1NF3A

Structure of cdc42 in a complex with the gtpase-binding domain of the cell polarity protein, par6
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
194
structure length
194
Chain Sequence
GAMGIQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGLEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords G25K GTP-binding protein, placental isoform
total genus 66
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1nf3A00
2KE5A 1E79A 4AKEA 5JBQA 1AS0A 3IQWA 5CLQA 4TYWA 1HYQA 3EZFA 2GCNA 5J40A 2D62A 1YR7A 3AKCA 3DHWC 2BJVA 4M1KA 3R8CA 2BMJA 2MSCB 3GJ4A 1FMJA 4GNKA 1UDXA 4G5QA 1LNZA 5AK0A 5JHGB 3ICEA 2GILA 2R2AA 2UKDA 4L4UA 2R65A 1BH2A 1KOFA 1W7AA 1TU4A 1F48A 4PQYA 3B5JA 1HT2E 2CCJA 4DC9A 3K70C 4QGHA 2IEYA 3VU9B 2IS2A 3GFTA 1TU3A 4TQUS 1MO6A 3T61A 3I8SA 4ARZA 1G9XA 3IQXA 4MUBA 1KJZA 3OIWA 2GDJA 1W48A 4JS0A 2OM2A 2BOVA 3UATA 2QSZA 3UMFA 2WKPA 2GVDC 3NC0C 5BYKA 4CZ2A 3F0TA 1XBTA 2QP3A 1NIJA 4UNRA 3UWOA 2EWWA 1EGAA 3AVQA 5JJKA 3IO3A 1YZTA 4TYYA 3D3QA 3X1DA 3TW8B 1OB5A 3OEHD 1VECA 1TQDA 1P6XA 5KOYA 2IC5A 4JLMA 1IOZA 1OXTA 3OIUA 3Q7QA 4PZZA 4HB3A 4MGZR 2IEZA 2GCPA 5EP4A 5H68A 1Z6XA 2IYVA 2QMHA 3GEHA 5FBVB 5AJVB 1T6NA 2GXQA 1MRNA 4XTCS 4UNQA 2FSHA 2ZEJA 3I72A 2NPFA 3CW2A 3ZH9B 2Z6VA 1LB1B 2VEDA 2J0UB 3JZAA 4K81B 2YWGA 3QXSA 5AR1A 1E2KA 4HLUA 4DKXA 2Q3FA 1GDDA 3EZ2A 4H1UA 3BERA 4R98A 4HUTA 3CPJB 3KFXA 3GFPA 3SHFA 3GJ7A 4ITRC 2VHJA 4MGKR 1GL9B 3WHKA 1S9DA 3PQCA 2R62A 1OB2A 4ABYA 5AUQA 2RHDA 4G0NA 4C0AC 2QTFA 2Z4SA 4XIGS 1TNDA 2O8FA 2RGBA 4N3NA 4Q00A 4EFLA 4Z8YA 4X8HA 1SXJA 1E1RA 3R20A 4CRWB 1E2IA 4TSFA 2IS1A 3FHOA 1ESMA 4JLAA 3KXKA 2B21A 3A1SA 2ZITA 721PA 3K0FA 4AKIA 3HU3A 4JVSB 3Q9LA 2RHMA 4Q4LA 2GJ8A 2ZI9A 1Y63A 1Z07A 4OL0A 2Q9CA 1KI1A 4WW0A 3KTAA 4LJ4A 4XWAA 1E1RD 2JGNA 4DUGA 1IN8A 1JQJC 5KUTA 5FTMA 4LSGA 4PPFA 3LRPA 3SI7A 4D82A 3QF4A 4TTQA 2D3WA 2BBOA 3BWDD 2BJWA 2GCOB 3AH8A 1KNQA 1Q12A 5DNYB 3I5YA 4ZI2A 1I2DA 5F9FA 3KQNA 1M1YE 1CJUC 1G7SA 2FPKA 2CCKA 2HXSA 4URYR 5EE3A 5B30A 4DB2A 2F6RA 1NMXA 4D81A 1M74A 3VNUA 2Z0MA 3BIFA 1F2UB 3SJCA 1US8B 2OFXA 4D0GA 4B32A 2IT1A 3PUZA 2IUTA 3OFNA 2NO0A 3X1YA 2OE2A 1MH1A 2EFDB 2C04A 2H18A 1JXMA 2V7QA 2R9VA 2HYIC 5CJ2A 5FL3A 5HCIA 2GZDA 5KYKA 2ANBA 4Q7LA 4FN5A 3E5HA 4TYNA 2OILA 2IYWA 1SVLA 5AJZA 4OHZA 3CZQA 3H84A 2AFIE 2ZUDA 2OG2A 4MQBA 2J7KA 4C4PA 5JS8A 3PUVA 3ZVRA 1YE8A 4DIDA 4NCHA 2B7CA 2SHKA 3A1TA 4LDJA 5A5GA 3THYA 1KI2A 3ASZA 4HLUC 1OH6A 4DIEA 1Z83A 5A0FA 1EWRA 5D3MA 3RS4A 5JECA 1QZXA 2H16A 2XB2A 1GVNB 2NGRA 4O0MA 1UPTA 5E4FA 4TQAA 4BWYA 2QMUA 2ZRNA 1YZQA 1JB1A 2PZGA 5GVSA 1S1CA 4EJSA 1IXZA 2WPDD 3FFAA 4D26A 2G3YA 3QPVA 4LC1A 1NVVQ 5FPYA 4CEHA 3I4LA 4LRWA 3IIKA 4RFSA 1UEJA 3B13B 1SXJD 3OAAD 4BFZA 4IXNA 4ACBA 2XTZA 3E70C 1ZUIA 2FEOA 1CRQA 3MMPA 1W4BA 2XNSA 4WOPA 3DZ8A 5JCZA 3SFVA 3ONWA 4WVFA 3DL0A 1IN6A 2REBA 3EC2A 2A5JA 2G0NA 4GDFA 5DGXA 5GADl 2C03A 2OXCA 3HR8A 3TW4A 2JLVA 4PANA 5E7IA 4XWOA 3DDCA 1AA9A 1FZQA 4PC1A 1OXUA 4A36A 3LNCA 3T5DA 1O3YA 2NQ2C 4DLRA 2QA5A 2ODBA 3IDQA 3QJYA 5HTKA 3P32A 4QM6A 1NSTA 4V03A 4YMVA 1KGDA 3CLVA 2VP0A 4QC2A 4GOKA 4QM7A 1XMSA 1Z6GA 4BLOA 3TR5A 4PAOA 3FFBA 2WZQA 4KVAA 1P9RA 4M53A 4Q1DA 4OYHA 1YVDA 2HV8A 5FOXA 3SOPA 1QHNA 2ZR9A 3K53A 4Q4AA 5TY0A 3PUXA 4F91B 4NYJR 2JJ8A 2WJHA 2BVNA 3PXGA 5L3QB 1JJVA 2BM1A 5EE9A 2OEPA 3QUSA 1E2LA 1NLFA 2I4IA 1PUIA 1N0UA 3CF6R 2IWHA 1KI6B 3RRYA 2PT5A 1G4UR 2OCYC 5KDOA 3N2EA 1XD2B 4LPSA 4M1WA 4C7OB 1G41A 3MFYA 4ZPXA 1N25A 2QRNA 4C0KA 1NN5A 4X8OA 3K0AB 3W8RA 4LCBA 5DN6D 2JJ2A 3LVQE 1R6BX 4RD2A 2XEXA 2ECKA 4QBGB 2ASEA 4CDGA 1NBMA 3IIJA 2GCOA 3LVRE 4WBSA 2BC9A 3SHWA 4D4MA 1ZUHA 2PH1A 1JQLB 2DPXA 4IDOA 3HJNA 3A6PC 3BH6A 2YKGA 3ZVMA 1ZC4A 5B64A 1P3JA 2GWHA 4GOJA 2DWOA 2BMEA 4JL5A 5CK4A 1Q1QA 2YC2C 4L5BA 1K5DA 2PLRA 3GD7A 2IK8A 2QM8A 4RZXA 1ZRHA 4NDZA 3VFDA 5FBLB 4DZZA 1Q57A 3KKQA 1W5SA 3K0AA 4D6PA 3B1ZA 3O8DA 4PSKA 2JDID 5G41A 1D9ZA 4BGDA 1XJ0A 1NBME 2KI5A 2FWRA 1R7RA 1AQYA 5FBWB 5K8IA 3CPHA 5EE5B 1KJYA 1WDTA 4PC3A 4RD1A 2ZJOA 1IAQA 2ZI3A 3I73A 4LYHA 1GKIA 3QKSB 2RAPA 1A5TA 1C4OA 1ELOA 2JLYA 3BB1A 1MO3A 1MO5A 4CT5A 2EQBA 2YOFA 1KAOA 4EIWA 2PMKA 3T12A 3TAUA 221PA 4DLWA 1F6BA 4DJTA 2C8VA 1PLKA 2IF0A 4XSGA 3GEIA 3L0IB 4FCWA 3R9XA 3QNUA 3BB3A 1KSGA 5JWHA 1K6MA 3BH7A 3KDSE 1ODFA 1XXHE 2HYDA 3WNDA 3L43A 4HAXA 1GG2A 2PCJA 1OIWA 2XX3A 1G17A 3AP2A 3L0PA 2AWOA 1VDZA 3FPAA 1W1WA 3SC3A 1NIPA 4OQFA 3LY5A 3K9NA 3PV0A 4FIDA 3NBZC 1U90A 2WHXA 1D9XA 4JMPA 1NY5A 2ZU0C 2YWEA 3B7GA 1I4TD 2QP9X 1E69A 5E7MA 2PJRA 3QVVA 3EX7C 1G21E 4WXRA 2ZRJA 5KSZA 1G3UA 4BEBA 3ZVNA 2E1RA 4XSHA 3T1VA 3EIEA 1FMLA 2FZLA 3I61A 2GAOA 1Z28A 2FMXA 2JATA 5EXPA 5L3VA 4JT4A 3N2IA 1SVIA 2CMKA 1R0XA 2FV8A 1AGRA 4MKIA 2VPPA 3UG7A 2HLDD 2ZSAA 3TVDA 1Z63A 3QQ5A 1TX4B 4A8JB 1QHXA 5J4YA 1OFTA 3W3ZB 2XXAA 3I62A 2DFNA 3K0CA 4EAQA 1KI4A 1F2TB 1YZGA 2EW1A 1KHTA 3CNOA 1VMAA 5HZKA 5K8LA 5CIWA 1UBCA 3GP8A 2GJKA 3GLFE 4L8GA 4NMMA 3HPRA 3CNNA 2AKAB 2IXGA 4PPNA 2WV9A 1AZTA 4UKDA 4KITB 1HE8B 2WJVA 4GFDA 3AKDA 3TBKA 4PC6A 4A9AA 3GLFA 3C14C 1E9AA 2QU8A 3JVUA 4E07A 1CLUA 4ZCLA 4W5HA 2BCGY 3WNBA 3BH0A 3G5UA 4DUGD 1QHHA 2VP2A 3OF5A 4JSTA 2FE4A 5F98A 3AKYA 2AR7A 4HAZA 3WMFA 4RJLA 5HZHA 2CLDX 1PZNA 4HB0A 1E79D 2QAGB 3FVQA 1ZINA 1LVGA 3Q85A 2TMKA 4PSVA 4A15A 1KO4A 4JKIA 1VHLA 2X2FA 1LV7A 5FPSA 5JJLA 2XOKD 4OJKA 2ZRPA 2QRZA 5J4LA 1D5CA 4DLSA 1X86B 3H0KA 1DAGA 2W6JA 4DEYA 5L3SA 2QSYA 3N5CA 3AVVA 3LLMA 4MA4A 1IN7A 2FFQA 1Q22A 3A36A 5HE9A 4AWXA 1Z5ZA 1ZD1A 2QQ0A 1OV4A 2F43A 4MRVA 5KTYA 4F38A 1OFHA 1FQJA 1QHHB 1SXJE 1ETUA 1TUEA 3IILA 4B2PA 2WM9B 4M1MA 4OJQA 5CK5A 4FWIB 4Q03A 3LFUA 2NIPA 1P60A 5FBRB 3AF2A 4RKEA 2BKUA 4WAUA 2GEUA 3FKQA 1FTSA 4GSYA 4BLTA 3ZQJA 4AKHA 1UKZA 2O8BB 3DZDA 4EJSB 3B60A 4TWZA 3DPUA 5J4HA 3CR8A 1E2PA 1U8ZA 3SDZA 5F2EA 3Q7PA 1JNYA 4IVRA 1P9NA 1W36B 1P2VA 1L2TA 5EZ5A 3FOZA 3WRYC 3THXA 3CUEF 4US2R 5JS7A 2R6DA 1CIPA 2J7PD 1K8RA 2I1QA 3UXMA 1W5TA 2KB0A 3VR2A 3QSYA 3GLIA 2VLIA 1XTKA 4Q48A 2YC4C 3K0EA 2FDCA 2OFWA 3K1JA 2QL6A 2PX3A 3OEED 1CEEA 2FN4A 1KI6A 1TQ2A 1NRJB 2CHGA 4LV8B 3A4MA 4FI3C 2PZEA 2Z43A 1E4VA 4B43A 4DCTA 1VG8A 1ZM2A 4Q9HA 2QE7A 2QTVB 4KYUA 4M9SA 5AUOB 4TMKA 1LTQA 2PEYA 4UXIA 2RGDA 1ZM7A 1XMIA 1S3GA 3IEVA 2YOHA 2D4HA 2HEIA 2WWXA 2ZVPX 1E96A 1CR4A 3ADKA 3NH9A 2JLRA 2LKDA 4QNMA 5IHPA 4U02A 2F1RA 2OBNA 5AUNB 1OW3B 4KODA 3QG1A 4PX9A 5DYIA 3SR0A 3SBEA 3K09A 3BFVA 2X1VA 1YR6A 1N3BA 3BB4A 2QNRA 3EC1A 1II8B 1ESNA 4XD7D 4B6FA 4BPBA 1G4AE 3QOFA 3FHCB 3KJEA 3K8YA 2GXAA 4BFVA 3K9HA 5JWOA 4KAXA 1RJ9B 4US1R 2BWJA 3RLFA 3AVUA 4JJKA 4TYQA 4TMWA 4XJXA 1GRRA 3B2EA 3CRRA 5FOVA 2F1HA 3QXCA 2VTKA 4ARZB 2PEZA 1P7CA 4RD3A 3ZZ0A 1BS1A 1ZVQA 2ZU6A 4KHZA 2CDNA 3WRXC 1NVXQ 2OAP1 3B1VA 4G3XA 5DYGA 3GLIB 1U98A 1LF5A 4YDHB 1EK0A 1NBMD 3GJ6A 3NH6A 1CF4A 4R2HA 1DADA 3CM0A 1HH4A 3ND9A 4XVQA 1GKYA 1IHUA 2CNWD 4Q18A 4LY6A 2AL7A 2Q3HA 1QHSA 1JXOA 1Q44A 1D2NA 1FW6A 4Q5IA 1II8A 1YQTA 5FUYA 1VPLA 2GESA 1W46A 2QP4A 3FMOB 1HEIA 2JJ1A 4H1VA 4TQ9A 4PZLA 2FSGA 2QI9C 1GM5A 1E2EA 3L0SA 5CYOA 2ZUCA 1L4YA 1E0JA 1R8QA 1ZYUA 5HCNA 3U3RA 2WIAA 1WRBA 1NMYA 4YQFA 4V0OA 4JLBA 3CKLA 3CX7A 4DCUA 1WBBA 2QAJA 4A6XA 1GL7A 3O8CA 1P4SA 2ZANA 3ZIAA 2WAXA 3RANA 5FR2A 5L3RA 4BZXA 1W2GA 3I1FA 3U3OA 5C1BA 2ZRFA 1JBKA 1M8PA 4DB4A 1ZUNB 1U0JA 2ZR7A 5EUQB 5KDLA 1DAHA 2F9LA 2Q3MA 3PEVA 4NHOA 1HUQA 3CR7A 1KY3A 4QRHA 2IUSA 4OHYA 5J4KA 2E87A 2H1LA 4FD2A 1WXQA 1DAMA 1DO2A 3ECCA 2QBYB 1HY3A 2ZRBA 1T3SA 3C5CA 3CB4A 3FKSA 1OF1A 5CM9C 2CJWB 3U7FB 1TTTA 2VO1A 4FWTA 1Q3TA 3I32A 1AKEA 5TVKA 3MUFA 1BIFA 2DFLA 4JJZA 3B1WA 2QROA 1JEDA 1XP8A 4KLZA 4OI2A 4NU0A 1MABA 1W49A 2OESA 2AX4A 3MWLA 4NCJA 2QY9A 3AQ4A 1FNMA 2AD5A 3QVUA 1G7RA 3CX6A 1CR1A 3KQUA 4TMVA 2OV2A 3RAPR 2BBSA 4US0R 2GAAA 1CULC 2QTHA 3THYB 2ERXA 3WNCA 2OLJA 3BC1A 2ZAOA 4LJ6A 4O25A 5E7JA 3SYKA 4ZDJA 2F3TA 2CK3D 1LY1A 4JLDA 3KXLA 4Q9JA 2O5VA 3GCGA 1Z0IA 4LX0A 2ZSFA 3NBFA 2CCGA 3I3SR 5KHOC 4DT1B 2BCJQ 4O3MA 1GKUB 3ZS9A 4LJ9A 2J45A 5FOWA 1AM4D 2CVFA 1R2QA 3P20A 3QKSA 3A58B 4RSGA 4TT3A 1H8HD 2OFOA 3GLHB 2H8KA 3QXJA 1DAIA 3LW8A 1KDRA 3EXAA 2JIZD 1T5IA 4DLTA 3L0OA 5DI3B 2V3CC 3TH5A 1NLZA 2BV3A 2HCBA 1N6OA 1KI8A 3SBDA 1KY2A 4HUQB 5EE0A 5C18A 1OE0A 4LPKA 1R5OA 1XTIA 4D4LA 1WF3A 2WKRA 3OEHA 1OFUX 4P0TA 5FTJA 4B48A 2ZJYA 2IWRA 2XXAB 1Z2CA 2JDIA 3A1WA 4HAVA 4QKQA 2RGNC 4MYCA 4Z54A 4QJ3A 2VA8A 2CL0X 2ZRGA 2IBMA 4V02A 2BKEA 2QAGC 4NE2A 1S2MA 4TL6A 3TGPA 3BAFA 3KKPA 4F4JA 3U3MA 2QEQA 4L9WA 1P5ZB 3F3YA 2A7QA 2WIBA 1B23P 1JAIA 4ZDWA 3BORA 3LW7A 1E2GA 2WSSA 3U61B 2WVJA 4UNNA 3GLGA 1IXSB 1E3MA 2B7BA 2XZOA 3GLHE 3CX8A 3AUXA 3DEFA 1E9CA 2LWIA 3K0FB 2N46A 2F1JA 2Y8EA 1HA3A 1ZNWA 3E1SA 3U4QB 4B35A 3SE0A 5JEEA 2PT7A 5EZ6B 4L15A 2H57A 4LBVA 1X1RA 5JI2E 2J0QA 4G5GA 2ZAMA 4AKGA 3EG5A 4IHQA 5CM8B 4C0LA 3B9PA 2FOLA 5KNCA 5FUVA 2FF7A 3QXHA 1OIVA 3WY9A 4QJ5A 5AJXA 1Q20A 3BGWA 4ILEA 3ZIAD 2ONKA 3I92A 1XPUA 1OLOA 3C8UA 5KU1A 1E2HA 2X19A 1GFIA 2QG6A 2G0TA 1C1YA 1KYIA 2QUZA 521PA 4BZPA 3BE4A 2O8FB 4WIAA 5FTNA 1JR3E 4PHTA 2XNDA 3TIFA 3C16C 3H86A 4OQLA 3VNVA 1EFRD 4B75A 2Z4RA 2HLDA 3FMPB 1S1MA 3EPLA 2J5XA 3SNHA 2DBYA 4N0DA 4DSUA 2OO7A 2RKOA 1ZM9A 4TT3D 1XJCA 1SVWA 2WWWA 1DS6A 4BLQA 1OH5A 5A4JA 2BBTA 2DFKB 1US8A 2WOJA 4JVMA 2XNDD 3ZVLA 5KNDA 1XEXB 3EWAA 2JCSA 2W2XA 3Q72A 2F3RA 3AGPA 4C30A 1E2DA 3IBGA 4B34A 3IO5A 1RRCA 5BWMA 1UKYA 1G1MA 4YMTA 1XTJA 1B0UA 1D8TA 3DM9B 2HJVA 1XD2A 1N5JA 2ORVA 4TLAA 1NG9A 4M1YA 3AP1A 1A7JA 3A1UA 1MABB 2GTPA 3KTAB 3Q8XB 1S8FA 2G77B 1E0SA 1Z0AA 1RIFA 5GJCA 4PHGA 4IDHA 3LBIA 3RRZA 4LYFA 1G6OA 4UJ5A 2J3EA 4ESHA 1DPFA 2ZRDA 1PLJA 1YRBA 3H1TA 3SJBA 4LUCA 4Q47A 3TUZC 3CRW1 1TMKA 1WB9A 5GVRA 2ZRIA 2FJUA 1N2CE 4PR0A 1ZU4A 3U2QA 1KMQA 1ONBA 4LI0A 3THXB 3MLEA 1AN0A 3RC3A 1NG1A 1V43A 1KAGA 2WWIA 1KI7A 2ZE8A 4B47A 4ZIRB 3G0HA 1QG2A 5JFGA 1H65A 3NBYC 2O8DB 4R9UC 2RMKA 1A2KC 4FCTA 4TTRA 2ZI5A 2ZSDA 4XWKA 4DCNA 1WCV1 1XFAA 1DELA 2R6AA 2ZXUA 2ZYUX 1J90A 4M1TA 4LBYA 4QGGA 1DAFA 2ZRKA 3EZ9A 3CO5A 2F1IA 4S35A 1I4DD 4GZLA 3W6PA 1E32A 4DDWA 2YINC 4A0FA 5L8VA 1YR8A 3B1XA 5TV2A 2Q0HA 1E2MA 1LFDB 2C9YA 3CRQA 1J99A 1UBFA 4HLDA 1E9RA 4M21A 1NN1A 2YHSA 1RJ9A 1IY1A 2C96A 1NKSA 3ETLA 3ZD7A 4R7ZA 4MYTA 4IOKA 1T0JB 5G3ZA 1E2QA 2IF2A 4JYBA 2HUPA 2GXUA 4MGYR 1QVRA 5JEDA 1RW4A 3QBTA 3DMNA 2PL3A 4TN1A 2WTUA 4MRRA 1GTVA 2JIZA 1UBEA 2WKQA 2ZJ8A 1EX6A 4MGIR 2J41A 4NP6A 3ZGXA 1G5PA 2PJZA 2V4ZA 1OH8A 4DLZA 5DE3A 1RRGA 3K9GA 1EG7A 4Q19A 3UWKA 1OIXA 3UG6A 3GLIE 3U5ZB 5FTKA 1P73A 3TMKA 3PFIA 3GQBA 4OI0A 2W0MA 2ERYA 2HT6A 4EPXA 5BW8A 2D06A 4W5JA 5J5CA 1TQ6A 1ZD8A 5HKKA 2CE2X 1IXRC 3QXXA 1GRNA 2ZI4A 1OFIA 1YJ5A 4MH0R 3EW9A 2GJSA 2MSDB 2MSEB 4CT4B 2WJJA 3PENA 2V7QD 1EFCA 4LJAA 4XTRA 1J2JA 4Q4JA 4P4SA 2AFHE 4LJ5A 2O8EB 3M4YA 4URUR 2WWHA 5JWRA 1ZW6A 4NYMQ 3JVVA 4B3DA 2O8EA 5LDDC 2J0SA 2G1JA 2OHFA 5K8UA 4IOMA 1EX7A 4Z1MA 4K8OA 4RCZA 3D31A 2JAQA 1AQUA 1FNNA 2C78A 3T1OA 4TLEA 2FEMA 1ZCBA 4FMDF 3PEWA 3AF1A 3WP0A 1AIPA 3P4YA 4CEJA 2N1BA 3B8HA 5F3WB 2VIIA 3OEEA 4PPQA 5HR5A 5GJVC 1TF7A 3FKSD 1JPJA 1KK2A 2VL7A 4EPWA 5EJEA 2ZJZA 2C5LA 3X1WA 4KVGA 4TZ0A 1SQ5A 3KB2A 2FU5C 5EP3A 1JECA 1P9WA 4A92A 1G291 1BKDR 2DWQA 3OZXA 4R71A 1PJRA 4P4SB 4LYAA 4MUAA 1M7HA 4F7WA 2GBLA 1D6JA 4GT1A 2ZJ5A 1W0KD 3DOFA 2ZE5A 1GL6A 1MV5A 3T1TA 2QT0A 1X8LA 2V8OA 4GMXA 1NSFA 2B8TA 4EPYA 4J0QA 1G19A 3LXXA 1FQKA 3AVTA 3QBVA 4EQ6A 2ONJA 4Y0VA 1KJWA 4Z51A 4IFEA 2J87A 2W6ID 4ZCIA 4YXWD 1T3HA 1TEVA 4PAQA 3MWJA 2BM0A 1UAAA 1BOFA 2HF8A 3VX4A 3MD0A 4CVNA 1KZGB 4D80A 5FPKA 4U7DA 2CHQA 4A2PA 1R0YA 1VIYA 2IYUA 1NY6A 4P31A 4OK3A 1E98A 3PEUA 3THWA 3REFA 4N0EA 4CW7A 3RABA 3HDTA 3NBXX 4RZ3A 3BRWD 2O0JA 4NZYA 3U7EB 3AM1A 2OBLA 3OESA 4ACAA 4P3YA 4AD8A 4ASUD 2WMOB 1P75A 3W34A 3AB3A 2XTNA 3J81k 4PFSA 4WZBE 5JJIA 4FMCF 4BASA 2HDNB 4Q01A 3I5XA 2O52A 3I8XA 3M1IA 4Z8XA 1AK2A 2ZREA 4M22A 1VYUA 1FFHA 4DSTA 4PZYA 3AVWA 1Z06A 5AWFC 5GJBA 1JR3D 2IW3A 2VP5A 2ZETA 4LV5B 3R9IA 4BLSA 4AI6A 1R4AA 1EESA 2ZS8A 4MRNA 2QE7D 1KDPA 2LKCA 1CR0A 3AF3A 1X3SA 4DWJA 2ZRLA 1SHKA 1U2RA 2ODWA 3F5FA 2PMDA 2CXXA 3OHMA 2ZUBA 4LYJA 1PUJA 3TUJC 2FSIA 5CB8A 2J59A 1EXMA 1E9SA 1G8PA 1U9IC 1P72A 2FFAA 4JLJA 4HDOB 2P3SA 4JLKA 3TSWA 1OH7A 3GLFB 3P1JA 2HCJB 2X8AA 2YVUA 5BN5A 4NH0A 4BLRA 2XJ9A 1XX6A 3KKOA 4A6PA 4BFWA 1ANKA 4QBHA 2NPIA 1MO4A 1CR2A 1QDEA 1QVAA 2ZRMA 3D8BA 3CF0A 4ZV4A 3GMTA 5DLQC 5G3YA 4G01B 3UPUA 1E9BA 5JHHB 4TSFD 4F4CA 1KI3A 4NKRA 2NO7A 2WWFA 1EFRA 1R8SA 4D4KA 4OK5A 5FOSA 2GBLC 4MDFA 1RRFA 3C5HA 2F55A 1CTQA 4D25A 1XZPA 3TAHA 2REOA 3LD9A 4Q1EA 2FA9A 4DSNA 2ZYWX 5L3SB 2GF0A 1Q1ZA 1Z8FA 4ZDKA 4IVQA 5CDFE 2Q21A 3LA6A 4D0NA 4HATA 4RVCA 2FZ4A 1Q1EA 2R6CA 4BEJA 4CGZA 1XTSA 3V9PA 2AWNA 3THOA 1Z0DA 1ZP6A 1JEEA 3EARA 3QPWA 2O8CB 2HT1A 3OFND 4Q4AB 4NCIA 2GETA 3GPLA 3U7GA 2WJYA 1QBKC 1XD9A 1T91A 3BFKA 2OAQ1 2RGAA 3B82A 3V4RA 3VR3A 1LF0A 3U7HB 5JSZB 1JALA 3VQTA 8OHMA 1K5GA 4WZ6A 5BXQC 1EFHA 3W9YA 3Q5DA 1KKLA 3FTQA 2H92A 3DO6A 4OHWA 4UNPA 3CH4B 1BO6A 1KKMA 4BFXA 1G8FA 4B3BA 3LQQA 3VHXA 3KUDA 821PA 1PLLA 3PUWA 1L8QA 2WOOA 2RB4A 1XXHB 3B1YA 3IGFA 5LB2A 1JPNA 2OCBA 1IM2A 4RKFA 1XMVA 4ERNA 2W2VA 2VF8A 4G5SA 1N0VC 4POAA 1R5BA 2XZPA 4QHYA 1Z6TA 2G1KA 1AKYA 1DOAA 2CLSA 1QRAA 2YWFA 2B92A 2OSBA 3LAWA 4A0HA 5DIFA 3DOEA 4F93B 3ZYCA 4FXPA 4HZIA 2ORIA 1UM8A 4B44A 5BN4A 3GLGE 3M0EA 2D2EA 1COWA 2IA5A 2ZI6A 4LHVA 4E09A 1XCMA 1A2BA 1XJQA 1CJTC 2EFHB 3TSZA 2IUUA 1UKVY 1P2UA 4BRWA 1OXSC 4BFUA 2R6FA 5C46F 4URZR 2G83A 3P4XA 3NXSA 3AVXA 3PG5A 5EP2A 2F9MA 4OQXA 1TEXA 4BFSA 3AVYA 4MITA 4M9XA 1GILA 1XDBA 5D3MB 4NYJQ 3OIVA 3ADCA 3LBHA 4K46A 1T4GA 2G6BA 3KX2A 2KJQA 3AGQA 5JRZA 1Z0JA 2HJGA 4Q4HB 2RCNA 2G88A 1YHNA 3IUYA 1FTNA 2ZM5A 2IX3A 1R0WA 4HSEA 2GK7A 1BYIA 1II0A 2GF9A 2CVHA 1Z2AA 1Z22A 4XD7A 3MJRA 4IEEA 4JBWA 2V6IA 3RS0A 1CXZA 4NCNA 4EPVA 2W6JD 4MKGA 2OXRA 3CRVA 4M8NE 1KO8A 3LQRA 5BQ5A 1OHHA 3A4LA 2VH5R 3MRSA 2IYLD 1M2OB 3RDPA 4YXWA 4M4SA 1CKEA 5DSZA 1XCGB 2EFGA 4Q7KA 4LHXA 3EZ6A 4I1UA 4KV9A 4QHTA 4FINA 1ZNYA 4NONA 1KO5A 2ATXA 4G5RA 2P5TB 4BLPA 5C2JB 2QBYA 3IHWA 4Q4JB 4BECA 3SQWA 3LX8A 2DFTA 2VHQA 2ZS9A 5IF9A 6Q21A 2NOAA 4QOSA 3RS2A 4DRZA 4LHWA 2A3RA 4I1SA 1G16A 4Q02A 2QENA 4CF7A 3KQLA 3QENA 3HYTA 3TNFA 1W0JD 1G7TA 4H9GA 4PO1A 3BBPA 4TL9A 2OBMA 4EFNA 1FUKA 4TMXA 1Z0KA 5KSYA 4B3CA 2CEAA 4JBYA 1VYTA 2FFBA 3Q5EA 2FGJA 2W00A 4P33A 2CJWA 2J0UA 4B3XA 5FI1B 4C7OA 2GEDA 4TL8A 4LGMA 3RC8A 3BFXA 4KBFA 2XAUA 4M9ZA 3HP1A 3V00A 3VMFA 1V5WA 3VKGA 2ZE6A 3WP1B 1NP6A 2FGKA 3VAAA 1E9DA 2WBLC 5IT5A 2R8RA 3AF4A 5B58C 4TZ6A 1TL7C 3OE7D 2IS6A 5EUMA 3SZRA 2EVWX 5CLLA 2IXEA 1XF9A 2DWPA 4TLCA 1DBSA 2CE7A 3UK6A 4TMZA 4KSCA 1JAHA 2QZ4A 2ZJAA 5TARA 3W90A 3C7KA 5FOUA 2Q6TA 4NPHA 1YKSA 2VHUA 1SXJB 3IPXA 1OT3A 1UADA 2GHIA 2ZYVX 3ZS8A 2XB4A 5JSZA 3C15C 3RWOA 4ESVA 4BZQA 2QM7A 1H8EA 4JL8A 5D3QA 2A5GA 1Z6YA 4PTLA 2NO9A 3WYAA 1XEWX 1G8HA 1VG1A 1M6NA 4PXAA 1DEKA 1MKYA 4A82A 1NVUQ 2DB3A 1VKJA 3RRMA 4Q1AA 2J46A 1N6NA 1VTKA 3GEEA 4DT1A 3FYHA 3B85A 1F2UA 4A8JC 1RZ3A 2A2ZA 4I1OA 3VHLB 4QBFA 5K8TA 5FUXA 1YZKA 1Q21A 1VYVA 3LBNA 2VP4A 4OHVA 2OLKA 2QMEA 1OKKA 3AEZA 2JJ2D 4Q21A 1G3IA 2X2EA 5DI9A 2BMDA 5JI3E 2VYFA 1GNPA 4ZDIA 1SGWA 3ADBA 1C9KA 1GSIA 1U0HC 3U44A 4I81A 4DLYA 3KJIA 4LOAA 4BUJA 3RVBA 1H8HA 1M7GA 2GZHA 3CWQA 4GMDA 3TUIC 3QI2A 4C0QC 1CU1A 4HAYA 421PA 4PQFA 3M6AA 3KQHA 2WMNB 1XTQA 4IOLA 4LZZA 3DM5A 4JLPA 1M7BA 2GVZC 4HDQB 2UZIR 4QBIA 2WJIA 1RRPA 5FH9A 5KSPA 2WWYA 4Q1FA 3TQCA 1KMHA 2KBEA 4EPRA 4V0LA 3T15A 5TXGA 4I4LA 1ZM4A 2WAYA 4C3ZA 2NTYC 3WBKA 2QT1A 4QNRA 2NZ8A 2K5UA 2UVQA 3ZDQA 2GEVA 1GZSA 5DHFA 1ZD9A 2GKSA 1A82A 4C0BA 1FX0A 4GPTA 5C4GB 1ZAKA 2IYQA 3W5JA 2QGZA 1Z3IX 2GK6A 3X1ZA 4EKDA 1SZPA 2JJ1D 1KSJA 3G82C 3FB4A 3PIRA 4LHYA 4ASUA 1FL9A 4IOJA 1WA5A 2PBRA 2YV5A 5DH9A 3SS8A 1YZNA 3VR5A 1G3MA 3DKPA 3GLHA 2VF7A 1N0WA 4JLVA 1FUUA 3RRNA 2IYTA 4GZMA 4Q7JB 5HKKD 1J70A 4UXJA 4AG5A 2DYKA 3VR6A 3B6EA 2OT3B 2ZRAA 3CRMA 4F4IA 3TKLA 4D2IA 5C4MA 1CP2A 3SJAA 3CZPA 2JLUA 2C95A 2D2FA 4KYIB 3U4QA 1I2MA 4KFRA 3Q3JB 4RD4A 1FP7A 2WSMA 2JASA 4LBZA 1J8YF 4KO8A 4WXPA 1KDOA 1GNRA 1IQPA 3CBQA 4AYXA 2EYQA 3T1QA 4V0ME 2W6IA 1U0LA 4EUNA 2ATVA 3EPHA 4QXAA 1T0HB 4GBMA 3ZLJA 2J7PA 5FPTA 2XGJA 1ZBDA 4AC9A 4LHZA 4M9QA 1XEFA 3MCAA 2LCFA 4JT2A 1DTSA 1WP9A 2R44A 2W83A 4KLNA 5TB5A 2QQEA 1ZCAA 3ND8A 1KTVA 3NDPA 3SJZA 5IRCD 4KFTA 3CH5A 2FPLA 1KI9A 1DAEA 3E2IA 4X8LA 5ANRB 2V1UA 3ADDA 5JZVA 1NJFA 4PHHA 3P27A 2EFCB 4QL3A 3V4FA 5CIQA 4NYIQ 1G6HA 4B73A 2QPAA 1F2TA 1OXVA 4II7A 3U6BA 3W5IA 1N6LA 1DVRA 4L16A 3MAAC 3T5GA 4JVNA 3TE6A 5KPJA 1S4QA 4HB2A 4V0KA 1VG9B 4AIIA 1D2EA 1X1SA 3GJ0A 4TL7A 3FDIA 4ZI3A 4HB4A 4QHSA 3R9WA 1W44A 2KBFA 1T8TA 2YJTD 3U3KA 1NKTA 3KXIA 1U99A 4R2IA 1TAGA 1D2MA 3KUCA 1N5IA 4Q9KA 1E94E 4JIMA 3R7WA 2REXB 2VHTA 3KFVA 4RD0A 1CBUA 1KK3A 1FOEB 4E22A 1ZM3A 3CWZA 4UQOA 4YMSA 5JCPA 4OQMA 3KQKA 3RS5A 4CEIB 1XZQA 1UDWA 5KPDA 1IONA 4ZKDA 4LJYA 1S3SA 1J7KA 1M34E 3FGNA 1MRSA 1U8AA 2I1VB 3ZZUA 2A5DA 3CF2A 4U00A 5J4VA 3AKEA 4P4UA 1O87A 1E6CA 4ON9A 3CPEA 1NI3A 3F8TA 4HYYA 4LWZA 5FOTA 2G9NA 4A0GA 1GITA 3K70D 1IJEA 4AYTA 2AK3A 4M1OA 4OBEA 1CJMA 1W4AA 3ICQB 3SFZA 3EIQA 1IY2A 1XXHA 3ASYA 4DBLC 4Y0AA 2RH5A 3KZ1E 3W6NA 4IXMA 2YOGA 1SVSA 2P2LA 3S1AA 1ZC3A 2IYSA 2XOKA 3SU8A 1XPRA 4DCSA 3PUYA 2ZPTX 4DLXA 1RKBA 2YNMA 3W3AA 4DHEA 1A1VA 4G5OA 2GXSA 2O8DA 2ZRHA 4Q7MB 3BJIC 4CIDA 4DVGA 1W0KA 3PVSA 2BDTA 3REGA 4ZIRA 3PJRA 1SHZA 2V1XA 3BS4A 5LPNA 4RZUA 3SYLA 2C9OA 2I3BA 1L7VC 1XU4A 4G1UC 2V6JA 3RSOA 4PC2A 4URXR 1P2SA 2QGNA 4TTPA 4DDVA 4GL2A 1HQYE 5ELXA 5DN6A 2X77A 4S2EA 1E1QD 1HT1E 3KL4A 1SULA 2JA1A 4Q4HA 3AVOA 1N6KA 3DMDA 5LD2C 1AGPA 3QIAA 3IEUA 1OHHD 2XJ4A 2FG5A 1KIMA 3K70B 4B3GA 2GA8A 5KNBA 1GIAA 1U8YA 3U44B 1WBDA 1SKYB 5BN3A 4Q66C 1T3LA 4DEXA 4KBGA 3TQFA 2O0KA 2JEOA 4KXFB 2DHRA 3R8FA 1W4RA 5BYJA 1N6RA 2P6RA 3LO5A 4ZCMA 3L8YA 2DR3A 3WYGA 1E9EA 4DDTA 2P5SA 2QPOA 3NWJA 5G53C 2NMVA 3ZJYA 5EE1A 2XSZA 5EXSA 4FMDB 3PITA 1DARA 1GRQA 3AP3A 1KSFX 5G40A 2CLCX 2ZTSA 4DCVA 1G64A 4JZKA 4L9SA 1XEXA 4HI0E 5HPYB 2ODNA 4C2UA 1N5LA 4Q9LA 1DG3A 4RCYA 1DG1G 1U9IA 2Z83A 3TJZA 4MDEA 1FX0B 1CJVC 1W36C 3LDAA 621PA 2J0VA 4XH9B 4PPGA 4XVRA 2PZFA 2VP9A 3KB1A 4FCVA 3THWB 3GJ5A 4HAUA 3WHLA 1AZSC 2P67A 1NN3A 1OYYA 3QEOA 4JKYA 4B2IA 1SKYE 4DLUA 1U94A 3NG1A 3P26A 4A8JA 5KDDA 1TUIA 1H8ED 3OE7A 4NYMR 5SZKB 2MMGA 3N70A 1XNJA 4HZUB 2EYUA 2Q9AA 1JI0A 4UXHA 1G7CA 4D4JA 3HR7A 2AD1A 4AG6A 1NL3A 3MJHA 4OKSA 1GUAA 2R6GA 3B78A 2XZLA 1R0ZA 1CS4C 1X6VA 3WBJA 4RD6A 2W58A 2V54A 4LJ7A 1KMHB 4MYUA 4UNSA 1J8MF 5FUWA 1E9FA 3LWNA 3JZMA 4PHFA 4O2RA 2E9SA 1HTWA 2IHBA 4PSAA 3GLGB 3DKVA 3O8BA 5AJYA 4GP6A 1FPMA 3RYTC 2P6NA 3T06B 1OSNA 5FI0B 4A2WA 4B6EA 3NKVA 4DDUA 2NG1A 4U5XA 2ZRCA 2JLXA 5IK2D 4BE7B 2PCLA 2CHVA 2WSSD 3LH5A 4C0JA 5KO2A 4DLVA 4FMCB 4IKEA 3L2OB 4IDPA 1XRJA 4RY2A 2RGGA 3RWMB 3U6KA 1II9A 1IN5A 4E5UA 3K0CC 3A37A 3A8TA 5CJPA 2GNOA 5CITA 2H7VA 2J1LA 1E0KA 4BQSA 4AURA 2ZS7A 3SYNA 4LJ8A 1KK1A 2NO1A 2FFHA 2P0EA 1S0UA 3NIBA 3PEYA 5B57C 2IYZA 1F5NA 2D7CA 4QFMA 1IN4A 5H70A 1Y3AA 1VCOA 2AN9A 3WXMA 2EWVA 1KO7A 3UKDA 1E99A 1UF9A 4CEJB 2A5YB 2A5FA 2F7SA 1ZJ6A 4TLBA 3T34A 2H5EA 4EDHA 1AJEA 4YLGA 5AJWA 1G5TA 1G3QA 4W9MC 3K9LA 3QF7A 4PC7A 4WA7A 3QE0A 1FP6A 1Z0FA 4I99A 3SQXA 1NMZA 3D6TB 3TR0A 1GNQA 2FH5B 1OXXK 5SZJA 3C4JA 4GRAA 1NLYA 4JBXA 2EU8A 1L4UA 2HXYA 4IDNA 1SVMA 1S96A 121PA 1AS3A 3QPUA 4PAMA 5EP1A 3QY0A 5P21A 4B3FX 3O47A 5LB4A 4HLCA 1XB2A 1VIAA 2ZR0A 2WICA 1LS6A 2C9CA 3FWYA 4GI7A 2PX0A 2XSZD 4IEIA 5FPHA 3NC1C 3UMRA 1OJLA 2CBZA 2A9KA 1X8JA 1TADA 4F92B 1UFQA 1A4RA 1NN0A 3GJXC 5H8WA 1ZIPA 2F43B 4P4TA 4YC7A 3U60B 1Z08A 4MRPA 2ZSBA 4FMBB 2D7DA 2ZE7A 2BEKA 4KCGA 4PO8A 2W0SA 2JLZA 5FR1A 3EZ7A 2ZI7A 3H2YA 4LC0A 2FSFA 4M2LA 2V9PA 4NCKA 2DCUA 4JL6A 3EPJA 3LLUA 4QGFA 1RC8A 4P32A 4B33A 3IHLA 1KDTA 4NYIR 1QHGA 2RGXA 3SN6A 4URVR 1XWIA 5DO9A 1NNEA 5DI3A 1EFUA 2B6HA 3A1VA 3L8ZA 5JLJA 1BYUA 1W2HA 3NHBA 4IVPA 5UKDA 3EA0A 4C0SA 1YZUA 5CB6A 5SZHB 3EAQA 5KSOA 4AY2A 1JR6A 4B74A 1XPOA 3O8RA 1SVOA 2N42A 3MWYW 1QF9A 3B9QA 1SKQA 2NO6A 1IBRA 1NJGA 3AF0A 5IDVA 1R10A 2YYZA 3TVTA 4BRUA 1N6IA 3C41J 2RGNA 3LX5A 4YONB 1YZLA 4EFMA 2AKYA 3MSXA 1PV4A 2L0XA 2IYXA 2O8CA 3UIEA 2FNAA 2QAGA 2BHRA 1E2NA 3EWSA 3FMFA 2VHCA 1T5LA 4NTZA 2JLQA 1N6PA 3OIYA 1NVWQ 1RYHA 4HAWA 4A4DA 1UKEA 2VBCA 2RGEA 2IS4A 2VSXA 2WWGA 3FMIA 1UJ2A 4Q9IA 1N6HA 2C2HA 2O0HA 1Z29A 2BEJA 3HU2A 3IPYA 3AVPA 4TLDA 3NEYA 2IYYA 1YR9A 4A1FA 1VCMA 4Q1BA 1YRAA 4OK6A 1E2FA 1NVVR 3VKHA 4DXAA 2NZJA 3HPQA 4PO9A 3TLXA 2JLSA 3KKMA 2A78A 4MKFA 1EFTA 3K09C 4JYCA 1E2JA 1G18A 4KU4A 2P65A 3MG9A 4KFSA 4UJ3A 3AUYA 2VP6A 4OQNA 5TDHA 1KZ7B 1SVKA 2QN6A 4IRUB 1W36D 2P6UA 3OAAA 4IW3B 5TMPA 2C77A 2ZYTX 1AS2A 2CK3A 4QG7A 4MYHA 5JRJA 4BFTA 1JJ7A 3NVAA 5J47A 1W0JA 3NEJA 4RZ2A 5FFMA 4O2LA 4YDSA 4D0LB 2QMOA 5H1YA 2GRJA 4RFVA 2VQSA 3GFOA 3KJHA 1GP2A 2VRWA 2ZQ5A 3AV0B 5EQTA 1XEWY 2B8WA 1VCIA 1KNXA 2C99A 1XTRA 4JSYA 1ZNZA 3S1AB 5IK2A 3NDBB 1SXJC 3A4NA 1KSHA 2OCPA 5LD2B 1I4LD 2RGCA 4HEJA 1GAJA 1UBGA 5EXTA 3VTKA 1NF3A 3BD9A 3X2SA 1KK0A 1GWNA 2IL1A 1R5NA 3H4MA 3VR4A 1XCPA 4JLNA 2V55B 2ZIAA 4LBWA 3LV8A 1F60A 1ZNXA 3RHFA 3HWSA 1DAKA 4KJZA 2KWIA 3QG5A 4LV6A 4M1SA 1RFLA 3WMGA 1WMSA 3L82B 4V0MA 3K0SA 2HF9A 3PCRB 4B76A 1CJKC 5GJWC 4C2TA 1S9HA 2ORWA 2ZJ2A 3IIMA 3MWKA 3BOSA 2ZVQX 3TRFA 2XTMA 4ZKEA 5FL7D 3ZQ6A 1T8UA 2FX3A 3BXZA 3GJ3A 4NL4H 4CYMA 1HURA 3HU1A 3RS7A 3SEAA 2A30A 1MR3F 1W4CA 4QGAA 1BMFD 3CONA 3TK1A 1P2TA 5LBIA 2PLFA 1P61B 3QKUA 3RS3A 1UEIA 1ZU5A 4XOIA 4JLOA 1TF5A 1DO0A 1E0AA 2AK2A 1W47A 5DHAA 1OPXA 2O8BA 4A0RA 1MOZA 1BMFA 1Q3HA 4KI0A 2J9RA 3EASA 4PQRA 3PR1A 1LW7A 1G8GA 4C0HA 1YU9A 4OI1A 3TSOA 4V0NA 1XD8A 2Z5FA 3BK7A 1RYFA 4TYPA 2BIFA 5B2ZA 3GJ8A 3D7MA 5F9HA 2W2TA 1ZIOA 3HYRA 3FE2A 1XMJA 3NTUA 4HUQA 3R7WB 1LS1A 2IXFA 1N5KA 4I1VA 4HLQB 1E1QA 1Q1BA 4HZUA 3DVLA 1EWQA 3ZD6A 1HV8A 4RFSB 4N1AA 1Z47A 4EQ6B 2ODEA 5AUPB 4CEIA 2GJAA 1WQ1R 4E03A 1G5RA 1TF2A 5FBQB 2OCAA 1Q0UA 4Z1MD 1WE2A 2YZ2A 4M0LA 4C9BA 5FTLA 3QKRA 4HDCA 3NHAA 2CL7X 4OI4A 2XITA 3IBYA 3QEJA 4KFUA 3T35A 4LK2A 2WPDA 2MMCA 2VSOA 2ZJBA 4ZO4A 1T9HA 4XVUA 5M04A 4AYWA 2EFEB 4Q1CA 1HQCA 4KSBA 3WMEA 5CDFA 2OUKA 4X8MA 4YMWA 3CNLA 2QORA 3W6OA 2VSFA 4OHXA 1DE0A 3ZZTA 4YMUA 1G3RA 4BFYA 1OKKD 1VG0B 2UZ3A 5CYPA 3W8NA 1GOTA 4B2LA 2KSQA 4CEHB 4QJ4A 3VKWA 1RVDA 2GZAA 3UMSA 5FL7A 2WJGA 4IJMA 5EXXA 1P62B 3VR1A 4DSOA 3LXRA 3VX3A 2JLWA 4MRSA 3UANA 4FW9A 1OYWA 2C98A 5E95A 1TPZA 4B71A 1PVOA 4EJSC 3IKJA 2CL6X 2IYRA 4MKHA 1QG4A 3QKTA 1F3OA 3EPKA 4AK9A 1HE1C 5HE8A 3VU9A 2AXPA 1VCNA 1QHYA 4GOXA 3X1XA 2AXNA 1JR3A 2DY1A 2H17A 1G20E 4EPTA 1KO1A 2FPMA 4TMTA 3CIOA 2CNWA 2YWHA 3KKNA 2BBWA 2ZROA 2D74A 4WZAE 1E4YA 1CRPA 1MT0A 1X8KA 2BMFA 3QF4B 3U3JA 1IJFA 3WYFA 2OZEA 2QPTA 2Q9BA 2ZSEA 4JVLA 1ZMXA 4IDQA 5E3HA 3RSLA 3FHTA 4A2QA 4URWR 1U81A 3MGCA 3QKRB 4IFBA 2ANCA 1QHIA 1IY0A 5SZIA 5L3QA 1G8YA 2IHYA 3KJGA 3EA5A 1Z6AA 4W7SA 2GJ9A 3EIHA 2AHOA 1RE0A 4GP7A 1TQ4A 3RNLA 5DISB 4W5WA 1RPZA 4NBSA 5JMTA 1COWD 1VHTA
chains in the Genus database with same CATH superfamily
1VHJA 4PYIA 1ABEA 1QDLB 5C51B 1RQNA 1E1CB 5NULA 4ISBA 3TQOA 3PYLA 4I2NA 2CZGA 3E18A 1EGHA 1CNMA 1D07A 2AB0A 2D62A 3DA8A 4QQFA 3ZI4A 3FRIA 2MSCB 4YVFA 3RYFA 1FMJA 2PR7A 5JANA 2V3VA 1SCJA 2VPIA 4OSPA 3AZPA 4W63A 1J1UA 1XTZA 1NVTA 5F35A 2UKDA 3FWPA 2R65A 1B43A 1Y1QA 3GRZA 1K4KA 2BHTA 3A4IA 3KHTA 4LE2A 3T7IA 3TIXB 1T4CB 2WUVA 5KWIA 2CCJA 2QHXA 3KLMX 2EX1A 2LP4Y 3E9DA 4ND5A 2B99A 3ZLVA 3A1EA 2HIGA 3K70C 3E35A 4R1UA 1TU3A 1EE9A 3IAUA 4J4HA 1V25A 1MO6A 3I6MA 1TJYA 4RKRA 1DC7A 4YJ2F 1QFSA 3JZFA 1KJZA 3OEYA 5T4BA 4ARZA 3BMOA 1NF2A 3A3OA 2XUQA 5CVTA 4C6HA 1WUKS 1R0CA 2WF8A 3W7BA 4G5XA 2PMWB 4N54A 4U7JA 2AR0A 3UATA 3U1BA 1TGYA 4MLDA 1QZ3A 4DREA 1J20A 3NC0C 4QUJA 3F0TA 3SPXA 3X0DA 4OCZA 4F5ZA 3BDAA 5EHIA 1I24A 2H54A 2QP3A 4QSHA 3TQIA 1YXMA 1I01A 1PNVA 4KIFA 4FQ5A 1EGAA 3R3HA 5JJKA 4YFVA 1KEWA 1RHRA 3LCUA 3L93A 2OC4A 4EX6A 5KOJB 1PK9A 1AQNA 3JQGB 1NP3A 1TQDA 1P6XA 4COKA 1KQFA 2CFCA 3BMCA 2IYFA 1I3OA 1IOZA 3RT1A 1OXTA 4ENVA 3DVAA 1M9NA 1CC1S 3QTLA 5D5HA 1JDPA 4BZWA 4XWGA 1ZN8A 4WLOA 5EP4A 3S8MA 3SHVA 2IYVA 2QMHA 3OZ7A 5A9SA 5L4LA 2F3PA 4TZ6A 5AJVB 1L7DA 3JD3A 4NS1A 2QOEA 3GJTA 4LQ4A 2QW0X 4ZV7A 2QUIA 4BJ3A 1K7XB 2Q2OA 5B4UA 1IMOA 4FHDA 4E1AA 3SF8B 1NJ5A 4KDCA 2R86A 2O06A 4DKXA 1WETA 2P4QA 3AU9A 4Y2HA 5EUBA 3BSFA 3A04A 4KCGA 4AZTA 2RK3A 4H1UA 1J24A 2VT2A 4WERA 1FSPA 3KFXA 3RBZA 2M98A 2YV1A 3GFPA 5AVJA 1F0YA 1U31A 2JI9A 2W22A 3I2JA 4IF4A 4ITRC 4IP0A 1FMTA 3WHKA 3L0DA 3PQCA 5AVKA 1P1BA 2CUKA 1Z5UA 3TPCA 2YWBA 3WIBA 1UAAA 2ZT8A 4BU1A 4RH1A 3RGWS 2Q1SA 4PLPA 1GTZA 3L5KA 1PV2A 5JASA 5JJ5A 2O8FA 4PFKA 4ZEOA 2GDZA 4PO3X 1VI6A 4S1WA 4F84A 3ACBA 3U4CA 1Q0SA 1E1RA 1RD4A 1EH5A 4B4VA 1E2IA 5BVHA 1UBUS 4XM1A 1ESMA 2KX7A 3TLZA 3K0FA 2N75A 4OQ4A 3VKFA 4D41A 3HU3A 3KXPA 4JVSB 1ZVKA 3RTCA 1TKCA 3ABRB 3L7BA 4CKZA 4XWAA 2OAEA 4RIHA 1IN8A 3V46A 3M6FA 3IP8A 4X3CA 4C2BA 4FEAA 4CFSA 5KUTA 5TQ0B 3BJEA 4PPFA 1LI4A 4IIEA 3ZKAA 3ZU2A 4TS9A 1YR2A 2D3WA 1RRMA 3L46A 3PD7A 3QVTA 2OHOA 3RUAA 1TZKA 3M34A 3UK7A 5F9FA 4JGGA 4CN9A 5JSYA 2O2SA 5E1DA 4CDNA 3KQNA 3UJCA 1M1YE 4HTFB 2FPKA 3DR3A 4URYR 5B30A 4DB2A 5J5AA 1FVHA 2P11A 3TD6A 3WLTA 1A2QA 2D2VA 3IBSA 4BVBA 4D81A 1VFPA 2PBFA 2Z0MA 2QN8A 3G9QA 1F2UB 5ALHA 1L5ZA 4N18A 2R1VB 2GOYA 4A0SA 2OFXA 1OXKB 4B5LA 3O4GA 5ADHA 4B32A 2IT1A 1T34A 2X4IA 2NO0A 2YFHA 1HE5A 2OE2A 3CH6A 1MH1A 4O4LB 1NQVA 4RQTA 3ZWWA 2D1SA 5GM2A 5HCIA 4F1WA 1QYCA 3INNA 3NOOA 4PFJA 2G8LA 2UXBB 4ZARA 1SVLA 4OHZA 1VDMA 4UEOA 2BGUA 5AW4A 2AFIE 4BRSA 4AY4A 4KO4S 4W1SA 1SG6A 4B8ZA 1N5DA 1IIRA 3UK1A 4C4PA 2GYYA 3W77A 4RA6B 4LIPD 4N5DA 5F77A 1RWWA 2H3HA 1MFPA 2OZPA 4DIDA 3AWDA 4NCHA 4H6VA 4LVOA 1V37A 1QG0A 2QTTA 5EWMA 2SHKA 3A1TA 1N36B 3HS3A 3QRWA 1DXYA 3L92A 1EK5A 1KI2A 1OH6A 4QU8A 5IANA 2R8BA 1Z83A 1Q1NA 5EFZA 1ENYA 2I4MA 1Z5WA 2VDWA 2VQ6A 5D3MA 3LXMA 5JECA 1GVNB 4QUHA 5E4FA 5LU8A 1TGVA 2QMUA 2GBFA 3E0XA 1NNSA 1ZFNA 1BE1A 4KXXA 1L4BA 1S1CA 5JALA 4S1TA 4EJSA 2WPDD 4HWGA 1JDVA 3M2TA 1X94A 1A69A 2WDPA 4FYHA 3VU1A 4FW8A 4I5FA 1SQFA 1HQKA 1YFKA 4LRWA 3IIKA 5TF0A 4YECA 1UEJA 2CL5A 4WVLA 3B13B 4BB6A 3ZV6A 4QULA 1U6KA 4BBJA 4B3JA 2PSHA 2VJPA 3OAAD 2XF8A 4KH0A 4C07A 4XFDA 5GZ1A 5K99A 1O89A 2O1XA 1BVHA 2FEOA 4HDSA 1CRQA 1YBMA 1W4BA 2XNSA 3F4LA 4PXSA 4WOPA 2P4UA 3TMYA 3SFVA 2GGSA 4WVFA 3ROXA 3SLKA 4BLUA 4WXHA 3QBDA 2VNSA 2ZIXA 2XUZA 4NJOA 5DGXA 4JT8A 5KWEA 3HR8A 2OXCA 1TLTA 2X8LA 3K4PA 3KKZA 3C0KA 3GWGA 5E7IA 1SQSA 4CL3A 1AA9A 1A7AA 3JR3A 4CHTA 1V95A 2NT4A 4J4TA 1J9ZA 2ODBA 1Z36A 2XRYA 3KZCA 4G0QA 3PPVA 2NXNA 4LG1A 1RM3A 1SCUA 1VP9A 1KGDA 3RHSA 5EJGA 2C29D 2VP0A 1FQWA 3CLVA 3JASA 3JW8A 4Q3DA 3DD1A 3OTOB 3RIHA 3W2HA 4X95A 3M1LA 4LJSA 3HCBA 4NJMB 2SCUA 4M53A 3WGVA 5FOXA 5C8DA 1VSBA 1QHNA 3PUXA 2BH2A 2JJ8A 1YB5A 2H9IA 3JSXA 4ZTZB 3IS3A 2A9QA 3MJDA 5C5EA 2V03A 5KZMB 2OEPA 1CK4A 1L7BA 2GK3A 1NLFA 2I4IA 1PUIA 2Y76A 1XL0A 2YZNA 3EXIA 1MZVA 2H0QA 3Q7SA 4WFJA 1RI2A 1M2VA 2A9VA 2GARA 2PT5A 3N75A 3RRYA 3JVEA 3T3PB 4CQLA 4YWHA 2C2ZA 4BN4A 5CX4A 3N2EA 1A97A 2HF7A 4FHCA 4CR6A 2WJ6A 4KIUA 2D6FA 4UHJA 2WM3A 5JAQA 4L2IA 5LLDA 1N25A 2FEKA 2QRNA 3D59A 4C0KA 4ZHQA 3D1LA 3K0AB 4GVXA 4OYYA 4BP8A 2CXOA 3W5SA 2YWRA 1E3IA 1IBSA 3NETA 4S0XA 1IDOA 3E1KA 1ADBA 3RRJA 4A8TA 2XEXA 5DXAA 4X62B 5DX8A 3VMFA 2QVCA 3VNSA 3TNDA 1NV9A 2JI6A 2P1RA 4WBSA 2BC9A 3OTQA 5CVCA 3SHWA 3DFMA 2ADFA 2PH1A 2FHPA 3DZCA 4TV9F 4QEZA 1QP0A 1VLHA 2XKKA 2EFJA 4HNSA 2IZ6A 4IDOA 3KD2A 4M0FA 4CU5A 4KDRA 5EI5A 2ZB4A 3A6PC 3ZVMA 3KT3A 2GWHA 3BL5A 4BQPA 4JL5A 4GX2A 4L5BA 1K5DA 3PRYA 4JGBA 2VZ0A 4W8OA 2IK8A 2QM8A 2Z2IA 4UTZA 4DCJA 3NANA 4YIHA 1XQVA 3ANSA 4ZQHA 5FBLB 4DZZA 1Q57A 8GPBA 1W5SA 2IELA 3B1ZA 1E63A 4PSKA 4YAOA 1IVSA 4IQFA 4XCQA 3FSJX 1D9ZA 1N9ZA 1SUAA 3SF0A 2POCA 4IJVA 2YZKA 1PR1A 2VT7A 1R7RA 5K8IA 4FSDA 4TPKA 5EPEA 5EE5B 3HN2A 1KJYA 1WDTA 3B89A 4MVYA 4KR3A 4D9CA 3PF8A 7REQB 1PT8A 1ZLYA 1F6WA 1SMKA 4Q3OA 1A5TA 5K20A 5LU9A 5FFFA 3CVXA 2JLYA 3O8QB 4ZEMA 1VLVA 2P35A 3BB1A 1PQ4A 1YS9A 5DLEA 2WJ3A 3NIDB 2YOFA 3BCHA 221PA 1QQ5A 3VZBA 4ZCRA 1E20A 2IF0A 1SWWA 4ILKA 4DJTA 4U3JB 2XYQA 3MF4A 4NULA 2A6PA 3DE2X 2DWCA 2QS9A 3QNUA 3BB3A 3V6LA 4RVOA 5CT4A 3CEHA 1NVBA 5CFPA 3S2YA 5BSGA 2JI4A 2HYDA 4HQ6A 4MW1A 3AQIA 2PCJA 4U6NA 5T57A 5LZ9A 4H15A 1OIWA 1V5FA 2R0QC 1JKXA 5KYVA 1U3CA 2GHQA 3DLAA 5HJ7A 1CHNA 3LY5A 3PV0A 5MF6A 2Q46A 2QZJA 2WHXA 4BGDA 1PJ8A 1NY5A 2I4LA 4JMPA 1I4TD 1E69A 2W6NA 3QVVA 4UZEA 3DTVA 1N75A 1Y81A 2ZRJA 5KSZA 1R4ZA 2A1UA 5HW0A 1WOMA 1YZFA 2ECPA 3E03A 4RMJA 4XSHA 3T1VA 2FZLA 3O38A 1H2EA 4RLSA 5CNJA 2FMXA 4JT4A 1UXJA 5I4BA 2C3UA 1R0XA 2JGEA 1FRFS 2UV8A 1WXDA 2FV8A 4P5EA 3KQYA 1KYYA 2E2WA 2VPPA 1I4WA 3DXYA 1PU2A 2OB2A 1AURA 5J4YA 1GN8A 2Q1XA 3O0DA 3E23A 1SPXA 3RVNA 2H29A 5KREA 3FB1A 1F2TB 1R4MA 1YZGA 1Y7TA 5D1NA 2EW1A 3OF2A 5KYXA 2ARKA 4HNQA 2FXIA 1SKAA 2E4AA 2ODQA 3GP8A 2GJKA 3UHJA 2XCOA 1OAOA 1SB9A 2RJOA 4NMMA 2J5KA 4DC1A 16PKA 3IAM1 3KALA 4PPNA 4L57A 1KZHA 2BGIA 1IOWA 4UKDA 4KITB 5JQWA 3UMMA 1HE8B 1JMYA 4GLFA 1U7XA 4GFDA 4N4AA 4BVEA 3TBKA 4PC6A 3BEOA 5KNBD 2V4UA 3FUCA 3C14C 3OM9A 3JVUA 4E07A 4JJFA 1ZZEA 2P8JA 2BCGY 1M0SA 4CM1A 3ZHOA 3BH0A 3G5UA 2WFLB 3DFUA 1QHHA 2VP2A 1UWKA 4JSTA 4O4JF 4OQEA 1JV2B 2VDJA 3OT4A 5F98A 3UJ8A 1U9YA 5ED4A 2AR7A 2JVJA 4QWMA 3FYTA 4GH5A 3JXEA 2CLDX 1N1MA 1ZUWA 4IKOA 1E79D 2G9ZA 3KSUA 5DU2A 2TMKA 3A06A 4N01A 1EZZA 1KO4A 4G09A 3QPBA 4Q37A 2VAVA 5EIOA 4WZAB 3U7QA 1EA7A 4TVKA 1VZ2A 1CE8B 4B3SB 2WIJA 1QQ7A 3D43A 2R8YA 4Q6WA 1ZKMA 4RK1A 2PRKA 1AXEA 2NZ2A 2QRKA 2B8JA 2WAMA 2O23A 3CLRC 3FPCA 4BUZA 4ETIA 2BZGA 2KYRA 5AVSA 3SS9X 1E1KA 2WLSA 1DAGA 1LC0A 2I9PA 1SIOA 2W6JA 1CB7A 2PTGA 3N5CA 2UU9B 4IF6A 4TRJA 1YVRA 2XCUA 1NE7A 2OCIA 4MA4A 3H17A 4G63A 2PM8A 5KTYA 1GFZA 4GMGA 1W35A 2BEWB 4TS1A 1ZITA 1ONOA 2JFNA 3I6QA 3RUFA 1ETUA 3GOQA 1N2OA 2P4SA 1NXQA 4YQEA 3OJ0A 4JI6B 2ZZNA 4LYEA 1JT2A 2IKQA 3B1JA 3C48A 1P60A 3PC4A 2R1VA 3QU9A 4EGSA 4HDAA 1Z5OA 2GD6A 3Q5GA 3VDMA 3WK7A 3ANLA 3GN2A 1B00A 1M1NB 1UJCA 4WAUA 3WIUA 2GEUA 4GSYA 1FTSA 2J48A 3TNYA 1XP5A 3DDHA 3IT2A 5ITSA 4KEAA 1X42A 4ER0A 1Y7PA 2AI3A 3DPUA 1R0LA 1ULZA 2CVZA 1VLLA 2EZUA 3KCNA 3O8QA 4PSDA 4XQGA 1ACJA 4QECA 1R6DA 4YRFA 1H42A 1V8BA 3SDZA 2VJKA 1DBPA 1Q1AA 3Q7PA 4IVRA 1P9NA 1NZDA 1HPLA 3QLUC 2I8AA 3F6YA 5I9MA 4D8TA 3THXA 3BXEA 3OZBA 4US2R 3ZQKA 4OHPA 4AN4A 4F46A 2MT9A 4O29A 1MZPA 1JAZA 2QVYX 4YUVA 3PPYA 2QPLA 2CF6A 1WF6A 3QSYA 4PX2A 1RHQA 2VLIA 4CWAA 1YRHA 4Z0HO 1S2LA 2OCXA 3HADA 2LPMA 5DW3A 5AHKA 2QNBA 5JMPA 2WB2A 5G4KB 1V1RB 1CEEA 1OVGA 1A88A 2FLVA 2IEGA 2GPAA 4TKMA 1NRJB 2HQOA 2ZSKA 4R1LA 2D5LA 3A4MA 5CA0A 5L9AA 3TTVA 4GKAA 3VHXB 2PZEA 4TKLA 1E6WA 3SZ3A 4DCTA 5B7QA 3ZE6A 4UDXX 2QD4A 1T2AA 2QE7A 4O3FA 4X44A 2O5EA 4QEDA 1NOKA 2QTVB 2JZOA 3WLLA 2C07A 2GTIA 1WO8A 1Z15A 3MELA 4UXIA 5K51A 1JVNA 2RGDA 1V41E 3AETA 1A9SA 2FX5A 1DDIA 5K0GA 2D4HA 2FK8A 2HEIA 4PQEA 1E3TA 1E96A 4HOYA 2WG2A 3KR2A 1MOSA 3D8SA 4Y1RA 4U02A 5C31A 4KXYA 4M0MA 1OW3B 3AFIA 4X5OA 3T3IA 3BGDA 2XKBA 4FR0A 2EZTA 1OROA 4PX9A 3A3PA 5ESXA 4W8GA 5FHRA 3IJ5A 3UW3A 5IC4A 4O6VA 1N3BA 4C4AA 4D57A 3IDSA 3BB4A 2C0CA 4Z0TA 1ZD2P 3S2UA 5JAIA 4B6FA 3ZDRA 1U9ZA 1PK8A 3QOFA 3ZCUA 3LY7A 4RK7A 3K0HA 4JENA 4YLYA 1SQGA 5FIUA 1KJIA 4TS3A 4KAXA 3UAZA 3D8NA 1MXFA 4TYQA 3VNQA 1YF3A 3WICA 1JDJA 2HI0A 1QRUA 2JLBA 2VXBA 4OUDB 2J9XB 2F1HA 2PEZA 3FIUA 1E4EB 1P7CA 2XCLA 3VR6H 2C2MA 4RD3A 2R3SA 1E4EA 2CZCA 1Q6YA 2CSUA 1NVXQ 2PL9A 4RENA 4ZOCA 2OAP1 3B1VA 1AUOA 1ONPA 3ETNA 4PX3A 4PW0A 3B9RA 1PJ3A 2AQ8A 1EK0A 3GJ6A 3HSSA 1V8FA 4OQZA 4RFLA 1O9BA 1IB6A 1H0RA 3QK7A 3RJ5A 3KXDA 5IDWA 1DADA 1PWXA 3VMMA 1CF4A 5L7TA 3EOBI 2XMSA 3UT6A 2GPJA 4ZAVA 4U6SA 1I33A 1K0FA 2W8ZA 2CV2A 1GPLA 1UT8A 1II8A 4Q5IA 1CZHA 3OPXA 2CXSA 1EPUA 3WADA 1W46A 3WZLA 3E3OA 4PZLA 2QI9C 3OA0A 4G67A 1Z9BA 4EL5A 3TLYA 2F3SA 4EJ6A 1GCGA 5L51A 1O0CA 2ZUCA 1L4YA 3ZY6A 1ZYUA 3HM9A 1W34A 2B78A 2WIAA 4E3WA 1P80A 1NMYA 9ATCA 4YQFA 1XK7A 1YFZA 4GP9A 3DHNA 1YKGA 5I7EA 4OFWA 4A6XA 2YFYA 3NJ8A 5IW8A 3RIGA 4LZWA 3ZIAA 2WAXA 5C8YF 1XHEA 2F17A 3GZJA 4E5SA 3RANA 1RJDA 5FR2A 3NV9A 3Q11A 1CEXA 1XZAA 1W2GA 2ZRFA 5IUKC 4MS4A 1UM9B 2IH2A 1M8PA 1NAIA 3WAGA 1NTRA 3OFVA 3HB9A 5EUQB 5KDLA 2RD2A 3IR5A 2F9LA 2MYTA 2BGLA 4NHOA 4NV3A 3CR7A 1YJ8A 1KY3A 3NHPA 5DW0A 1L5RA 3DAFA 3GQBB 3N3BC 2AOUA 5J4KA 1VJDA 4M87A 4DAEA 3ECCA 5U9CA 4GM4A 2LVBA 1T26A 4HN2A 4PYNA 1W73A 5TS3A 1UJBA 2AGVA 3D2CA 1FFXB 1OF1A 2QDKA 1WHTB 2WHRA 1W59A 1QIMA 2VO1A 3D0OA 5CM9C 3EEOA 1SXQA 2PZLA 4K1XA 1ORVA 5BR4A 4HH1A 3B1WA 3PJEA 2Q1YA 3NQ41 4OHUA 1OYVA 4OI2A 2X40A 3MWLA 1W49A 2I0FA 2OESA 3A10A 5TS2A 1OGYA 3AQ4A 1ZI8A 3KQUA 3UGQA 3RAPR 3RJTA 1JU9A 4UPDA 4R0MA 1CULC 2QX8A 4LVCA 3WNCA 5B6IA 4I1RA 1U3UA 2CXHA 2CLOB 3DE5X 4JXZA 2ABWA 3EXHA 3GFGA 1CJSA 1X92A 1ECGA 3Q12A 4V38A 1ISSA 1AKVA 3BGSA 4U9IS 1V8DA 3GCGA 3QHQA 4IZOA 1OX4A 4UXHA 5AQ1A 3GJRA 4G5HA 4BNFA 2W4IA 3CFYA 3NBFA 5DYWA 2XWQA 4EW3A 1KVSA 3I9OA 2BCJQ 2XUDA 6REQA 3UYLA 2GN1A 3EMDA 4OJMX 3T7JA 3GFSA 2OWEA 4FDVA 1K06A 4QQ8A 1R00A 3QKSA 1KZYC 3PP8A 4ML3A 3LW8A 4NOLA 3EXAA 1AF7A 4P3PA 1V3VA 4I4TA 3SKYA 3NRBA 1T5IA 4DLTA 1Z4QA 3P19A 3VOTA 5JATA 2M1ZA 4J07A 3ZCXA 5D1HA 4LI3X 4JXXA 2AVNA 4N48A 3SBDA 1WX1A 3KAQA 4HUQB 1CF9A 4Q24A 4KFCA 9LDTA 3COJA 2JGMA 1X0XA 1XTIA 1QWSA 1WLSA 1WF3A 2EOAA 2WKRA 4IIDA 4PLGA 3QFFA 1M1UA 3OEHA 1OFUX 1PAUA 1W6UA 1PJ4A 3A2LA 2FUG6 4CMEA 4QKQA 3KHUA 1VKNA 2X0IA 4P7KA 3HKEA 4WSOA 4DLAA 2DUUA 2CL0X 4CIYA 4E32A 3KSDO 4L02A 2O2CA 5AHWA 1VHQA 5ALIA 1ND6A 3FUVA 4N3GA 2DJIA 1BCSA 2R11A 3JQGA 3KKPA 1NQOA 4ZEXA 3PI7A 3F3YA 4YRRA 2WIBA 1QP7A 1B23P 3BORA 4RYLA 1R9MA 3OQVA 3ANTA 3CZAA 3URKA 4UNNA 3SWWA 1IXSB 2OXEA 3IAS6 3NYWA 4MAFA 3GLGA 1E3MA 1PZEA 1K68A 2NUPB 4PZEA 3MJCA 2QYHA 3CX8A 1ABFA 4Q34A 4XYEA 5D01A 2GHRA 2NYAA 4DLPA 1UKBA 3K0FB 3KE9A 1QMGA 3M6WA 1QVWA 2O05A 3MCVA 3R5KA 4YRIA 2Y8EA 3UNXA 1LBQA 4BHTA 3U4QB 4MB0A 2PPLA 2RHJA 3B6ZA 3SE0A 4I19A 1DFGA 2H57A 1X1RA 2BTEA 4JCCA 1G5IA 2Y0EA 3K2QA 2VNKA 3V1UA 4NABA 5KNCA 1XRPA 3LK7A 4IZ6A 4JHLA 3WGLA 3AUUA 2FF7A 1JHPA 1CQZA 1RLUA 4ALMA 2NW6A 4QJ5A 1O6ZA 5AJXA 1DG9A 1Y6QA 3OPVA 4J0JA 5G4KA 2MU1A 4YIKA 4P34A 4ZZ1A 1OLOA 1NMQA 2VUSA 1KL7A 3FPKA 1F06A 3A28A 3NM5A 5KAMA 4YR7A 5KU1A 5GIOE 1M2KA 2X19A 3EE6A 2G0TA 1E1YA 1KYIA 1PR9A 3FNRA 3HN6A 2QUZA 1DC3A 4BZPA 4TV9B 4W82A 3JTEA 1J5EB 2BGMA 1F3LA 1TM3E 1Q7RA 3E3LA 3LKBA 5L3ZA 3AR3A 2XNDA 4HPXB 3C16C 4IH9A 4M49A 2QV0A 4PHTA 2EBWA 3P9SA 4Z9BA 1QH1B 5GOZA 4B75A 3FMPB 1W9MA 1WW8A 2J5XA 3SNHA 4XXHA 2BMWA 1CS0B 1AUXA 2RKOA 1ZM9A 3T4PA 1GO2A 4RETA 4TT3D 4BEVA 4YCBA 2QMQA 4QARA 1SVWA 1DS6A 5IM4F 1US8A 4JVMA 4BP3A 1UWLA 1BGVA 3OIDA 1BJRE 3CW8X 1WUHS 4X1IB 3ZVLA 1ZN2A 5KVVA 2XA2A 2JCSA 3EWAA 4X45A 5BXYA 3TYXA 4YPOA 3TG8A 4AZ3A 3AGPA 1SCQA 3EYAA 3OSZA 3GCXA 1G1MA 4FSHA 4YDQA 3PC3A 3IB3A 3QA9A 4WDRA 3U16A 4FI3F 1XZMA 3DPSA 1GYPA 4EY6A 5GONF 1XD2A 2FKNA 2LDBA 1N5JA 2ORVA 1TM1E 3EGDA 4NMLA 4KWHA 4Y18A 5DTIA 4LXIA 3ONEA 3V3TA 3VBEA 3T3MB 4EEXA 5BSEA 1RXUA 4IJKA 1VXOA 1A7JA 4JNCA 4QOEA 1MABB 4M83A 4XGNA 5DNDA 4YUYA 2Z57A 4D9NA 1Z75A 1Z0AA 1ZCZA 4RVDA 1RIFA 5CA0B 1G9SA 2XNHA 3UAVA 1CVLA 1H5QA 4X7MA 1G6OA 3HRKA 4G86A 1MIOA 1JHOA 4MIYA 1QV6A 5IPFA 2OHJA 4IV5A 1SBCA 2PQ0A 3ZY5A 5AVYA 2DP4E 1WCIA 4UHKA 3K3PA 1PLJA 1HL3A 5BN5B 4Q9NA 3TEMA 3SJBA 2YXEA 1I7NA 3LUCA 2JANA 3PCTA 3DYVA 2X0EA 2CDRA 1SZDA 3CKKA 2DKFA 2ZRIA 4H3VA 4IIBA 1WB9A 1N2CE 4M76B 3RIYA 1YBVA 2INGX 3H9QA 2Q5CA 4IUYA 4JUDX 5LIRA 3THXB 4D8VA 3RC3A 1N2CA 2GFHA 3G0HA 2C4HA 2WWIA 2C84A 5EKDA 3JAWA 2IYAA 4ZIRB 3PTLA 1H1LB 2O1EA 3TM5A 2RBEA 3KAPA 3NBYC 4MW6A 5DN9A 1N7JA 3WB2A 5JAMA 3K5HA 2PRIA 1V8PA 4ND7A 5ESRA 5HP4A 4TTRA 2DLCX 3E8SA 4X93A 4RNCA 1XFAA 1ZONA 4RUKA 3JARA 4M1TA 3RROA 3Q6NA 4GBGA 4LBYA 1EFAA 4PO8A 1HFKA 2A94A 2P78A 4ZPJA 4H0CA 1L7QA 3C3JA 4S1PA 4X97A 3D3WB 4IICA 4GZLA 3KKKA 4DDWA 1CY0A 1TUBA 4U2GA 2C9YA 4QATA 1JIXA 3HEMA 2HSWA 4NFYA 1E9RA 2YHSA 3RD5A 3CR3C 4BO8A 4JI7B 4IINA 5FWYB 4R7ZA 5KYYA 4I1YA 1HF3A 3DP7A 4JYBA 5LZ4A 2HUPA 5DEOA 1TFRA 2JCVA 4JJ7A 5JEDA 1ILEA 1OWOA 1OX4B 3L6DA 5F52A 1HG0A 4P6VF 1MC5A 3OWOA 5BSHA 4MRRA 3FSGA 1GTL1 2UAGA 2X5JO 3DFZA 3LF1A 1NNUA 3A2MA 3GJQA 1FS4A 3P0FA 1M6VA 4NP6A 4V0SA 4MR9A 4WNCA 5DE3A 3H5IA 4WZBA 5KTNA 1EG7A 2Y66A 4CMHA 3N2LA 3WJ1A 1AZLA 4CM9A 1OIXA 3UG6A 4I3HA 1GGEA 5FTKA 3D8UA 2FWJA 2WAAA 4FT4A 3TQQA 2XLBA 4CR8A 3N0WA 2D06A 1MDFA 4W5JA 1J0DA 1ZD8A 2JFZA 5EIHA 5BW8A 2BI4A 2CE2X 3QXXA 3BHJA 4DM3A 1JZTA 4NG4A 2J5BA 3G9UA 5EJAA 2WSIA 3LUFA 1CR6A 2GJSA 2MSDB 4XJVA 1IHOA 3ZHQA 1RQGA 1J5PA 3L8CA 4YP6A 1O1YA 3C4QA 1F4LA 4KN8A 3ILHA 3MGKA 2Z5GA 3TW0A 4P4SA 2E6KA 4LJ5A 2NUAB 1RABA 1L9XA 1VSTA 2WWHA 3T8YA 4B3DA 1KEPA 2OHFA 3AY7A 4IOMA 5FPQA 1HFWA 4Z1MA 4RTQA 5EAIA 2JAQA 1MG0A 1ICIA 1UP6A 3LPDA 2FEMA 1Z6QA 3CVVA 1CFJA 3AF1A 2QTNA 1JPVA 2CYAA 3S5JA 3VNBA 4F2GA 1TUBB 1LRJA 1MPXA 5ALRA 3HHPA 3TZ6A 1WPGA 5HYVA 3I9V6 1UC4B 2LE0A 3Q0TA 3EIFA 4PPQA 2OHHA 1J1IA 1DI0A 2QLFA 3FKSD 2PS0A 3LL4A 4RK4A 2PUBA 3RTEA 2XIJA 2G82A 4FBLA 5EJEA 2ZJZA 1IYZA 4HDNB 1C2TA 3NDIA 2PG3A 5HKOA 1QIJA 4FBMA 1SQ5A 3KB2A 3O92A 3K9FC 4PQGA 1CUHA 4GRDA 1B1AA 3PNKA 1L5HA 1XCJA 3WQBA 1BKDR 4AY5A 1WMEA 4HBZA 4RL6A 1J0EA 2QRQA 4DARA 1SRRA 4R71A 4UTXA 4S1NA 3N2KB 1K5HA 2BW0A 1NFFA 3EWNA 2RGWA 4MV8A 4F7WA 2IGBA 1D6JA 1PUXA 2D3TA 1JDTA 5F33A 1JG6A 3PC7A 4XIJA 1FYDA 3N6VA 3U09A 5A3SA 3ZEAA 1Q92A 1UEXC 1P7PA 2B8TA 3NV7A 4YA6A 3HFJA 1GQOA 4EPYA 3DE6X 2B0JA 2FN8A 2Z09A 3QBVA 2ISQA 4QOJA 1PFQA 2ONJA 3VJLA 4PN7A 4QG3A 3TW6A 2ID7A 3NUGA 4NV1A 3TRDA 2W6ID 2G5TA 4S1OA 2GRUA 2IDMA 1KWKA 3W5BA 3MWJA 3Q15C 1ESCA 1GAWA 2XGMA 4GGOA 4L5YA 2IU6A 4LZAA 1K92A 2A92A 4YCSA 3W9BA 1PR4A 1SA0B 3CE9A 3NTVA 3RR2A 3ZCPA 4ENPA 3UHAA 5FPKA 4U7DA 5DM1A 4QYXA 1R0YA 1DT3A 3WK5A 1Y3IA 1E98A 3H1BA 4EHIA 3THWA 3PFFA 4COOA 4N0EA 3EXIB 4CW7A 1L5KA 3BRWD 3TECE 1Q0LA 3I09A 1Y3BE 1PBTA 4HRXA 4BVGA 3NWOA 5A02A 2N1MA 4BAZA 2J5RA 4J2TA 4PXYA 2H4WA 3WO1A 2XHEA 4QYIB 1GGKA 3C3DA 3I5XA 2SCUB 2VKTA 4AY6A 2HW8A 1JP7A 2ZREA 4IWXA 1RJFA 3AVWA 4YCLA 2FMTA 4FGZA 3PGJA 4ENSA 2OYCA 4LV5B 3RHZA 1YZVA 4XCVA 3U7QB 3C8MA 3GP5A 1EESA 2ZS8A 4MRNA 3V6MA 4UTOA 4DMRA 1QYIA 2UZAA 3W7AA 4ZYXA 4MRMB 3NVKI 1CRLA 2I34A 3F5FA 1BVUA 3R5TA 1ZG3A 2ZUBA 3OHMA 2WSYB 2MCFA 4OKIA 4BL5A 1ODSA 3TUJC 3S1SA 1QGDA 1E9SA 1VLZA 3MMSA 4ECEA 1Z6ZA 4HDOB 1Z4NA 3L1VA 2VUUA 4JLKA 4EUFA 9GPBA 4JBLA 3GLFB 5BN5A 2HCJB 3CUWA 3AESA 2IKSA 2O6LA 2ZYGA 4ZTUB 5C8XA 4BAUA 3UJAA 3QEMB 4BFWA 1KFCB 4XDHA 1CR2A 1KXJA 3D8BA 3NALA 4FYVA 2V59A 3GMTA 1QVZA 5DLQC 5G3YA 3UPUA 4F4HA 1A9PA 5JHHB 1KI3A 3PR2B 4KR0A 5CFQA 4NU6A 4H17A 1VBKA 1I94B 2WWFA 1YMQA 1R8SA 3GGCA 1TZ2A 5A3JA 5KTKA 1DXQA 3SXPA 2Z2XA 2B2CA 1GUBA 4R1PA 3N8DA 3C5HA 4I5IA 3PWZA 4EHHA 3RVQA 4C30A 2QD2A 4OH1A 1T8SA 1KEKA 4NJEB 1TA0A 1M0WA 3F6RA 3CLTC 2REOA 3R6WA 5L3SB 1KDZA 3BIWA 1XU7A 4HEHA 4QBKA 5JMTA 4RXTA 3SM9A 2GNAA 3HABA 4RMHA 2PUEA 4ZDKA 1S01A 1L4EA 5CDFE 1H5NA 2Q21A 3A1CA 5EIXA 4RVCA 4KMMA 5DTQA 1ZOPA 5WRFA 1DRVA 4ZT6A 2JVIA 3HSKA 4BEJA 4EKEA 4YR9A 1ZCFA 1XTSA 3DW3X 1JSCA 4QUBA 2PKXA 1PSZA 3OZTA 1L5LA 1A2OA 2AQHA 1P4HA 2GM5A 2B0CA 3MBIA 4KMRA 5HIIA 2YJ5A 3C5EA 3F97A 3PYMA 1ZJYA 1MH9A 2CLKB 3U7GA 2GETA 3HJCA 3GDWA 3JRWA 1DIOB 3IT0A 1XD9A 3VYTB 4AMVA 5MFPA 2DFPA 1JDBB 1R18A 1JHXA 3QU7A 1IWOA 2UUPA 1N57A 1U11A 3VR3A 5JSZB 4MARA 1HXHA 1QIEA 1PR6A 4UUAA 8OHMA 3P7MA 4OMCA 1QUFA 2YMLA 2XODA 4G0XA 1I7SB 3HEAA 4OD0A 1CS0A 4UNPA 2GN9A 1OBCA 1NA5A 1BO6A 1KKMA 2HWWA 2V45A 3CH4B 3G5TA 1PIWA 4ND6A 3L4KA 3BE6A 3P9RA 9ABPA 1UR5A 3LM8A 4U7PB 3R40A 5JLAA 3FDJA 3PUWA 2WOOA 3W4KA 1XXHB 4M37A 4CG0A 1JPNA 4FGSA 3EG9A 1IM2A 4KNYA 1XMVA 2V7EA 3EQ2A 1K8XB 3UQZA 3TQTA 4LOLA 4GG1A 4ESEA 5FORA 1L1RA 4G5SA 5J2TF 2DJ5A 3DFFA 1Z6TA 5SY4A 1SUIA 3HN7A 4YT5A 5AKHA 3BCSA 2IPXA 4NPAA 2G9VA 1O6CA 2OSBA 2YWFA 1S7CA 4YP0A 5DIFA 7ADHA 4FXPA 4CQMD 5TPZD 3I2FA 1O4WA 5T67A 3OX1A 3LZDA 4V0RA 1COWA 4QT0A 3MCUA 1Y9AA 1A2BA 1XJQA 4MKXA 2PV7A 3FNQA 2PY6A 1IWPB 1WJGA 1E1LA 2XUFA 5KX5B 2PUFA 4BRWA 3FI9A 2EERA 2R6FA 4NFHA 1E3DA 2B1JA 2G83A 6ABPA 4EQZA 3AVXA 2YV2A 2ZWMA 1GZVA 2D0OB 1FRVA 3U48A 5I9IA 1IEVA 3H42B 4H77A 4KQMA 1PVVA 3QITA 4YBRA 2MSKA 3H83A 4XPIB 1NKVA 1SIBE 5LCXA 4WJLA 3N86A 1T4GA 3KX2A 2KJQA 3X1KA 5HKAA 3HCWA 1AK1A 1OZHA 2VJCA 3UUGA 1X13A 1XLVA 1LFAA 3OPQA 5JAZA 1JEYA 2AZXA 2ST1A 1YHNA 5IBPA 1BE0A 5U1PA 1R0RE 2BFEB 2ZM5A 2AEFA 4HSEA 1VKZA 4D8WA 1BYIA 3KO8A 4HDKB 1II0A 5TT1A 4KPUB 2CVHA 1Z17A 1SCKA 3LBYA 4CLDA 3KJFA 2BTOA 1M6EX 4JBWA 5JT1A 1W85B 1RI3A 4Q7EA 1E0DA 2OXRA 1KO8A 3A4LA 5CDHA 1X0VA 2WSLA 1ZK4A 4O4JB 1NT2A 2IYLD 4H1WA 4JEUA 1YA8A 1XKLA 3PDJA 4KQCA 1CKEA 1NM5C 3VR4D 4BNKA 1WD7A 2A9RA 1FNSA 2PMCA 3K31A 3KWLA 4BKPA 4OLBA 4I1UA 4KBYA 1GPAA 1M72A 3FR7A 3DUFA 4NEQA 4D43A 1Z38A 4NONA 2XVXA 1KO5A 2P2CA 4BQFA 3U19A 4EB6B 2WTBA 4BLPA 2I1WA 5GINE 3UXEA 5BYBA 5EZYA 1C7QA 2EJTA 5GMOA 3FLEA 2DFTA 2VHQA 2BTQB 2DECA 2R00C 2ZS9A 3GCZA 3QWHA 4E5PA 5IF9A 5JD4A 4QOSA 4GC9A 4PWYA 2PMEA 2F64A 1X39A 3FVRA 3M5PA 4DRZA 1UJ4A