 4RHXA 2HL6A 4HWTA 1LDGA 2PGIA 2C42A 4MS3A 5DYYA 3S2YA 2A33A 2NYAA 4AFNA 2QV0A 4CJXA 4DIOA 3TKAA 4XM0A 2IKQA 4MINA 3JAKA 1PFWA 4WY2A 1HRKA 5AVXA 3LO5A 2WTUA 4CEIA 4JBWA 2N0SA 3ML1A 2IPAB 4UTPA 4YR7A 2WB2A 1LNZA 4HUJA 4JKOA 3DUFA 4RAOA 3SS9X 3O8CA 4MEBA 3T3HA 4D6XA 3QE2A 4AKHA 2IHVA 1QOQB 2GDJA 2RHDA 2V0CA 3HWWA 3A1DA 1W88A 1LLQA 4Z86A 1AGXA 4FT2A 3GELA 2VNHA 1VFPA 4NR0A 4P3OA 4BP3A 3IH5A 2O8FA 3P52A 5E9QA 3PHIA 3UUGA 5J2UA 4GC9A 3H5AA 3U49A 1YVEI 5HVNA 2GJ9A 1TRKA 2DY0A 1P6XA 2HLDA 2NZVG 3DC2A 4QNMA 2D1YA 5E1DA 4LXQA 1ISPA 1C81A 2HDHA 3AHGA 3GA5A 1GYRA 2O06A 4MKRA 1E5DA 1OSNA 3G2QA 2VWQA 2MMCA 4BVHA 1IWOA 3NXKA 4DLUA 3NHFA 5FKJA 2RK6A 4NCNA 3CYFA 1VL5A 3SXPA 3WWEA 3LOQA 2IS2A 2JD0A 4JYPA 4TZKA 1KC1A 1L3BA 4LHXA 1FMJA 2QK4A 2XVYA 1YBVA 1YZTA 1VDZA 2GI4A 3L04A 3PFCA 1R8SA 1R0CA 1JU3A 2GF2A 1CP3A 1LLCA 2C29D 2D06A 2ZDQA 3FNIA 4H7FA 4OVKA 3DXXA 3ZIAD 2AZXA 1XTTA 3SDBA 1ORVA 1UDCA 3W9UA 1WMFA 1X39A 4XW2A 1JMKC 4L15A 5E3IA 1Y5IA 3ONEA 1U9IC 2QUKA 3OOHA 5DBGA 3ZX5A 4CQMA 4IO0A 2YN4A 1HYQA 2OP1A 4LBZA 3DFIA 4D3YA 3ILYA 4G0XA 3VM6A 2PT6A 3JYNA 3EW9A 4PE5B 2ZQ5A 4B4UA 3UBTA 3ETHA 3GROA 1KOGA 4ZDKA 2RHWA 2W0MA 2ZRGA 3LDGA 3RRYA 5IF9A 2NZ8A 2HK9A 2XZDA 2YKGA 5AO9A 3U44A 2PWYA 3EEYA 3R2JA 4U6QA 2VWPA 4XWGA 4JH0A 3TBHA 2ENUA 4RGQA 4YCBA 121PA 2C5LA 4UEQA 3UGJA 3GRZA 2F4VB 1KOFA 5AI4A 1RI3A 2RSLA 3U7QB 3RYCA 3D2CA 2AFIA 2G9NA 5KOIA 4Z0HO 4KQ2A 1DQNA 1Q21A 4MV8A 3SJ7A 4R51A 2P1ZA 3T1HB 2QM8A 2XRYA 4IKEA 4ZK6A 4QVKA 4R1QA 3HJCA 5HNKA 2UUCB 1FNMA 4LYDA 2M9MA 4MHSA 2BGRA 4EM6A 3AEYA 2Q1YA 3CGGA 1JG3A 1R15A 2FRXA 1E9SA 3ITEA 4HBGA 4JLAA 4JD5A 4WEOA 5K3EA 4ND2A 1F6BA 3HCFA 1YKGA 2FUG6 5GZ3A 3BE6A 5TLSA 3SFTA 5BWMA 1L5YA 2YMMA 1CUCA 4PPNA 3IPYA 3WX0A 3DLHA 3A1EA 4IHJB 4D0LB 3EXHA 4R81A 2P6RA 1PQWA 4FYIA 2WJJA 3FYUB 1U1FA 5E4YA 2EZ4A 2AL7A 4LZLA 1RCUA 3L7DA 1VRWA 4LDQA 3ZGYA 3T12A 4EP1A 3EA0A 2GTHA 1NQAO 3L0DA 4ZOLF 3S1LA 4DS3A 1I7QB 1BEZA 4IIDA 3FG9A 2CMDA 3R0IA 2IZZA 1YJAA 2P27A 1S3FA 3AY0A 3EN0A 3KOMA 3D8UA 3QVWA 5D85A 5DULA 2HWXA 2MSEB 1XEXA 3AOEA 1R5JA 3JQ9C 3WYCA 4ALJA 4TZ0A 1F3OA 2OHHA 2JIZA 2Y9PB 1JFSA 1KI1A 4CU5A 3OQIB 5HW0A 1AKVA 3MQFA 1YBMA 4XX1A 1UMCB 3W2GA 1HFEL 2W2VA 2XHZA 4J0EA 3T5MA 3UBMA 1AO0A 1W5AA 5KS2A 3JTMA 3ONDA 2D2IA 2JCVA 2ISCA 4G5HA 5FAXA 3N5KA 4RKFA 1MHPA 2H1HA 4N5MA 4Y2XA 4IFTA 1JMVA 1JZSA 1VPTA 3NAZA 1VJDA 3OPXA 3Q6NA 4NTZA 3TQFA 2AN4A 2EX1A 1YKFA 2HPHA 2K5UA 2P2GA 4GKVA 4JUAA 4NZ9A 4UVHA 5ER9A 3AK4A 3WQSB 1H22A 4ROTA 2E21A 2GCEA 1OU4A 4FYXA 4ZFNA 1LXCA 3HS3A 3V2HA 2JAXA 1U6JA 1GPNA 2EZ9A 3RTBA 4ARSA 4X62B 5ALGA 2EYUA 4PV7A 8GPBA 2IYNA 4GM1A 1M2HA 3ESRA 3TUIC 2BEWA 2JFBA 3PNLA 4DPLA 3WWYA 5GWXA 5KCZA 2C57A 1Z5WA 2CHVA 4TM8A 1OT3A 1QG4A 2C2MA 1II9A 4HFJA 3QE9Y 5KTPA 3A4LA 2A6PA 2GEDA 2C1EA 3AR4A 2QV7A 1FF9A 2Y99A 3MT9A 3LHKA 4EITA 2I62A 4JHLA 5EUBA 1UBRS 3L06A 3EY4A 3C6KA 4Q01A 3S8YA 1XJ5A 2G40A 4N8SA 1J21A 1OBVA 3AUTA 5HK8A 5JSKA 3UANA 3OOYA 3BMXA 1Z08A 2PD4A 3E3AA 4OBXA 5HILA 4PN3A 1FPMA 2ZBFA 4RTNA 2B8TA 3SVTA 2XTAA 1EX7A 1UQTA 4GR9A 1NBMA 3D4IA 3H7AA 1HQCA 4ND6A 3WRWA 3DLBA 3CONA 5MFPA 1KJQA 4RFVA 1TFRA 2RD2A 1XQ1A 3TN7A 2R7MA 4FOSA 3CLHA 4WFIA 3ASUA 1UKEA 3GCZA 1Z8DA 1HL7A 4MW2A 4BJ3A 2PSHA 3K94A 1NASA 2QPLA 3TAUA 2YUIA 1W9MA 4MP6A 4CI0B 1EFUA 2ZVJA 5JZ9A 1VL0A 4NPHA 3D02A 4FIZA 3CN9A 2PRYA 1LVHA 4L74A 1LPNA 1RPJA 3BIOA 4V0ME 5AFSA 2BEVB 1V8DA 3A1TA 4AWBA 3DL4A 4D56A 1UOQA 4NX2A 1N7JA 3L8EA 3RS9A 4L5YA 3VC1A 4BNYA 4L0MA 4DREA 1Z7EA 3DDUA 1WKCA 4GNKA 4HXEB 3T0FA 3AF4A 2P9QA 1BW9A 3WLTA 4RKRA 3I52A 2O8BA 1NZFA 3BH6A 4YMSA 4ZRNA 3KUCA 3MS4A 5KC9A 2IHBA 3P32A 4F3KA 5CB8A 1T4MA 4FFWA 1E9RA 2IOYA 5CA0F 4WDQA 3HY3A 4E08A 2EATA 1ZVMA 5JNVA 2JANA 5EJGA 3KO8A 3I37X 5DRTA 1ETUA 2I71A 1JJBA 3JVVA 1CZKA 2WG0A 3OT1A 5C32A 1L7AA 2L82A 3KQNA 2J67A 1XXHE 4REMA 4RK6A 3ZVKA 1MZPA 5JQGB 1ADYA 1GILA 2W8ZA 3A04A 2VF2A 5DCLA 3VZBA 3LCUA 1PRYA 4PFQA 4RVCA 5D5PA 5EZYF 3SHFA 4R69A 3WNVA 1IU9A 4E15A 2QMEA 4HYTA 2JAHA 2B4YA 4IF4A 4E6PA 2RE8A 2FEOA 2FG5A 3MLAA 4LVCA 4NYMR 2V7BA 4NFSA 3W2FA 2MHCA 3NAQA 3BGSA 5I4BA 3RE1A 4GXNA 3C5HA 2QUIA 3TDNA 2ERYA 3EEBA 1ZCJA 4ESOA 4C4PA 3N2KB 3EPHA 1N2HA 4PHCA 3II6X 5B58T 3WYEA 1E2BA 4ZI3A 2IP2A 1MB9A 2PRIA 4IDOA 4L4UA 3J81A 3HBNA 5DI3A 4TTPA 4UHFA 2AFHE 1T0IA 1QZTA 2C4WA 1RHJA 3ENVA 5TGDA 5I48A 1KWKA 3EASA 3I73A 3X3HA 3IUMA 4F5WA 4BB6A 5TQ2A 2WIBA 1CB0A 3EAFA 3KDPA 4MK4A 1KMQA 4J29A 1NF3A 5TMPA 3LNTA 4ID9A 3VBCA 3DKVA 3AEZA 1Z4NA 2D1TA 1DIAA 4WZZA 1I80A 5AVJA 1PZNA 5KHOC 3D9QX 4R05A 5MDHA 2EHDA 3N6RA 1FC0A 2MT9A 5BN5B 2X9NA 1WD7A 2A3RA 5E4FA 1RIIA 4RV5A 4ZK2A 1OLOA 1UT5A 2IS6A 5H5JA 1O08A 5BR1A 2ZUFA 1Y9AA 1F14A 4GOXA 5LB2A 4MQBA 5ALNA 5B2FA 4GU5A 1XTIA 2ECKA 3OE7D 4JLMA 1KGDA 4DAOA 5U1P<