1NF3A

Structure of cdc42 in a complex with the gtpase-binding domain of the cell polarity protein, par6
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
194
structure length
194
Chain Sequence
GAMGIQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGLEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G25K GTP-binding protein, placental isoform
publication title Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 66
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1nf3A00
4LYHA 2P67A 1N6HA 2W6JA 1DEKA 4O3MA 4R71A 4IHQA 2DPXA 4TMZA 1G41A 3SQXA 4XD7A 1U99A 3A8TA 5EE9A 2W00A 4KSCA 4HZUB 2E1RA 5TXGA 4DHEA 3THOA 3U3KA 1Z63A 4MUAA 3NC0C 4NZYA 1GITA 4RY2A 2V3CC 1EFTA 2ZSAA 1PV4A 4RD3A 5JJKA 2RAPA 3FHOA 1IN7A 1YZGA 4C3ZA 1KHTA 2RHMA 4AK9A 1QHSA 1XD2A 2J45A 2RGNC 3GFPA 4TMVA 3KZ1E 2WKRA 2IEZA 4PSVA 4UNSA 1YZLA 4QGGA 1E2JA 5JCZA 2WAYA 4Q7MB 1S4QA 5LB2A 4JLBA 1G8GA 1CJVC 3QPVA 5JSZB 3AVYA 4DCVA 3LX5A 4M8NE 4XSGA 4OHVA 4C0SA 4LOAA 3SN6A 4KFUA 2O8BA 1RE0A 2OLKA 1XEWY 4CEIA 5J4LA 3LBNA 4I1SA 2JCSA 4D80A 5LDDC 1V43A 3CRMA 3TUIC 4BZPA 2V6IA 1S0UA 3IO5A 1N2CE 1XZQA 3ZVNA 2QMOA 1U94A 2GAAA 4C0HA 2Q9AA 1W0KA 4BLRA 4FMBB 4G5GA 2XSZD 4DLRA 5TV2A 4NMMA 2JLRA 1KJYA 2OXRA 2XX3A 1ETUA 3V4FA 121PA 2IYZA 3SDZA 3CRVA 4B3FX 4P4UA 1XXHB 2O8DA 2PMKA 1Z0DA 2CCKA 2BEKA 4MRVA 2P2LA 3NBXX 1JAIA 1MT0A 2IUSA 1KO5A 3K0EA 4IXMA 5DH9A 4YXWA 3UKDA 3K70B 2FOLA 1O87A 5DE3A 3A1UA 5HCIA 2FFBA 3TQFA 2A5YB 2D06A 1TQ6A 4PHHA 1N6PA 3SE0A 3WMGA 2AWNA 2BMEA 3AB3A 1KDOA 2YOFA 1M7BA 4C2TA 3EX7C 4CT4B 2WJYA 2IYQA 3CF0A 4ASUD 2RGEA 4DIDA 1OXVA 3FDIA 1E9AA 1FNMA 4KI0A 3X1DA 2WWWA 5D3MB 3EPLA 4DSNA 1G7RA 4URYR 3CR7A 4CRWB 4KLNA 2C78A 2ZE7A 3BERA 1MRNA 5JS8A 1SXJC 1WMSA 2NO0A 3E2IA 5HR5A 4AYXA 4OI2A 1G5PA 3B1ZA 1N6IA 4ITRC 3KB2A 4LCBA 3IBGA 1XEXB 2R6DA 2ZRPA 4RSGA 2JIZD 5FR1A 3GLGB 1RYFA 3VKWA 1TQ2A 4I1VA 2QNRA 4RD2A 2PT7A 1BO6A 1JI0A 4Z51A 3LA6A 1TEVA 4CGZA 3GFTA 2UZ3A 2O8EB 1TQDA 4IOJA 2WOOA 4UXHA 4QJ3A 4F4CA 1GAJA 3RS2A 4ZDJA 1IY0A 3B1YA 2WSSA 2X19A 1OKKD 5JZVA 2GK6A 4D82A 4JT2A 4WAUA 1YKSA 2QQEA 3CF2A 2R62A 2JLSA 2HCJB 4FMCB 4DB2A 2QE7A 4DJTA 2OBLA 2W6IA 4LBVA 3BFXA 3R9IA 3HPRA 3O8DA 1BMFD 2YZ2A 1NL3A 4TN1A 2CL0X 3GJ0A 1XWIA 5C4MA 3ZD7A 1FX0A 1II0A 2MSDB 2QAJA 4TMWA 3BB1A 1SKYE 2HLDA 4N0DA 3X1YA 2AFIE 2J59A 4KFSA 1CXZA 721PA 2YKGA 4IXNA 3EPHA 3W6NA 1KYIA 1E79A 4OKSA 1XXHE 1ANKA 3WBJA 5DNYB 1E9CA 4WZBE 3KTAA 3WP1B 1UBCA 3LRPA 3UK6A 3R7WB 2XZLA 3TH5A 1W4BA 2YWEA 3NHBA 2XITA 3D6TB 4A2WA 3FMPB 4TYPA 1Y63A 4K46A 3B1VA 4ZIRB 4JL8A 3UMRA 2VP9A 1NIJA 2OLJA 1Z08A 3AKYA 3P1JA 4AKHA 2D7CA 4M1YA 2XGJA 3RS4A 3VTKA 3ZQJA 2KE5A 2ONKA 2YNMA 3EZ9A 3QKTA 3SOPA 4CF7A 2A7QA 2R44A 2OCPA 1ZIPA 3QENA 2JJ1D 1SQ5A 3RS7A 4GMXA 4LYJA 2WJVA 3EZ7A 1U8YA 5FL7A 2Z4RA 1N0VC 5GVSA 4Q5IA 4RFSA 1VECA 3GLIE 1XZPA 2IYUA 3VR6A 5AJVB 3CNNA 3P20A 1T4GA 1YRBA 3CWQA 1Q1QA 1U8AA 3P27A 4LYFA 4WXRA 4RZ3A 4B73A 1N3BA 1BS1A 4D26A 5JCPA 2N46A 1W5TA 2G83A 5AWFC 3SFVA 1P60A 2PEYA 3HYRA 5CYOA 3KJIA 4XWOA 3FHCB 1GRNA 1ZBDA 2BM0A 1N6OA 2DCUA 2CVHA 3G82C 4KXFB 1PZNA 3B1XA 3CIOA 2HF9A 4ILEA 2JAQA 3WY9A 5EP4A 2IT1A 2R6AA 1P72A 4A0FA 5AUPB 3DZ8A 3IIJA 5LBIA 2F3RA 1SVMA 2VYFA 1G8HA 1CR0A 5FOSA 3GJ4A 4C0KA 4DXAA 1YZQA 3N2EA 5L3SB 2GF9A 3QXJA 2I1VB 3BH7A 2HDNB 2CNWA 5E4FA 1GL7A 4NBSA 4AY2A 2ORWA 5EE0A 3OZXA 2HEIA 4BRWA 2GXQA 2ZRIA 2C98A 2X2EA 4JVNA 1ZUIA 3RLFA 1F60A 1Z6AA 1OW3B 1U0HC 1TMKA 2PCLA 4KCGA 1DAEA 1N5IA 1N6KA 1ZYUA 3RWOA 4OK5A 1KJZA 1Z6XA 2N42A 4LPKA 5DI9A 1AGRA 2GEUA 2PLRA 4PTLA 3X1WA 3U44B 1IXRC 4C9BA 1TF5A 5LD2B 3W3ZB 1O3YA 3TVDA 4AYWA 4B6FA 1NBME 2F1RA 1D5CA 1IHUA 2GAOA 2VP2A 1HQCA 4QNMA 2G3YA 4BFWA 3VNVA 2BMFA 4YMUA 1M2OB 1NI3A 2OXCA 2ZJOA 3QKRA 1XCMA 4RZUA 4M9ZA 3SS8A 4A6PA 1NMZA 1KO8A 3DKVA 3K9NA 1LS6A 2FG5A 5JJLA 1XD8A 4E09A 1ZM9A 1D9ZA 1GSIA 2FGJA 4I4LA 4A9AA 2VHTA 5E7MA 3PITA 1ELOA 4JSTA 4HZIA 4EPWA 3ADCA 3R9WA 2BIFA 3ZH9B 2H92A 4BLTA 1Z28A 4AG5A 1KK1A 4O25A 4A8JC 1D2MA 2EYQA 1QHXA 4DLWA 4JKIA 4PHTA 1G8YA 5G40A 2P6NA 3BS4A 4XH9B 4EQ6B 3TKLA 1XMJA 4GFDA 5ANRB 2A5GA 4ARZA 3IPXA 3AF1A 2Q9BA 3TK1A 2BCJQ 4R9UC 3RC3A 2I1QA 1K6MA 3FGNA 1W36C 1ESNA 4TYYA 5FPTA 4N3NA 1D8TA 1T3HA 1TADA 1KSGA 3ZIAA 2JLVA 3QNUA 2WWFA 1E2DA 1E2FA 2VL7A 2JA1A 2ODBA 5HKKD 2HJVA 4E22A 1XJ0A 1VCOA 3AF4A 4Q4LA 1ZCAA 4JJKA 4GRAA 1KDPA 2HXYA 4MRRA 4JL5A 4A92A 1QHHB 3ONWA 1OH6A 4B3BA 2FN4A 1OT3A 3QKSA 5EJEA 2JJ2A 1P9NA 1RW4A 4QM6A 2AFHE 3AF0A 3BB4A 4Q47A 1CEEA 2QMEA 4DCTA 4MKHA 4QJ5A 3JVUA 2G88A 2YOHA 1DELA 4FN5A 2VF7A 1E94E 3LVQE 1Q20A 1T6NA 5CJPA 4QL3A 3WNBA 1OHHA 4KFTA 2DHRA 2HT6A 1FQKA 3CF6R 4CEIB 4ACAA 1R6BX 2MMGA 3ADKA 2UKDA 4MITA 2ZAMA 1HUQA 3DVLA 4NCNA 1QRAA 2P0EA 3WNDA 4Y0VA 4UNRA 2QBYB 2QROA 5FFMA 4RD1A 4EFMA 4B33A 4C0BA 1KI3A 3TW4A 4TQUS 2OO7A 4X8MA 3ZYCA 4A1FA 4LBYA 4Y0AA 3Q72A 4FI3C 1EX7A 4OHWA 1U98A 3RSOA 4MKFA 2OM2A 4EFNA 4DUGD 1IN4A 2FSFA 2QA5A 2YINC 4HB0A 1U81A 3H4MA 2AR7A 1W48A 3G5UA 4HDCA 4LJ9A 3U3RA 3UANA 2V8OA 1E69A 3B7GA 1Q1ZA 5E7IA 1Q22A 3E5HA 2IUUA 4IDHA 1OH5A 2EWVA 1IN8A 2OSBA 3MUFA 3GJ7A 3LAWA 4GOJA 1YJ5A 2ZTSA 2QGZA 1JJVA 4WW0A 1HA3A 4M1SA 8OHMA 1JXOA 1Z5ZA 1KI4A 2PX0A 2ZAOA 2AD5A 1HV8A 1MABB 3I3SR 5EP2A 5JHGB 2IX3A 1VIAA 2IUTA 2ZITA 1D2NA 3IIKA 3OF5A 4OJKA 1G18A 1W46A 1PVOA 4KYIB 5SZIA 3REGA 5F9HA 1PUIA 4MH0R 3JVVA 3U60B 3NEYA 3W8NA 4HAUA 2TMKA 5AUOB 3MJHA 2ZS9A 4PHFA 4U00A 3TSZA 1G3IA 4IFEA 2GBLC 4TT3D 3T35A 2ZJ5A 3NH6A 3KL4A 3GJ5A 2ZSEA 1QF9A 2NO7A 2J7PA 1W0JD 2C2HA 2R6GA 2AKYA 5FTMA 1T9HA 2ODWA 5D3MA 2YWGA 2GZAA 2W83A 1F6BA 1WRBA 1GOTA 4NHOA 1R7RA 2IYYA 2IWRA 5CDFA 3V00A 1N6RA 1ZVQA 2BDTA 3I5YA 3B5JA 4C4PA 4TYWA 1JPJA 1DG3A 1NBMD 3QF7A 4OJQA 4QBIA 3TQCA 3X1ZA 1E1QA 3SR0A 4GP7A 4XVQA 3ZVLA 2ZRNA 3KQLA 1OPXA 1GWNA 3KTAB 2C8VA 2OBMA 5B30A 1ZNXA 2ZS7A 3B9PA 1DAKA 4JLAA 2ZE8A 3K1JA 4PZYA 1UBEA 2O8EA 1P61B 5FBWB 4LUCA 1FL9A 2D62A 5JWHA 3NDBB 1OIVA 3AF3A 3M6AA 4L9SA 2O52A 3HU3A 3JZMA 4D25A 2QG6A 3UATA 3IHLA 2QU8A 2J46A 3CPJB 3SYKA 2QTHA 1OFIA 1FMJA 2ZPTX 4BQSA 3SZRA 2YWHA 4RD0A 1OJLA 4DDWA 5M04A 3B82A 2KJQA 1GVNB 4I81A 3BFKA 4L15A 3ZS8A 1J99A 4CIDA 2OE2A 3VNUA 2IS6A 5F9FA 1C9KA 4V0MA 4EPXA 2WJGA 4DC9A 2VIIA 1KAOA 2GXAA 3F3YA 4RFSB 1Z0JA 2C99A 1T0JB 2VHUA 1COWD 5KO2A 1KDRA 3C5CA 1W2GA 3QBVA 4P4SA 2FX3A 5H68A 2GESA 4N0EA 1R8SA 2FFQA 2WWIA 5G53C 2ZSFA 1JECA 3GFOA 1ZIOA 2JDID 3JZAA 3R7WA 4B76A 5J4YA 2JLUA 1R0XA 4PHGA 1HT1E 3CONA 4URZR 4DWJA 4NL4H 1Z6YA 1WP9A 1KY2A 3RRZA 5BQ5A 3VQTA 4C0LA 1NG9A 2QP4A 4L16A 1R0ZA 4FWTA 3DMDA 5DN6A 5IT5A 3PJRA 2G6BA 4YMVA 5E7JA 1LFDB 2R6FA 4A36A 3C41J 1Q57A 4AURA 2P6RA 1K5DA 2O0JA 3SQWA 1XEFA 4KBFA 2YOGA 4M9QA 4Q19A 4DDVA 1N25A 3MWLA 5IK2A 5J4HA 3RWMB 3VHXA 4DLSA 3AUYA 5BYJA 2ZE6A 3OEEA 2VSFA 3LLMA 2HYDA 3UMSA 1DOAA 1E2QA 3SJCA 4B3GA 4D4MA 1KK3A 2GKSA 4CVNA 1D2EA 3QG1A 2C77A 2GETA 2W6JD 4Q21A 4TL9A 3CBQA 3Q7QA 3CX7A 4KO8A 2QMUA 4XD7D 1Z83A 4WZAE 4FMDB 3W9YA 1P73A 3U7EB 1NSTA 3ETLA 5FUXA 1DARA 2ZJ8A 3NH9A 3RYTC 4QBHA 1DAMA 3MG9A 1XTJA 4ZDIA 2UVQA 2ZU6A 4DRZA 3PEYA 3DKPA 1Z2CA 3EW9A 2ZM5A 1ZD9A 1MO3A 2J0VA 2CHGA 3KJHA 1TQ4A 3LDAA 4U7DA 2G9NA 1E6CA 1B0UA 2BWJA 2OG2A 1LVGA 1BIFA 5FH9A 4M1TA 1DADA 1R10A 2RGNA 3H2YA 1T3SA 5BN3A 4IEIA 1P4SA 1G7SA 1T8UA 1NLFA 2W58A 5FI1B 3SHFA 1CS4C 2A2ZA 3A6PC 4PPQA 4BLSA 1YRAA 3IILA 4YDHB 5DI3A 1LV7A 2VEDA 4LDJA 4Q18A 1AZSC 4W5WA 5L3SA 1XCPA 3FTQA 5FPYA 4U02A 5HZKA 5EZ5A 2G0TA 1CRQA 1M34E 2GVDC 1U0JA 3D7MA 3BH6A 2VO1A 1XTKA 2BMDA 4QOSA 1W5SA 4UNQA 4AYTA 5AUQA 1C1YA 2PZFA 4ARZB 1IONA 2ZSBA 3ZZUA 4RKEA 1SVKA 1W0KD 2PMDA 4G5SA 1NNEA 5C46F 1KSJA 5FOVA 3ZLJA 1XPUA 2ANBA 1NRJB 4DT1A 2H17A 3MWKA 2HYIC 3FMOB 5CITA 2YVUA 4JBYA 1YZTA 4IW3B 1XMIA 1X8JA 4IOLA 2FEOA 4LSGA 1YHNA 1NG1A 4Z54A 1Z47A 4YXWD 1NVVR 1UEIA 1XBTA 3WYFA 2XAUA 4RD4A 1J8YF 5CM9C 1US8B 3QKSB 3A1WA 2BBWA 2O0HA 4NCJA 3WHKA 4CT5A 4NCIA 4EPVA 3FMFA 3I8XA 1OSNA 4L9WA 3KDSE 1DAHA 5DHAA 1G5RA 1SVLA 3RNLA 3TE6A 3AVWA 2YV5A 1Z2AA 3T15A 4LBZA 1OXXK 4TTRA 1WBDA 3B6EA 4EPRA 3L0SA 3UPUA 4NTZA 4OI4A 4BPBA 1GNRA 1SXJA 3PENA 1VG8A 1VDZA 5GJVC 5CM8B 1TF7A 4EQ6A 3U5ZB 1G9XA 4PFSA 2ZR9A 5CK4A 2XJ9A 2PJZA 3GPLA 4ZI3A 2JLYA 5KHOC 1G8FA 3QBTA 5TMPA 1RZ3A 1G3RA 4LHVA 4C7OB 1E1RA 4P3YA 1CIPA 1OXUA 2DFLA 3C16C 3L0OA 3M4YA 4PZLA 4DCSA 2ZJZA 1XTQA 1H65A 2VP5A 4JYCA 1SVSA 1JALA 4TTPA 3ND8A 1S3SA 1T8TA 2A5DA 3FE2A 4C0AC 2IHBA 4Q1FA 1CULC 2LCFA 2W2XA 3TUZC 1E2LA 3C8UA 5UKDA 2ERXA 4C30A 4M21A 1ZM3A 1Z3IX 1QHHA 5TY0A 5L3QA 2WSSD 4R98A 1UKYA 3BJIC 1Z07A 3IGFA 2A5FA 2A5JA 3THXA 5FPSA 4U5XA 1ZM7A 2F1JA 2WKQA 4MGZR 4US1R 2BBSA 2QE7D 2RKOA 3TBKA 1Z22A 1OB5A 4BFSA 4ESHA 3U4QA 2W6ID 2RGDA 3K0AA 5FI0B 3B13B 2ZRHA 3V9PA 1XRJA 1UADA 4DCUA 1G20E 2ZRMA 2CL7X 1GRQA 3QF4B 1DVRA 3WP0A 5JHHB 1TL7C 2A78A 2EFGA 4P31A 1M8PA 5GJCA 4CW7A 2W0MA 2ZJ2A 4DSUA 2QBYA 3A1SA 3LFUA 4WVFA 4HLDA 1ESMA 5A4JA 1EK0A 2EFDB 2WPDA 1E79D 4HI0E 4PC6A 3LQQA 1S8FA 3KQHA 4G1UC 3QVUA 1ZNWA 4L5BA 4BLPA 5A5GA 2QQ0A 5AJXA 1MO4A 4D0NA 4A0HA 2B92A 3O8RA 3U3JA 2IS1A 4A2QA 2MMCA 4RCYA 3KB1A 4NU0A 2H8KA 2Q3HA 2R8RA 4HAZA 2OILA 3BXZA 4B44A 4CZ2A 1KI6A 2IXGA 2IYWA 2Q0HA 4O2RA 1QHGA 3CO5A 3KXLA 1TAGA 4P33A 5J4VA 1CP2A 1BH2A 1RVDA 2DFTA 5HZHA 4BFVA 2GXUA 4TYQA 1E2KA 2H1LA 3MLEA 3KQKA 1NP6A 3TW8B 1ZC3A 4HAYA 5BXQC 1A2BA 3I1FA 4US2R 1G7CA 4Q02A 5EE5B 5L3RA 2Q6TA 4QJ4A 2FDCA 1HY3A 4KV9A 2QMHA 4YQFA 2BVNA 3CRRA 1CJUC 4K81B 1MABA 1QG2A 1W4RA 1KMHA 3Q85A 1G16A 1E9DA 4V0NA 1II8B 4Q9LA 4XOIA 5FL7D 2XNDD 1OYWA 2ZRCA 1DAFA 2C9OA 4PAQA 2H7VA 3THWB 3CWZA 1XFAA 3PQCA 2GNOA 3EZ2A 1I2DA 4B35A 3K09C 3PV0A 1FMLA 4BLOA 4LYAA 4PQFA 3T12A 4BASA 1KO4A 2D3WA 3DM9B 2KI5A 3BD9A 2EU8A 4TSFA 4QHTA 1UM8A 4TZ6A 2ZRBA 2WIBA 1UKEA 2IF2A 4FMCF 4D4LA 2GEVA 1KGDA 5EXTA 4MKGA 3BORA 3ZQ6A 1P2UA 2C96A 3ZJYA 4MDFA 4D6PA 2Y8EA 4Q1EA 2XTMA 2REBA 4AKGA 1G291 2C9CA 2SHKA 1AGPA 1KTVA 1RJ9A 4TYNA 4Q4HA 2QP9X 1HEIA 2GCPA 1DO0A 521PA 1PLLA 4P4SB 1OIXA 2GJAA 1EWRA 2XSZA 2Q21A 2H16A 4YC7A 5IRCD 3MD0A 4QGAA 4YLGA 2NZJA 1TU3A 3SBEA 1AKEA 1DBSA 1KI1A 1ZM2A 4TMXA 3WRXC 2KWIA 4EIWA 3ASYA 4NCHA 1KI7A 1GL9B 2NIPA 2FPKA 1V5WA 2ZS8A 1Y3AA 2CNWD 3GJ8A 2QPOA 3CZPA 1G3UA 1QVAA 1FUUA 3PG5A 3C7KA 4TMTA 4TWZA 5CIQA 1OFTA 1MRSA 2AXPA 3EC2A 2QN6A 2AD1A 1K5GA 2I3BA 4ZDKA 1QBKC 4LJ6A 2R2AA 1OH7A 3QJYA 3TSOA 4H9GA 4PANA 1QDEA 3AVQA 1R2QA 2ATVA 4G5QA 3U7FB 3IDQA 2V6JA 4FWIB 5SZJA 1E2NA 1FP6A 1C4OA 2GILA 2GTPA 1WBBA 5KDDA 4IKEA 3LXXA 3QUSA 4B2LA 3HU2A 4CDGA 5G41A 1FPMA 2ZJYA 4TTQA 5JECA 3K9GA 4URVR 3NHAA 1XTRA 2ZI7A 1T3LA 1TTTA 4GI7A 3GLGE 4Q9KA 1IN6A 2FZLA 3A1TA 4DB4A 2REOA 1R4AA 3BE4A 3QI2A 3TUJC 2JIZA 2R65A 5FUWA 3AUXA 3CX8A 4JVMA 1Q21A 2IYSA 2JLQA 4V0LA 2AL7A 4OL0A 5E3HA 1DAGA 1LY1A 2ZJAA 3U2QA 2G0NA 3B60A 2PEZA 4OQFA 4J0QA 2QEQA 1M1YE 3QY0A 3RS0A 1KI2A 4MGIR 5KDLA 1Z0IA 1U9IA 4YMSA 3AVPA 3VR4A 1G21E 6Q21A 5DLQC 2IYLD 3FPAA 1RYHA 1Z0KA 4UKDA 4NYJR 4Q7LA 2VHJA 1JB1A 5ELXA 1ZW6A 2QT0A 1HH4A 2LKDA 4OI0A 1VMAA 1G7TA 2RB4A 1GP2A 1VG1A 3OIYA 4V0ME 5DI3B 4M9SA 3PCRB 4B75A 5EE3A 3M0EA 4WOPA 4HB3A 1ZMXA 4B48A 4MA4A 5HTKA 1KMQA 4FIDA 3L2OB 4AWXA 1DG1G 2ZR7A 2ASEA 2CK3A 1JR6A 3GEIA 1UEJA 4QHSA 1Z0AA 2CHQA 3L0PA 3ZIAD 2EWWA 4L4UA 3AP2A 2ZI4A 3K0SA 4PPGA 2OZEA 2A3RA 3PUYA 4LI0A 3I61A 3L8ZA 4KBGA 5JWOA 1UJ2A 4PSKA 4EJSC 2O8CA 2ZUBA 4E07A 4TL8A 2XTNA 2QORA 2XOKD 2CXXA 3THYB 3LW8A 4ZCMA 2JJ2D 5DYGA 1Z0FA 3QVVA 1E9RA 4Q7KA 4DT1B 3OAAA 2QSYA 3EIHA 1XD9A 1FTNA 3BBPA 5CB6A 4F7WA 1Q3TA 1XMSA 1OFUX 4NPHA 2QRZA 3U7HB 1OHHD 2X1VA 3GLFA 1W4AA 4W5JA 2PH1A 1I4TD 5KDOA 5B57C 2GCOA 4M2LA 1KKLA 1FQJA 1ZC4A 5D3QA 1X3SA 2K5UA 1E32A 5H1YA 1R5OA 1NLZA 3LXRA 3SFZA 5KPJA 1ZU5A 4PSAA 3EWSA 2JEOA 3RRYA 2B8WA 4CYMA 3ADDA 3TSWA 1WA5A 2MSEB 4KVAA 3O8CA 4IFBA 2B21A 4HAXA 1Q0UA 3VMFA 1ONBA 3SNHA 4PAMA 1SXJB 3AKEA 2Q3FA 3DO6A 2ZVQX 4AIIA 1IXZA 1P62B 2H5EA 3FYHA 3T06B 2FJUA 2XB2A 1G5TA 1KI8A 2ORIA 3LLUA 3RRNA 1KZGB 4C0JA 4DLVA 3KKQA 2BJVA 4L8GA 2BC9A 4LWZA 3AQ4A 4R7ZA 1VCIA 3PFIA 5J4KA 3FB4A 4FINA 3CRW1 2CBZA 5G3YA 1VPLA 1G4UR 4D2IA 4ZO4A 2NG1A 3LW7A 2GRJA 2NQ2C 3K70D 821PA 1IJFA 1P3JA 4MDEA 1ZRHA 4WXPA 2F1HA 4DVGA 2XJ4A 3MRSA 5L3QB 4KITB 1US8A 1RPZA 3B85A 2HXSA 3WYAA 3THXB 3GMTA 4ZI2A 2VH5R 1P5ZB 5AR1A 4JLOA 2GWHA 1Q1EA 3WMFA 2J7PD 3U4QB 3K0AB 3GJ6A 4CEJA 2Q3MA 4MYCA 4HDQB 3QXSA 4OHXA 1NN0A 4LX0A 3SJBA 2IYXA 2DWOA 1JNYA 4OQLA 3MGCA 3I62A 4NP6A 4ZV4A 4Q4JB 3W5IA 3REFA 2QENA 2ZUCA 2VQSA 2B7BA 2Z43A 1II9A 2QGNA 2X8AA 4NYIR 3AVXA 4D0GA 4TLDA 1XPRA 1E1QD 2Z83A 1HTWA 1G6HA 1RRGA 4NYMR 3ADBA 3TGPA 3K0CC 2ZRAA 3N2IA 4OYHA 4Q66C 2J0SA 4UNNA 4QNRA 5GADl 2NO6A 4JLDA 3PVSA 3QKUA 4JIMA 1AJEA 2GJKA 4NH0A 1QHNA 1GDDA 3BFVA 3KUDA 1KI6B 1W2HA 1NVVQ 5G3ZA 3SC3A 3SEAA 3C4JA 5IF9A 4ESVA 2VHQA 1CF4A 1U2RA 3C5HA 3QXHA 2MSCB 3K0FB 4QBGB 2RGXA 2FFHA 3RABA 3ZGXA 3TR5A 1GM5A 3EXAA 4V0OA 1LTQA 3O8BA 1X8KA 3C14C 1HE1C 3FVQA 4GDFA 1SULA 4MUBA 1OLOA 1MH1A 2JLWA 2WV9A 5EZ6B 3RDPA 1NKSA 4FCVA 1GILA 3T1VA 5CIWA 4JT4A 2QPTA 3HR7A 1JPNA 1KMHB 3TLXA 3UWOA 3EPKA 2QPAA 3M1IA 3QF4A 4BWYA 2DR3A 1KDTA 5BW8A 4HB4A 4B34A 4TQ9A 2ZSDA 2QRNA 4PO8A 3QXXA 2NGRA 4M1MA 4B3DA 5FUYA 5CYPA 2CEAA 2XZPA 5BN4A 3Q3JB 1AZTA 4TL6A 1YZNA 1QVRA 2GJ9A 5FTNA 2BCGY 4JMPA 1LB1B 2DY1A 1XTSA 4V0KA 5F2EA 5FBRB 3C15C 3W5JA 5KSYA 1OB2A 1QHYA 2PL3A 1ZD8A 5HKKA 2HJGA 2GVZC 1IN5A 3VX3A 2WKPA 2PX3A 3AGPA 3P32A 2GJ8A 2P65A 1UBGA 3AGQA 4V03A 3NDPA 3BK7A 3TMKA 3J81k 421PA 2FNAA 3R20A 5TDHA 4KJZA 1RJ9B 4Q4HB 2ZRKA 1OFHA 5CJ2A 3VX4A 5DN6D 4EAQA 4I1UA 3DOFA 4DLYA 4DDTA 4BFTA 4BFZA 4MGKR 4DEXA 3ICQB 2PBRA 1E2GA 2FU5C 1N5KA 1F48A 3OFND 5KNBA 5IK2D 3S1AB 1CU1A 2XZOA 1EFRA 1XMVA 3OEED 4OK6A 3KFVA 4JBWA 1E99A 1WQ1R 1II8A 2H57A 3CW2A 4EDHA 3D3QA 1XDBA 4ZCIA 621PA 2P5SA 2G1JA 4KAXA 3THWA 4BECA 2EQBA 4Z8XA 2CLSA 4GZLA 2UZIR 3PUZA 5AJWA 4B6EA 1H8HD 3KJEA 1TU4A 4KU4A 4JLVA 3GLIA 1F2TA 1B23P 1VYTA 4Q1DA 3FFBA 2V1XA 5FBQB 3BH0A 4BEBA 1YR7A 4PC1A 4TL7A 5F98A 4TQAA 4LJYA 1NVUQ 5H8WA 3LH5A 5H70A 4DLXA 2RGGA 3SU8A 2R6CA 3AVOA 4XTCS 1E0KA 4IRUB 2VSOA 2AX4A 4Q1CA 3EIEA 4XTRA 3TR0A 2CE7A 1IQPA 1W44A 3A58B 2QM8A 3UMFA 1A5TA 4UJ3A 3U61B 1R0WA 2PZEA 2D2FA 1P2VA 4LHWA 3QOFA 2AXNA 1TF2A 1CR2A 2ZANA 4HUQB 5SZKB 4LK2A 4OQXA 3EPJA 1CTQA 1P9WA 1BYIA 3ZD6A 3IQXA 3T1QA 4DDUA 3U7GA 4A8JB 3R9XA 1X6VA 2FE4A 3K70C 4LRWA 3GP8A 5DGXA 2IA5A 4X8HA 1ZM4A 1VCNA 4IDNA 4Q01A 2QAGC 2BEJA 1W4CA 1FFHA 4TT3A 1TUIA 2XXAA 2CCJA 1JR3A 3LVRE 2R9VA 1R0YA 3LO5A 5P21A 3H1TA 1SHZA 2GCNA 5IDVA 1DAIA 2F7SA 3IUYA 2D4HA 3D8BA 4M1OA 1YR9A 3E70C 1G6OA 2VTKA 2RMKA 2WM9B 2ZRLA 2EFCB 3OEHA 3HR8A 1W36B 5KOYA 3CPEA 3E1SA 3NXSA 3OIUA 1IAQA 2HF8A 3K8YA 4QBFA 4FW9A 4G01B 4IDOA 3WYGA 2BOVA 3NWJA 4LV5B 4D4JA 5JEEA 5JS7A 1L4YA 3DOEA 4PPFA 1IY1A 3A4NA 1VIYA 4ABYA 3QE0A 4PC2A 2O8CB 1EG7A 4HLUC 1ZP6A 1A1VA 4LBWA 5JWRA 2PZGA 2GK7A 2ZYVX 2BJWA 4FMDF 1I4LD 1QHIA 3EAQA 3LX8A 3FKSA 3T1TA 3A36A 3RS5A 3T1OA 1H8EA 4MRPA 1G1MA 5J5CA 3FWYA 5TVKA 1EESA 1VG9B 1GNQA 2QP3A 1Q1BA 4W9MC 1VYVA 1EWQA 3TAUA 5FPKA 3GLFB 2LKCA 1AS3A 2ZR0A 3K53A 3LWNA 4RJLA 4D4KA 1MKYA 2GCOB 3L43A 1YZUA 1EX6A 3MJRA 1FZQA 2VRWA 4JLJA 2F6RA 2QL6A 1M7HA 1E3MA 4ZKDA 5BYKA 4GZMA 4LY6A 4Q9JA 2G1KA 1E1RD 2WJJA 1EFCA 3KUCA 3AVTA 2WAXA 1MV5A 3PUXA 3NBFA 4HYYA 2REXB 4JYBA 3PUVA 2F9LA 1T91A 1G3QA 4B47A 1AS2A 1CJTC 3QQ5A 3VU9A 1CLUA 4WZ6A 4TMKA 4TZ0A 3B2EA 5FBLB 2CVFA 2RGAA 2KB0A 2CJWA 3CLVA 1E9FA 2WWHA 3KKNA 3PEWA 3THYA 1P6XA 1P2TA 1Q44A 1NLYA 3SBDA 5KNDA 4OK3A 3OIWA 2D74A 2IYTA 1N0UA 4B2PA 3KKOA 3OE7A 2RHDA 1NIPA 3KQUA 5A0FA 4KVGA 2O8FB 2GDJA 4JLNA 4UNPA 1GUAA 1S1CA 4NYJQ 4BE7B 3PEUA 3G0HA 2ZETA 3VFDA 3A37A 2VP4A 1OIWA 5C18A 3IPYA 2ODNA 1X8LA 1EGAA 2WPDD 3EG5A 3Q8XB 3SJZA 1XP8A 2RGCA 3LQRA 3PR1A 4CEJB 1KO7A 3MFYA 1ZU4A 2FEMA 2CLCX 4TLAA 1DS6A 2ZRJA 1AQUA 4LC0A 4QXAA 1WCV1 3NIBA 2ECKA 4YMTA 4H1VA 4PC7A 3ECCA 1OF1A 2IYRA 2ZI6A 4MKIA 1HQYE 3TVTA 2I4IA 3IEVA 4C7OA 2V7QA 3V4RA 3MCAA 3VR1A 2ZYTX 1N6NA 3EA5A 2DFNA 3X2SA 4UXIA 4F93B 2ERYA 3NC1C 3HJNA 4QKQA 1Z8FA 3GLFE 3B1WA 3QEOA 1XTIA 3TAHA 3LV8A 5HCNA 1HYQA 1RRCA 4NCKA 3RANA 2IBMA 1KNXA 4RZ2A 4OI1A 1ZD1A 2EW1A 4F4JA 2NOAA 3BWDD 2ZXUA 4JS0A 4BRUA 1UKVY 4JZKA 2JASA 3CNLA 3AP1A 1YE8A 1BYUA 4OQMA 3I92A 2CCGA 2N1BA 2OCYC 2WMNB 4B3CA 3NBZC 3K09A 2EYUA 1G4AE 3KXIA 2A9KA 4M1KA 4GBMA 4A6XA 4B74A 3RC8A 1ZNYA 2BM1A 1J2JA 2CE2X 4E03A 3PEVA 4TSFD 3FFAA 1P75A 2NTYC 3I32A 2WMOB 5KSZA 1K8RA 5CLQA 2ZE5A 3KXKA 4EUNA 1TX4B 5B2ZA 2E87A 5JEDA 4BZQA 1QG4A 1NJFA 5DYIA 1Z6GA 2HLDD 3IQWA 4MYHA 2VF8A 1S9DA 4Q4JA 4AC9A 5JRJA 3A4LA 1ZUHA 1VYUA 4IOMA 2YJTD 4M1WA 4F4IA 2D7DA 2HT1A 4GL2A 1Z29A 5LD2C 2P5TB 1IXSB 4Z1MA 4HAVA 1SKYB 1SGWA 2PT5A 5CLLA 1A82A 3TNFA 1P9RA 5KSPA 3AVVA 3A4MA 2CL6X 1AQYA 4BFUA 1L2TA 3QEJA 2GJSA 1KNQA 3OESA 5TB5A 4PX9A 5L8VA 1XCGB 3LBHA 2QAGB 2VLIA 2J9RA 5AUNB 5K8LA 3VR5A 2OAQ1 4HB2A 3K0FA 4Q1AA 5FR2A 2ZQ5A 3ZZTA 2B7CA 2FA9A 3EWAA 4GOKA 5TARA 3T5DA 2HUPA 3MAAC 1YR8A 3U6KA 1VG0B 4IJMA 4IVQA 1YZKA 1WE2A 4JVLA 2ZU0C 3KKMA 4AKEA 1F5NA 2ZYUX 1A4RA 3CX6A 3NEJA 2FV8A 5JRZA 3DEFA 1NSFA 3GCGA 3WHLA 1W1WA 1DTSA 5FTJA 2GA8A 2ZUDA 1JQJC 4NYIQ 4DCNA 2W0SA 1R5NA 4KSBA 2VP0A 3AVUA 2VSXA 3CUEF 2OEPA 1BKDR 2ORVA 4NYMQ 4X8LA 2QUZA 3GLIB 1F2TB 1KK0A 4Z8YA 2PJRA 4HDOB 4W7SA 1F2UA 1J8MF 4HSEA 4W5HA 5CK5A 2PLFA 3QXCA 3ZS9A 5B58C 5JJIA 4OHZA 2X2FA 2GZHA 3T34A 3BC1A 4OQNA 1JAHA 4O2LA 3ZDQA 4M9XA 4Q1BA 5DO9A 3FHTA 1GRRA 2ZI5A 4PXAA 1NN5A 1DO2A 4UJ5A 1QZXA 1NMYA 1N6LA 2YWFA 4DLTA 1AM4D 4YMWA 1S1MA 4ZCLA 4D81A 3QG5A 3NKVA 2V9PA 4XJXA 2YC4C 3FKQA 3RAPR 2NMVA 4CEHA 2ZREA 4GPTA 4D0LB 2OHFA 3S1AA 5JBQA 2ZI3A 3NTUA 3R8FA 3CKLA 3P4YA 3DDCA 1W36D 3MSXA 2CK3D 4MYTA 4PZZA 2AWOA 1MO5A 4Q9HA 3HYTA 1E2MA 2BHRA 4KHZA 3D31A 1KSFX 1SVOA 4FCTA 2XXAB 4PO9A 1RRPA 5EE1A 4ASUA 4EJSA 2AKAB 4LV6A 2ZRDA 1JJ7A 4JBXA 3PXGA 3CNOA 4Q9IA 5CDFE 1UDXA 4RFVA 4ZDWA 4XVUA 3F8TA 3WNCA 1LF0A 1ZAKA 4XWKA 2QT1A 4LHYA 3OAAD 3RS3A 1N5JA 1LW7A 1M74A 1P7CA 2ZIAA 5CB8A 5FTKA 4TLBA 3LBIA 1E96A 3H84A 2WVJA 2BV3A 5GJWC 1A7JA 1SKQA 5SZHB 1HURA 1A2KC 5EXXA 4JJZA 1BOFA 1WDTA 2ZRGA 3BOSA 5BWMA 4HUQA 1XPOA 4KYUA 2QTFA 1S2MA 4BGDA 2KBEA 4KODA 4DSTA 3ND9A 2W2TA 2J0UB 4ON9A 4IVRA 2Z0MA 3H86A 5EQTA 3NG1A 1E9SA 2NO9A 2DWQA 3I4LA 4DLUA 4P32A 4A8JA 2XTZA 5C4GB 2XNDA 5JMTA 4MGYR 1OKKA 2ZYWX 1R8QA 3P26A 2BMJA 2FSHA 4EKDA 3I5XA 1E98A 3KJGA 3FOZA 5DHFA 2F9MA 2GZDA 1CR1A 3IIMA 4IDQA 1BMFA 4NONA 1E2IA 3GLHA 4PR0A 1WB9A 4EPTA 2ZRFA 1NMXA 2CHVA 3MWJA 2DWPA 2OESA 3U6BA 2EFHB 1S96A 3GEEA 1F3OA 1J7KA 4O0MA 4A82A 5JFGA 4JLPA 2KSQA 4IEEA 1PUJA 3VU9B 3IHWA 1JBKA 2F43B 2YC2C 3AEZA 2CJWB 5KNCA 1FUKA 4BLQA 4JKYA 5KYKA 2JJ8A 2FSGA 1E4VA 4Q4AA 3RVBA 2F55A 1ZINA 2PCJA 4IOKA 1ZUNB 1M6NA 3WBKA 1CKEA 2WWGA 1JR3E 3DPUA 4BFYA 2QZ4A 1AN0A 3WRYC 2GEDA 2QTVB 4YONB 2ZEJA 2HCBA 4H1UA 3HP1A 2J7KA 2EVWX 1L7VC 2RGBA 3WXMA 2X77A 2AK3A 5C1BA 4BUJA 1IY2A 1J90A 2J3EA 2JJ1A 2YHSA 2Z6VA 1GKUB 4QGHA 3P4XA 4OHYA 4DZZA 4A4DA 4POAA 1GKYA 2NPIA 2WBLC 3K0CA 4V02A 4LHZA 3GD7A 3X1XA 2VP6A 1XJCA 3BAFA 4PAOA 3LNCA 1G19A 4QM7A 1JEEA 4PQYA 3UXMA 1I4DD 3AF2A 1VHLA 2DBYA 4G0NA 4NDZA 1ZCBA 2IL1A 3ZVRA 2DYKA 3Q9LA 4P4TA 1E9EA 2FF7A 2QM7A 4PO1A 1E0SA 4QFMA 1OYYA 4K8OA 3R8CA 3W90A 5LPNA 3W6PA 2WSMA 4LJ5A 3EA0A 4DIEA 4Q00A 4RD6A 1E2HA 3W8RA 1GG2A 3IKJA 1MOZA 1W47A 2JLXA 1DE0A 3GJ3A 1D6JA 4B43A 1KAGA 4EPYA 1EFUA 1U9IC 3EZFA 4R2IA 2J5XA 4G5RA 5IHPA 1XD2B 1Z6TA 4A0GA 5FOTA 2O8FA 2IHYA 4HATA 1AIPA 2H18A 2J1LA 2Q9CA 3GEHA 4MQBA 5KSOA 4B2IA 3BB3A 2O5VA 1XB2A 2Z5FA 2GF0A 1GTVA 2L0XA 1G8PA 2ATXA 1CJKC 2GBLA 1MO6A 2LWIA 3KQNA 1KIMA 1IJEA 4P0TA 4S2EA 3RHFA 1KJWA 2J87A 3CH5A 3QPWA 1U0LA 4LPSA 2FPLA 4X8OA 2O8BB 4AI6A 1XJQA 3DL0A 1KO1A 3TJZA 1Q12A 2NO1A 1RRFA 1Q3HA 4HLCA 1E2PA 2G77B 2JGNA 3GJXC 4B3XA 3VHLB 3H0KA 5EP1A 1M7GA 2IK8A 3AV0B 4GMDA 4HZUA 4HAWA 2XOKA 3WMEA 1AA9A 4A15A 4JLKA 3HPQA 4QRHA 2W2VA 3CZQA 3FMIA 2OCBA 4MRNA 3IBYA 3O47A 2GXSA 2O8DB 2DFKB 4IVPA 1IOZA 1RIFA 2XB4A 1AK2A 3T5GA 2OCAA 1IM2A 1EFRD 2BKEA 4RVCA 3K9LA 4GSYA 3CPHA 1NKTA 2GHIA 4HEJA 3OHMA 1KK2A 2OFWA 4LJAA 4M4SA 4QHYA 4II7A 4BFXA 5JSZA 2BBTA 1ODFA 1T0HB 5JI2E 2IWHA 5KTYA 4URUR 2J0QA 1L8QA 3U3MA 1SXJE 4RCZA 3QPUA 5EP3A 1JXMA 4XWAA 3F5FA 4LJ8A 2FWRA 3CRQA 5AJZA 4I1OA 1JQLB 2IXFA 3BGWA 3LY5A 1TPZA 2IF0A 4C0QC 5B64A 1FW6A 4C2UA 1CBUA 2OBNA 1XU4A 3MWYW 1NF3A 1S9HA 2CLDX 2HV8A 3AKCA 2WWYA 2BBOA 4M22A 3SYNA 2KBFA 1OXTA 1NVXQ 1G3MA 1UAAA 1GKIA 5DSZA 1F2UB 3GQBA 2Z4SA 1XXHA 5K8IA 3CM0A 4A2PA 1EFHA 5JLJA 1CRPA 1NY6A 1G17A 3MMPA 1OV4A 3DZDA 1RKBA 3CH4B 3N5CA 3HU1A 1RC8A 1HT2E 5KPDA 1W7AA 3QSYA 3ICEA 2OAP1 4AG6A 3VKGA 4LC1A 3AKDA 3AH8A 2WICA 2QAGA 2QSZA 4MYUA 5K8TA 2WWXA 1PLKA 2B6HA 3UG6A 2D2EA 3KKPA 4R2HA 3VKHA 1JR3D 1UPTA 3EC1A 4UQOA 2OT3B 1FP7A 3K9HA 3OIVA 4XVRA 3TIFA 1WXQA 1Z06A 2BKUA 4CEHB 1HE8B 4URXR 5F3WB 3UWKA 2WZQA 2ZVPX 5FBVB 4JLMA 3OEHD 3IO3A 3VAAA 1OE0A 3CB4A 3EASA 1FX0B 1VTKA 4TLCA 4DSOA 1VHTA 4LGMA 3EIQA 1SVWA 1YU9A 2C95A 2NPFA 3W6OA 2WJHA 5HPYB 1TEXA 2QY9A 2ZROA 5JI3E 4LZZA 5FPHA 4NE2A 4BEJA 3W3AA 4EJSB 2ZI9A 1VCMA 1XEXA 1UFQA 3I73A 3PIRA 4HLUA 5EUMA 1E0AA 2VHCA 4G5OA 2OFOA 2VBCA 3NBYC 1AKYA 4PC3A 3VR3A 3GLGA 4YDSA 1DPFA 1YQTA 4Q03A 4M53A 4DUGA 1UBFA 2ONJA 4JSYA 1NN3A 5EUQB 5FTLA 1KY3A 4RKFA 1X86B 2YYZA 3FKSD 1IBRA 2CMKA 4DKXA 4EFLA 2F3TA 1H8ED 4GNKA 1KSHA 3N70A 4LJ7A 2V55B 2P6UA 4URWR 2XEXA 2XNSA 5EXPA 2WIAA 5HE8A 2WTUA 5AJYA 4Q7JB 5FL3A 4E5UA 3B78A 2P3SA 5DISB 4HUTA 1FNNA 3ZVMA 1CR4A 2IW3A 2OV2A 4LHXA 4FD2A 4RZXA 1X1RA 4ERNA 2AK2A 1AS0A 4S35A 2OFXA 4ZKEA 2J41A 1R5BA 2EFEB 4PQRA 4QC2A 5BN5A 1VKJA 1ZNZA 2IYVA 4M0LA 1G64A 2OUKA 3I72A 1GIAA 3QIAA 1FTSA 2IXEA 1XNJA 3Q7PA 4US0R 3TRFA 2VPPA 1SHKA 3EARA 4WBSA 1P2SA 4IDPA 4AD8A 2ZJBA 3Q5DA 4HLQB 1W0JA 3RRMA 4G3XA 1LNZA 4GOXA 4FXPA 3HDTA 5FOUA 1FOEB 3DHWC 4KLZA 1J70A 3GLHB 5KUTA 4GT1A 3UG7A 4QGFA 2FGKA 1E9BA 4WA7A 1XX6A 3SJAA 1ZJ6A 1NJGA 1YVDA 1LF5A 1XEWX 2ANCA 2O0KA 1OXSC 4LJ4A 4Q48A 2ODEA 2C9YA 4ZIRA 1NBMA 3IEUA 4ZPXA 2VA8A 3A1VA 3ASZA 4I99A 3OE7D 4WIAA 1WF3A 3AM1A 1I2MA 3NVAA 1T5LA 5AK0A 5J47A 4B32A 2WHXA 1KOFA 1SZPA 1OH8A 4F92B 1NVWQ 3OFNA 2IEYA 2WJIA 4XIGS 2FH5B 1KI9A 2C04A 4Q4AB 5GJBA 4GP6A 2NZ8A 1JEDA 3B9QA 3SHWA 1TNDA 3U3OA 2J0UA 2C5LA 3CR8A 1U90A 4PPNA 3F0TA 2CDNA 5EXSA 1GZSA 1LS1A 1W49A 1GFIA 2RH5A 1E0JA 4KFRA 3PUWA 5FOWA 3L8YA 4QG7A 1SXJD 1KZ7B 5FOXA 1H8HA 4B71A 5FUVA 1UKZA 1PLJA 2FMXA 3LD9A 2V7QD 4FCWA 2FPMA 3DM5A 3UIEA 5KU1A 1X1SA 3B8HA 4F91B 1L4UA 3RSLA 3L0IB 3Q5EA 4TLEA 2C03A 3HWSA 5LB4A 3W34A 5K8UA 1RFLA 3EZ6A 5C2JB 2WOJA 2A30A 3L82B 4ACBA 1YR6A 3ZZ0A 1UDWA 3DMNA 3SI7A 4XSHA 1PJRA 1S3GA 3BRWD 2FSIA 2F1IA 3QKRB 2QI9C 2FFAA 1TUEA 1COWA 1SVIA 4F38A 1GL6A 4AKIA 1E2EA 4DBLC 1UF9A 4MRSA 4OBEA 5GVRA 1D9XA 2F43A 2AHOA 3KX2A 4BZXA 2E9SA 4JVSB 2V1UA 4UXJA 1T5IA 2JDIA 2V54A 1NY5A 2FZ4A 221PA 5E95A 5J40A 2IS2A 3KFXA 1KKMA 1CJMA 2DB3A 2IC5A 4NKRA 3BIFA 5L3VA 1E4YA 1MR3F 3GLHE 4LV8B 1N0WA 3SYLA 4DEYA 1NN1A 4N1AA 3AP3A 2B8TA 2RCNA 3U44A 3I8SA 3VR2A 1EXMA 2V4ZA 2AN9A 3T61A 1GNPA 4A0RA 1XF9A 4Z1MD 2JLZA 1N5LA 4DLZA 5DIFA 1U8ZA 5HE9A 2IS4A 4JL6A 2JATA
chains in the Genus database with same CATH superfamily
3TZKA 4RF2A 3IPCA 2PUWA 2W5UA 3EWNA 4GD3Q 2W6JA 4QLAA 1KAQA 1IE3A 2C84A 4IHQA 2VUHB 3DTTA 1H2FA 4R0NA 3V4ZA 1QUFA 4BO0A 3RVMA 3UJNA 2R8YA 1J2TA 1YL7A 1CUHA 3KOOA 5FEMA 1OV6A 3TQHA 3COYA 3OD1A 4UE3S 4KSCA 2AN3A 4HZUB 3AY0A 5TXGA 1NT2A 2NQTA 3FFXA 4DHEA 1Q2XA 1V3UA 3VR5D 5TJHA 5IZ4A 3VTAA 1ORVA 1KJNA 2AMVA 1LDMA 3GEMA 3NC0C 4NZYA 1PJ8A 1O5IA 4RY2A 5EQJB 1EFTA 2ZSAA 3LIIA 3OPYB 1FVHA 5KOJA 2JHAA 3WLMA 3GCWA 4OMUA 5B7PA 5JNTA 3FHOA 4NJMA 5ILOA 1IN7A 3NIFB 2RHMA 1I1OA 4AK9A 1QHSA 4UOZA 3KZ1E 3WGKA 4MW5A 4J16C 2WKRA 2DF8A 3AUUA 2X6QA 2JAPA 3L7KA 4PSVA 3T99A 1UPXA 3FUTA 1J0XO 3DTNA 4N7RA 1E2JA 2M6KA 2KLHA 4JLBA 4J0EA 1CJVC 4GPZA 2VZLA 3OWXA 3OIFA 3LX5A 1V71A 3BE5A 4EQZA 4M8NE 4N82A 4WBNA 2BW0A 2CJPA 1D4ZA 2VWPA 4RANA 4JY7A 1RE0A 3FGOA 2O8BA 1HE5A 3LT2A 2FUNB 3N2GB 4DJJA 3TQSA 1DUVG 4Y2QA 1V43A 4FFBA 1MB9A 3VSEA 4AJLA 4C4OA 2P9BA 1UJ5A 4DLYA 3L4KA 1S0UA 5ECWA 2OORA 4D3YA 2FG7C 5JYEA 2PSJA 3ZVNA 1GGVA 3UW1A 2I9KA 4LQCA 4B2YA 5KJ6A 3QMMA 4DCPA 4DXDA 1CY4A 1YDGA 1HSZA 2J33A 3FAKA 1P18A 4N6GA 1TEZA 4HDNB 4CUJA 2WKWA 2JLRA 3MS7A 3D3NA 4BIIA 1KOGA 2FEWB 4Z49A 2J4FA 1JI3A 4P4UA 5ABPA 2PMKA 2UYHA 2FKAA 2WJ4A 3HVKA 4FUTA 4L7QA 4MMZB 4MRVA 2IUSA 1MT0A 3G5TA 4IXMA 3LYUA 1DDIA 2ODTX 5FAXA 1T26A 5BMVF 5LFAA 3K70B 1OBCA 4JJAA 3U49A 2V7XA 2PGNA 5SY9A 4BNWA 1I51A 2A5YB 3S81A 4G26A 1TQ6A 3QFSA 4HRYA 4PHHA 4YALA 1ML3A 2ISCA 4U8HA 5SY6A 4HDSB 3ZU2A 3MRVA 2BMEA 2JBAA 5DU2A 4CT4B 1KYXA 2WJYA 2OLEA 4KGXA 1TAQA 1WXEA 5BUCA 2FSPA 4BGIA 2QYHA 4N7BA 2J3LA 1OXVA 2XUGA 3U13A 3Q8KA 3O4JA 3EPLA 4HEHA 1RXEA 4DSNA 4UOEA 3WLKX 2H6EA 3EGDA 4KLNA 4CRWB 5CH5A 1MJGM 1R3DA 3BERA 4DV6B 3Q7IA 4J0FA 2RK3A 4MP6A 2VDPB 1WUHS 2RBKA 1HWYA 3JQFC 4M99A 1QTIA 1KDVA 3DD5A 4DMFA 2G17A 3NAQA 1F3LA 4TS4A 2POQX 4D6XA 3P9CA 4OI2A 5BVHB 1N6IA 3U40A 2ODQA 1YRHA 3FBGA 2ZRPA 3F74A 4HG2A 3RHTA 4B3IA 1AHPA 3P9QA 1ZSVA 1TPYA 4PEVA 4ZRDA 1XQYA 5LCXA 1PL0A 1HXHA 2QRMA 4UDOA 4UMEA 2LDBA 2P1RA 2YJ3A 3A6LA 1TQ2A 4I1VA 3STXA 4F9TA 4YRBA 4GM1A 4ZT2A 4CKYA 2QQ5A 2PT7A 2XCLA 1BO6A 1WUJS 1OA0A 1F38A 4CGZA 1RPAA 3WLQA 1Z3CA 4LZAA 3ZX5A 4IIHA 2J67A 4HZGA 3E0QA 3EXEA 4UXHA 4O2BF 4Y2SA 3LQ4A 4X85A 3KK0A 3RS2A 1DC7A 4ZDJA 1HDOA 1HDEA 3MWFA 2X19A 3RTEA 5CEFA 1DKQA 4RA9B 4XQCA 4XDHA 4Y98A 2FK7A 1TK2A 1KTIA 1LVUA 1JT2A 1DHTA 5EWMB 1YKSA 2A5LA 2H1IA 4D42A 4D9EA 4FKZA 3SKXA 2W6IA 3OM0A 1UDAA 1U3DA 1Z4JA 3IDFA 3TXYA 1NL3A 2EP8A 4R3NA 3ESAA 4J03A 3ZWCA 2DH6A 3IOYA 4TN1A 2CL0X 2CNLA 4ZQIA 1O2DA 4JP2A 2OYRA 2R84A 3AHFA 5A2GA 3UOGA 2HRRA 5WRFA 4TMWA 3BB1A 4XASA 1CUSA 3JQBA 4O4JA 3UT5A 4C87A 5CCEA 1CXZA 1IOLA 2FP4B 1ZH8A 4QULA 2F17A 2AC2A 4EEKA 1A9OA 1E79A 2PU5A 1OFGA 5DNYB 1Z15A 1E9CA 2XZDA 2QW1A 3O7WA 4OGFA 2CLMB 5EHIA 5B3JC 1U9YA 5CDYA 1BCRA 3PFHA 5JBIA 3BKWA 1O08A 1CZOA 1RQRA 1C2YA 1KORA 4YMGA 1OGIA 1ECBA 4MW9A 3TLKA 3NHBA 2HJHA 4Q16A 1NXQA 3TSAA 2VA9A 4BNMA 4E6EA 1PGQA 4JI2B 1JQKA 3GH3A 2VHEA 1ZRSA 1Y63A 4MXDA 4K46A 4TV8A 5JXJA 1N34B 2E5LB 1TA0A 2VP9A 2Z5VA 3WRYA 2EJVA 2R87A 1VE3A 4N47A 4DF3A 2OLJA 3HZRA 4OP1A 1KQFA 1SEPA 4XIJA 4MQUA 3AEUA 4RHXA 4L2IB 1C3JA 3VTKA 2ONKA 3SXPA 1NP7A 1M0WA 5TPWA 1JJFA 4ZD6A 1J39A 4BX3A 4FZJA 1GZ3A 2A7QA 4GX1A 1E8DA 3HUTA 1QM5A 3AI1A 1ZIPA 3C3DA 3VPXA 4WCFB 3TB4A 4ISBA 2H4WA 1HF3A 1XMPA 1GZ7A 1P2FA 4TKLA 4DM4A 3IHKA 5FL7A 4I4IA 3CNEA 1X1EA 1N0VC 1WM1A 2GX6A 2V3WA 3PJEA 4Q5IA 4RFSA 3D81A 2I8LA 5CD9A 1C30B 1JDUA 1GCUA 1SPBS 2INGX 2PS0A 1V95A 4W4TA 3VR6A 4QUKA 4F8YA 1UJNA 4NENB 3UT6A 3TGWA 4G85A 4OL9A 3G68A 3GCDA 1N3BA 3FGPA 5DGTA 1H6BA 2HU5A 2ZUEA 3K4HA 5JCPA 1F6DA 4K6HA 3TEMA 5CDUA 1JEAA 5AWFC 5DOZA 1XAIA 4UDXX 5CYOA 3KJIA 3RKSA 5AVJA 3S5JA 4ZJZA 1EVEA 1GRNA 2XRYA 2BM0A 1B1AA 4FR2A 1Z62A 4LRXA 3TKYA 4A8PA 5BWNA 1X38A 4B9AA 3JYLA 1PZNA 3B1XA 2Q4RA 2HF9A 3AR6A 4ILEA 1FW8A 1MENA 1RYZA 3BXPA 4X93A 4DHWA 3WY9A 1VE5A 5BR8B 2C8KA 5AW3A 2D5BA 1P72A 4G8DA 4JBNA 4A0FA 5EHXA 5AVXA 1SVMA 2YY5A 1M2KA 2FSUA 2PBFA 3E2MA 4DXAA 4GO1A 3H1EA 1YZQA 4H2DA 2XF8A 1O0BA 2HSDA 2I1VB 3CVYA 1YFLA 1FVXA 1HFKA 2HDNB 3JQQA 1DRWA 1CJSA 4FYHA 1IH8A 1GL7A 4KRYA 1OB5A 4MPPA 1O4WA 3SZOA 4CDNA 2C98A 1Q7EA 1VZ2A 1ZUIA 2QG4A 4PZCA 4RESA 3ROFA 1L7DA 5IN4A 3KSUA 5F7OA 1TMKA 1DAEA 1N5IA 1ZYUA 5HF8A 1H3FA 3OOSA 3SR4A 2WF5A 3MF4A 1KJZA 3VDMA 4W8OA 5AK6A 2GEUA 3QLUA 3U44B 3AEKA 2VP3A 1N2JA 4A5OA 1O3YA 1ONNA 1DQPA 1QAMA 3NRBA 4E2ZA 4B6FA 5ITVA 5DB4A 2O2DA 1D5CA 3DP9A 1IHUA 1KF0A 1MHTA 4X3CA 1U2ZA 2W8BA 4H0FA 2X2OA 4BWFB 4X61A 2O48X 3HI6A 2A3NA 3SS9X 2ZB7A 1FRFS 4BCCA 4YUZA 2XWQA 3FPKA 1NI3A 2HH9A 3QKRA 4XWGA 5LN1A 1EBFA 2QGFA 3T3NA 1VKOA 3MAGA 2DFDA 3DKVA 5E2AA 4C1BA 1LS6A 2VPQA 3RK0A 4I50F 5KQGA 1XD8A 3PB3A 5C8YB 4IEFB 5BUSA 4O4IB 2NXJA 1U7OA 4AQYB 2VHTA 5H7XA 5LWQA 1ELOA 2E89A 4NAVA 1IC6A 3GUZA 3X43A 4EPWA 4M8LA 4JENA 3R9WA 1FDVA 2FRVA 3WIUA 3ZH9B 4BLTA 5IJZA 4BN5A 5KOJB 4M0FA 2HGZA 2VQFB 1M67A 5KVQA 4NJMB 4IWNA 4J29A 1T4MA 4BX8A 2EYQA 4CLEA 1QHXA 3PQ5A 4DLWA 5THQA 4QNNA 1RC1A 4PHTA 4B83A 3LT1A 5G40A 3O75A 2P6NA 1VLVA 4XH9B 3N58A 3TKLA 3AESA 4GR4A 3C4VA 4X84A 4GPEA 3OZUA 1K8QA 3IPXA 4IJKA 4MIOA 3W04A 2HBQA 3MPOA 1I8TA 5DYWA 2BCJQ 5LMCA 3D7RA 3WAJA 4WBNB 1W36C 5AQEA 5FPTA 1QFZA 1BX3A 3EF1A 3ZIAA 5B6JA 4L28A 4EDFA 1AB6A 3AEQB 3IYLW 1E2FA 3T9EA 2IEGA 2JA1A 2I6GA 4NZNA 3E9DA 2HJVA 3SXUA 1KHHA 2JCGA 1NX6A 1LW6E 1ZCAA 4Q4LA 5AQ1A 1KDPA 2M32A 3WNZA 1NFRA 1CZUA 4H1HA 4MRRA 4DQDA 3B7WA 1ZMTA 3FMVA 1I10A 4PR3A 1WF6A 4LY0A 3QKSA 4QPJC 2JJ2A 1E92A 4PONA 4S2UA 3O03A 4G0XA 1RW4A 3KVNA 1XZJA 3L7OA 4I9UA 3ZHVA 1EK1A 3LKVA 4Q47A 5KHLB 4QM6A 5DM4A 4QJ5A 4JX8A 3EVBA 3WQHA 2OV3A 4R8MA 2VF7A 4JXKA 4MOWA 5LA6A 1E94E 1F5SA 1JFFB 1Q20A 1XQWA 1FJ2A 2AUMA 1EJ2A 1N7IA 2HQBA 1I3CA 1OHHA 3PDIA 3WNBA 1JHPA 5ALLA 1TC2A 3STTA 2P9JA 4ACAA 1U28C 1ESCA 3TPFA 4NOKA 3UJ7A 1ZVVA 2HJWA 4U4AA 5GVSA 4R3WA 4IJVA 3WNDA 4NCNA 2P0EA 1NW9B 2CD9A 1QO0D 4JQOA 1DX6A 2DPGA 3FR7A 4C0BA 2JBAB 1P5JA 5AK3A 4E4TA 4B8ZA 2FRDA 2P0AA 3JQPA 4CGYA 3KAKA 4H59A 4OG2A 2GZ3A 3LF1A 3NT2A 2CFCA 4OB6A 4UC0A 3STYA 4B9EA 4CLRA 4YCAA 2RH4A 3UV6A 1JG1A 2WB4A 4KWEA 4HQLA 3OPXA 1NZFA 3DBRA 2YINC 3EGDB 4G5HA 3TWOA 2FW8A 5LP6F 2JFHA 4YBRA 1ZXBA 4IV5A 3T7EA 4HEQA 3ESCA 3FJYA 1E69A 4CFZA 1ZGZA 4O08A 1Q1ZA 5F77A 5E7IA 1Q22A 3WMWA 4IDHA 1Q77A 1ZOLA 3CUUA 1ZAYA 3ILSA 1WZCA 3KEQA 3MUFA 5CB4B 4OMFG 3LAWA 5LP1A 4G25A 2JVKA 5JASA 1X7ZA 2XMCA 3DHNA 3DTYA 1I32A 2OBYA 1SOVA 2ZB2A 4GRDA 3RT1A 1JXOA 2IPOA 2RH9B 4RK5A 1GPUA 3R6DA 2V58A 5KTRA 4KO1S 4M7WA 2IX3A 2EJCA 2RC6A 1GPBA 4MVXA 2WHPA 4X1KA 1TCAA 1D2NA 1PVOA 3OF5A 3EXEB 1RC0A 1C80A 3EVFA 2CZCA 4MH0R 3JVVA 1FSSA 3TB6A 1C0LA 3HCWA 4G2NA 2OBBA 1G59A 3MJHA 3R76A 3D3WB 1ZXXA 1ICEA 2K7FA 1IMOA 1KVRA 3NVDA 3TSZA 3NTXA 2G8NA 2YJZA 2V4UA 2ZWVA 3IA7A 3TJRA 1LK0A 4M9UA 2ZYSA 4PF1A 5FTMA 5A4MS 5JATA 4RLSA 1O95D 1T9HA 4KQ2A 4TRJA 2ODWA 2ACVA 1DRKA 1U5BA 1I6WA 2YWGA 4ND8A 2GZAA 4Y1GA 1HDIA 1GOTA 5MF6A 4YAWA 1MTOA 3VC7A 3HFRA 2IWRA 2QR2A 4BEWA 4EF6A 1CZHA 3S1SA 1KMNA 1BXGB 4Z7QB 3DHEA 4HY3A 2BP7B 2P68A 3MT8A 3DE3X 1E1QA 3EUFA 5AI8A 5L6LB 3PNSA 3HEBA 3SR0A 1BN7A 3O1IC 1A1SA 2O3JA 4BUCA 2ZRNA 1OPXA 2QRQA 4UUNA 1GWNA 1N9KA 2X7XA 1BCRB 1XZGA 1WUTA 3EN0A 3H1FA 1UR5A 1UKCA 4PN7A 4LYDA 4B5KA 4JLAA 2ZE8A 4XLTA 4NIMA 5KX5F 4RHEA 5ER9A 1MD9A 2VVTA 4RY9A 4J2HA 2H85A 4GI3A 4TV8B 1PQUA 3QFCA 5G0VA 3EXIA 2JLBA 1OIVA 2WWRA 1OX4A 3JZMA 3AEUB 2ACKA 4XDGA 1T4CB 4RH0A 3H17A 3JYQA 4ROTA 1R0CA 4XLLA 3IHLA 4ZC8A 5HEKA 3BFPA 3L0BA 1ZONA 4X91A 2AE2A 5AIAA 1KETA 4ND7A 5TPWB 4XFJA 1CQZA 4MAAA 4XB2A 3K35A 5AHWA 1IHPA 2I1WA 2X22A 4BQSA 1OJLA 4F5YA 2KJQA 2PZMA 3LCRA 3O94A 2P40A 4I81A 2BF7A 4JD5A 4NBUA 2IS6A 2JK1A 5I4KA 3WV5A 3NGXA 3UJ8A 3F3YA 1Y98A 4X64B 1NZJA 1ZUWA 4RFSB 1HR0B 3MFQA 3K2QA 4R6WA 4RUKA 2C99A 5EKSA 2VHUA 4OSOA 5KO2A 3WIOA 2EJBA 2IPLA 1BX0A 2FX3A 2Q49A 2F3PA 2WJ3A 2YVAA 4ETIA 2UXCB 3A4VA 1GAXA 5F35A 3UXHA 3LPMA 4NI5A 2CYCA 3UAXA 1GTJ1 4EK9A 3D6UA 2XMZA 4B76A 3AU9A 2OQIA 2IZ6A 1HT1E 3ZU5A 2EBWA 4CKEA 3F6YA 5TS3A 1T3GA 1WP9A 4J9UE 1EK6A 1W76A 1RZVA 1GTZA 2ESRA 3LHKA 2VNAA 5C1PA 2PE5A 1NG9A 3DMDA 5DN6A 1PR0A 5JQGB 2G6BA 3HBNA 3JAKA 1SAYA 5AKGA 3IAFA 5IYZA 3WRVA 2DQKA 3PL1A 5E7JA 3C41J 1Q57A 3Q1LA 2SCUB 3BGSA 3MJSA 5A4DA 3ISJA 5IAOA 2QTLA 2ZTLA 4KBFA 4YQZA 3EMBA 4PNHA 3VHXA 1VXRA 1WMFA 4F9GA 4NZOA 3U1BA 3ZWVA 1I0IA 2IITA 1U0TA 2ZE6A 3KXPA 1TO6A 4CI9A 1DOAA 1E2QA 1E4EA 5DIZA 3ORYA 3EMKA 1PV2A 3W4JA 2IH4A 1L1RA 1TFUA 3QG1A 2GETA 2IDKA 4KR6A 4TL9A 5EKDA 1LJ8A 4KO8A 2QMUA 4MVJH 1LUAA 4TWJA 3AV3A 1P73A 3SDSA 4HK4A 4YVFA 5LYJA 2HU2A 4J0GA 4E1AA 1NR5A 3MG9A 4HWTA 4MI1A 2UVQA 2ZU6A 3M6XA 3DKPA 1EQUA 4KDRA 5DX1A 3UT0A 1ZD9A 1RI2A 1MO3A 2AQKA 3FZGA 2W8BB 3H2IA 1WSAA 4OJNA 1ZL2A 1TQ4A 4EGFA 1E6CA 3A11A 2OG2A 3AHCA 3N8KA 1L5WA 5K3BA 2H8GA 1DADA 3AJAA 1D2HA 3T7RA 4IEIA 3DT9A 1P4SA 1G7SA 1N2OA 1T8UA 1H22A 3QMPA 5DXJA 1KC1A 1UM9A 2V98A 3IILA 4YDHB 3ANMA 4XJTA 1LV7A 1FRNA 5DI3A 4FBGA 2VPXA 3JALA 1AZSC 3O3NB 4RVOA 5IEBA 1XCPA 3AUSA 1EMDA 4CI0B 4GYJA 4BP9A 1Y9ZA 5FPYA 4BMDA 3CGWA 4P2BA 4AECA 2PZJA 2XRZA 4PSCA 3ABZA 1T2DA 1CRQA 4W9NC 5DGDA 2VBIA 1DQRA 3IBSA 4NNPA 3UMYA 4QOSA 3NUQA 4G0QA 1SBHA 3ADPA 3AESB 4U7FA 4XIIA 4CBVA 5HS4A 3W3AD 2PUAA 1C1YA 1IONA 4MS4A 4AG3A 2H7XA 1JKIA 4H35A 4WDQA 1ZJYA 3JWEA 3ZZUA 1TXGA 1VPWA 4NXNB 1SVKA 3W7BA 4ZK6A 4G5SA 3FWPA 2OA0A 4C4AA 5C46F 3GVXA 3UH0A 3ZLJA 1H1TA 2ANBA 4RPLA 1Y5NA 3K4PA 3PD1A 4C06A 4DT1A 1GAQA 3KNZA 3UPTA 5CITA 2H1RA 1UEXC 5G0SA 2F3SA 2JI6A 1J23A 3H4IA 3FYUC 3LY8A 5ICSA 1X8JA 3CH7A 3VPDA 2FEOA 4DCJA 1YHNA 1YR2A 5LZ8A 1TKAA 4Q4DA 1K6XA 2G5CA 3RKRA 5GWXA 4B6GA 4CM3A 1SHTX 1UEIA 4YXWD 1XBTA 5C53B 3TSCA 1YS1X 2PFGA 4XX0A 1GKLA 1VKZA 4F2DA 4KIJA 1PR9A 3HGQA 3O84A 3WFZA 1PN3A 3MJVA 4JJFA 4E30A 3QKSB 3UQZA 2HPVA 2BBWA 3FNHA 2AJTA 1QCZA 3H42B 1L5LA 5JS2A 2W6MA 4JDUA 3AERB 2I2DA 3FMFA 3I8XA 2ID9A 4XPZA 3RROA 3U7JA 5AESA 1YACA 3WKAA 5BR4A 3ZOKA 3O3CA 1QK5A 5LA6B 1G5RA 1CEXA 3HKCB 4P80A 2LGJA 3AEXA 3PDIB 4H7FA 1WBDA 2PWYA 3KHUA 3UYKA 1YJ8A 1FYDA 1VLHA 2VATA 2CXTA 3L0SA 4NTZA 1WMDA 4PLCA 4AMVA 1Q6ZA 4ANFA 3MINB 4GLBA 4UHJA 5DSTA 5MN4A 1SXJA 2JI9A 2V45A 2YIMA 3OIGA 5F4BA 5GJVC 5CM8B 3JRNA 2C2WA 4EQ6A 1BE1A 4RGQA 2QXYA 2AYZA 3CUVA 1LV8A 2F1KA 2WM3A 2XJ9A 3LCJA 4D56A 4B3SB 2AX3A 3GLQA 1GCAA 1AQ6A 1PK8A 4O02B 1MDFA 2BDEA 4IDBA 2ETXA 4M7PA 1WXXA 1G3RA 5JVDA 4P3YA 1CIPA 3D8UA 3WLPA 4KPGA 5AKJA 1XTQA 2DFPA 2VP5A 3P9YA 1JKXA 1LLFA 2IU6A 3CUWA 2YWBA 1IZZA 1EEHA 1WS6A 1S3SA 1YJXA 3DBRB 3FE2A 3ZBQA 1H2XA 4DL9A 5L4NA 2P91A 4FE7A 5HGJA 2ATIA 1OXBB 3HJUA 5A3QA 3TUZC 1GQRA 4GSLA 2ERXA 3FYDA 1ZM3A 1NLUA 4M21A 3ZK8A 1V8BA 1Z5VA 3PHCA 3Q7TA 4FNGA 1QHHA 4W1PA 4K1XA 3ISVA 4ALJA 2YRFA 1LDBA 2P6OA 3THXA 2A5JA 5AVOA 5FPSA 4CCYA 1OC2A 5BSFA 2WKQA 2F1JA 3A6FA 4CKWB 1EUYA 3OFJA 4CG1A 2BBSA 4JI5B 3TBKA 1EUDB 3EFBA 3UCEA 1Z22A 2TRSB 1AB5A 5IARA 3U4QA 3V9PA 1GFWA 3MNFA 5KAMA 1ZGCA 3NEAA 4DA7A 4P4LA 1UADA 4X1KB 4DCUA 3KYDB 3WP0A 4AL4A 1UBMS 2JLZA 2JD1A 1F17A 5JHHB 1TL7C 2A78A 3RC9A 4P31A 3PUKA 1JIXA 3EJ6A 1YNOA 5GZ1A 5H9VA 4YX9A 2FPXA 3LFUA 2QBYA 4WVFA 3NOVA 5LUBA 4BO4A 2P77A 2GS9A 3QYJA 2EFDB 1R6DA 2M1XA 3LO8A 4R9NA 3LQQA 1TA4A 5ECYA 3KJXA 3ZPXA 3KQHA 1IXYA 3D6VA 3DAFA 1YH3A 3IALA 3QVUA 4L5BA 1QTQA 4C4XA 3O8OA 3KSAC 3HBLA 3U3JA 4AF7A 2IS1A 3QGMA 4RCYA 2D0DA 1FRVA 1VDMA 1U5BB 4ND8B 3I4CA 1PI3A 2OILA 2Z2YA 5DASA 4JGBA 4B44A 3E8SA 1QPGA 1KI6A 2IXGA 3GPIA 4LVOA 3CO5A 5HKBA 1G5HA 3RS8A 1ADJA 1QH9A 2WC1A 3MTQA 4TROA 5HKLA 1EVLA 2HMAA 3TCXB 2A94A 1DZ3A 5FULA 5CFPA 2V0GA 2W37A 2BLNA 4QQ8A 5KCZA 4V1CI 2H1LA 1Y7TA 1NP6A 1Q7BA 2C3UA 2XQIA 3T8YA 5CURA 3TW8B 4D41A 5BXQC 1G7CA 4HPXB 4PWZA 2Q8PA 2Q6TA 1G6Q1 4P92A 1EHYA 4FJ2A 1KQNA 3BULA 3FCAA 4KV9A 2WWVD 3I6QA 4YQFA 5LYYA 2HWUA 4K81B 3SGLA 5HM8A 5J3JA 7MHTA 3GU3A 3L3BA 1KMHA 1X0VA 1Z4QA 4JBLA 4I1YA 1SKBA 4DR5B 3TNJA 4XOIA 3FYTA 5BQPA 1K7SN 1VIMA 4ALKA 3MXOA 2ZRCA 1HDYA 2JAUA 3EY4A 3O4HA 1YUNA 3CWZA 1XFAA 2OHOA 1XK6A 1FE8A 3AXSA 1EXVA 4QOHA 1TM2A 1WJGA 3PV0A 2DM6A 1HX7A 4C20A 2ZBUA 3QMVA 2Q5CA 5K0BA 1Y3CE 2D3WA 3BD9A 1BE6A 1B41A 3OSZA 4QHTA 2C5HA 3EFEA 4RHYA 4B6SA 3ZDDA 3NNDA 2HSEA 4FMCF 1L5FA 5DYYA 5LQKA 4MKGA 1P2UA 1TD9A 4UBOA 4Q9NA 4MDFA 2EIXA 3OT1B 5HKAA 1WB5A 1U3GA 4YY3B 4QGSA 1R9NA 2FF5A 4Q1EA 3DEJA 4DJAA 4KX5A 4LS3A 1MVOA 2SHKA 3R09A 4TYNA 1TU0A 3CCCA 2VSYA 1DO0A 1OI7A 5D00A 1X9IA 4MUFA 2H16A 1MJFA 1XNQB 2B1GA 4YLGA 1X8XA 4LSMA 2WM2A 4R16A 3SBEA 5AVWA 1ZLYA 2B2CA 2W11A 1L4LA 2G36A 3DVSX 1L8AA 1ZM2A 1X80A 2KWIA 4EIWA 2R7MA 2WHEA 3ASYA 3P0HA 4XR4A 4LXQA 1GL9B 5GONA 8GPBA 4EB3A 1YC2A 4UULA 4F4UA 2QMYA 2Z56A 3ZX4A 4CKEB 2VZ0A 1FUUA 3FM9A 3C7KA 2GD6A 4TWZA 2C2BA 1JW9B 4IGAA 3K73O 4DMLA 1XZNA 3VVBA 2XCRB 2WAAA 5T5QA 1YBVA 1QDLB 3CNBA 3EC2A 3NI2A 2QN6A 3JAKB 3ZE8A 5IYZB 4ZDKA 4MGHA 1SKMA 1QOPB 2C8LA 1OH7A 5L7YA 2JGMA 1QDEA 1VHQA 3AVQA 1TGYA 3GHYA 4XCVA 1OZ0A 1X94A 2ATVA 2BFOA 4G5QA 5DULA 3U7FB 3IQIX 3H4TA 2V6JA 2X8JA 1ND5A 1L5SA 4ZJYA 2CYAA 2XY4A 4S04A 2WVGA 3VHXB 1E2NA 5K1ZA 1ZN7A 1AT1A 1PVDA 2GILA 2Q62A 2PGLA 1GQ2A 2VBFA 3I04M 4OUDA 4IKEA 1J1ZA 2XD9A 3JQ9C 3HU2A 2KW5A 3V1TC 1FPMA 4TTQA 1U7TA 2E4AA 1IRXA 2ZJ3A 2Q3LA 2R7KA 3IXLA 3WAGA 3NKLA 3NHAA 1XTRA 4D57A 3LECA 4IDEA 1TTTA 1IN6A 4JZYA 2GFIA 1DMRA 2GEKA 5LXTF 1B8NA 2BMAA 2H1WA 4RL6A 1HM5A 1UK9A 1M3SA 5LYJB 1LSOA 4FNOA 2NPOA 3DKRA 5K09A 3AUXA 4GWGA 1Q21A 1USKA 2JLQA 3DMPA 2AL7A 3QVLA 4C07A 5C8XA 5A3VA 3K5IA 1JGTA 2G0NA 2PEZA 3B60A 5HRUA 3DMYA 3UHFA 4GPAA 4MGIR 3OCZA 1Z0IA 3GNTA 3JZDA 3BCUA 1RVV1 2EG5A 3RU7A 1WIWA 4URFA 1Y9EA 1Q0ZA 4QICA 1JYFA 4DR7B 4R2LA 4NYJR 3ZWAA 2A4MA 2G80A 2VHJA 1CEQA 2XAAA 3KQMA 3LHDA 3OA0A 4YCDA 5DI3B 1JH8A 1Y4UA 4DABA 3ZWYA 2FZ5A 3M0EA 4WOPA 1KRWA 4B48A 3W0LB 3TPCA 1KMQA 1YRWA 3BXXA 3I9LA 4FIDA 2ASEA 1MZVA 1WXWA 4E1VA 4UEKA 1JR6A 1I2AA 3WB9A 4RPCA 4QTZA 5BOVA 3ZNOA 1BU5A 2H2WA 2V7GA 3JWIA 4CKCB 4PYNA 4K28A 1DT3A 4LI0A 4LF4B 3ET4A 4HXYA 3OJ0A 4D79A 4R1TA 4L0DA 4PSKA 5I7RA 2B83A 2ZUBA 2JGJA 3JX9A 1JDBB 4MS4B 4PU0A 4DNOA 3CMMA 4E07A 5BPFA 2O7VA 5B7QA 4CTJA 1Y5MA 2G9RA 1C9EA 1O57A 2XOKD 3EIFA 3O21A 5F4ZA 1AU9A 2HNKA 3KEMA 4DT1B 4N0QA 4NSNA 3OAAA 3AXTA 3MQ2A 3O38A 4WFKA 2QW0X 1Y4AE 2QMQA 2YVLA 1XL1A 4ARCA 1XTBA 4N6NA 2DUWA 2C7VA 1CYEA 4R9VA 3VPGA 3D6NB 2X1VA 1HC7A 1IWOA 3C6MA 3E5RA 2W8ZA 4KIFA 3SICE 1QUEA 2XCQA 4R1QA 4L4ZA 2PH1A 1I4TD 3LC0A 3JYOA 4K9LA 3KM0A 2GCOA 4S1PA 1KKLA 1FQJA 1ZC4A 3EVZA 3SDBA 1SBQA 1R5OA 3LXRA 3AB7A 2WG0A 3QUBA 4MWOA 2UAGA 1X7GA 2JEOA 2HUNA 1EJ0A 4KVAA 1FTWA 3OFSA 2GD1O 5ES4B 5A4KA 1U3FA 2QD4A 4EARA 4AY6A 5IAEA 3SNHA 3SKVA 1SXIA 1SXJB 3OZ7A 4X95A 1RYEA 1Y6JA 5JR3A 2YH2A 4KWTA 5F33A 4W6ZA 3FJ1A 1P62B 4AIIA 1DKRA 2WIKA 3PVZA 2H5EA 4BX0A 4OHOA 5JVDB 1PWHA 2PL9A 5E9QA 3JQ7A 2XB2A 2O2CA 2YFHA 1MA3A 4RYDA 1KZGB 1OWOA 3RRNA 4R1LA 1JHMA 5JUWA 2IRWA 3KKQA 2BC9A 4JI8B 4LWZA 3GN1A 5A05A 2O2SA 3RSSA 3PFIA 5EJIA 1ZESA 5AOCA 3CRW1 2RHTA 1VPLA 2C61A 3IAEA 5J5VA 2Y05A 3SBOA 2EBUA 4ZJPA 2C3PA 5IUNC 4IZIA 5B4TA 4ZO4A 5CFRA 5JNUA 3FOWA 2GRJA 2NQ2C 4MJXA 2JIRA 1VBNA 4XLZA 1P3JA 1PR1A 1XHFA 4WXPA 1ZVKA 2F1HA 3U62A 4EY6A 2XJ4A 4MDEA 3DA8A 2WTBA 3E18A 3MRSA 1RPZA 1WEKA 2XE4A 3B85A 5GQSA 1VPTA 1H85A 5L7TA 3THXB 3GMTA 3C3BA 1X1DA 4CCYB 4UTZA 1P5ZB 3WQQA 5IC6A 1Z74A 4X3OA 4NX2A 4JLOA 2GPBA 5JFOA 2J7PD 3U4QB 2A0YA 2QTGA 3IEPA 2GJ4A 1W88B 1DIGA 4ZOQI 2P7HA 1YB7A 2QX7A 2YIDA 5JMPA 3ZKAA 4HDQB 4AXBA 3QXSA 3L6RA 4OHXA 2X3YA 1VL5A 3ZV3A 1PS8A 1U2DA 4OQLA 4UFNA 3GA0A 2H54A 4BVJA 5JZBA 1SKUA 1IHOA 2YIVX 2UV8A 3I62A 1DNPA 4ZV4A 4Q4JB 3IS3A 1QVZA 3AJ8A 5K3SA 3A6DA 2Z43A 4R0VA 1I7SB 2D1YA 1FNBA 4G97A 4CQJA 3KETA 1RKQA 3P8ZA 4JEHA 4URHA 5IC4A 3MBKA 3OQ6A 4PX2A 1G6HA 1RRGA 4YQYA 1SR8A 3R5KA 4MUXA 2VNHA 3GUHA 3N2IA 1JX6A 3PHJA 4UNNA 5GADl 3O92A 3EXFA 2JAOA 2YY6A 1ISRA 4JIMA 1Q15A 4KMMA 3PPVA 5EHNA 3SPXA 2GJKA 3RO7A 1QHNA 3MK31 2VDMB 1TZCA 4CF4A 3KUDA 3KVOA 1KI6B 4AMBA 2QXTA 3I30X 2NUPB 3SC3A 2EKQA 3S2FA 3TOVA 1FDIA 1WX1A 5JQWA 5LM3A 4ESVA 3T4UA 3C5HA 2ADOA 3K0FB 3S1LA 1UK6A 4KDCA 4E2XA 1MTZA 3LBYA 1YZVA 3H0EA 5JXHA 4AY4A 1KEUA 1SUCA 3E3AA 1GM5A 3F78A 1PNOA 1X8KA 3A4YA 3C14C 4FQ5A 1GJRA 1YGYA 4ND2A 4AN0A 4EGQA 1JU3A 4RK0A 4BXOA 5JANA 3RDPA 3LMKA 5TE9A 4C0KA 5TJ9A 1XVVA 1ZMOA 4RLHA 3T1VA 1KY4A 3IEKA 1KMHB 4JJ6A 4ZP1A 5DBGA 3L8HA 4IIEA 4JLWA 4BRSA 1UOOA 3QF4A 4BWYA 4MA5A 5D5QA 4X66B 5BW8A 1TYZA 3VZBA 1P19A 4PO8A 4NAUA 5TIIA 3IRUA 4FZVA 5EG5A 5ESWA 3IVMA 3SJUA 1U2TA 2AUNA 2D5AA 2DBVO 5FUYA 2CXSA 4B3DA 5HMMA 4PO3X 4RTNA 2XZPA 1MAHA 1YI8A 4XB6B 4ZYUA 1FJGB 1QVRA 1JG4A 3OJXA 1VSVA 2GPTA 5F2EA 3USZA 3W5JA 1AKWA 2H2FA 1P31A 1D7AA 5KWSA 1NBEA 1ZD8A 2E37A 2GVZC 3VX3A 2WKPA 3ENZA 2PX3A 3LDGA 5AI0A 2GJ8A 5ICFA 1Z7WA 4HH0A 2JGDA 3GVCA 3TMKA 4LKOA 2YDYA 1OI2A 3RH0A 2BFNA 1PJTA 1Y1SA 3VX4A 3DF9A 1WMEA 3DOFA 1WUYA 2OK8A 1QVWA 2VNSA 1L8XA 4IUBS 4BFZA 4EM6A 3VVMA 3QFHA 2Q2NA 3VU0A 5TRTA 3RYFA 1Z13A 1N5KA 1X80B 1QCCA 3EYWA 5GONB 2I3DA 2EG9A 1CT9A 2I7XA 2Q3EA 5JDIC 4MS1A 4UCWA 1F0YA 4YRJA 2ORED 3S1AB 3AX6A 3HY6A 3RK4A 2ROQA 4XSVA 1DEHA 1EZZA 1D2GA 2C4TA 4FE4A 5BV0A 4S1OA 1E99A 1QF7A 1WQ1R 1SG6A 1U1EA 3AQIA 4QFBA 1UQUA 4HNHA 3WGTA 4ZCIA 4MVCA 3OE1A 1OX6A 1UBKS 2OSVA 2G1JA 2YZNA 4IFTA 4KAXA 4RJKA 3ZUPA 1ZGJA 2BRUC 2EQBA 3BGVA 2FPIB 1MO2A 2UZIR 2OPBA 3KQOA 1PS0A 3D7LA 3PWSA 4LF9B 2BEUA 1H9CA 3NTLA 2PIAA 1H8HD 3AG6A 5DNUA 1YE5A 4P93A 3GDGA 1TM1E 4LECA 2X8JB 1YE3A 1FY2A 1UJMA 1F2TA 1YMVA 3I2HA 5MFZA 2FPWA 4Q1DA 3ZGZA 3BH0A 2EAUA 4BEBA 2BFEA 5F98A 3L0YA 4FYPA 4TQAA 3NDRA 4OA5A 4LJYA 1NVUQ 2XUPA 1IZYA 3HLYA 2AZDA 2LE0A 4HFNA 5AMXA 4B7XA 2R6CA 3AVOA 1H42A 3KQVA 4IRUB 4OREX 2LZ0A 2XT0A 2D7JA 3EIEA 1NDUA 3QE4A 4Q1CA 4XTRA 1DRJA 3TR0A 1N32B 3MTBA 4J7XA 1QHEA 3KEGA 3PGVA 3B5IA 1OBVA 2PRJA 3PNVA 1A5TA 1TO1E 2R6ZA 5AKLA 5T4EA 3WJ2A 4CMHA 5ICCA 4LHWA 3IKTA 3QOFA 2YWRA 1Y6GA 2AXNA 2IH2A 3TLCA 4YAOA 3HRIA 2PSFA 2X0RA 4HUQB 2RAVA 1OWLA 3CZMA 4OQXA 1UBNA 1Z12A 1XDUA 5HIIA 1ZQ9A 3HKEA 3T1QA 3CB2A 4A8JB 1X6VA 1SCNE 3K70C 1R6AA 4XTCS 4ERXA 2C2GA 2GGSA