1NF3A

Structure of cdc42 in a complex with the gtpase-binding domain of the cell polarity protein, par6
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
194
structure length
194
Chain Sequence
GAMGIQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGLEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords G25K GTP-binding protein, placental isoform
publication title Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1nf3A00
2WBLC 3AVUA 2FSHA 1UEJA 3EZ2A 4YMWA 1YZUA 4DKXA 4MUAA 2R8RA 2A7QA 4TT3A 3OHMA 4A6XA 2GRJA 1QDEA 1SXJE 2E87A 4OHZA 4PHHA 1E79D 1WE2A 1RW4A 2FH5B 2WJVA 3CX6A 2F1JA 3HPRA 1NN1A 2W00A 4FN5A 4MGIR 4V0OA 4C3ZA 1P60A 2XB2A 1RRFA 3PENA 2B92A 3AKCA 1BO6A 1GRQA 3PQCA 3TUJC 2KI5A 4NDZA 1IXSB 4YXWD 1P9RA 2B21A 2ZYVX 3SR0A 1Q44A 2AK2A 4X8LA 3WRYC 4AURA 1T0JB 3QXSA 2X1VA 5FPYA 1E98A 3BK7A 1NBME 3P27A 2O52A 1E99A 4L9SA 2QMOA 5IT5A 4RZ3A 2HYDA 2VIIA 1KSFX 1DVRA 3VQTA 3QKTA 1R5OA 1II0A 2HLDD 1UKVY 5C18A 2X2EA 1DAIA 1SKYE 5DISB 2F3RA 4CEIA 2EYQA 1IN8A 1OT3A 1UBFA 3QI2A 1P2UA 1P7CA 4QKQA 5DO9A 1UM8A 1WF3A 2LKCA 1GM5A 1IONA 1I4TD 2CCKA 5JJIA 3K0FB 1CRPA 1FX0A 1KDPA 1GTVA 2CE7A 3M0EA 4Q7LA 1NBMA 2RHDA 1QHYA 4E09A 4QGAA 4PQRA 5AUPB 3C15C 1KJYA 1MO6A 2ZE7A 4AD8A 3K9GA 3V00A 2O8EA 1Z29A 4BFWA 1RYFA 1NLFA 3C8UA 1Z0DA 4YDSA 3KKQA 4UNQA 1DO2A 2PCJA 4LYJA 5FUYA 5CITA 4UXJA 5JRJA 2QP4A 2NG1A 4RZXA 4EPVA 2UZ3A 3L0PA 3MWKA 1RIFA 3H4MA 1KMQA 4TLDA 3LAWA 1DS6A 1MO3A 2XZPA 4JL6A 1N5LA 4GRAA 1FUKA 1D9XA 1NI3A 4ZKEA 1W47A 2FF7A 1G6HA 5FPHA 3SJBA 5G53C 2FNAA 3CNNA 3PEVA 4DSTA 2I3BA 2HXSA 3TGPA 1XMJA 4ESVA 3E1SA 4HATA 2NO0A 3PFIA 1Q1QA 2WWGA 4AI6A 3SNHA 5CLQA 3AUYA 1YR7A 1P73A 2ZRIA 3SN6A 1FMJA 3ZVRA 2O0KA 2ZU0C 3U3KA 5EE3A 2QL6A 1GITA 4LCBA 1IJFA 4Q7KA 5CK4A 4LX0A 1R7RA 2C8VA 5GJVC 3HWSA 5K8UA 3P4YA 1DTSA 2AR7A 3GEEA 4FXPA 2CXXA 2GXQA 3FHTA 2HT1A 4LJ4A 3T1VA 2GJ8A 2ODBA 1YZKA 4L5BA 5IDVA 1FMLA 1QZXA 3BRWD 4GPTA 5SZIA 3O8BA 4E07A 4LK2A 4BGDA 4Q4JB 4RFSB 1X8JA 2ZYWX 5EZ6B 2JLQA 3CRW1 3TQFA 5KSPA 5KSYA 1R2QA 3IEUA 2GVDC 3ONWA 1JNYA 4TZ6A 2VP0A 2Q9BA 1EFTA 4G3XA 4MKIA 4MQBA 3OFND 5LD2B 1BMFD 2ZR0A 3ZZUA 2FOLA 3FDIA 4TL6A 2PZGA 4IVRA 4MH0R 3IPYA 4LJ7A 5ELXA 3VKGA 2QU8A 4TL7A 2QP9X 2QUZA 2VF7A 3T35A 4F93B 4HUQB 1CJKC 1Z0AA 2P2LA 3NC0C 3K1JA 1SVLA 4EJSC 4B75A 2QRZA 5K8LA 4Q47A 1UFQA 5HZKA 2O0JA 3AF1A 4B74A 1XJQA 1G6OA 3HR7A 3IO5A 1KOFA 4Q02A 3ZIAD 1B23P 2XTZA 1E0JA 2JA1A 2TMKA 2ATXA 4PAQA 1HH4A 3RWOA 2QPTA 3TAUA 2HCBA 4CT5A 2XTNA 3SHWA 2EVWX 1VCOA 4M9QA 4ACBA 4X8MA 2G77B 2ANCA 3MRSA 4C0AC 4R2IA 4V0MA 4IXMA 5CJ2A 3MUFA 3DKVA 4HYYA 1QVAA 4MRRA 1R0WA 3DOFA 2GEUA 2RB4A 4FD2A 4V02A 3MG9A 2FG5A 5KOYA 4KAXA 1JEDA 3Q5DA 5CB6A 1YRBA 4MGZR 2CL0X 2KBFA 3SQXA 3TH5A 3CR8A 2YC4C 1HUQA 3NHBA 1G8FA 2V1XA 2HF8A 4LHXA 2ZRHA 5CB8A 4AKIA 5JHGB 1GNQA 3EXAA 4ON9A 1KI4A 5KO2A 1E2IA 2Z6VA 3UATA 4WZAE 1J8YF 1YZQA 2ZPTX 3LFUA 4AG5A 4CDGA 3B78A 3KKNA 1E2QA 2IXGA 3K09C 4EPYA 3EAQA 2A2ZA 4CEIB 2YINC 1PJRA 4JMPA 5KU1A 3X1XA 3AKDA 1KNQA 5CK5A 1FX0B 3IILA 1M7HA 2G0NA 3BH6A 2ZXUA 3LO5A 1X3SA 2WIBA 4BLPA 3T1OA 3T61A 3QENA 3NEJA 3SYKA 2O8EB 4FIDA 2BWJA 1D2NA 1SKYB 1E2HA 4IDNA 4DSOA 5J4KA 3FMPB 3QXHA 2Z43A 1KK0A 1U8YA 3AP1A 3ZYCA 1EFUA 3LVQE 5EXTA 3O47A 1MO4A 2ZROA 1TF7A 4JKYA 1N25A 3NH9A 3RHFA 2D2FA 3BJIC 4FCVA 1MH1A 4PC1A 4X8HA 4OI0A 2XJ9A 4QBIA 5FTLA 1IN6A 4NYIR 2CK3A 1WQ1R 2WJJA 4OQMA 1HA3A 1CR2A 2J59A 2QMUA 5FTKA 2PMDA 3NG1A 4Q18A 4QBGB 5KNDA 3RRMA 1P9NA 2C98A 1OKKD 3VHXA 4A2WA 1XTKA 3EWSA 1OIWA 4FWIB 2FSFA 1J70A 3QUSA 1E2LA 2QGZA 2O8DA 1CP2A 2FEOA 3U6KA 4AK9A 5JS8A 1NLYA 3D31A 4FW9A 1XXHE 4QFMA 4GMXA 2YHSA 3AGPA 4BEJA 3A1VA 1E0SA 5P21A 3TQCA 2MSEB 2JLWA 2Z5FA 1N6HA 4UJ5A 1FL9A 1PUJA 1DPFA 1M34E 4LYHA 421PA 3SOPA 3P1JA 1XF9A 3I1FA 2OG2A 2FZLA 2OLKA 2QSZA 3Q5EA 2R6FA 1S9DA 1XEWY 1IN4A 1W0KA 2BDTA 2VO1A 4KYIB 3WYAA 2QTHA 1AGRA 1WBBA 2OBNA 5B57C 4KFRA 4URUR 1OH7A 2GJ9A 1UAAA 2ZJOA 2CVFA 3KX2A 2PLRA 4OQXA 1M2OB 2QQ0A 3EZFA 4NONA 3UMRA 3FGNA 3FMOB 3RRNA 4Q66C 3BWDD 3OEHD 5EXSA 4O3MA 2IS4A 1UDWA 2CCGA 3U61B 4M1SA 5C1BA 1JR3E 1K6MA 1AQUA 3OEEA 4PC6A 2FEMA 2MSDB 1XZQA 5J40A 2RAPA 5TXGA 5C46F 3VAAA 4OK6A 3QKSA 5DI9A 3QBVA 1DAKA 5EP3A 3EPLA 3THXA 1SXJC 1BKDR 4B76A 1P2TA 2HUPA 3JZAA 3OIWA 4V0LA 2LKDA 1N5KA 2IYLD 4BFYA 1JR3A 2GJSA 4BEBA 4DDTA 2ZITA 1KI3A 3FKSD 5H8WA 5L3QA 3W6PA 4YONB 1GKUB 1QHNA 2QT0A 4HLUC 5DI3A 3VR2A 1LFDB 2EQBA 4AWXA 3VFDA 4LJ6A 2ECKA 2NQ2C 4JLPA 5FUWA 4M1WA 3N2IA 2IYUA 5HE8A 4A8JC 3SHFA 2O8BA 1FUUA 1R6BX 2FPLA 1SGWA 3VX4A 4UQOA 3WY9A 4CVNA 2XITA 5C4GB 3HYRA 3H84A 4RZ2A 1E6CA 1GKIA 3A37A 2VH5R 3QXXA 4IDPA 1GVNB 1E2GA 1KKMA 2BEKA 2GZDA 3OF5A 4PXAA 2J87A 2W0MA 2ZI5A 4B2LA 5F9HA 3OE7A 4TQAA 4AYWA 4JL5A 4GOKA 1KJWA 3L2OB 5KPJA 4URXR 2X77A 2ZIAA 1E2PA 2DFTA 4HAWA 4E03A 2VP5A 2ZJZA 1JXOA 4NYJR 1W36B 4OI2A 1G1MA 1R8QA 2CJWA 1V43A 2HV8A 2A3RA 4CGZA 1G5RA 1CTQA 4DDWA 2GETA 3KQUA 3ASYA 4U7DA 3KKPA 3NDPA 3I32A 4JBWA 3BBPA 2YC2C 3BERA 3RNLA 1T3HA 2IYRA 3BGWA 1GL7A 1XD9A 4F91B 1XWIA 3R9XA 1AKYA 3VNUA 3EZ9A 2EFEB 3L0IB 1VG1A 4MUBA 1VCIA 5B64A 2ZRFA 2C99A 4URVR 4QNMA 2E9SA 1E3MA 4N0EA 4Q1BA 3QOFA 4BLQA 4EPTA 2JEOA 2HCJB 2ZM5A 3QEOA 4XOIA 2L0XA 4D80A 2WOJA 2F9LA 3CKLA 3CX8A 3D3QA 4P4SA 4GL2A 5LBIA 4D4LA 5KTYA 4JSYA 4RD0A 1K5DA 2PH1A 1HQYE 4BWYA 3AM1A 1T4GA 4JLJA 4US0R 4M1TA 2V55B 2JJ1A 3NBFA 2C96A 2FSGA 2IHYA 3RDPA 3NDBB 2D06A 2H18A 1VYVA 3GCGA 2FN4A 4I1UA 4LBWA 1ODFA 1G3MA 1W1WA 5F98A 3L0SA 1KYIA 1SHZA 3PUWA 1M6NA 2IS1A 1FNNA 3BC1A 4G5SA 1E1QD 5L3RA 3HR8A 4MA4A 1ZIPA 3G5UA 2FFAA 2Q9CA 2GCNA 2ZUDA 4TTRA 2ZRAA 2VSOA 2IF2A 4I1OA 2GWHA 2QAGC 2WM9B 821PA 1HQCA 1KGDA 3DOEA 5EXXA 4EKDA 4WBSA 5FOVA 3RC8A 2J7KA 1U2RA 4US2R 2O8DB 3DKPA 1ZM2A 1CJMA 3QF7A 2AKAB 2FGJA 2R6GA 2OSBA 1DADA 4BZPA 4BUJA 1P5ZB 1L8QA 4NKRA 4Q4HA 4TSFA 4L15A 1G5PA 2NZ8A 1UKYA 4PZLA 2OXCA 1OHHA 2DHRA 3RWMB 4EAQA 2KBEA 4ACAA 2GJAA 2F3TA 4ZCMA 5JCPA 2WJIA 2QN6A 1ZIOA 2BBTA 2Z4RA 3X1ZA 3E2IA 3B7GA 3GPLA 3TSOA 3ADDA 2NPIA 5EP2A 4D0NA 1OXVA 2BV3A 3I4LA 4FI3C 1B0UA 1YKSA 2A5FA 1NP6A 4M1MA 1KKLA 3IBYA 5CIQA 1T5IA 4G5OA 1CU1A 3TJZA 2V4ZA 4MKHA 4NPHA 4DLUA 1M1YE 3B1XA 1OF1A 3AF2A 1NVVR 2RGNA 3KDSE 4MDFA 3T06B 4BFVA 4KXFB 4IRUB 4S2EA 4DUGA 3CH5A 2OCBA 2ZRLA 3FMIA 3CZQA 1KSHA 1PUIA 1LNZA 4B3XA 1ESNA 2ZI3A 4QJ4A 1N6LA 3U3MA 2IEZA 2PJZA 2QRNA 3QKSB 4M9ZA 3THXB 3VTKA 2ZU6A 4KVGA 3RABA 2W83A 3LV8A 1E96A 3F8TA 1E9AA 4EFLA 1AS2A 1CRQA 3EZ7A 4HDQB 5TVKA 1EFRA 1N3BA 1DAGA 5L3QB 4JLDA 2FZ4A 2OAQ1 5DI3B 2GESA 1NIJA 4DHEA 4C0HA 4KBGA 3LY5A 3W5IA 3W90A 3BFXA 3NEYA 3CW2A 3KUDA 4NYIQ 4S35A 3KFXA 1II9A 2Z0MA 5AJWA 2WKRA 2O8BB 2CLSA 2VHUA 1OPXA 4GP6A 1RC8A 1HT2E 3WXMA 3LW7A 3ZQ6A 2WV9A 3FMFA 4DDUA 2BVNA 1QF9A 2CL7X 2Q6TA 4QHYA 1ZD8A 2HF9A 3ZH9B 4JVLA 3CRVA 4UKDA 5FH9A 4K81B 1ZM9A 1K5GA 4NZYA 5K8IA 3A1WA 3AVYA 5L8VA 4LUCA 2WSSD 3AP2A 1GRRA 1J7KA 1KO8A 3FFAA 4JVNA 4YDHB 5JMTA 3T1TA 4DLRA 4KLZA 4JZKA 5TB5A 1KHTA 4TZ0A 3OESA 5EE9A 2QE7D 2R2AA 4N0DA 2CJWB 2WPDA 3NH6A 4PC2A 4LHZA 2XJ4A 3OAAA 4MRSA 4MRVA 1AJEA 5JWOA 3ZVNA 1H8EA 2QM8A 3TR0A 3GLIE 3ND9A 3FB4A 3AKYA 2DFLA 3KTAA 3M4YA 1TQ6A 4U5XA 4HZIA 2DCUA 1VECA 2PBRA 1TU3A 4KFTA 3U3RA 2WICA 1E9BA 2OHFA 1ZM3A 2AX4A 4RD3A 1ZMXA 4DDVA 3GLIA 3FKQA 3AF4A 4P4SB 3PXGA 1G4UR 1S9HA 1MR3F 4F38A 5IF9A 2G1JA 1JQJC 1LF5A 4ASUD 3QNUA 4BFXA 3CIOA 1FPMA 2H16A 3QF4A 1GP2A 1Z0FA 2FV8A 4IHQA 4PSAA 1XEFA 4JSTA 4H9GA 3WHLA 2RGBA 3MD0A 1KK1A 2ZRDA 4A0GA 4B3CA 1ZUIA 4B6EA 5BQ5A 3I61A 3R7WA 3UKDA 2YWGA 3RS7A 1Z2CA 3SJZA 6Q21A 2PLFA 2MMGA 5JS7A 4OI4A 3CPHA 1Q1EA 1CR1A 4KYUA 1E1RD 1AZTA 2JATA 4YMSA 3KXKA 1GSIA 2OESA 5FUXA 2EW1A 1XJ0A 2I1VB 2WWXA 2H7VA 2YYZA 3VR4A 1XTSA 4ZO4A 2ZEJA 1SZPA 1AK2A 2ORIA 3UWOA 4U00A 5F2EA 2GCOA 2WWHA 5JCZA 4N1AA 1YR6A 1N2CE 3R8CA 1Q22A 1N5JA 4Q4HB 3ZS9A 2QPAA 1P61B 4IDOA 4PQFA 1SVWA 2QMEA 1JBKA 4DC9A 4DIDA 1KY3A 3NHAA 1W2GA 3AVPA 3LXXA 3MJHA 3K70B 3UG7A 5KDOA 4NCHA 4YXWA 3C16C 3GJXC 2OCPA 1G8HA 3A6PC 4AKEA 2WWFA 1XEXA 2FWRA 3QE0A 3FTQA 2FSIA 2CNWD 3ND8A 3B9PA 4UXIA 3VR6A 3AVOA 2VSFA 3LW8A 1X86B 3IHWA 1QVRA 2MSCB 4NE2A 5DGXA 1F2UA 5DN6A 1WXQA 4EIWA 1YR8A 3AQ4A 2JIZA 1ZINA 2F43A 1CR4A 3AVTA 1TF5A 1KY2A 1ZVQA 4TLAA 4TYPA 3WBJA 1EWQA 1DOAA 1ZP6A 1G9XA 2GAAA 4ZCLA 5DHAA 4BRUA 1HURA 1S3GA 3U4QA 5SZKB 1G7RA 1R10A 1M8PA 2YOFA 4B48A 3BFVA 4HLQB 1H8HA 2W6IA 4XWAA 3F3YA 4CZ2A 2OM2A 3F0TA 1G19A 2JDID 1G7TA 2YJTD 3U7EB 1OW3B 1R8SA 1VPLA 5AJVB 2IX3A 1ZU4A 2YWFA 2PCLA 2J45A 1T6NA 3AGQA 2JJ8A 4G0NA 3BH7A 4NYMQ 3DMDA 5FR1A 4IVQA 3ZD7A 3MFYA 1P75A 4KODA 1PLJA 4IOKA 4QNRA 2J0UA 4PAMA 4OQNA 2FPKA 1CS4C 2Q3FA 1G4AE 1NN0A 2AWOA 3HPQA 1W44A 2J7PA 3TLXA 5J47A 1S96A 2CHQA 1I2MA 1SXJD 3TR5A 5JWRA 2IXFA 2UVQA 4RZUA 3CNLA 3DM9B 3SFVA 3FYHA 3EC1A 1JB1A 4BLOA 1W48A 2ATVA 2J41A 3R20A 1COWD 1YZGA 4MRNA 4MYHA 3A1UA 1IY2A 3UWKA 2KWIA 3L8YA 4GT1A 1NN5A 5HKKA 1TQ4A 5FL3A 1ZM7A 2ZI7A 4ERNA 4B73A 3BAFA 2AFIE 1NBMD 1JECA 2RCNA 3RYTC 3GJ3A 5CLLA 3PCRB 1N0UA 3A4LA 3QIAA 3P4XA 3CX7A 3X2SA 2VA8A 3B60A 1S2MA 1D8TA 4M1KA 3TE6A 1JALA 1G8GA 1SVIA 4DB4A 3AKEA 1QG2A 4TTQA 4TN1A 2QTVB 4IW3B 2XNDD 2JCSA 1HV8A 2JJ2A 1XMSA 2GILA 5CIWA 1Q0UA 4LHVA 2FA9A 2XSZD 3IIKA 3LLUA 2RKOA 1G8YA 2P5SA 4WAUA 2CBZA 1I2DA 1Z63A 1E2DA 3LQQA 1KK2A 3KTAB 4URWR 1D5CA 1XCMA 1P62B 1GKYA 1CULC 5JEDA 1AGPA 1FTSA 1W0JA 4IEEA 1NVVQ 2OBMA 3F5FA 3CWZA 721PA 1GWNA 3QJYA 2JLXA 121PA 1Z8FA 3NWJA 3GLIB 3PUYA 4JIMA 2SHKA 4Q7JB 1QHIA 1Z47A 2WOOA 4KFUA 2AK3A 2A5GA 3PEWA 2RGAA 3ZQJA 1RVDA 3SYNA 4MYUA 3WNCA 3AVWA 1N6PA 5UKDA 3NKVA 3QF4B 1E0KA 4BFZA 4PTLA 4MGKR 2XOKA 5KYKA 1BH2A 1TUIA 3LBNA 4D26A 4KITB 2GK7A 3TUZC 1X8KA 5EUMA 1MRSA 1U8AA 2BJVA 1D2MA 1NN3A 1OFUX 4LYAA 3R7WB 1XPOA 4HB2A 4GOJA 2QORA 5KDDA 2IW3A 4V0ME 1AN0A 4A82A 2VP6A 2GNOA 1T8TA 2ZS8A 1KAOA 4PFSA 3CF0A 4PR0A 1GOTA 4Q4LA 3PITA 3RS4A 2V1UA 4EDHA 2ZRCA 1W5SA 4V0KA 3GLHE 2V6JA 4KSBA 4PO8A 3U5ZB 2X2FA 4I99A 4HLCA 3UMSA 2F1HA 2ZS7A 2GCOB 1RRPA 1AA9A 1TEXA 3KXIA 4TMVA 3ZZ0A 4LJ5A 1VDZA 2AHOA 2DR3A 1U0JA 2IL1A 1NVWQ 2H5EA 3GEIA 1U8ZA 3GLHA 4F92B 2GXAA 2Q3HA 4PSKA 4P0TA 5IK2A 3W6NA 1HTWA 3EZ6A 1YU9A 2CLCX 1XEXB 1E9DA 1NVXQ 3GJ6A 2XB4A 3GFPA 4Q1CA 2BKEA 1SVOA 2HJVA 4HZUA 3GQBA 4TMKA 4XH9B 3ADKA 3EA0A 1F2UB 3IKJA 2NO9A 3LDAA 3PG5A 5FPTA 3T15A 4TLEA 2VQSA 1E2MA 2F43B 5BYJA 1US8A 3DZDA 2WAYA 2GA8A 1SVMA 4DWJA 4A0HA 5AJZA 2ZE6A 3U4QB 1DARA 1E9SA 1BIFA 1A1VA 2XEXA 4Q9JA 5DLQC 2YWHA 3BD9A 2ZVPX 3PVSA 2Z83A 4JLVA 4US1R 3RSOA 3U2QA 4EQ6A 4PPGA 3B8HA 3T5DA 1HT1E 5E7JA 2P65A 3P20A 3OIVA 4IVPA 4L16A 4E22A 1Q57A 1XB2A 4ZIRA 3BIFA 2MMCA 2O0HA 5FOXA 2ORWA 5HCIA 4JLKA 1CXZA 5E7MA 2GJKA 4TWZA 4XWKA 4Y0AA 1SULA 2ZANA 4QBFA 3LNCA 4Q48A 4C0JA 1CJUC 2P0EA 5SZJA 2J0UB 3ZLJA 3QY0A 1L7VC 2NTYC 2OT3B 2VHCA 4B2PA 5LD2C 4AKGA 4K46A 1Q1BA 5J4HA 2G1KA 1G3QA 3U7FB 2ZJ8A 5FR2A 4IJMA 1OKKA 1ZRHA 5AJYA 1XJCA 1VYTA 1N6RA 4ILEA 4Q5IA 3SQWA 2V6IA 5AK0A 3I62A 1KI1A 1DG3A 1SVSA 1VKJA 1YRAA 1Q20A 3WP1B 4OQFA 2OAP1 4OK5A 4CF7A 3ADBA 3R9WA 2X19A 4JBXA 1U9IC 1XTJA 1Z0KA 2CLDX 2VRWA 4QGFA 3J81k 1VYUA 3THWA 2ODWA 2RGXA 4Q1EA 1GL6A 3TK1A 2C5LA 3ICEA 3I72A 4PC7A 4P4UA 3V4RA 5GADl 3I8SA 1PLKA 2H1LA 2YZ2A 3QEJA 2QA5A 3I5YA 5TARA 4Q21A 3VR1A 3A4MA 3BE4A 3CR7A 4Q1AA 4BLSA 3R8FA 2CHGA 1F60A 3FFBA 5J4LA 4IEIA 4PZYA 3ZJYA 1G20E 4DCSA 3IUYA 4BECA 5KSOA 3N2EA 4LV8B 2EFHB 2PT7A 2HXYA 1EXMA 4C2TA 4QHTA 1FOEB 5LB4A 1DG1G 4KO8A 2WAXA 4LPSA 4ZKDA 1XD8A 2N42A 2BBSA 1NMXA 4B3BA 3IGFA 2YOGA 1DBSA 3Q3JB 2CMKA 2F7SA 4LV6A 4JBYA 4R2HA 1W4AA 1WA5A 2A5DA 3IBGA 3KZ1E 4O2LA 4XTCS 3CB4A 1OXTA 2H57A 1KO1A 2ZRJA 3LX8A 4LY6A 2GKSA 3DVLA 3FKSA 4LJ9A 3U3JA 3VR3A 2J0VA 4D82A 2OFOA 3IIMA 1ZC3A 4BLRA 4IFEA 5DH9A 4Q9HA 4DSNA 3C5HA 4GSYA 3K0CA 4M9XA 4LHYA 1ZD1A 2RGEA 1G64A 2ZE5A 3VHLB 3KB1A 5FBWB 4LI0A 4R98A 4A2PA 1E2EA 3GJ0A 3V4FA 5GVRA 1KDOA 2BEJA 1E0AA 1ZU5A 2ZSDA 3A8TA 4I1SA 5H1YA 2BM1A 2HDNB 2IC5A 2ZYTX 4A4DA 4F4IA 5CYOA 1J2JA 1WBDA 1VIAA 2J3EA 4NP6A 1P2SA 4G01B 3OEED 5IHPA 3EPKA 4PO1A 1RKBA 2PZFA 2ZRBA 1RFLA 1YZTA 4HAVA 1KSGA 3SYLA 4C9BA 3MJRA 4IOLA 1AS3A 4G5GA 2DWQA 3GLHB 2QG6A 4PPQA 5HE9A 3CLVA 1L4UA 1P6XA 1G291 2BMFA 1JI0A 4FCWA 3UG6A 3B2EA 1JR3D 1P3JA 5AJXA 4DCUA 1GILA 4KHZA 4A6PA 4DIEA 3NTUA 4JLMA 2GXUA 5HZHA 2A5JA 4XD7D 2VL7A 2J0QA 4HZUB 4HAXA 3PUZA 4EPXA 4URYR 3IPXA 4GFDA 4YMUA 5FI1B 3SZRA 4G1UC 2OBLA 1US8B 2N1BA 2ZJBA 1UF9A 4P31A 5A5GA 2QQEA 4GP7A 2GZHA 4M4SA 2OXRA 3SEAA 5CM9C 1LS6A 3QVVA 3EIHA 3OE7D 2BJWA 4EQ6B 3KXLA 4CRWB 4JYCA 4RCYA 2BBOA 4BFUA 2V7QA 1RPZA 2C2HA 3L82B 4ZIRB 3PUVA 3ZVLA 4A9AA 3DL0A 1II8A 5CDFE 1MT0A 4A36A 2VTKA 1E1QA 1W5TA 3CO5A 4Q00A 2DY1A 4DLXA 3WMGA 4QBHA 3JVUA 3RRYA 3U7GA 4DVGA 2E1RA 1UKEA 5JLJA 3Q72A 4B34A 4TL9A 1QHXA 4F7WA 2G9NA 3BOSA 1N6IA 3EARA 4IFBA 5CDFA 4C0LA 4HI0E 4PHTA 5FL7A 5FOTA 2D62A 1NVUQ 1Y63A 3EA5A 1ZNYA 3RLFA 4HAZA 2FJUA 4DCTA 5KNBA 2PJRA 1FP7A 3KL4A 4AC9A 1EGAA 1P4SA 1U90A 2ZUCA 1VHLA 2D7DA 1YR9A 3THWB 2ODNA 2OLJA 2JLUA 1ZNXA 2F6RA 3IDQA 3THYA 4D0LB 1MABA 3VKWA 2JJ1D 4RD4A 4KU4A 1GL9B 3BFKA 3SE0A 2YKGA 4LC1A 1ZD9A 4EPWA 2ZSBA 1SQ5A 2BMDA 2W2XA 4OJKA 2PT5A 2RMKA 4ITRC 4OL0A 4D81A 1VG9B 2R9VA 1NG1A 1NL3A 3W3ZB 3ZGXA 4NTZA 1KZ7B 5E4FA 4JL8A 4GOXA 4HEJA 3P32A 1EX6A 3IQXA 1RRGA 2NMVA 4M53A 4HUTA 5GJCA 5JBQA 4Q7MB 2D2EA 5FOWA 2ZR7A 3QXCA 1OB2A 2GEDA 2RHMA 3DPUA 4A0RA 2P5TB 2V9PA 4M1OA 5J4YA 4L4UA 221PA 2NOAA 4B3FX 1W36C 1FP6A 3K0EA 4IKEA 1Z22A 1UBEA 1FQJA 4QJ5A 1F2TA 4EFNA 5FBQB 4ABYA 4UJ3A 4X8OA 4EUNA 1U0HC 1IJEA 1OE0A 2GZAA 4DLVA 3D6TB 3SJCA 4TSFD 5JFGA 1KNXA 2A30A 3E70C 5JSZA 1I4DD 3X1DA 2Z4SA 1Z0IA 1OHHD 3AV0B 1PLLA 4GI7A 4PAOA 2IS6A 5EQTA 4EPRA 2H92A 1G21E 4ARZA 4RSGA 5DSZA 2ANBA 2PEZA 2ZVQX 5H70A 4ZI3A 4D4KA 1SHKA 2WIAA 5EJEA 2K5UA 4ZPXA 2JGNA 5J5CA 2WWYA 1XCGB 1A7JA 2QROA 4HB0A 4EJSA 2WWWA 2R6DA 5KSZA 3CUEF 3KKMA 2VP2A 4W9MC 3CPJB 5HCNA 2ZTSA 2ZI9A 4BPBA 1KAGA 2WVJA 5FFMA 2RGGA 1Z2AA 4C30A 1N0VC 4GZMA 1Q1ZA 3KJGA 2WJYA 3SC3A 3WYGA 2WSSA 3ADCA 4DUGD 1UBGA 3DZ8A 1JPJA 1Z6YA 2PX0A 1Z08A 2FGKA 4YC7A 5FBVB 1QHSA 2DPXA 4KCGA 1Q3TA 3QQ5A 4KV9A 4XJXA 4M21A 4DBLC 5M04A 3VKHA 2FDCA 1ZC4A 2QE7A 2ASEA 4Z1MD 4M2LA 1T3LA 2ODEA 4LYFA 4HSEA 3LBHA 1Z6GA 1OYYA 4DJTA 2D74A 5D3MA 3SFZA 3DO6A 1NF3A 3CF6R 3LH5A 3N70A 1KDTA 1M7BA 3B1VA 3CM0A 3A1TA 3VU9A 5JZVA 4B35A 3RVBA 1C9KA 2ZSAA 3UANA 5FTMA 1G3UA 1V5WA 4JLBA 1Z3IX 5DIFA 5JJKA 4HAUA 2IK8A 1KI8A 1E32A 1KZGB 5GJWC 2G3YA 4I4LA 1VCMA 2QSYA 4D6PA 1EG7A 1OIXA 2B8WA 3PEUA 1OFTA 2FE4A 5E95A 4BFSA 1MO5A 1YZNA 5GVSA 2FPMA 4DXAA 4DLWA 3SI7A 3ZZTA 1Z6AA 1VTKA 1EX7A 2VHJA 1NKSA 5FOUA 1G7CA 2BIFA 2ZJ2A 4RD2A 5TV2A 3K09A 4TQ9A 3ZD6A 1E2JA 2IYXA 5CJPA 4R71A 2XZOA 1GIAA 3TSZA 1NRJB 1G8PA 2LWIA 2ZRPA 4M9SA 1CJVC 1II8B 3KJEA 5B30A 4MYCA 2OO7A 2W58A 2QZ4A 3MCAA 3B9QA 3OAAD 1OB5A 3ZVMA 1JR6A 1QHHA 2QP3A 5FTJA 4LV5B 4IOMA 4R9UC 4WIAA 2ONKA 5JECA 5DYIA 2WMNB 2OUKA 3CRRA 4LSGA 2FU5C 3RAPR 4DEYA 2W6JA 2G88A 2UKDA 3IIJA 2AWNA 4QHSA 5LDDC 1GZSA 4UNSA 1S0UA 3ETLA 3L8ZA 3PR1A 2NZJA 1XCPA 3QKUA 1TAGA 3IHLA 2REXB 2RH5A 2VEDA 1T9HA 1KMHA 1Z83A 3I8XA 1QBKC 4QJ3A 1XPRA 1XEWX 2W2VA 1XTQA 3THYB 4DLSA 3TRFA 1MABB 1HE8B 1Z06A 2NO7A 5FBRB 2IUSA 1ZNWA 4MITA 3TNFA 1BYUA 1E79A 4JLNA 2QM7A 2QBYA 1A4RA 2QMHA 4R7ZA 1D2EA 4XSHA 3TVDA 4TMXA 2ERXA 3X1YA 2OFWA 2ZAMA 4NYJQ 4BE7B 2D3WA 1LV7A 1JJVA 1G5TA 4OK3A 4B2IA 3KQHA 2OCAA 1S1CA 3OZXA 1N6KA 4LBZA 2P6NA 2ZRNA 3BB4A 3I5XA 5CYPA 2FX3A 1SVKA 4UXHA 4Q9LA 4B47A 2Q9AA 5EE0A 2A9KA 1ZUHA 4AY2A 3SU8A 4MRPA 3KJIA 4HAYA 1YHNA 2HLDA 2YWEA 3UPUA 2B7CA 2OE2A 2PZEA 4Q9IA 2C04A 3PIRA 4D4MA 5DYGA 2PX3A 2ZR9A 1A2KC 5EP4A 5B2ZA 4AG6A 2BKUA 2JDIA 1DAFA 5H68A 3V9PA 5JRZA 1F2TB 1MRNA 2CEAA 5FI0B 4TTPA 1QHGA 1XRJA 4GZLA 3PUXA 4J0QA 2JASA 4KVAA 4QC2A 2AN9A 4TQUS 2FFQA 4Z8YA 3EC2A 1XBTA 1ZNZA 5JSZB 4WXPA 1UADA 1YQTA 2CHVA 2IA5A 3K9NA 5BN3A 1JAIA 4XIGS 4TT3D 1LVGA 1DAHA 2REBA 3QXJA 1WCV1 4I81A 4ARZB 5EP1A 1SXJA 3O8DA 3ECCA 3REFA 5A0FA 1Z5ZA 2B8TA 4KBFA 2R6AA 3M6AA 3P26A 1NJGA 4RKEA 4EJSB 1COWA 3Q8XB 2YOHA 3BH0A 5DN6D 2DYKA 1Z6TA 5L3SA 3WRXC 1TX4B 1KO5A 2JIZD 3U7HB 4FWTA 4HDOB 3PEYA 1X6VA 3A4NA 4HLUA 1PZNA 1TNDA 3LA6A 1C1YA 3WMEA 1G18A 1F48A 1H8HD 2NIPA 4A8JA 2W6ID 4IDHA 4LJYA 2OCYC 2ZSFA 4M22A 4RCZA 3DMNA 2FFHA 4Q1DA 2IHBA 3W3AA 1DEKA 1GFIA 4XSGA 1L4YA 1RJ9A 2PMKA 2C9YA 1VIYA 2XNDA 1W2HA 2VP9A 1OH8A 3B1YA 5D3MB 1JXMA 2FFBA 1JAHA 2XSZA 3VU9B 2DWPA 5FPSA 1X8LA 1FQKA 3EPJA 3KQNA 5F3WB 1OFIA 2J7PD 1N0WA 4ZDWA 2V8OA 3SBEA 3DHWC 2EFGA 2XAUA 1XU4A 3EWAA 2QPOA 1N6NA 3WMFA 3K8YA 2ZUBA 1HE1C 3QPVA 1DAMA 3IO3A 1YJ5A 3W34A 3KB2A 3OFNA 5HR5A 1BMFA 1NMYA 2VBCA 2R65A 3I3SR 2J5XA 4LWZA 4QXAA 2ZJ5A 2WKQA 5HKKD 3GLGE 2GCPA 2IT1A 3VMFA 4PZZA 3K70C 3X1WA 1OXUA 5G41A 3GLFE 4DSUA 1SKQA 1AQYA 4TLBA 2BBWA 5FBLB 5JJLA 2GEVA 3AEZA 3AVXA 3TIFA 1LW7A 4KSCA 1GG2A 4E5UA 1IXRC 3MMPA 4ZDKA 1TL7C 4JJKA 2XXAA 3GLGA 5JWHA 4QRHA 4ZI2A 5JEEA 5SZHB 1XTRA 3RSLA 3THOA 4TYQA 2IWRA 4Q4AA 1IM2A 3GLFA 2D7CA 1TQ2A 3ZIAA 2JJ2D 3B1WA 1P2VA 1QHHB 1T8UA 4U02A 3VR5A 4B3GA 1IN7A 4URZR 2RGNC 3FHOA 3NBXX 1RYHA 1QRAA 4TLCA 1T91A 3HU1A 3I92A 4GNKA 4YMTA 4CT4B 1F5NA 1X1RA 1P72A 1T0HB 1OJLA 3MWLA 4DEXA 2F1RA 1NIPA 3GEHA 3RS3A 1Q21A 1W0JD 4A0FA 4TMTA 1NY5A 4M1YA 1D9ZA 3LD9A 5AWFC 3RANA 4YMVA 5AUQA 1YVDA 4LZZA 2WKPA 3RRZA 4DCNA 1KMHB 4PHFA 3QPWA 1A82A 4JJZA 2GBLC 3ZDQA 2R6CA 4QM7A 4XVUA 4KFSA 3U44A 3WBKA 4LJ8A 2QAGA 2OZEA 2ZS9A 2QENA 4OYHA 1ESMA 4PO9A 4JS0A 2QBYB 3EASA 4FINA 3RS5A 3E5HA 2XOKD 3TW8B 1IOZA 2QEQA 4Q1FA 3RS0A 2NO1A 1LTQA 2VPPA 1ELOA 1C4OA 4P3YA 2BCGY 3W9YA 2C77A 4DT1A 1W7AA 4D0GA 4ZV4A 4K8OA 4AIIA 2N46A 1Q12A 2OEPA 4TMZA 2I1QA 4A1FA 5F9FA 4BZXA 2O8FA 1JJ7A 3B6EA 1E69A 4O0MA 1L2TA 4WA7A 3TUIC 4AYXA 1IBRA 1KK3A 1KJZA 1P9WA 1KTVA 2JAQA 2VSXA 3HU3A 4H1UA 1F3OA 4FMCF 5KDLA 3DDCA 3T5GA 3EX7C 4P33A 1TTTA 1GNPA 2ZREA 4O2RA 1TMKA 3C41J 2ZE8A 1OIVA 4PX9A 4L9WA 2REOA 4PQYA 1E4VA 4PPNA 3CH4B 1HYQA 1LS1A 5BXQC 1RRCA 4P32A 2ERYA 4JVSB 2C9OA 4XWOA 5IK2D 1U81A 2WHXA 3T12A 2J0SA 5DNYB 1WP9A 4CEHA 4LHWA 1NY6A 2IYYA 3PV0A 3GJ4A 2AL7A 1W36D 4HLDA 1U94A 3AH8A 1EFHA 1SXJB 1J99A 2VYFA 2Y8EA 2ZJAA 3CPEA 3H0KA 3BB3A 1EFCA 2IS2A 2R44A 1W46A 2W0SA 3DEFA 3MWYW 2C9CA 4MKFA 4H1VA 2P3SA 4DZZA 5L3SB 1A5TA 3QKRA 1ZBDA 1M74A 4QOSA 3UXMA 2AD1A 2KSQA 4O25A 2ZAOA 3GMTA 2GK6A 4TL8A 3R9IA 3LBIA 3B82A 1DO0A 3EIQA 3OIYA 4G5RA 8OHMA 1Z0JA 2IF0A 3EW9A 1XD2A 2VP4A 2QTFA 4A8JB 4MKGA 4RD6A 4BASA 2GDJA 1CLUA 4W5HA 5G3ZA 1NG9A 1E9EA 1OLOA 1Q3HA 4XVQA 4FMCB 1GUAA 3W6OA 1FNMA 1AS0A 3CWQA 1E4YA 3GP8A 1RJ9B 3VX3A 3ICQB 1R5NA 4N3NA 4QM6A 2P6UA 3GJ5A 1ZJ6A 1KI6A 2C95A 2XTMA 4Q19A 1NSFA 2GHIA 3GD7A 4RFVA 3BXZA 3O8CA 1LY1A 1JPNA 3A1SA 5EZ5A 4CIDA 2IYQA 4DLYA 3FHCB 3LVRE 1R0YA 3WHKA 1XDBA 2CK3D 5KPDA 2WMOB 4B71A 3OEHA 4C2UA 2D4HA 2BMJA 1KO4A 1VMAA 4RKFA 4B32A 4LPKA 1CBUA 4C7OA 1TEVA 1E2FA 3CBQA 4M8NE 1JEEA 1ZCAA 2ZETA 4WOPA 4GBMA 1U99A 5E3HA 1G3RA 4NH0A 1W49A 3W8NA 3L0OA 2GF9A 4M0LA 4PHGA 3O8RA 4LJAA 3K9LA 4JYBA 4Q01A 2OILA 5C2JB 2XXAB 1XXHA 2CCJA 4UNPA 3TW4A 3GLGB 2YV5A 3Q7PA 4Q4AB 2DFNA 2GXSA 2VF8A 4WZBE 3GLFB 1D6JA 1W4CA 4NCKA 4RD1A 4D4JA 3LWNA 3Q9LA 3OIUA 4HB3A 4OBEA 2ZI6A 1W0KD 2O8CA 4NCIA 1O87A 3Q7QA 2XZLA 3WYFA 4IOJA 4JLAA 1G3IA 3AUXA 2P67A 4IXNA 3HJNA 3T34A 4OHXA 2OFXA 3HYTA 1ZCBA 1VCNA 1YZLA 1G41A 2J9RA 1XNJA 2AD5A 1NMZA 3A36A 4B44A 5C4MA 5TMPA 3U44B 2ZYUX 5K8TA 2QAGB 4GMDA 1UJ2A 2B6HA 1AKEA 1KDRA 2AXPA 2X8AA 1ETUA 1WMSA 1IAQA 2R62A 1TPZA 1X1SA 3AF0A 3KQKA 1KI2A 2BHRA 2AKYA 4XD7A 1GDDA 2NPFA 1R0ZA 2CE2X 2QY9A 5DHFA 5EXPA 3K53A 2IUUA 3TBKA 3NVAA 4I1VA 2AXNA 2DWOA 4RVCA 2LCFA 4DT1B 2WSMA 4POAA 1OV4A 4LC0A 2CL6X 3D7MA 4LGMA 4JLOA 4V03A 1S8FA 1NLZA 1ZUNB 4JT4A 2J46A 1ANKA 3QBTA 2A5YB 3QG1A 4II7A 3NBZC 3MLEA 2O8FB 4UNNA 4D25A 3LRPA 3SS8A 4V0NA 2IYVA 4WVFA 2JLSA 2ZRKA 1ZAKA 2ZRMA 1RZ3A 3BORA 4LOAA 1EESA 4Q9KA 1EK0A 4LDJA 4C0KA 3EPHA 1XX6A 4NL4H 5FPKA 3W5JA 4OHVA 5KHOC 2DBYA 2VHQA 1J8MF 5L3VA 3KUCA 2OV2A 4LRWA 1MOZA 1YE8A 2WZQA 1AZSC 2A78A 4XTRA 1OH6A 5KNCA 4OKSA 4CEHB 3SJAA 2JLVA 4OI1A 3NXSA 1NKTA 2BOVA 1PV4A 2DB3A 3H1TA 5ANRB 3TSWA 3CONA 3QPUA 3CF2A 2JLRA 4CYMA 3N5CA 4CW7A 3K0AA 2H17A 1R0XA 3GFTA 5TY0A 4AKHA 1IHUA 1XTIA 3C4JA 5AR1A 1S4QA 2BC9A 4C4PA 1BS1A 3L43A 3QKRB 3K9HA 3CRMA 1N5IA 5EUQB 4D2IA 3SDZA 3LQRA 1NNEA 2PEYA 4Z8XA 1S3SA 4A2QA 4TYNA 2XX3A 1J90A 3I73A 2QNRA 1XD2B 3FWYA 1FZQA 4CEJA 1VHTA 3AB3A 4DRZA 1CJTC 5FOSA 4NYMR 4WXRA 2V7QD 1Y3AA 3KFVA 4UNRA 3U60B 3LXRA 4Y0VA 4NU0A 2IXEA 1AIPA 3HP1A 4GDFA 2IYWA 4ESHA 2HT6A 4DCVA 4NCJA 2NGRA 4WW0A 4FMDF 5LB2A 4MGYR 4B43A 5BN5A 2P6RA 3B13B 3H86A 1N6OA 1G16A 1KI6B 3B5JA 1CEEA 1G17A 5EE1A 2ONJA 1T3SA 3D8BA 3CNOA 3C14C 5JHHB 1OYWA 3G82C 2EWVA 4ZDIA 1CKEA 2KB0A 4W5WA 2IEYA 3FPAA 5FL7D 3W8RA 2Q0HA 1R5BA 2GF0A 1S1MA 4EFMA 2AFHE 2IUTA 1TU4A 1U98A 1KI9A 3UK6A 4YQFA 4C7OB 3G0HA 3K0SA 2QI9C 1KSJA 3S1AA 4XVRA 2I4IA 4C0SA 5G40A 4OQLA 3PJRA 3KKOA 4Z51A 3AF3A 1AM4D 3HDTA 2IBMA 1H65A 5D3QA 2C03A 3MWJA 2G0TA 2ZSEA 3U3OA 4QL3A 2RGDA 5AUOB 1E9RA 1CIPA 4LBYA 2YNMA 1XXHB 1IY1A 3FE2A 1TQDA 4Z54A 1CF4A 1U0LA 2QT1A 4NMMA 3JVVA 1XPUA 1OXSC 3TKLA 4PPFA 1IQPA 4FCTA 3K70D 3RC3A 4FMDB 3BS4A 1FW6A 1DE0A 1WB9A 2RGCA 4DLTA 1QG4A 3ASZA 1Z28A 4KJZA 2O5VA 5A4JA 2UZIR 1G7SA 1O3YA 1T5LA 1UEIA 2O8CB 2WWIA 2C78A 3WP0A 4F4CA 4C0BA 2WTUA 1LB1B 1KO7A 4IDQA 1XFAA 5JI2E 2ZRGA 2ZQ5A 2NO6A 3UIEA 1W4RA 4ZCIA 3K0FA 1A2BA 4P4TA 5J4VA 1UDXA 4Z1MA 4Q03A 1BOFA 4TYWA 1TADA 4BFTA 3IEVA 4TYYA 521PA 2GBLA 5CM8B 2XNSA 3H2YA 4OHWA 4BQSA 2HJGA 1ZM4A 2GTPA 1CR0A 1M7GA 2EWWA 2FMXA 3C5CA 4PC3A 1IXZA 2HEIA 4NBSA 4JVMA 4L8GA 5FTNA 1MV5A 3IQWA 2HYIC 3U6BA 1MKYA 5B58C 1EFRD 2ZI4A 4JKIA 2G83A 5LPNA 3QSYA 4KI0A 2EFDB 2GAOA 1KIMA 4AYTA 2ORVA 3GJ7A 1UKZA 1R4AA 4QG7A 1Z6XA 3QVUA 3ZS8A 2BM0A 5DE3A 621PA 2Q3MA 3JZMA 3Q85A 1FFHA 3NC1C 3MAAC 1LF0A 2Q21A 4NHOA 2J1LA 1OSNA 4WZ6A 1ONBA 2IYZA 5BW8A 2V3CC 3LX5A 3CZPA 4OHYA 1ZW6A 1BYIA 3A58B 4OJQA 4B6FA 1HY3A 4B33A 2JLZA 1GNRA 3LLMA 3SBDA 4W7SA 1VG0B 3FOZA 2YVUA 4ASUA 2IWHA 1E2KA 5AUNB 3AP3A 1WDTA 2G6BA 3KJHA 4TMWA 2F55A 3CRQA 3UMFA 3FVQA 4BZQA 2EYUA 3BB1A 1GAJA 5E7IA 2CVHA 2PL3A 5TDHA 4B3DA 3B85A 2WPDD 4ZDJA 1KI7A 5JI3E 4DLZA 4DB2A 4Q4JA 4RFSA 5BWMA 3NIBA 4RY2A 1UBCA 4PANA 4QGHA 3MSXA 4JT2A 4BLTA 3K0AB 1FTNA 4C0QC 1H8ED 2DFKB 1XMVA 2ZJYA 3DM5A 4RJLA 2EU8A 2V54A 1TF2A 4G5QA 2F9MA 3TVTA 4MDEA 2F1IA 2CDNA 1E94E 1JQLB 1E1RA 3GFOA 4W5JA 2IYSA 2XGJA 3KQLA 1Z07A 2B7BA 1I4LD 3MGCA 4MYTA 5G3YA 1DELA 3C7KA 3REGA 1XMIA 1NJFA 1W4BA 3K0CC 3TAHA 1OXXK 4CEJB 5BN4A 2GVZC 1OH5A 3EG5A 3NBYC 4HUQA 3EIEA 3B1ZA 3QG5A 3VNVA 2QGNA 3GJ8A 3TMKA 1XP8A 1U9IA 4KLNA 1TUEA 2W2TA 2BCJQ 1EWRA 4A92A 4QGGA 2WJGA 5GJBA 1F6BA 2KJQA 2WJHA 1PVOA 3T1QA 4FMBB 2VHTA 4NCNA 5IRCD 2CNWA 1E9CA 1XZPA 4LBVA 5FUVA 5HPYB 1VG8A 2IYTA 4YLGA 4F4JA 1IN5A 1UPTA 2QAJA 2W6JD 2VLIA 5HTKA 1ZYUA 2H8KA 1E9FA 3WNDA 5BYKA 2EFCB 1IY0A 1DAEA 1E2NA 1K8RA 1NSTA 1WRBA 2KE5A 1GRNA 3M1IA 4HB4A 4PSVA 3WNBA 2BMEA 5KUTA 1OFHA 4BRWA 4HDCA 1HEIA 2JLYA 1RE0A 3RS2A 4A15A 3HU2A 3AVQA 5EE5B 3S1AB 3AVVA
chains in the Genus database with same CATH superfamily
2EFYA 2FW0A 2FSHA 3AVUA 1M8KA 4IBOA 3WLPA 4AUEA 1H3FA 2FEAA 4E5NA 2NN3C 4R8MA 2O06A 3PFKA 2C59A 3DNMA 2EHJA 2A7QA 3SOZA 1T3ZA 3SXPA 4A6XA 5DLPA 4AY3A 2FQXA 1NQUA 3L0CA 4O4LF 4ER3A 2FH5B 3CX6A 1XA3A 1GO2A 2F1JA 4FN5A 4OXQA 2QL5A 4V0OA 4Z4GA 1NMQA 3NNSA 2JRCA 3ZZMA 5I8PA 3FZQA 3PENA 2B92A 3AKCA 2QQGA 3RFXA 1U6IA 1BO6A 1GRQA 1OZHA 1PWZA 2ACEA 2KI5A 3PQCA 4YGXB 1IXSB 2DUNA 2EBUA 3VZPA 4DTIA 1P9RA 2B21A 4QDKA 4N65A 5DGTA 2RDMA 4X8LA 4ZAVA 5FPYA 5IAKA 1NFQA 3P27A 3PQ8A 4QASA 1KBZA 1E99A 4WY2A 3R7BA 4EP1A 9GPBA 1HOXA 1XDDA 2HYDA 2VIIA 4L07A 1WQ3A 3QKTA 1GQ2A 1J0AA 1WUKS 3MNFA 3PE6A 5C18A 1JHUA 2DHEA 4FOSA 4OUKX 5DISB 1U8TA 5AVJA 1MG5A 2X9GA 3CEMA 8ABPA 4CEIA 1IN8A 1OT3A 2FW7A 3QI2A 4KQKA 1P2UA 1EX9A 4L4XA 4OXNA 4W9NC 2XMSA 3E7DA 2ISQA 4BNKA 4C6RA 4AY4A 1CRPA 1I4TD 2NV0A 4BZZA 4YX9A 1KDPA 3M0EA 2CE7A 4FGUA 1Y3HA 3REOA 5IEBA 3BJRA 3PFGA 1PYOA 1CQJB 3HEMA 1KJYA 5AO9A 5HF5A 1XMOB 2H4FA 4AD8A 3V00A 2RI6A 3P0EA 5DWVA 1K89A 1QBGA 1Z29A 4JH0A 3B48A 4DTCA 1GR1A 4K86A 4KGDA 5JRJA 2E4VA 3ZY4A 1OU4A 4UXJA 5CITA 1KQ3A 3AUUA 3L0PA 1F0YA 4R16A 3HXLA 4E7PA 2XGOA 4XIFA 2C2KA 2CHEA 2L17A 1CY1A 3EDRA 3H4MA 3NGLA 5HEKA 1XRQA 4LVCA 3RPEA 1ZD5A 3L1HA 1TM7E 1WUIS 3EFHA 4QYIA 5K0JA 3NYQA 3LAWA 1B8VA 4DIMA 4LOHA 4JL6A 1E1CA 5ALLA 1N5LA 1VSVA 2XA9A 1Z33A 1D9XA 2Q7OE 3W9UA 2HK9A 4E46A 2VZLA 1KOGA 2DG2A 4KMSA 3QFFA 3VTAA 1W47A 2FF7A 3WE7A 3QITA 3EMBA 4MS1A 2FNAA 1AQJA 3PEVA 1SCBA 3CA8A 3DOIA 3GGOA 2QRMA 4HATA 2NO0A 3PFIA 4AI6A 1FUYB 2D6FA 1HYBA 2VLBA 5AKHA 4BX2A 3DLHA 2FLKA 4RORA 4RNDB 4WUVA 4HWGA 3T4PA 3GLFB 3SN6A 1FMJA 1ZR4A 4FFRA 4I9UA 3TSAA 3U3KA 4KX5A 4AG3A 1IJFA 4CETA 3U4MA 1V8DA 4MV3A 4MVJF 2R1UA 3DR5A 4U2CA 4CTOA 2UUPA 4RVNA 4O4HA 3P4YA 2ZYSA 1DTSA 2AR7A 1KU6A 3W4KA 1GYRA 5LN1A 3ZDAA 2CXXA 1VGQA 5DNDA 5CA0B 2HT1A 3T1VA 1T8PA 1YZKA 4L5BA 5H7XA 1FMLA 5JCXA 5SZIA 3O8BA 1KYXA 4LK2A 4JROA 4YRRA 3OLYA 2JGDB 4OA5A 4B0OA 1X8JA 4O5OA 3R5KA 3TKAA 1Q1GA 1KIAA 1KGSA 2JLQA 1L7DA 3BXXA 3L3BA 4DLLA 1X1BA 1NBHA 2NVOA 3N5KA 3UK2A 4EK9A 5KSYA 4PY2A 4ZC8A 4OFBA 2B94A 4C6SA 1WB5A 1IWPB 5H0IA 4G0VA 3RJMA 3O8QB 4YAUA 2XQKA 3RVJA 2LUOA 4G3XA 1UJ5A 3CZRA 1BMFD 2NNLD 4PF1A 4IQGA 2FOLA 4AUKA 2Y27A 2QSUA 3QFRA 3LCMA 5CBPA 3LBFA 2ZIXB 1CUIA 4N4AA 4MH0R 1EM8B 1JAXA 4G0QA 2PIDA 1DOHA 4JP3A 3X3HA 2PUAA 3W5BA 4F45A 3VKGA 5I7WA 3H2IA 4NULA 2NMVA 4TL7A 4IDCA 1YHYA 3HZRA 1J0EA 2OZKA 2R5WA 4HUQB 2P2LA 4F93B 1JFFA 1CRZA 5EZYA 4MV7A 3D8TA 4EJSC 4J3NA 2QRZA 3IV7A 4J16C 1TD9A 2P9EA 5TEWA 1ZN9A 1XVTA 2JGMA 3PE4A 4E3WA 1XJQA 1G6OA 2Q6VA 2P9HA 2F48A 3IO5A 4JK3A 5FLYA 2SICE 3ZIAD 1DXYA 1INLA 3V5NA 4MQFB 4TS1A 4EUSA 2O3JA 3ZR4B 3RSCA 4LZWA 4AQ7A 2HCBA 1MF7A 3THRA 1OFVA 1C7EA 1LDYA 1THTA 3QX9A 2EVWX 5KQPA 3V4ZA 4DJJA 3U4IA 4X8MA 2G77B 2I4MA 4FYHA 3VC2A 4C0AC 1U6KA 4R2IA 4TKUB 1POWA 1T1GA 3E9QA 1CUDA 2R1TB 1ACMA 3F6EX 3MTJA 2DECA 4OOEA 1JJFA 2JPDA 5DPMA 3ESZA 3MG9A 4ZCRA 1VKNA 3JSAA 4MINA 2BFBA 4FYXA 3N0TA 4D44A 2GZRA 5E0KB 1YRBA 4GIBA 1NBAA 4D1YA 1DHRA 3SQXA 1JX6A 3H18A 3Q2KA 4YAJA 4C7XA 5GONF 4CM9D 2YJZA 1T10A 4NOJA 1EGVB 3EGVA 4Z0NA 2C7VA 3V7NA 3NHBA 2V1XA 2WNSA 4LHXA 1Z2OX 2HU2A 3RVLA 4OMUA 3DBHA 3EXAA 4KO4S 3ZU6A 2P1ZA 4LXIA 1IBLB 2GEJA 3TOXA 3VSEA 2C3MA 3WGTA 1E2IA 1GKLA 1ZO8A 3KFLA 4IYRA 3DFZA 2Z6VA 4KQHA 4YMLA 3GYBA 1YZQA 2YW2A 4JT9A 1MU0A 2V7BA 3VSCA 1FLAA 3B78A 4CDGA 1ADJA 1KQOA 2YHIA 1JQ5A 3GMDA 3KKNA 3RSFA 3SJ7A 2PGLA 5CCXA 3IKVA 1YS4A 1RWWA 2P9ZA 4L4RA 5AKIA 4J9VA 3GT7A 1SMKA 4XJTA 5CK5A 6REQA 5ECDA 3GZTB 1U3DA 1WLSA 2DCMA 4QFDA 4GKKB 4DBLE 1VM6A 2G0NA 2I7CA 5LQKA 2WIBA 5DB4A 1ORRA 2WYOA 4RUKA 4BLPA 3DQZA 1OWOA 4O4HF 4J1SA 4QYIB 5M34A 1E1NA 1M0EA 3NEJA 3FTEA 2O8EB 3U4HA 4HQ6A 5C35A 3GF4A 4FGJA 3ZIUA 1NX6A 4IDNA 4DA7A 5HRCA 4B0PA 5J4KA 3FMPB 2XUIA 3QXHA 4G67A 4DLKA 2C54A 2X5JO 3KLBA 2MCFA 4ZI7B 1HLPA 1DU4A 2EJUA 5EXTA 5JISA 2OORC 4FYVA 5BVGA 4GPEA 1TF7A 4JKYA 4PO3X 2D2FA 1PBTA 4PG4A 2L42A 4TM7A 2Z3ZA 1YACA 2WNHA 3EQ6A 1IN6A 1J56A 2BELA 4I36A 4JELA 2DQZA 4EGAA 2XNHA 4WCFA 2QMUA 5FTKA 1QQAA 3LBAA 1Y5NA 2AMFA 3OE1A 5FHQA 2VKQA 2A0WA 3TXXA 1RI3A 3G9ZA 4BP3A 4O2BF 1LZKA 2I2WA 1OIWA 3IJRA 4REQB 1JU9A 4JEUA 2FSFA 4YRCA 1J70A 1KYVA 2QGZA 3V4LA 2O8DA 1C7ZA 1JTVA 4JCOA 3A6GA 1PEYA 4AK9A 4CHTA 5JS8A 3BM5A 1L7NA 1QP0A 1NLYA 3OC6A 5D5HA 4ZICA 5FWAA 2B83A 4Y2QA 2YHSA 5EZYF 1E6WA 2IXBA 5IARA 3TQCA 5KWVA 4XCQA 2B4TO 3P2EA 2HW8A 2HK6A 3DMYA 1I0LA 1PUJA 3DZFA 4HNSA 4DR5B 3RG8A 1DPFA 4WKOA 1I7SB 1FDVA 1XF9A 3ET5A 4O4IA 3I1FA 4D5GA 2OLKA 4IZIA 3TF5A 1SBTA 3Q5EA 4E14A 2R6FA 4PE5B 3L6CA 3NEAA 1S9DA 4HZGA 2IY8A 1XEWY 1IN4A 2VUIB 5TS2A 3FFXA 4FCCA 9LDTA 1GPAA 4OP1A 1KFJB 1PWXA 2Y99A 5B57C 3C8HA 4IX1A 4JLWA 4M6WA 5DULA 1OH7A 1LZLA 3KX2A 2PLRA 3I01M 1M2OB 1Z5GA 2A88A 3EZFA 3REQB 4S3MA 4OHRA 3T5MA 4CWAA 3OEHD 4NI5A 1P5FA 4ARSA 1T36B 1TVKA 4XEUA 1IQRA 5BVHB 1JE1A 1RPJA 2PSFA 5C1BA 5IS2A 1DKPA 3OCVA 4ODIA 1K08A 2DSTA 1X80A 3GHHA 3ZGOA 2A94A 1HMPA 1J09A 5TXGA 3GLRA 2MSDB 5J40A 2AJLI 1YRLA 1DEOA 1PQPA 2WIGA 3AIOA 3DVQX 1GPWB 2XHZA 1U8UA 1ZH2A 1DAKA 2VYVA 3IB3A 1M6VA 1SXJC 3L49A 3QBVA 3T3NA 5EC8A 1Y6RA 1AC5A 4IL5A 4CCWA 1P2TA 3GEDA 4EG4A 3HFJA 1KEZA 5CT9A 4J6FA 3FSEA 3IP1A 3BRSA 3DMTC 3HNPA 5G0SA 1TD1A 2CWDA 3UFXA 3IAUA 1CP3A 1TZ2A 2GJSA 3FKSD 1YT5A 2B1GA 4WY8A 1JJIA 3K0BA 4P3PA 2I4LA 3OETA 1GKUB 1QHNA 1U7PA 5DI3A 1LFDB 2EQBA 4R1LA 4AN1A 3HM9A 3NHLA 2PQ0A 4ZYTA 4RXUA 3WLTA 5I7VA 1JKJA 3CXRA 1OREA 3PBKA 2IYUA 4WK6A 3UQZA 2JIOA 1T15A 3BD7A 1MAUA 3SHFA 4YR9A 2VXCA 5IYZB 1ZN2A 2FPLA 2MSKA 1SGWA 2GJ4A 3COWA 2PYDA 4IJWA 4QU9A 3HYRA 4NG5A 2VEOA 1GKIA 2VH5R 3UOAB 2ZUEA 5CT6A 4DR3B 5AM5A 3AWIA 1E2GA 3E9EA 2BEKA 2GZDA 3NYRA 4B2LA 2HTFA 2HPAA 2WFMA 3FOWA 2LGJA 3GXOA 4EX6A 4CN8A 3B3GA 3IUEA 4GOKA 1KJWA 3VR6H 2IIBA 2OUIA 3KJXA 2H1HA 5CDUA 3GVCA 5DBFA 3G02A 2VK8A 2DFTA 4E03A 4M0FA 1MMFB 4TV9F 5AVZA 2VP5A 2ZJZA 4NV3A 1MH9A 4N03A 2M32A 5AYVA 1TGVA 1GARA 4LXGA 1Z8NA 4CL2A 1QQBA 4F3TA 5KUTA 4FE7A 2ODAA 5LQJA 3DFIA 2XYQA 5CNJA 2C88A 4IMPA 4TKMA 2A0XA 2I67A 4KXVA 3UJAA 3RYCB 3R9XA 2NZYA 3BGWA 3A9VA 4M7OA 3OI7A 1B1CA 1XWIA 3E5NA 1AKYA 3AESA 3AI1A 2DTEA 3DEJA 3IUQA 4X7BA 5KCMA 3ROMA 4EFDA 4MUBA 2ZXFA 3K1TA 5AM1A 1RYZA 1VOTA 5K0BA 3ZHBA 4URVR 2J3KA 2ZULA 1KJQA 2IY9A 3DYIA 1L8AA 2TMDA 2HCJB 4JC4A 3P9SA 1UKCA 3NWBA 1QYRA 2F9LA 1DJQA 3SS7X 4ZO7A 1PT8A 2W6PA 2FFRA 2W93A 2ZB7A 1DZ3A 3GMSA 5EPEA 1LUAA 2EIXA 2Y68A 4F4DA 1EEXB 5H5JA 5A3RA 2FDXA 3DTTA 4BP9A 4RD0A 1K4YA 2O05A 4HWKA 2VRCD 1A9ZA 4JLJA 2HU7A 3AM1A 2H7XA 4O4IF 4TQGA 4BNLA 5JT1A 3Q88A 1JU3A 4Q15A 3NDBB 5FWNA 3PNPA 4DRYA 3GCGA 4QJBA 2FN4A 2SKDA 3OBBA 4ND8A 4C07A 5K8CA 3N7TA 1OTHA 4I08A 1XELA 4FFPA 2C4UA 1JG3A 3PUWA 4LWPA 2WYUA 3UW3A 3GRYA 1FU8A 3FWNA 4LDNA 1J42A 4BFLA 5JS6A 3HR8A 4MA4A 2JAOA 2JAPA 5AH0A 2FFAA 5E6SB 5DX0A 1GZ5A 2SKCA 3VJRA 3DE7X 2YY5A 5BSRA 1FTGA 2UU9B 2VQ6A 1E8MA 2ZUDA 1E77A 2WKWA 2I6XA 3ABQB 4QFCA 4TTRA 4WA8A 1ITZA 2BYTA 3V34A 1SZCA 2XUGA 3G88A 3RVMA 1YMVA 3TCXB 2ZJ0A 2H1OA 5FPQA 4Y1EA 1KGDA 5FLEX 3SC2A 3TVYA 1U7DA 2C92A 1GZ4A 1U9CA 5KYGA 1ZM2A 3O0DA 5FNZA 4AO6A 2FGJA 3DG9A 5AI9A 3COVA 4M99A 4PCLA 5EWLA 4HNQA 1P5ZB 3HBMA 2G04A 3AERB 4IIJA 4Q4HA 3PC3A 3QYJA 5ALQA 4F6LA 1X7ZA 1XLVA 2I6GA 5JAIA 1OXBB 5KYWB 3BIJA 4MIOA 2YQZA 1ZMBA 2YDXA 2YHBA 3JAKA 2KBEA 3QVTA 1PSZA 1EP3B 2CV0A 2QN6A 3OZSA 4UOQA 3UMVA 1ZIOA 2BBTA 2DH5A 1AUVA 2DQSA 5EFZA 4KQCA 4NBUA 3HVUA 3B7GA 1G4HA 2RK4A 3KLMX 3GPLA 2SCUB 1DRJA 3QELB 1JB9A 1WUYA 1RXWA 1J9ZA 1KJJA 1N2BA 2NPIA 4N6GA 3CISA 4XWYA 3MHTA 2P2GA 1OXVA 4P7BA 4R3UC 5EHQA 3CNQS 4QULA 2FRDC 2Q1YA 1YA8A 1P0IA 1VMIA 1KKLA 3IBYA 4M1MA 3D0RA 4JZYA 3VPCA 4CR6A 4G5OA 4NMWA 4HSGA 4ZZIA 1XDZA 1P1RA 3C45A 1V8FA 2XMQA 4DLUA 1DBWA 4NPHA 3GR6A 3UB4A 4E1AA 3GX1A 4MDFA 3TPFA 5K05A 3VR5H 4HXEB 1WXXA 4HDRB 3ZCSA 4CG1A 4AJNA 2BFOA 3FWHA 3A6EA 1JILA 1W4LA 1LNZA 2Q4BA 5EKXA 1N6LA 2QUIA 1LBHA 1V37A 1O4VA 3II6X 3THXB 1DL5A 2FEKA 3VTKA 3VJKA 3L4KA 4GYJA 4H0NA 2C8LA 1I2ZA 3ZDFA 2HQRA 3LV8A 5ETJA 1E96A 1RBZA 2B1JA 2JGIA 1DC3A 3D9QX 3CUVA 4L50A 4RHYA 3E61A 3P2YA 1XZMA 3SEZA 1GU1A 3HB5X 1YS2X 2R47A 4RVGA 1EFRA 1RJEA 1DAGA 1SWWA 1H6AA 2BGNA 5L7TA 4BO4A 2FZ4A 2PUFA 4GKAA 2O8NA 4TKVA 3IUMA 4C0HA 4KBGA 3VZDA 2HDHA 3MGBA 5EJ9A 3EXG1 2P7IA 2ZYAA 3E8SA 3N2YA 4MP6A 1FDTA 2ACKA 3NEYA 3A9CA 3CW2A 3FNHA 3KUDA 4NYIQ 2IV3A 2X41A 1ECLA 1D03A 1XG5A 3B6MA 4LQCA 3S27A 1EQAA 2Z0MA 1TYEB 1TJ4A 4GDMA 4R1OA 2O8BB 4PS1A 1R4MB 2VHUA 4M98A 5GOTA 1RC8A 2BH9A 4H4CA 3WXMA 1GXSB 3LW7A 4RVDA 3ZQ6A 1WM1A 1DDOA 4DR7B 4MWOA 1QF9A 2CL7X 2Q6TA 4QHYA 1ZD8A 3X2EA 3ZH9B 1Z5PA 3CRVA 1C30A 4JVLA 4WLOA 5KS2A 3QZUA 1PFGA 1YD7A 1K5GA 2O7SA 2DHCA 1ID1A 2RH4A 3QBEA 2JI6A 4P5PA 4QUKA 3OQIB 5E8RA 5L8VA 4E33A 5K6AA 4YXFA 1KO8A 5JMTA 3ENKA 1DOZA 4JVNA 4YDHB 2J0EA 1FCJA 2JIMA 3OKFA 1VPEA 2DU8A 3SZUA 2B1RA 3T3DA 2CBGA 1FPQA 4AS3A 4DLRA 1FLDA 4YAGA 2WB2A 3NCHA 3TNDA 3QE3A 5DM4A 1VPWA 4TYMA 1BA2A 2EP5A 4TZ0A 4C29A 2Q0QA 3RIGA 2R2AA 1G63A 1WXFA 4K9NA 2CJWB 3KP1A 4ITVA 4NPCA 2Z2YA 2J6IA 2O48X 3MQ2A 4ZT3A 3R24A 4G4SO 3KVOA 3A3NA 4MRVA 5FT9A 4ETWA 2AT1A 3EXEA 2JGEA 4NQZA 4OIFA 5B12A 4MLCA 1I9CA 2JFUA 2OHVA 2XDQB 2A0UA 2BHSA 4MKXA 5I4IA 2V97A 4ALKA 3ND9A 1FYFA 1L6IA 4KREA 3MCTA 1TYBE 4E13A 1SR8A 2PYZA 1F6WA 1JDTA 2I4OA 4QDZA 1WOYA 4BX0A 2XRZA 2PUTA 4G65A 4JT8A 1CVLA 2DCUA 2R1ZA 3PFNA 4XFKA 2PBRA 3NASA 2XOXA 2JIDA 3U3RA 1A98A 1ZM3A 3KG2A 1H2BA 2YXNA 4E1VA 1V25A 1ZMXA 2XCUA 2FK7A 1QOZA 2RHLA 3EDQA 3FKQA 4HNAA 4IIJF 4ZEVA 2R00A 3PXGA 2CD9A 3ANNA 4UHKA 5IF9A 1QLJA 1PJ2A 3MMXA 5K3BA 4RJ2A 1NI5A 3EVTA 2W6QA 1NP3A 2IITA 1OA0A 2JFOA 2C4KA 3FM9A 3G0OA 3K5PA 2BEUA 2DBVO 4MWEA 3OVMA 4U1RA 1GP2A 1JPVA 3LWDA 3RYHB 3LL4A 1K7YA 3AJAA 4PSAA 4H9GA 1H4SA 1B8NA 1HG1A 3GGPA 3PQ4A 2GN4A 2AOTB 4IHKA 1GGNA 1A5BB 2X2OA 4DNXA 4EUFA 4YT4A 4B3CA 3VOAA 5BQ5A 2CY0A 4YT5A 3T7JA 1TO6A 3QV2A 3E5MA 1GCAA 3WGLA 2XA1A 4YCNA 1KH3A 1K3TA 5BR8B 2AR0A 4BQEA 5K0LA 2PLFA 3FVWA 5KX5A 3HSKA 4IV0A 4KO3S 1AXRA 1TJPB 2QLBA 3KSAC 3AM4A 3OLCX 4KYUA 4ZODA 4UBOA 5FUXA 4BV9A 2I1VB 1XJ0A 3AI7A 1N2ZA 4OSOA 5CXUA 2VAXA 2JHCA 1XTSA 1JXQA 2RHCA 1EVZA 2YXLA 4EO7A 1EUCA 3KCNA 3L6UA 3UJBA 4UTNA 2XXBA 3STXA 3LHIA 4XR9A 5JCZA 5IASA 1FDRA 4N3BA 4UMVA 1T6XA 3NHFA 3ZS9A 1CETA 1SCUA 3JQAD 3S3TA 4NENB 4WEQA 2QMEA 4G5FA 1JBKA 1ISMA 1YFLA 4DIDA 2J3MA 1V3TA 2O4UX 3MJHA 5JXJA 4NCHA 2PMBA 4ARCA 2OCPA 1WD5A 1XEXA 3IODA 5CT4A 4DA9A 4ZGBA 4UXIA 3B9PA 3ZJTA 2JD0A 2NWQA 3C6KA 4D7AA 1QC5B 5MDHA 1ESDA 1FS4A 1QGUB 1RLOA 4ZJUA 1PQUA 4KDRA 3U1BA 2XZTA 3A4IA 3PICA 621PA 4EIWA 1YR8A 2Q1WA 2JIZA 1ZINA 3D1LA 1CR4A 2JFFA 2ZLBA 4GQIA 2XUAA 1DT5A 4HDNA 2J3HA 2C61A 3FY4A 3WBJA 5CMLA 4X66B 1ZP6A 3BWYA 2YRWA 1G9XA 5LA6A 2O7VA 2WVGA 3U4QA 1HURA 3AJEA 2GAJA 4I4CA 5HGJA 5DCUA 1ENYA 1GVHA 1QK4A 2YOFA 5AI5A 5BMOA 5EYPA 4Y9UA 4HLQB 1REQB 1Y33E 4GOMD 4XWAA 2HLNA 3O4JA 1Q7CA 4Q93A 3UA3A 4ETIA 5BSKA 3L6RA 2R8PA 1NXPA 2BZGA 4Z86A 2Q27A 1IXKA 1H22A 1RLUA 2NXNA 4YUXA 2FYTA 4F9TA 3RCBA 4LJLA 1UJ4A 4YALA 3HCEA 5JSFA 3LQKA 4JOCA 1HDCA 3L18A 4Y2GA 1UQTA 3LUJA 1IM8A 1A4UA 2FZEA 3BH7A 5JCOA 3IVMA 2RHGB 4IVQA 4MYDA 3MFYA 2VTBA 5GM1A 1TM2A 4PAMA 4F1KA 1H42A 1T6YA 1V95A 1Y3CE 2FPKA 3OJXA 4KZPA 2HH9A 1PWHA 3LMKA 4II3A 2Q3FA 3HPQA 1CZUA 1DTEA 2AWOA 5FUMA 3MS2A 5J47A 5BT8A 4ZTBA 2VDWA 1N57A 2CHQA 3A06A 1RM0A 4JXXA 4FDVA 5JWRA 3MPOA 3TPZA 1VL1A 4GF5A 3FYHA 3I12A 5KWJA 4NDAA 4BLOA 3NI2A 5BWLA 4OY3A 2J41A 3ZW9A 3WKDA 1D5WA 2NX2A 2HBRA 4AS1A 3PWTA 2C4WA 2ISCA 4MYHA 1EUQA 1LH0A 3GFFA 1IY2A 2Z9CA 3MRVA 5EY5B 5A4AA 1ISIA 4G5YA 4LXTA 3PDUA 4NV1A 3V32A 2AFIE 3ICPA 1JECA 3CUTA 1XQYA 4IKOA 1ZSNA 1YBHA 1Y4SA 1N0UA 3A4LA 2PBZA 3KSBC 3CX7A 4I55B 1ZGCA 1D8TA 2ILVA 1Z26A 3G2NA 1QVZA 4FP9A 4M1KA 4P3KA 5G4LA 3UJ7A 1JP7A 3AKEA 1QG2A 1NQTA 3KSDO 3CUUA 2Y6VA 5DM2A 5EGSA 4TN1A 4ZVLA 3WIDA 1UC8A 3N2LA 4ZCSA 1TM5E 5E2BA 4IW3B 1LBTA 1PZXA 2ZB8A 1HV8A 4D9BA 2AQHA 1XNHA 3OPYB 3N2GB 4IF4A 2W2MA 5F4ZA 1Q0UA 3TFQA 5KX5F 2KM1A 2DR0A 2P5SA 4XUGB 3K5HA 1Z63A 1C4WA 1NRWA 1C8BA 3KSUA 3KTAB 3ZXXA 1KS2A 1QFZA 4GVXA 2R68A 5FADA 1H23A 4NESA 4EA6A 2D1YA 2PXXA 3EXIB 4LNUA 5AXDA 1UC9A 1AGPA 1H3NA 3F6YA 4IEEA 1NVVQ 1XUOA 5EKSA 2Z3WA 3V42A 2R4QA 1TZBA 121PA 1Z8FA 3NWJA 2DMRA 4XCXA 3QXGA 4AX8A 3F97A 3V8VA 2Y77A 2WOOA 2A3NA 1L1FA 3FFTA 4JODA 3TYXA 1QFYA 1WMFA 1SOWA 1QYDA 3WNCA 3ZLTA 4OSPA 3R3YA 2O2ZA 3T3EA 5B3LA 4ENWA 1DC6A 1IMJA 1V6SA 5JJCA 3IVAA 4TS9A 5AK3A 4BFZA 1O0BA 4YQZA 3QVGA 4MGKR 3D7KA 3GGCA 2XOKA 4RM3A 3OLZA 1ZD4A 2IQ5A 1M2VA 3PXUA 3PZRA 4HQLA 4MVYA 4RH3A 1TUIA 3I9V6 4MI3A 2GK7A 5KTNA 1QR6A 3IULA 3RIYA 5KNBH 1L5HB 1NN3A 4FONA 1OFUX 1IEVA 3JWJA 3R7WB 2QORA 1U8CB 5KDDA 4V0ME 4A82A 2VP6A 3GB9A 1GUFA 2GNOA 1T8TA 5AVTA 3E2MA 2A6PA 3ESRA 4XLLA 1GOTA 1C7FA 3DTVD 3HZOA 5K3AA 5LA6F 3RS4A 1YVUA 4L4YA 4F11A 1WXDA 2ZRCA 3T7KA 1D2AA 1W5SA 3JALB 4H7KA 4EG3A 2RHJA 2V6JA 1MHPA 4KSBA 3B9BA 2X2FA 1XZLA 1YSCA 4HLCA 3A31A 3KAJA 3PB3A 4NK5A 1LQTA 3FBTA 4RHTA 4U6SA 1XRLA 4Y2UA 3SYTA 3KYCA 3NVMB 3U26A 2WLTA 2F1HA 3UOGA 2R86A 5HNKA 1RRPA 2BFNA 1AA9A 1V7PC 1TEXA 4HFMA 3KXIA 1GQRA 1AD2A 1JR4A 1GEEA 1M66A 3ZZ0A 5MGNA 1KP2A 1VDZA 5HFNA 3UHAA 2DR3A 3PYLA 4GLJA 3WIVA 3GLHA 3R0VA 2R7AA 2HPVA 4N12A 4N18A 2Q3HA 4PSKA 4NAHA 2OBBA 3M6FA 3W6NA 3O93A 1EIWA 1DRWA 3CVOA 4YY3B 2YVQA 4RGYA 2QUJA 1GAXA 4BNJA 3NALA 3UCEA 1HNZB 4WNIA 2PPVA 1J06A 3PUJA 1NVXQ 5IW8A 3GJ6A 1O9GA 2CXPA 2XB4A 1ENOA 1SVOA 4BCCA 2HXGA 4GI3A 3N8KA 3KM0A 1KFEB 1IUPA 2Z1DA 4P80A 5HS4A 3NC4A 1JHXA 3ADKA 4M0DA 4TMKA 4HVAA 1WNTA 4XH9B 1JDUA 3EA0A 3ZCUA 2X8BA 4JLSA 1B73A 4MI6A 4C1BA 4YRAA 5C37A 1FP1D 2H4JA 3HG7A 2JGFA 1CZRA 2SNIE 5M3BA 2QUKA 2PZLA 2FG6C 4X7MA 2O8VA 5I7AA 5IG2A 1SVMA 4DWJA 5AJZA 2P4EA 3GV0A 2FVYA 3ZK8A 5FOQA 5AD1A 4X44A 2BP7A 1DIHA 4FKBA 5CD9A 3N6RA 4ZOAA 1Q7GA 5DLQC 2WHQA 4BO0A 3BD9A 3M34A 4UARA 4US1R 3COZA 2H1WA 2ZQZA 4KMOA 5E9JA 3TD6A 3TMYA 2OC9A 1HT1E 3HJTA 4IVPA 2RHHA 3F9IA 4RMGA 3ZE7A 2F4NA 2I34A 4OQEA 1XB2A 4Q4CA 5IDWA 2XMBA 2ORWA 2PU7A 1ZGAA 4E4YA 5E7MA 3DULA 1B00A 3VNQA 3EF1A 2J5KA 4AECA 3V3KA 1Z12A 3H0EA 2MSLA 3M3HA 4NJMB 4ZEMA 1RWXA 3ZLJA 1FJ2A 1FFXB 1XWWA 2OT3B 2QVCA 2B7LA 4NHEA 4Q9DA 2NQTA 1UT6A 2GT1A 1QE3A 3KWJA 5HOEA 1Q1BA 3U7RA 1P4AA 3HJFA 2AG0A 1G3QA 3U7FB 3U1TA 1J8VA 1ZRHA 1PS0A 3FGPA 3LK6A 1R5JA 6LDHA 3INYA 1VYTA 2NUPB 3CUSA 3RF6A 4D02A 5AK0A 3AG6A 1UWVA 4QUHA 4CQMA 4RWEA 2JHFA 4Y18A 4OJTA 1F06A 3WK7A 4RNCA 3ZY2A 4OQFA 1NUQA 4OK5A 2NNWB 2PS3A 4F21A 1BHQ1 2X19A 3LYLA 5AW2A 1JSXA 1XTJA 1M72A 2F17A 2VRWA 3CX3A 3GL9A 3I3OA 3QMMA 5TQJA 1EP1B 1KAEA 1R3DA 2ZPUA 5JALA 1QU2A 2HZBA 1YVEI 1JLKA 2JHGA 2XI4A 3JAWB 1XCBA 3E82A 3I72A 3FJ1A 3FTNA 1EJ0A 2H1LA 3I8SA 4M9RA 3I5YA 1Z6PA 4S05A 3CR7A 1RXCA 2JFWA 3R3WA 1B74A 2JIPA 2YV2A 3B3JA 2VK1A 3FFBA 1ONSA 2AFIB 4UUMA 4WPGA 1U28C 3SIWA 2PGJA 4PZYA 3N3AC 1HZZA 3KC2A 4PLPA 4QUIA 4BECA 4DRXA 2O2JA 2DHQA 1JAYA 2B5OA 2IEAA 5E3IA 2ZRQA 4EEXA 1QH8B 1Q16A 2JB9A 4K5QA 2V74B 3O82A 4MLDA 4YDRA 3T3HA 3NGXA 3VH3A 1BCSA 2XMCA 4M7RA 4XLZA 4PBTA 3QFTA 1X42A 4X6LA 3Q3JB 3SXUB 1KS9A 2J32A 4JXJA 4PNZA 1H3EA 3GZ4A 1PJQA 3FNFA 4L57A 4IS2A 1UDCA 4WEOA 4F46A 3V7YA 4R2HA 1FNDA 1W4AA 2GTHA 3IBGA 3KZ1E 1T9AA 4MWTA 5EAIA 1CUYA 1EA7A 3CB4A 4ZAZA 5DXFA 2ONCA 1AMUA 4LY6A 5LC1A 2FPOA 2Y0PA 4MIEA 5LOVB 1KAQA 1K92A 3DVLA 4LJ9A 1AY0A 1Y5IA 2J0VA 4IPTA 1Y9EA 4D82A 1Y34E 2RD2A 2RBEA 4BLRA 2A14A 1PEKE 5DH9A 3H5TA 1LDMA 4KP7A 1A7UA 4Q9HA 4XX0B 4DSNA 3DL2A 2DUMA 2Q5JA 2C0QA 1UINA 2BFMA 1C8KA 3C3MA 2QMYA 3CKYA 5WRFA 2IPLA 2XUDA 5LJLA 1CUVA 2ZE5A 2I6UA 1L0BA 1D0VA 2R96A 4R98A 4E12A 2JARA 3O1JC 2XQVA 3TXYA 3DO5A 4B9AA 5JS1A 4XQ0A 5HIMA 3FOAA 4MHOA 4HGQA 5A0VA 2O2DA 1F12A 1J8QA 3OD5A 1YJBA 1E0AA 2H2WA 1OBOA 1C9YA 2JVKA 1JLMA 3Q10A 2Q4TA 1DQNA 1WBJB 4PIPA 2ZYTX 4F4IA 1PE0A 4RW0A 1WBDA 2V7WA 4X7RA 5THQA 4KR2A 4EARA 1R9NA 4G01B 2J9XB 1J0DA 1BE6A 1H6BA 5B53A 5AVUA 3EIOA 3EPKA 1RKBA 4MCJA 4RZHA 1T2UA 2VYVD 5EPUA 1ZXXA 4NZOA 2QZZA 4LIPD 5E3JA 1KSGA 3DT9A 3LC7O 4C9BA 1AS3A 2OB1A 1EFVA 1R1DA 1TZJA 2I1LA 2QG6A 3C3PA 3MGKA 3R5XA 4GUAA 4TMFA 2GRAA 1JHOA 1BCRA 3U9LA 5BOSA 1SN7A 2A92A 4B5LA 5K8VA 3K6SA 4A6PA 2FMKA 1WDLA 1WUJS 4WNCA 4BLUA 3E1KA 2A5JA 4ARAA 1PGOA 2DRIA 4BNDA 1ZOPA 1TAHA 4HAXA 4PRZA 1AV7A 1P81A 3IMFA 4GFDA 4URYR 1SQSA 4RA6B 1DJOA 3H1BA 3X43A 4YMUA 5I3CA 3AJDA 2OBLA 4GNRA 5BR7A 1ILEA 3P94A 3N0XA 2N1BA 2OV1A 1UF9A 4IX9A 4P31A 4EJ2A 2A33A 3EH1A 4HNGA 4CV0A 5CM9C 1E8NA 5AMXA 3H9CA 1LS6A 1I33A 1UAYA 5IJ9B 5BOVA 1WLYA 4EQ6B 4W1SA 1DFGA 3W7BA 3GLTA 1WV0A 2BBOA 3OX4A 4BFUA 1A77A 1RPZA 4NC9A 4ZIRB 3DB2A 4KNYA 3SBOA 3C7DB 2A84A 4J3FA 5EWMB 4A9AA 3DL0A 4GPZA 5LIRA 3TPCA 3TWOA 2EZUA 5L9AA 1ABFA 2XD4A 3DV9A 5A7FA 3U7GA 3O1IC 4ADSG 1VPVA 1U1CA 5I7EA 4FSXA 3ROGA 3RFTA 3LF1A 5BSUA 4B7UA 1HQDA 1SVNA 2HGSA 1V9SA 4H6PA 1YOVA 4J2HA 5I4KA 4IIBA 2G9NA 1GPYA 2G17A 3HBFA 1RZRA 2PUCA 2DERA 3QWFA 4EITA 1Q0TA 4HI0E 4PHTA 4BVAA 1I3CA 5FOTA 1N2XA 1RI1A 3RLFA 3A9SA 3ZOKA 4LRYA 4W5TA 2FJUA 2IZ0A 4A0QA 1OILA 2WYHA 3DE3X 1QS0A 2EG5A 2HQBA 3D0KA 3OTQA 2VSQA 4HGNA 3TZHA 1BDBA 3UWSA 5DHQA 3CIFA 5IANA 1U90A 1SCAA 1AUXA 4RX1A 3KJNA 3AFNA 1ZNXA 3W4JA 1Z5UA 4E4RA 3CUKA 3KJZA 1EB9A 4RTPA 2QRGA 1GL9B 3BFKA 2YKGA 1LQUA 4ALJA 3V55A 5E6UA 1E6UA 1RWKA 2PGOA 4G0OA 3OY2A 4WDQA 4BRSA 2VUTA 3EE6A 3AEQB 3S4YA 1Y8QB 2R9VA 2BFFA 3ILYA 4R2MA 4K9LA 1NW9B 4PZ0A 4RIIA 3B1JA 1NL3A 1G59A 4NTZA 1KZ7B 1UJ6A 3AU9A 4JL8A 4XUCA 2GPJA 5LYJB 1JN0A 4KN9S 2QZPA 1EX6A 4H31A 1V8BA 3IQXA 3PFCA 4F86A 3IP9A 1ZGGA 3EMVA 5FOWA 4RADA 4G26A 2ZR7A 3LWZA 2RHMA 1YL7A 3DPUA 4PIVA 4B6RA 4MUEA 2V9PA 3PUKA 3ISJA 4LXYA 4OCZA 2VHZA 1SHLA 3WKBA 5ESRA 3OLWA 3L1JA 2NOAA 4B3FX 1C3XA 2PLAA 2WJWA 2DLNA 4BJ5A 1W36C 3LP5A 3QX7A 3STYA 2MSWA 3S2FA 1GPH1 4ZYYA 1IH8A 1N2IA 2PUWA 3WGHA 2WEKA 5JAMA 5BUQA 1K3FA 4GC5A 2Q1SA 4PLYA 3JQ8B 5HIKA 3A6HA 3D6TB 4ZT5A 5FYQA 5H82A 3TTVA 1KNXA 2YZKA 4FR5A 4UUAA 3E4CA 3C3XA 5JDCA 3QBJA 1TJ3A 1Z9BA 5B4TA 5B2FA 2ABWA 2VP3A 3USES 1EUDB 1FMTA 2P90A 3QLJA 4C4RA 4IXDA 2B3TA 5F7XA 3WL4A 2H92A