1NF3A

Structure of cdc42 in a complex with the gtpase-binding domain of the cell polarity protein, par6
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
194
structure length
194
Chain Sequence
GAMGIQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGLEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G25K GTP-binding protein, placental isoform
publication title Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 66
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1nf3A00
1EFRD 4R71A 1R2QA 1GIAA 1YVDA 3P4YA 5UKDA 1AQUA 3T35A 4A2PA 2QL6A 4CDGA 2RB4A 1VPLA 4LV5B 1XTQA 3W6PA 3AGQA 1P3JA 2GXUA 1SKYB 4LC1A 4L4UA 1JR3E 4QFMA 1GM5A 1AJEA 3BWDD 5DI9A 1XXHE 4K81B 1X8LA 1KZ7B 3K0FA 3MJHA 1B23P 1R8SA 3J81k 1XD9A 2O0KA 2ZJOA 3D31A 3QE0A 3GLGA 4UNSA 1E2IA 3GEEA 2FJUA 4B3FX 4HSEA 1GL6A 3B9QA 4IDNA 1NVUQ 2P5TB 1RRGA 1Z29A 1SHZA 4AKIA 2QQEA 1II9A 4AKGA 4MRVA 3GFOA 1P7CA 1XX6A 4YMVA 3LY5A 2KBFA 3RWOA 1H8HA 2IS4A 3RC8A 1AN0A 1T5LA 1FMLA 3IIKA 1E2QA 2AD5A 2BKUA 5SZJA 3W3ZB 3CM0A 1KSHA 4BFXA 1QBKC 2VH5R 4CEJB 1LS6A 1E69A 1T4GA 4A2QA 2I3BA 2D2FA 4RY2A 3P1JA 1E9CA 1G8GA 1ZUNB 2C9CA 2P2LA 5DLQC 1G5RA 4JVSB 1K6MA 3MCAA 4H1VA 4PQRA 4Q9HA 4JBWA 5EXXA 3W8NA 2GCOA 1M6NA 4HZIA 4W5JA 4TLCA 2O5VA 5C2JB 4Z1MA 2AXNA 3SU8A 2IS2A 1OXTA 1Z08A 4NKRA 4U02A 4BFSA 1LVGA 2CVHA 4A6PA 3T1OA 3IHWA 3MUFA 3OEHA 3QPWA 5KNBA 1XEXB 1DO2A 3NIBA 5C4MA 3QKSB 4Q1AA 1YU9A 2ZUCA 1G7CA 1RJ9B 4GMDA 4KYIB 3LNCA 4GPTA 5EJEA 4O2RA 4WXRA 4OQNA 2ZXUA 4XD7A 2IUUA 3I5YA 2QMOA 4C0LA 2VO1A 2R44A 1KI6A 2VSFA 3QVVA 1IAQA 3W3AA 2C9YA 2GEDA 4TYPA 4A15A 3R8CA 1KSJA 2CE2X 2V6JA 1OIWA 4URYR 4HLDA 1W7AA 1NY6A 3ZQ6A 1KI9A 3BIFA 2IHYA 3U3OA 5D3QA 2QT1A 1TUIA 1ZU5A 3A4MA 3CH4B 5FTJA 3MMPA 2XNDD 4EFMA 4B3XA 1TU3A 1JBKA 1LV7A 4M9XA 5GJBA 3T1TA 1G4AE 4NYIQ 3AQ4A 1OB2A 1Z5ZA 2IWHA 3ZDQA 3KZ1E 4M4SA 2ZE5A 2NTYC 1E1RD 3AVTA 2HCBA 2VP0A 3BE4A 4HUQA 3L0IB 1WMSA 4JYBA 5K8IA 2YV5A 1G21E 1ZCBA 1ZM2A 3MFYA 4QBHA 2WJYA 2GRJA 3DM5A 1KK1A 2IC5A 5A5GA 1T3LA 4PR0A 3QF4B 1WQ1R 3T61A 2BMEA 1OHHA 3AVQA 4E22A 4JKYA 1VHLA 1E6CA 2Q3FA 1UKVY 1U8ZA 3HU2A 4DLZA 3GJ6A 3CUEF 1W46A 1BYIA 1BYUA 2NMVA 1EX6A 1G9XA 3R7WA 3B9PA 1KSFX 1GNPA 2WICA 4D6PA 5KUTA 1EFHA 3A4LA 4BUJA 3W5JA 5IRCD 1P6XA 4PAOA 5EP2A 1CP2A 5JI3E 2IS1A 3VR6A 5JHHB 2G6BA 4FCWA 2RHDA 1YR7A 3C15C 2NO6A 4DWJA 3ADKA 4Q4HB 2A78A 1K5DA 1W36C 3A1UA 4FXPA 1XWIA 2BMJA 2I1QA 2J0VA 4US0R 1YR8A 4DB4A 3QBVA 2WIAA 4PC6A 3GLHE 1OKKA 2GZDA 2WWXA 2NGRA 1QHXA 2GCPA 2DHRA 1ZM7A 2EQBA 721PA 1T9HA 3HDTA 4OL0A 2V9PA 4KLNA 4AK9A 1XEFA 1N5KA 1IN6A 3RWMB 3SZRA 4Z51A 2X19A 1IXSB 2FGKA 4TMWA 5KSZA 4MKIA 4A0GA 4TL9A 3NC1C 3OIVA 2WWYA 2OSBA 2QZ4A 1BO6A 3HYRA 4Q19A 5KPDA 4PZYA 2H92A 2WPDA 4Q02A 1NVVQ 1Z06A 3EG5A 3MAAC 2IT1A 3IKJA 1XJ0A 4LYFA 3TQFA 4PC1A 5TDHA 4IDPA 1FUUA 1EWRA 5DI3A 1E2GA 4HB0A 4FMCB 3GCGA 3TJZA 2IXEA 4M2LA 2QI9C 2PCLA 2WJIA 2X77A 3QKUA 4GI7A 4IDHA 1DADA 4IW3B 4Q21A 1EWQA 4G5RA 3ZH9B 1XZQA 5CLLA 3ICQB 1KHTA 3GP8A 3AP2A 3RRYA 4TN1A 1XU4A 1ZBDA 3RHFA 2G1JA 4JLNA 5IT5A 3W8RA 1G5TA 1CXZA 1DPFA 2P67A 3FMIA 5E3HA 2PT7A 1U0LA 1UAAA 3LD9A 2F1JA 2XXAA 4V02A 4QBIA 4Q1EA 2VHUA 2REXB 2HT6A 1GG2A 1KO8A 1LS1A 3I8XA 1F2UB 5C4GB 3NWJA 3H84A 2BM1A 2OCYC 1E96A 4QRHA 1MO5A 3A4NA 4F7WA 4GOXA 5JLJA 5FPYA 2HT1A 1C9KA 2C8VA 2BM0A 4B74A 2BCJQ 3VAAA 4DUGA 4OBEA 2RGCA 1UFQA 1OLOA 4I1OA 1Z2CA 1W4RA 3AF0A 3T12A 3IHLA 4LHXA 4O2LA 2GF0A 4A82A 3VKGA 3I4LA 3LO5A 2WWGA 3LLUA 3SJCA 3VR2A 4D25A 4PAMA 1E9EA 4D4LA 4G1UC 2IUTA 2QPAA 1G291 2ZRIA 1ZJ6A 2ZSDA 1OFHA 2ZE7A 1II0A 1CTQA 1TADA 1SVWA 5CYPA 4BZQA 2CDNA 5B64A 4ACAA 2CJWA 4A0RA 2ZR9A 5KSOA 1AS3A 3HWSA 1T6NA 5L8VA 3V4FA 5M04A 4OK6A 4A2WA 3REGA 1W1WA 1SXJD 1M74A 4V03A 2VEDA 2OAQ1 2PZEA 4OQMA 5G41A 5DISB 5HE8A 5LBIA 4OKSA 3TAHA 4U00A 5JMTA 5KSYA 4B76A 1GAJA 1QF9A 3BK7A 2Q9BA 4M22A 3K09A 3EA0A 1AZSC 3R20A 1P4SA 1PV4A 1DAIA 2J45A 1TQ6A 1Z22A 3IGFA 1T3HA 3AVOA 3CRVA 4P32A 4DLSA 4U7DA 3UWOA 1XEWY 3KFVA 3L0SA 1A2KC 1E9AA 2JLQA 4Q03A 1VCOA 3CPJB 4R2IA 3K1JA 1WA5A 4M21A 1W2GA 1JR6A 3EWAA 3TRFA 4LJ5A 4Q7JB 1ZW6A 5FL3A 1F6BA 1FTSA 2IYYA 3NVAA 3GLFA 1DBSA 1MR3F 4HB3A 3ZS8A 4B75A 4PC3A 1SVSA 2G9NA 2XJ4A 1Z8FA 3VNVA 4DXAA 2SHKA 2GESA 3SOPA 1CJKC 2HF9A 1GRQA 2ZSAA 3NBYC 4MITA 5E4FA 2J0SA 3GLIA 1NBMA 1UEIA 1FNNA 1IY2A 1X8JA 4MKFA 5KU1A 3GEHA 3CRRA 3UK6A 1W0JA 2W6ID 1XD2A 4FN5A 4D4JA 4EPRA 3WNCA 5HZHA 1HQCA 1QDEA 2VHTA 5JHGB 1JR3D 3HYTA 3NDBB 2AL7A 4HI0E 3Q72A 4A0FA 4C0SA 5DIFA 1P2VA 1Q21A 4BLPA 2QU8A 4LBWA 3W6OA 2QROA 4XVRA 2RGNC 1H8HD 4H9GA 3PEWA 3AKYA 2ZRLA 3I61A 1VYTA 4Q4AB 3QIAA 4MUAA 4OK3A 2O8FB 2OEPA 2W0SA 3T15A 2XTZA 3ND8A 2ZI9A 2E87A 1GRRA 1ZM4A 2WJVA 3PUXA 4LX0A 4JLPA 2PEZA 4RKEA 4A0HA 5DHAA 4ZIRB 2GILA 4GMXA 1NVVR 1XF9A 4B6EA 2IYRA 5JWHA 3RDPA 3OE7A 3HU1A 1OJLA 4IJMA 1W4AA 4WAUA 2QAGA 4BASA 2PMKA 3WP0A 3U2QA 4Z1MD 1BS1A 1S8FA 1W2HA 3EPKA 4NH0A 3BS4A 3SJAA 4E5UA 1P2SA 4UNRA 4GZMA 1U98A 1J70A 1WCV1 2JLSA 3X1ZA 3AUXA 3SFVA 4JJKA 1TL7C 1G7TA 3ZGXA 5EP4A 2CNWA 4YDHB 2BMFA 2E9SA 3KKQA 4FMDB 2GNOA 2WWWA 2F3TA 4ABYA 4S35A 1DAGA 1KI2A 4XD7D 1W44A 2XNDA 3CW2A 4QKQA 1NF3A 3IEVA 3BD9A 3W90A 2KJQA 5JS7A 5L3VA 2CHVA 3FFBA 3C7KA 1RVDA 2FFBA 3BFKA 1WBDA 3IILA 4LJAA 1E1RA 2GZAA 3QUSA 4UXJA 2QTHA 2VIIA 2WAYA 5DO9A 1QHHB 2JDIA 3AH8A 3PR1A 5AJXA 1QG4A 1TF7A 2R9VA 3JVUA 2Z4RA 4DLVA 5BW8A 3SYLA 5JBQA 5KDOA 5LD2C 3PUZA 4GP6A 1WXQA 3DHWC 4YMSA 2WOOA 5EUQB 3TW4A 2DY1A 5DN6A 4A1FA 1JAHA 3U3KA 5G3ZA 4NCIA 5FOSA 3REFA 2X2EA 2D7DA 1VG1A 4ARZB 4D0GA 3GD7A 2H16A 2VRWA 3CRQA 4RCYA 2DCUA 3ASZA 4I1VA 1NSFA 2KWIA 2OV2A 1S4QA 2ZRPA 3HP1A 3VMFA 1Z0JA 4MRSA 5CJPA 3M1IA 3RC3A 3ZVRA 3CH5A 4LUCA 2OE2A 2FSIA 2QPTA 4WA7A 3NXSA 3RLFA 3ZVNA 2LKDA 5GJCA 5J47A 3A36A 1VTKA 2BBWA 4I4LA 1HT2E 1OHHD 2A5GA 2JLRA 4V0MA 3KDSE 1WP9A 4V0KA 1KMQA 4TQAA 1SXJB 4LBVA 4YQFA 1UBCA 1VG9B 1XCMA 1D8TA 4YMTA 4HAWA 3U3JA 4LI0A 1E1QA 2FPLA 4R7ZA 1VHTA 2WJGA 4MKGA 2CLCX 4BZXA 1YZGA 1L7VC 2A30A 1FZQA 4B35A 4CYMA 2YKGA 4HYYA 1ETUA 1Z2AA 3CX6A 4G5OA 5FBRB 3U3MA 5LDDC 3I8SA 2N46A 2YC4C 2RGXA 4Q66C 4BFWA 3EZ7A 3ZIAD 1QG2A 4WBSA 5HKKA 2XTNA 1ONBA 3K8YA 2FPKA 1E4VA 3GJ3A 4WW0A 3C14C 1YZUA 1SHKA 3L82B 3PEVA 4PC2A 1M7HA 3BOSA 2FZLA 1OYWA 3NBXX 3U7FB 1U8YA 3EIEA 3AVYA 4OI0A 3BB4A 2ZYWX 3IPYA 1E9DA 3LWNA 4W5HA 3DKPA 4MGKR 3TKLA 5JWRA 1D2NA 2EVWX 4PPNA 1MOZA 1OKKD 4LOAA 1CR1A 1KGDA 2NG1A 2XSZA 4KFRA 1J90A 4I81A 2WSMA 5EE1A 3K0FB 2VP4A 1FQKA 3LBNA 2OUKA 1MO6A 1U9IA 5AUOB 2FGJA 3NG1A 3KQKA 3GLGB 1KMHB 3H2YA 2UKDA 4ESHA 2RGEA 1XBTA 2KBEA 2YWEA 3O47A 2ZRCA 2XZOA 3I62A 1AKEA 3DMDA 1ESMA 1XD8A 2VPPA 5GJVC 4FI3C 2QP9X 3AF1A 121PA 3F0TA 1DO0A 1M7GA 2BBSA 2OBNA 5AUPB 5DYGA 1VCMA 2LWIA 2IYXA 2LCFA 3A58B 1KAGA 2J5XA 4M1KA 4RFSA 1P73A 2J46A 1JECA 1AS2A 4RZ2A 1RE0A 3JVVA 4EJSC 2RHMA 3FB4A 3BB1A 4DIEA 1J8MF 2A5DA 1JI0A 5KPJA 2HXSA 2GCOB 2X1VA 2FMXA 5KNCA 1H65A 1E0AA 1MABA 1N6OA 3MSXA 1ELOA 4ZDWA 1KDTA 3EARA 1QHGA 1P61B 1E99A 5FR2A 4ZDIA 5BXQC 3IBYA 4HDOB 3U7HB 1RYFA 2WJJA 1KIMA 2WBLC 1YRAA 3G82C 5EZ6B 2KSQA 5AJVB 2JLWA 4KLZA 3A1VA 3EZ2A 1KYIA 4NU0A 2QG6A 2ZSBA 2ZVQX 4PO9A 3WYGA 4ARZA 2G88A 4DUGD 1KI3A 1OSNA 2J3EA 1LB1B 1KI6B 2HF8A 3B85A 3RSOA 4HAUA 2I1VB 3CIOA 3LX5A 4O0MA 5HCIA 4OI1A 3JZAA 5FOTA 4AURA 4AG5A 3I73A 4E09A 3RS0A 3ONWA 3SNHA 5K8TA 1PVOA 2QGNA 4C0KA 1YR9A 4N1AA 2YVUA 2QQ0A 1MT0A 3OZXA 3V00A 4DSTA 3PUVA 1KY3A 1WE2A 2C98A 4DC9A 1HQYE 2DBYA 4TT3A 1EGAA 5G3YA 2PX3A 3BC1A 4RD2A 5DE3A 3VR4A 4B3GA 2GKSA 4LHYA 2QNRA 4JYCA 1GWNA 3PG5A 2FOLA 3KKMA 2IF2A 1F3OA 3CB4A 2D7CA 1UKEA 3L43A 4HUQB 3RANA 3VQTA 3EPJA 1DAHA 1G64A 4IVPA 1CKEA 5D3MA 3GJ8A 1T91A 3EWSA 3EX7C 3B1VA 4DHEA 1N5JA 1KJWA 4OQLA 4IOLA 4DBLC 1W4BA 4FWTA 5HE9A 3B60A 3K70D 4NCNA 2ERXA 1JJVA 1VG0B 4QC2A 3IIJA 4A8JA 2UVQA 5BN4A 2J1LA 1YZKA 4W7SA 2YC2C 521PA 1Q0UA 2GJKA 1XCGB 1L8QA 2PLRA 2WWFA 2XNSA 4M1OA 3SQXA 2IK8A 2PH1A 2ZROA 1XMVA 5FUXA 3QXCA 4XOIA 3WBKA 1CJUC 3BH0A 1U0HC 3FHOA 3R7WB 1ZYUA 4R98A 3VFDA 2R2AA 3GEIA 1AA9A 1NKTA 4B34A 4DT1A 5JSZA 1HUQA 2GVZC 3BJIC 2IW3A 3KXIA 4DLYA 2QTVB 4GOKA 2B8TA 1OIXA 3KKNA 4JL8A 2VP2A 3ZYCA 1YZQA 5J4LA 4TZ6A 2W6IA 4PHFA 1KDOA 3TSZA 2BKEA 3QF7A 3AKCA 3EIQA 2Q9CA 1KMHA 1Q1BA 4W5WA 4B33A 4QGAA 2NO0A 1JR3A 1U81A 3S1AA 2BDTA 2PZGA 1O87A 3QSYA 2AN9A 3VR1A 3UMSA 1XXHA 3GLGE 1JALA 2IXGA 2ZJAA 1WDTA 4RD0A 2W6JA 1NBMD 3K0CC 5BN3A 1I4DD 4EFNA 4DLWA 1JB1A 1AZTA 1S96A 2F6RA 2QMHA 4HB2A 4YLGA 5JI2E 1W0JD 5E7IA 1OV4A 4QG7A 1OH5A 3TH5A 2FFAA 2FZ4A 2VF8A 5FOUA 2Q9AA 2WJHA 5G40A 3ZZ0A 6Q21A 1II8A 5F9FA 4US2R 3EASA 3W5IA 2H18A 3FVQA 1GKIA 1ZNZA 2CHGA 3LLMA 4PPGA 4B3CA 4AKEA 4XSGA 1C4OA 5FBVB 3AF4A 4D0LB 4F4JA 1U99A 2OG2A 1Z0IA 5HZKA 3THXA 3A1SA 3Q8XB 2ZETA 1KJZA 4MYTA 3H0KA 3SI7A 5CDFE 3UXMA 4WIAA 1NLFA 3MWYW 1CEEA 4WZBE 5TXGA 3FTQA 2XZLA 1TPZA 4QNMA 3U4QA 3LQQA 3E70C 3AVVA 1K8RA 1T8UA 2XTMA 1N6RA 1G41A 2JA1A 1TQ4A 2PT5A 1Z6GA 2H7VA 5DI3B 3CF0A 3N2EA 2JATA 2ODWA 3OE7D 4DEXA 5E7JA 4P4TA 4X8MA 2RCNA 5E7MA 2ZI7A 4DVGA 4EQ6A 3N70A 3BORA 4UJ3A 2A5FA 4AIIA 1M7BA 4AD8A 1AIPA 4AG6A 2GXQA 1GP2A 1GNQA 3ADBA 5F98A 3KTAA 1YZTA 3SYNA 3GFTA 4US1R 1JXOA 4Q9LA 3RSLA 4XVUA 1M8PA 3PUWA 4LHZA 2VA8A 4IEEA 1CULC 5BN5A 2ASEA 1ZD9A 3RVBA 2CNWD 3KXLA 1GUAA 1XMSA 2GHIA 4QM6A 2Y8EA 4LZZA 4DDVA 3B1XA 3PIRA 2XXAB 3QOFA 4Q01A 3IQXA 2MSDB 2ZRNA 4C0HA 3TSOA 2ZITA 2OLKA 2D2EA 1OFTA 2FE4A 2JLYA 1IQPA 2YYZA 1ZNXA 1ZUHA 1QHIA 5H8WA 3L8ZA 3QG5A 2AHOA 4EDHA 1QHNA 4WOPA 2Z43A 1T0HB 3K09C 5FUVA 5C18A 1E2EA 2C9OA 1FMJA 2JDID 2R6FA 4Q7KA 1KNXA 2W0MA 4F38A 3X1XA 2QP4A 1I4LD 2FX3A 2R8RA 4HEJA 4BFUA 2DB3A 1ZMXA 2HJVA 4P33A 2FWRA 2AXPA 4QGFA 5DN6D 4ESVA 4ZI3A 2AWNA 4B44A 2QM8A 4CRWB 4OK5A 2ZYTX 2VHQA 2OFWA 2RAPA 4H1UA 4MH0R 1O3YA 2GDJA 4F4CA 1LY1A 2ZSEA 3DZ8A 2F1RA 2BHRA 1OH8A 1SULA 2CJWB 3OHMA 2ODBA 3DMNA 3X1YA 1SKYE 3QQ5A 4PC7A 2XAUA 4J0QA 1VDZA 4PFSA 1K5GA 4IEIA 4RD4A 4JT2A 3ZIAA 2HUPA 2PEYA 1GKUB 3GQBA 3MG9A 2FPMA 3RYTC 3K70B 1E1QD 3SDZA 4BFTA 4BEJA 1R0YA 3Q9LA 5GADl 1Z07A 3PVSA 3SS8A 1E2JA 2B21A 3B8HA 4IXMA 2EFGA 1XTKA 5LB2A 4BLRA 5HKKD 4D26A 3QENA 5EE0A 2ANCA 1CJTC 1MRNA 5FTMA 2IUSA 4MGYR 1Q57A 2IEYA 3NH6A 2J9RA 3IUYA 4DLUA 3GLFB 3OEED 4Q48A 2ZRAA 4BLQA 5CYOA 3QKRA 1KDRA 4X8OA 2FEOA 1KI7A 1EK0A 2EWVA 4M1WA 4JKIA 2YOHA 1W5TA 4L15A 3GLHA 2LKCA 2VSOA 3V9PA 3ICEA 3IEUA 2OFOA 1GRNA 2WMOB 2ZE6A 4D2IA 1GKYA 4F4IA 3AGPA 2XSZD 4M1YA 3FFAA 4ACBA 5L3SA 1RKBA 2A7QA 4A9AA 3GLIB 4GNKA 2MMGA 2NIPA 2OHFA 3QKTA 4LBZA 4TMKA 2HYDA 1R4AA 4LYJA 2GXAA 1TAGA 1G3MA 1OFUX 1XD2B 4M9SA 4NDZA 2IS6A 5FH9A 2E1RA 5FR1A 3DKVA 2DYKA 1RRFA 1LTQA 2OT3B 1IONA 5AR1A 1GFIA 3AM1A 3TR0A 3ECCA 1NLYA 2O52A 1NJGA 2OM2A 1HEIA 1E0SA 5IHPA 3G0HA 2XOKD 1JPNA 1KI1A 4FINA 1QRAA 1MH1A 4DLRA 1E9BA 2FA9A 4DJTA 1P5ZB 4M0LA 1EX7A 2P6NA 3MRSA 2K5UA 2W00A 1ZD1A 4LJYA 1HA3A 1OH7A 4MQBA 2D74A 5G53C 2R6GA 4AY2A 4PHGA 5HCNA 2VLIA 1CS4C 1UKZA 3DOEA 3MWKA 3EPLA 4PZLA 3TUJC 4NTZA 4P4UA 4LK2A 2HLDA 2QAGB 2MSCB 4Q18A 4XWOA 1OXXK 2WWIA 4PSKA 2H1LA 2WZQA 4TMTA 3WRYC 4QHSA 5AJWA 3IPXA 2ZI4A 3LH5A 2ZU6A 5JS8A 1FX0A 3THOA 2ZTSA 4TYQA 4B47A 1SZPA 4DDUA 3DPUA 4RD1A 3UWKA 4NYJQ 1ZC3A 3U6BA 4UXIA 1F48A 1LF5A 5AJYA 3VU9A 4Q9IA 4TL6A 5FBWB 1DTSA 4PZZA 2Q21A 4QHYA 4NYMQ 2WV9A 2WMNB 3O8BA 3RRMA 4TTQA 2BEKA 2CHQA 2QSZA 3KFXA 1DE0A 4NYIR 4XWAA 1TQ2A 4BLTA 4TT3D 2WSSA 4G0NA 3KQHA 2HEIA 3SC3A 5KDDA 4FWIB 4URUR 2V7QD 2QM7A 3WHKA 4FCTA 5FTKA 3P4XA 4URXR 2F7SA 5HR5A 2QPOA 3AVXA 3F3YA 2H57A 4G01B 3RS7A 3VHXA 3U5ZB 4TWZA 4KSCA 5J5CA 2EYUA 3UG6A 2BJVA 2HXYA 2QORA 2WKRA 2GAOA 1RC8A 2QMEA 4GSYA 1E79A 4MRPA 4EKDA 1JQLB 2REOA 2QBYA 1X1RA 3QPVA 4RZ3A 1T5IA 1JEEA 4ZDKA 5DSZA 5JZVA 1BIFA 1TF2A 2QRNA 1G6OA 3K9HA 2GAAA 3H86A 1JXMA 2WOJA 4UJ5A 2HDNB 2F55A 1U9IC 3X1DA 2RGBA 4QJ4A 4KI0A 3K0EA 3LRPA 3B78A 1E2HA 1PUIA 2IYUA 4YXWA 5KYKA 3T34A 4B6FA 4URZR 1MV5A 2GBLC 1Z0KA 1L4UA 2QUZA 3MD0A 4NP6A 1DARA 2FSHA 3W9YA 1XB2A 2CBZA 5CLQA 5CM9C 3GLIE 1NY5A 2WVJA 3T5DA 3ASYA 2O8BA 4KV9A 2CL0X 3PEUA 3EC1A 4HAXA 4ASUA 3AVUA 4MGIR 1GILA 1B0UA 4LRWA 2W6JD 1VIYA 2XEXA 4JZKA 4WVFA 1G3QA 4LJ9A 2A5YB 2BBOA 2O0HA 4MRRA 4HATA 2ECKA 3WNBA 2CXXA 4F91B 5BYKA 1D2MA 3FMPB 3GPLA 1NRJB 1FTNA 3DL0A 1KJYA 3THWA 1CR4A 4C3ZA 5CJ2A 2VL7A 4C2UA 1HE1C 1HV8A 2IYTA 2PLFA 1X8KA 4EIWA 3GMTA 2O8DB 3CRW1 3K0AA 1LF0A 2ZS8A 1XCPA 3FMFA 4EAQA 3O8RA 1ZNWA 4DDTA 1SVIA 2QP3A 2RMKA 4N0DA 1BOFA 4FW9A 5EXTA 2Z83A 2MMCA 2ZRMA 2I4IA 3W6NA 4LSGA 4POAA 2ZREA 3IQWA 5CB8A 2HV8A 1A82A 1Q22A 3AUYA 3DOFA 1EG7A 4IDOA 1U94A 5IK2D 1OB5A 2UZIR 4GL2A 1UBGA 3CR8A 3AVPA 3H4MA 3RRNA 4ZPXA 1WBBA 4CT5A 2ZRHA 2AWOA 1KO7A 4URWR 4JLBA 3KUCA 2CCGA 3WP1B 4KBFA 2GZHA 3TUZC 4L5BA 4LBYA 1G5PA 3U7GA 4JLDA 4KAXA 1TTTA 3VKHA 3AKEA 4RFSB 3IDQA 3ZZTA 2P0EA 1P75A 4DCSA 4ITRC 1QHYA 1NLZA 4E03A 4LPKA 3SJZA 1A1VA 1SXJC 4UQOA 1E98A 2QT0A 4TMVA 3B1YA 2WTUA 3TGPA 1NIJA 4KVGA 2DWQA 4HAVA 4NCHA 3A1TA 4QM7A 1MABB 4AYTA 4C0AC 1XTSA 3P27A 1IN5A 5SZKB 2A3RA 1S2MA 2D4HA 3HR8A 5FBQB 2B8WA 1QZXA 2DFKB 1U0JA 4KVAA 2O8CA 1ZIOA 1S9HA 4EPWA 5B2ZA 1G8PA 4UNQA 4RD3A 3G5UA 4Y0AA 4B2LA 5CM8B 1KK2A 4YC7A 1PUJA 2EYQA 4L9WA 4Q7LA 1G8FA 1G4UR 1VCIA 4JS0A 1EFCA 4S2EA 1RFLA 4A8JC 1EESA 1IY0A 1ZCAA 2ZJ8A 2XX3A 4LC0A 2H8KA 1X86B 4OJQA 2VP5A 4P4SB 4NYJR 1YZNA 4I99A 4ZO4A 1QVAA 4FIDA 4PSAA 3TVDA 3WYAA 1SVLA 2JJ1D 1T3SA 3A6PC 4NYMR 3R9XA 4KSBA 4Q7MB 2DFTA 4EPXA 1OXUA 3BAFA 3CR7A 4GOJA 1KI8A 3FOZA 2ZAOA 3TAUA 421PA 1IOZA 4CEHB 4V0ME 3CONA 2VTKA 2YZ2A 4W9MC 3I1FA 4TLAA 4EFLA 3OF5A 2EW1A 2QY9A 2R65A 1FW6A 3CLVA 4ZDJA 2IA5A 4O3MA 2W58A 1R6BX 3BFXA 5D3MB 1VG8A 1AK2A 2R6DA 1J2JA 1NMZA 2ORIA 4LGMA 5AJZA 3ZD7A 1GNRA 2CE7A 3C41J 5DH9A 1XDBA 2PMDA 3NBZC 1A4RA 4N0EA 2F43A 2FN4A 5A4JA 4BZPA 4A8JB 4M53A 1XTIA 2G0TA 3OEEA 2WAXA 2ZSFA 1Z0FA 3T5GA 4ZCMA 4RD6A 1N6KA 1UPTA 2ERYA 2NOAA 4IVRA 2OXCA 2C95A 4TTPA 1IJEA 1AS0A 2JJ2A 2GCNA 1FOEB 3D8BA 2ZVPX 3DZDA 3JZMA 1CIPA 4V0OA 5FPHA 1ZRHA 4QOSA 4DT1B 5JSZB 1A7JA 4GZLA 5KTYA 1IM2A 4TYNA 2GVDC 4DIDA 1NI3A 2O8DA 3FKSD 5JEDA 5BYJA 4CT4B 1MKYA 1BMFA 2EFHB 3CWZA 2Q3HA 2B92A 4YMUA 2VP6A 2Z0MA 3S1AB 5GVRA 1W5SA 1YQTA 5E95A 2AR7A 4JL5A 5EP3A 2IYWA 1XXHB 3B2EA 1DG3A 2J7PA 4GDFA 1KO5A 2OESA 3LVRE 3KKOA 1HT1E 4HUTA 3I5XA 2MSEB 2XOKA 3KX2A 4GRAA 4B73A 2ZJBA 1N6LA 1UEJA 4F92B 5JJLA 4XIGS 1C1YA 1FQJA 4TTRA 4Z8YA 3K0SA 1II8B 2CL6X 5L3RA 2ZUBA 1JNYA 4Q9KA 3MGCA 1G8YA 3LAWA 4TYYA 5DHFA 3PJRA 5TB5A 4NBSA 3ZQJA 1L4YA 4ON9A 3THXB 4X8HA 2AFHE 2F9MA 2GK7A 3HPQA 2IXFA 4TMXA 1COWA 2BMDA 2IBMA 3R8FA 3PUYA 1G18A 3GJ0A 4FMBB 4LDJA 3T1VA 3U4QB 1A5TA 4G5SA 4M9QA 1RW4A 1J99A 3CKLA 2HJGA 1KTVA 1TEXA 3ZVMA 1Q44A 2IF0A 4IOKA 1YRBA 3B82A 2OILA 2IYSA 3CNNA 4B3DA 1CJMA 3L2OB 3ZZUA 2CCKA 3QEOA 2RGNA 2ODNA 2HLDD 2PL3A 4DLXA 4EQ6B 1TQDA 3BH7A 3VR5A 1F2TA 4KFSA 4ZV4A 1ZAKA 1X3SA 3KTAB 4JVMA 2B7CA 3LW7A 4C9BA 3DEFA 3I92A 2FEMA 4UNNA 4DSOA 4P4SA 1Y3AA 2GEUA 1WB9A 2F3RA 4TLDA 2DWOA 3PEYA 1ZVQA 4JIMA 4TYWA 1W0KD 4Q1DA 1M1YE 2ZYVX 2OZEA 1OYYA 2RGGA 4FD2A 2J41A 1KDPA 1TU4A 4G5GA 4P0TA 4CVNA 3QNUA 4AYWA 5DNYB 3U7EB 4AKHA 1E32A 1ZD8A 2V7QA 4GP7A 3VX4A 4CEHA 5CK4A 2HCJB 4IRUB 1TUEA 3C16C 1SXJE 3LV8A 3CWQA 3CBQA 2XB2A 4XVQA 1OXSC 1YHNA 1BH2A 3ETLA 3A37A 3R9WA 2WSSD 1LFDB 2PZFA 1N0WA 1IY1A 2J87A 4DLTA 1E2KA 3AVWA 4OHXA 1IXRC 3UATA 2O8EA 3Q7PA 2ORVA 2GJ8A 4DCVA 621PA 1US8A 4XJXA 1U90A 3LFUA 1FFHA 4DB2A 4RCZA 2VP9A 4DDWA 3RS4A 5J40A 1CRPA 1E79D 2ZR0A 1KNQA 3KQUA 1W47A 4DCUA 2PBRA 1SVKA 2UZ3A 1PLJA 2IHBA 5DYIA 3WMEA 3TK1A 2QMUA 4RZXA 1G3UA 3TMKA 2FG5A 5FL7A 4DSNA 5L3QA 5BWMA 1FNMA 1P60A 4LV8B 1RZ3A 3Q85A 1E0JA 1MRSA 3KQNA 3EPHA 4KO8A 4Q4JA 3DVLA 3TVTA 2XB4A 4YXWD 1Q1EA 1M2OB 5GJWC 3LBIA 1NMYA 3WXMA 1DEKA 4LY6A 1VMAA 4EUNA 3PCRB 1P62B 2ZS7A 2XZPA 4XH9B 2OXRA 4V0LA 5B57C 1NVXQ 4IHQA 3X1WA 1WF3A 2OBMA 3IO5A 2BVNA 3SEAA 3T1QA 2EWWA 4TLEA 2FSFA 2P6UA 2JAQA 2AD1A 3Q5DA 2VBCA 1E4YA 1CJVC 4ASUD 4NCKA 2NQ2C 4OHVA 4A36A 3QKRB 4IFEA 1FL9A 1FUKA 3TSWA 2C99A 3U44A 2H5EA 3GLHB 2IYQA 3KUDA 4BQSA 1UDXA 3CPEA 3BH6A 1F5NA 3TBKA 3EA5A 5L3SB 3AP1A 2L0XA 2NO7A 5IK2A 3HPRA 4PAQA 4CEIB 1W49A 3D7MA 3MWLA 4PQYA 1E9FA 3B13B 4C4PA 1W36D 3CX7A 8OHMA 4OI4A 3KJIA 4TSFA 4RKFA 4LYHA 4Q47A 1UJ2A 3U3RA 4BRWA 2GA8A 5CDFA 3T06B 1DAFA 1J8YF 3QVUA 3QY0A 1U2RA 4HZUA 1DS6A 2ZEJA 4D4KA 1ODFA 4BE7B 1E2NA 1R0WA 2VF7A 2FFHA 3QJYA 4C7OA 5C1BA 1R10A 3FHCB 2WIBA 3LW8A 4JJZA 4NPHA 2DPXA 1G3IA 2P5SA 3QEJA 3CNOA 2CCJA 3NHAA 4HLUA 2ZRJA 3TUIC 5JRJA 4PO8A 3FWYA 1BKDR 1ESNA 3NEYA 2RGAA 1XRJA 2YJTD 3THYA 2CVFA 2JLVA 3AKDA 3B5JA 1G6HA 3SE0A 3PXGA 1I2MA 5KSPA 4DZZA 3LXRA 2R6CA 3F8TA 3KB1A 4DCNA 1U8AA 3LXXA 2GWHA 2Q0HA 5AK0A 3K70C 4JLKA 2PX0A 2YOGA 4BRUA 2ZIAA 5JFGA 2IWRA 3BXZA 4KJZA 4EJSA 4LWZA 4A6XA 2BWJA 1FX0B 3R9IA 3QXXA 2VHJA 1NVWQ 3GJ5A 1X1SA 3K53A 2JJ1A 2AFIE 4Q00A 3VKWA 3FE2A 4X8LA 2ZI5A 2QSYA 5H70A 1KO4A 1S3GA 4CF7A 3VU9B 4BGDA 4F93B 2QRZA 1NMXA 1XFAA 2ONJA 5KOYA 1UADA 2TMKA 3OFNA 3RS2A 4ERNA 2N42A 1OW3B 3P32A 5JJKA 5SZIA 4D81A 1JPJA 1XPUA 4OYHA 4QJ3A 2EFCB 3QBTA 5FFMA 4AYXA 5JRZA 4L16A 4RJLA 3CF2A 3TR5A 1H8ED 2W2TA 2C5LA 3OAAD 4CZ2A 1UF9A 3W34A 4BFYA 1XMJA 5F2EA 1Q3TA 2GXSA 4YDSA 1S0UA 1Z6TA 3TW8B 2ZJZA 4DRZA 1G16A 1OXVA 2GF9A 2AKYA 2C03A 4QBFA 4IXNA 2KB0A 1DVRA 4K46A 4PANA 3PQCA 3A8TA 3EZ9A 3C4JA 1YKSA 3WRXC 5AUQA 2QBYB 2REBA 2WHXA 4AC9A 2IYVA 3PFIA 3QXHA 4CW7A 2Z6VA 4JLVA 1NN5A 5F9HA 2ANBA 4KBGA 3GJ4A 4Z54A 1E2LA 2DR3A 5K8LA 3E5HA 2PJRA 1KK0A 4OQFA 5AUNB 1RPZA 2AKAB 5EXSA 5KNDA 4I1SA 3FKSA 3EZ6A 3RNLA 5B58C 3I72A 2JJ2D 3K9GA 1RYHA 3P26A 1E9SA 4B32A 2VYFA 2ZPTX 1P9NA 2NO1A 1GZSA 1KK3A 821PA 1UBFA 4MKHA 3B7GA 3C8UA 4ILEA 5JEEA 2QAGC 3KB2A 4PPQA 1YE8A 3VR3A 2EFEB 3QG1A 1IHUA 4BPBA 3SBEA 4CEIA 1KAOA 4LHWA 2FV8A 1Z63A 4JBYA 1OPXA 4CEJA 1Z47A 1BMFD 3WMFA 2D62A 1NSTA 4B3BA 3B1ZA 2JCSA 2P65A 2O8BB 3DDCA 4QBGB 2J7PD 1OIVA 4AWXA 1GL9B 4L9SA 4JSTA 3ZD6A 3M0EA 4MYCA 1R5NA 3WBJA 3VHLB 2ONKA 5EE9A 3E2IA 2ZYUX 2VQSA 4QXAA 4JL6A 4LYAA 4C30A 2CMKA 3THWB 1E94E 2C77A 3WHLA 3GJXC 3NEJA 5LB4A 2XGJA 2CK3A 1XEXA 1SQ5A 5FUYA 3K0AB 3QKSA 4JVNA 1Q1ZA 3M6AA 2FFQA 1P9RA 1RJ9A 4HAYA 1W36B 3UMRA 4NCJA 3ZLJA 1JQJC 4QNRA 221PA 1AGRA 3K0CA 3KQLA 5CIQA 5JCPA 2W2XA 4Q1CA 1IJFA 3VTKA 2G0NA 3QXSA 1COWD 1ANKA 1VCNA 3V4RA 2WWHA 3Q7QA 1ZINA 2ZJYA 4KODA 1R5OA 5FTNA 1NN0A 1NG1A 4RSGA 3ND9A 1QVRA 4TMZA 2FF7A 2ODEA 3UKDA 2OO7A 1XMIA 3CZPA 4WXPA 4NMMA 5TMPA 2WM9B 5TY0A 4ZCIA 1W0KA 2BEJA 3H1TA 4MUBA 5FPSA 4LV6A 4Q5IA 1OF1A 4PO1A 4B48A 1D5CA 3Q5EA 2GETA 2OFXA 4KCGA 3CPHA 3LQRA 2F1HA 2QE7D 4QGHA 2O0JA 2ZRKA 4UXHA 4K8OA 1T0JB 1MO3A 2R6AA 4YMWA 3C5CA 1ZM9A 3LA6A 3CF6R 4NONA 2IL1A 2G83A 2AX4A 2YOFA 5TVKA 2YNMA 2IYZA 2QENA 3QF4A 4JT4A 5FOWA 2GTPA 3TNFA 1OH6A 2O8CB 1P72A 3U60B 1HH4A 1P2TA 3MLEA 2OCBA 2YWGA 1DAMA 5EP1A 4JVLA 4N3NA 4PHHA 2BJWA 4D0NA 1Z0AA 1R8QA 5K8UA 3QPUA 5GVSA 4P3YA 2NO9A 3BRWD 3MJRA 2Z5FA 3WMGA 1JAIA 1S1MA 2ZAMA 1GOTA 2FNAA 1GITA 5JCZA 1Q1QA 4P31A 3SBDA 1QHSA 5EZ5A 4BLSA 3SHFA 4Q9JA 4B71A 3BERA 1XJQA 4OQXA 4KFUA 1HE8B 3O8CA 2V4ZA 3ADDA 4A4DA 2JLXA 3KJGA 3U6KA 4LJ6A 3DM9B 3SN6A 4PQFA 1PJRA 4Q4HA 2PCJA 1EFRA 1OE0A 4WZ6A 3F5FA 3GLFE 5HTKA 2RKOA 1XPOA 3L8YA 3AEZA 2Z4SA 4PSVA 2DFNA 1DELA 2JIZD 5FL7D 4Z8XA 2G77B 1XEWX 5H68A 1RRCA 3CO5A 4KITB 2QAJA 4L8GA 2V3CC 3FKQA 1NBME 1KZGB 1N6PA 1VKJA 5J4VA 2V54A 1NNEA 2F43B 4HLQB 4YONB 2RGDA 4Q1FA 3RAPR 2F1IA 1N0VC 1JJ7A 4WZAE 1N5IA 1XNJA 3SJBA 3VX3A 3WNDA 2VSXA 1IN4A 4NE2A 2ZJ2A 1OFIA 3HR7A 4FMCF 1HY3A 2J0QA 1N6IA 3AB3A 5BQ5A 3NKVA 3RRZA 2ZI3A 1W4CA 4C0BA 4ZKDA 2OLJA 4GT1A 4NL4H 1HYQA 2JGNA 2JLUA 1ZNYA 3UG7A 2NPIA 2Q3MA 3SQWA 1XJCA 3KJHA 4MYHA 2CLDX 3FGNA 2P6RA 3CNLA 2C78A 3I3SR 3KXKA 1EXMA 2BC9A 1Q3HA 3EW9A 4BECA 2VHCA 5ELXA 2OBLA 3U61B 4AI6A 2GEVA 4BWYA 2F9LA 3BB3A 4LHVA 5ANRB 2J0UB 5FUWA 5TARA 3C5HA 4EPYA 3QXJA 3SYKA 4TSFD 3BFVA 4O25A 3GFPA 4QGGA 4MDEA 2X8AA 4XWKA 3EXAA 1GTVA 3N2IA 2RH5A 1VIAA 2JJ8A 3EC2A 2JLZA 1F2UA 4QL3A 3SR0A 1R7RA 4M1SA 5EE3A 4PHTA 4MYUA 3TLXA 1N2CE 5IF9A 1ZP6A 2V1UA 1I4TD 3B6EA 4B2IA 2JEOA 2FSGA 1E2PA 3UIEA 2V1XA 5F3WB 4JLAA 2W2VA 2IX3A 3K9NA 1TF5A 3QI2A 1Z6AA 4UNPA 3FHTA 5HPYB 4R9UC 3OEHD 1NN3A 1XTJA 3FYHA 5FBLB 3LBHA 5FOXA 3SFZA 1EFTA 3E1SA 4PPFA 4IVQA 1IXZA 3NBFA 1HURA 1TX4B 1I2DA 4XTRA 3IBGA 1E2MA 1UKYA 1D9XA 1NN1A 4UKDA 1UDWA 2A2ZA 4II7A 2CEAA 1CLUA 2OCPA 2WKPA 1KO1A 1J7KA 2C04A 2ZI6A 2XJ9A 1F2TB 1V43A 2CL7X 3LDAA 3PV0A 1E9RA 5FPKA 4QJ5A 2P3SA 1GDDA 1P2UA 1TEVA 3NC0C 3OIWA 5FI0B 4D4MA 4Q1BA 5TV2A 2XITA 3PITA 1G1MA 5DGXA 1Z0DA 3TE6A 5FOVA 1YZLA 3P20A 5EE5B 4BFVA 3L0PA 1G19A 1N6NA 2ZJ5A 5J4YA 3IIMA 4XSHA 1D9ZA 3BBPA 1UM8A 5CITA 2G1KA 1H8EA 4RFVA 4LCBA 1GVNB 3OIYA 3OAAA 4JBXA 4JLJA 5SZHB 3AF3A 3VNUA 1G20E 1KI4A 2FH5B 3LX8A 3ADCA 1Y63A 3FMOB 1R5BA 3OFND 4OJKA 1WRBA 5LPNA 2CLSA 2YWFA 3CRMA 4HDCA 4JMPA 3M4YA 4EPTA 5JJIA 1SVMA 1SVOA 5A0FA 2PJZA 2ZUDA 3EIHA 2O8EB 2NPFA 1CBUA 2QGZA 3N5CA 2A9KA 1V5WA 2EU8A 4A92A 2ZANA 3D3QA 4JLOA 2YWHA 4OHZA 1ZC4A 1US8B 2IYLD 1G3RA 1ZM3A 1XPRA 2N1BA 1G7RA 1VYVA 4MDFA 4BFZA 1S1CA 4C2TA 1KOFA 3FDIA 5KDLA 2OAP1 4PTLA 2AK3A 3IO3A 1ZUIA 2ZQ5A 3HU3A 3LVQE 4Q4LA 2GJ9A 5J4HA 3TQCA 1NP6A 2JASA 4CIDA 5LD2B 3AV0B 1Z83A 4LJ7A 3BGWA 3CX8A 2ZR7A 3CZQA 2D06A 2C96A 5L3QB 1NKSA 4V0NA 4GFDA 4IDQA 1FPMA 2GK6A 5FI1B 3TIFA 4D82A 1N25A 1CR2A 1PLKA 2ZM5A 2DWPA 2WKQA 1YJ5A 3O8DA 4PX9A 1AQYA 1KKLA 5IDVA 2V55B 4KYUA 1IN8A 4LPSA 4Q4JB 4TL7A 4FCVA 2J59A 1X6VA 1TNDA 3UMFA 3I32A 2J7KA 2ZRFA 3KKPA 1DAEA 1KSGA 2QEQA 4TL8A 2QA5A 1RIFA 4Q4AA 3AF2A 3RABA 4LJ8A 3D6TB 2O8FA 1DG1G 2J0UA 4PXAA 2ZS9A 2OCAA 1R0XA 4KHZA 2ATVA 3FPAA 2ZU0C 1PZNA 3B1WA 3EZFA 1CR0A 4ZIRA 4HDQB 4RZUA 2IEZA 4DCTA 1FP7A 1N6HA 2NZ8A 2H17A 2ZRBA 4HLUC 4KU4A 4M1MA 5AWFC 4E07A 2Q6TA 5C46F 2YINC 1D2EA 4RVCA 1IN7A 1NJFA 4BEBA 1E3MA 2GBLA 2WPDD 4G5QA 3U44B 4XTCS 2NZJA 3ZVLA 1W48A 4C0JA 1CU1A 1N0UA 2BIFA 4M9ZA 1ZIPA 5P21A 3A1WA 4MGZR 4U5XA 4NHOA 1Z6XA 2FDCA 4FMDF 4MRNA 3MWJA 4TLBA 1MO4A 3KL4A 2CK3D 4DKXA 1ZU4A 4M1TA 5CIWA 4MA4A 1SGWA 4ZCLA 1VECA 1SKQA 1CF4A 3GJ7A 2ZE8A 3UPUA 2QTFA 5JECA 1S3SA 1XTRA 1D6JA 1GL7A 2ZRGA 4OI2A 1KKMA 4HZUB 2D3WA 4G3XA 4BLOA 4KFTA 5KHOC 4TQ9A 3L0OA 1NIPA 3HJNA 4C7OB 3EAQA 2W83A 2EFDB 2BCGY 1LW7A 2QE7A 4JSYA 1E2FA 1OT3A 1LNZA 1E2DA 1AGPA 1E0KA 4IOJA 1Z3IX 1QHHA 1FP6A 5FTLA 3KJEA 1N5LA 3RS5A 5KO2A 5CB6A 2BV3A 1R0ZA 4R2HA 1M34E 1A2BA 3NDPA 5H1YA 4HLCA 4EPVA 2B7BA 3SHWA 1CRQA 3THYB 5EQTA 4LJ4A 4B43A 3ZJYA 1N3BA 1P9WA 1PLLA 1TMKA 2V8OA 2QN6A 3NTUA 4KXFB 3OESA 1G17A 1HTWA 2ZRDA 5FPTA 4GBMA 4IFBA 2B6HA 2C2HA 4OHWA 1GSIA 4DEYA 2G3YA 4M8NE 3ZS9A 4CGZA 1XZPA 4HAZA 4NZYA 2AK2A 4IOMA 1KY2A 3WYFA 4JLMA 4Y0VA 5J4KA 1RRPA 4ZKEA 1G7SA 1F60A 4OHYA 3K9LA 2R62A 2GJSA 4DSUA 4HB4A 4EJSB 5JWOA 4QHTA 1L2TA 3UANA 1AKYA 3DO6A 3WY9A 1Z28A 1G8HA 1SXJA 1DAKA 1Q12A 2DFLA 1S9DA 2BOVA 2FU5C 2ORWA 1NL3A 2YHSA 4ZI2A 1EFUA 4IKEA 5B30A 2KE5A 4C0QC 2KI5A 1UBEA 5CK5A 4B2PA 4TZ0A 2BBTA 2ATXA 1VYUA 2V6IA 1Q20A 4TQUS 5EUMA 4I1UA 1YR6A 5EXPA 3RS3A 1JEDA 2GJAA 1T8TA 2X2FA 3NH9A 3X2SA 1DOAA 4URVR 2A5JA 3NHBA 2HYIC 4D80A 1IBRA 3OIUA 3PENA 1XP8A 2JIZA 1NG9A 1AM4D 1Z6YA 3Q3JB 3AP3A
chains in the Genus database with same CATH superfamily
1F6WA 2IH4A 3GBPA 1AQUA 2NXNA 1B26A 1L5KA 3T35A 3GEDA 4CDGA 3NT4A 4LV5B 4R31A 3Q4GA 4DCGA 3MQ4A 1ISJA 2YV4A 1UQTA 2GXUA 2ZAGA 4QFMA 4L4UA 1JR3E 1YNSA 4G41A 4RY8A 3GB9A 3QLTA 4TVOA 5EMMA 1AJEA 4PZCA 1GSAA 3K6JA 4K81B 5JSUA 2C5AA 1X8LA 2XKJE 2Y0CA 1KZ7B 1UCFA 3FGZA 3K0FA 3PRKE 4V0SA 2CUNA 1DWQA 1R8SA 1DRWA 3A1EA 4LMPA 2VJQA 3DQPA 4GKAA 3Q3GE 4DPLA 3QE0A 3HDVA 2W6NA 3V2GA 1BE0A 3G2KA 4UNSA 4BQEA 2VH1A 3PXBA 4J4HA 5JO0A 2GOYA 1AHPA 2AUMA 4H1HA 2BFWA 4IDNA 2ID8A 3F74A 3VSDA 1J2UA 4OPMA 3NHYA 1A98A 3GQVA 2PX2A 1KL7A 3K9QO 5HM6A 1Q7BA 2Q46A 4X20A 3NYRA 3F2IA 1H8HA 2UUCB 3C39A 4JJEA 1FMLA 3IIKA 1RM3A 2AD5A 3O1JC 2XT0A 3QE3A 5SZJA 5DVZA 3ZE0B 4BFXA 4NZ9A 2QVLA 5CFNA 3U16A 3NHWA 1QBKC 5BW6B 4F1KA 3DWIA 3KZVA 1R0LA 4WX2B 3WOVA 3M6XA 1KJQA 1XJ5A 1D6NA 2AI2A 2VJLA 5M3BA 1I94B 4A2QA 1U5CA 3MMZA 4HYEA 1EVQA 4RY2A 4BUJA 4YTEA 3ZWMA 4DFDA 4Z86A 1UM9A 1E9CA 1G8GA 1ZUNB 3L0YA 4M36A 2C9CA 2P2LA 2QXUA 5AOBA 3N8KA 3MCAA 1TM4E 4Q9HA 3VNAA 4DV3B 2I4OA 1M5UA 3DWEX 1M6NA 1Y1QA 3R3XA 5MN5A 3PQ3A 4CDNA 1RJFA 1QXSA 3HFSA 5AXCA 4BWVA 5C2JB 4G8JA 4MW5A 4YASA 1EINA 2IS2A 5CNIA 1Z08A 3NRCA 4U02A 1JKJB 1QPGA 1XC7A 4A6PA 1P74A 2HQBA 3IHWA 4HWRA 3T1OA 5IJZA 3N53A 1DQYA 3DAPA 3NIBA 1DO2A 1VLVA 3DNPA 1EM6A 2EW2A 2ZUCA 1G7CA 1TYCA 3BXFA 2XVZA 1WW2A 5CEEA 3HI6A 3LNCA 1Q7GA 1PFYA 1SKAA 4O2RA 2ZXUA 4OQNA 5DRYA 3FKJA 2QMOA 1CS0B 4KUEA 4C0LA 1S2IA 2YYSA 2Z5VA 4L2IA 4I8IA 4H35A 4UE2A 4ZQCB 4HEHA 3QVVA 5LU8A 4W1RA 1FNDA 4FZ3A 3W3AA 4TYPA 5F1OA 2HRDA 4YO8A 4URYR 3AF6A 2QJFA 2NSHA 3ZQ6A 3W8FA 3G3EA 2PUHA 2VPXA 2QT1A 1YRQA 3L4BA 2HTEA 3CH4B 3F78A 2NVBA 2C1XA 3MMPA 1KBOA 2XNDD 4G65A 4UAJA 2DG2A 5JADA 1N1GA 1GTRA 2J6CA 1VRVA 2ZJ6A 2VNSA 3D7RA 5EFZA 3UH0A 1JBKA 1LV7A 3EDQA 4BV9A 3STYA 2JAHA 1IZYA 1G4AE 1VI2A 2B8JA 2WIGA 1EXDA 5TQJA 1JEQB 4AP6A 1E1MA 4D9HA 5KVAA 5DNCA 4S2UA 2PSJA 4M4SA 1SKBA 2NTYC 5KCZA 1M10A 2VPQA 4B5KA 2HBQA 3RYHA 4FB4A 5C53B 4R5MA 4D9FA 4PBRA 1DIGA 2PV0A 3L0IB 1R88A 4JYBA 5K8IA 4K05A 2PANA 4UVDA 1XWFA 1NUTA 3BFPA 4ZOLB 2WT4A 2AFIA 3GA7A 4AZ3B 1QHEA 3QU9A 4QBHA 2GGSA 4Z51A 2IC5A 3GWGA 1T3LA 3ND5A 5A5GA 1PR0A 3AINA 3QF4B 3CINA 4GG1A 3T61A 1QX4A 2BT4A 4D0RA 1OHHA 2B1GA 1M2EA 1ZD2P 2HA4A 3AVQA 1VHLA 4JKYA 1E6CA 1JVBA 2Q3FA 3TPCA 3JQ9A 3D2AA 4HDMB 4TRMA 3I9MA 2ZIFA 3QVJA 3S2EA 3GJ6A 5F3RA 4ERXA 4F4FA 2ZXFA 1LRLA 1TLLA 3MJ4A 1G9XA 4DNQA 3QUBA 1GNPA 1L0BA 2WJPA 4OD0A 3IAM6 2PBFA 2WZDA 3KVNA 4M0PA 3WLLA 4K1XA 1T4DA 4FFRA 1B0ZA 1KAMA 1QV7A 2OHXA 1XWWA 3L5OA 3N58A 1RWWA 4HHEA 4Q34A 4BMYA 1P6XA 4PAOA 1H42A 1WPRA 2IS1A 1GPAA 1ECLA 1M2FA 1O9GA 2EDAA 4C7KA 4DMKA 3SXJA 4QVGA 1XAHA 4CF7A 2GYWA 2MSLA 3PKZA 2Q07A 4CWAA 2NP7A 2J3HA 1JMYA 4DWJA 1P4JA 4B85A 1P1BA 1RWPA 5EYPA 2XDAA 4JOSA 5F4ZA 1EQ2A 3RGGA 3T3MB 5A0VA 6ADHA 3D3JA 2NSDA 2ZIGA 1W36C 3A1UA 3UQYS 2UZ0A 3V32A 1PNTA 2WHEA 5A4IS 4RTLA 1XLVA 4I9NA 2Z8ZA 1PBTA 2J0VA 3DMRA 4DB4A 2BGNA 4PC6A 1T34A 2VWQA 3P9IA 4BDTA 3E9YA 2VJYA 1MD9A 1YC5A 4XJVA 1QHXA 2DHRA 2PGNA 2Q0SA 1ZM7A 1T9HA 3U1TA 4RELA 3H1GA 4E08A 4ZAZA 1EDZA 3FDXA 4LYDA 1V5FA 3ANTA 4MGEA 3ZHRA 1S7CA 1WY5A 4IP0A 1EZ1A 1BA2A 2FGKA 3LQFA 1TJNA 1M8JA 4TL9A 1TT7A 4ZTBA 2R2GA 4FQ7A 2AC7A 1BO6A 3IFSA 3WG9A 4IICA 1H94A 2ROQA 5KOJB 4PZYA 1JHYA 1NVVQ 4K9KA 4BFLA 4DNXA 5C32A 5LNK6 1JQ3A 3S1SA 1YCFA 4NNJA 5CYGA 2RHBA 2IT1A 1MPXA 2VK4A 1SPBS 2JS7A 4LYFA 1PYOA 3NHUA 4YAJA 5KOIA 2IHKA 4PC1A 4HX2A 4RMHA 1BRTA 3UBTA 1X7YB 4R8VA 3CE9A 3TJZA 4NE7A 3BEDA 2PCLA 3L7JA 3QKUA 3QOWA 3VNQA 3ETJA 1DADA 1GV1A 3W0LB 4F46A 1MZVA 3HYCA 2XY4A 2BJHA 3ZH9B 1XZQA 1REQB 1MOQA 1PR4A 4CKZA 2FMTA 2XWSA 1SQFA 2GYVA 3TTXA 2UYQA 3FVVA 3MUOA 3GOHA 3RRYA 1G63A 4D9KA 3JATA 1Y82A 1OWPA 5IT5A 1DPFA 2QYTA 1U0LA 3JQBC 3NWPA 3LD9A 3TG8A 2WF9A 1B8NA 4ZZ2A 4DMMA 4V02A 3KSBC 5BT9A 2XIQA 2G7ZA 3V9AA 2C4UA 1NJ6A 2PXCA 2PG3A 2WWTA 3RQIA 2A0FA 2HAEA 1KO8A 3RKUA 2YWRA 3T7SA 1F2UB 3DF7A 4I4TF 1Q1AA 3H84A 4F8JA 5BRJA 1E96A 1P2FA 1P81A 4NAHA 5JLJA 2RC5A 2ZTHA 2V5VA 5FPYA 3ILXA 4D45A 4B74A 2QR2A 3BHNA 3STTA 3A9RA 4X3OA 1OLOA 2SKEA 5B1EA 2NYRA 3DMFA 4X1OA 3TZCA 4DILA 4I1OA 4HN2A 1W4RA 1L1FA 3AF0A 3T12A 5HUJA 5E6SB 3MUEA 3ZWVA 1HNWB 3ZDCA 3ANNA 5C51B 1PGNA 5AI8A 2OZLA 3ZHVA 3IHLA 2WJZB 3PGMA 2GF0A 3E5NA 2HJRA 4LJRA 3VKGA 3O9VA 4WNYA 3GLQA 4MRMB 4UC0A 3LLUA 2P90A 4YUWA 3NGMA 1ATZA 4N4AA 4IFIA 1GPNA 1I2CA 1K75A 3LUCA 1Y3BE 3PFNA 1O6BA 3T4PA 1IQUA 1D2RA 2D5AA 2X5JO 3UH1A 4AQDA 1CD5A 4IV5A 4ND3A 1G291 2ZRIA 4Q82A 2ZE7A 2IRWA 1SD2A 1SVWA 5BV8A 1PKEA 1PFWA 5B64A 2G6TA 4ACAA 4PGGA 5KSOA 1FYWA 2AN3A 2ZR9A 1ZK0A 3C1OA 3QE4A 4L27A 4CU2A 4EY7A 4D8WA 1T6NA 1SU4A 1FRFS 3BREA 4KQWA 4DADA 3LCUA 2O2IA 2V03A 2P1DA 4IQFA 3REGA 5M04A 1L6RA 1W1WA 4HGYA 1KC1A 3L6BA 2VEDA 4V03A 4NJOA 2TECE 2PV7A 5G41A 4KRFA 4F97A 1SU6A 2V7WA 3NVMB 3TAHA 4U00A 4B76A 5EJAA 1T5SA 4Y9RA 3ESRA 4NBRA 1C0KA 1QF9A 3AZOA 3BK7A 4OXRA 3V8VA 5J2UA 5TT1A 2JH8A 2DBVO 1BU5A 2XE6A 1YQ9A 3TNLA 4RNCA 4GYJA 5HGXA 3AL2A 3AVOA 4ZCSA 2L17A 4P32A 1BHQ1 4HAIA 3KFVA 2QV0A 4RHYA 5SICE 1A2KC 1BVUA 2JLQA 5DHRA 2XZTA 1WA5A 1ZK1A 4M21A 1W2GA 4X91A 1JR6A 1ORWA 2QJWA 4Q7JB 1QC5B 5JSYA 4YRSA 1KQOA 4LKOA 1UT6A 3KXDA 3RGWS 4UBLA 4HB3A 3ZS8A 1T35A 4B75A 1DKPA 3CSSA 4CFZA 4PC3A 4H6XA 1SVSA 3LMKA 5DB4A 2BTQA 4D57A 4DXAA 4TM8A 4A5OA 4N5HX 2M32A 4RK0A 3FTEA 1OFVA 1TQ8A 2UYYA 3ZH2A 3ZW8A 3KS9A 1CJKC 2HF9A 4EYKA 2ZSAA 3NBYC 5E4FA 3IMFA 1L1QA 3WGLA 1CYEA 4QTTB 3F5QA 3GLIA 4BE4A 1CEXA 5KU1A 1AA6A 1OZAA 4NBLA 5FBKA 3V80A 4PZ0A 5D3KA 5BSKA 2PTHA 1W0JA 2QTGA 2DBRA 3R0VA 4URHA 2IV2X 2VT2A 3TRHA 3V42A 2BHSA 3RG8A 2EZTA 4ED9A 1RJEA 2VHTA 3ER6A 4AJ4A 3HSYA 1ZR4A 1AV6A 1G8AA 2AL7A 2NO5A 3HNRA 3Q72A 5I48A 1I0ZA 1P2VA 2Y93A 3E7FA 1ZRMA 2ECQA 4L07A 4Y8VA 3DYIA 4LEIA 1CEYA 2P0AA 2XA2A 2Y6UA 3H2JA 4JYPA 1H8HD 2HRRA 2Q7DA 4GF5A 4J0CA 3AZQA 4PF1A 2A57A 1R6VA 4AJLA 3QIAA 4OK3A 1ZN9A 5JMWA 4NXMB 3ZGLA 1KPIA 2FPPA 3O8NA 3RYIA 3FR7A 2J08A 3WISA 2EERA 3ND8A 5G2OA 4JK3A 3DZBA 3HCFA 4ZO6A 3M70A 1D7AA 1XAGA 4LX0A 1HNZB 2H7CA 4RKEA 5DHAA 3R09A 4G0VA 1DDGA 4GMXA 4BX3A 4ZAVA 2RH9B 3ZI7A 1WD7A 4HVLA 1T1RA 3LFTA 4MVJE 2H0QA 3CKMA 4WAUA 2QAGA 1KXZA 2PMKA 3D59A 4X3CA 2ADMA 2P40A 1YVUA 2X23A 3CJQA 1IZZA 4YDRA 3RLIA 4KR2A 3LT2A 4RGQA 4BMCA 3OP4A 1AGXA 3E3AA 3DTTA 4NH0A 1M1NB 2VRBA 3CX3A 2IJGX 3ENZA 3P9KA 2H9IA 1J70A 2PWYA 4O4LA 1P4RA 4UNRA 4F3YA 1DIHA 4WXHA 3U3ZA 3SHTA 4DYDA 5F9MA 2E9SA 5JANA 3LUJA 3UJ7A 1N2CA 2WWWA 1A1SA 4NDAA 2BDEA 3BE6A 3K96A 4O2BF 3A26A 2AFHB 1LKZA 5EKTA 1NF3A 2JI4A 1NQUA 3BD9A 2QX8A 3A6GA 4JEUA 3W90A 1AMOA 3E9DA 3HKDB 1JE0A 3W3AD 4S05A 1RVDA 1IBKB 5M29A 5EJ6A 3FG9A 4MUMA 4LJAA 2D4AA 2CZCA 5CCEA 2XAAA 3OZVA 3O90A 3PT5A 4GH5A 2CNLA 2PKYX 4ZVSA 3U39A 3OQHA 3PR1A 1EDEA 3TTUA 4TGLA 4B81A 2ZPUA 3VZCA 1DBVO 1TF7A 1TJYA 4PE5B 2Z4RA 2X9LA 2DJIA 5FYDA 2INGX 1HYEA 4DLVA 2I80A 4GP6A 3DHWC 2WOOA 3EF0A 5EUQB 1DRUA 3UCEA 4B31A 4EP1A 4WKBA 4UMEA 4H6WA 1EDDA 4A1FA 2RIPA 3U4HA 1FUEA 1ORVA 4ARZB 2Q2QA 5BVGA 2VRWA 4QEKA 3CRQA 4A7PA 4ARCA 1SD1A 1FFYA 2QF7A 1L1RA 2OV2A 3VMFA 5LXTA 1ZA1A 4MQFA 5CJPA 2WTBA 3M1IA 3RC3A 3ANLA 1L7XA 1U3TA 4GXQA 2OE2A 3HBJA 4QYIA 1AK9A 4XW2A 3JQGB 1BQ4A 3NXSA 4J3NA 3RKRA 2LKDA 2QM3A 5J47A 3O38A 1VTKA 1RABA 3FZGA 1OHHD 2WD9A 2PQ6A 2A5GA 2JLRA 3KXPA 1CVIA 3EVBA 2HRCA 3H3JA 3EGOA 4YQFA 2P3LA 3RIGA 3RW9A 1KFEB 2R6ZA 2O57A 4OUKX 1ULBA 2YUTA 1D8TA 1OILA 4R4JA 3BX1A 4LI0A 4RDIA 4F2HA 3K1AB 1CF9A 1EE1A 1ZHFA 4R7ZA 3RC1A 3IMKA 2M9MA 4EABA 3U19A 2RI1A 1FZQA 4CYMA 1N1MA 1NV9A 1Z2AA 3B3GA 4JNKA 5FBRB 5FKJA 4CG1A 4Q66C 4AJKA 2JCYA 3B7WA 2GSWA 4QJIA 4EECA 5AHKA 4JUFA 1QG2A 4HWTA 4KXUA 3HCOA 2XTNA 4QQ8A 4LFCB 1E7WA 3K8YA 3W5AA 3N2ZB 1L3BA 3LPNA 3ZDEA 1VGQA 3KYDA 4Q05A 4UZSA 1GV0A 3BOSA 4YJ2B 3AVYA 1U8YA 3BB4A 3EVEA 3WIUA 3QVLA 4N47A 3IPYA 1E1LA 4NJEB 1EQUA 3DKPA 5C34B 1ZISA 3K0BA 2QXTA 3VR4H 4ZGGA 1Z3CA 1IJKA 3TKLA 3TZEA 5JWRA 2EVWX 4TKVB 2NXWA 1MOZA 2I6UA 2YJGA 5GPBA 3HUFA 1CR1A 1DHTA 4NENA 3ZLVA 2WP8J 2WSMA 4N7BA 4I7EA 4PYMA 3RG2A 3G9QA 3FAKA 2OUKA 2C3UA 1I9CA 1OI2A 3GFSA 1RCUA 3H16A 1D4AA 4DR1B 3IP6A 3GLGB 4X1KA 3F6EX 4JFAA 4G36A 3IUQA 3BE8A 4TV9B 2O3RA 1YONA 2BSXA 2KBEA 2RGEA 2YWEA 2XZOA 1RPAA 1MH9A 1P91A 2Z2JA 2YN0A 3DMDA 3G2HA 5DOVA 4YRZA 3PFFA 1NPTO 1XD8A 2VF5X 3AWIA 5FPPA 1JHZA 2ODQA 1ZBQA 3ZIUA 1E3LA 121PA 3G0IA 3F0TA 3OJLA 5I9TA 3K16A 2GB4A 3VH3A 1OXKB 3E03A 1B3BA 2I6XA 5K01A 1QSGA 1VCMA 2IYXA 3TRIA 4EG4A 2J5XA 3QFFA 1QYRA 2VNHA 4M1KA 2J46A 2BGKA 4FFSA 1JECA 2YXLA 4RZ2A 4LXTA 6NULA 5KTPA 1P19A 1UMCA 2AC4A 4EYSA 1XN4A 2IKSA 1SUCA 4FYYA 1Y4AE 1CY0A 1S8AA 3ZHXA 1KS2A 1AXGA 4DIEA 4WUTA 1J8MF 1ZJWA 2C57A 4R16A 5KPJA 5FRDA 1BXZA 2HXSA 3HRHA 2GCOB 4JXZA 1F2VA 2DQZA 4R05A 4BAGA 1MABA 2XDYA 3ETCA 3PUHA 4PTYA 1WD5A 1P61B 5JH7A 1T24A 5BXQC 2QJTA 1A7AA 3DVSX 3IBYA 2WU1A 2OKGA 2WABA 2Z8YA 2UZ1B 3CG0A 5CG1A 2GN8A 4BMSA 2Z6QA 4GXRA 3RODA 2EEZA 3RUIA 4ZYLA 2JB9A 5GOZA 5TGTA 2B2CA 4YAKA 6REQB 3U1BA 1QIKA 4MUKA 5AW9A 2FZEA 3IA7A 3OOHA 3PQ6A 2QG6A 1OCEA 2G09A 1Z5PA 3SS7X 2HRZA 4NSNA 3WYGA 4E7OA 3H11A 3R0ZA 5KC9A 1CUSA 1M34A 3DT6A 1TZKA 2C8LA 1PFUA 1SFRA 2DMRA 2I1VB 3JALA 3E9CA 4HWKA 4GM4A 4AG5A 4B4KA 5COBA 3ONWA 3EPRA 1KJ8A 2AQKA 2G1PA 4N48A 1PVOA 4IUCS 4IIHA 2WM8A 4C0KA 1NASA 2IPOA 2QQ0A 2W2LA 3HKCA 1OAOC 4RA6A 2H07A 3HXMA 4DC9A 1QE3A 2C98A 1HQYE 1PG5A 4TT3A 1BDIA 2EHDA 5BWNA 1K2WA 1WR8A 4I1YA 2F59A 2H0RA 3E18A 4KRYA 5G3YA 2PX3A 3BC1A 4G5XA 4B3GA 4YMLA 3ZJVA 2R87A 4UTNA 1GWNA 1CCWA 3PG5A 2FOLA 5G4KB 5TQ0A 1F3OA 1IPHA 4I6EA 2Q5FA 3K05A 4ZQHA 5DLPA 2GF2A 2VDWA 3EPJA 3WRVA 3A9CA 4CV1A 4KUGA 1G64A 4UPVA 2WUEA 1SM4A 4UU0A 1E61A 4O6VA 3WZMA 1CKEA 4YRAA 5F7OA 3EWSA 4LIPD 4DHEA 4CMHA 4OQLA 4IOLA 4AZWA 1OASA 2FEXA 1UC5B 3FCEA 3K70D 4KWHA 4NCNA 4EB6A 4IHJB 1MJNA 1N9KA 1H2XA 1QORA 3JQDA 3OOWA 4MUNA 3H8JA 3TQHA 2UVQA 4A8JA 2JG3A 5BN4A 1V26A 2X1MA 3WLNA 1W1UA 4ZVUA 1WSAA 2GQ0A 3SQXA 3ZWOA 4ITUA 2PH1A 1R4ZA 2WIDA 2ZT7A 3QOXA 1CY6A 5DTEA 5HGJA 1A8HA 4AMUA 1CJUC 1RYBA 4U7JA 1RXIA 2R2AA 2CFRA 3HBAA 1ZG3A 3S81A 4DANA 4DT1A 5CNMA 1O5OA 1QKJA 2BN4A 3BJIC 3F9IA 3KXIA 4K7JA 3MWDA 4DLYA 2FXIA 2R5NA 4J76A 4GOKA 1JZQA 3MXOA 1UEXC 2B8TA 3KKNA 3WC4A 4C04A 3W7BA 2W6IA 3IS3A 4PHFA 1M72A 3FGPA 4GGOA 3L7KA 5IJ9B 3EVNA 4B33A 3E7WA 1E59A 1KMHA 2I76A 1N2IA 4O4IA 3LVFO 5BT8A 5FF9A 5I9IA 1JR3A 2HZBA 4MP3A 1Z7EA 3ZV5A 4PIVA 2BDTA 4ER3A 2VYNA 1K4MA 5JQGF 3ABOB 3TFOA 3GLGE 4FZVA 3H5IA 3BXEA 3GZNA 3FSJX 1I4DD 2VI5A 3GI1A 3EGWA 4HNHA 1JB1A 1XN1A 5JI2E 1YOVB 4H4EA 4R1NA 1W0JD 2JAUA 1JAZA 3QJGA 4QG7A 1UBJS 3TH5A 1OH5A 5E9QA 2FW6A 2OBFA 3QLUC 2J3KA 5G0VA 2NXJA 3I6BA 4FDMA 4FFDA 2JHFA 1IBSA 2I54A 5F9FA 1XI2A 1JHMA 1DC4A 2FI1A 1BNCA 4UVIA 3T7AA 3ELWA 3EASA 3E0QA 4L3OA 2CHGA 1KAEA 3ITNA 3Q1LA 1U7OA 4XSGA 1C4OA 5FBVB 1YK0A 4D0LB 1U99A 1MJ5A 2OG2A 3M83A 4NFYA 1JG7A 3A1SA 1CJCA 3Q8XB 4HQLA 5FWDA 4MYTA 2FW9A 3GW8A 5C8DA 3UXMA 1YQEA 3KEOA 2Y9PB 2R7AA 5IC4A 3FTQA 2XZLA 2ILVA 4WN9B 1TPZA 4WASA 2HDWA 3AW8A 1RVV1 3EFBA 3IUSA 2G36A 1LZKA 4WKOA 3GRYA 1MCZA 2PX6A 1F8YA 2PT5A 1Z6GA 1NZJA 1JKIA 1FYXA 3CF0A 4IEFB 4YCJA 3N2EA 3Q40A 3DPIA 3KV3O 2JATA 4DEXA 4I3HA 3JX9A 1DU4A 1LCIA 2ETVA 5E7MA 4DVGA 1UBKS 4N0MA 4KDEA 3BORA 1M7BA 2V7VA 3PD7A 2FUKA 1GNQA 3KTAA 5KNDH 1YZTA 3VPDA 1QAOA 2I66A 4KDCA 4C88A 3BILA 2CC2A 2I5PO 3IE2A 4DKJA 4L8YA 3DAOA 3PUWA 4FSXA 3RF7A 1CULC 4P38A 2C9ZA 1QIIA 1ZD9A 3OT5A 4OU4A 4QWMA 3RVBA 1YL6A 4RH0A 3DV0A 4DV2B 2YDYA 2HWWA 3K5IA 2JRCA 3R4CA 4UHCA 3VXKA 3EWIA 1E77A 5IFLA 2X9VA 1FSSA 2RKBA 2XXAB 2JFUA 4KLCA 2ZJ4A 3QOFA 4Q01A 1ISRA 2IOYA 4CKWB 2MSDB 2XMDA 4PM4A 2BHTA 3H7IA 1OFTA 2EBWA 2GX6A 5FHRA 2JLYA 1XZKA 4Q7EA 1FXWF 1ZNXA 1IG0A 3HWX1 2WTAA 2AHOA 1LD3A 3IP8A 1U2GC 4Z0NA 3L07A 3SD7A 1QRUA 1QHNA 2FP4A 1BMTA 3E2PA 3HA2A 3QUTA 5CJJA 3RM3A 4S1NA 4DV7B 5IKEA 1UJMA 4IIFA 2C9OA 1FMJA 4YP1A 3ZXYA 3WZ2A 1KNXA 2HF2A 4WA8A 4B7ZA 4F38A 3KT3A 3IAFA 4QXMA 2FX3A 3A3YA 4JVOA 1VL1A 1ZA2A 2R8RA 4HEJA 4TOIA 5GV8A 4BFUA 3JWEA 1T4CB 4MI1A 4UHBA 2ZYAA 3C3BA 3TZKA 1C8KA 1PR2A 2C0CA 1LXCA 3NHMA 4D3XA 4D3YA 4ESVA 1Q74A 3AJ8A 1V3TA 3TLMA 1IOWA 1WOYA 2GZ1A 1BE6A 4YEDA 4CRWB 1K3TA 5DCWA 2VUUA 2OFWA 4H1UA 1PS8A 1ZI6A 1O3YA 4F4CA 2TYSB 3CY6A 2HHHB 1Y1KE 3BA1A 3MINA 1KBZA 3DZ8A 3T9BA 4X64B 2BHRA 2IYAA 2JFYA 3MPUA 2E6KA 2C7OA 1SULA 2OQ2A 4EO4A 2UVPA 4YMIA 1K0FA 5DCLA 2VEOA 3D3WB 5BV2P 3RD5A 4YN3A 3ZC3A 4E1AA 5DBEX 2XAUA 3NNDA 5TJHA 1VDZA 4RD4A 4WKNA 5CMLA 3ZIAA 2HUPA 2YUIA 4MMZB 2PEYA 3RRXA 1J21A 1DZIA 2JCVA 3GQBA 3V8EA 4IDAA 3OD1A 1BJRE 4Q7QA 1XSEA 4UCXA 1JWLA 1KMCA 4K1LA 4KO2S 4WKCA 3B36A 3I9OA 3O1IC 1FUYB 4Z0TA 5KNLA 4HQRA 4HXGA 1LI5A 1G2QA 1N9ZA 2GERA 2R1TB 4GLJA 4IXMA 4MS3B 1SK9A 4H3HB 1O97D 2P4HX 3LVBA 1JHAA 4AJHA 4BLRA 5LLDA 1LPPA 4D26A 1K9VF 2QZPA 3MJSA 5EE0A 3EDYA 2D5CA 3U7QB 1WSDA 2OB1A 1LJUA 2IU6A 5FTMA 1YI0A 2IUSA 3QMVA 4I1RA 1E4OA 2J9RA 3IUYA 1E0DA 4LXGA 5FWXB 3OEED 3UK0A 4AWAA 3NQ41 4LGYA 3OPQA 4BLQA 5B6PA 1EK0A 1J22A 5D85A 3GWZA 2JARA 1RHQA 3ZV6A 2YOHA 3B89A 2IHNA 4NQZA 2BTEA 4L15A 4XDZA 3WGVA 3JD3A 3N2GA 1C7ZA 3IEUA 4MMYB 4BP3A 3W2FA 3EQ7A 2ZE6A 2MWMA 4F4IA 1XKLA 4M1YA 3G0DA 1P5RA 4ACBA 5L3SA 3R77A 1TJ3A 4MW0A 4B4WA 2N0SA 3EZXA 3MVEA 4JQYA 5AT1A 2NIPA 2HBZA 4YJ3B 4IY1A 4YECA 4MVCA 5JXWA 4HXFB 2A88A 1Q7EA 1P1IA 1YB1A 1YS6A 2E1RA 5H0IA 5CAEB 4PTZA 3RTEA 5IBCA 1B1AA 1LTQA 1RAHA 3H2IA 1H9CA 5AR1A 2NNWB 4X7MA 3AM1A 4QOJA 3UW1A 2GPNA 1LK5A 1WZIA 1E60A 2OM2A 4BL5A 2BGUA 1TAUA 1JPNA 1KI1A 2C5SA 1QRAA 2FPGA 1YWGO 1O0CA 5BSFA 4DJTA 4JDUA 4M0LA 1GRVA 2IHTA 2W00A 2DQ4A 3SF0A 4D5EA 4EI7A 1W52X 4M7WA 3NV7A 1ZW1A 1OH7A 1GZUA 2XDQA 2R6GA 4MVWA 1JV2B 2AJ8A 3A3OA 2JHPA 4O59O 3LUFA 3ZX5A 1JEJA 4XQGA 3EPLA 4PZLA 2HUNA 5LOVF 3NT5A 4COKA 4IGIA 2I71A 5E8JA 5F23A 3C74A 4GOND 4BU1A 2HLDA 3TM5A 4YNBA 3VOSA 3A11A 3VBEA 3LYHA 1NFRA 3C3KA 3W4IA 4WECA 5TRTA 3OFVA 2J6HA 5FP0A 2AN1A 2BFDB 2C7RA 2I2WA 1KRWA 2HKIA 1P7YA 3PQ7A 1Z25A 5AJWA 2AG8A 2Z9CA 2G9UA 3LH5A 3ANSA 4JBLA 3NBAA 4M0DA 4TWRA 5A6SB 5C1PA 1BVRA 4IL5A 1R8XA 2JRLA 5JS8A 3QE9Y 3THOA 1TA0A 2GRUA 2F3PA 2VAMA 2IFTA 1YZHA 4UBIA 3DPUA 4RD1A 1L5WA 1VPEA 4NYJQ 1ZC3A 1CP3A 4B7XA 1IC6A 1QIJA 2BISA 1RP1A 2GAIA 1LF5A 4UXIA 1AKMA 4Z9FA 5FNZA 4TL6A 2QD5A 3NTOA 4OHUA 1XZNA 3VU9A 5IZCA 2OCLA 2VRCA 2WJ3A 5KYWB 3U7IA 3QIVA 3IB6A 3RRMA 1ORTA 1YGPA 2BEKA 3QM1A 3FOAA 5C8ZA 3ZV3A 5C7IO 3PX2A 3PXAA 4H15A 2QSZA 3AIIA 3KFXA 1NT4A 2VN8A 2W2LD 4Y1FA 3LLSA 1Y7HA 3IEPA 1PGQA 5KQGA 1MAVA 1WUTA 1QIDA 4TT3D 4CN9A 2R1UA 5J2UF 2NXCA 4E30A 4URUR 3MK31 1RC1A 3HCDA 3HO8A 3NTXA 4FCTA 3N86A 3P4XA 2F7SA 4P5DA 1QCYA 3VJLA 3CUSA 5ESWA 3GBVA 4QELA 1U2EA 3X1MA 1T1EA 3L4JA 3QK7A 3P9XA 3VHXA 5IKXA 3ZK8A 5DKFA 5HMMA 3UG6A 5H16A 5LQJA 2AEJA 3OI7A 4Z4IA 2GAOA 3JWIA 4Q6WA 3DS8A 1JAYA 1K4YA 1A97A 1M2VB 1MQ8B 1JEOA 3GA5A 5F2NA 1NR1A 4HCJA 4KPUB 3QPVA 3F3MA 4YRMA 4G0UA 2O6LA 3UT5B 2GD0A 5FLXA 2KLBA 3HZHA 4KXQA 3PEFA 5BRAA 2W42A 5HP4A 3VYVA 1G6OA 1GZHB 3LU1A 1QR6A 4B3SB 1G20B 1Z4MA 2GAAA 3H86A 4QXRA 3DE0X 5JASA 2LRHA 5F5XA 2QW0X 1DBQA 2OKCA 4ZALA 4UJ5A 3ZJUA 2HDNB 3EOAI 3R76A 2F55A 1QIGA 1U9IC 3LRPA 4MAMA 3WB1A 1J39A 1E2HA 1YZYA 4YXWA 3MN1A 2W5UA 2BUCA 3BQ9A 5IYZA 4DAEA 1Y6GA 2RK4A 5FIUA 4UM8B 1JIXA 1Z0KA 2GBLC 2IDKA 4HNGA 4NP6A 4KQKA 2FSHA 5KOHB 3STVA 3VPHA 1SQ6A 1XB2A 2EGGA 4OMDA 2IYFA 3O6VA 3HVJA 4M0MA 3D0KA 1NY5A 4FZRA 3O2JA 2B4TO 1PK8A 1QIEA 2O8BA 5TJ9A 1SUBA 3EC1A 2HK6A 4DWOA 4ZYWA 4BJ1A 2I2AA 1B0UA 2O2ZA 4LRWA 1VIYA 4U6NA 2XEXA 4JZKA 4EZIA 1G3QA 2PMCA 1ND5A 4F91B 3Q12A 2ECKA 2CXXA 4UUOA 3TEJA 1K27A 2HJWA 2QTWB 1D2MA 4G5HA 5C37A 4MHOA 5FEUA 1KDYA 1JBQA 1NRJB 3JQ6A 1J2TA 3TEFA 5JD5A 1YS1X 3W5DA 2VL7A 4CV3A 4K2AA 1N1DA 1Y9AA 5EINA 2PLFA 1X8KA 3FBTA 4EIWA 5IDQA 1EJ6A 4D9GA 3K0AA 5IS2A 2LIPA 3DE5X 1UWKA 1QH8B 3I1JA 1XCPA 2Q2VA 3OM0A 3MIIA 4K26A 4LSMA 4M38A 1L5NA 1FE8A 4EAQA 2P9TA 4BAZA 3O8RA 3X44A 4DDTA 2GM3A 3DBVO 4N0DA 1J00A 2Q7OE 4GHWA 3TE7A 5BYAA 2FW0A 1DINA 1H1LB 1RI2A 4G8CA 3R7AA 4O4LF 1I7PA 1GT91 2ZREA 5CB8A 1EG7A 1HRKA 4ENPA 1J25A 5EN4A 4GKJB 2UZIR 4UNIA 1URPA 1Y6JA 4QYSA 5AK5A 1NAHA 1QJCA 2DE0X 3AVPA 1BFDA 4ZPXA 4CT5A 1JA0A 3R5JA 1IIRA 4WCFA 3WP1B 2OB2A 4LY9A 1AQNA 4I6JA 1FDRA 3KOWA 4MVJA 4KN5A 3E27A 3VKHA 3R24A 4CI9A 5A4KA 4WLUA 3V1LA 4OXXA 4KVZA 4MZDA 3GIWA 1IM8A 1P75A 4DCSA 2GEKA 1QHYA 2CMDA 4E03A 1D5WA 2PGXA 3O3OB 3B70A 3CNEA 4LPKA 2C9MA 4OGKA 3B51X 4Y9DA 2LW7A 4H7IA 2C5BA 2XH8A 2XNJA 1KEEB 4BNUA 2BL4A 3H42B 1NIJA 3BWBA 2DWQA 2B20A 4Z7JA 2HDOA 2IY9A 4NNPA 2KQUA 2BFFB 1IN5A 1B41A 1QFYA 2XHEA 3GARA 3OQJA 4P54A 2C84A 4R83A 2A3RA 4HEQA 2D4HA 5EWJB 4BKMA 1J5XA 4CTJA 2Z8YM 1U0JA 1L8LA 4LNUA 1IN1A 2X41A 4G9EA 2DQKA 4ZU1X 4ZD6A 1ZIOA 4WOBA 3LC0A 5C8YB 5B2ZA 3KHUA 4RD3A 2ZIUB 2BGJA 3T0IA 4B2LA 5LXTF 3UMJA 1PUJA 2FYTA 3SQLA 4CKCA 4L9WA 1GGHA 2WJ4A 4JS0A 3OH8A 4U6SA 1SKUA 2ZYSA 3L93A 3L1JA 1C7IA 1KORA 4G24A 5EKSA 1T25A 1X86B 4OJQA 4I5GA 4EI9A 3KHKA 2DCMA 3BICA 3VDQA 3WWCA 5MF6A 1QVAA 4PSAA 4U8HA 2E4ZA 3K9CA 1R74A 1ISGA 1T1GA 2VSYA 5EGNA 2DFPA 3R0XA 3WWDA 4BQPA 2ZM6B 1FS5A 3R9XA 3EZNA 1V45E 1EFKA 3UJCA 3VDMA 3WDMA 4EPXA 4B46A 3PNOA 3QFTA 2BM8A 3TAUA 1IUPA 2V97A 3EDRA 3RAFC 4CEHB 3DZKA 4IZ6A 1WQ3A 3OZ7A 5EXDA 3NBQA 1NQ5A 4C22A 1KMMA 1Y8AA 3I1FA 4TLAA 3VAZA 2JAOA 4BQIA 5KVCA 2QY9A 4IO1A 1C3LA 1HL3A 1OBOA 1JR2A 2JD1A 1Y6RA 3JASB 4KHPB 3HJUA 1Y1PA 4IKPA 4CFYA 1K88A 1KFBB 2W58A 3M6FA 1FNSA 2BH9A 1NXSA 5D3MB 3AXSA 5IW8A 2MSNA 2C2XA 1GQOA 2FUNB 2X3UA 3U26A 3UAYA 4ZHSA 1DKQA 2ZB8A 4I08A 2DKNA 5CH5A 1ECBA 1V5IA 1R16A 1X9HA 4ZODA 1XDBA 3OX3A 2BR4A 2PBZA 4N0EA 2F43A 3GNTA 4AW9A 5JS6A 1UODA 2FRXA 2HU5A 2ZVDA 4AULA 2GJ4A 2ZSFA 5AKIA 5ESRA 4D3DA 4DZRA 4ZCMA 2VA9A 4RD6A 2CDAA 4XR9A 2XXBA 1X0XA 4TTPA 1IJEA 2J8ZA 1HK7A 2IEIA 2ZVPX 1IE3A 2WIFA 3SG0A 4I4IA 1CG6A 5FPHA 3LPLA 2IYNA 4UTRA 4JI2B 2D1SA 1U11A 4YHBA 4WOKA 3VDNB 4DIDA 3HJBA 2GR9A 4KIUA 5GV7A 3X3HA 1JQKA 2VQDA 4JBHA 4EUHA 4EY4A 5AOAA 4W5RA 3U56A 1OBFO 1TK9A 4JEHA 4X5OA 4C7BA 4J0DA 2HLNA 4MA5A 1V47A 4P4LA 1MC1A 2B92A 2ZB2A 4TVKA 3TX6A 1VZ2A 2FQ1A 4Q4CA 5K0BA 3ELUA 1W5SA