1NF3A

Structure of cdc42 in a complex with the gtpase-binding domain of the cell polarity protein, par6
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
194
structure length
194
Chain Sequence
b'GAMGIQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGLEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G25K GTP-binding protein, placental isoform
molecule tags Signaling protein
source organism Homo sapiens
publication title Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6
pubmed doi rcsb
total genus 66
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1nf3A00
4TT3A 3U3KA 3DOFA 3QXXA 3QVVA 1W4AA 4M9QA 1S1CA 1Z83A 3ONWA 3TUZC 1FQJA 3AB3A 4PQFA 4R9UC 1DBSA 2C04A 1HE8B 3TIFA 2XNDD 1UM8A 2IEZA 1SKQA 1YQTA 1VDZA 1TU4A 3V4RA 1WA5A 2XSZD 4NCIA 2Q9CA 4ZDJA 3CF0A 5FL7A 2NO0A 3BBPA 1XTSA 2NQ2C 2P2LA 1G4UR 3U44B 4YQFA 1GKUB 4PO1A 4B2IA 3SC3A 1E32A 3QPVA 3SYKA 2BM0A 4N3NA 3MG9A 2AKYA 2ATVA 1VG8A 2D06A 1E2LA 4FW9A 4HAVA 3C15C 3GJ0A 3ZZTA 4AYXA 4BLOA 3DDCA 4V03A 1VYTA 3CKLA 4ZIRB 2AFHE 2ZVQX 4YC7A 3ZD6A 1KK3A 3AVXA 2J0UB 2IYWA 2QAGA 4I1VA 3CBQA 2OBNA 4HAWA 2IYYA 2QENA 4B3BA 2D4HA 2ZRNA 1II8A 5GJCA 4KHZA 4A4DA 4C9BA 5JRZA 4MKHA 2ZSAA 3QG1A 1N6PA 4TQ9A 1NY5A 3DKVA 5EUQB 1ZNZA 2HT6A 1QHIA 1WMSA 3UK6A 4IXNA 1OFHA 2J0VA 1F48A 3WYFA 5E7JA 3GLHB 3ZD7A 1E2DA 1KO7A 1JR6A 5J4YA 5IK2D 1G3IA 3MUFA 2JLWA 4KV9A 2EFHB 4LYFA 2ODBA 1NMXA 1UF9A 4V0ME 1SVLA 1KMHA 5KPDA 4HB3A 3FYHA 4G3XA 3I5YA 3X2SA 5UKDA 2ZS9A 2HF9A 3F0TA 2GXSA 1XZQA 1M7BA 2IK8A 5CJ2A 1ZW6A 4DLWA 1E9BA 1HV8A 2EYUA 3H84A 4QBFA 2DFKB 4DSOA 4DT1A 3RRMA 3HU1A 3VFDA 5JCPA 4BZQA 2WIBA 3GQBA 4TL9A 2I1QA 5C18A 2KSQA 1J8MF 1W5TA 3GLHA 2IYTA 4NCJA 1WQ1R 3IQXA 4B6FA 1UKYA 3H86A 4OQXA 1W44A 4FN5A 1N6NA 1Z2AA 3IEUA 3MGCA 2O8EB 2P65A 1JPNA 1PLLA 3OAAA 4PZLA 1GRNA 1GITA 2XJ9A 4JL6A 5DI3B 4RFSA 2JASA 2JJ2A 2CLCX 4LJ9A 4R98A 3GPLA 4PO8A 2RH5A 5EUMA 3W6PA 1U8AA 3BAFA 1CU1A 1KSGA 4FIDA 1GL7A 3K70D 5EZ6B 4LSGA 3PENA 2VSXA 4MRRA 1RRFA 1DE0A 1JQJC 3RRZA 4URZR 5JSZB 1YHNA 5C1BA 1VCNA 2OFXA 4M1WA 1MO5A 1GUAA 2PBRA 5G40A 1G9XA 2ZRMA 1GL9B 4V0MA 4C2UA 1XPUA 1ZM9A 3DPUA 4PO9A 1EWQA 4M8NE 4LJ5A 2HLDA 2JLQA 2VBCA 5IF9A 4MYCA 5CYOA 5CJPA 2REXB 1ZRHA 4DSTA 1WB9A 2IYRA 4QNMA 2REBA 1OXVA 5EE1A 3RS2A 2FG5A 1E0AA 4O2RA 2GNOA 3BERA 1BH2A 2PEZA 1NBME 5JMTA 1KHTA 3PITA 1OH7A 2QA5A 1EESA 1AKEA 1TQ6A 3OIWA 2FN4A 3NVAA 4HAXA 2C03A 3RS3A 1CXZA 4TL6A 3OE7A 3U3OA 4C0QC 4NTZA 4ZDWA 4CEJB 3I1FA 4QHTA 3CW2A 1G7RA 4PC3A 3I32A 2FSIA 4RSGA 4DIDA 1IN5A 4B47A 4UNRA 4B43A 4GP7A 3TSOA 4B3DA 3EX7C 1ZD8A 1NJGA 2V8OA 2YOGA 1RZ3A 1SKYB 1SZPA 2I4IA 1W36B 4WZAE 1E2PA 4F7WA 2DWOA 5EE3A 4OJQA 3SS8A 1JJVA 2FF7A 4HLDA 3CF2A 2J45A 3BFVA 1GNRA 4AC9A 1G19A 3RS4A 1EK0A 1ZCBA 1M7GA 2QROA 2ZUBA 2J7PA 2WAXA 3H2YA 4G01B 4OQLA 1DTSA 3GJ4A 1D6JA 1QHNA 3HWSA 5JBQA 2KB0A 1VYUA 1G8GA 2ZRDA 4KFUA 4MITA 4TMWA 5SZKB 3GLIA 1KDTA 1OXXK 4LY6A 4DDWA 4JSTA 2W6JA 4DEXA 3I5XA 2ECKA 4OHZA 4DLYA 3BWDD 1ZM4A 1CP2A 1DAHA 2GWHA 2ZE8A 3BH0A 3FMIA 2VP6A 2A5JA 1ZD1A 3LO5A 1N0VC 2J3EA 3KJHA 2DFTA 3AVQA 1MABB 1D9ZA 2J1LA 3DVLA 4BRWA 1KI2A 2Z83A 3KTAA 3QBVA 2G3YA 1IJFA 2E9SA 3AP3A 4BFVA 5KDOA 3U6KA 3K0SA 5A0FA 1TEVA 4HUQB 2ZS8A 2WMOB 4GBMA 2GF9A 4WZ6A 3BH6A 4Q1EA 4NMMA 4HLCA 4XTRA 4AKIA 4AYWA 1R5NA 1U2RA 2B8WA 2YVUA 1N5JA 1UDWA 4A0RA 1B23P 3ADCA 5FR2A 2W6IA 5LDDC 5G41A 2J87A 3RWOA 1JXOA 5AJWA 1XU4A 2MMGA 2JJ8A 3OZXA 3SFZA 1KJZA 2X8AA 3WMGA 4A6PA 1XD2B 4BZXA 1PUIA 3OEEA 1JXMA 4W5HA 5LPNA 5M04A 2CCJA 4CEHA 2C2HA 2QY9A 4JKYA 5TARA 4GMDA 5CM9C 2BKEA 4B3GA 1UKZA 1ZAKA 1IN4A 4V0NA 3X1WA 2BMEA 1HY3A 3KQUA 2XNDA 1NY6A 1T3HA 2JJ2D 4LYAA 2OT3B 2GDJA 3LW8A 4G0NA 3ICQB 4KFSA 4KSCA 1TTTA 2A9KA 1J99A 2AX4A 3EAQA 2N42A 3VU9A 3T1TA 5AJZA 1Q1ZA 1ZIOA 1TU3A 1F2UB 4I99A 3KQLA 1ZIPA 4G5SA 2WSSD 3EIEA 4JLKA 3FE2A 4Y0VA 1F2TA 2HXSA 4PSAA 1ESNA 2P0EA 3NKVA 1MO4A 1JEEA 3EC2A 4DWJA 1N6LA 3RYTC 3AVOA 1FNNA 4JVMA 4NYJR 1UJ2A 2GTPA 3IQWA 1WRBA 4DCVA 1N5IA 2OO7A 2FZ4A 1DAEA 3SN6A 2A5GA 3UATA 3QSYA 3K09C 3DOEA 4TYNA 3HJNA 2QSZA 2F7SA 2EFGA 4A2QA 2ZJZA 1AM4D 2LKDA 4PPQA 2FMXA 1T5IA 1XEXA 3BB4A 2FZLA 3LQQA 3PG5A 3QXSA 1WE2A 5JZVA 4QBIA 2ZRCA 3L0PA 4BGDA 1NLFA 3DEFA 3T12A 1NLYA 3NDBB 3GEIA 2ANCA 2X1VA 2QTVB 2ZAOA 1W48A 2YYZA 3I73A 1Q0UA 3QXCA 1E2FA 3K9NA 1IN8A 3MMPA 4TL7A 3GJXC 4KI0A 2TMKA 4Q00A 2R6DA 2JIZD 1GG2A 1NSTA 3JVVA 2GCOA 4RD3A 1GKIA 4FINA 2ZRPA 4U5XA 3P27A 3RC8A 3WYGA 2KBFA 3SOPA 2F55A 4TLEA 2CBZA 4JVLA 5JJIA 4D4MA 3GLIB 2ZR0A 1KI1A 5A5GA 3VTKA 2VRWA 4F92B 1OXUA 3B5JA 2XOKA 1FUUA 4YMSA 3L2OB 3A1TA 4UJ3A 2WPDA 2JCSA 3KXIA 5FUYA 3I92A 4PC1A 1AKYA 1G8YA 4AG5A 2B7BA 2WV9A 4MGZR 1A4RA 2BJWA 1KK0A 1DPFA 1J70A 2ONKA 4Q47A 4AURA 1M7HA 3BE4A 2C78A 3BOSA 5EXPA 1S4QA 4QRHA 3RS5A 5GJWC 4HSEA 4ACAA 4KVAA 2ZITA 1E6CA 4QHSA 1YZTA 2WWIA 3SJAA 4TN1A 2OEPA 1W1WA 2F43A 4AYTA 4FMDF 1E79A 4LHZA 4PX9A 4A8JC 5L3VA 4RCYA 2ZI3A 1P62B 2F6RA 1Z0AA 4NPHA 1DG1G 1PJRA 2ZEJA 3KKOA 2HLDD 2WHXA 3QI2A 2L0XA 2PJZA 1XD9A 5DN6A 2B92A 1A2KC 121PA 3LD9A 4D80A 4QGGA 5CLQA 3LBIA 1ODFA 4RD4A 3ZQJA 1H8HA 3VR1A 4IW3B 1KO8A 2IF2A 1RW4A 2BWJA 4N0EA 4Q7KA 3UMFA 1Z07A 2BM1A 4GI7A 3K09A 3L8ZA 3B1YA 3B1WA 3TUJC 3PVSA 3PIRA 4B76A 4AWXA 5JI2E 3GLGB 3QF7A 1KY2A 4NU0A 4TTRA 1GVNB 2K5UA 4CZ2A 1GKYA 3OAAD 4RCZA 3P32A 4YMWA 1FMLA 2G9NA 5C4MA 3M0EA 4A8JB 3T06B 1VG9B 2DBYA 2V4ZA 2CHGA 1OIVA 2YWHA 3NBYC 1TUIA 1OHHD 2J59A 3CPJB 4LCBA 1W5SA 2O8EA 2EFEB 3PV0A 4X8HA 5FTNA 4JVSB 1PLKA 4DBLC 4IKEA 1CRPA 3GLFB 1EGAA 3SJCA 2N46A 3W5JA 1W7AA 4ON9A 3ZS8A 1ZP6A 2VA8A 5BYKA 4OHWA 2RGGA 2VPPA 4GZLA 4IEIA 4IOLA 1G17A 5F9FA 5TV2A 1TNDA 2AN9A 3TQFA 1G16A 4LHYA 2CVFA 2GESA 3WNDA 2QI9C 5JEDA 4TMKA 5HE8A 1DG3A 3HR7A 3ZDQA 2BCJQ 1RJ9B 1UKEA 1E0JA 2ZRHA 3GFPA 4XWAA 5AUPB 5EE0A 2GEVA 4KFRA 4AG6A 5FUVA 3KB2A 1W0JD 2GILA 2VLIA 3C7KA 4P4UA 1KMHB 2VP4A 4Q1FA 2GBLC 3KX2A 3RLFA 3W8NA 1XXHA 2CLDX 2LWIA 3JZMA 4US0R 4JL5A 5EE5B 4P3YA 1BS1A 5F2EA 5SZIA 3THYB 3WRYC 1GAJA 1XEWX 3I62A 3U3MA 2XX3A 4UNPA 4BLPA 4M1KA 1OB2A 1XXHB 4PAMA 3WMFA 1E1QD 1Z2CA 1CR2A 1G4AE 1MRNA 1IBRA 4L4UA 2QM7A 4JL8A 3FDIA 1Y3AA 3Q5DA 5CDFE 1JNYA 4LJ6A 3AVVA 2W6JD 4B48A 2FFHA 2WKQA 1R5OA 1AS2A 3DL0A 3SQWA 2ZI9A 4TT3D 1KY3A 3QKRA 4LYJA 4YONB 4IDOA 2Q3HA 2ZI4A 4RKFA 4TWZA 3SQXA 2C8VA 2JLZA 3CRRA 2GCPA 4ESVA 5FBWB 2ZAMA 4I1UA 3T5GA 3PUYA 3GLFA 3TSZA 4OK5A 5KTYA 1F5NA 4D4KA 4I4LA 3UKDA 3NXSA 5FPHA 2MMCA 1KJWA 2FPMA 4DDTA 3TR5A 1XTRA 4P32A 2QE7D 4HYYA 1OW3B 3GFOA 4I1OA 1XBTA 5FI0B 4HZUA 4B33A 4RY2A 2O8DA 3UPUA 5KU1A 3RABA 3MSXA 2NOAA 2WSMA 4IHQA 3R7WA 3EXAA 4ARZB 5F9HA 3LNCA 4ESHA 2OILA 1DELA 2ODEA 4DC9A 4HAZA 5IHPA 4LV5B 4CIDA 3B1ZA 1MR3F 2PMDA 3AUYA 3THXA 4QL3A 4AIIA 2YC2C 1E69A 4AKEA 3UANA 1QZXA 2RGNC 1LS6A 1FQKA 3AF1A 1YR6A 2EQBA 1KIMA 1RVDA 2JEOA 2QUZA 4LHXA 4D0GA 4M2LA 2W0MA 3QPUA 1RC8A 4L5BA 3TMKA 2O8DB 4HZUB 3CO5A 4WVFA 1KNQA 2PL3A 3H4MA 1EXMA 1MRSA 4EJSC 1GRQA 5JFGA 4XD7D 1M2OB 2B21A 2PX3A 4PTLA 2ZS7A 5C46F 2IA5A 1XJCA 3RRNA 2WJVA 4PHGA 2WWYA 2VP5A 3WHKA 1VCOA 1FUKA 4Q1CA 5TVKA 5CIWA 4DUGD 4C3ZA 3U7EB 1VECA 2AWNA 2R6AA 2C95A 2XZPA 4MRSA 2BC9A 2ZPTX 1OKKA 3K9HA 2Q3MA 4LUCA 4LJAA 3CLVA 4O0MA 1GDDA 4RFVA 3WBKA 5P21A 4P4SB 5KYKA 1G20E 2KBEA 2JDID 3VX4A 1R5BA 4PZZA 1QF9A 3CZPA 3QIAA 5FH9A 5LD2C 4C7OA 2FFAA 1UBCA 2AWOA 4Q01A 5IDVA 4NHOA 3THYA 3ECCA 2CXXA 3ZVRA 2EW1A 1JR3A 5G3ZA 1VTKA 1FTSA 2RGEA 3D8BA 3VR2A 3AF0A 4S35A 2HT1A 4M1TA 5EP2A 4DCTA 1Z22A 4KAXA 1E9SA 2H5EA 5DE3A 5FTJA 1CR1A 2CL7X 1KMQA 8OHMA 4MKIA 4Q03A 2IS2A 4L8GA 3BS4A 3AKEA 1VMAA 1LY1A 3NC1C 1WP9A 2QGNA 4Q9HA 2ZYUX 1U8YA 3WNCA 5JS7A 4UKDA 3BC1A 3OFNA 4Z8YA 2HYIC 4KSBA 3UXMA 5HTKA 5B64A 2JJ1D 1X3SA 4OL0A 4QGAA 1DS6A 5DH9A 2WWHA 4EAQA 3OESA 3PUXA 1ZUHA 2ZETA 2PT7A 4AI6A 1ZU4A 3VAAA 1YZUA 4LI0A 3NH9A 4KYIB 1Z06A 1XZPA 1ZINA 2Z6VA 3TRFA 3ETLA 1E96A 1LS1A 2EWWA 4HDOB 4WXRA 2WJIA 3KXKA 5FBLB 3WRXC 1E94E 3FKQA 2QGZA 4AY2A 2IS4A 5BN3A 4XVRA 4GPTA 5KDDA 1P60A 1QG4A 3TSWA 1IHUA 4JLAA 4D6PA 2ERYA 4AKGA 1DOAA 1I2DA 1FOEB 2V6JA 1Q1EA 1XMSA 3IPXA 3KXLA 3TW4A 3VU9B 4CW7A 2ZSBA 3FMPB 3RC3A 2XSZA 1Q3HA 2WWWA 2ZJAA 1T3LA 4D4JA 4TZ6A 3PJRA 1US8B 1GL6A 3R9IA 1DEKA 3TAHA 1OH8A 1R0WA 1OT3A 2D74A 1K5GA 1W0JA 3R8CA 3TQCA 3FMOB 3F8TA 1GOTA 1ZNYA 3THWA 4IVQA 1IM2A 2F3RA 3U3JA 4JLNA 3AP1A 1LFDB 3LLUA 2FFQA 5JEEA 2V6IA 3K0AA 1S9HA 2O5VA 4GL2A 3FHTA 3FWYA 4Y0AA 2P6UA 4LBYA 3LX5A 1XJ0A 4CYMA 4BECA 5KNBA 3GCGA 1GTVA 3FGNA 2NIPA 2OCPA 2VHCA 5AUNB 5ELXA 5F98A 1K8RA 1W4BA 2ZI7A 4URVR 3CRVA 1LV7A 3RANA 1KAOA 3NTUA 4EPYA 4Z51A 2O8BB 5KSZA 1JALA 1KSHA 1AQYA 1NVVR 2F1JA 4Q1BA 1P2SA 1AGPA 5FL3A 3TH5A 1SXJA 4IOMA 3X1ZA 2V9PA 3I72A 3G5UA 1ZC4A 2RAPA 4G5GA 2A5DA 2ZRIA 2GJSA 1W47A 4Q19A 2QPTA 4PHFA 4URWR 3MJHA 4MUBA 4IVRA 3DO6A 3ZZ0A 4JLPA 4KCGA 3GEEA 3RVBA 2OBMA 3FFAA 5SZJA 2R9VA 2JDIA 5JS8A 3GJ5A 1L2TA 4LV8B 3I3SR 1HA3A 1ONBA 3D31A 2IWHA 1S96A 1VHTA 1N5KA 3QKSB 2DB3A 2B6HA 2AK3A 4OI2A 2QQ0A 1NVUQ 1E2JA 1IY0A 3EPJA 3NG1A 5H68A 2W58A 2ZRBA 1P2UA 1QHHB 1FZQA 1XTQA 3L8YA 4ERNA 3IO5A 1KI6A 2J7KA 1N25A 1XMIA 2J41A 2XTNA 4DLZA 2R6GA 1QBKC 3CWZA 2HXYA 4FWTA 3AKDA 4PQRA 4NCNA 3HU3A 3OIVA 3C41J 3K0AB 1XJQA 2QBYB 2V1XA 5DGXA 4DCSA 2ZVPX 3B85A 3THWB 3B9QA 3WHLA 3ZS9A 1KI8A 4RZXA 3OIUA 4YMVA 1MOZA 3GP8A 1TQ4A 4HZIA 3ZJYA 4Z1MD 4JYCA 1G8HA 2HJGA 1C1YA 2PZEA 5AJXA 1MKYA 5FTLA 3VKHA 3EG5A 3CH5A 3B8HA 3MWJA 4QXAA 2QQEA 4RZ2A 4A92A 4R2HA 4BQSA 2IW3A 1E1RD 3ND9A 2ZJ5A 4KLNA 4PC2A 1OXSC 3B1XA 1CEEA 3HP1A 1J8YF 4TMVA 2VTKA 1KOFA 2E87A 1PUJA 4BPBA 3L0OA 2BMFA 3WNBA 5FTKA 4MRNA 3THXB 4W7SA 3VMFA 2OCAA 3KB1A 2AK2A 5CB6A 2QP4A 1D2EA 4QOSA 1YZLA 5E95A 1W36C 1XCMA 1E9FA 3BB3A 2BBWA 2ZJOA 1AS3A 2A5YB 3R7WB 4ZPXA 1E4VA 2G88A 3LXRA 4JJZA 1XB2A 3ND8A 4TMZA 4NP6A 2OUKA 4ZI3A 3ZH9B 1R0XA 4YMUA 1G8FA 2ZYVX 4OHVA 1Q1QA 1U99A 2FEMA 1AZTA 1P5ZB 1RE0A 3F3YA 1E2MA 1OFTA 3W8RA 2ASEA 2IF0A 2G0NA 2RGNA 2QAJA 1KO4A 2C9CA 1G21E 2IXFA 3OHMA 4DLSA 1DARA 2VF7A 3TNFA 4F38A 4OJKA 3GLHE 4OBEA 1L8QA 5TXGA 3AF4A 3E70C 1XD8A 4IVPA 3P4XA 2AXPA 3CNOA 4RVCA 2CNWD 2JA1A 1RRPA 3IIKA 2ZRKA 1AN0A 1SHKA 5KSPA 4P4SA 4C0SA 5FR1A 2ZR7A 2OCYC 5KSOA 1NN1A 3V00A 4LHVA 2JATA 5BW8A 5FOWA 1KJYA 3TVTA 5DN6D 4Q7MB 1RPZA 1TF7A 5BWMA 5DHFA 1HQCA 1NP6A 3IKJA 3OEHD 3KZ1E 1P9WA 2QAGB 4N0DA 4F4JA 3AUXA 4EDHA 3C16C 1ZNWA 1P3JA 2CMKA 4PSKA 5KUTA 4MRPA 3SJZA 3I61A 2N1BA 5B30A 1N5LA 5E3HA 4ZCIA 5GVRA 2RGDA 1JBKA 1EWRA 2A5FA 4NE2A 5DSZA 1VG1A 4OQNA 3AVTA 3VKGA 1XP8A 1E9AA 4LK2A 2VIIA 1DAMA 1COWD 4BFZA 5DNYB 4ITRC 3R9WA 4Q4JB 1JAIA 1OYYA 1P9RA 4MDFA 4NYIQ 1YRBA 1F6BA 2JJ1A 3SI7A 1R7RA 1Z6AA 2FPLA 5K8UA 4M9XA 3TK1A 1W36D 1XEWY 1Z6YA 5FBRB 3A36A 2ODWA 3MWYW 2XXAB 1JPJA 3EWAA 1ZCAA 4IDPA 4UQOA 3DHWC 3WY9A 4OI0A 4QNRA 1L4YA 4K46A 3BFKA 2RGCA 5TB5A 3TGPA 4C0HA 3J81k 1G7SA 4U02A 4HLQB 2OZEA 2GJ8A 5L3RA 4XVQA 4ASUD 1IXZA 2JAQA 1GILA 2QMHA 4KBFA 4C0JA 4UNQA 1H65A 5G3YA 1NF3A 1FNMA 4A2PA 3K70C 1CBUA 1OLOA 3Q85A 1MH1A 2PCJA 4EPTA 5H8WA 3GJ8A 4XWKA 2ZANA 2NTYC 3MD0A 1ZU5A 4B34A 4ZI2A 1G3UA 2BEJA 4RJLA 1ESMA 2QTHA 4E5UA 3C14C 3VR5A 1D2NA 2J5XA 3Q72A 2BMDA 3A8TA 4XTCS 3EARA 4CVNA 1OIWA 1PVOA 3P26A 4JMPA 4JKIA 2IYXA 4Q9JA 5E7MA 1D2MA 1KKLA 3NEJA 4PSVA 1XMJA 2H7VA 5HCNA 1SULA 2YNMA 2QE7A 4K81B 3UIEA 2QORA 3UMRA 821PA 1NJFA 2NO7A 4A0HA 1ZD9A 1BYIA 3CRQA 2O0JA 1M6NA 4D25A 3B9PA 5EXXA 3B60A 2PEYA 6Q21A 1AGRA 3VHLB 1QHHA 4FD2A 1BIFA 4ZO4A 4C4PA 1ZNXA 2KI5A 3X1DA 5JCZA 2JGNA 5BXQC 2GEDA 1Q57A 2V55B 1WCV1 4MYUA 3T35A 2ZQ5A 2W6ID 3O47A 621PA 2IXEA 1H8EA 3GLGE 3DZDA 4IDHA 2CHVA 2J9RA 2R65A 4Q21A 2KJQA 3QE0A 4RZUA 4IJMA 2EVWX 4TYQA 4TSFD 4M0LA 1E2HA 1TPZA 4DUGA 5CK4A 2GCNA 1II8B 3K0CA 4V0KA 1P2TA 1P4SA 1Z8FA 2AKAB 4DLVA 1MO6A 5FOUA 4D26A 1D8TA 1G6OA 1Z29A 1IN6A 1J90A 2MSEB 1CTQA 2IEYA 3OEED 4A2WA 3GEHA 1XRJA 4FCWA 2C77A 4J0QA 3TVDA 1YR8A 2YZ2A 2ZUDA 2QZ4A 2CCGA 2QP3A 1XDBA 3B78A 4C0LA 2RHDA 4O3MA 2O8CB 3QY0A 4Q4LA 4TQUS 5FI1B 2ZSEA 5EXTA 1TQDA 4FWIB 5B2ZA 2BHRA 4HDCA 721PA 4HAUA 2GBLA 3FHOA 5KNCA 2O8BA 1Z0JA 1XEXB 3Q3JB 5BYJA 2BIFA 4MKFA 4F4IA 4TYWA 1Z28A 1WDTA 4KFTA 4I1SA 4ZDKA 1CJUC 1XMVA 3MLEA 3L0SA 1TL7C 4POAA 1AIPA 4A0FA 4AKHA 2FWRA 2WSSA 4FI3C 4E03A 5B57C 3CR8A 1OH6A 4ABYA 3AH8A 1Z0DA 1NN3A 4HLUC 4OHXA 1Z47A 3D6TB 5FPTA 2QP9X 2VHQA 4LBZA 3RS7A 4P4TA 2YINC 1JECA 2YWEA 4JLJA 3W34A 1HUQA 2R62A 3QXHA 1IY1A 1OSNA 3B1VA 3R8FA 1D9XA 4PC6A 3Q5EA 1AJEA 1KO5A 2DY1A 2WOJA 2WVJA 1X8LA 2HCBA 4LV6A 1OIXA 4WAUA 1QVRA 4M1YA 2F1IA 1S3SA 1HE1C 4F4CA 3REFA 3EWSA 1IY2A 3ZQ6A 1MO3A 4UXHA 2EFDB 3EC1A 3B7GA 2LKCA 4BWYA 5KHOC 4QM6A 1B0UA 4DHEA 3IHWA 1GIAA 3E5HA 2XGJA 4HATA 1Z0FA 1KK1A 2GRJA 3BGWA 1SXJC 2WICA 3AF2A 4S2EA 1YZKA 3NIBA 2JLUA 3IUYA 5GJBA 1T3SA 2NMVA 1R8QA 2ZM5A 4BASA 1E3MA 1XD2A 5FOTA 2FH5B 2V54A 4QHYA 5EP3A 4DSUA 3VQTA 1ZM3A 5FFMA 3TJZA 1KI6B 1EFHA 1N6RA 2D7DA 2GZAA 2GXQA 4TSFA 2BBSA 3CNLA 4HLUA 2SHKA 1YZGA 1CRQA 2YV5A 3QBTA 3CRW1 4URUR 1II0A 2GCOB 3BXZA 1ELOA 1VIYA 1XXHE 4DKXA 1JEDA 3WXMA 3CX6A 4DCNA 4D81A 1XWIA 4OKSA 4JLVA 4P0TA 2PH1A 3ZYCA 5L3SB 2XITA 4HUTA 1G7CA 5JJLA 1MABA 2IL1A 5LB2A 4LWZA 1O3YA 2GAAA 1V5WA 3HYTA 2VSOA 2O8FA 2IHYA 2O52A 3SHFA 1AZSC 1W49A 3ADKA 2ZI5A 3TW8B 3OF5A 3D7MA 5HR5A 5HPYB 2QPOA 5SZHB 1PLJA 4BEBA 2D2EA 1UAAA 3ADBA 5JHHB 1IN7A 1M1YE 1CLUA 2BBTA 2EU8A 3QNUA 4QJ5A 4O2LA 4DLRA 5AUOB 1PV4A 3QEOA 1VHLA 4GOKA 1BOFA 4B3XA 3CNNA 4TZ0A 2QAGC 2QU8A 2ZJ8A 2ZRAA 4Q1DA 4L9SA 3H0KA 1ETUA 1LW7A 4GOJA 3X1XA 3NBXX 4KITB 2DHRA 4N1AA 3I4LA 1EX7A 2HYDA 1IQPA 1CULC 3EASA 3PCRB 2WJJA 4X8LA 4E22A 4B71A 1X6VA 5DIFA 3KQNA 2H17A 3BJIC 4NDZA 2BBOA 4JZKA 2WWXA 1G18A 2H18A 2OESA 1OFIA 1GNQA 4V02A 3U3RA 2FGKA 2WOOA 3CX8A 2PZGA 3KDSE 2YOFA 3AEZA 1W0KD 3O8CA 1US8A 4C2TA 1U0LA 4BEJA 2RMKA 4B2PA 1P7CA 1SGWA 1CJKC 1KAGA 1W4CA 1F60A 3T15A 1U0HC 2IYSA 5EXSA 5HCIA 3W6NA 4ARZA 2DR3A 3TBKA 3NC0C 2H92A 3B82A 2GXUA 3IHLA 1JI0A 2OFOA 1UBFA 2QL6A 3K0EA 1YZQA 1KI9A 2FSGA 5HZHA 4RFSB 3AQ4A 2P3SA 3IBYA 3KKMA 2G77B 2WIAA 3A1WA 3KTAB 4DEYA 2ZE5A 3OIYA 2WJHA 3M4YA 4KJZA 3VNVA 3QJYA 4PC7A 5FBQB 3W3AA 4NH0A 4KVGA 1YZNA 3S1AA 1S9DA 1VPLA 1E4YA 5GVSA 2ZE7A 1HURA 2V7QA 3MRSA 4MRVA 3DM9B 3QKRB 3UG6A 4W5WA 2OFWA 4BFSA 2H1LA 3QXJA 1D5CA 4B3FX 1N2CE 2Q9AA 1ZMXA 3Q8XB 1OPXA 5JJKA 2FU5C 2AD1A 3EW9A 1NG1A 3PUZA 1OE0A 2VF8A 2EYQA 2MSCB 3AV0B 1OH5A 4Z54A 4DDUA 4MGYR 1H8HD 2A2ZA 4DJTA 5FPKA 5FPYA 4Q7LA 3A1UA 4LDJA 4XH9B 1XTJA 3KJGA 1HTWA 4D82A 2J7PD 2AL7A 2VHTA 4CEJA 1T0JB 1I4TD 1JAHA 1K6MA 1KO1A 3U4QB 2FEOA 1Z0IA 3LQRA 1RKBA 4D0NA 2Z43A 1L7VC 2Z0MA 4G5QA 1FPMA 4M1OA 1G3QA 3CB4A 2PLFA 1FW6A 4ZDIA 4ZCLA 4TTQA 2OXCA 1NMZA 4QBGB 4EFLA 2W0SA 1IAQA 5L8VA 1TF2A 1KDRA 1YU9A 2R44A 2OSBA 1KSFX 4TL8A 1NN5A 2CK3D 3UMSA 1W2GA 2ZJ2A 3NDPA 1C9KA 3N2IA 4KYUA 2PZFA 1GSIA 2NG1A 2D3WA 4A8JA 2DPXA 4KODA 3A4LA 1KYIA 4DLXA 1U9IA 5JSZA 3BD9A 2BV3A 4UNNA 1Q20A 3O8RA 1EFCA 3KFXA 4BLTA 3GLGA 1I4LD 3RAPR 3SEAA 2NO6A 4OQFA 1Q3TA 1AK2A 5J4KA 3U5ZB 4Q1AA 4NCHA 3THOA 2A3RA 4M9SA 1IJEA 1JQLB 1VCMA 2FFBA 5AWFC 3GLIE 4YDHB 4JBWA 1XFAA 4A15A 1AQUA 2XXAA 2WMNB 4DLUA 1TADA 3QKUA 1KZGB 3U6BA 4IOKA 2P5SA 4FMBB 4DLTA 1YKSA 1M8PA 4JLOA 2H57A 4DB2A 1Z08A 3AVPA 1GFIA 2GXAA 3A6PC 4KLZA 3KKQA 3A1SA 2MSDB 2F43B 3FKSA 3W6OA 2Z4SA 4CGZA 3VR6A 3Q7QA 1DAIA 2QT1A 4JS0A 3X1YA 4OI1A 2IYQA 3PEYA 3NEYA 4JYBA 1G6HA 2WPDD 2WWFA 3SFVA 4IEEA 1NBMA 2P67A 2ZJYA 4QG7A 2Z4RA 3A4MA 1J2JA 4JLDA 2VP2A 5FOSA 3VNUA 4C0AC 2ZSDA 1NLZA 3IBGA 4Q18A 2IWRA 3VX3A 4ILEA 3LWNA 4Z1MA 2WBLC 3K8YA 2W83A 3CPHA 4JBXA 4XOIA 3ZZUA 4B6EA 3NH6A 3LLMA 1CF4A 1E99A 4B75A 3K9GA 5D3QA 4AK9A 4K8OA 4GMXA 2GHIA 1UEJA 1G64A 4ZIRA 2KE5A 2X19A 1W2HA 1VKJA 2W00A 5LD2B 3E2IA 3QQ5A 4OI4A 3T1QA 2DCUA 1ZJ6A 2YC4C 3LRPA 2F1RA 3CUEF 2UKDA 4IXMA 3TLXA 1E98A 2UVQA 2ZRGA 2FSHA 4YMTA 2QMOA 5CDFA 3TE6A 1X8JA 2QNRA 1P75A 2OHFA 4NCKA 5F3WB 3HPRA 2GZDA 4TQAA 1FX0B 3ASYA 3D3QA 1XNJA 4ZCMA 1SVSA 2J0SA 4PHHA 1NRJB 3SYNA 3QENA 4Q7JB 2OE2A 1KI3A 4BLQA 5J4HA 4PPNA 5EQTA 3GLFE 4EPXA 1R0ZA 4I81A 2H16A 1PZNA 4LYHA 3SBDA 2PT5A 2X2EA 4GDFA 2ANBA 2HEIA 1XTKA 2BJVA 4L16A 4M9ZA 4IFEA 4US1R 2JLRA 1F2TB 3KKPA 2QSYA 3ZLJA 3GJ3A 5L3QA 1CS4C 1F2UA 4NYMQ 4GP6A 4M4SA 1LNZA 1N0UA 1ZYUA 1RYFA 3A37A 1Z63A 1SVWA 1SVKA 3G0HA 2IC5A 1UBGA 2PX0A 2WZQA 5TY0A 4A9AA 4EQ6A 4C0KA 5D3MA 4B35A 2RB4A 3O8BA 2ZYTX 5GADl 3K53A 4BE7B 2BOVA 1G5RA 1YR7A 2F9LA 4WZBE 2QTFA 1N6HA 1NVWQ 1NIPA 4LJ7A 5IT5A 3BH7A 3KFVA 1W46A 5HKKA 1GM5A 221PA 4PANA 4YDSA 3ZVLA 1ANKA 1GP2A 4EFMA 2VHJA 4NKRA 3CRMA 4EJSA 2BCGY 4CEIA 521PA 2C5LA 1E9CA 3EPHA 3W5IA 2R6FA 2HCJB 1NKSA 4TTPA 2HF8A 1SVIA 1X8KA 3K0FA 1CJTC 1E0SA 1YRAA 4O25A 1R6BX 4MGKR 5JLJA 2P5TB 2XEXA 3PUWA 2Q3FA 3QVUA 5FL7D 2CE2X 3GFTA 5FPSA 3K1JA 1P6XA 3FKSD 3K0CC 3FOZA 4OK6A 2C99A 3FB4A 3AVWA 2GVZC 1IONA 2Q0HA 2V3CC 5BQ5A 2CHQA 3P1JA 5CB8A 1KDOA 2IUTA 2V1UA 3Q7PA 3I8XA 3SJBA 2LCFA 3QF4B 4FMCB 2A30A 4LJ4A 2EFCB 2P6NA 4JLMA 1T91A 4D4LA 4A82A 1SVOA 1VYVA 4V0OA 5KO2A 1G7TA 4QM7A 4DCUA 1YVDA 3CZQA 1KSJA 2OAQ1 3PQCA 4EQ6B 1YJ5A 2RKOA 5EE9A 2GK7A 3KUCA 5LB4A 2WAYA 1U98A 4IDQA 1Z5ZA 2C9YA 3A4NA 1P2VA 2UZ3A 1XTIA 2EWVA 5EP1A 4CF7A 5K8IA 2ZE6A 3FHCB 3U61B 1I2MA 2ONJA 4Z8XA 3KUDA 5E4FA 2CNWA 1U81A 5FOVA 2OM2A 1XX6A 2FDCA 5GJVC 1LB1B 1Q21A 1QVAA 3UWOA 4QFMA 4R71A 4BUJA 3OE7D 3GJ6A 1BKDR 2VP0A 3V9PA 4BRUA 1NSFA 2ZYWX 5JECA 3K9LA 1BMFD 2BVNA 1Q12A 1QDEA 4LJYA 1EFUA 1VG0B 5K8LA 3ZIAA 5CYPA 4Q5IA 2XTZA 4G1UC 4MKGA 3NWJA 4EPWA 2XJ4A 5KOYA 3K70B 4Q4AA 2F9MA 3R20A 1RRGA 1U8ZA 4B32A 1CIPA 1HH4A 3SBEA 4Q48A 5HE9A 5KPJA 3ZGXA 1UDXA 4LOAA 1FL9A 3LFUA 2G1KA 4DIEA 4F93B 1MV5A 2X2FA 1II9A 1S3GA 2IUSA 1QHGA 1X1SA 1WBDA 5JWHA 1Y63A 4EPVA 2C96A 3PEVA 1U94A 2ODNA 4JLBA 3CM0A 1JR3D 3AM1A 4HB0A 1N3BA 4CRWB 2F1HA 2G83A 2OAP1 2FNAA 3QPWA 3W3ZB 3LAWA 3LY5A 2YOHA 3T1VA 1XCPA 4CEHB 3RSLA 1JR3E 1T0HB 2XZLA 3SR0A 3IPYA 4F91B 1E1RA 2AD5A 3LX8A 5DISB 3B2EA 1E9DA 1R2QA 1FMJA 1LVGA 4PPGA 2IUUA 2Q6TA 3M6AA 3VR3A 1X1RA 4R7ZA 5JHGB 3IGFA 4PAQA 5C4GB 4QC2A 3EIHA 2C9OA 4DXAA 3PXGA 3I8SA 4GZMA 4II7A 1E1QA 3ADDA 1M34E 1J7KA 2IBMA 2HDNB 1OYWA 1UEIA 5DO9A 2JLYA 4Q4HA 4HUQA 1T6NA 2C98A 1G3RA 3MJRA 2NGRA 2DFLA 2ORWA 5EJEA 2QG6A 3HYRA 1EG7A 3KJEA 4CEIB 4EFNA 3SNHA 2W2XA 4LBWA 4KXFB 4EJSB 1A7JA 2GAOA 2NO1A 5AUQA 5IK2A 3T1OA 3T61A 3G82C 4PQYA 2IS1A 3M1IA 2QM8A 1HQYE 2ZRLA 2FJUA 5DLQC 5E7IA 4M22A 2HUPA 3U7HB 5ANRB 1P9NA 1Z6TA 2E1RA 2W2TA 2CL0X 5AJVB 1QG2A 4JJKA 1ZC3A 1E2QA 1K5DA 3P4YA 2D62A 2RGAA 2O0KA 1TX4B 2B7CA 2YKGA 4M1SA 1TF5A 2FE4A 3QOFA 2ZUCA 3HU2A 3RS0A 1G5PA 2KWIA 4OQMA 1F3OA 4ASUA 2I1VB 1U0JA 1TUEA 1H8ED 4TYYA 3SE0A 2CVHA 4E07A 4HB4A 1DO2A 4LHWA 1W4RA 2Q21A 4OK3A 1A1VA 4LGMA 4URYR 1SKYE 4C30A 3SYLA 3FTQA 1RRCA 3KQKA 2VYFA 1DAKA 2R2AA 1NI3A 5A4JA 4U7DA 4B44A 4BFXA 2GEUA 2XB4A 2GJAA 1NN0A 4JVNA 3TAUA 3W90A 2ZRFA 1HT2E 1NIJA 3U44A 3QEJA 3QKTA 2DYKA 5H1YA 4GT1A 4A1FA 4CT4B 1DADA 1GNPA 4FMDB 4URXR 1WBBA 2ORIA 2IHBA 1E9RA 1TEXA 3FFBA 1ZM7A 1DAFA 1FX0A 2FOLA 4TLBA 3BIFA 2NZJA 3LDAA 4XD7A 1ZM2A 4QGFA 3WP1B 1QHXA 3DMDA 2NPIA 3A58B 3PEWA 3AVUA 3EZ7A 4Q4JA 4TYPA 3WP0A 1VIAA 2IYLD 2IYVA 4A6XA 2DWQA 3MWKA 5KDLA 4RD1A 4JIMA 2NPFA 4XWOA 1XF9A 3EZ9A 1QHYA 3AP2A 1JJ7A 3U4QA 2FSFA 4MA4A 2OG2A 1SVMA 3MCAA 2ZROA 2IX3A 3N5CA 4LX0A 1R8SA 3R9XA 2IS6A 1LTQA 2ZXUA 3N2EA 3EA0A 1OV4A 2D2FA 4NL4H 5C2JB 4IRUB 4WA7A 3WMEA 4JT2A 1DO0A 1KZ7B 1OHHA 4G5RA 3VR4A 4BFWA 4NONA 2AHOA 4PFSA 1RFLA 5DI3A 3ASZA 2NZ8A 4NYMR 2OLJA 2VHUA 1GWNA 2X77A 1V43A 3DZ8A 4DSNA 2ZI6A 1KDPA 4EIWA 3ICEA 1ZVQA 1P61B 2GJ9A 5HKKD 2GKSA 3KL4A 5DYIA 3SZRA 4BLRA 3U7GA 3CF6R 4XSHA 5KSYA 2RHMA 2G1JA 5IRCD 1NG9A 2GZHA 4TLCA 4DT1B 4HAYA 3IIJA 2JLXA 1LF5A 1C4OA 2VEDA 3C8UA 1E2IA 4YXWD 4BFTA 1G41A 5JI3E 1CR0A 2R8RA 3A1VA 3DMNA 4FCTA 2JIZA 3MWLA 3RSOA 1EX6A 4JBYA 4TLDA 1OF1A 1T4GA 3U60B 4UJ5A 1XCGB 1YE8A 1OJLA 3ZVMA 3NHAA 5DI9A 2VSFA 2OBLA 4KO8A 3CPEA 1XPOA 1E79D 3W9YA 3NBZC 4EKDA 3OEHA 2D7CA 4MH0R 2FPKA 3PFIA 4QJ3A 4B3CA 2XB2A 1FTNA 3TUIC 4GOXA 1A5TA 3HR8A 3QUSA 1G5TA 4DDVA 1RJ9A 1FP7A 2BMJA 4RKEA 3WYAA 3CWQA 2V7QD 1G291 5J5CA 2PJRA 1KNXA 2WWGA 3CIOA 1T8UA 4GFDA 4TMXA 2J0UA 5FUWA 1T9HA 2H8KA 4IOJA 2NO9A 3JZAA 3PR1A 5JWOA 1HEIA 2XNSA 2CEAA 3BRWD 4Q02A 4W9MC 2ORVA 3Q9LA 2GA8A 3LVQE 4U00A 421PA 3T5DA 2GJKA 1SQ5A 1E2KA 2ERXA 3GD7A 4H9GA 2ZSFA 3LV8A 4EPRA 2XZOA 4DVGA 4LRWA 2QN6A 1EFTA 2OCBA 4RD2A 2A7QA 5J4VA 2CK3A 2VQSA 1CJMA 4P31A 4YXWA 1P72A 2CCKA 2O0HA 1GRRA 5JRJA 1N0WA 1SXJE 1JB1A 2QT0A 4UXIA 2QBYA 1N6KA 1P73A 4W5JA 1NVXQ 3V4FA 3KQHA 2YWGA 3IILA 4WBSA 4C0BA 1R0YA 1W0KA 1U9IC 1RIFA 2CLSA 2VH5R 2DFNA 3U2QA 1L4UA 5TDHA 3AVYA 2QEQA 5H70A 1SHZA 4DB4A 4PZYA 2GK6A 1G1MA 4UXJA 2G0TA 2ZTSA 1CJVC 2J46A 1EFRA 3CH4B 4ZV4A 2O8FB 1COWA 4LJ8A 3C4JA 4TMTA 1ZUIA 1Q22A 4LC1A 4NBSA 5J40A 5EZ5A 3P20A 1E9EA 4QKQA 3QKSA 5B58C 3EPKA 4GSYA 3MFYA 1NNEA 2JLSA 1BO6A 1E0KA 2AXNA 3LH5A 5L3SA 1Z6GA 2FV8A 1OKKD 3AGQA 3OFND 5CK5A 2CJWB 4WOPA 1I4DD 2PLRA 2XAUA 4A0GA 4Q4HB 3LA6A 3LW7A 2CDNA 2G6BA 4PR0A 2OXRA 2UZIR 3RDPA 2JLVA 2R6CA 4TLAA 2WKRA 1ZBDA 2ZU0C 3L0IB 3KJIA 3S1AB 1MT0A 2B8TA 2I3BA 3QF4A 4JT4A 4P33A 1NL3A 3L82B 4LC0A 4HB2A 1SXJB 4XIGS 4NZYA 2GF0A 4M21A 3RHFA 4ZKDA 4JSYA 4YLGA 1WXQA 4EUNA 2REOA 1FFHA 3LBHA 3T34A 3UG7A 3E1SA 2RCNA 1QHSA 2IYUA 2FA9A 3AGPA 3REGA 3IIMA 4UNSA 1XEFA 4MGIR 2XOKD 2VO1A 1OXTA 5AJYA 4CDGA 4OYHA 1FP6A 1UFQA 2CJWA 2OLKA 3HDTA 4HDQB 5CM8B 1NBMD 2ZR9A 3C5HA 3ZIAD 4B2LA 1VCIA 2QRZA 3AKYA 3B13B 4B74A 5CITA 1X86B 3NBFA 1E2EA 4B73A 4BLSA 1EFRD 1BMFA 2BKUA 1DVRA 2GETA 2YJTD 5FUXA 1GZSA 5G53C 3EPLA 2ZJBA 3ZVNA 1TQ2A 2QMUA 3H1TA 3RWMB 5FTMA 5J47A 3CR7A 3SDZA 4RD6A 4LPKA 5JWRA 3HPQA 4Q9KA 1E2NA 3GJ7A 3BB1A 5AR1A 5D3MB 4MQBA 4Q4AB 4GNKA 4E09A 4PPFA 4FXPA 1NMYA 4Q9LA 4X8OA 1OB5A 4LBVA 3BK7A 3BORA 3EZ2A 1DAGA 1WF3A 4KBGA 4FMCF 4MYTA 4XVUA 2Q9BA 1R10A 5CLLA 5BN5A 4XSGA 1S1MA 4PAOA 5L3QB 5BN4A 4D0LB 3QG5A 2IYZA 2RGBA 1ZUNB 2QPAA 4NYIR 2HV8A 3CONA 2WJYA 1NVVQ 4QGHA 3EA5A 4ZKEA 2ZRJA 2CL6X 2Y8EA 3KKNA 2AFIE 1R4AA 5TMPA 4QBHA 2FGJA 3GMTA 2Z5FA 4L9WA 1T8TA 3L43A 4MUAA 4HEJA 3LVRE 3RRYA 5FOXA 3DKPA 4V0LA 3AF3A 1U90A 1KKMA 2O8CA 2CE7A 3B6EA 2VP9A 4Q66C 1N6OA 1E2GA 5J4LA 1HT1E 1O87A 1UKVY 1UBEA 5K8TA 1AS0A 2HJVA 5KNDA 4IFBA 2A78A 4IDNA 2FX3A 4OHYA 5EP4A 3IO3A 3LXXA 1BYUA 4H1UA 5LBIA 3LBNA 3AKCA 4WW0A 2BDTA 4MDEA 2ZU6A 2IXGA 4GRAA 4L15A 5AK0A 3SHWA 1G3MA 4DZZA 1Q1BA 4R2IA 2YWFA 1IOZA 3VKWA 3EZFA 4RD0A 4XJXA 3JVUA 4M1MA 2WTUA 1UPTA 3FMFA 4FCVA 3IEVA 3F5FA 2VL7A 4M53A 1Z0KA 4BZPA 4MYHA 3SU8A 1LF0A 1OFUX 3EZ6A 3FVQA 4ACBA 1YR9A 4CT5A 4C7OB 5CIQA 4DRZA 3EIQA 2BEKA 3C5CA 3K0FB 1Z3IX 4QJ4A 1RYHA 1UADA 4RZ3A 2RGXA 1KI4A 2IT1A 4LZZA 1NKTA 4WXPA 1S8FA 2GVDC 3N70A 1QRAA 2QRNA 3PUVA 4NYJQ 2WJGA 3FPAA 1KK2A 1N6IA 3RNLA 4AD8A 1CR4A 2ZREA 3TKLA 3CX7A 4PXAA 3U7FB 1Z6XA 4PHTA 5FBVB 3NHBA 2YHSA 4D2IA 3IDQA 3BFXA 5DYGA 1KGDA 1SXJD 1TMKA 1HYQA 1KI7A 3VHXA 2WKPA 4LPSA 4Q9IA 3TR0A 3MAAC 1CKEA 2WM9B 4X8MA 2AR7A 3PEUA 2OV2A 3WBJA 4A36A 1G8PA 1IXRC 1S2MA 3O8DA 2J0QA 1IXSB 2ZIAA 2P6RA 4BFYA 1T5LA 5HZKA 2XTMA 3DM5A 4HI0E 1TAGA 4BFUA 2DWPA 1Q44A 1S0UA 2F3TA 4WIAA 1A2BA 2PMKA 1KTVA 2W2VA 2ATXA 4KU4A 3UWKA 4US2R 1XPRA 1AA9A 1M74A 4H1VA 5DHAA 2PCLA 4G5OA 1A82A 2QMEA
chains in the Genus database with same CATH superfamily
1FU4A 3FZQA 3U3KA 3T6KA 5KWVA 3DOFA 3GJZA 3QXXA 4HVAA 1QZTA 2W11A 4S0XA 2WU3A 2IUYA 3WLRA 4DYDA 5AW7A 3NHRA 5LA6B 1GO2A 1W4AA 1YDMA 1QRRA 2WT4A 3MA0A 3CMMA 3G2MA 2OOKA 3TUZC 2BGJA 1DI0A 3AB3A 4OB6A 4PQFA 3ZXSA 4AZ0A 3WDMA 1PFWA 2XNDD 2YVQA 4CM8A 3ZWWA 2IEZA 3EGOA 4OGKA 3AL2A 3TSAA 1N2BA 1YQTA 1WA5A 2JHCA 4HC4A 2O06A 2H31A 5THQA 1VIMA 4N5DA 3ENNA 1VP9A 2IGTA 2VDJA 3O8QA 4G1BA 5FL7A 3DUFB 5KYYA 3LHDA 4H15A 1Y6JA 1JA1A 4U1RA 4PO1A 2VF5X 4OMFG 4CIXA 1E32A 1RI3A 4N3NA 3ZTWA 2AKYA 2VOEA 4MAFA 2G71A 3GI1A 1E2LA 1TA4A 1CHDA 1EK2A 4BLOA 3DDCA 3WHIA 1TYCA 3CKLA 3T3MB 4ZIRB 5IM4F 1D4AA 1H0KA 2J0UB 2IYWA 2QAGA 2JGFA 1J09A 4CM3A 2O5CA 4I1VA 1J25A 1W581 4B3BA 3EFBA 1Y37A 5GJCA 3RU7A 4MV9A 4BB5A 1NNSA 3NV9A 4EY5A 2NXNA 4C9BA 1Z4PX 2YWJA 3G02A 3QG1A 5IF3A 5IFKA 3H16A 3DKVA 5JMOA 3D7NA 2HT6A 1N9ZA 4R8LA 1YC5A 4HSGA 3M4NA 1NKVA 1QGUA 3BEOA 3QKWA 1E63A 4IKPA 4IXNA 4UTVA 1JMVA 3L1UA 4FFSA 1G2IA 2QD5A 1LXCA 4X00A 5LYJA 1BX0A 5AKYA 4WLOA 3QWIA 1BNCA 2WB4A 3L7CA 4RJKA 5CFOA 2DULA 5IK2D 1G3IA 1L5OA 4OV6B 2BKXA 3GJYA 4PXSA 3RW9A 1LX7A 2P4UA 2O3JA 4KAJA 2PK3A 3B36A 4YP1A 3ENQA 5AT1A 1SVLA 5A9RA 1EFAA 1NXTA 1KMHA 2NV2B 4DIMA 4FEEA 4OP2A 3RUFA 4BMSA 1I9CA 4GWLA 4M98A 3RVQA 5UKDA 3VI3B 2UUCB 1NP3A 3F0TA 1WNTA 4BNKA 4UATA 4J4TA 4FM9A 1M7BA 5CJ2A 1ZW6A 4DLWA 1F1BA 1MIOB 3OQMA 1FFXB 1FDIA 1E9BA 4DBVO 2EYUA 2HSWA 3H84A 2L2QA 3JQAB 4PGHA 4DT1A 2B5WA 3RRMA 3HU1A 1FPQA 4ND2A 2MYNA 3PRHA 1Z8NA 3OPVA 4H4EA 3A3KA 3GQBA 3H9QA 4TL9A 1SH7A 4BZQA 4YRMA 2JFQA 5C18A 1NRWA 4KQWA 1L1EA 1W5TA 3GLHA 3HY4A 3P9CA 4UBIA 3MJSA 5GP1A 3U9SA 2AMVA 3C3EA 4DCGA 2BEWA 2H06A 4DABA 3UCXA 2QN8A 3P52A 1Y6QA 3GA0A 4XCQA 1N6NA 5IUJC 3M6IA 2K4MA 1AKVA 2O8EB 2P65A 3GG9A 3NPAA 4KXVA 1B8UA 1MAVA 2JASA 4R98A 1ULAA 1U5BB 2P40A 2LCQA 1DTEA 2YWCA 2G09A 1KMIY 2FSUA 3LKVA 1PZXA 3EBOA 4DTCA 4ES6A 2Q62A 3K70D 5EZ6B 3JWHA 4LSGA 2VSXA 1JPUA 3LQKA 2IP1A 3DVSX 1U7TA 3R0QA 4RLSA 2FVYA 4UMFA 5GOZA 1A3CA 1EUYA 4HN2A 5BQPA 3WYCA 1C81A 4BYGA 2KS6A 3L7IA 1IRXA 2ZRMA 3SKXA 4HS9A 2QTRA 5HOEA 2PLAA 3G2IA 4M8NE 5JZSA 2ZSHA 4C5BA 5CJPA 1XCBA 1GZ5A 4GXTA 1ZRHA 4RVSA 1GZ7A 3H9GA 1SCUA 4QNMA 1Q7EA 2REBA 5TF0A 5E3JA 2FG5A 3ELDA 2OGZA 4PLPA 5DHUA 1NBME 4J3JA 1ILEA 2WJ4A 1OH7A 2QA5A 1SKMA 3K1YA 1TQ6A 3KJXA 4ZQFA 3LLSA 3WWYA 3Q6IA 3OFJA 1UP4A 2C7PA 3RS3A 1R9NA 4L6AA 4N6NA 3LPMA 3OE7A 5D3ZA 3SYMA 5IH7A 3NWEA 5F1YA 4ZQGA 4F8EA 3I1IA 4ZDWA 4XYBA 4CEJB 1JT9A 4QHTA 4QQKA 4S05A 2YYYA 2AOTB 1I2BA 1MLDA 1QO9A 3H2GA 3IP8A 1IN5A 3AM4A 4ZVRA 5CYGA 1KYXA 3TSOA 4B3DA 4HYTA 2EP5A 1ZD8A 3WGLA 3ZGOA 3QU4A 1P0CA 1TI7A 1SKYB 4MI6A 1W36B 2UYGA 3AJ9A 4RENA 4TV9A 3KTDA 2DWOA 5DYTA 4CLOB 1RI4A 1JJVA 4U6SA 4HLDA 3DE7X 3W77A 1TM2A 4AC9A 1NW8A 1XZGA 2J7PA 2WAXA 4G01B 1DTSA 2E4UA 3GJ4A 3VH4A 1QHNA 1E3TA 2GSDA 2I03A 2WJAA 3Q5GA 4KFUA 4E7PA 2WTEA 4OP3A 3DVAB 1PYDA 3VYUB 1KDTA 1IHPA 1OXXK 1VLLA 3G8DA 3O3CA 5ALLA 3WL4A 4OX9B 3TSYA 4RJIA 3HG7A 2QQGA 5DTIA 3ACDA 1DAHA 2D8AA 4NE9A 4WK0B 1NSYA 1J2TA 2VP6A 3I04A 3VYWA 2ATCA 4U2CA 3A6HA 3HB5X 2DFTA 4RIGA 1LEHA 5TF4A 1U7OA 2J1LA 3DVLA 1C2TA 1WZUA 3CH6A 2DEUA 1BDHA 2VKQA 1TMYA 1WV1A 1V8PA 4XGIA 4P83A 4UHBA 2P8JA 1RT9A 1BMTA 4QZVA 1A8PA 2G3YA 2R8EA 3LTNC 3NHJA 1DOHA 3VJKA 3AZOA 3K0SA 2Q27A 1Y5MA 5A0FA 4HUQB 3URMA 4DA9A 4EY7A 1V8DA 4EG0A 4CNBA 2HK7A 3BH6A 4Q1EA 3FYUA 4YAIA 4BVGA 1R5NA 2B8WA 1V7ZA 3KYCB 4IEFB 4ZCSA 2DXIA 1FRVA 2C7QA 1RYMA 2BZ1A 3DG9A 3N74A 4I9GA 4A0RA 5GY7A 4E5DA 5FR2A 2W6IA 2P4EA 2WF7A 4RH3A 2J87A 3PFGA 1M1YB 1MN6A 4PLWA 3RWOA 3ZQ4A 1KHHA 1XU4A 3HP4A 3OZXA 4P86A 4MCIA 2ZBDA 3Q7RA 4FFRA 4J90A 1AT1A 1KJZA 4L78A 5IW8A 4PGAA 2W2LD 4PLTA 1LPNA 4ALLA 3FG9A 2ZJFA 1SELA 4G2NA 4BZXA 5BWNA 3JQ9A 2CCJA 2C2HA 4V38A 1TYDE 1RWVA 2QY9A 3DEZA 1U8CB 1KQNA 3UGKA 1EE1A 2DAPA 1QWSA 2BKEA 4V0NA 4D4HA 4HNRA 4JJFA 4O1MA 5I5GA 4YO8A 3KQUA 3DL2A 2JJ2D 4L50A 2PR2A 1FUIA 3LW8A 4G0NA 1X0VA 4QTZA 4TS4A 1M3SA 2FWIA 3DDZX 1X7YA 2MSWA 4NH4A 3TQQA 2NZVG 1ICEA 3G0CA 3VJMA 4A10A 4R9RA 2N42A 1T5DX 5AJZA 4AJPA 1ZHFA 1YRQA 4QPDA 4RETA 3R6GA 3M2PA 3LSTA 6AT1A 5C9ZA 3KZNA 2XUFA 2PWAA 2XDWA 3KO8A 4Y0VA 1N5RA 1L4HA 4B7ZA 1RXCA 4CTOA 2HXSA 5K2OA 4R3NA 1ZLYA 3LRTA 5HIJA 2ISQA 2ZIZA 3FUCA 2PNFA 1OZHA 3A05A 1F0YA 4NYJR 4BNDA 4LVOA 2XYRA 2AX3A 2J3KA 4OY3A 1OXMA 3IQWA 4Q6WA 1I13A 5CB4B 4TWIA 4FOSA 5JROA 2Y99A 1OLXA 1F2VA 2I9KA 1I80A 2QS9A 4MWOA 2EJVA 3SN6A 3QSYA 2QRHA 2R48A 3KHKA 4P9NA 1XA3A 2IEIA 4FR2A 4M1EA 4UVIA 4COKA 3W5UA 3EGDA 1ZMRA 3KR9A 5AJHA 5LM3A 3FHJA 2QSZA 2F7SA 2EFGA 3AHCA 1Y8QB 2EG9A 3DHEA 3L77A 3PKJA 1AM4D 4PNZA 4PPQA 3E9MA 5CXQA 2C58A 5ED4A 4JUFA 3AW8A 3LQQA 2WTBA 1M67A 2H5IA 4BGDA 4OYYA 3JQPA 3ZCXA 4MVJG 3T12A 3NDBB 1ACLA 1UIMA 1L5MA 3WWDA 1W48A 2Q5EA 4WNAB 4Y2YA 2FR8A 2WHPA 4AUMA 2H08A 1MA0A 3PFBA 1KU0A 3SC2A 4XI9A 3PKZA 4TL7A 5IEJA 4Q00A 1H1LB 2JIZD 4U5XA 4RD3A 4CJXA 4X20B 4CKYA 1H2BA 2WSIA 1PGPA 3FYCA 3P27A 2WG0A 1S2OA 2KBFA 5DNAA 3WYGA 1N2EA 4TLEA 1RJFA 5SICE 1QRDA 2BGKA 3UMMA 2V6FA 2H1OA 2VRCD 4WQMA 2I34A 4ARIA 5JJIA 3ZOKA 3H8VA 3WG9A 4CTKA 4KX5A 1O4WA 1KI1A 3GZTB 5A5GA 3EYWA 2VN8A 3B3FA 1SQSA 3SGLA 4F92B 3EXG1 2WKSA 3ELYA 3NW9A 4Q9NA 3L2OB 5G02A 3TRDA 4OBBA 2ARKA 2ODQA 4IDEA 4UJ3A 5CW2A 5T57A 2WPDA 1NR1A 4Y2XA 5FUYA 3F46A 4RKYA 1VJCA 4AY6A 4PC1A 3UV3A 3H8JA 2B7BA 2WV9A 3W5BA 1PSDA 1XZBA 2NVWA 4MVJA 2ZAGA 1DPFA 1L8XA 1RWNA 3CCFA 3L4EA 2M6SA 1KPIA 4KPFC 4D96A 5LUBA 5IS2A 3LQ1A 1M7HA 3BE4A 3BOSA 3F6SA 2C59A 3O0TA 4S2UA 3DMRA 3RS5A 1T25A 4ACAA 2HA3A 1UOOA 1ND5A 3ZY5A 1C0LA 3G9ZA 3KTFA 4R9VA 1E6CA 2EX1A 1LLCA 1QYXA 4IDDA 1YZTA 4TKUA 4BVHA 3DMPA 4TN1A 1W9MA 2CXUA 2OEPA 1LUAA 2XWQA 3G2KA 2QVCA 3MGBA 4OHRA 4PX9A 4WNIA 3R7FA 2J33A 3MCZA 1USGA 3RK1A 4AW9A 3Q8LA 1Z0AA 3WMWA 4ZOCA 2CLMB 2ZEJA 3KKOA 3OLWA 1B93A 4JZYA 5BV7A 5F23A 3W5DA 1D2CA 2L0XA 1PWYE 2PJZA 1FFWA 3E61A 4NMXB 3PDIA 2B92A 3K15A 4J1TC 5FIUA 2IOFA 4A5OA 4QGGA 4D80A 3PHCA 5CLQA 4OJTA 3OVMA 4RD4A 3G2LA 2ZYAA 4N49A 3FROA 1WB9A 1I3OA 1X1EA 2CLKB 2ZBFA 2HQOA 2G04A 1R6DA 1DQNA 5KJFA 2G25A 3BIOA 4F3KA 4I5GA 2DOKA 3HABA 3K09A 1QX3A 1QE0A 4PG6A 1R50A 1Z4QA 1N9GA 2GBPA 2QJRA 4BGVA 4EL5A 3FI0A 3O93A 3PVSA 3PIRA 3GLGB 2WC1A 3LE8A 3PC8A 4TTRA 5JI2E 2BHTA 2GR9A 2YUTA 4RCZA 1U80A 2ZYDA 3JVEA 1OZGA 4O2AF 1B73A 1FMLA 2E37A 5DNWA 4OHMA 3ZC3A 1Z4MA 2J3HA 5ICGA 1J7JA 5T4FA 2FG7C 5K0SA 5BYAA 1HFJA 2YW9A 1P2GA 4MKRA 4TN5A 2IH2A 2ADFA 2I2XB 3QLVA 3OJXA 2G4CA 3K5HA 4RAQA 1QDLB 2WUWE 3IV6A 2O8EA 3PV0A 4X8HA 5FTNA 2V5UA 2BN4A 5KVSA 4IKEA 2DH6A 5ADWA 1EGAA 4B7CA 1XDSA 3GYGA 5L6LB 1CRPA 1BGWA 2QRLA 2O7SA 3VOSA 1W7AA 2G9VA 1NVTA 4TLMB 2VPPA 3NOQA 4IEIA 4IOLA 1M6WA 2QI9F 3R9KA 1ZCFA 9ABPA 1TZMA 4Y9DA 5F9FA 1IRIA 4GVXA 3FR7A 4TKVB 5JXJA 3QEBZ 1IZZA 1JIIA 4H6VA 5JFOA 3COPA 2J67A 2CVFA 3ORRA 1ABBA 2YL2A 3BSFA 3CY6A 3WGNA 1TLLA 3B7WA 4TMKA 4C4XA 1VGRA 2BCJQ 1ITZA 1RJ9B 1E0JA 4XWAA 1Z4NA 5EE0A 1NW7A 2GILA 3C7KA 2VLIA 3M3HA 4P4UA 3OQHA 1DEXA 4Q1FA 2PRYA 3DV9A 2WUGA 3DKRA 1XXHA 2CLDX 3H1AA 3C3KA 1QGYA 4N82A 1OPRA 4ZVUA 1H2EA 4UZEA 5EE5B 5SZIA 3THYB 2C2WA 2MHCA 2NNLD 1IMOA 4JCCA 4RZIA 4YCBA 1UXGA 1UOQA 5L7TA 3OJFA 2QTTA 3SSMA 3H9JA 1L5RA 3A32A 3NHMA 4AVYA 1E1QD 3E4CA 3AYXB 2WMYA 3FDIA 3L84A 3Q5DA 5CDFE 1QYWA 4RTKA 4PZ9A 1TFRA 2GFHA 3AIMA 4B48A 3TRIA 4R0MA 4J3NA 3ZLVA 3WGMA 1KY3A 3QKRA 4YRGA 1M73E 1FFYA 4NV3A 2KW5A 2QZPA 2BKLA 2Q41A 4IDOA 1YGYA 4LMAA 4RKFA 3ZLTA 3UA3A 3SQXA 3ZKWA 2X3YA 4FHGA 2C83A 2ZAMA 2NQ8A 4AAYA 4QGSA 3PUYA 1V3UA 1PZFA 2W2NA 3QU5A 4P0PB 4CMIA 4I4LA 2XHZA 3S27A 1CYDA 4XZ3A 3NXSA 3UKDA 3CX4A 5FPHA 3V48A 4AECA 1NQTA 2QQ5A 3KQSA 4RNCA 2P35A 4I2VA 3ULKA 4HYYA 5KYYB 1XBTA 3VPAA 2QD2A 4HZUA 1MAWA 4NK4A 5FI0B 4Z2YA 4U2BA 4F06A 5A9SA 5CTAA 2BFDA 2BISA 1FP4B 1ATIA 2D5BA 2QIOA 2LBPA 1SXGA 4U3JB 1B6TA 3EXAA 3GMDA 1JIUA 1Z5WA 2OMKA 1QV7A 5D1HA 1LPAB 1N9GB 3LI2A 5G2OA 4E11A 1OFUA 3NJ4A 4ZD6A 1JHYA 1MR3F 2PMDA 2QLFA 1QC5B 3AUYA 3ZX5A 4F96A 1DDGA 2YC2C 1E69A 1SCJA 4AKEA 3I0MA 5TVGA 2W2KA 5AQEA 3W4JA 4NWIA 3AUAA 3KD2A 5EZYF 4YCMA 5CD1A 2JEOA 2RK6A 3RM3A 1Y1LA 4C87A 5EFOA 5IM5A 2WIJA 3TMKA 1ZK3A 4PS1A 1BGXT 2CUZA 2EJBA 2VZ8A 4DJFC 1NAIA 1JDNA 1KNQA 1BMQA 3H4MA 4EJSC 2FDRA 1GRQA 1MX1A 4QNNA 3V7NA 5A4KA 2WD9A 3JYQA 4II3A 4IWXA 3TQOA 2PFSA 4TKUB 2PX3A 1P5FA 2ZS7A 5AH0A 3RVSA 3SYTA 1T26A 1ONOA 3W5AA 1NBEA 2A1UB 4PHGA 2WWYA 1QZUA 2FI1A 1RKXA 1PNOA 1IZ9A 1UMCA 2IITA 3C45A 4N47A 4XB6B 2ZWPA 4WCDA 4DUGD 4ZREA 1SCAA 2IIBA 1P0MA 3IP3A 4EA8A 5C8ZA 1VECA 1V3VA 4PSCA 4AZSA 1T9AA 4MRSA 4MLZA 1HX7A 1U0EA 2BC9A 2ZPTX 4YGXB 1TM1E 5LL6P 4B9EA 2YVKA 4E3WA 4EGAA 1G8SA 4BNVA 3A25A 2A33A 4DGSA 1KQ3A 1KL7A 1GCUA 5FT9A 3M9XA 5P21A 2EQ5A 4UCFA 1G20E 5BPFA 3KPWA 4R3UC 2J3DA 2NSYA 3RV3A 2JDID 3VX4A 3BFJA 3CF4G 3RWBA 1XA4A 1QF9A 2XXBA 4TTJA 1UBHS 2HFKA 1NX9A 2FFAA 2FSVA 1Q11A 4PX2A 5ALNA 2OFPA 2QL7A 1MQ8B 3D7LA 5IYZA 5IDVA 2QJFA 1H1LA 1ZICA 2G7MC 3L6DA 1QYVA 2CXXA 2X1LA 3H1EA 4HQNA 2EW1A 3TOZA 4AS1A 1A04A 1JR3A 3KT8A 2Q0SA 3O4JA 3R3ZA 5DX0A 1TKCA 1FTSA 2WHPB 2G4LA 3HC7A 4PSUA 3VR2A 4R69A 1O8BA 4M1TA 3DPSA 3G2HA 3DAOA 3ZG6A 2UZ1B 1EK6A 3O6VA 5FTJA 3FPLA 1NNUA 5A6VA 8OHMA 1GU0A 3N59A 4Q03A 1ZMOA 4R40A 1E4OA 1VMAA 1ENYA 1LY1A 3JATA 3KOWA 3IAHA 2QGNA 4JKOA 5DK4A 1HDZA 4ZT2A 1U8YA 5EJMA 3A3YA 3OFNA 4H1HA 1M8JA 3FVRA 2WHEA 5DIZA 2J9GA 5DNUA 1C8KA 5B64A 2HYIC 4HGPA 3C97A 4PLHA 3C6MA 3X1KA 1OLXB 2OD9A 2PT7A 4LI0A 3FSGA 4RZHA 4KYIB 1JILA 2I7CA 2Z6VA 1XZPA 7GPBA 3TRFA 3DR3A 1X39A 1L0BA 4HDOB 4LZLA 1FXSA 5AW5A 1ZRMA 1Z12A 3WRXC 1RYYA 4EGQA 1LJ8A 3TRJA 2G28A 2J4CA 2IS4A 4M1ZA 2WTAA 4Y1GA 3LFTA 2V5AA 1T5TA 4HH3C 3CS3A 4ZVOA 3SIRA 4D8WA 4ND1A 2HX1A 2VEOA 1G0NA 1FOEB 3DKKA 3FNRA 4RS3A 2V6JA 1Q1EA 3RJ9A 4CW7A 2P2DA 3KXLA 1OREA 2OHJA 2Q4OA 3E5RA 4N54A 2HXGA 4LGCA 1V3QE 3WQSB 2BEVB 2QF7A 3OZCA 3LMKA 3O84A 4D4JA 4P2GA 3AMVA 2HNKA 1PR2A 1X77A 2EC5A 1G55A 1DEKA 1DLIA 2I62A 2HBQA 2VBFA 5BNTA 3NATA 3LY8A 1K5GA 1L4FA 3FMOB 3C3MA 4UHEA 2B9EA 2GK4A 1JLLA 4IVQA 4OXXA 1IM2A 4M8IA 2F3RA 3S7ZA 5ERXA 1DRKA 1SJ9A 5BT8A 1LFDB 3LS2A 1AXEA 1KJIA 1ZX1A 1DPGA 2C5HA 2C7BA 2O5VA 4UHDA 5AIBA 2C8KA 2JFZA 4KO2S 3C7DB 4LBYA 3EIFA 3RVOA 1CUVA 4B0PA 4BECA 5KNBA 3K6SB 4DC0A 2XQKA 1GTVA 4V0SA 5A2GA 1T10A 3C5WP 1L5YA 4J3FA 4LRSB 4RWZA 4ZJZA 4EG5A 4URVR 5D84A 5ALGA 2GZ1A 5A5FA 4AMUA 3K0BA 1OI3A 1YDFA 3ITDA 3B12A 3ONVA 3E7WA 2NVUA 4JEIA 1SBIA 4W1RA 4EPYA 5A4FS 2OOSA 1M2WA 1OQAA 5FWXB 1R6XA 2O8BB 5KSZA 1KQOA 5HIIA 3FJYA 3QM1A 3G0OA 4CF4A 2PT9A 1YDGA 3DEHA 3OQIB 3E18A 3TJRA 4CTMA 1UT8A 1TB4A 3ICWA 3G5UA 3EWNA 5SYAA 1L1FA 1QUFA 2P4HX 1COZA 1FQOA 4ITVA 1HG1A 3ZK7A 2ZRIA 4HADA 4Q19A 1JG2A 4F2PA 3FOEC 2QPTA 4QAQA 4OXIA 1OLSB 4URWR 3WISA 1O0SA 3A2KA 3MJHA 3CQ9A 4IVRA 3TZQA 4G0PA 3HGQA 5L4LA 4A27A 2FFJA 1O54A 1RWPA 3ZHCA 3L3BA 5DYYA 1ZLXA 3OCXA 3PQ5A 5KQMA 3RVBA 2X5KO 3A04A 2AMYA 1GG5A 4R05A 5HEKA 5SZJA 1FVHA 2UZAA 3ZNOA 5ERGB 4ZVSA 5A3QA 1HA3A 1ONBA 2XUZA 1CZRA 3F1LA 3I45A 2A0FA 4ANFA 2I6XA 5LA6F 2F62A 1O95C 2IWHA 2FG6C 3A0UA 1N5KA 3QKSB 3L7JA 2OHHA 3RIXA 2AK3A 3KR0A 3U7JA 2GPYA 3MWFA 2PWPA 2E1PA 1ZCZA 1SBCA 4S12A 1VBMA 1PG2A 2EEZA 1QHHB 5DDIP 4U0KA 1V35A 4IH9A 1VMDA 2X5NA 4H77A 4DQLA 5IC4A 1KI6A 1IK4A 4NDNE 1T43A 1XMIA 1JSXA 1K3TA 1WU7A 1IEWA 1C9JA 3F47A 1Z8DA 2VCHA 5DOZA 3WK9A 1QBKC 5IXYA 5JQWA 1B15A 1OZFA 2ACEA 3MWDB 3CE6A 4PQRA 1C14A 4LXIA 3C41J 3JX9A 1MB2A 3E5NA 3O91A 1E5QA 4RPJA 3SICE 2V1XA 3ESRA 1D0VA 5DGXA 1SXHA 1J9ZA 4MR9A 3THWB 1XF1A 2XYHA 2XCUA 5C3MA 4RZXA 1XAJA 3IUMA 1XHFA 5K6AA 3ZWKA 3ZJYA 1G2QA 1LDYA 1RYDA 1YAHA 3ELBA 4LSZA 3ROEA 1XRNA 4TRMA 3N5KA 2VBIA 1SN7A 4KHPB 5JY6A 5AJXA 3RS8A 3W2IA 5KSWB 2FP4A 3BL6A 5FTLA 3A2MA 1HO3A 3E2PA 3L8MA 2XUGA 4OHBA 4KFCA 3NT4A 2F17A 1G6KA 1KA9H 1OX4B 2FSSA 2QQEA 4A92A 4C4OA 5EQDA 1DHTA 2GZ3A 1JXAA 2ZP1A 3H0EA 2ZTHA 3Q1LA 3ZHRA 4RF5A 1WD5A 4JJAA 1FMTA 1KP2A 1TCBA 2QYOA 2Z09A 3CLKA 1LPMA 2JGDA 3HB0A 3MOGA 4IIBA 4RSHA 4WCFA 1CUFA 3A6FA 1CEEA 4JEMA 5J2TA 3H97A 3Q3GE 4M8SA 1KOFA 3CFYA 1C8LA 4OFZA 1J07A 5AVVA 1NZFA 1ZVKA 1KEWA 1Y5NA 1EQAA 4J75A 4KLCA 1U4SA 2OA0A 3EDOA 4HTFA 4PZCA 4W7SA 2H4FA 3VMFA 2ONCA 2VDQB 2Z1MA 4Q1VA 1PGQA 3KB1A 3TOSA 5CB6A 4AJ1A 1X74A 3ESQA 3IUQA 3TKAA 1VQ1A 1L4MA 3OLVA 2ZJOA 5ICFA 2NUAB 2I4TA 4YPVA 4HNVA 3K4QA 1YS2X 3FNFA 3ND8A 3PWKA 2NQTA 2OUKA 2VPWA 3AJ8A 4MCAA 1G8FA 4TMZA 3ZH9B 4CUKA 2WQZA 2YMMA 3S29A 4QEKA 4IG9A 1RE0A 1JJAA 1SD1A 1UJ6A 5FORA 5A1JA 2GM3A 6ABPA 1B8PA 4I8DA 3WL8A 2RKBA 3ZUPA 1OFTA 2R86A 4RIEA 3RNOA 1F3LA 5EZQA 5CFPA 4QTTB 4WY2A 3GHYA 3N1UA 2FR1A 1KMCA 1MW9X 1E7YA 5AKJA 5ECGC 3FDFA 5KYUA 1NXOA 2A4MA 4GOMD 3TO5A 5FHRA 4NXNB 3U7QB 5BVGB 4QUDA 1ECPA 1TECE 1EGVB 3X44A 3E70C 3PSAA 4CQLA 2FK8A 3CNOA 4RQAA 5C8YA 1CQWA 2ZRKA 4HYEA 2VWQA 4J43A 5KSPA 3RBXA 5KKCA 3C6BA 4X1IB 1NJ6A 1XP5A 2X8JB 1NN1A 3AHFA 3OOJA 5EJFA 5DN6D 2IYAA 3MPUA 3FUUA 2PIAA 2H1SA 5D7BA 2CD9A 3OEHD 4K6MA 2XA9A 5L95A 3KZ1E 2BTQB 3Q4GA 1I7PA 2F00A 3C16C 1ZNWA 4N0DA 1QGZA 4EDHA 4Z4QA 4JV5B 3IBFA 3SIWA 3HRKA 1KFEB 2AYYA 4NNPA 4RL6A 4ZT5A 4D41A 1LH0A 1GTMA 5BSWA 3ODGA 1CB7A 2A0YA 3I09A 2OCDA 1KAEA 4R5HA 4YROA 1R8JA 1SB8A 2A5FA 3VKFA 1ST3A 4I6GA 2I9PA 3ZY3A 4QASA 1ZOIA 4OQNA 4EZEA 1KC1A 1QIJA 1SHLA 1XP8A 3R6TA 3VKGA 5K3FA 4LK2A 4DE5A 1COWD 4KDCA 1EZZA 1Z9BA 1MB0A 2VYNA 3CU5A 4RPCA 5A6SB 4OAOA 5DNYB 2VTBA 2AEEA 4YY3B 2G9UA 3DOCA 1MORA 4MDFA 1I0IA 3RYFB 3SSAA 4Q3AA 1YQQA 4B9AA 3ZWXA 1CWUA 5K8UA 3DYIA 1Z6YA 1PD1A 3EUFA 1REQA 3F2IA 1GZHB 4XB2A 2ODWA 3W1VA 1PT7A 1WCIB 1HDYA 3AFNA 3AY0A 3EVBA 3EWAA 3KVYA 3OX1A 1EP1B 3F6EX 4JU9A 5BSVA 4Z53A 3VZRA 5I9IA 1M0WA 4PZUA 2QW0X 5ALKA 5EY5B 1L4YA 4K46A 2W42A 2XOEA 1E89A 2VJNA 1G7SA 5DX8A 3NJ8A 4BP1A 3W79A 4CLXA 2HSJA 1AK1A 4XVQA 1HYGA 5C1DA 4C7JA 1Y6FA 2ACWA 5BSTA 1GILA 2YYAA 4D3FA 4KBFA 3GUVA 3RUAA 1A5BB 1UBJS 2W6OA 1H65A 4EZBA 3NAMA 2OV4A 1NF3A 1TK9A 5C1PA 1BXRB 3L9WA 1PS0A 5KNLA 1DKPA 2LE0A 3Q85A 2J08A 2AE2A 1BJTA 4FE7A 3SP1A 4EPTA 4XWKA 5H8WA 3WK5A 2ZANA 5DGTA 2VJPA 3T3DA 1ZU5A 1XZHA 2RHWA 2GYVA 4RJLA 2QTHA 1IHOA 1U31A 1JHVA 3C14C 2J5XA 2I3DA 2BMDA 3AFGA 3O2QB 1PJAA 3AR9A 5CA1B 4CVNA 3S3TA 3P26A 1T1RA 1U3CA 3UNXA 1Q92A 2I29A 5GONA 1PDVA 2IYXA 4Q9JA 1TT5A 5E7MA 2PUEA 1K1EA 5LQMA 2P41A 2YNMA 3IAM1 4K81B 4XASA 3UIEA 1OCEA 2QORA 2Z8XA 4J1TA 1OI7A 1RXVA 2PS0A 3QPAA 3A6LA 4H27A 3T0FA 1XZKA 1GPMA 4D9JA 1TIBA 5FO0A 1ZFNA 2HA7A 4IIJB 1KXJA 4JT9A 1VOTA 5CDYA 2P68A 1QR2A 2PEYA 6Q21A 1MP0A 1JKXA 1LDBA 1OVMA 4R41A 4XQGA 2AJTA 3ORFA 1PJ2A 3B6KA 3O9VA 4JU8A 1SC3A 3Q7IA 1Q57A 4G0YA 4MQLA 4Q34A 3EEIA 4G4IA 5FLYA 1FVOA 3T35A 4MVJP 2ZBQA 5B4UA 4QDZA 5HUQA 2ESRA 1B8VA 3HUDA 4UVDA 1BOOA 5F1OA 5L3ZA 2CHVA 1PX2A 2J9RA 4FCCA 4DLKA 1T34A 3QE0A 9ATCA 3EZYA 3PCXA 3SAJA 3CX3A 4OQZA 4TSFD 5J9FA 1A95A 1E2HA 3DD5A 1ZCJA 4DUGA 4XSVA 1II8B 2QB5A 3HS3A 1Z8FA 1P44A 1Z68A 2QTLA 1GPKA 1WW3A 2Q2NA 1GUBA 4GAEA 4UD6A 3WIEA 5B2FA 3HWRA 2MSEB 4IBOA 2SCUA 1UM9A 1SIBE 4GX2A 5BVGA 2QRKA 2J4FA 4ID9A 2IPNA 2Q8NA 3GEHA 4M1QA 5D85A 4Z4IA 1Z56C 1LI7A 4FCWA 5EPEA 1KWGA 2C77A 3WIUA 5T7BA 1VI6A 4FEAA 1EUCB 4MV0A 4C0LA 2RHDA 5LDGA 4EYGA 1DFGA 1ZI9A 4TQUS 1AF4A 3EGXB 1N1DA 1T15A 2ZSEA 3PQ6A 4IIFA 1GAQA 4P7BA 5EXTA 5C0OE 5B2ZA 4WBXC 3DE3X 1XL1A 1RM4A 2H1WA 2HSEA 4H18A 2GBLA 2Y9MB 4M76B 1U02A 2J9ZB 3T3EA 3VYVA 5JNTA 5E9QA 5LWHA 2EJTA 1XEXB 3L6BA 4FS3A 2PRSA 2HPZA 3HCOA 1Z28A 2IX9A 3HRHA 1LZLA 2OBBA 1ABEA 2FHSA 3BSYA 3MLEA 3MJCA 4JHXA 4MMYB 4WFIA 4RHCA 2Q8PA 4JUAA 1YVEI 4WUTA 4BU1A 1PT9A 3AH8A 1PFQA 3PJFA 2FLWA 3DCYA 3GT3A 4OHXA 3ET5A 3ZWMA 5K8JB 1KEUA 1L9XA 3D6TB 4UASA 3RS7A 5HQ3A 4P4TA 2YINC 3RYHB 4BV9A 2NN3C 3LDFA 3F3KA 3G1TA 3WRVA 4XWWA 1HUQA 3V2GA 4L27A 4YJFA 5BVHB 4HJXA 2PXHA 3DLTA 4MUMA 4PC6A 4AF7A 4OM7A 1EGQA 3TM5A 5GTDA 1VL1A 2WVJA 1Q0LA 1H0SA 1KYWA 3J81A 3M2TA 4DA6A 3T3GA 4BN0A 2MDTA 3OIFA 5EESA 4MA5A 1FFEA 2JA2A 4I8XA 2JFOA 3GY0A 5GMOA 3ZOZA 4F04A 4A26A 3REFA 3OG9A 1PN3A 3OQJA 1IY2A 4MWDA 4RZQA 4DA8A 3CSSA 2X9NA 1JEJA 2VQ3A 4AZ3B 3B7GA 1MDBA 1ODIA 3ELUA 3LP6A 4HDRA 5EUBA 4HAIA 1P9LA 1T2UA 5SY4A 1FMCA 4ETIA 1DX9A 4EKYA 5DTQA 5F73A 3VHXB 3C87A 5HIKA 4HEA1 1U11A 3T4XA 2XGJA 3H42B 5ISMA 3BIWA 1KK1A 1E6LA 1A9TA 1F1JA 2GRJA 1SXJC 2WICA 5CURA 3WTCA 2JLUA 3BWBA 3LUDA 5GJBA 2NMVA 3REOA 1C3EA 1R8QA 1BDJA 3GU3A 5SYMA 1E3MA 2X14A 5FOTA 1N32B 9LDBA 3FWHA 1AO3A 1T8RA 2CVQA 5A4IS 4QHYA 4S1TA 4YV1A 3GIWA 2QXTA 3AFOA 5JSFA 2LNDA 2QWXA 5JCOA 4FZJA 5FFMA 2H0RA 4EA6A 2JANA 1EFHA 3DJFA 3HMKA 1XAIA 3DJYA 1Z25A 4EMSA 4ZZIA 1Y33E 3ETJA 3TW8A 4MMXB 1X42A 2HDHA 2LV8A 5TPWA 2DWCA 2IV7A 4BN4A 3KALA 1PIWA 1AN9A 5DXFA 2HPVA 3CRW1 3D6UA 1W2WB 4URUR 2GCOB 5AW2A 3BXZA 1ELOA 1MJHA 4FJ2A 2WE7A 3T5BA 3EEOA 1GDTA 4ZYLA 4RTOA 4HQLA 1JEDA 3KOUA 1RLIA 2W7TA 2ZJ4A 4Z86A 2AR9A 3R5JA 3EY4A 4BEWA 4OKSA 4P0TA 1GM5A 1SC4A 2OXFA 2PH1A 3A31A 3ZYCA 1G7CA 3CF4A 2OK7A 4GWGA 4DPKA 5LQCA 3BD8A 3FCSB 1M8GA 3OZSA 4H31A 4LHEA 3FUTA 8AT1A 2E82A 1ENPA 3VKUA 2PBZA 9GPBA 4TVOA 1KEEA 3U16A 3I5UA 1N7HA 2O52A 4RVDA 1AZSC 1G60A 4NPAA 1MOSA 5F52A 4F8JA 1U0OC 3TTUA 4S24A 2ZI5A 3TW8B 1WDWB 1B2RA 3KB8A 1U63A 4U7HA 2VR1A 4Q12A 1PLJA 3FCXA 2C0PA 1PTJA 2H00A 3PGKA 1IN7A 2EU8A 3MRTA 5AUOB 5FV4A 2WQ7A 3DLBA 1SPXA 3FYSA 5AIAA 2H4WA 3OQIA 1VHLA 3QFFA 3OZAA 4B3XA 1GDHA 4Q1DA 2ZRAA 3CJQA 1D04A 3H0KA 1ETUA 3CTPA 1EBBA 1JFRA 3I01A 1E3WA 3NONA 3NBXX 4N1AA 1P9OA 5EWMA 4IZHA 3N7AA 2VDRB 2XMZA 3PJEA 5DF1A 1IYZA 1Z33A 4L9AA 3IAUA 5LYJF 1HQKA 3W7AA 2KMLA 4R1OA 4HWSA 1HTTA 4ER5A 5JPDA 3E9NA 1NAHA 2V7BA 3PL1A 5FJJA 2FYTA 4YN3A 4AZ3A 1KARA 3OHPA 1C3VA 4NDZA 4JZKA 1JDVA 1M2VA 1X1CA 1M2EA 4ME6A 2WWXA 1N78A 1BWRA 2H18A 1W94A 4Z99A 1EPUA 1NPDA 2OESA 3DLIA 1OFIA 4H0FA 1AA6A 3AR3A 3DQQA 2REQA 5FBZA 4DPLA 1JLLB 2PZJA 1ENZA 3IL2A 2WSYB 1E58A 1N77A 1KP3A 2OPBA 4O33A 4B5KA 3LHFA 2JH8A 2PZGA 2WSBA 2VHXA 4FKBA 2AEMA 1KXZA 4R8RA 2YOFA 5KQRA 3AEZA 2GAFA 1U0LA 3KEGA 3MBOA 3W06A 1V8BA 5IH3A 2F8SA 3L8DA 4EMTA 4K8RB 1QORA 2Q7OE 3VO2A 4B4VA 5I7AA 1W4CA 1KAGA 8GPBA 1XG5A 1F60A 4UPEA 4RYDA 4MVJD 4YJ3A 2IYSA 3IRVA 3BEDA 5AXBA 2OAEA 4MV3A 3F3SA 2BSAA 2QX6A 3E7XA