1NF3A

Structure of cdc42 in a complex with the gtpase-binding domain of the cell polarity protein, par6
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
194
structure length
194
Chain Sequence
GAMGIQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGLEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords G25K GTP-binding protein, placental isoform
total genus 66
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1nf3A00
3A37A 4LV5B 3WYGA 2ORWA 2A5FA 3AF4A 4YDSA 3T35A 2HXYA 4Q48A 1OXSC 3IIJA 1J99A 5C4GB 2IS2A 1E0AA 2GCOB 2JATA 3RSOA 4DEXA 3QIAA 2IL1A 2V1UA 1QHSA 1AA9A 1G16A 1DOAA 1P5ZB 4C0BA 3AM1A 5F2EA 2WJJA 3FHCB 1TU3A 2P5TB 1IBRA 3SZRA 1Z29A 3EWSA 2QSZA 3L2OB 3BAFA 1KI7A 3QI2A 2ZS9A 4GOKA 4BFVA 4OJQA 2BBOA 4J0QA 1HT2E 3RLFA 2FU5C 5EZ6B 2JJ2D 2DR3A 5GJCA 3REGA 1G3RA 2AWOA 1W2GA 5JBQA 1E2HA 4HEJA 3D3QA 1KO1A 3LO5A 1C1YA 4LBYA 5AR1A 4DUGD 1OYYA 2FSGA 4KBFA 2FJUA 3B13B 3FMPB 4FXPA 3B6EA 4FMDB 5JS7A 1E9AA 4FW9A 4NCHA 4DXAA 4NCNA 1IN4A 2RGGA 2X77A 3LA6A 1VHTA 3GJ5A 5GVSA 3QBTA 3WY9A 1EWRA 1MRNA 2P6NA 2FZLA 2V4ZA 3P26A 4RD4A 1TF7A 2RGDA 1Z6TA 1BMFD 1Z0JA 3R7WB 3WHKA 1U81A 3BC1A 4Q1CA 5AJWA 3THXA 2GKSA 2W0MA 1OT3A 2ZJAA 1OHHA 2DWPA 4V03A 3PUZA 1G8FA 2GCNA 2GETA 4HB4A 1WDTA 2ZSEA 3QXHA 2FN4A 2D7DA 4M1SA 1M34E 1KKLA 1XX6A 3LW7A 2PX3A 4OI1A 4EQ6B 1TL7C 4DHEA 3I1FA 2EFHB 3KUCA 1C4OA 2WOJA 1P60A 1XFAA 1A2BA 1UEIA 1W5TA 2BDTA 5KHOC 3MMPA 1E2EA 4FCVA 2ATXA 4OHYA 1KDOA 2A78A 4IOKA 1QHIA 1ZD1A 4LHWA 3RYTC 4DLZA 5JEEA 3L82B 3ADDA 1N6NA 4PX9A 3AVUA 4BEBA 2A5DA 1EFTA 3JZAA 5KNBA 1DE0A 4GOJA 4Y0AA 2XTMA 1CJTC 3OEHA 5E7MA 3WRYC 1G8HA 1EWQA 1YRBA 4ILEA 4Q1BA 3IQWA 3C16C 4GI7A 1ZCBA 4F7WA 1KSGA 5B64A 2QU8A 4R2IA 3IO3A 2DHRA 1XEWX 3PUYA 1G3UA 4CVNA 2QT0A 1U0JA 3UMRA 2JLZA 3BE4A 3VHXA 1IN8A 1XDBA 4NKRA 3NXSA 1NVWQ 1ZM3A 1W4AA 1HQCA 4DLSA 1U0HC 3ONWA 3GLHE 2BHRA 4B48A 4WW0A 3TJZA 3VNUA 4F93B 3H4MA 4RZUA 3EA5A 2B8TA 4QNRA 3QVUA 3N2EA 5JLJA 2ZPTX 2X8AA 1KMHB 1LNZA 1VMAA 4QKQA 4GT1A 3EZ7A 1R0YA 1IAQA 1F48A 3DHWC 4GL2A 4MGKR 1GRNA 4M1MA 1TMKA 4TLDA 4HLCA 1DG1G 1KSHA 3EARA 5FTMA 5EXTA 1IQPA 4JKYA 3RHFA 4O2RA 1DARA 3WP1B 4TMZA 4ZCMA 1PUIA 1Z0FA 3RS5A 3T34A 2PJRA 1KO5A 3K9GA 1N6PA 2BJVA 5DLQC 3KQLA 4PQRA 1XD9A 3KTAA 3KB1A 1P62B 1L2TA 1EFRD 4R7ZA 2G6BA 5SZIA 3PUWA 1P61B 2CVHA 4LCBA 4ZCLA 5GVRA 3SJZA 1DO2A 4B34A 2P6UA 3GLIE 4HAXA 1CTQA 1VG1A 5KTYA 3OF5A 4B73A 2NO7A 4QM6A 1W46A 5CJ2A 2JLWA 1VYUA 4AKIA 2ZRIA 4JJKA 1KJWA 1TPZA 3LAWA 1ZYUA 4IFEA 4NBSA 1SVMA 3VKGA 1O87A 1T6NA 4NH0A 1RRFA 4EFLA 2ZI9A 2PZEA 3R20A 3BFVA 1T8TA 4UKDA 2FE4A 4B3DA 1R4AA 2AXPA 2UZIR 4XD7D 2AWNA 2IXGA 3MWYW 4P4UA 3KQNA 1TQ6A 4KVAA 1ZIPA 1T5IA 2GBLA 2EWWA 1II9A 1M2OB 3B9PA 1QRAA 3TBKA 3AV0B 4DCTA 1I4LD 4EJSB 1XCMA 4KFRA 3GLGA 4U02A 3W3AA 5F9HA 3U3MA 1G17A 4RZXA 2ZYWX 1SULA 4NYMR 1DAKA 4DDWA 2OXCA 4JSYA 5TXGA 2YC4C 2AD5A 3DL0A 5KSPA 3PENA 4W7SA 2V9PA 3X1WA 4BRWA 2ZROA 2C03A 4EPYA 5G53C 5KPJA 1SXJC 4DLUA 4A0RA 1TADA 1ANKA 3HU1A 4QHTA 1U94A 3QF4A 4Z54A 3F3YA 2VP9A 2CK3D 1YZTA 1KGDA 1G7RA 1X1RA 3OEEA 4RCYA 5FL7D 3CZPA 2R6CA 1QHNA 1XZPA 1WP9A 1AK2A 1FQJA 2D7CA 2VSOA 1XP8A 2RGBA 2A5GA 3IDQA 3M6AA 4IEEA 4LZZA 4B6FA 2JLRA 2CNWD 4JLMA 1UKVY 4TZ0A 2O52A 3T1OA 5KPDA 1CRQA 1ZD9A 1RPZA 1E2QA 1W0KD 4B2PA 1NBME 1IXZA 3A36A 3EASA 1UDXA 2XITA 4A4DA 2VQSA 1F3OA 1Q12A 3RVBA 4DDUA 3AGPA 3LW8A 4F38A 1P6XA 5L3QA 3HU3A 4LYAA 4Q4LA 1OHHD 1M6NA 2WSMA 4US1R 5EXSA 1UBCA 2A5JA 3DM5A 5H1YA 4EDHA 5FPSA 4RFSB 5L3QB 2QP9X 1XCPA 4O0MA 3P4XA 2ZSFA 3U2QA 1CJUC 1Q3TA 2K5UA 3QSYA 1B23P 3W6OA 2O0KA 4EIWA 1US8B 1Q1BA 3V9PA 5AUPB 1T0HB 1NY6A 1T3HA 1U90A 5FBRB 3OESA 4OHZA 3VKWA 5J4VA 1OH5A 1P4SA 1XCGB 2QMHA 4LPKA 4M22A 1W7AA 2QI9C 1H8ED 4RKEA 1AKYA 3NHAA 4OQMA 3T1QA 2MSCB 2GK7A 2BV3A 4A8JB 4DSTA 2RGAA 1S1CA 4YMWA 3L0SA 2W6JA 3RS4A 4Q1DA 2P3SA 3CF6R 2B7BA 3ZVNA 3NG1A 3PIRA 3PEYA 4D82A 3BWDD 5K8IA 1IHUA 2EFEB 3I62A 3ZVRA 4WIAA 1G4AE 1TEXA 3U7GA 1P3JA 3RRMA 2DY1A 4JL6A 3QKSA 5KSZA 1FL9A 4NYJR 3LWNA 3QXXA 2QAGA 4PC1A 5FOUA 3IBYA 5FTLA 5J4HA 2VEDA 3LX5A 5H70A 1RW4A 3NBXX 1QHHA 4HZUA 4W5WA 4XJXA 4RY2A 1WXQA 3QBVA 3T61A 2J7PD 4ZDWA 1D5CA 2UVQA 3KXKA 1KI4A 2YVUA 2W6JD 3KQUA 2C5LA 3EIEA 1GL6A 1V5WA 2OFWA 1AN0A 3G82C 4TSFA 4PQYA 1DTSA 2GCOA 5CB6A 4JL5A 1JQJC 2ODEA 4A8JC 2ZJ5A 4MUBA 4TT3D 5FOWA 3MJHA 1KMQA 1BS1A 3BFKA 3TAHA 3A6PC 2FFHA 3AVYA 3I5YA 2XOKA 4LC1A 2J0UA 5G3YA 1HV8A 2QTFA 3NKVA 1KJZA 2IS4A 2RGNC 2O0HA 2N46A 4AYTA 3GMTA 1R5OA 2QBYB 3SU8A 3NHBA 2C77A 1E94E 2LCFA 4QJ3A 4LPSA 1Z6YA 4C0HA 3TVDA 3ZLJA 2OCBA 3LXRA 4GRAA 4ZV4A 2BKEA 2FOLA 2WJYA 5E7IA 2W2TA 1QG4A 4PR0A 3MWJA 1E4VA 4K8OA 4MGYR 1W0JD 2EYUA 4ARZA 1YU9A 4B47A 3WYFA 2YKGA 2CLCX 2CXXA 1N0WA 1Z83A 1VDZA 2KBEA 2VTKA 5AJYA 3PEUA 4F4JA 4YMUA 2FMXA 1N6LA 5EE3A 5BW8A 4TTPA 4A15A 2R62A 2GESA 1UFQA 3Q72A 3AEZA 5EUQB 4YMTA 3GEIA 1CJVC 4HAWA 2QP3A 3C14C 4LBZA 2O8CA 1HT1E 2YWGA 2CLDX 2W00A 2GDJA 4PZLA 2JJ8A 5D3QA 5J4YA 4LHVA 4EAQA 2Z6VA 3ND8A 3S1AA 3SHFA 2MMCA 1CR1A 1MABB 4LY6A 4US0R 4TMWA 1E79A 4BFTA 3NEYA 2V6JA 4AYXA 4NCJA 2SHKA 2ZQ5A 3CNNA 4EJSC 3KKPA 4C0AC 3UMSA 3ADCA 3MLEA 2XGJA 3WNBA 5IDVA 1IN7A 4PHHA 3LXXA 2WBLC 4N3NA 1FQKA 1NMXA 2ZS8A 4B74A 2MSEB 2GJ8A 1NMZA 4CRWB 1RKBA 4LC0A 4Y0VA 1VG8A 2VHTA 4A0HA 3LBIA 4NL4H 2OCAA 3K53A 4JJZA 1X8KA 2R2AA 2O5VA 2ZI6A 1LF0A 3CX7A 3WRXC 1N6RA 5JECA 3WMEA 1GL7A 3SR0A 5DO9A 3HU2A 4OK5A 1DELA 2ZR7A 1T3SA 1OSNA 1RYFA 1Z2AA 1GILA 5AUNB 3VKHA 1ZUHA 2VHCA 1U0LA 2QQ0A 3K0AA 3E2IA 5L3SA 4WOPA 3P27A 1EESA 1JAIA 3AF2A 2GXAA 3OE7D 2ODWA 2J45A 2RGCA 2ZE6A 2V55B 1S3GA 1MO3A 1FTNA 2WJHA 4AG6A 2JEOA 2XJ9A 4EPVA 4XD7A 2D2EA 4V0NA 1GKYA 1KOFA 2H17A 4M1WA 3WP0A 3EPHA 4CEHB 2YOHA 5K8TA 1U99A 5LD2C 4BLPA 3JVVA 2E87A 1OV4A 4OBEA 3E5HA 1W0JA 2OZEA 3GFTA 2MMGA 5E4FA 1FP7A 1E1RD 1G6OA 2GEVA 3ZYCA 5JI3E 521PA 2RGXA 2KB0A 1S9HA 3ZZTA 5TMPA 3EXAA 5EJEA 1OH8A 2VA8A 4AG5A 2VLIA 3CBQA 5HR5A 3RC8A 5G41A 5FTNA 1U9IC 3V00A 2WIAA 1LB1B 5FUXA 1OYWA 2BMJA 3CWQA 1Z6GA 2ASEA 3IEUA 4CIDA 5KSYA 3KXLA 2AFHE 3BB1A 1VPLA 2G0TA 4NZYA 3HP1A 5EP2A 1Z3IX 1JI0A 2I4IA 3MRSA 3VHLB 5EQTA 3PCRB 4TTQA 4FCWA 3QF7A 5EE0A 4U7DA 3K0SA 1A1VA 1XMJA 4M1OA 4QC2A 4S2EA 1IY1A 1E2LA 1SKQA 4KFTA 2BBWA 4EPTA 1WB9A 2D74A 2F43A 2KJQA 1NL3A 2DB3A 2FEOA 1ZW6A 2X2FA 2WMOB 4JIMA 1YRAA 2FFAA 2C78A 3Q5EA 5DYIA 1XXHA 5FUVA 5K8LA 2GA8A 3AVQA 1XPRA 1CRPA 1EFCA 4UNQA 3SHWA 1NVVQ 1M7HA 3AKCA 1XXHE 2OAQ1 3DPUA 2YV5A 5KNCA 3QKUA 3SQWA 4LHXA 3KXIA 4ZIRA 4ZDKA 2OSBA 1VCIA 3KX2A 4EFMA 2A2ZA 4C2TA 4Q9LA 3AGQA 2G1KA 3BK7A 1SVKA 4MYHA 3TQCA 2H92A 3GLFA 3AF0A 3VU9A 1M7BA 4G01B 4CEIB 1S8FA 3ZD6A 2IK8A 1G9XA 4FMCF 5BXQC 1AS0A 4URYR 3QPUA 3I3SR 4F91B 3R8CA 1E3MA 2BJWA 1SHZA 1W1WA 2OFXA 4X8MA 4GP7A 1RE0A 1N5JA 3FPAA 2ZJ8A 3AUXA 4HAYA 4MYUA 2IF2A 1F2TB 5J4LA 1VKJA 3QENA 3ZIAD 2ZM5A 2W2VA 1G3QA 2QMEA 2YHSA 1P9WA 3M4YA 5B30A 4V0LA 2ZRBA 4I1UA 2OESA 2BM1A 2N1BA 3DOEA 4FCTA 4MKHA 4DEYA 4A9AA 5HZHA 3NBFA 5H8WA 4FI3C 4R71A 1NVUQ 1H8HA 1KSFX 2D2FA 3TLXA 4LOAA 4QHYA 3K9HA 2G1JA 4HAUA 4HLUA 4DDTA 4HUTA 2NOAA 1XD2B 2NO0A 3T5GA 3WBKA 3L0PA 3X1DA 2QE7A 3LQRA 2C96A 3SBDA 1E1QA 4PC6A 1JR3D 5AJZA 1RRPA 2R6FA 2L0XA 1EFRA 2XZPA 4LSGA 1QHHB 1N5LA 4HZUB 4ZDIA 3ZVMA 2OO7A 5A5GA 1NNEA 4LDJA 4XVRA 1L7VC 4YXWA 2VF8A 1XJ0A 3IILA 1KHTA 2O8EA 2IYWA 1KIMA 3C8UA 2ZR9A 3BS4A 3WMGA 1XF9A 2F1IA 5FTJA 1R0WA 3NIBA 4QG7A 4JVLA 2RAPA 3D6TB 3SFZA 4AC9A 2ZRJA 1A7JA 2VP2A 4Q4HA 1IONA 3M1IA 3U44B 2R65A 1ESNA 2D3WA 2PX0A 1OKKD 2ZRMA 4KI0A 2VF7A 1AQUA 2DWQA 3SNHA 1E0SA 1Z06A 3Q3JB 2HT1A 5C1BA 3RS0A 1NN1A 3CF0A 3LY5A 4IDOA 4QOSA 4N0DA 2DFTA 3IIMA 3QKSB 1MKYA 3ZS8A 2PJZA 4ZI2A 2BBTA 3D31A 2GNOA 2D62A 4CT4B 5BWMA 3MFYA 3O8DA 1QHXA 2B21A 4IVQA 4C0JA 3Q9LA 1YE8A 2YWEA 3D7MA 1XJCA 4KVGA 1E9BA 4QGGA 4I4LA 4O3MA 3UG7A 4PZYA 4DCVA 2WAXA 4IDHA 1E2NA 3DOFA 3CPEA 1BOFA 1E9SA 5FR2A 2BVNA 3BH6A 2ODNA 3HYRA 2YOGA 4B2LA 2JJ1A 3EIQA 2ZVQX 3QG5A 1U8ZA 2WICA 1XTRA 4KBGA 1HTWA 4Q9HA 4XSGA 4POAA 4RZ3A 4Q7JB 1WE2A 3G5UA 4ZKEA 2ZRLA 3MSXA 2QL6A 4TZ6A 4A0GA 2VHQA 1T0JB 1GRRA 2J1LA 2VP5A 4LI0A 3A1UA 2FG5A 4B3GA 2QGZA 3TSZA 1HH4A 4A2QA 3C4JA 4DIDA 1EG7A 4C9BA 2GILA 3LRPA 1ZNZA 1GSIA 3GCGA 2HT6A 1R2QA 4BLSA 2ZETA 3JZMA 4JLVA 2A9KA 721PA 1NBMD 1XJQA 1V43A 4QBIA 4QHSA 4XVQA 3TE6A 2ERXA 3HPQA 5JWHA 3ZQJA 4FMCB 2HJGA 4E07A 5CYPA 3B1VA 5EP4A 1GRQA 2ZAOA 4EJSA 5JJLA 2CL0X 5EZ5A 2IYYA 2VHUA 5LDDC 3UWOA 4DVGA 3AP3A 3ZD7A 1X8JA 5FOVA 1GKIA 4PFSA 4HI0E 3FFAA 4A92A 1FNMA 4V0OA 1CR0A 2GF9A 3KFXA 5A4JA 4Z51A 4P0TA 3OEED 1T9HA 4IKEA 3EZFA 4DIEA 1N6HA 3NC0C 4I1SA 4I81A 4MRNA 3U7HB 2ZJYA 1Z0AA 3IUYA 3FMIA 1ZJ6A 2IA5A 1G18A 1F2TA 3QNUA 4FIDA 4DRZA 5EE1A 1IY0A 4G5OA 2G9NA 5C4MA 1JNYA 3IPXA 1HURA 2E1RA 2QAGC 1E79D 1LTQA 2GTPA 2OCPA 4R9UC 3AP2A 4MKIA 3TR0A 4BASA 3UATA 1HEIA 3CX8A 4MRRA 4YQFA 1OXUA 3CM0A 5EUMA 4Z1MA 1KNQA 1M8PA 1HUQA 1OPXA 2BMDA 3DDCA 4KYIB 5FUYA 2XTNA 2XXAA 3W34A 3KL4A 5J4KA 4NCKA 4N1AA 2ONJA 1Q57A 2PCLA 5J5CA 1BYIA 2OBMA 2Z83A 2XX3A 1KKMA 5FI0B 4HB0A 5HCNA 4LV8B 3W9YA 4DKXA 4E5UA 8OHMA 4ESVA 1EGAA 2UKDA 2PZGA 1S1MA 3AUYA 2NZ8A 4PPNA 1J8YF 3TR5A 3TUIC 4P3YA 2VHJA 4BQSA 3GLIA 3SDZA 1N6OA 3MWLA 1TX4B 4LJ8A 5IK2A 2VSFA 5KU1A 5J47A 2FPKA 3R8FA 3NH6A 4OYHA 2AK2A 3I4LA 3HR8A 1ZRHA 2KSQA 2IYUA 1R0XA 4A6PA 1GL9B 1TTTA 4PC7A 2JLYA 5F3WB 3GFOA 3FHTA 1E1RA 4TQ9A 4V0KA 3QEJA 3LFUA 4NTZA 1GFIA 2JLUA 1XTSA 3U44A 1OB2A 3K70B 4D6PA 3TMKA 1XMVA 2QTVB 3U5ZB 3Q85A 1CS4C 5TY0A 4AD8A 1F60A 3TUZC 4KITB 3C5HA 1D2MA 1ZUNB 1G41A 1JB1A 1XEWY 2EFCB 3WNCA 2IYVA 2PT5A 3GLGE 3WHLA 1D8TA 5F9FA 1R5BA 1M1YE 2Z4RA 1SHKA 4A36A 1VIAA 2PMKA 1P7CA 4IDPA 2P6RA 4OK6A 2QUZA 1SGWA 3T1VA 2P2LA 1NRJB 1FPMA 3B7GA 3OIYA 3QKRA 3PUXA 4GMXA 1KSJA 4Z8YA 3K70C 3AVXA 2QM8A 4U00A 2HUPA 5G40A 3HR7A 1FNNA 1ONBA 2FSIA 1E96A 2F3RA 2NG1A 2QA5A 2YJTD 2IXEA 3GLIB 2WM9B 1NVVR 4AIIA 2QEQA 2HXSA 2QMOA 3EAQA 1TQ4A 5DI3A 621PA 4TL9A 2H5EA 4UXHA 1X6VA 4BFSA 5HKKA 1P2VA 1FTSA 5CJPA 3FFBA 1OXTA 1AGRA 1MH1A 3NTUA 1S9DA 1Q0UA 2BIFA 3B1WA 3I92A 3GLGB 1S96A 1Y3AA 3CH5A 2ZU6A 2C2HA 1QG2A 4FINA 3FB4A 3GP8A 3THYA 1YKSA 4FN5A 1JR6A 4CEJB 3MAAC 4D80A 5FPTA 3QE0A 3ZDQA 1E2KA 3WXMA 4QJ5A 4PPGA 4DT1A 2G83A 4KFSA 4CZ2A 3MD0A 2FA9A 4JLAA 1H65A 5L3RA 1COWD 1F2UB 1Z22A 2JLQA 1GNRA 3I32A 3LX8A 1G21E 3C15C 2G88A 1FX0A 3LQQA 3OIVA 2R9VA 2CCGA 2IEZA 1JAHA 4YMSA 4OKSA 1DEKA 2QQEA 3H0KA 4JMPA 3OHMA 4DLXA 5EP3A 5FI1B 1U9IA 2R8RA 2WV9A 2VSXA 2JLVA 2XTZA 5EXPA 4L9SA 2WAYA 3GLFB 2AFIE 2J0UB 3KJGA 1A82A 4TYQA 3K1JA 2QY9A 4BLQA 4NE2A 4IVPA 4PHGA 3RANA 3UIEA 3V4FA 3TRFA 1KI1A 2GVDC 1E0KA 2HJVA 4DLVA 2ZVPX 3FMFA 1OF1A 3QXJA 1JEEA 1N5IA 1SZPA 2ZTSA 3J81k 4JVMA 1FOEB 3A1TA 2KE5A 4WA7A 3LBHA 3NH9A 1KY3A 1X8LA 3TUJC 3T12A 1AJEA 1II8A 4URVR 4MDEA 2RHDA 1KO4A 4P32A 2QAGB 2Q21A 2CJWA 1UF9A 4NCIA 1NSFA 5HTKA 1D2NA 1XNJA 2XEXA 4UXIA 3TSOA 1GNQA 4LX0A 1VCNA 5CM9C 2O0JA 1YZNA 3MJRA 4IVRA 1R5NA 4DLWA 2W83A 3O8CA 1FP6A 1G5RA 1IJEA 2GJKA 4A8JA 3LD9A 1NN0A 2JDID 3VMFA 1E9CA 4Q21A 1Q22A 1U98A 3C41J 1A4RA 5FOTA 3VX3A 2AD1A 3EZ2A 1IY2A 4C0SA 4BFXA 4LBVA 2IX3A 4IDNA 4JLDA 2EW1A 3B78A 4AURA 4HUQA 1U2RA 2JLXA 4DCNA 4CT5A 1CF4A 4I99A 3PR1A 3X1XA 3H86A 1KK3A 2ZRDA 1T4GA 4MQBA 1ZM7A 5FBVB 3SYLA 3CNOA 3ZQ6A 1VYVA 4URZR 4ZDJA 4EKDA 4UNRA 3KQKA 1KNXA 4WZAE 1XPOA 1GVNB 4TL8A 1RJ9A 2F9LA 3GJ6A 4C30A 2QP4A 4A82A 4OI2A 1GDDA 2QG6A 1P2SA 1E2JA 1GP2A 2R6DA 4K81B 4QL3A 3L43A 5JSZB 1P2UA 1R8SA 3FOZA 4M53A 3UANA 3W8RA 2NO1A 2J7PA 1LY1A 2ZXUA 4NDZA 3CR8A 3RS7A 2VRWA 3TKLA 1COWA 1XBTA 1P9NA 2F1JA 2C95A 3VX4A 3X1ZA 1GM5A 1OFUX 4MGZR 2C9CA 3OIWA 2F43B 2HCJB 1G1MA 4BWYA 2ZE8A 3PUVA 2TMKA 5C46F 4B44A 1JQLB 2ZYUX 4R98A 3Q8XB 4TYWA 1S2MA 3NBYC 4PSVA 2YC2C 1Y63A 2AK3A 5F98A 4Q9KA 2ANBA 4C3ZA 5FR1A 5GJBA 2ZEJA 2OM2A 4PHTA 2YOFA 3QXCA 4PC2A 4TLAA 5J40A 2IUTA 1WF3A 1JPNA 2JA1A 1ZU4A 5CIQA 4XTCS 1OE0A 3CRQA 4NONA 4OQXA 4DB4A 3OZXA 3U3KA 4P4TA 2YZ2A 1JXOA 1DAFA 4O2LA 4L16A 4IXMA 1JJ7A 3E1SA 1Z28A 3BXZA 5EE5B 1ODFA 2IS6A 3N70A 5DIFA 4N0EA 3RRZA 3QJYA 4FWIB 5JEDA 5KYKA 3PEVA 5IT5A 3A8TA 1FX0B 3BIFA 5FPKA 2QPAA 4JKIA 3KJEA 1UJ2A 1KYIA 1G7TA 2UZ3A 3KKNA 2CHGA 121PA 1JECA 4JT2A 4L15A 4JSTA 4MYCA 1PLJA 1VECA 1YR6A 1I4DD 1NLFA 1X3SA 4JT4A 5SZJA 3CPJB 2HYDA 4CF7A 1G3IA 2XAUA 2R6AA 3GLHA 1G5TA 3VR5A 5E95A 1W4CA 4JZKA 2O8CB 3CRRA 1ZNYA 2CNWA 1U8AA 1MV5A 4KSCA 3RABA 4II7A 3U4QA 2F1HA 2HF8A 3BORA 3Q5DA 1MR3F 2F1RA 4MA4A 3FVQA 2IYLD 2QT1A 1OXXK 3NWJA 1XB2A 4M1KA 2FWRA 2G3YA 3ZGXA 5BN5A 2ECKA 4OK3A 2ZJ2A 1FUKA 3VR4A 5JJIA 3K9LA 4DUGA 2FF7A 1Q1QA 4Q02A 4XVUA 2B92A 2B6HA 1RIFA 4L4UA 4MRPA 1FW6A 3NDBB 4GNKA 2ZITA 4GFDA 2BKUA 1ELOA 221PA 4CEIA 3CRW1 4LJAA 2OHFA 4HDCA 3W90A 3CRMA 2FV8A 4GOXA 1NJGA 4Q1FA 3LLMA 2OUKA 3RNLA 4TL6A 5GJVC 2GK6A 1J8MF 2FGJA 2GF0A 3AKDA 3GEHA 4GSYA 4M1TA 3U7FB 3GD7A 2QMUA 4IOMA 3SN6A 1TF5A 5FL3A 2EFDB 4HDQB 3JVUA 4MRVA 4A6XA 4GPTA 5L3VA 2VH5R 1O3YA 4AWXA 2XZLA 2V3CC 2J59A 4PO9A 4C2UA 3FE2A 4IFBA 4PANA 3EPKA 1WA5A 1X1SA 4WXRA 2H16A 5FUWA 3TGPA 2FPMA 1KI3A 3VFDA 3FYHA 3NC1C 1OIWA 5JZVA 2DWOA 4P4SA 5L8VA 4PZZA 2DFNA 3FMOB 4G1UC 3OEHD 3X1YA 2Y8EA 2FX3A 3IBGA 4LHYA 5G3ZA 1OH7A 2AXNA 3K0FA 4B76A 1G6HA 1SXJA 2ZYVX 4E22A 3DKPA 2IYZA 3VR6A 2ZSDA 1Z5ZA 2JCSA 1LS6A 4TMKA 1QF9A 3N2IA 2PCJA 3CIOA 4D0NA 2QSYA 1YZLA 3ICQB 5DHFA 2QBYA 1UADA 1PUJA 1NP6A 2ANCA 2REBA 2F9MA 1P2TA 4JBYA 1RRCA 1II8B 2O8DA 4M2LA 2GJAA 5LBIA 4PXAA 2B7CA 4PO8A 3EIHA 2Z5FA 1KI6B 1YZUA 4M1YA 2REXB 3A1VA 4ASUD 2D4HA 2IF0A 1LS1A 4QBFA 2C9OA 5AUOB 4RD3A 2P5SA 2WKPA 4OQLA 3AVOA 3RSLA 3UMFA 3FHOA 4KO8A 2Q9BA 3RS2A 1VTKA 1E98A 1D9ZA 2FNAA 2VO1A 1N2CE 3BH7A 3F8TA 5IHPA 3R9XA 4ZKDA 5KUTA 2ZREA 2IEYA 4LUCA 2B8WA 4PAOA 2OEPA 1NKTA 2AKAB 3B8HA 1YQTA 1TU4A 3BJIC 3CONA 3VTKA 2GJSA 3AVPA 1JJVA 1NN3A 2ZE7A 5SZKB 4PSAA 1QVAA 1OFIA 3TH5A 1PLKA 4Q18A 1IN6A 2DPXA 5HKKD 2N42A 3TVTA 1GITA 1KK2A 4JLBA 5HE8A 2V54A 2ZRCA 5CLQA 1E2DA 2AKYA 3CRVA 1UBFA 2FZ4A 2HDNB 2XXAB 1TUIA 1AS2A 1ZNWA 2W6ID 3PXGA 3I8XA 1G8YA 3Q7PA 4M21A 4OHXA 3I8SA 4KHZA 2F6RA 4GZMA 4C0LA 3ADKA 1SVWA 3L8ZA 1NMYA 2WWIA 1ESMA 2F7SA 3P1JA 4G3XA 2WZQA 3W5IA 4MH0R 3LV8A 2Z0MA 4URWR 5DE3A 3IQXA 4BUJA 5DHAA 4BFUA 1OIXA 3SI7A 1CULC 4Q7MB 2WHXA 3A1SA 5DI3B 1KI2A 4KSBA 4AKEA 1KK0A 4BRUA 2EFGA 3K0EA 2CL6X 1KJYA 2QZ4A 4BECA 1E9RA 4KV9A 2OLKA 2HCBA 2XNSA 2HLDD 1ZBDA 1JR3A 4AYWA 3H84A 1ZCAA 2NO6A 5FH9A 4BLOA 5JFGA 2RGNA 3FKSA 3VAAA 1Q1ZA 1SXJB 3IO5A 2YINC 3VU9B 3LH5A 2WMNB 4M9SA 1G7SA 2QENA 2VPPA 1E9FA 4AI6A 4RJLA 4HB2A 5HE9A 4CEHA 4TL7A 1S4QA 1FUUA 4TQAA 4D0GA 3ECCA 1XWIA 5KSOA 2GBLC 1W36D 2C04A 1YZKA 3N5CA 1Q1EA 3FKQA 3NBZC 5AJXA 1NJFA 3GPLA 2C98A 4PAQA 4OQFA 5HZKA 3GLFE 2ZRFA 3B1YA 4D2IA 2GAOA 1BYUA 4Q4AA 3Q7QA 1QHYA 2IYTA 2E9SA 3OIUA 1E6CA 1D9XA 2H8KA 2REOA 1K5DA 3HJNA 1XPUA 4BGDA 4RSGA 5JCZA 1T5LA 4CGZA 2OAP1 2X2EA 3BRWD 3CKLA 2QROA 3IHWA 3OAAD 4OHVA 4S35A 4BZPA 2ORIA 2WJGA 2C8VA 4KYUA 2NMVA 4JS0A 1UDWA 3CW2A 3O8BA 1ZD8A 3H2YA 4KCGA 1Q44A 3BBPA 4MYTA 3ZS9A 3B2EA 4LWZA 2ZAMA 4D25A 4L8GA 1YR9A 1E9DA 5ELXA 2WJVA 1LV7A 2J5XA 1NF3A 3THWA 3OE7A 4YDHB 3AH8A 4OI0A 1VYTA 3RC3A 5K8UA 4YXWD 1XMIA 3IKJA 1RZ3A 3I72A 4G5GA 3PV0A 3RWMB 3UXMA 4US2R 5HPYB 1GKUB 4DCSA 1G64A 2F3TA 2X19A 4DBLC 4H1VA 1YR8A 1ZM9A 5UKDA 2OE2A 2XSZD 2GAAA 4E03A 2V7QA 2O8FA 2XNDD 2CMKA 5AJVB 3BOSA 3LVRE 4UNNA 4MGIR 1MRSA 2P65A 1U8YA 2CDNA 3DM9B 2GXSA 3W5JA 1Z6AA 2FEMA 4M9ZA 4DSNA 4U5XA 4QM7A 1ZM4A 2ZJZA 4NYIQ 5DH9A 1T3LA 1VG0B 4A2WA 1I4TD 4I1VA 1E2IA 1GZSA 3DO6A 3MG9A 2VP6A 4TLCA 3SYKA 5D3MA 4RKFA 2ERYA 2XOKD 4FMBB 4UJ5A 4ARZB 4YLGA 3QXSA 2IHBA 4YONB 2LKCA 4Q19A 421PA 3CB4A 2IT1A 3KKQA 1YZQA 4XWKA 5M04A 1NY5A 3I61A 1CXZA 4DLTA 4O25A 1CEEA 4NP6A 1Z0IA 3DZDA 4EPWA 2J46A 4LJYA 2IWHA 1Z63A 2CHVA 1LVGA 2R6GA 1W4BA 3K0FB 1P75A 3K8YA 1DG3A 2FSFA 4LJ7A 2XJ4A 1M74A 4JLOA 4JLJA 3CH4B 4HB3A 1UBEA 4D4MA 1UPTA 2RMKA 3MCAA 4BPBA 4HSEA 3GFPA 5C2JB 1FMLA 3U61B 1S3SA 2CBZA 2ZU0C 5FOXA 2IWRA 5TB5A 4W9MC 1Q21A 1QDEA 3CUEF 4IW3B 1KI8A 1E0JA 5BN3A 3VR1A 3A4LA 5BYJA 3AKYA 2NO9A 1CU1A 3GQBA 2I1QA 1C9KA 2A30A 1XTIA 2LKDA 4JBWA 4V0MA 4B2IA 2IUSA 4B3XA 4A0FA 1P72A 1W49A 1ZP6A 4PAMA 2GZAA 3ZVLA 1T8UA 5KOYA 1DAIA 1L8QA 4LYHA 4EPRA 3QY0A 4QJ4A 4V02A 1NG9A 2W6IA 1E2PA 4Z1MD 3SBEA 4LJ4A 1NIPA 1II0A 1OW3B 1NLZA 1QVRA 3D8BA 2ZRKA 3SE0A 2ZRGA 4NHOA 2Q3FA 3ZZ0A 4BLRA 4D4JA 2FDCA 2WJIA 3LDAA 5JRZA 1MABA 2NTYC 4RD0A 4TSFD 1MO6A 2GXUA 4Q7LA 3GJ3A 2ORVA 3B1XA 4WAUA 4WXPA 4IDQA 4TTRA 1ZU5A 2CE7A 1L4UA 2XSZA 4OJKA 2PMDA 2FGKA 4YMVA 4ZI3A 3ASYA 3SS8A 3FTQA 3T1TA 4G5SA 4QBGB 2EYQA 3GLHB 3O47A 4URUR 3WNDA 1ZC3A 3FGNA 4B32A 3PJRA 4D81A 5DYGA 2NPIA 1N3BA 4RD1A 1CP2A 2RB4A 4B3CA 4LJ5A 4RD6A 4XSHA 5E3HA 4OHWA 1GUAA 4P4SB 3EC2A 5JWRA 4LRWA 1PLLA 3HPRA 2XB2A 1AGPA 4LHZA 5JS8A 5IRCD 2JIZD 1SXJE 5TVKA 2WVJA 2GZHA 2VP4A 2Q3MA 2ZI4A 4DLYA 4Q9IA 4Q66C 2QGNA 2ZRPA 1MO4A 1LW7A 1US8A 2PZFA 3KJHA 1WBBA 4GBMA 4WBSA 4Q7KA 2ZI3A 2H1LA 2XZOA 3SFVA 3GJ8A 4Q1AA 4TMVA 4D0LB 3SEAA 1NKSA 5DSZA 5LPNA 4C0KA 1N0VC 5EXXA 4GMDA 4QXAA 4XOIA 1XZQA 2CEAA 3KFVA 1CJMA 5E7JA 1SXJD 3P20A 1Z0DA 4MKFA 1I2DA 2Q9AA 4URXR 1DAEA 2OLJA 4LYFA 4M4SA 4M0LA 1SVIA 3A58B 2QM7A 2NGRA 1PVOA 1R0ZA 2IHYA 4XWOA 1HA3A 4MUAA 5EE9A 2H7VA 2Q0HA 5FBQB 3DMDA 4ON9A 2BOVA 1Z2CA 1XEXB 3AVVA 1NVXQ 3EZ6A 4ABYA 4JYBA 2EU8A 4IOLA 2VBCA 4C7OB 4B3FX 1OLOA 2BMFA 1OJLA 2BBSA 3A1WA 2OILA 3AB3A 1IJFA 1BH2A 3KTAB 2DFKB 5LB4A 3U3OA 1G8GA 5FPYA 4PC3A 4D4LA 2IYQA 2RH5A 4FMDF 1SQ5A 5LD2B 1OKKA 3TSWA 1NSTA 3FDIA 4FWTA 5AK0A 3QKRB 4D26A 4TQUS 2KI5A 2JLSA 5JI2E 1N0UA 5EP1A 2QRZA 1KI9A 1R8QA 3BERA 6Q21A 1R7RA 1UKEA 4CDGA 4AKGA 1DAHA 5JSZA 1WBDA 4TWZA 3F5FA 3RRYA 2FH5B 2X1VA 4JL8A 1VHLA 3L0OA 4PO1A 4MITA 2PH1A 2IYXA 2QPTA 1JEDA 2AN9A 4C0QC 1XEXA 2WKRA 3B1ZA 2ZJBA 1H8HD 3QVVA 3K0AB 3BB4A 1TAGA 5ANRB 4G5QA 5AWFC 5DGXA 1CBUA 1CJKC 4MRSA 2OG2A 1TEVA 3AF1A 3EA0A 3P4YA 4PHFA 2IYRA 4DDVA 1PZNA 3KB2A 4M9XA 2AL7A 1TF2A 3HYTA 2QORA 2W58A 2GXQA 3AKEA 2O8BA 1E2GA 2O8DB 5CITA 3K0CA 1ZMXA 2JGNA 1TQDA 2C9YA 1DBSA 2WWXA 4TMTA 4W5JA 4NPHA 3THXB 3TW4A 1AM4D 3TIFA 4EFNA 1IXSB 5FBWB 2JAQA 3AVWA 4M8NE 1Z6XA 3L8YA 4QGAA 3EX7C 1AKEA 4Q9JA 5CLLA 3W6NA 1GIAA 4BZXA 1G19A 2WSSA 2DBYA 4QFMA 3RDPA 1IM2A 2ZYTX 4B43A 4L9WA 5JHGB 2EVWX 4JLPA 4W5HA 1X86B 3QG1A 1XD2A 3FWYA 5KO2A 5TARA 4LJ6A 1AQYA 2GEUA 3O8RA 1K8RA 3TAUA 1W0KA 3SQXA 3IEVA 1DO0A 1J2JA 1RJ9B 1I2MA 2OBLA 2BEKA 4Q00A 4DWJA 2FFBA 2ZI5A 4RD2A 1J7KA 2AR7A 1G7CA 4I1OA 3T15A 1DVRA 2FPLA 5DN6D 1EXMA 1R10A 2V7QD 1ZVQA 3EC1A 4MKGA 3H1TA 4ZO4A 4NYMQ 4LV6A 4QNMA 3PVSA 1G5PA 3R7WA 2WOOA 1G8PA 4HAVA 3GJ4A 1KY2A 2QE7D 3UKDA 1E99A 2NIPA 4RCZA 3K0CC 3DZ8A 2BEJA 2XNDA 5FPHA 5JCPA 4DSOA 2IS1A 3CZQA 1XXHB 5CYOA 1Z8FA 2ONKA 2IC5A 4HAZA 4PSKA 4PPQA 4F4CA 1XMSA 1NN5A 1YHNA 1MT0A 1ZINA 2ZJOA 4UJ3A 1HE8B 3G0HA 2PEYA 3I73A 4BEJA 1RC8A 3WMFA 1GAJA 4OL0A 4ZIRB 2ZUDA 1R6BX 4CEJA 3B9QA 2WIBA 2H57A 1G20E 2QRNA 2IUUA 2KBFA 3LBNA 3OFNA 2PBRA 3GJ7A 1RFLA 4LBWA 2GHIA 1KZGB 1W47A 3ZJYA 1T91A 4P31A 3ASZA 4Q5IA 3THOA 3KQHA 1UKYA 3SJAA 3SYNA 2J41A 1EFHA 3DEFA 2Z43A 2CLSA 2JIZA 3EW9A 1KDRA 1DPFA 3LNCA 3QUSA 4B71A 4DLRA 1VCOA 3TW8B 3U3RA 2VP0A 2J0SA 3ADBA 1KAGA 4HLUC 2P0EA 5CDFE 5D3MB 4TLBA 2ODBA 2Q3HA 1KI6A 1IXRC 2A3RA 1KMHA 2PT7A 1K6MA 1W36B 1E32A 2PEZA 2FSHA 2V6IA 1WQ1R 5KNDA 1G291 4WZBE 1FMJA 1W48A 3SC3A 4HZIA 1KDTA 2DFLA 2HV8A 1NLYA 3W3ZB 4MDFA 2ZR0A 3EPJA 1A2KC 1AS3A 1Z47A 2V1XA 3RWOA 5P21A 1KO8A 2MSDB 1E4YA 4GDFA 3GJ0A 3X2SA 5FTKA 3QPWA 4ACAA 3VR2A 3SJBA 5HCIA 4JLKA 4V0ME 3NDPA 2IW3A 2ZSAA 3KKMA 5C18A 3CLVA 3THWB 1F5NA 1SKYB 3SJCA 2ZS7A 4UNPA 3GEEA 1W36C 2CE2X 4Q4AB 1OIVA 2BC9A 4LGMA 1H8EA 1RYHA 1NIJA 4X8LA 2CCKA 3QOFA 2HYIC 2ZSBA 1YVDA 4E09A 2WWYA 1KO7A 1ETUA 2WTUA 3NVAA 4B33A 4DZZA 2YWHA 5H68A 1VG9B 1EX6A 2EWVA 1AIPA 3PG5A 2WWFA 4FD2A 4KODA 4B75A 4F4IA 5IK2D 2O8FB 4HUQB 5JHHB 1LF5A 2A7QA 2YYZA 1E9EA 3A4NA 3MWKA 1GTVA 3VNVA 4IHQA 2I1VB 3W6PA 4NMMA 3AVTA 1SVOA 2WWHA 3EZ9A 4KLNA 4A1FA 4BLTA 1WCV1 1D6JA 1KZ7B 5CK4A 2JASA 5CK5A 1QBKC 5DNYB 3OFND 4H9GA 3DVLA 4JLNA 2XB4A 3B5JA 1EK0A 4TN1A 1JXMA 3REFA 3T5DA 5KDOA 3TK1A 5CM8B 3IGFA 1W4RA 4YC7A 2O8EB 1XU4A 3SOPA 1ZUIA 2BCGY 2EQBA 1G3MA 3TQFA 2ZI7A 1EX7A 4K46A 2QPOA 2KWIA 4H1UA 2IYSA 5SZHB 2WWGA 2J3EA 2YNMA 5KDDA 3DMNA 2OCYC 3VQTA 5B57C 2J0QA 4ACBA 4HLQB 4NYJQ 4KFUA 4X8OA 3QF4B 4KAXA 1OFTA 4Q47A 2A5YB 2ZRHA 3AF3A 3EWAA 4Q01A 5JRJA 2ZRNA 4HLDA 3NEJA 2P67A 5CIWA 3S1AB 4Q1EA 1JBKA 5DISB 2CJWB 3RAPR 3ZZUA 2OFOA 4BZQA 2WWWA 2HEIA 3OAAA 3A4MA 4RVCA 5JJKA 4CW7A 1G4UR 1XD8A 2OT3B 5DI9A 3GJXC 2NZJA 2NQ2C 1IOZA 3HDTA 3KDSE 1BO6A 2BWJA 5DN6A 3U7EB 1E69A 2CL7X 4AK9A 4BFWA 1BKDR 4Q4HB 1ZAKA 2J0VA 4AKHA 1TUEA 1W44A 3RS3A 4EPXA 2ATVA 3MGCA 1GG2A 3UWKA 3U3JA 1CIPA 5CB8A 1P73A 3IIKA 1NBMA 2Z4SA 1JPJA 3E70C 2H18A 3KKOA 4Q4JB 4IOJA 2BCJQ 3QQ5A 5TDHA 2RGEA 1EFUA 3M0EA 4X8HA 5CDFA 2BM0A 3KZ1E 4TYPA 4C7OA 2GCPA 4D4KA 2G77B 4PTLA 5IF9A 3MUFA 3U6KA 2O8BB 2RCNA 3LVQE 1DS6A 4Z8XA 4LJ9A 1GOTA 3ETLA 5FFMA 4DJTA 5BQ5A 5B58C 1D2EA 1PJRA 4LYJA 2YWFA 3K9NA 4DC9A 4AY2A 4ITRC 3UG6A 4DSUA 1J70A 2RKOA 1Q3HA 5KDLA 1VIYA 3ND9A 1UKZA 4KU4A 5BN4A 2OV2A 1XEFA 1QZXA 2G0NA 1E2FA 4OQNA 2WPDA 1RVDA 3ICEA 3DKVA 5TV2A 2PLRA 3CX6A 3K09C 1FZQA 1NG1A 2ZRAA 1UBGA 4GP6A 1XTJA 5FOSA 3UK6A 1AZSC 4ZCIA 2QN6A 4CYMA 2WKQA 1B0UA 3THYB 1JR3E 3IPYA 2Q6TA 3BB3A 4KLZA 4P33A 3KJIA 1YR7A 1E2MA 2GRJA 3PEWA 1HQYE 2V8OA 1N6KA 3F0TA 1ZC4A 1RRGA 3CNLA 3WYAA 3KUDA 3B82A 4WVFA 4XTRA 1SVLA 3CWZA 4BFYA 1Z07A 1TNDA 4RZ2A 1XRJA 4ERNA 2W2XA 1MOZA 1CLUA 1J90A 1UM8A 3QKTA 4BFZA 4Q4JA 2GEDA 3B60A 2PLFA 3CF2A 4KXFB 3I5XA 1MO5A 2W0SA 1XTKA 4RFSA 2IBMA 1TQ2A 4ZPXA 4DB2A 4XIGS 2CHQA 1N6IA 1XTQA 3BGWA 2GVZC 4QBHA 2OXRA 1P9RA 2WPDD 2ZUBA 2CVFA 2HF9A 3VR3A 2CK3A 4GZLA 2JDIA 4LK2A 3K09A 4XH9B 1LFDB 2ZANA 1SVSA 5AUQA 3WBJA 1Z0KA 5JWOA 2JJ1D 3P32A 2NPFA 4JVNA 4KJZA 2BMEA 3UPUA 3U60B 2GJ9A 4PQFA 4ASUA 2J9RA 3IHLA 1SKYE 4F92B 4XWAA 1BIFA 1WMSA 2C99A 4HDOB 2ZUCA 4ESHA 5BYKA 1OB5A 2OBNA 4DCUA 1IN5A 1KTVA 1N25A 1YZGA 5GJWC 3HWSA 3LLUA 3T06B 1JALA 4M9QA 2QTHA 5LB2A 1VCMA 2AX4A 1WRBA 1CKEA 2QNRA 4TYYA 4C4PA 4IRUB 3ZH9B 1DAGA 2R44A 1YJ5A 3BFXA 3CR7A 3C5CA 2J87A 4UXJA 1AZTA 1CR4A 4NU0A 4OI4A 1OFHA 821PA 3L0IB 2LWIA 4B35A 1OXVA 2FFQA 4Q03A 4A2PA 3U6BA 1BMFA 4QRHA 3AP1A 1K5GA 1GNPA 1ZM2A 4HYYA 3PITA 1W5SA 3PQCA 2D06A 1Z08A 4QGHA 2I3BA 3R9IA 4IXNA 2CCJA 4EQ6A 1Q20A 1HE1C 3AQ4A 3C7KA 1HY3A 3BH0A 3BD9A 4IEIA 3U4QB 1GWNA 5FL7A 2RHMA 2VYFA 4JBXA 3V4RA 3K70D 1UAAA 2PL3A 4NYIR 4QGFA 2QAJA 1DADA 1DAMA 5FBLB 3PFIA 4PPFA 1A5TA 2GZDA 2ZE5A 2VIIA 4IJMA 2DYKA 4BE7B 4TYNA 1F6BA 4JVSB 1NI3A 2Q9CA 3QPVA 1L4YA 1W2HA 1KAOA 3QEOA 1UEJA 3ZIAA 5L3SB 3CO5A 2F55A 1M7GA 1HYQA 3CPHA 4WZ6A 1S0UA 4HATA 4B6EA 4TMXA 3TNFA 2AHOA 4R2HA 4RFVA 3W8NA 3R9WA 2IXFA 2JJ2A 3FKSD 4TLEA 4UNSA 1PV4A 2GWHA 4B3BA 1FFHA 4G0NA 1N5KA 4UQOA 2ZIAA 2VL7A 5B2ZA 5A0FA 3B85A 2HLDA 2J7KA 1F2UA 1QHGA 1ZIOA 4G5RA 3RRNA 2WSSD 4DT1B 1OH6A 4JYCA 3EG5A 4L5BA 4EUNA 1CR2A 5JMTA 1ZNXA 3EPLA 4TT3A 1KDPA 5GADl 2DCUA 1E1QD 1KK1A
chains in the Genus database with same CATH superfamily
3FWKA 4LV5B 3T4PA 3VV3A 3WYGA 4RK1A 1X7DA 4C1BA 4YDSA 4JD5A 3RUIA 3R6GA 4XJTA 1E0AA 2GCOB 4FYPA 4MCIA 2ZZMA 1CRZA 4N65A 4YK7A 4MIOA 1UJBA 3QIAA 4DEXA 3L01A 2HI0A 1QHSA 3IVRA 4I5DA 4C0BA 1JEYA 4PGHA 2YJ5A 2BW0A 5JBIA 3RG2A 3PB3A 4P0QB 2P5TB 3SZRA 1ZRMA 2XVYA 3PDIA 4TRMA 3N0XA 5CCBA 2HNAA 2QLNA 2W2QA 2ECPA 4TQGA 3EGVA 4OSPA 4EHNA 5A9RA 3WGKA 2CV2A 5K0LA 3L2OB 3CZRA 3LNTA 3QI2A 4GSLA 2AE2A 4AZSA 1B8UA 3NHUA 4F9TA 2PMFA 1SUIA 2VPIA 1RWNA 2GFIA 1RQPA 4LOJA 1QU2A 3DDUA 3I2YX 4Y2GA 4UTRA 5EZ6B 2JJ2D 2DR3A 1E8MA 1O5IA 5FYQA 3FH0A 2AWOA 1XVVA 4Q9NA 2VOJA 3BHJA 4WK4B 1XKLA 4ADSG 3RS9A 1E2HA 4J8PA 5EPEA 2YRFA 3EFEA 5AR1A 4EKGA 3TGWA 2O2CA 1OYYA 3FZYA 4EJ0A 2FJUA 4O02B 5LP1A 4PGFA 2B6NA 2ZIXA 4R9SA 1WB6A 1JTEA 3IC5A 4KQMA 1KWGA 5DOVA 4BO1A 1DCTA 5C53B 3AUTA 2X77A 3PFFA 3K6SA 3LA6A 1K08A 1PFKA 1AXGA 3C5WP 2OP1A 4BTEA 3P26A 1ZJ4A 2P6NA 2Y1DA 3WO0A 3H3FA 1MPXA 1Z0JA 4HX5A 1YJQA 3IKMB 3B6IA 2PZAA 5E9WA 2ZIEA 4E88A 4FUQA 4Q1CA 1BXKA 3KB8A 1YR3A 4NNOA 1OR8A 5AJWA 1EZ4A 2VJNA 3P0RA 4XR4A 3GF4A 4NE9A 3WK8A 4I9NA 4N8EA 1G8FA 2GCNA 3KHTA 3FOEC 1M73E 4Y8VA 2ISQA 3QXHA 3LS2A 4ZYYA 2GA9A 4XGQA 1IMOA 1M34E 1LLFA 3G6KA 3H2SA 4KNVA 4XCXA 3JQFA 3CVUA 5MN4A 2PX3A 3CIFA 4OI1A 3GUZA 4F8EA 1J21A 1Z13A 4DHEA 3CVXA 3I1JA 4BCBA 4ZZ1A 3KUCA 1Z7GA 3O3NB 1P60A 1BD4A 1JU4A 1SC3A 1SG9A 1UEIA 1W5TA 1XFAA 1RWXA 2J9FB 1NM5A 3GBSA 5CVEA 5L53A 5AW0A 1TXGA 3N58A 2ATXA 5AI5A 3NX4A 2NYUA 3MBKA 2DPMA 4PG7A 3UBTA 2O0MA 3DYIA 3DBLB 3DAYA 3ZQKA 2QXTA 3U5TA 2D6FA 2ZKLA 2NZWA 3WTCA 3RV4A 4WOCA 2G9VA 4PX9A 2RARA 4PWYA 4B6PA 3KEOA 4BEBA 4MW4A 1EFTA 3TCXB 1E3DA 1DE0A 1I4WA 1PFUA 1X19A 4HDMA 1CJTC 4P35A 3ZY2A 3BA1A 4YPVA 4HQFA 3U3XA 1GPDG 4HPWA 4Q1BA 3TDNA 1OZFA 4RGYA 4GI7A 1TT7A 1ZCBA 3SIPA 4MV1A 4D5EA 5FV7A 5LYJF 5D8DA 3TMYA 2H4ZA 4I19A 4ICIA 4R2IA 1QHEA 2HSEA 3NTQA 4RU1A 4UTOA 3H18A 4ESEA 3R5FA 1U0JA 2WIDA 4UCQA 3HCDA 2JLZA 1AG9A 3DO8A 4X20A 5IZ4A 3I2GA 1IN8A 2W8BA 4XYBA 6REQB 3A6DA 1H3FA 1UDBA 5KKNB 1SIWA 3Q41A 5FP0A 3SVZA 4CMKA 4DLSA 3I0ZA 2F8SA 1Y1LA 1QHFA 4MUEA 1Q77A 3ONWA 3OOSA 4MMYB 4CMCA 3OKCA 4QYMA 2WNSA 3WS7A 4B48A 4ZGBA 3U49A 2R8OA 2HHJA 3MGAA 3PPYA 3EA5A 2P69A 2C9BA 5JLJA 1YS2X 2ZPTX 4X0EA 4XM1A 1KMHB 1LNZA 2OV6A 5IAOA 5BV7A 1CUIA 4YHBA 5L4SA 3OTIA 1R0YA 2G40A 2IU4A 5AHOA 3QVTA 3DHWC 5HIAA 2VNJA 5DYWA 3RSFA 4M1MA 4TLDA 4HLCA 3DV9A 2CDRA 3L7AA 4JX9A 5DCWA 2XCSB 3EARA 2RJ3A 1TEHA 4TRRA 1IQPA 3QHAA 1GFZA 4JKYA 5EXTA 5LNK6 2O50A 4J2TA 3RHFA 3F90A 2G04A 1SD1A 5ISMA 2C5EA 2D5BA 4PLVA 3T34A 2PJRA 1KO5A 2ZYDA 2JNWA 3EQ8A 3G7UA 1M83A 1V1RA 2X6RA 2X7XA 3Q40A 5DLQC 2HMWA 3HSKA 3KQLA 1EA7A 2XCRB 1XD9A 3K4QA 1P62B 3SM9A 1L2TA 1N7HA 4X63A 5E4TA 2FYTA 3EE6A 2X2PA 4AFNA 2G6BA 3QA9A 4V39A 4Y67A 4BV3A 2W42A 3W3AD 3OFKA 3DA8A 2VQ6A 2CV1A 3DAGA 1DO2A 2MSWA 3VVMA 3KAQA 1CTQA 1V45E 3KFLA 4YLEA 4YUXA 5KTYA 1CYEA 3OF5A 2G9UA 1VYUA 3PX2A 3G17A 3PNPA 1KJWA 5AK3A 5EMMA 4HN9A 1SRQA 1SVMA 2XZDA 1JKFA 3VKGA 2MYPA 2XYPA 4Z2AA 4EFLA 2V7XA 2OV8A 2CC2A 1EP2B 4J1QA 4UVIA 1ZS9A 4KJXA 3BFVA 5EPOA 1MNQA 5HF6A 4UKDA 2DSTA 3OPYB 4K2AA 1TRHA 4K40A 3RVJA 4WK2B 3DLHA 3DFZA 3HRKA 3DPIA 1Y8AA 4ZI7B 2ONCA 2ZUTA 3PNYA 1TQ6A 3C6QA 1T5IA 4NCXA 5ALDA 1FFXA 5ECGC 1Y6QA 3TLGB 1ZRSA 1II9A 4C5BA 3DLBA 2O19A 3TBKA 3ZWAA 4KDRA 4QREA 2CF6A 4H15A 4DCTA 4O4HB 5CVDA 3OFJA 2HPAA 5BN1A 4PQGA 1A9OA 4YT8A 4YA6A 3FFTA 4RTKA 3GLGA 2VUSA 1YU6A 2F9FA 3U3MA 5KWSA 2E4YA 2ZYWX 4L07A 2W6ZA 2A4MA 2W2LA 2YC4C 4IIJA 3A1DA 2Q27A 5JS6A 4J0HA 2OGTA 4TWIA 2X0NA 5KSPA 4W7SA 5EVCA 3X1WA 3BN3A 4BN4A 1QQ7A 2WJ4A 4BP3A 5GM1A 2C03A 2EL7A 2RBKA 4R1NA 1SXJC 1N75A 1GGHA 1WXFA 5F5LA 1V1MA 4QHTA 4ZQEA 3F67A 3RG8A 1U94A 3ASVA 4EA6A 3WADA 5BSHA 2H63A 3UA4A 4ZTUB 2QTVA 2VP9A 3T7CA 2CK3D 2G25A 3Q2OA 4HK4A 4GGOA 5U9CA 5CXSA 2R6CA 3OA0A 3LBAA 1BSVA 3BT7A 3NOXA 1WP9A 3IA7A 3P9YA 4ENQA 4CQNA 1QGED 1VPWA 2ODPA 4LZZA 5AXBA 3VH4A 3IPRA 2QTGA 4D9GA 1FLDA 2J3DA 3GBVA 4MEJA 4DLLA 3VJRA 1I36A 1MVLA 2QVYX 1UKVY 4JLMA 2OP0A 3IBSA 4L3WA 4QQ8A 2YIJA 2O52A 3IULA 4QUIA 3T1OA 1LBIA 1CRQA 1YL7A 3VJKA 2OGSA 3KB6A 3ECSA 4ZMSA 1V4NA 2NXJA 2X9GA 1E2QA 2AZTA 3K31A 4JC4A 4ND6A 5DP2A 1QB7A 3V7NA 5AW9A 5HDBB 2XDQA 1CX9B 1Z4JA 1UDXA 2A4KA 2XITA 4OJNA 3ZV5A 1C4XA 2VQSA 3D0QA 1HEUA 3I2HA 2NUTA 4DDUA 3AGPA 2BGMA 3WGHA 3O1IC 1L7NA 3I5MA 4TUYF 4Q4LA 2O14A 3U4DA 3JD2A 3PE4A 1L7EA 1P4AA 1M6NA 2WSMA 1NZJA 3C70A 2QZZA 5D00A 5H1YA 5EMHA 3UHJA 3MTGA 4ZIRB 2O2DA 1Y1TA 2QP9X 2C3YA 1PYOA 4O0MA 4RYLA 1XVTA 1TFUA 3P4XA 3RUCA 3U2QA 4PRKA 1CJUC 4ZGWA 5FLEX 1TT5A 2K5UA 1B23P 4RANA 3V9PA 1XRSB 3BCUA 4LCJA 2J9YB 3SM3A 5AFSA 1T3HA 1U90A 4QU5A 2YQZA 1DL5A 3OESA 4UDNA 3VKWA 2TMYA 2PGAA 4DV1B 2QW1A 4X85A 5PGMA 3RYFB 1OH5A 3DT9A 2NTEA 4N39A 5IBPA 3SDSA 4G0QA 1HDIA 1NC1A 2GZSA 1AKYA 1HT3A 4OQMA 1NRXA 4FYMA 5H59A 2GK7A 2BV3A 4DSTA 4UOQA 1VMIA 3ZGOA 1B3RA 3UK0A 3AR5A 5CDSA 4Q3LA 1YBHA 1E1NA 1V7QA 4K9NA 5ALTA 4AZWA 1CCWA 5T3UA 3L7DA 3ZVNA 4GEKA 3Q9NA 1C80A 3B70A 3LBFA 4DDMA 4D9FA 5BV0A 4EYOA 5K8IA 3UUEA 2EFEB 3CR3C 4IMPA 4HNRA 3N2KB 4NBKA 4XR9A 4WIAA 3EPPA 3DTTA 3JQAB 4U4AA 1P3JA 3ZVRA 4BMZA 2Q62A 5EJIA 2A9FA 3U7GA 1E1CA 1F12A 1Q2UA 1R6UA 3VNRA 5C37A 1I3MA 2VDJA 4ZVLA 3V4VB 2NZ2A 5KSZA 2QAIA 3OT1A 3QXXA 3SE7A 3LX5A 1RW4A 3R3XA 4DV5B 4RY2A 2IYOA 2VOEA 4ZDWA 3VI4B 4AY6A 1D5CA 2CYBA 4RY0A 3S7ZA 2YVUA 3DXXA 4EUEA 4B3IA 5GONA 1GCOA 3DONA 4OHKA 1V5WA 2OFWA 1AN0A 1Y3CE 1N5RA 3QE2A 2FUCA 1NYRA 2Q99A 3TTYA 2ODEA 2JFWA 5C8DA 4TT3D 5FOWA 1TJ3A 2ENUA 1AGXA 1LX6A 1KMQA 2MSLA 3CEAA 1Z9BA 4EI9A 1TLFA 3GFVA 3QYPA 2IS4A 1HV8A 4E5SA 1KJZA 1MJNA 2O1SA 4DCVA 5K0GA 4M55A 4MNTA 1GCGA 4B80A 3GMTA 3PYLA 4TS4A 3FYDA 1ZRNA 1Q0HA 4I9UA 4M7PA 1BHSA 1GGEA 2RHRA 4UEKA 1JFTA 4JXXA 4Q6BA 2LCFA 1E94E 5HK9A 4KXYA 3S5UA 3KPJA 1NU6A 3WLTA 1XEAA 2QTTA 1DV1A 2TSYB 2AG1A 2H4JA 5E7IA 1E18A 2W2TA 3RASA 2YZ7A 2G67A 1FY2A 3I6BA 1X7WA 4HEHA 4MGYR 1PE0A 3FPLA 4ZRNA 1KZ6A 3U40A 1QTIA 1KS2A 3EVDA 4B47A 5IASA 1VDZA 1EVLA 5AJYA 4CM3A 1YWGO 1I9CA 1AE1A 3UY4A 1TZMA 1H1DA 1UBJS 4OPMA 3F9IA 5EE3A 5HIIA 1Y81A 3M83A 5BW8A 4HDMB 1U02A 1SQ0A 3HI6A 5E2IA 2GESA 1BU5A 2VXCA 5P8WA 4XYLA 5EUQB 3S8MA 2PD3A 3GEIA 5K6AA 3F1LA 1JJFA 3ENWA 3VKUA 3C14C 4LBZA 3B48A 3GCXA 2YWGA 3VPHA 2O8CA 3SDBA 6CHYA 1U7TA 3FRIA 3UJ7A 2JJ8A 5D3QA 1X77A 3GGGA 1DJQA 3S1AA 4YYZA 1Y5NA 1X7HA 2BGRA 3OEYA 4O0LA 1MABB 3V6LA 3VTAA 1APBA 2ZWAA 3L7YA 1QNLA 5EKSA 2VBFA 3G5TA 4FS8A 4YCJA 4EYKA 4TMWA 3VPFA 1R6TA 1IQRA 3NEYA 3SQNA 4BYGA 1W30A 1VBMA 2ZQ5A 3CNNA 3BF8A 4NX2A 4EJSC 3KKPA 3Q11A 4PF1A 2WT4A 3UMSA 3V8EA 4C05A 1HL3A 5CNMA 1H2BA 2HB6A 5D3ZA 5IDVA 1C29B 1W5EA 1HZZA 2OHHA 1Z4MA 3EZYA 3HZHA 4N3NA 5JSFA 1T8RA 1FQKA 1V8DA 2XQVA 4OU5A 4D5GA 1CUAA 4RIHA 3AFGA 1G8JA 2VHTA 3DXYA 4A0HA 5ICFA 4BNMA 4NJMA 4NL4H 4JJZA 4L7VA 1U8CB 3DVAB 3CLSD 4BX0A 3WRXC 3ORQA 3KJZA 3PZRA 3ZY4A 3HRIA 3U37A 4CIXA 1BHQ1 5F1YA 3UN1A 4XD2A 4UC0A 2WHPA 5DO9A 2FW1A 3TQOA 1T3SA 3VVBA 1AT1A 1QFZA 3F6RA 4HH1A 5CNJA 5DF1A 5BSUA 1ZH8A 4F2GA 5I48A 5AUNB 2E4WA 4XRGA 4DM7A 4ZOLA 4UMVA 5KTOA 5L3SA 6GPBA 3HU5A 2YH2A 1P0MA 3JATA 5C32A 2GXAA 1SHJA 3H2IA 5KJCA 1DNPA 3OE7D 1WMFA 2RGCA 3A3PA 3JSAA 2ZE6A 3HJTA 4I0WB 4JEUA 4L72A 2V55B 1RBZA 1JL3A 1P5HA 5A5DA 1MO3A 1FTNA 4OYRA 2XJ9A 2D2EA 3R09A 1H3NA 2FZWA 3KALA 1KOFA 3PUIA 3PSAA 4M1WA 2BUBA 3WP0A 1U1FA 3TB4A 2XMRA 1L5ZA 3D2AA 2TYSB 4LFAB 3E6AA 4ZZ2A 3VZBA 3TAXA 2E87A 1BFDA 3D7LA 3CH6A 1W0JA 1B8OA 2MMGA 3QPBA 4JHLA 5E4FA 3PQ5A 2GEVA 3AUSA 3PR3A 1MAVA 5KAMA 5TVGA 2M6KA 1GZ7A 2AJ8A 3HVKA 3JAWB 1SMKA 3H9CA 5BO5A 4JUBA 3LT0A 3GFGA 4RPJA 3NM4A 3CG0A 5G41A 5F78A 4J7XA 3DBLA 3N5KA 2NSLA 4V1CB 1LB1B 5JQWA 2Y0EA 5FUXA 3IPAA 3N7UA 5KYUB 3OD5A 1XZMA 3GIWA 4KTVE 2V7WA 5CH3A 1YNSA 3KXLA 4X45A 5TPZA 1TEZA 3HP1A 5EP2A 1PGQA 1U3GA 1NW3A 2I4IA 5DEIA 4A6EA 3BD7A 2X3FA 4YRKA 3KD3A 2F8TA 3PCRB 5AVWA 5CFNA 4TTQA 3EMDA 2RKBA 3FNQA 3QF7A 3U4GA 5KVCA 1XMJA 3ADPA 1IY1A 1E2LA 2WDPA 3CE9A 1JEQA 4MOWA 4CHGA 5KCZA 2D74A 1JAYA 2F43A 1B73A 5JDIC 1O58A 4M6WB 1NL3A 3DZGA 2XT9A 5KNDD 1WX1A 4KO3S 1KVQA 4ZQIA 3DZJA 4N49A 1M2NA 2H3EA 5LZ5A 4CV0A 1YS1X 2Y76A 2QTWB 3F7OA 3DF7A 5I8ZA 3AVQA 1XPRA 4Z0PA 3WFZA 4HHEA 1HLDA 1SC9A 2XUGA 1Q7TA 1M7HA 1QH1B 1EFKA 1XXHE 1FA9A 2ECFA 2LR0A 2OAQ1 2YV5A 3DPUA 4KIWA 5TEWA 1IWBB 2XNKA 4IXTA 4ZIRA 3OPNA 1GUFA 4NF2A 2Q3JA 3KPYA 4I8XA 3ISJA 3G2HA 3KX2A 2A2ZA 1IVYA 1HE2A 1TVCA 2O2SA 1GZ3A 3AGQA 2YWJA 3HNPA 3ITNA 4HQOA 3BK7A 4W9NA 4Y9TA 4DPMA 4OV6B 4WESB 2A1UA 2C4HA 3P19A 4DWVA 2ZYRA 1Q0PA 1C30B 3CN9A 4ZOCA 1S8FA 2ZYHA 3ZD6A 1L3CA 2W6CX 1G9XA 3W2GA 5DNDA 4FMCF 5AW7A 4L78A 1ICEA 5IW8A 2OL4A 1JFRA 1F3LA 4MZXA 5BXQC 4PCLA 5A6VA 1RWKA 7MHTA 3R8CA 2BJWA 1GHTA 4DNOA 3OFVA 2PX4A 3R3JA 4FQ7A 3M33A 3KSZO 3JALA 1OWLA 3CFYA 4GP7A 1RE0A 1Z35A 4M8LA 1GXSA 4PLGA 2ZJ8A 2J6IA 3PC3A 2FWNA 1VKJA 2QPLA 1DKLA 4XX1A 1NNLA 1QP4A 2XNHA 2W2VA 1JKJB 3L5KA 2VYCA 3GYBA 4ATNA 1X7XB 2A0WA 2XWJI 3PJDA 4D4HA 4L8WB 5B30A 5L7WA 3OPQA 2Z58A 2BM1A 4MKHA 4LWQA 3W5VA 4DEYA 1ICIA 3AI2A 3UKJA 1S02A 5H8WA 1XRNA 1A5ZA 1ZHHA 4FI3C 2O05A 4U7WA 4BVBA 4QLBA 2Y4OA 1Y4UA 1A1SA 3ZWKA 5A06A 3KSMA 4I14A 4OJMX 3K9HA 3MYRA 2G1JA 5E7QA 2W4QA 2H52A 2WU4A 3MPOA 4DDTA 1NURA 1RKVA 1U4NA 5IC4A 3DNMA 3WDMA 2B94A 1HBJA 2NO0A 1LDBA 1WTAA 2FKAA 2J4DA 1V71A 4ETIA 3HACA 3PNMA 2CLFB 4WDQA 2GWRA 3FROA 4JC5A 5AJZA 2R6FA 1RCTE 4AN0A 4P7FA 1L1RA 3GWGA 3ZVMA 1DT5A 1CY1A 3H5IA 3FI9A 1NF9A 3LF1A 5JFOA 4P4LA 4DABA 3IILA 4F9EA 1KHTA 1N2SA 4INZA 5C7IO 4G84A 1KWKA 4KO2S 1FP4A 3KL2A 3WMGA 4IIHA 2Q1XA 1O94C 1ZGJA 2P9HA 2OR3A 2R8EA 4X84A 3ETCA 4AC9A 2V9CA 2ZQZA 1GFWA 4B79A 3KT8A 3DVQX 3M1IA 3M2TA 4GEGA 3U44B 5CPBA 2PWBA 1QGYA 1ESNA 3IIEA 3FTFA 4GE0A 4M0UA 5THKA 4CG0A 2CF5A 3K0KA 1J25A 1EDBA 2EZTA 4KI0A 3EJWA 1V37A 1E0SA 3B1JA 2MU1A 1Y7HA 1TMOA 1V41E 3FW1A 3L4BA 3DYVA 4G07A 5E6UB 3RS0A 1YS7A 3VNSA 3JXEA 1Z5WA 4IDOA 4QU9A 3Q8LA 4QOSA 2D5AA 1GZ4A 1L6IA 3IIMA 3QKSB 2BM8A 4N47A 2PJZA 4MWDA 3UICA 3ZBQA 5IVKA 1CB7A 4Z4FA 4GWLA 3D31A 3IUSA 2D62A 2JAWA 4AZ3B 3LPNA 2XD9A 1PK8A 3H9JA 1NFQA 3EY9A 4HNSA 2GARA 3E9NA 4PYOA 2Z98A 1OT5A 5BPFA 3Q9LA 1YE8A 3D7MA 1X94A 2H2WA 4RF4A 3HY6A 3KV1A 1TJYA 1VBKA 4I4LA 4MIYA 3ZU2A 4BWFB 2P11A 1G8KA 1PS9A 2H7YA 2WAXA 1E2NA 1BH6A 2HF7A 3MTJA 3UJDA 5K9ZA 1HMPA 3INYA 1BOFA 2FW8A 2QZPA 3D0OA 3L6UA 5FR2A 3ZLTA 1CDDA 4DJJA 2FEKA 4EOGA 3HYRA 3RBZA 2VUUA 3B9RA 3G0BA 3NTXA 3L7BA 3QG5A 4CF6A 2B7LA 3PTAA 3BDIA 2WICA 2GAFA 4BLVA 4CL3A 2HRCA 3ZPXA 3KZCA 1TC2A 1G2QA 2ACVA 1VHWA 4QRIA 1GPNA 2K7ZA 2HN9A 4RJIA 3RYHB 3KDPA 2CUTA 3D3WB 3G5UA 4ZKEA 5BYAA 1JLSA 5ALVA 1T0PA 1E3IA 1SELA 1Z16A 3V7FA 2Z2ZA 1YQ9A 1EU1A 2P9TA 1ZXBA 4IAOA 4P3XA 3ZCUA 4RLHA 3LPAA 4F4UA 2A67A 4X6LA 3UJ6A 3J7AC 4RGBA 2QRQA 5K20A 1B3BA 2FPRA 4BVGA 3KTDA 3LT4A 4PYJA 5ALLA 1KMMA 3LRPA 5F35A 2OXFA 2Z2XA 4GC5A 4B82A 4Z4EA 1YFKA 1UC9A 3FA2A 4G37A 4BC1A 4C7JA 1JBQA 4ZJZA 1G21B 1CK4A 1D0IA 6YASA 2DH5A 4M0KA 3GRPA 3HO8A 4MQEA 2R86A 3LUAA 2B8EA 2EJCA 2IHUA 4BB0A 1CHDA 2DHQA 4GXRA 4Y2PA 2P9BA 4ZZ3A 4J94A 1NJ1A 5KAPA 4F04A 5EZ5A 1XTVA 3GJYA 4QPCA 3GGJA 2OHGA 1A8HA 3U62A 1W9MA 1D4ZA 4B83A 1RLJA 4PFSA 2PL1A 2GYWA 2JFFA 5ER6A 2XHEA 4N6OA 1FNMA 2IOFK 5CFOA 5DULA 2Q3LA 3PFWO 5F7JA 2Z57A 3ZN2A 1NUUA 4Z51A 2Z2KA 3BXOA 4IKEA 1WG8A 3RVLA 2AQHA 1ZVMA 3FNGA 3T3OA 5EMJA 3IVMA 4Q93A 2J3MA 4HWRA 3F47A 2YHAA 1HKUA 2Z3VA 2ZJYA 3X2FA 4D9KA 1MJFA 1YDFA 3ESRA 1ZI9A 2SBTA 3L7KA 3IPLA 1G18A 4FIDA 5LJIA 1LRKA 3GXOA 4MA0A 4G5OA 1PW7A 5EE1A 1NATA 5JSHA 1IBLB 4B7XA 5EG5A 1G0NA 1XUOA 1JNYA 3WOHA 3IPXA 1ZMOA 4MV7A 5T7BA 3OA2A 1HTTA 3C8HA 1XDSA 1QOPB 4ENSA 4Y7CA 4B7CA 1FVHA 5JMPA 1Z12A 3DHEA 3TR0A 5A3VA 1GZUA 1SUBA 2P9QA 4FHEA 1HEIA 3UATA 5K8JB 4UZFA 1OXUA 1QYDA 3CM0A 5EUMA 1QOQB 1OXBB 1I3KA 1M8PA 5ES3A 3VR2D 1HUQA 1WD5A 4X97A 3DYBA 4DMFA 1VPDA 4NCKA 4N1AA 4C7MA 1QO0D 3PQ8A 4G56A 2IOHA 1BYIA 1NLUA 1QIHA 2OBMA 3E81A 4OXKA 4YRAA 3M4NA 5FI0B 1GUZA 3N8GA 4HB0A 3TZLA 4MVYA 1D6MA 1TYBE 1OTHA 5AKKA 4ZJUA 4BMVA 1EGAA 2GF2A 2JH8A 2P6MA 5HEKA 2PZGA 3HEAA 1ADJA 4AG3A 1UFOA 3C8MA 3FPKA 2BCEA 2IZ0A 4FONA 2DVMA 1J6UA 1EB9A 3DQZA 3TR5A 1YBVA 2XVXA 3GLIA 4BQSA 3WQRA 1C0IA 4M36A 4UTXA 5JROA 3T5BA 4HAIA 2EG9A 2FZGA 4R8SA 5J47A 4EDFA 1XTZA 1GPH1 2LNDA 4GZ6A 3HFGA 3LOUA 3T94A 2NLOA 1GCUA 2KSQA 2IYUA 2FQYA 1HLPA 2WF6A 3AJ9A 3NAQA 4BN0A 3KYCA 2W6QA 5BQFA 2R3SA 3MGKA 4WEOA 1U9JA 4BBJA 3QW4B 1MX5A 1N4DA 3KUUA 5AXCA 4ZJYA 3ZJVA 2PM8A 3FHTA 2JIRA 3OLZA 2Y1LA 3HA5A 1GPUA 4TQ9A 1K6XA 4KQCA 5BWBA 2Z8XA 3LFUA 3NATA 3ZE6A 2G8NA 2VXBA 1OGIA 1XTSA 4EB6A 2A9OA 3K70B 1MZPA 1DOHA 4GC9A 5K2MA 1XMVA 2QTVB 2XF8A 1PGOA 2AOUA 3LECA 3EISA 3Q85A 4JNCA 3U5ZB 1MB0A 3TGLA 3OMLA 3G88A 2GPYA 2DHDA 4L74A 4O4HF 1FSPA 3A70A 1ZUNB 3NO4A 4O4IB 4M38A 2GYYA 3GFRA 4R8LA 3GUVA 2Q5HA 1XEWY 2J3JA 2M2IA 2VJLA 2WYVA 3WSWA 4WADA 4Z7NB 4XDZA 2PT5A 2QK4A 3RU9A 4IIFA 1D8TA 4GO1A 1J07A 2ZWIA 3F7TA 2JFVA 2VT7A 3GDGA 3H97A 1S3IA 3GUUA 3PT9A 2NNLD 4P22A 3UCEA 3VPXA 3ZYZA 1AKQA 4BEWA 1WR8A 3MCTA 1R5BA 2P40A 4IIGA 2XB2A 3HJBA 2PMKA 1QYRA 3CLRD 3LTNC 2VKQA 4OK6A 1OLUA 3IERA 1KRHA 1SGWA 1CD5A 4UFOA 1GTJ1 4U0KA 2P2LA 2BT4A 2NUTB 5EJ9A 3B7GA 3F3MA 3NKLA 3OIYA 4NQZA 4EQZA 3K70C 3DHVA 2F8MA 4S12A 3GZNB 2GSWA 4U00A 3FY4A 2HUPA 1P5JA 4X44A 5G40A 2VJDA 3I28A 5ITZA 3HR7A 4AN1A 2VRBA 4HDRB 1ONBA 1UJNA 2X14A 1JQEA 1E96A 1ULHA 1YGYA 1AOXA 1GN8A 1OA1A 4BB6A 2YJTD 1DC8A 3CNQS 3JR7A 4RDXA 2WM9B 4G8BA 1OX6A 1A9XA 2H06A 1A9SA 2QMOA 3C5EA 3H0CA 1Z8NA 1W4LA 1KH2A 2Y1CA 621PA 4PLZA 5HKKA 1B6RA 2IXTA 1PV1A 5ALOA 3WHIA 1LDEA 4JLUA 3FFBA 1OXTA 1RJFA 4G85A 5CJPA 4G2TA 1AGRA 1MH1A 1TLTA 1HE4A 1HFWA 1T9KA 1S9DA 2BIFA 5GOZA 4HC4A 1MHPA 2N3ZA 2ZYSA 3I92A 3GLGB 3CH5A 2H1SA 1QG2A 2AR0A 4FINA 4DLBA 4UE6A 3PU6A 3JQFC 3BXXA 3J7TA 2WHEA 1HNZB 3W7AA 1JR6A 2R8ZA 1HSZA 1NQVA 4YCSA 4XA8A 5AIBA 3OTOB 4D42A 3MCWA 4QJ5A 1MENA 2B83A 3AY0A 3B5EA 2AN5A 2Z8ZA 4UTNA 2G4CA 1LPBB 2D0PB 4J1NA 2HF2A 4JU8A 3IP1A 4JLAA 4RNDB 1TJPB 2H1HA 4YYEA 1I3OA 3M5WA 2ODTX 5EIBD 2GX6A 1IUKA 1GNRA 2WF5A 2CHFA 4MUHA 2AF4C 1Z73A 3BDVA 1FX0A 3WA6A 1YDEA 2E2WA 3D8RA 4NWIA 3QLEA 4J0JA 1TUGA 1VSBA 3E8XA 4OKSA 3IAS6 1ORRA 4TWRA 2O3TA 3IS3A 3U3ZA 2BF4A 4D96A 3ODGA 3LZDA 3MF4A 5AICA 1JSZA 2D5CA 3ML1A 4LJSA 4DWWA 4Z4IA 2E5LB 5ENDA 1YRLA 1EBFA 2VPYA 1CRLA 4E4YA 1A82A 4DV0B 1F1JA 2QY9A 4BLQA 1ULZA 2PX8A 1AUPA 3MLAA 1YMUA 2UUCB 1E0KA 1JJIA 5A4KA 1QE0A 4EHFA 4F96A 3ECAA 1KEEA 1NHGA 3QXJA 5DMHA 3P8ZA 4B4UA 1W35A 1JEEA 2V03A 3AEUA 4JOCA 3TLEA 1JT9A 3E82A 5TMBA 1XIVA 3DE1X 3AEUB 3E1GA 3RKSA 3LBHA 2OTCA 4MW0A 3OPVA 3NH9A 3V48A 1HLFA 1SC4A 1N77A 3T12A 2C9DA 1Q15A 4ZO7A 1RT9A 4XASA 2BR4A 1TTHA 1FTWA 1QIJA 1YJBA 2I6FA 3FSEA 3H87A 3N8DA 4LZPA 1A04A 1IG0A 5HTKA 1Z5NA 3LKVA 1XNJA 1GKLA 1GNQA 1K8YB 2Q6KA 3CTMA 3O03A 1ZH2A 1WMBA 1DKRA 5KYVA 1ADYA 1HG0A 3N28A 1TZJA 3FZNA 3O8CA 3VC1A 1RS0A 2NPOA 3AHCA 1PWEA 2GJKA 5BSRA 2Q2NA 5EMLA 1NN0A 1P1RA 2JDID 1CZKA 1WXIA 2IPNA 4Q21A 4ALIA 4E1VA 5KINB 4UTZA 3OZTA 1T1IA 2GD6A 2AD1A 3EZ2A 1IY2A 3VO9A 2PGJA 3LDGA 5GOTA 2VA9A 1K5PA 4F4DA 3B78A 4AURA 2IU6A 4HUQA 1NQTA 2P1DA 1T4CA 4CT5A 3GR6A 2PU7A 3M1YA 2FWIA 3PR1A 4DC0A 3V2GA 3TLJA 1GPYA 2MIIA 1ZK3A 2FSVC 5ENVA 3HFJA 5FWNA 2FEWB 2QN8A 3WQSB 5CYFA 2LV8A 2WZBA 3AUAA 3C3JA 4UQLA 1VYVA 2O2HA 4ZDJA 3AYXB 3JWEA 3EB9A 1MIOA 4WZAE 4EKDA 5ICMA 4TL8A 5F2OA 3I45A 1GDDA 4P8RA 5G1NA 3ZDYB 1GP2A 4REMA 1P2UA 4DRXB 4WASA 1UBNA 2H11A 4D7AA 2AEJA 2Z3ZA 1Y6ZA 1LY1A 3K30A 5DRYA 4Q7QA 3HVUA 3LDUA 4L02A 1D0SA 2EFYA 3HUFA 3JR3A 3PHLA 3TKLA 3ROMA 1P9NA 5EUBA 2F1JA 3CGGA 3ILVA 2C95A 3NETA 3HUDA 1NI5A 4GKAA 3TTWA 1RM4A 1GM5A 1RRKA 1OFUX 3GWZA 1X42A 3ZHBA 4CG3A 2R87A 1VJRA 1N5OX 3IT0A 2B1JA 2Q4DA 2CBGA 2IIVA 4H7EA 3TCKA 1IPEA 2TMKA 3I6IA 3QLUC 3A1EA 3CZMA 3JATB 1XE3A 1D7OA 4BGVA 3HWWA 1QH0A 4JY7A 3SC2B 1ZMBA 3NXKA 2YC2C 4QZVA 1Y63A 5F98A 3EXIA 3KOOA 4JJ8A 4Q9KA 1E8DA 4C4AA 4W1QA 2OM2A 4NU8X 4Z9BA 3AW8A 1JHMA 1PCXA 3QXCA 3EXIB 4FJ0A 1BS2A 4WFKA 1EGMB 1PZEA 5IANA 2ZZNA 1JPNA 3TPFA 1ZU4A 2W2KA 2I71A 1Z8HA 2PGNA 2PMWB 1YS9A 3HA7A 7ABPA 2EOAA 2H7XA 1QQBA 4XTCS 3TEMA 3CRQA 4NONA 2CMHA 3DWGA 3TYXA 3NHSA 1XNQB 3EEIA 1J0BA 3AK4A 3HV0A 3VO2A 1ISPA 5TGDA 2QTCA 2ZPAA 3EVGA 3TRDA 2VJQA 3WK4A 4C7KA 4YGYA 2C1XA 5EE5B 1QONA 2Q0SA 2Q6IA 4HNHA 1BRMA 4FWIB 5JEDA 1GT6A 5IT5A 4EY4A 3A8TA 1K66A 3BIFA 5J1SB 5FPKA 1NQOA 3PYXA 1KYIA 3I09A 3MIZA 5JY1A 1OI7A 121PA 1QGUA 4X66B 3WKAA 9MHTA 1C2TA 1ZZGA 1EK2A 3ZH2A 4EZEA 1JHQA 1NLFA 1X3SA 3HC7A 1XVUA 1V35A 3ZJ5A 1G0OA 4ZCQA 1Q7EA 1G42A 2YHBA 2X5XA 3FI0A 3SIXA 2GNAA 3S40A 3D54D 4JZKA 4BKPA 1ZNYA 1Z2DA 1U8AA 1PNOA 1Y5MA 3VH3A 2PYZA 1PYGA 1NVKA 1MV5A 4JQOA 4O2AB 2PRYA 5IKXA 2PSEA 4ZT3A 3HJFA 2CDAA 4D6XA 4RW0A 3B6KA 2HF8A 1T6BY 1TGVA 2C9ZA 2I22A 1D4OA 3BORA 4MJXA 2Q3BA 3FCAA 3FVQA 2QT1A 1LKZA 2WZCA 4QWWA 2FRDA 2X6QA 1OXXK 1GQOA 3T7RA 2G71A 1W87A 1CQZA 1XB2A 1V5EA 1CJBA 3EGEA 1O4WA 3ZXUB 5BN5A 2ECKA 5AI9A 5LA6F 2POCA 2YVAA 5FORA 3VR4A 4GYYA 4AJHA 2BM9A 1P1JA 3K9LA 4OM8A 4RF2A 3R9KA 3WGYA 5K3DA 5K2OA 4Q02A 1MC8A 3CX4A 4JI1B 4CM1A 1OCEA 4XVUA 3SSAA 1C1XA 4NBNA 1PG2A 1VBFA 2GQ0A 2GZ2A 3E5NA 2ET6A 3EQ9A 4FGWA 4WESA 4GNKA 2HA0A 1I7PA 1NNUA 4JMLA 4Q9DA 3WB2A 1ISRA 1ELOA 3WK9A 4C3VA 4NIMA 4LJAA 4IFIA 1OFGA 5KIAA 2C61A 2OHFA 2CVOA 1N1EA 1WUHS 1W29A 3CO0S 5F2KA 3AR8A 1T1GA 2GPWA 1NJGA 3B3FA 1U0GA 2O5EA 3AIIA 2OUKA 4CCWA 4ZVOA 3RNLA 4TL6A 1AQIA 3WLRA 2NP6A 4MQ5A 1YVPA 4WWHA 3UUGA 2VHZA 5DOZA 1UBUS 1DEOA 1CZOA 1SBIA 2QMUA 2QVCA 3K20A 4G0MA 4ZAVA 1EK1A 4KE8A 4JGGA 2EFDB 4N5IX 5J9FA 3B6MA 2P2ZA 4RIFA 4J0CA 4EECA 4MRVA 3JQGB 1JI3A 3MVEA 4KN5A 1O3YA 4YUAA 4P5PA 1AA6A 2V3CC 5KWVA 2WTXA 1QH8B 4PANA 3EPKA 4OQYA 1U9ZA 1NSYA 5JQGA 4KXXA 5IJ0B 4PZDA 2DQYA 5FUWA 3BICA 2IHVA 5EYPA 1XOIA 4BMSA 4DILA 4Y1RA 2O5CA 3LY8A 3FYHA 1OIWA 1CQWA 3O2SB 1QCZA 4JUAA 4ND8A 3MERA 1SXIA 5LN1A 2QL9A 1U4OA 2XEDA 2JFNA 3BFPA 2AN4A 3FZEA 3NHPA 2XGOA 3OZAA 2Y8EA 4OHMA 3GJTA 1B1CA 4DMCA 1OH7A 2AXNA 2HJWA 2WMDA 2GT1A 3ZI7A 4B76A 2WQ6A 1LNQA 1D2CA 1YCGA 3MIIA 2ZSDA 4JP5A 3AOGA 1MTZA 1WPRA 2JCSA