2J85A

B116 of sulfolobus turreted icosahedral virus (stiv)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
Knots found
sequence length
117
structure length
117
Chain Sequence
GKVFLTNAFSINMLKEFPTTITIDKLDEEDFCLKLELRLEDGTLINAIGHDSTINLVNTLCGTQLQKNRVEVKMNEGDEALIIMISQRLEEGKVLSDKEIKDMYRQGKISFYEVWHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STIV B116
publication title A New DNA Binding Protein Highly Conserved in Diverse Crenarchaeal Viruses
pubmed doi rcsb
source organism Sulfolobus turreted icosahedral virus
molecule tags Viral protein
total genus 24
structure length 117
sequence length 117
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08960 DUF1874 Domain of unknown function (DUF1874)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2j85A00
2J6CA 2J6BA 2X4IA 2J85A
chains in the Genus database with same CATH superfamily
3KPVA 5BW8A 5L3SA 2AHRA 2X2FA 3AOGA 3MT0A 4R54A 1LS1A 2NQTA 1JDPA 5F12A 3AVVA 5CIQA 1P2SA 1Z8HA 2A9OA 3R74A 2YVLA 3IALA 4NOMA 4PPNA 4Q3EA 4AYXA 3LY9A 1DTEA 3REFA 2QVCA 1DJQA 1KI4A 1SUPA 2B6NA 3HY6A 1DC8A 3LZCA 4J0CA 4KC0A 5B4VA 3RS2A 1LK5A 4X92A 2I4OA 4UBKA 3VO2A 2Q1YA 4N4AA 5REQB 1WSDA 3TBHA 2Q6VA 1WR8A 2AOUA 3OWXA 1I3NA 4E5MA 1Y7PA 3DTYA 4I9FA 4OBBA 3SHOA 1XDGA 5IM5A 1T9HA 2CD7A 1L8LA 2RFLA 3BEOA 4IJUA 4JC8A 4KL8S 3SM3A 1RWBA 4HNUA 1QAMA 2C2KA 1SELA 3C43A 3HUDA 1VIVA 1SM4A 2X6RA 4YUWA 1DQSA 4DM7A 4IGIA 1O95D 3ASVA 4OFWA 1FP1D 4P53A 2YRXA 1VTKA 3QUBA 1ZK0A 2P9GA 2W2XA 4MUHA 4XM1A 1RMQA 2JFPA 3MSXA 5K01A 5E2BA 1DUVG 2VKQA 4M1YA 1IHOA 4LI0A 1AUOA 2IU3A 5BY2A 3V7UA 4JT2A 1JJFA 1KRHA 3U60B 4B4OA 3WAGA 4Q47A 4UVHA 5PGMA 4BP1A 1ISPA 3WQBA 2XHEA 3AV0B 4OTZA 1Y4SA 3HO8A 2C7OA 3TD2A 4J16A 5C34B 6GPBA 1C30B 1F0YA 3RIYA 5C37A 4TSKA 1RLTA 1Z6YA 3UF0A 4QNMA 3OF2A 2F6RA 2ZULA 3B53X 1C9JA 4INZA 1YS2X 4HYTA 4QASA 1JBEA 2OXCA 1UBHS 4I5EA 1XCOA 5ILQA 4TZ6A 4UFNA 2ZATA 4BRSA 1W1IA 2I2WA 3C16C 3ONWA 3ZV6A 1WO8A 2CHVA 4MDEA 3CZPA 1QTNA 2MMGA 2SKCA 1RM3A 4C03A 1DNPA 1TZ2A 3A58B 1FMLA 3DAYA 5BV8A 1VL0A 5KQMA 2G0TA 3C3XA 2FY8A 1XE3A 3GFVA 5J43A 3A9CA 3NDIA 1SKYB 3QUQA 1Q0PA 4M8SA 4NESA 4DUGD 3KTOA 3NVAA 5A2QA 5JS8A 3CONA 4F4DA 1AK2A 3QQPA 5JECA 2E18A 3QJ5A 3VR6A 5LU9A 3WWPA 3RJZA 4XLZA 3AHFA 2AJ8A 3HB7A 1Q7RA 1AKYA 3JYOA 3L4SO 5IC5A 4YUAA 3DE6X 3FDXA 2UUOA 1JDNA 3FSEA 4HNAA 4FVTA 2BGJA 1B0PA 1T5SA 2APJA 2PQ2A 2QG6A 4GPEA 4QOGA 4XFJA 4XIIA 3RSSA 4XXHA 4S1NA 5DCUA 3V4SA 4X8HA 1AU9A 1UBRS 3ZIUA 2IIBA 4PEVA 4DKJA 1R27A 1L7AA 1J25A 5J59A 3KQLA 1OT3A 4KVGA 4OXRA 4BLRA 2ZR7A 3B6JA 3GH3A 4UATA 3NANA 3T9DA 2BJWA 1ZBDA 2EVWX 3MS2A 1DRVA 3HLYA 3KQTA 2ZRIA 1W59A 3C7AA 4RXTA 1CBUA 3K09A 1MAVA 2LTAA 2WHYA 5J2TB 2CMFA 3HE3A 3RABA 2BY4A 1WKCA 1IAVA 2WLTA 4K8RB 4OG2A 4QEDA 4AJPA 4KP7A 4LQDA 1FLNA 3OQIB 5MN6A 2FPKA 2O59A 1NN3A 1KTVA 2WINI 2Q9BA 1TJ4A 3KYIB 1QC5B 1IHYA 4QYXA 1JE1A 2JJQA 4B33A 3URKA 3ZTWA 1U5AA 4BUZA 4Z3OA 3N2LA 3WRYC 3ZTYA 3D64A 3KXKA 1ZK3A 2P7IA 2NZVG 5AOCA 2NU9B 5EA2A 1P7YA 3CISA 1ZG3A 1PEDA 1X1EA 4ZV7A 2PBRA 3OQNA 3H5TA 4FS3A 4MLPA 5IMBA 1QK5A 5H8WA 3LF2A 1GDDA 2C2BA 2NVWA 4WOCA 4UAJA 1HG1A 2IYOA 5KYXB 4KI0A 4Q03A 4G3XA 1KZ1A 3G5TA 3W1EA 2Q5QA 3HDYA 1MXFA 4G5XA 5B3JA 2CNWA 1L5ZA 2ABWA 2VEOA 1OKKA 2XTNA 4E2YA 4DV6B 1EFVB 4DR3B 3H4VA 3N2ZB 2PUGA 1USKA 1ST2A 1YB5A 2PS0A 2ZBVA 3ZDBA 3K1YA 1ZKMA 1QIGA 2VJMA 3FPEA 3DKIA 1Q6YA 3R3HA 1VJGA 4RK6A 3LK6A 3M6FA 3C7CB 3KFVA 3U40A 4S2UA 4MH0R 1YR2A 3JWGA 1PX0A 1SCNE 4GP6A 2RI1A 5BURA 2VPPA 3HV0A 1GDHA 2ODPA 2PH7A 4Q9JA 3WBKA 1VA4A 1ZCFA 2WKQA 4HFRA 5JYEA 3B1YA 5EHNA 2DEUA 2D7DA 4DEXA 1T3HA 5AIBA 1QIEA 2IP1A 2JFWA 2OMKA 1UBJS 4M99A 2PZJA 3S8EA 5SZIA 2VPTA 3GL9A 5T41A 3UAGA 2EBFX 1QTIA 2DPMA 3EC1A 4TN5A 1MOQA 2YCLA 5CNMA 5BSVA 4YHHB 3W5AA 2OWDA 5G53C 2FDCA 1ZNZA 2QN3A 3IMGA 1GT91 1WXGA 3DE1X 2Y77A 3PD1A 4O4HB 1K7SN 2QTVB 1GTZA 1VI6A 4O2BF 4D8UA 1TF7A 3EOAI 3LO8A 1PFYA 2FP3A 2W2KB 4GI5A 4CU5A 2K5UA 4CEJA 2IYWA 5EKXA 5CJ2A 5ITSA 2ATCA 2A78A 1OVGA 2OD7A 4IV0A 4YAEA 3P4UA 3F4LA 2BF4A 2Q5FA 3UJHA 2JRCA 5CDHA 3NEAA 2XKJE 5JS1A 3DCNA 3DMGA 1G8HA 3GK3A 1N6LA 3UH1A 2IT1A 4C20A 5KREA 4ZOCA 3K6RA 5I48A 1DQRA 4Y2HA 1V11B 1HT2E 2BDEA 4NIMA 2R47A 3PQFA 4K9KA 4UPDA 1BA2A 4GYJA 2DT8A 5G0TA 1V4VA 1SCUB 2H6EA 2OCKA 3E23A 1JXOA 1NU8A 3RTDA 2WKPA 1XHEA 2J9FA 7AT1A 2Q3BA 4GU5A 1DKPA 1AGYA 3KEGA 4LECA 3VVMA 2Q8QA 2PQMA 2X8LA 3A6LA 4WZZA 3KPYA 4H4EA 1CYDA 3GVCA 3H75A 4JK3A 2YR0A 3I04A 4H17A 5JFGA 2CBZA 5LSAA 5KQRA 4P34A 4TMFA 2QPAA 3PB3A 3BKWA 3KZNA 3PDUA 1GAEO 3B38A 1DARA 2YL2A 3OUTA 1B93A 1TMYA 4V0KA 3SEAA 1QPZA 1GCIA 4MQEA 4ZDWA 5HMLA 2PKEA 4BO9A 4NV1A 5JNLA 3G1WA 3DZKA 2OBYA 1YONA 2V9ZA 2VJLA 3FCAA 4TKMA 1XVLA 3W2EA 5KJ1A 3BXZA 4I1UA 2BD0A 3QOYA 2XRMA 2VP4A 1MG5A 3LKVA 3R3SA 4O0LA 3UATA 3NGLA 4NYMR 3PUXA 4XSHA 3WKDA 1ZWKA 2Q28A 2BTQA 3CLTD 1GKLA 3L04A 1HEUA 1VJ5A 1UZNA 3PVZA 1NY5A 4BQOA 4LWQA 2OPHA 5IYZA 1GGNA 1GNTA 1SXJC 5K3CA 2C2MA 1E6WA 5MN4A 1ST3A 3LUBA 5DW3A 5DE3A 4JYZA 3H9EO 3ZBQA 4ZU3A 5AM4A 1OAAA 5KKNB 1W4LA 1VLLA 5AI6A 4DCOA 3TR6A 1G20A 1VHJA 4PSAA 1PT7A 1XC7A 5DLYA 5EZYF 1BVHA 5EJEA 4PLVA 4HSEA 4ZT3A 4XGIA 2XQKA 3HKDB 4CUZA 2VIIA 1M8KA 1P1BA 2FZWA 2XE6A 4I4CA 1CWUA 1L4KA 4MKGA 4Y8VA 3WRWA 3L8MA 1W52X 1T9ZA 5AHWA 3EYWA 3QLJA 1ONOA 1FXWA 2FSPA 1FFCA 2J3MA 5A1TA 1RXEA 4R81A 3LHIA 4CZ2A 3O26A 4I1YA 1QCCA 1WCWA 3R0ZA 4CL3A 2B7BA 5LC1A 4ZCQA 4HQOA 4CT4B 3DM5A 4IKEA 1ISGA 1KR5A 1NUUA 1KAMA 2Z1NA 3S28A 3T3EA 4YMWA 3S1AA 5LP6A 2WPNA 1EFRA 5F73A 1Y7LA 5IANA 1JHUA 1Y7HA 1YIAA 3SXUA 5JWRA 3ND7A 1F1JA 1OMOA 3BICA 2W6MA 3MWDA 4I50B 4MSUA 2AV6A 4RIFA 5DNAA 2ZIUB 3IMEA 2CSUA 1JJVA 1KMQA 3F78A 3HI4A 4XQEA 5EY5B 4YS6A 1HYQA 3WFIA 5THKA 1H8ED 1RJEA 4LY0A 1N7HA 3HEBA 1ZGGA 4LE2A 5ER9A 2A9VA 4LRSB 4UOQA 5FNZA 3LCJA 4A8PA 4B8WA 5B37A 2EP8A 2J67A 3M6IA 5BN5A 2VZ9A 1O8BA 1BE8A 3HKEA 3SU8A 2CCKA 2VF4X 2PWPA 2DPYA 3UANA 2PU7A 3B8HA 2IYUA 3E82A 3JYLA 1CC1S 4AECA 3AIMA 5K0BA 2WYOA 2DZDA 4BKPA 2DUWA 2ZS9A 5CEJA 4QBKA 3TEJA 2REQB 1E6CA 3MJFA 2WTUA 1S3SA 1SMKA 1JXQA 1TQ4A 3CN9A 4DIMA 3CA8A 1SHZA 1T36A 1X7YA 2ZVJA 3GJ6A 1ZU5A 4GZ6A 4KK3A 2IU0A 3SYLA 2BI7A 3P7MA 1WSAA 1VHLA 1Z2OX 4JJIA 1C9NA 2A0XA 3C6BA 1NT4A 4RU1A 3TIXB 3TTWA 1YDMA 1YJCA 2UVPB 2GD6A 3MERA 2DFLA 2HQBA 3OTWA 4KN6A 3S2IA 4CKEB 4LSWA 4D0RA 4UBOA 1SVIA 5E38A 3FBWA 3GVPA 3UB2A 4PU0A 1PFKA 3UWDA 5HUJA 4FFSA 1OAOA 2H3EA 3CH6A 1YJAA 2ZYUX 4ROSA 2CJWA 4B43A 2AI1A 4G5SA 2XTJA 4QXAA 3I1JA 3B1ZA 3BCHA 3LYAA 1RQPA 1XT6A 4GDFA 1BGWA 3HHEA 1R7RA 1VJCA 3CO5A 2VLIA 4A5SA 5EJAA 5HW0A 1O94A 5DM2A 4ZALA 2WE7A 5DI3B 2F1RA 3RC3A 1UBFA 4JR2A 1RYDA 1UEXC 3AR9A 4NH4A 3H87A 1VIYA 5IKPA 1R4ZA 3HO6A 2V8OA 3LT1A 1ULZA 4REMA 4NDNE 3HB1A 5JATA 3F6CA 4Y3UA 4PHGA 3EVFA 1DIHA 3ANNA 5CFQA 3GH1A 5TPWA 2FPPB 1EG7A 3A9TA 1GDTA 1GQRA 5A3SA 2HYIC 4MEAA 1OGIA 2A0UA 3UK6A 2OCXA 2IPNA 4LFCB 1YIOA 5KWEA 3K1TA 1O87A 3BWYA 2QD1A 3H5LA 5A9TA 4RE5A 1SC3A 2K4MA 4TT8A 4FN5A 2WQ7A 1UBMS 3SFVA 3QJGA 1P44A 2ZWMA 4LTNA 3CCFA 3NIWA 2VVTA 2CV0A 4L4RA 1G60A 3S2GA 3EAFA 5KS2A 1PLJA 4BZWA 4ETIA 2A30A 2UZ1B 4PYMA 1HE4A 3JATA 3OE4A 2ZCJA 1SVNA 3DC7A 1HXHA 3IUPA 3GLHE 4XWKA 2Z2XA 1CK4A 2JGFA 4F45A 4OYHA 1CUFA 2B4QA 4XQ9A 4ZHQA 3UG6A 4I46A 3C70A 1GZ5A 4G0VA 5KAPA 2BFFA 3H2IA 3ADPA 4W6ZA 5LMZA 4KSBA 2WF9A 4DKXA 3OJOA 1WY5A 2ZIGA 5ES3A 3DF7A 3TE6A 5IH3A 3CJTA 4OQMA 4XD7D 4O0MA 3MPOA 1TZCA 2FGJA 1KO1A 1MTZA 2PFKA 2PX0A 3JYNA 3AUKA 1YKSA 3HKCB 4I55A 1KZ7B 3EQ6A 4RC9A 2BRUA 5IJ0B 1J2RA 1X2EA 2I1QA 4FPXA 2OHOA 4QQRA 3TL2A 3TQIA 4DE5A 1HOTA 4WOJA 2ZE8A 4CI0B 5G1PA 3OZWA 4HY3A 6ADHA 3O2JA 1IB0A 3KTFA 1Y3CE 5IJWA 3DOEA 2PJDA 4DV3B 1NDQA 2E1RA 3HWRA 2PWBA 5AJHA 1YJXA 3UN1A 3VTZA 4ZJPA 2IKQA 3WO0A 1XSEA 1P77A 3VDQA 5FIUA 5JBQA 5BR4A 1Y0BA 1U3VA 1WOMA 2HX1A 3GAAA 4LA4A 4NFLA 5FUYA 4LJ5A 4B7XA 2QTMA 4FCWA 3RG2A 4NYMQ 7REQA 2XXBA 4L50A 2JLWA 3V4VB 3R40A 5KJFA 2BKEA 3D3WA 2C0CA 1PD1A 3F47A 3FVVA 3M6MD 3TJMA 2P0YA 4NBNA 3WYEA 3G8DA 5I5EA 1SURA 4C21A 5IDQA 5IU6A 2INGX 4AP6A 5GY7A 1U8FO 2QV7A 2FF7A 2R8YA 2QN1A 5F23A 2VEDA 1DMRA 3L18A 1BH2A 4Y0VA 1CIJA 3AB7A 4A8HA 1I6MA 1W76A 4GZ5A 3B85A 3TZCA 1E0SA 2QG4A 3FMPB 5K51A 1GTSA 4P4LA 2XY4A 1OI4A 1JJ7A 2CE7A 1PYGA 1PL6A 1ZIOA 3Q98A 1D9XA 1RYFA 1YJBA 3AHEA 1D8AA 3GWGA 5DSZA 4E32A 4EELA 8ATCA 3E9DA 1E3JA 4P83A 4LJSA 3I8SA 3EBPA 3IUMA 1I4TD 2CVZA 3HXTA 4XWOA 4CM7A 4RQUA 2EGUA 2IZOA 4I5DA 1IHUA 1H4QA 2IS1A 421PA 1CEYA 1R0KA 4Y2YA 3TRIA 3KFXA 3S27A 1GCGA 3AMVA 3PCTA 4R6XA 3GB9A 4ENPA 4FJ1A 4IJ6A 1E9VA 1J8DA 3AR3A 1ZSVA 4R9RA 4URUR 5J9FA 1GO2A 4FGZA 1IIRA 2ZR8A 4QQKA 3FGZA 2XI4A 4B9AA 3SN6A 1N3IA 4GPIB 1VBKA 2J7PA 4XB6B 6REQB 1UM8A 1H2WA 4JHLA 1GUFA 2I3BA 1WV0A 2CDBA 3DS8A 4IH4A 3DQQA 4S1OA 4CMHA 5CX4A 4LY3A 4RD3A 1TEXA 1P33A 3JPWA 1SU7A 2DOKA 5DEIA 2NUAA 3JWHA 3OF5A 3QMPA 3R8FA 1MH9A 1M8PA 3QQ5A 4KVFA 4A0RA 3AEZA 4FZ3A 4IDOA 1MP0A 1Q14A 1YOVA 3HL4A 1KI8A 3WK9A 5B57C 4TMXA 3GXBA 1DJMA 2MINB 3A31A 3FW1A 2VP5A 4PBTA 3HRKA 1YGPA 4Z86A 1UKCA 3WSWA 2VHJA 1POWA 2R8BA 1IOLA 2EQBA 1NX6A 2BFDB 2PCLA 3KOOA 1M1YA 4RHEA 4CQMD 4DWVA 4ZYWA 3Q7PA 2GCOA 1XMVA 2P4UA 1I3OA 1P2GA 3NX4A 2AFVA 4HZGA 4TQAA 4OUDA 2EFDB 5DCWA 4LWZA 4KR0A 1CEXA 3ZEIA 5LQMA 2PGLA 1GGVA 2FW0A 3MAJA 4BXOB 1MABA 3F5SA 4FOLA 3KL4A 3RYTC 2AFHB 2UYOA 2WVJA 1TMOA 2O05A 4L9SA 2I6UA 3UJ9A 1AHNA 4Q9IA 1KOLA 1SQ6A 4TV8A 5JE8A 1IRIA 2BKLA 2ZTLA 5GINE 1U8YA 2RGGA 3VR1A 1J2YA 4HQLA 4C3OB 2BE7A 2VDPB 2G5CA 4JL8A 3LFUA 2GPYA 3QA9A 2ZAGA 2MWMA 4AG3A 4CMGA 2H1WA 2JJ2D 2XGJA 3Q88A 1NLYA 3WLQA 4EGJA 3FLBA 2IOQA 3QRWA 1ACMA 2QP9X 5KC9A 5KBYA 3ZU6A 2HA2A 2QQEA 3JY6A 2ZJOA 4TLLB 4ZGGA 4IUCS 3NV9A 4DY6A 3EZ9A 2R7LA 3EZFA 4QM7A 4XYBA 4KQKA 1IXZA 5K1ZA 1HMPA 5CNIA 4URXR 2MSNA 1R50A 5CPBA 2WJGA 4JUIA 1W2GA 2Z5LA 1XNRB 2BGRA 1T3LA 3GJTA 1G2PA 2QUZA 2TSYB 1JNYA 2HMTA 3JVVA 2IBSA 4TVSA 2G6TA 3K4QA 5IFKA 3ME5A 3W8EA 2ZW9A 1CR4A 1W1WA 4WY8A 3VR2D 2Y66A 4F71A 3HN2A 3LQQA 1W30A 4G07A 4CN8A 4UXIA 5KTPA 1PJ8A 1ICEA 4MS4A 4E2ZA 3WNBA 3GP3A 2N1MA 1OE0A 2NYUA 3FTEA 2O0KA 2QYHA 2WHPB 3E61A 1XB2A 1WPQA 1NVDA 3MJTA 4L2IB 3RSZA 4HVLA 3L8ZA 2JLYA 3WGOA 1V4NA 1XMOB 4YJKA 3CE9A 3UMMA 1XQVA 4ND2A 2G76A 4E22A 3V8VA 4LHEA 3FE2A 3PNMA 4DC0A 3LUGA 4L4ZA 1SA0B 3C5HA 4HZUA 4IIFA 2I7XA 3PQ2A 1P74A 4II3A 3ZLVA 5D5QA 1E3DA 1VKOA 3ZZ1A 1NBWB 1P31A 2JPDA 1BNCA 1O2DA 3D8SA 1JH9A 3W34A 3WYNA 4RTRA 2AFIE 1XJWA 1A7UA 3OQJA 3BZUA 4NATA 1T2AA 3KJXA 2AJLI 2B4YA 3MXOA 5TE9A 2XMPA 1L8XA 4G4GA 3RUAA 2KMLA 1U0SY 3SK0A 1T4CA 2NVUB 5FX2A 1GD1O 1MZPA 2CJFA 2V6BA 4QICA 3AF0A 4QU0A 3KDSE 5JTUA 4ICIA 5I7SA 3GP8A 2ZJ5A 4L7VA 4CE6A 2Q5HA 3GBSA 4NONA 4WA7A 4ZCIA 3P4YA 5EFOA 3VNRA 4RTPA 3MWFA 4FFRA 1OZFA 3MUNA 4J43A 4F1WA 2IXGA 3Q8WA 4G4SO 2FX2A 4TUYB 4BV2A 3IXQA 1RWMA 1Z15A 1EJ2A 5AJZA 4KLAA 4WLEA 5AVRA 3RYIB 2PMKA 3IO5A 1RMTA 4D2IA 1RFLA 4W82A 4C2TA 3N05A 3NVMB 4X91A 4OGKA 4QE3A 4IVPA 1EX7A 5IK2D 3LHDA 2G17A 2FG6C 4HH3C 2Q0SA 3S7ZA 4HQRA 4CETA 3PGKA 3ZHUA 3P8ZA 5K4HA 3M8KA 1Z73A 4QELA 1HQDA 3K5IA 1SUIA 3P5SA 5DOZA 1UMBB 5T67A 5DHRA 1IONA 4HXGA 1ZFNA 5JAQA 2IU4A 1OWOA 4Z9BA 3SZ3A 4IIJB 3LWDA 3QVKA 2VRNA 5FHQA 2YYYA 3U7IA 4B4UA 2HNKA 3ABOB 4Z1MD 4QG3A 3H1GA 4JH0A 1GRVA 2V7QD 4L6IA 2IH2A 5EZQA 1SGWA 3QXHA 5A7GA 3T52A 3W3AD 3WLAA 5AW8A 3PFIA 2VSQA 2VJKA 1S96A 2D1RA 3K5PA 1BKSB 1A5SB 3C5VA 1YVDA 2BFCB 3EBLA 3IV6A 1YE8A 4DC1A 3CR7A 4LC9A 4B6PA 3SQXA 1E7QA 4GKJB 1VJRA 4YC7A 3C5EA 2GHQA 5FQNA 3WKBA 1EGHA 3CUYA 4PPFA 1T3SA 2R6GA 1RP7A 4ZHSA 3SNHA 2LIPA 4X85A 3LT0A 4AAYA 1H1LB 1L4FA 2FGKA 4FI3F 1ID1A 3VO9A 4HTFB 1QQAA 5GIOE 4DIEA 2X5NA 3ZJTA 3KKPA 1YZNA 4G24A 3O2NA 1FJXA 4LMPA 5JPDA 3GLFB 4IDAA 4WE3A 5CIWA 3UFXA 3UO8B 1D5WA 2I7DA 3FETA 2CXUA 1PYOA 2FW7A 2P9BA 1T1SA 2Q2OA 2HF2A 2V55B 1QX3A 3AUYA 4IXMA 4V2UA 5CFOA 1F8YA 2OXRA 1W9HA 3RRBA 3ZH9B 3PTLA 2XQGA 1JLRA 1ESCA 5GM2A 1JILA 4W63A 1OBHA 1BZYA 1YMQA 2VOEA 3QPWA 3U1VA 3EVZA 3ZWCA 4ZGBA 2PZBA 1UPXA 2O2EA 1H9BA 3KBBA 1PR3A 2C95A 1EVIA 4BNZA 3EEQA 1F2UB 1G6OA 1IQRA 1TCUA 2CLSA 1ENYA 2GZHA 4PZUA 5AJXA 4ZQBA 5JAPA 2NXEA 1YHZA 2I8LA 2R5FA 4K9PA 2JHFA 1IWOA 3IIKA 4EHBA 2PUAA 3V42A 1YKGA 3KUCA 3UW3A 4GMFA 1FDIA 5FD8A 4DIBA 2FR8A 2QVXX 4O2BA 3I23A 1Y6JA 4PHTA 1BS2A 2P6NA 4J0IA 3FGNA 3KJEA 5DYWA 3GG2A 1WMSA 2NV6A 5BMOA 2WWWA 4IAOA 1U0RA 3C8ZA 3QKRA 4I5GA 1LB1B 2G1KA 4UJ3A 4HB0A 3REQB 1GZ6A 1MQSA 3PGXA 4EA9A 1TQ6A 1YTLA 3IHLA 3HXQA 3WK5A 1CQJB 3RRZA 3MB8A 2FMTA 1UBNA 4EPTA 3QU9A 3RH0A 3H04A 1U7WA 5LYJB 5T64A 5E3HA 3MINB 2XZOA 5TVKA 1WCYA 4K6OA 2O7VA 3JZFA 1Z74A 3K9FC 1KIFA 3NYIA 1YB1A 4CDGA 4RHCA 2GYUA 1OBOA 1EUCA 1K06A 5GOZA 1BYIA 1CX9B 4M7RA 1SG0A 4KAAA 3D31A 3MT7A 3DG9A 1V7ZA 4BNWA 2YICA 3V80A 1KVUA 4L8LA 5L45A 2XT9A 2H7XA 1Q19A 1OUMA 4LBVA 4P5PA 1Y42X 3CWZA 1W4AA 3U7EB 2HRZA 2NSLA 4KQMA 2Q6LA 5LQJA 2RDMA 4RVNA 4M76B 1ZDMA 1I3CA 1Y4ZA 2QW0X 5E7MA 3T4UA 4EB3A 4YDQA 4A5OA 1L5YA 1VMDA 3ZVMA 4CEIB 5LA6B 3BULA 1JWLA 1U2DA 3AEUB 4MJ7A 4QNRA 4YV0A 4FKBA 1CDDA 1XEXB 2JBAB 2OQRA 2WUDA 1QSGA 1E1CA 4WXMA 3T5PA 1RAGA 4HJRA 4NG5A 4F2DA 2VK1A 1ZA2A 1N6PA 4KN9S 1CQPA 5A3VA 4F6LA 1R0ZA 2IPOA 4JUAA 4WZ6A 1AQJA 3KOYA 2PKRA 1YC5A 4LYEA 4F5EA 4FFLA 4HWSA 3AHHA 3S5JA 4ZI7F 2YCBA 1J2TA 3O8DA 3UH0A 2FPMA 1A9YA 2Q4BA 2VDUE 5IULC 2NO0A 1V5GA 2ZJ2A 4OX9Y 1PZMA 4HWKA 2DSNA 3BZWA 3DMHA 4DSNA 3NM4A 5IVDA 4ZKEA 1JUDA 4BO5A 1CFZA 4HH0A 4IZIA 4YA6A 2A86A 4KXWA 5AHXA 3ROQA 5FDFA 4F4CA 3DDWA 2OZLA 4IIHA 3OE7D 2BHRA 1ORVA 5EZYA 2ZVPX 3QTBA 4Z5XA 1V16A 4RPKA 4Q1CA 4G8CA 4COKA 4HNVA 1V3UA 1JN0A 3EZLA 4JLWA 4O4JF 1P1HA 3T5CA 2XSZA 2OO5C 1DC5A 3MC1A 4DNFA 1DT5A 4ZEWA 4Q9HA 1O58A 3EGIA 1O7JA 1W4BA 1IRXA 3R0QA 4Q37A 1IBSA 2QN6A 5IBRA 1QCDA 3RVNA 3I61A 2F55A 1MEOA 1ZJZA 2X0IA 3HYSA 3DLBA 3OC6A 4NVRA 4US1R 4AC9A 3O92A 2DQKA 2QXTA 5CYGA 1CVIA 1K4YA 4UDXX 3OFVA 1MO2A 3QNUA 2G06A 3C7TA 1QGAA 2P3LA 1BCSA 1A0OA 4N3AA 3PWKA 2NU6A 3NLLA 3QKSB 4LGVA 4Q3NA 1SUAA 2J4CA 1O08A 4P3NA 2FSHA 1AB5A 1ZICA 2JIDA 4A3SA 3IBTA 5ILOA 2O8BA 1N75A 2O9JA 1WULS 3KUXA 3FFTA 1PG5A 2OORA 4G0PA 4TS3A 4CL0A 1EUDA 4YBRA 3WDMA 2YVAA 4OQEA 1Y3DE 3E9NA 3KTAA 1ZJ4A 2JGIA 3N6RA 4RIGA 2PANA 4BVKA 2DWQA 4X1YA 1Z2CA 3TLJA 5BUZA 3DV0A 1OHHA 5FLXA 1ISJA 4ECEA 3RU9A 3WJ7A 3ET5A 5JXGA 3LQ2A 1YL6A 2IIQA 1HLFA 2QUAA 3KZKA 2KJQA 4LHSA 4N5IX 4YIHA 1E9CA 4ZARA 3L9XA 4QDKA 4RA9B 3DVSX 1EHIA 1L4LA 2FN4A 1NBHA 3SF8A 2R00C 5ILGA 1MX9A 2DBZA 2HK9A 5AICA 4ER6A 2ORWA 4UNRA 5KX5B 4C07A 4M9SA 1USVA 3B13B 5IN5A 1E1QD 2J59A 4H7FA 2WMYA 1P7PA 2CFIA 2O1XA 1M66A 2AMFA 3ML1A 1N3BA 2FSSA 2R97A 3HR7A 2GA9A 4I4TB 4JGIA 1S7GA 4Q0MA 4WDRA 4XLTA 1H0KA 3VSCA 1QU3A 3DOOA 5CYPA 1SU6A 1OX6A 3LBNA 2XMCA 4NK5A 1I94B 1H5UA 3U4IA 1GL3A 4PINA 1EUYA 1WDTA 1E3WB 3I3OA 1LSJA 2BFPA 3EWSA 1H2YA 2FETA 2GAJA 3K92A 1CZUA 3IPCA 4C0LA 1EWTA 3WS7A 1GPH1 2XLBA 1LNQA 1RI5A 3IB3A 4JP3A 4F85A 1N5MA 2VQFB 3R9IA 1RWNA 4JS0A 2ROQA 5U4XA 2WAMA 1W29A 2VI5A 5B3JC 2JCGA 1SZJG 5L3QA 3X1MA 4WK6A 5LZ9A 3CH7A 4U2DA 4D9CA 3Q3JB 3KWLA 1M5TA 4EARA 3ZIAA 2PGIA 2Q3CA 3OX1A 4XM2A 4XQCA 2XUDA 2GAIA 2OBXA 1Z37A 4MV0A 4R8VA 5BVGB 2JKYA 3IVMA 3QG5A 5ER6A 1YZHA 4ZYYA 2YZGA 5F1KA 1KZHA 4B4KA 3I9LA 2KLBA 2YZMA 4O2AA 3ZI4A 3DAFA 4O4LB 4C2BA 1PFVA 3RNLA 4A91A 1U0BB 2GZAA 2AVNA 3M34A 2XMBA 4HAUA 4KMSA 4M7OA 3SDZA 3FZNA 2GNOA 5DHPA 1G7CA 3LQFA 4BV8A 1F5SA 1A77A 3BSFA 1C1XA 1I4EB 2JGMA 3EVDA 3AERB 3V32A 2QS9A 1PGPA 3H13A 1NBMA 2H1VA 4WERA 3U7RA 4K7JA 1MDBA 1XA0A 3IP8A 4MUNA 1MVLA 1JLLA 5F7JA 5GOTA 1QGZA 1XN4A 1Y1PA 1CUUA 4UE2A 3H4IA 5I7FA 1WETA 3CEJA 1B8VA 3NJ4A 3LTEA 1KEKA 3ILSA 3S70A 1PWXA 1U0JA 2OFFA 1FS5A 4N3GA 2QX9A 4C22A 4A6PA 4E33A 5L7YA 3GLQA 1QIHA 5A0FA 1GPLA 5EIBC 2IHYA 2OG1A 4C1BA 2RGDA 3CUEF 1A1VA 3B7PA 3LS2A 4X6UA 4AWBA 1T4DA 3TZQA 1Q7GA 1JS1X 4E6PA 4JGGA 1VLZA 2AN9A 4MI3A 3OURA 1NSTA 2AOTA 2PLAA 3FVQA 4FT2A 1OI2A 3FKSD 4EB0A 4AQYB 1NYTA 3HVIA 3DBRA 4KPYA 1AV7A 3HGTA 1UADA 4X97A 1D1QA 1J0XO 4I6GA 1CNFA 3CZRA 2QVBA 1ONBA 4TQ9A 2OK8A 1J7KA 1XQWA 4MPTA 4B7AA 2O8EA 3SQNA 3FPKA 3SZGA 3ANLA 1JQ3A 4PSCA 2IZ6A 2R65A 4IUYA 3LAWA 4DLRA 5I7WA 2HSDA 2ZTMA 4IG4A 3CE6A 3DUWA 1EWVA 1ODIA 1Y4UA 2RH9B 2CXHA 4OJMX 1BXRB 2FEOA 1STOA 4NZNA 2QR5A 2YQ4A 4K6KA 1CD5A 1R9MA 2JDID 5JMOA 4YN3A 2KPOA 3OE1A 3G8AA 1SBNE 2IS6A 1H5NA 4H4CA 3AZPA 1KFKB 1BC5A 3L06A 3L41A 1HFEL 3PEVA 2LIVA 3AR7A 4TYPA 2ZRQA 4FW8A 5KNDA 2N42A 1CRWG 1VQ1A 1CE8B 4C29A 4UZFA 3KEQA 1T8SA 3EMBA 3RWMB 5K6AA 4LYGA 4ZQGA 2PJRA 1NP3A 3CV3A 3S29A 4F21A 6Q21A 2W6CX 3LL7A 2JH8A 2WP8J 4MW7A 5DTQA 3NG1A 2JJMA 4IMRA 4IZHA 1TIPA 5FWYB 4J3JA 4D57A 3HA7A 3SAJA 3ADDA 1M1ZA 4X8LA 4JLBA 1C14A 3WWOA 5JD4A 3ICQB 5EHXA 5ED4A 1BIFA 4H7JA 4YJ2B 1FTQA 5EJ8A 3JSAA 1DO2A 4BQFA 1L9XA 4XYGA 1I4WA 1QJ4A 3B6EA 2D1FA 3GRVA 3UAVA 1YDGA 1T15A 2G63A 4UW9A 2O2JA 4OK3A 4JI2B 4LZPA 2RC6A 1LLUA 5CHYA 2G7MC 2ZI7A 1DDGA 3T5DA 3DXYA 3ROTA 2CLDX 3Q9UA 3ZCRA 2WSMA 1P4SA 2YJ5A 2OCIA 4GFDA 3UUFA 1NU6A 5TMEA 3GLKA 1CJKC 4KV7A 4UCFA 2FB9A 1KJZA 3D5EA 2Q3FA 4Q48A 1Q1BA 5F3RA 2RK6A 4RD4A 4U0JA 4EG7A 2Y0CA 1Z6AA 3JD2A 5IDWA 2OTCA 4X66B 3KKQA 4BNUA 2QT9A 1AHHA 1KKUA 1UOEA 3QEBZ 4EABA 2HUNA 1QGUA 3P52A 4AKGA 2JHCA 1UBCA 1ZVVA 1G3QA 1XCBA 1YA4A 4Q9LA 3KQHA 4HDCA 4LXGA 2VH1A 5B3AA 4NXNB 1I0IA 5DOVA 4E15A 1NRIA 1JG1A 3L1HA 2Q9AA 3EG9B 1P1JA 1KDPA 4AF7A 1IZYA 2X0DA 1RI1A 2ID9A 1EGMB 4IZ6A 2PSDA 5DWQA 5TVGA 2K7FA 3I73A 1JEAA 1XZIA 3IILA 4BLWA 1P0IA 4BO0A 2QRGA 5TEWA 5I7VA 2JK0A 3UK1A 3K1AA 1GTMA 1Z28A 1PLKA 4N8DA 2GTPA 4V02A 3DNFA 2HDWA 4BO4A 1V2GA 3AUJB 3GLHA 4MQ6A 5FTKA 4ZVTA 3QMVA 3L7DA 4WMLA 2PGJA 4BMOB 4D9KA 3K9GA 2YY6A 4G1FA 2FUG1 4PYKA 4CGZA 1GAWA 4WLUA 3T54A 1WB9A 1E7SA 2XUQA 4B81A 1U2PA 2XDQA 2GM9A 1Z5ZA 3KZMA 4U63A 4B79A 5E1BA 4B32A 2FQQA 3G2NA 5LUAA 1E0KA 1I6LA 1ZXBA 2HBRA 3H97A 2HUPA 2QK4A 5FT9A 3FMGA 4GLBA 5KDLA 3RTGA 4HNSA 4GPBA 3UMGA 3UPTA 5KYWA 4Q00A 4MRRA 4DQ0A 1VSVA 2I2DA 2P90A 4DTCA 4DV1B 4GX2A 1OYVA 2L18A 3I1YA 3NETA 4N47A 4XRRA 3HZHA 4F56A 4IO0A 4RADA 3BGIA 1SUCA 2VXBA 2YZ2A 3FF4A 4ZT4A 5NLLA 1FYXA 2ZJ8A 1JE0A 1R12A 3T1OA 3Q3GE 1KQGA 1D0SA 2WUVA 3EULA 3OM8A 2FMIA 1YI1A 5DYIA 3IA2A 3PXXA 4DLZA 1NVFA 2GCPA 2OFOA 2ZJ7A 1AS2A 3WRXA 1KWGA 4MUIA 1L4MA 2OHHA 2GWHA 2VTKA 4WVLA 2V98A 3CO0S 3GY0A 1NXVA 4LZNA 4GLJA 3ABZA 2FHSA 4U7WA 2B9VA 1A8UA 1RJFA 2AXQA 1GXSA 2XMDA 1OXBB 2E4ZA 2PT7A 2X9NA 3AJRA 3KDAA 4AQ7A 4OI0A 3DEFA 1NSYA 4EG1A 5DKFA 2C3MA 3PV0A 1T9BA 1M2EA 3TB6A 3U49A 5D86A 3WI7A 3WWZA 1RRCA 2ZJ4A 1DX9A 4JJAA 5K0EA 2FPIB 4KAFA 3H2YA 1RQ7A 2DYKA 3LLMA 3PXEA 4P6VF 3RODA 3PXBA 8MHTA 2GJAA 2HQOA 3HBAA 4GGOA 5H1YA 3TNLA 3S6JA 3AUXA 1LRKA 3VAAA 2IYYA 5HKOA 3FGOA 6ABPA 1E92A 4ROTA 2QE7D 3V8RA 2IITA 1JVSA 4IGKA 4CIXA 4Q1AA 3AF2A 4G8BA 4TRJA 3OCUA 5C2JB 1MV5A 3BFKA 3IDFA 1NFQA 1U2GC 1UXIA 2PBZA 1EXWA 2QTNA 1HT3A 1WXHA 3OM1A 3PP8A 4M83A 3FHOA 4OHPA 5AVWA 3TW0A 4UUAA 2QPTA 4E94A 1LVGA 2IX9A 5ENZA 1MLDA 4MJLA 4YWHA 1XVIA 3KKLA 3ZPXA 2YRWA 4KMOA 1ND6A 3C8DA 4BX8A 1M10A 2OGWA 4QDZA 1YOBA 2RBEA 3KVVA 4G1VA 1YQGA 1J2EA 1VRVA 2DUNA 5K3SA 2PZLA 4HXEB 5LZ5A 1D9ZA 1Z35A 4YJDA 5IW8A 5HF9A 5T6BA 1VHTA 1QIFA 3P20A 4HH1A 3HNPA 3TDKA 3ZU2A 4RM3A 4B3FX 5DK6A 3FUTA 1NMQA 2Y1OA 4C2UA 3IAM6 4XPIA 1E2PA 2PUFA 1NWHA 5BNWA 3PXDA 4AMVA 4DWWA 1WL8A 3IEKA 2DPGA 2R6CA 4G5RA 4RVOA 5SY6A 3EWNA 1JHQA 5C8YF 1GU0A 1XPJA 4U4AA 1LI4A 5HCUA 3U5ZB 3EQ9A 3VH4A 2XCTB 5CLHA 5AKHA 1PZNA 1U7PA 1U2ZA 1YUNA 2B98A 3A4MA 4RV4A 5LOVB 1V8PA 3C74A 5CA0A 2BBWA 4PR3A 1TM1E 3NHAA 3TW8B 1ONPA 3AR6A 1OZHA 5DRYA 4B6GA 2AG0A 1JMVA 4MR8B 2RGRA 1RI3A 1BAPA 1E94E 2GR9A 1SHKA 4NSNA 4MV7A 1OASA 1YR3A 5FNVB 4YXWD 3LPDA 1NVXQ 2CSXA 2M2IA 2UYQA 3K6SA 3BBPA 4N6GA 2HQ1A 4F9EA 1VG8A 4GKAA 3ROXA 1U3WA 3KU1A 1MC4A 1UJMA 2WIDA 3DFKA 1G4UR 3ANMA 3DBHB 4P80A 1ZIPA 4OMUA 3UYKA 3GCDA 1BJTA 1W0JD 1B1CA 1WHTB 4EHNA 2GBFA 4QIHA 1WEHA 2ANCA 1DOHA 1L6IA 3HU1A 1RHJA 3SKVA 5CIYA 1PQUA 1ZOPA 2DECA 2VUHB 2X9VA 1EM6A 4TTQA 5I7HA 2R6FA 3ODPA 4MTLA 2GAFA 4GH5A 3JQFA 1RXWA 2R68A 5LLSA 5HEKA 2NWQA 2GD2A 3GEIA 3PDCA 4ER3A 2OD2A 2IUEA 1KAOA 5JNTA 4Z99A 5JO9A 3F90A 2ZWVA 4C3VA 3KSZO 2JFHA 2GZ1A 3KOUA 4KAXA 5JMPA 1NC1A 4LN1A 5LM3A 2QSUA 1EG2A 1C9MA 5BV7A 5JNVA 3WLTA 1L8OA 1KOFA 1E79D 1I1QB 1ISHA 1ZRHA 2H11A 4LNUB 4X6XA 3VHXA 4TTRA 4BMVA 1XLVA 4TZ0A 1JEQA 1V39A 1G64A 5ES4B 5JRZA 2CL6X 4OK6A 2C5HA 4YP9A 3UT0A 1ZJ6A 4C08A 2CT8A 2XBLA 2AZMA 4BLVA 4YAGA 2WOJA 2QVGA 3L4KA 4MW0A 3LKDA 3THYA 3LKBA 5LCXA 1T6NA 3FNEA 4JWTA 1L7PA 1UEIA 1XQYA 2DKNA 3U4MA 2I4TA 2Q1UA 2J1LA 2PUWA 4YI3A 2G72A 2RGNC 5GZ3A 2X8JB 3F8SA 1N77A 1IUKA 4UD2A 4YDSA 2VYNA 4YB8A 5FADA 4L5IA 2HMSA 4XVQA 5FWNA 4IJVA 5A3JA 4L85A 1QRAA 3TIFA 5H9WA 1EDBA 5BSTA 5I4BA 1PNOA 3LX5A 1GTG1 4G2NA 1W47A 5ERGB 4E4YA 2H0QA 1NYRA 5I7AA 1EBUA 2EFHB 3CLSD 3FYCA 2X1HA 3CRRA 3LDAA 3HNOA 4CG2A 1HNZB 2XB8A 2ZZKA 4FGKA 3HWSA 2IXDA 2AC7A 3KOXA 4X1IB 2AFIA 3KVRA 3L6OO 4KPFC 3IOMA 5I7RA 3MS4A 2O3QA 4DR1B 2XHZA 4LI3X 3CXRA 4MWTA 4HBZA 2JFBA 4HK4A 1F6DA 1RIFA 2WT4A 5C5CA 5HWSA 3WIVA 4ERXA 3HVRA 4LDZA 3CH5A 2QN2A 3GARA 4HH4A 5JJLA 3IP3A 1NQUA 1OSNA 2IHUA 3QVGB 2XEXA 4ZZ0A 3D8RA 5FBVB 4WFKA 1Q3HA 2B7CA 2YVQA 2FZLA 2FVYA 2VRBA 3KEFA 2QRPA 3L8GA 1AS0A 1O3YA 2C7BA 4BYMA 4YMIA 2COEA 4D9IA 5LR6A 2J30A 4CM1A 2HSGA 1RT9A 2XOKA 3L9WA 1JI0A 3LPAA 4GWLA 1P75A 2CLLB 4DQLA 1NWCA 4UXHA 5DBIA 1T8UA 1T8WA 3L0OA 4OU4A 1A2KC 4V3BA 1YRLA 4Z2YA 1P9NA 1NIJA 1IZ8A 2AMJA 2B34A 2CZGA 1X1BA 2OV6A 1P2BA 4WGFA 1DI0A 3GQBA 4UBNA 5C5IA 4NR0A 5JJKA 2Q3DA 3ZHOA 2BE9A 5DGDA 4QJ4A 5K8VA 1XZDA 4P3OA 2PAFA 3WHLA 3L7KA 4S1VA 2FYTA 1L8AA 3ORHA 4UCXA 2H2DA 2IUYA 4OLBA 2F3TA 1GFZA 2A57A 3VDMA 1VPTA 2OB2A 3ZHXA 3OZFA 4D8YA 3OZAA 2QZ9A 2ZVDA 3AYXB 3IAXA 3N2KA 4XJXA 3PXGA 2D3TA 2ISSD 1OV6A 1R4MA 1VXRA 2XMSA 2VAPA 2BBOA 2ONYA 3O7WA 2PYIA 3NYRA 1DDIA 1GPJA 1WA5A 1UT6A 2IYRA 3BX1A 4CBVA 4RJTA 1EFLA 4O4IF 4QDXA 1GSAA 4PFKA 3I6IA 2C9CA 4S1TA 3PPIA 1XTZA 2B3DA 3O2QB 3NMUF 4KFUA 4C0XA 4EW6A 5JANA 2Y3IA 1AUXA 3JAKA 4DA6A 4KQWA 4F5DA 2WOOA 3D2AA 5TR9A 3TS1A 1WZEA 1Y37A 1YNOA 1LA2A 4HWPA 4LJ9A 4ZVVA 5CM2Z 3PJGA 1ECJA 2R79A 5M7EA 4ZOAA 4RTQA 4JASB 2JFNA 3DTVD 1AH2A 2NOAA 1V6CA 1R74A 2WWGA 1W94A 3EBOA 3K4HA 3OEWA 4OBWA 2Q7OE 3TR5A 3RWOA 5IBCA 3TBFA 1U7TA 1USWA 3EYAA 4J7UA 4Q6WA 5KTRA 3O4RA 4DLYA 3K05A 1DC6A 2VDJA 1A5BB 3PJFA 1DHTA 1EVZA 2JLZA 4N6OA 4TKLA 5LQSA 2H07A 3ONEA 4DDUA 5AOVA 3Q11A 5ALJA 3K94A 1Z6XA 5KZMB 2HOQA 4WJLA 3CMCO 1RP1A 1ADBA 5A7FA 2WEKA 3OTHA 5IT9A 3DOJA 5ICFA 4HDMA 2JGAA 3AJAA 4QXRA 4ZKDA 5JJCA 4PVDA 3HO1A 3JQAB 2IXTA 4M3NA 1O54A 4YHBA 3W7VA 1AY0A 1RXSA 2CNOA 4DMCA 1ZJYA 4Z7NB 1GCAA 2UXCB 4NECA 5SYMA 1HC7A 2BFBB 4UU0A 5LYYA 4MPPA 4BEVA 1RZ3A 1ULUA 3NBQA 1JPJA 4P4TA 4QGGA 1KK2A 4HVCA 8ABPA 1FFSA 1RU3A 1C7ZA 3FPAA 3IRUA 1PZEA 1Z0AA 4DLBA 4G5GA 4YUZA 3IH5A 1NJ2A 5GMOA 2PIDA 4FMDB 4KW7A 3ZHBA 1JEYB 1N5IA 3EIEA 4MPRA 4HGRA 3S5UA 2FWRA 2UZ4A 2ZUVA 3GYBA 3VC1A 4DAOA 1G5IA 3PTZA 1FYFA 5E9WA 2ZTUA 3ETEA 3MPUA 1HDYA 4ED9A 3M4JA 4E21A 5I6DA 3PQ3A 2DHQA 1JFFB 3DBIA 4PG5A 4Y6LA 5FRDA 2Q2WA 5A9SB 4J49A 1WLSA 3FYHA 1PTJC 1JKJA 3UHOA 3E53A 5CFMA 1ZUHA 3KAJA 3QY0A 4QOFA 4W7IA 3A05A 4UAGA 3QIVA 5G0UA 1G8AA 2DHEA 1QLHA 2DPXA 7ADHA 4PXAA 1GKYA 1YBMA 3TTYA 4P84A 4L6CA 1C1YA 2V6IA 4H3VA 3OA0A 1VRWA 4RV5A 2R85A 4J91A 5LUBA 3LK7A 4HVTA 1J5XA 5CURA 1VL1A 3KJNA 3OESA 5EVCA 4AT1A 3KEOA 2HBZA 4ZAWA 1RYEA 1WPXA 5KQSA 3HZZA 3SZUA 3B9BA 3FNQA 1RD4A 1X1SA 2H08A 1Y5RA 1PG0A 1REQA 2QUKA 3TNFA 1A7KA 1P45A 2OVBA 1PS0A 4U2FA 5EE5B 3WMFA 5LQUA 3FTQA 2ACKA 1RC1A 3E48A 2JD2A 4I6EA 3ADCA 2ZU6A 4OXIA 1B3RA 4KXVA 3EGWA 1BMTA 5L3RA 1RWVA 3RK4A 5A6SA 1D2GA 5FR1A 2N0SA 1VSTA 1MJFA 1E3SA 3HVUA 3TNDA 3ZGYA 4RLQA 1CJCA 1FFDA 3T9FA 3D2CA 1IMJA 4YO8A 5D3KA 5BUSA 4ZAXA 2LE0A 3W2IA 1TIKA 4XB2A 4C7OB 1AKMA 1TLFA 2DBRA 3EXEA 3VR3D 4EJ0A 4V3CA 5J1TB 3K2IA 3ZU3A 2GPJA 1ABEA 3NBZC 3NKLA 2J3KA 2JKZA 2XDWA 1JKFA 4PRKA 4QYTA 4FOSA 2VTEA 1U81A 1A9RA 5ECYA 3VJMA 1DWOA 1T3GA 4GPAA 1L3BA 2D0OB 2DQYA 2P78A 2Z56A 3ZLJA 1UM9B 4HNQA 1M2VA 3GCXA 3P2EA 4XUCA 1KWKA 4ENWA 1G0OA 4I5FA 5D7NA 3OTIA 2GUWA 2PWZA 2OMEA 3IJ5A 3BERA 4G9EA 1DGQA 3I05A 3L6EA 1N5LA 4UBIA 3QPAA 3PFGA 4BFVA 2H4FA 3STVA 1AN9A 3CSUA 5L3SB 1US8A 2FEXA 1M2JA 2R2GA 1N2EA 1E2GA 1G9XA 1S3IA 5T8KC 3WLFA 3IKTA 2GN4A 4ZTZB 4OBXA 1H9CA 1FBNA 2JVIA 2CDCA 1UANA 3SBDA 2FMFA 2POQX 4AMZA 4E5YA 1JDZA 1N0IA 1D7AA 4YLGA 1KH2A 1ZGCA 3B60A 4EY6A 1QU2A 4HNHA 3HS3A 4ID3A 4PZ9A 3CTMA 4CDMA 1ISFA 2QOEA 5BV1A 4C3UA 4IXDA 3SS7X 2IF0A 3PS9A 4DOMA 2NUPB 3OU6A 4EKEA 1WZIA 2BUCA 1FS6A 1JLSA 1GZSA 5JAZA 4LQ4A 3OZTA 2VDRB 1K88A 2AOUB 2O23A 2YV2A 2FWJA 5CFZA 5HQ3A 3X1JA 5FWDA 1E3IA 4JBNA 2NTJA 4FXPA 3NHSA 2M6LA 4HAWA 2HA5A 4DSOA 3MLEA 1K4MA 2ACEA 3KKNA 1BO6A 3BFVA 2QRHA 4JFRA 2BPOA 4KVAA 5FH9A 5MN5A 3W8NA 1R0LA 1FEZA 2XUHA 4OH7A 2ECPA 4WPGA 2XUZA 4O33A 3G2MA 4JU9A 1E6LA 1P1RA 1DCTA 1JDJA 1L3CA 1TXGA 1Y8CA 4L07A 3IGFA 1PGNA 4AN1A 4DABA 4QVGA 5KSPA 3INGA 3CCBA 1JIVA 5JI2E 4ARCA 4IBOA 2WWYA 1QFXA 3GJ0A 4CTKA 3GJQA 3VH1A 1FTWA 3LLVA 4Q15A 4JIGA 2QGZA 4MOWA 3SJAA 1Q1QA 3VHRA 1O97D 1D1PA 3TKYA 1KI7A 4GMXA 3UHFA 1JXMA 1NC3A 3CRNA 3FI0A 4EGCB 2I99A 2IW3A 3KV3O 4FKZA 1L5SA 4UHJA 3T6KA 2QEQA 4EENA 5JHHB 2I9KA 1JV2B 3CINA 3G7NA 4HQKA 4MV5A 2DBYA 1Z2DA 4PSDA 3WGVA 4Q3AA 4TLBA 2JGDA 3AHCA 3PR3A 5ALIA 1KDRA 1U31A 3PX7A 2I55A 3ECAA 4BDTA 1NXWA 3DLHA 4PW0A 1M1UA 1OT5A 1FW8A 1Z5NA 4GX1A 1R8YA 3O8CA 1XZAA 4RK0A 3PFHA 5FYQA 2I6TA 5AR1A 4P0PB 3GVIA 4FXOA 5H7XA 1D04A 4BE4A 5K6TA 1E0DA 5J2TA 4EQ6A 2HT1A 2ZI5A 4FFVA 4L8FA 4M55A 3IPXA 2WZQA 2YINC 3CJQA 1O77A 3UGQA 3C85A 3C98A 3DL4A 4BS9A 3EF0A 3OOWA 5AUOB 2EQ5A 1RE1A 4RH3A 5BQPA 4HNAB 4C4YA 2VH5R 1T4GA 4Q02A 3VMMA 2WNHA 1HTWA 3R4CA 1VOTA 2EG9A 1CP2A 4K9SA 2JI9A 3H5NA 4EKYA 2WSSD 1I9CA 4NNJA 4YJGA 3E9MA 5ALFA 3WDKA 3E27A 4MDYA 4ENTA 5CB4F 4MCJA 2GJSA 4GMHA 2IWHA 5EHZA 3LYHA 5LWQA 2Q29A 2ZK7A 1TD1A 4Z9YA 3W9YA 1IBKB 3EEFA 4M0KA 3AKYA 1W8DA 3LXMA 5F7XA 4AG6A 5CT8A 2R1VA 1V7PC 2R11A 1PDWA 3GFQA 2QI9F 1E9DA 1UFQA 1I5OA 2E4YA 2P2YA 2XCQA 4K28A 4AUKA 4Z0NA 5JXWA 4YFYA 1T0PA 3P2JA 2IZZA 3ASYA 3E7WA 4G0QA 3PNPA 3UVEA 1SK9A 2D59A 4EKIA 2LKCA 4BMSA 5KWJA 5DTMA 2BBSA 1PNRA 4OBEA 3NALA 4BJ3A 3HADA 1K63A 1VMEA 5A4AA 3KC2A 3VR5D 3PEWA 1SD2A 5GONF 1BEUB 3KK0A 3M4NA 4G0XA 4N54A 1Y9DA 3V2UA 4BPBA 4Y67A 1PWYE 4BDSA 4YR9A 2JBHA 2GDZA 1P9WA 5DV9A 4CFYA 4QTYA 1CR6A 4I2VA 1ZNWA 3I30X 4BVFA 1WBBA 3OQMA 4FD3A 2JAWA 1XP8A 2Z2IA 5HTKA 2DVMA 3ANSA 3CGWA 3KYDA 4R4JA 5L3VA 2B5WA 2CUTA 3RBAA 2P1RA 3KQMA 1YT5A 1RYHA 1PJAA 4EO7A 3OMLA 4LJAA 3WP1B 4UMVA 4WIAA 1U1EA 5ED0A 2C9YA 3Q1LA 1IOWA 5E6RA 1TF2A 1DADA 2VJMB 3TSOA 3SXJA 4Q9KA 4LYHA 3R7LA 3AVOA 2FN9A 4IFEA 5JHGB 3F96A 5AVVA 5IVHA 5CD1A 3FOCA 1JAXA 5FL7A 5J40A 3TLEA 4D79A 4P7KA 5C0OE 2YIDA 2YQZA 2PWAA 3AJ9A 1E9FA 3DLIA 4OGLA 2ZAYA 2D1SA 2BFOA 4KI7A 3MB5A 3C6XA 5K3AA 2J0QA 4M46A 2I2BA 3DBLA 4MVWA 1KBQA 2CK3A 1SOMA 5E8RA 5ECDA 3RV4A 1O95C 3VFDA 2SHKA 4P82A 3MTDA 5AI4A 4D4JA 3HVKA 3CNEA 4B5KA 2REBA 1II9A 2VXYA 3NXKA 4KEAA 5EMLA 4O08A 3E5MA 5TMBA 1HORA 2FUNB 3CQ9A 2P40A 5H4GA 4CEJB 4WZAA 3SF0A 4Q7KA 4BP8A 1Y1QA 2GRJA 3S68A 4BU1A 4GYYA 2V0CA 2CL5A 3VZQA 2ZI9A 4DHWA 4MA0A 1Z83A 4PLGA 3MQFA 4E5SA 2J9RA 4ZPJA 1JVNA 4K81B 3T38A 1GZHB 1E1RD 1JDBC 4GE0A 4YACA 3BGOS 4PGFA 2RB5A 1P29A 2LCFA 4F4HA 4A16A 1UK6A 2G71A 4CTJA 1EDDA 3B3GA 4JA2A 1L5FA 5K0NA 4FINA 4LF6B 9ABPA 1OH5A 2VHUA 1QNLA 3K5HA 2RHWA 4JOCA 5BNTA 1GA1A 1NBOA 2CNKA 3WA7A 4DDKA 2HJ9A 3KXLA 1O6CA 2J9FB 3BD8A 3E5NA 4QFMA 3LOUA 4YAJA 1NNEA 1KEUA 5HE8A 1HLDA 1U7ZA 1UPBA 4M8LA 1QO0A 4V2IA 5KNCA 4JL5A 5EP1A 2GZRA 5DULA 1WV1A 2I78A 1SBZA 3HN6A 3RSFA 3IP7A 4O1MA 5C8YA 1WW2A 3NWBA 3UMFA 3WX0A 1CJTC 1P39A 2EWMA 1FZQA 2IUSA 2D0DA 2JRLA 2QTGA 3ETDA 1KDTA 3A2LA 2RHHA 5KKCA 2XR1A 4S1PA 1N2HA 4RKQA 3BXGA 2HA0A 1QZXA 3FPCA 3VR6H 1XLUA 4MQEB 1NSFA 1E66A 3HCEA 4IHQA 4ND5A 1V0JA 2A3RA 2ZOSA 1NFFA 3P9YA 3T61A 3GG9A 3TH5A 5HKLA 5AK0A 1IJKA 1XCGB 3P9KA 1F3LA 3BPSA 1VB3A 1K86A 1RPTA 2WD7A 5KNBA 3UOWA 5KB3A 3G79A 1FFGA 2H4HA 2XNDD 2H0AA 2AQHA 2Q5OA 4GMGA 1E1KA 1OW3B 3V3TA 3I2KA 4Y1FA 3AONB 2WVGA 2BTQB 4L8GA 3HL0A 4XIYA 1JFTA 3G8BA 4K0RA 3AETA 1EWYA 2CFRA 1MT3A 5C51B 5EQTA 4R1TA 5IYZB 4OB6A 3NH9A 3PF9A 3CPSA 2EC5A 4D44A 4HDSA 1P4RA 2BFAA 4HGNA 5JOQA 4JB2A 4ZP1A 4CCAA 2MSDB 2R6HA 3MF4A 4TMKA 1TT7A 5EP2A 3TPFA 4M0DA 2FJ0A 1G20B 2B61A 3GUYA 2P75A 4MVCA 5CVJA 5TRTA 3SOZA 3TNJA 3TRKA 1E3TA 3ORRA 5GVRA 4M1OA 4ZV4A 9ATCA 4W9NC 1ZONA 1LBIA 1QQTA 3HUUA 4BEJA 5TIIA 3RVSA 4LC0A 2O3JA 3CC8A 3VQTA 3RYCA 4LXQA 1UFVA 4I1VA 3E1SA 3LG2A 2BGGA 2VK2A 4ZFNA 3VH3A 2OHFA 3NTXA 5D2CA 1VE1A 4ZO7A 2HWXA 4XOIA 4OHYA 3BC1A 1WUJS 1S8FA 2R7MA 3IQDB 4ZQHA 4BV3A 4B8ZA 1ZOLA 4HAOA 4J0KA 5HZKA 1CHNA 5ECGC 3K2EA 1FTSA 5IRCD 4RYDA 1TL7C 4NY1A 3S1AB 1TD9A 2QT0A 3UAWA 2UUBB 2CLFB 2CDAA 5JYDA 3SXUB 4KBFA 1R5BA 3MWDB 2VPIA 3D7SA 3UT5A 4GSYA 1S5PA 3QH4A 1H22A 4M9CA 2YHBA 4OAPA 5FUVA 5KVQA 1B8PA 4YCLA 5ALPA 5I3ZA 1EJ6A 3MHTA 1SC1A 3HJHA 2BR3A 5AXDA 4NYJR 3K0SA 1JRLA 1IJFA 4MR9A 4WI1A 3CVUA 1SCBA 4FDVA 4YT2A 3KZ1E 2EIXA 5BN5B 5AVXA 3B3FA 2XB2A 2G04A 4LGCA 1Z13A 2IHZA 3HGMA 5KHOC 4HMOA 3PE6A 4JGBA 1XF9A 2IZ5A 4HUQA 3CNLA 5TARA 4JC4A 2C83A 5IDYA 5JS6A 4KH1A 1L5VA 4NAUA 4UDOA 4J2TA 2FLWA 4RTLA 1KORA 1Z4JA 1SCIA 3T3DA 2GFHA 5E2IA 1T36B 1X7YB 1PWHA 2WAXA 2GTHA 5LNK6 1SVUA 2YXNA 4CHGA 1OGYA 1T5HX 2W6IA 3RVRA 2IYEA 1Q57A 1SBYA 2HMYB 4EUKA 721PA 5JCOC 2V74B 3FMVA 1SCJA 4IMIB 2Q3EA 4MYHA 2NO4A 1BCRA 2Y68A 5AW5A 5C1DA 1S0UA 1A98A 3OBIA 3C4QA 4K3VA 5FUBA 2OESA 1DO0A 1AC5A 2BFWA 2ODAA 4LZAA 1WDMA 2YYSA 4OI4A 1K8ZB 5F1PA 3RAPR 2VQEB 4LOKA 4HX2A 4RIIA 3LVRE 4DV5B 1SVSA 4JYBA 3ZJ5A 1EQ2A 5EI5A 2CJWB 2X3YA 1YB4A 4LVNA 4RNDB 5E6UA 4DVJA 1KDYA 4D8XA 4CUKA 2ZYGA 1OOEA 1FBTA 1L5RA 3KAQA 2ZRFA 4O6VA 3EIOA 4TYWA 2Q8NA 4AB1A 1C41A 2V9CA 2HCTA 2L2QA 5L6LB 1EVKA 3GRPA 2PMWB 1FFXA 3AU8A 3LC2O 4LXIA 3OX2A 1KEZA 821PA 3DEJA 2XE8A 2WQZA 4YT8A 2C4KA 4JX8A 3VTKA 3KP1A 2Q1TA 3VVLA 2WM9B 2E5LB 3UENA 4QOJA 1HH4A 1HWYA 2YW2A 1TGYA 4NPAA 5CCDA 4X54A 4G5QA 4MYTA 5TX7A 3RHZA 1IPHA 2P9CA 4QWMA 3U9SA 4XH9B 3ZGZA 4ND1A 1IK4A 3D54D 4UVGA 2MSWA 3FSGD 3H84A 5TPWB 2REOA 2Q6TA 4MRNA 3ZS9A 3N5KA 2OCYC 2RSLA 2VNJA 3CLTC 3A26A 1ORIA 3G6WA 3DXFA 2EBUA 3U44A 2PD3A 2NAFA 3OEYA 4FFMA 4FLEA 5EXXA 1BROA 5IAGA 5ALXA 3BH7A 5KIAA 1SXJD 2AJBA 1T6XA 1QORA 3ZWMA 1IY9A 2ZSBA 1XXLA 3ZVRA 5AVZA 2W48A 3BRWD 4HCJA 2Z9DA 3RBVA 2BM1A 3JATB 4MDHA 1CW2B 4C30A 2BEJA 2O1WA 4AKTA 1QV6A 3MTQA 3G1UA 1ZVMA 1YZKA 3RNOA 5IG2A 2YHSA 3BKXA 3F1LA 2FQWA 3RRJA 4RY2A 4QYIA 4ZCRA 4ZHQB 1J20A 1X70A 4R1MA 4EA8A 4A6DA 3F8WA 2BFFB 2QLLA 4ENUA 3F6SA 1WB4A 1G6HA 3ENWA 3FOFC 1A69A 1DFGA 5BYKA 2X0NA 3DZJA 4TV9A 3T5TA 3LBAA 1V9SA 3PL1A 3WB2A 1EXDA 5DH9A 4I55B 4LRQA 1AF4A 3FRHA 2CGEA 1QOQB 3B9PA 3ZCXA 2X5KO 5EHGA 3C3EA 4DT1A 1OH8A 2VBGA 4IH9A 3TRDA 1F17A 1A50B 2FN3A 3UJBA 1Q3TA 1WXXA 3ELYA 1PQPA 2QMZA 3FOAA 3ONDA 5CT6A 3SYKA 1QZZA 3FDFA 2I1LA 2C31A 2GO7A 1KYWA 4IOLA 4LF9B 2P4SA 2JHAA 3Q7TA 4F06A 2C5GA 5DYYA 3AB3A 3AG6A 2RI6A 3K4PA 4OLHA 1NXXA 1HRDA 3X1ZA 4KPEC 2EV9A 2FP4A 1VBFA 2PRKA 2R2AA 3CR8A 3FVTA 1Z4OA 3VR0A 7REQB 3QLVA 3DZIA 3O4FA 1QP7A 4PC6A 3NHKA 5FOVA 3D3WB 1B8OA 3R7BA 1KMNA 3PQDA 4HTAA 4D0SA 3RREA 3HB9A 3JQ6A 3FWHA 3U3XA 5A5GA 2EJBA 2FFHA 4D97A 1T8TA 2QL6A 3CW8X 4AZSA 2JAPA 1F8FA 2XGSA 4RCZA 3HMQA 3P26A 3CIOA 5HP4A 3B5IA 1CFJA 3I09A 1FNCA 4XCXA 3RFXA 2IY8A 3S1LA 4BFUA 3E9RA 3UJ7A 2ZSKA 1RNLA 4PGGA 4MW1A 3ZK8A 1RAEA 4MGIR 4ZRMA 3T9CA 3UBMA 1GUDA 2H1CA 4O63O 3UK7A 3OWOA 1YR6A 2V6GA 3GEEA 5HK8A 4ZAVA 4FDLA 1DKNA 2GN6A 2UZ3A 4WBNF 1P0FA 1P3Y1 2NO5A 3KWMA 2C3UA 4AJOA 1B6SA 3TOZA 2BZ0A 1ZW1A 4DS3A 2WSYB 3MYRA 4PRLA 3FR7A 2X22A 3H9JA 1QHYA 2GUGA 3BIOA 2EQAA 4BO7A 2RH8A 5CXQA 1QYVA 1W5SA 2O3UA 5P21A 5CDGA 3S2SA 3ZLUA 4CMCA 1A2QA 3C7KA 2R4UA 2HHCA 2VR1A 4DJFC 2BGKA 1YA6A 1LV7A 1ORRA 4M54A 2ZI6A 3W79A 2BM8A 1SBIA 4E5KA 2P62A 4N01A 3HCOA 1QKIA 1QH1A 3CRVA 2J6CA 4JSTA 5FBZA 4XIFA 5KOJA 2AN4A 3N2YA 4IW3B 4LXTA 2Z8YM 2BFMA 2H52A 1KK1A 4KQ6A 3DONA 5EERA 1IDOA 9LDBA 4UHFA 2FQYA 1VPEA 2D2EA 2LW7A 3O8BA 1SG6A 1UZLA 4JWKA 4NYJQ 1ONNA 1XU4A 4AS2A 1OF1A 3B5JA 3HCDA 3KQYA 4IYRA 4JFAA 1NBAA 3A0UA 4L0DA 2NUAB 4F46A 5IF3A 4G0OA 4MPDA 4RJKA 4OLFA 4XEUA 2R86A 1A9OA 1YOVB 2IRWA 3HR4A 5AJUA 3DQPA 1M0EA 1IY1A 4QGAA 4ENSA 2H2AA 3RVBA 2BGLA 3GUHA 2HRDA 2WJZB 1FSZA 1M2KA 1RWQA 4FC6A 1P2FA 4GYWA 1ISMA 2N9UA 4J90A 4LK3A 1PT9A 4M1TA 2O54A 1NHGA 2QM3A 1PR5A 3CF4G 3GROA 3Q7IA 1M1YB 5T4BA 4BIMA 3NHLA 3IVGA 4A2QA 4Z53A 1DS6A 1FLAA 1IK6A 3T5AA 4OUDB 4LE1A 3MEQA 3AF4A 4EAAA 4EJSA 2O0JA 2WY2D 4B3DA 2NADA 5BSFA 5TV2A 2ZM5A 4REQA 4Q1FA 5LMNB 1PGOA 1IJBA 1MABB 3O3CA 4D8VA 4UNSA 1FCJA 1DEHA 1PFQA 1C4OA 2I5PO 3OLZA 3QUSA 2P9JA 4MVJM 5DRTA 1IYZA 3TIIA 1BVUA 3ZV4A 1ZL0A 1QS0A 4IWYA 4AJKA 1YQXA 2ZS8A 3EFOB 4QUHA 4TV8B 5ESXA 1HI9A 1MX5A 2QVZX 1DL5A 13PKA 1QIJA 1SIWA 1V3QE 1GGKA 1RPJA 1VIDA 2AI3A 3H2SA 3P5BA 4Q3DA 1J1ZA 3QVJA 3WK8A 4QZVA 1QANA 1HNWB 1L8QA 3W9UA 4D0LB 1ZRMA 2JG3A 5JT1A 4U6SA 2VTDA 3UV7A 4WW0A 2OSVA 2QX4A 2DTDA 2VBCA 3DT8A 4C5BA 3Q12A 2I1VB 3A1NA 4HAIA 2OZEA 3I01M 4OQ4A 4R1UA 3ILVA 4RK1A 1ZCBA 3FNIA 3P9RA 4RCYA 5CH5A 3SZOA 3BWDD 3UC9A 3A27A 3Q5EA 2XB4A 4M7WA 4F96A 1NASA 2A0FA 2RAVA 4M0FA 5IKEA 3VKWA 1Z2AA 3OQPA 3SEZA 2HXSA 2D5LA 1AO3A 3LBIA 3IT2A 2RGCA 1PSWA 1A8HA 2PPVA 4C4XA 2GHIA 5FBKA 3FWYA 1XEWX 4KKXB 3QX3A 3R7WA 2ST1A 4YT4A 3A6EA 4JSYA 2PL5A 3SYTA 7YASA 4V1CA 2JA2A 1E9SA 1QZUA 3TINA 3P1JA 2AKEA 3AP3A 3ZH2A 4JQOA 4L16A 4RVCA 2GILA 2GKGA 1JFLA 1ESDA 2X0JA 3JRWA 2ISQA 3R7FA 1LZKA 4MS4B 3DTTA 5KHLB 1U9YA 1X0XA 3FI9A 2OP1A 1SUEA 4IJQA 2PUHA 4QT0A 3TI7A 1OLSA 3E9YA 1RXCA 1MC5A 4QXPA 3TQFA 1NVEA 2DXIA 1G7RA 1IE3A 1FOEB 3DFZA 5KYVA 1PW5A 5CFPA 1NF8A 1A76A 1JGTA 5F2EA 5I47A 5EIWA 3OZVA 3ZZ0A 2Y76A 4EG3A 1WS6A 3HCNA 4Y1RA 2DSTA 4LRTB 1XX6A 2C42A 4HZUB 4NCNA 3A3OA 4QDUA 2IEYA 3MN1A 4CLDA 1JL3A 5L95A 1XMIA 1K5PA 5DWVA 3GC6A 3ZV7A 2O2GA 4EZEA 5B6PA 3Q7QA 3GD5A 1JHXA 4QTZA 2QZPA 4KWHA 4NFYA 3SYRA 2PH3A 3IUEA 4J2OA 1DBWA 5AVJA 3X43A 2FHPA 4WJZA 4HN4B 1GKUB 2Y0PA 4OHWA 2Q9UA 4RQTA 1FDRA 2ONCA 5BT8A 1WLYA 4YGYA 4DV4B 5EQDA 3SFZA 3WC4A 3KELA 1JHPA 4NAHA 2FWMX 2D0IA 2FH5B 4EHIA 2AG5A 2PX8A 4URFA 4JI1B 1PSDA 1RYMA 2A92A 3WZ2A 1S7CA 2DKOA 2WABA 3WYAA 3O8RA 3CZMA 1YIDA 3DO6A 3PYMA 3Q5GA 2BMAA 4IQGA 3KJFA 3QXXA 2FMXA 1Q92A 3MXTA 4MQFA 3V1MA 4BX9A 2FNAA 1ANKA 3FHCB 4PN3A 3T41A 4Z4EA 3AIKA 1U7UA 1LQ2A 1VSUA 2LD4A 2RGXA 2V4MA 3K0FA 4II7A 1THZA 4BIIA 3UAZA 2O8FA 1RYNA 1MO4A 1MUUA 2IU6A 1RPNA 4KUHA 3M6XA 1Y8AA 4YRMA 5BT9A 1PDOA 3I6ZA 4TVOA 4PWZA 2B8EA 3ZW9A 1V3TA 2DCUA 1DAEA 3PQ4A 4J1QA 1GJRA 1PD0A 4PG7A 4WTOA 1E99A 1M7HA 1UT8A 2J3JA 3GBVA 4QOSA 2D2FA 2GERA 3L93A 4UU8A 1A9ZA 4G26A 1QKKA 2O2ZA 4B40A 3ZJ4A 4YRSA 5B7GA 4YH1A 1EJ0A 4DMHA 1YAJA 3RC2A 1Q0TA 4TRRA 4PNEA 4PNHA 1RFGE 2JI7A 3MGBA 3DA8A 3ED1A 1I4DD 4AWXA 3EWIA 1MFZA 3OP4A 4UTNA 2PWYA 3LVBA 3CHYA 4Y6RA 4KO1S 3AO0B 5EEHA 3IQHX 5GONA 3S40A 5BWOA 2CVQA 2YASA 3BMXA 1W5TA 3RUDA 2FWAA 3IAEA 3GRRA 2JEZA 4FFBA 4GG1A 4P4NA 1TQHA 2KHZA 4C4OA 4C6TB 1NJ1A 2E82A 1I14A 1U04A 3WGGA 5IHPA 1HGXA 2O50A 4GICA 1CUIA 4LYDA 2DFNA 3AT1A 3U7QA 3MIIA 3LBFA 4ZQEA 4M60A 3DWFA 1BG6A 3K9BA 3K8ZA 3Q40A 5K3FA 4E03A 4Y2VA 1AQUA 1WABA 2O8NA 3M3DA 4ACAA 3R7AA 3L0BA 3R3JA 1GNVA 4UEKA 5AM0A 1P4HA 2VZ0A 5ALDA 5BXQC 2OUKA 5IUJC 3F6PA 1XRRA 1DRJA 3GJXC 3UFXB 4ZCTA 1SIUA 4G8DA 1PKXA 5IVPA 4QQFA 1PVVA 4O3MA 4YRBA 5FKJA 5I45A 4ZJYA 2WUFA 3UKOA 1VP9A 1ZP6A 1GCUA 1E4YA 1RQXA 2WW8A 5JBNA 1JU9A 3NP9A 5EFZA 2PUEA 1ISSA 2ZTHA 1F0NA 4YR7A 1T2UA 4OYLA 4DR4B 4F93B 2HC9A 2XA1A 3FSRA 1NGSA 3NQ41 3VXKA 1QYRA 4GMDA 4TMZA 4DN6A 3TFOA 1DXYA 4RAOA 4P54A 4AMBA 1LDYA 1PEAA 2AE2A 2H5LA 2ZYWX 1ZUWA 3R3ZA 4D9BA 1OH6A 1DAOA 1IQ0A 3DP9A 3NS7A 3COVA 4TWBA 4BBZA 4X61A 1XPOA 4BKUA 1B1AA 1U28C 4O2BB 2PH1A 4K9RA 4YJHA 1YS4A 2ZYHA 5EHQA 3EFEA 4E3WA 4IMJB 4W5RA 3F5DA 5L4SA 2WFAA 2XVXA 7GPBA 4NMMA 5TSDA 1MKYA 3CNQS 3QKRB 1XKQA 3GUZA 4ZCPA 2Q2NA 3VUFA 3HXLA 4IOKA 4N8SA 3T8YA 2H9YA 4JKIA 5I7UA 1DQZA 4D0GA 1H23A 1ZNXA 2DHCA 1Q50A 2WWTA 4IHKA 1Z4IA 4JCOA 4EPRA 1NJ8A 4DA4A 1YFJA 2QX7A 2D5BA 2RG1A 2SECE 4AJEA 4TKVA 4HPJB 4DUGA 5LVAA 1M54A 2JLAA 3QOFA 2F8LA 4BVBA 121PA 3G49A 2RMKA 3D7KA 1HQKA 1H5QA 4EK9A 4DZZA 2C4UA 1EUCB 1NNI1 3OJCA 5ICSA 3O03A 5BN4A 3QVXA 3D02A 2ZG6A 3M9WA 1Q21A 1T3ZA 1T2VA 5DYGA 5EZ6B 4F4IA 2WK1A 3NTVA 5DXAA 1IN6A 4RHXA 3ZXIA 3BUSA 1JQEA 5DF1A 2YBEA 4GRAA 3M9XA 5HBRA 1KEVA 3BAZA 1SUSA 3JTEA 1IL0A 3NTLA 1GRRA 3GT7A 4YCBA 5C4GB 3WNVA 4YAWA 4OXQA 3LUPA 1IWBB 3PUJA 5B1EA 4M0PA 3I9OA 2X2OA 1VJ1A 2CVPA 4EA6A 1U6KA 1X38A 2PHZA 3N6XA 2RAPA 3LUAA 3PYLA 4YT5A 2DKFA 3H8VA 5AO9A 2NYRA 2JCBA 2J5RA 1E1CB 2CXTA 3LUFA 3WGNA 4A23A 3ER9A 2P9TA 4AZTA 4JV5B 2AEMA 2P9HA 3JQAD 4YEDA 1RAAA 5MGNA 3M4ZA 4G9GA 3OHSX 5G1NA 4GM1A 1TGVA 4WK2B 4XSVA 4CV3A 2Y9MB 4EY3A 1IXKA 1LBQA 3DBOB 3ZE1B 2DP4E 5C35A 3D59A 2CNBA 1N92A 1N6NA 2QTBA 2PBFA 5AWFC 2RGBA 2D00A 3ENNA 4U5XA 2G7ZA 1RLUA 5FLYA 4COOA 4B6RA 2C78A 2FPLA 5CR9A 1G6Q1 4YCAA 4BLPA 3T4PA 4HMPA 1KJYA 2OZLB 5FR2A 5EZYB 1VCNA 1V16B 4AS1A 1LD3A 5BWNA 1MIHA 1VL8A 3ZY3A 4UASA 1T5OA 3SQWA 2RGUA 4BPRA 4DLSA 2J48A 3OAAA 3RRXA 3VPHA 4BNJA 2CWWA 2QLMA 4JEMA 4RORA 3ULKA 2WYIA 1C3XA 2OT3B 3U3OA 1PHRA 2OY0A 1YMUA 3IUYA 2VT2A 2O20A 4PC3A 5EJIA 2YXLA 5FB3A 3IBSA 5FAXA 4DT1B 4N5NA 2ZUFA 2F9MA 3HGQA 3I12A 1FQJA 1B14A 1G3MA 1WUKS 2AEJA 3EFBA 1UDRA 4RM2A 5BSWA 2IHNA 2PYZA 1XIVA 1FVHA 2B1QA 4ZCSA 1W96A 5AI5A 4DCNA 4GOOD 1EJBA 1VE9A 2VJBA 2W8ZA 1TK3A 1BD4A 2B78A 4PHCA 4BJ6A 1T5DX 4EEKA 4CNBA 1KEPA 2PR2A 1BCSB 3PUVA 3AHGA 3KB2A 2FCAA 4HEA6 1XZFA 2DG2A 1K98A 4WN3A 4PYJA 1QG0A 3IQIX 4AZVA 3LNTA 4JQCA 4OREX 5E6SB 3WYBA 4FZRA 4HP8A 2O8BB 1MA3A 2NQ2C 4NFHA 4U2BA 3QU5A 5J2UF 1D0IA 2ODTX 1EUDB 4OMCA 1GEEA 1CR2A 2I71A 3PNVA 2PG3A 1AZTA 2FLVA 5H82A 2OLJA 3UM9A 3TLGA 3I28A 3N2IA 4X1YB 4CMIA 4YMGA 1U0GA 3DV0B 2RHGB 5KTMA 2GBCA 3RU7A 1BWSA 1Z2EA 4KE6A 3TXYA 1C4KA 1NT2A 3G85A 3H6KA 1FU8A 2EBHX 4K2HA 1T2FA 3B6KA 3FOWA 1W0CA 3RVLA 5KU1A 1L7NA 1Y48E 2Z04A 3EJ6A 2GX6A 2FA9A 4LQLA 1ZD2P 1J1IA 4UU7A 4D96A 1KEWA 2BTEA 1QKJA 2C04A 3S44A 2QTFA 3LHKA 3DMPA 3KZCA 1H93A 1JEEA 3SF8B 3CZ4A 3RRMA 1XG5A 1ZHFA 1QG2A 4PNZA 2VJPA 3N87A 5CLJA 1ZY2A 4CLRA 5FUMA 3BD7A 1B6GA 4XWYA 1QQBA 5HRUA 3DMDA 3A4IA 4KQ9A 3RTCA 2HH9A 3U37A 5IH7A 3REGA 3DDNA 1NHWA 1T34A 4FMPA 4CIWA 4QBTA 4B83A 3DVLA 4KLCA 2F43A 2NX2A 1BQEA 4PC2A 4P4SB 5IZCA 2XWBF 2GMWA 4MV3A 5HILA 2ODQA 3LT5A 1SZPA 3DLTA 4R8KA 5DNEA 3JV7A 2WM2A 1K5HA 4AO6A 4X63A 1GRCA 5KOYA 5F1YA 5ALEA 3AVQA 3WIEA 2VKTA 4D4IA 2PQ6A 2ZRNA 4KDCA 1RHRA 3LX6A 5FPSA 1J42A 3HUTA 5ULLA 1L5NA 3ZBTA 1SWVA 5TQ0A 3BWMA 2HHAA 3DDHA 5JXJA 2GRAA 3K72B 3WMRA 2NP7A 4J4BA 4OY3A 5L3QB 1X9HA 2IXAA 2W00A 2XMRA 1XTTA 3KAPA 2WHQA 3F0TA 2OG2A 3OEEA 4URVR 3JQ8B 1NW8A 1J8MF 1ESMA 1KDOA 1IFXA 3A7DA 2PXXA 2QIPA 4LDQA 3EUAA 3B3QA 2J41A 2JJYA 2ZIVB 4CL8A 3T1TA 3VMFA 1T91A 5JEDA 4B3IA 3HNRA 5FBHA 3AL3A 3D4BA 2AX3A 5B1IA 2QD5A 3A6GA 1O57A 2ETVA 2P6MA 4CM8A 4O2AB 4RHYA 3QVSA 1X7GA 2IODA 1BE0A 1ES9A 1Z0ZA 2G82A 1NE7A 4YP5A 2O7SA 2PT6A 3OF3A 4WH0A 1E69A 1XTIA 2MHCA 2BDUA 2JFUA 2XCLA 3H5RA 3O75A 4H16A 3WYDA 1C1XB 1BMQA 4IJWA 1YNSA 5CX1A 1SVKA 4FGSA 4FMCB 3AHDA 5K8IA 2X1MA 3A2NA 1HL3A 2A14A 1W44A 1JDBB 5EWMB 4B71A 1EM8A 1JLLB 4OQQA 3QM1A 3SJ7A 3Q15C 1BWPA 3KQKA 4YRKA 1C7EA 3GNQA 2YRFA 3W77A 4XCQA 3RHFA 4DJDC 5JD3A 3FUCA 2EJUA 2ZEJA 3L0PA 4AX4A 4I4IA 2RHJA 2XTMA 5LU8A 1U8EA 1XAIA 2EGHA 2KBEA 3HA2A 5A4DA 2P65A 1RAIA 3KYCB 1N6OA 3NAQA 2FW6A 1WG8A 4X7RA 3KIPA 4MKXA 2C1ZA 1J00A 2O2CA 2JIMA 3I0ZA 4MWEA 1H8EA 2GKOA 2ZRGA 3ZV5A 1ZRSA 3GXOA 2CE2X 4Y2QA 2AA3A 2GSDA 2RG7A 3HCAA 1N2XA 3JSXA 3VI4B 4C43A 5C5DA 1SCAA 1K92A 8AT1A 1HDGO 1M7GA 4TN1A 2AOTB 2C4WA 1KY3A 2VJDA 3DBRB 1PZFA 2C98A 3RB8A 1C81A 3T3IA 4ZCLA 2DGDA 3QVTA 3UFBA 4BC0A 2O5CA 2FV8A 3A3YA 4MS3A 4D9NA 2ATEA 5IAEA 3H86A 2C92A 2EU8A 2WYUA 4C01A 4PAMA 2O8EB 1HURA 1M2NA 3ETCA 5KYTA 2P2GA 2ZRHA 5KHAA 3VR6D 3WIUA 3HK2A 1BTOA 1XU9A 4UAVA 1V8OA 1Y6GA 2YVKA 3EXIA 3L1KA 4QECA 2GEFA 3DXXA 4GNKA 3VO1A 3ZQ4A 1Q84A 5AMXA 4KRXA 4DMLA 5C32A 3DOFA 1KP3A 2VDVE 3Q41A 5LFAA 3B89A 4PGMA 1GARA 4WEQA 3QNMA 2XA9A 1TUEA 2HCJB 2WKWA 1DKOA 3FTDA 3RANA 1VKHA 2WIJA 4D26A 1DEKA 4Q5IA 4KKVA 4YRPA 2WTMA 1FW6A 3BDIA 3V8EA 4CR8A 4Z3KA 1GV0A 5CEEA 4PTYA 2A33A 1Z4QA 1FNDA 4X7MA 1GR1A 5CU7A 4MVJI 4CTNA 3QFRA 2DWUA 3TQCA 2HTEA 1MC1A 4GRDA 4OXNA 4TKUA 4LF8B 3IPRA 1T1JA 2WAOA 3NOOA 2VPWA 5DFAA 1U2TA 4OMFG 1CY4A 4JC0A 3I8XA 4EYQA 1WZNA 1AKWA 4PZDA 2OFXA 4QKQA 1KIMA 3H0EA 4D02A 1UBEA 3QOXA 2HMAA 4EI9A 3FSJX 5JFTA 1NUAA 3QI2A 3TG2A 1FU7A 3V1TC 3DFUA 1F2TA 5LDDC 3OG9A 3OIVA 1C8LA 2UXDB 2G0AA 1L1FA 2RJNA 1P81A 2VHYA 4IOMA 4EB6A 4EL5A 4TT3D 4KTVE 3UPDA 1LTKA 1RXUA 2VHQA 1KFJB 3CX4A 3DKKA 3E7DA 1Z26A 4RTSA 2CNWD 3PA6A 3QKTA 3UWOA 1OKKD 3BDVA 3CKKA 4YJFA 2WA1A 4CVNA 5NULA 3AP1A 4Q7QA 2YV5A 1WUYA 1OB5A 3WGJA 2VAWA 5AKLA 1NAHA 1IOVA 2NVOA 3I4CA 3FY4A 4J29A 2H9IA 3D4NA 2ZS7A 1FQOA 4HATA 1R16A 1GLNA 3RRYA 3E03A 1FSPA 1TCBA 3OOJA 2A94A 4KHZA 4EI8A 4X20A 1KO5A 3NR2A 4OEHA 1JSXA 1S1MA 4ZVRA 3RUIA 1SIBE 3N7UA 4RZQA 3ABRB 1JYFA 5EUBA 1CUGA 3RFFA 3HV2A 5EGSA 2WTAA 4BC1A 3LOQA 1WE2A 4PZAA 4JUBA 4RA6A 5BYJA 3RUEA 2ATIA 3K1AB 4J1TA 4FQ8A 2VF8A 3IQWA 1OLXA 2IP4A 1L6RA 3PF8A 4L5CA 4NHEA 4RWEA 4M21A 1VPLA 1DTWA 4RLSA 5CLFA 2R87A 3C3AA 3GLHB 4HYEA 1QVWA 2UAGA 3AEYA 1D03A 3LY8A 2AI2A