4PYOA

Humanized rat comt bound to sah, semi-holo form
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
214
structure length
214
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 77
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pyoA00
4Z2YA 1BC5A 4BLWA 5EIFA 3KQMA 4P7KA 2WA2A 3REOA 1KYZA 4HH4A 2IH5A 1YZ3A 4M7RA 3LL7A 3B89A 4X1OA 2BR4A 5GINE 3DXXA 3G89A 1I1NA 1R74A 3GRRA 4RTSA 3DUWA 3G8BA 2JG3A 5GWXA 3EVCA 4DZRA 1RI3A 3HCEA 3KHKA 4X61A 5DXAA 3CJRA 3MHTA 4RVHA 3TKAA 2HMYB 2PXAA 5FA5A 1KPHA 3A26A 4B17A 5CVUA 3HA3A 4E33A 1X1AA 3TOSA 3O4FA 2N47A 4GEKA 4Y2HA 4RTKA 2QRVA 3GNLA 4U7TB 2OBFA 2P8JA 3EMDA 4BP1A 4KW7A 1X1CA 3VYWA 3DLIA 3UBTA 1QANA 3KQOA 3R6TA 5EKXA 3MERA 1WS6A 3LCUA 1TPYA 4PYNA 1ZKDA 4KVZA 5HFJA 4POOA 1XJ5A 5IKMA 5LQNA 2G70A 3PB3A 3EVFA 3C6MA 4BP3A 4EK9A 3KR9A 3IHTA 4QTUB 5E9WA 1VL5A 3ELYA 2QY6A 4PONA 1JQEA 3VC2A 4FR0A 2O06A 1YZHA 3L8DA 3UJ7A 1INLA 1D2HA 3EEYA 3UJCA 4IWNA 3EVDA 5EMKA 3GWZA 4PYJA 5K0FA 2PWPA 3V8VA 2VDWA 2ZWVA 3FUXA 3HTXA 2IGTA 4WXHA 1NW7A 3LDFA 2O57A 1R6AA 2XVMA 4OBXA 1QAOA 3MGGA 5C9ZA 5LQJA 3LKDA 3NDIA 2P1DA 4PYOA 4P7JA 2AVDA 1YUBA 3BXOA 2OPBA 3M6VA 2HNKA 4QPPA 2I62A 3JWJA 4ZTBA 1KXZA 4P7GA 5GM1A 3CCFA 5M5BA 3HA7A 2DULA 1R00A 5T6BA 3TKYA 1SQFA 3ELUA 3GIWA 4FSXA 3G8AA 4G56A 2C7QA 2Z6AA 3MTIA 1F38A 3FTFA 2IH2A 2E5WA 4RTLA 5H02A 2YQZA 3EGVA 2ZCJA 3NJRA 5K0EA 4RTRA 2ZULA 2ZZMA 2YXDA 3BGIA 4ER0A 4PYQA 2OXTA 3HA5A 2BM8A 1R8XA 4Y30A 4PCLA 1L3BA 4FZVA 5K0NA 4GOND 3M33A 3MCTA 1PRYA 1NW3A 5E1OA 2F8LA 5E8JA 5HILA 3CBGA 4FP9A 4EKIA 1JG4A 1IY9A 3DMFA 1Z3CA 2HV9A 2V74B 1G60A 3P71T 5DWQA 2Z6UA 1NBHA 3HCDA 2FK7A 3SXJA 2QE6A 4C08A 1X19A 2VDVE 4DCMA 2FK8A 2H11A 4GUAA 5FULA 4A6DA 2FPOA 2ZLBA 3NTVA 1MJFA 4M38A 4AZWA 2ZZNA 2EFJA 3D2LA 5EPEA 2OO3A 2R3SA 3KQTA 5GM2A 1X1BA 2PLWA 2IFTA 3ELDA 2AVNA 3HCBA 2I9KA 1SQGA 5DM2A 4E2XA 3A27A 2K4MA 4HTFB 2FRXA 3KQWA 5EHIA 2ZW9A 1L9KA 3JWHA 2ZIEA 4F86A 3B3JA 1L3CA 2PX2A 3BWYA 3FUWA 4CKEA 4KIGA 1ORIA 4HG2A 9MHTA 3P2KA 1QZZA 5DX8A 2QM3A 4FT4A 3MAGA 3G7UA 3GJYA 2PX4A 3I58A 5EGSA 2NNWB 5T67A 1G38A 3TR6A 2PT6A 2VP3A 1PJZA 3MB5A 2C7PA 3B5IA 3FPJA 5E2AA 5LQCA 3CKKA 1FBNA 4IV0A 5CVJA 5F2KA 1IXKA 2IDJA 4AX8A 1NW5A 2ZFUA 4ER6A 5ICGA 4DA4A 2H1RA 3DLCA 2Z6QA 4IKPA 5MHTA 2QYOA 2AOUB 3P9IA 5DTMA 1JG2A 2EJTA 5FQNA 4YUYA 2BM9A 1JSXA 4RTNA 4XUCA 3FRHA 3TLJA 3EVBA 1WY7A 1SUIA 2OY0A 3OZSA 2PX5A 3DMGA 1SG9A 1EJ0A 5K01A 3WSTA 3TM5A 3GRYA 5FUBA 2FYTA 3EVZA 4PYMA 3SM3A 2PT9A 4PIMA 5GIOE 5CUQA 3EVEA 1KYWA 4MIKA 4OX9Y 2CMHA 4YV2A 1L3IA 1R18A 2LD4A 3BWBA 5KQSA 3UJ8A 4JXJA 4QDJA 3B3FA 1XTPA 2UYOA 3P97A 2EX4A 3KR1A 2FCAA 4RVFA 5C0OE 1XDUA 1AV6A 4XUEA 5DTQA 4PINA 1QYRA 2KW5A 3E23A 4GBED 3G2QA 1D2CA 3OFKA 4E2WA 4M36A 1HNNA 1P91A 1DL5A 4PNEA 3C6KA 1KP9A 2XYQA 1FPQA 2PJDA 4LG1A 5E1DA 3BGDA 5FWAA 1TW3A 3IEIA 4F85A 4YUXA 3V97A 2WK1A 3VC1A 5G02A 3E7PA 5HIMA 3UZUA 2XBMA 2P35A 2UZ4A 4YUZA 3M6XA 1BHJA 3KPUA 3QOWA 2BH2A 3NMUF 3KQQA 2YVLA 3P9KA 3AXTA 3UJAA 1VE3A 3BWCA 2P3QA 3GRVA 3HVHA 4RTPA 3FPHA 3OU6A 1FP1D 3H2BA 3M70A 3KQYA 5EZQA 2O05A 4DQ0A 1N2XA 10MHA 1VPTA 3A7EA 2CL5A 4OQEA 4R8RA 3UA3A 3KU1A 2G1PA 1G55A 5DSTA 1RI5A 3FUVA 2P7IA 3FZGA 3GCZA 3ME5A 1FJXA 4E32A 3LBFA 4QQNA 4RVDA 1M6YA 3B3GA 4V0QA 4E2ZA 2UYHA 3DXZA 3UJBA 3I5UA 4X63A 5ICCA 3K0BA 2VZ9A 3UJ9A 2P3OA 3KPWA 3DXYA 3QV2A 3DP7A 5DT2A 1BOOA 5HIKA 1EIZA 2VDUE 1B42A 1F3LA 4HC4A 3F4KA 4RTMA 3GU3A 3BUSA 3ID6C 3GRUA 4GC9A 5EOVA 3FPEA 2Y1WA 2ZIGA 2IBSA 5T64A 1KR5A 1N7IA 2B3TA 3DMHA 3FTDA 3HNRA 4FS8A 4OBWA 4QVGA 3U81A 4CKCA 3EPPA 1NE2A 3PX2A 4RTJA 2AN4A 3OFJA 4EKGA 2IP2A 4GOMD 5BP7A 3CJQA 4CXMA 3FTEA 4OA5A 2AOTA 2Y1XA 2UYQA 1ZQ9A 1BKYA 3OE5A 3AY0A 5IH3A 4E31A 7MHTA 4HGZA 3PFGA 5DSXA 5GP1A 1MHTA 3FPFA 2YX1A 2GH1A 1RJEA 4RWZA 5DRTA 3EGEA 5ICFA 3A7DA 3LSTA 4MWZA 1RJDA 5EZSA 5BW5A 3E8SA 3HCFA 3HP7A 3KPYA 2EJUA 3LKZA 3HCAA 3CJTA 4GOOD 3JWGA 3C3PA 3FTCA 5ICEA 5FTWA 2PWYA 3G5LA 5D1NA 1HMYA 1P39A 3R3HA 2A14A 1NW8A 1XVAA 1RI1A 4WVLA 2NP6A 5K03A 4E70A 2VS1A 4P58A 5DPMA 3UFBA 5LQUA 3A4TA 3O31A 2GPYA 5CCXA 2AS0A 3FUTA 1RJGA 3UA4A 1QAMA 1D2GA 3HVJA 4XCXA 3FUUA 1SUSA 3KQPA 5EKUA 5F2NA 3SSOA 1DUSA 3BWMA 1YFJA 3UJDA 4RSRA 4E30A 1NV8A 5LQAA 1EG2A 1RJFA 2C7RA 4LWOA 3EVAA 1P1BA 5DX0A 3M6UA 3ANXA 4PCAA 3NWBA 3S68A 4P7FA 1I4WA 5BW4A 3GDHA 3LCCA 5DX1A 2AR0A 3LECA 2XVAA 5JR3A 2JHPA 4LWPA 5K0CA 2B2CA 5DLYA 3EMBA 3UJ6A 2ONZA 4MQ4A 1NT2A 2AOXA 1AF7A 2ZTHA 3TMAA 4M37A 3BGVA 2BR5A 3OZRA 3P2IA 3JWIA 2B25A 3I9FA 2NXJA 1ORHA 2IPXA 5K0JA 3FPGA 2OKCA 1XCJA 4O29A 4PIPA 4QQKA 3TM4A 5CD1A 4H0NA 5EEGA 1G6Q1 3B7PA 1I9GA 2P40A 5FCDA 5HEKA 2B9EA 5CM2Z 1KIAA 3DR5A 4E2YA 5B1SA 4V0RA 1WXWA 1NV9A 5E9QA 3AXSA 4GC5A 3R0QA 4HSGA 5HIJA 4C05A 1RI4A 5DTRA 4DM3A 1VLMA 4EMSA 2P7HA 5CVVA 4YMGA 1G8AA 2NYUA 3PS9A 2YTZA 5CVDA 2ADMA 4RTOA 4PYIA 5EC8A 2ZBQA 1ZGJA 3P9CA 3ELWA 3KR2A 4PGHA 5EMJA 3IYLW 4X60A 4ER3A 4YV1A 1KPGA 1JQ3A 2ONYA 2IIPA 1JSZA 3EVGA 5EVJA 5K0LA 4YV0A 1P1CA 5EHGA 4RTQA 3HM2A 3SSNA 3LGAA 3MCZA 4RX1A 2ERCA 2BZGA 3LCVB 3T7SA 3AWIA 3CC8A 2O07A 1UFKA 3TQSA 3PLAE 5LQRA 1ZGAA 2ZBRA 3BT7A 1V39A 3G88A 5DM1A 4GQBA 4HRAA 2B78A 2Q41A 1AQJA 5K8VA 3KR0A 2FHPA 4PWYA 2PXCA 3DTNA 2YXLA 3NWEA 4IV8A 4R8SA 2ZZKA 1U2ZA 3THSA 1UIRA 3KKZA 1T43A 4FGZA 3X0DA 4A6EA 2AZTA 3PVCA 2GB4A 4QVKA 3LBYA 4R6XA 3TFWA 4OA8A 2UYCA 4AZVA 4QPNA 2JHCA 5KVAA 3KQSA 3ERCA 3KPJA 3R24A 2YR0A 3OU2A 3RIEA 5K09A 5K05A 3Q87B 1M6EX 1WG8A 3LX6A 1JTFA 1JTEA 5EG5A 1NBIA 2PGXA 3DOUA 3FYDA 2PVCA 3M6WA 4CTJA 4X41A 4ER5A 2PBFA 5GIPE 2OZVA 2YXEA 4C06A 3G2PA 3FYCA 5DXJA 3NVMB 4DF3A 2WA1A 3OU7A 4OQDA 5ERGB 2AN3A 3NVKI 2JH9A 4L7VA 1O9GA 2XYRA 3BKWA 1X1DA 3P9NA 1ZG3A 3Q7EA 4HTFA 4RVGA 4FT2A 4C04A 3P2EA 5E1BA 2EG5A 4C4AA 3A25A 3FRIA 5FWDA 2JH8A 1TW2A 4PGGA 1Q0TA 2I7CA 3PT9A 4FSDA 3SMQA 5KYGA 3GXOA 1EQAA 5E9JA 2HR1A 4CKBA 1R8YA 4KDCA 4KRGA 8MHTA 1KPIA 4QDKA 5DM4A 3GO4A 1ZHFA 2PSSA 3SR4A 3NW9A 5E1MA 3I53A 4KIFA 1EJ6A 2IH4A 2YUIA 2AOUA 2PV0A 3HVKA 4C03A 5FHQA 2AOVA 1UWVA 2CKDA 4BY9E 4U7PB 5P8WA 1NKVA 3LDUA 5EMMA 3ER9A 1JR4A 2CWWA 1VBFA 3G2OA 4DKJA 3LHDA 2PXXA 3CGGA 2GA9A 4ER7A 2NP7A 4LECA 3SGLA 2XYVA 4F84A 3T7RA 2PX8A 1JQDA 5U4XA 2AOWA 1Q0SA 2OB2A 1NW6A 3GGDA 1VQ1A 4RYLA 5C1IA 3G2MA 4YUVA 3LPMA 5EEHA 5BXYA 3AJDA 1M0EA 2ESRA 2I6GA 4PYLA 4BLVA 1QAQA 1VIDA 2QRVB 3THRA 2IDKA 4KWCA 3SVZA 3OZTA 1KHHA 1YB2A 3C0KA 5KQRA 1G8SA 2NXNA 4EVIA 5FHRA 2PKWA 4BLUA 4CTKA 4PYKA 3EGIA 1XCLA 2ZWAA 4NECA 3G5TA 5HIIA 4YUWA 3VSEA 2ZIFA 2AN5A 3HCCA 5JUWA 4C07A 4R6WA 5F2OA 1SVUA 2BR3A 3OCJA 1O9HA 4HGYA 1O54A 5CIYA 5HOQA 3SSMA 4RV9A 4KDRA 2O0LA 3UWPA 2GAFA 3EEOA 3PTAA 1L1EA 5FQOA 3PX3A 5EQJB 4AUKA 3T7TA 1XDSA 4R05A 3P8ZA 3R9XB 2GS9A 3OPNA 2ZSUA 3M4XA 3O7WA 1N7JA 1VP9A 3OE4A 3HVIA 3TPZA 1FP2A 5DM0A 2IBTA 2P41A 2CMGA 4ATNA 1JG3A 5EIWA 3RODA 3ORHA 4YMHA 1Y8CA 1IM8A 1WZNA 4QTTB 5FA8A 2JHAA 3RW9A 3KQVA 4XUDA 2OB1A 4UOEA 2AOTB 5HZMA 2PY6A 5KS2A 2JJQA 2NXEA 1DCTA 1RI2A 1JG1A 2G8NA 3I64A 5CCBA 2GLUA 1AQIA 3TRKA 5LSAA 2HWKA 5LQKA 5EMLA 3ER8A 1EAMA 2R6ZA 5E8RA 1XDZA 4DCGA 4AZTA 1H1DA 4ISCA 4CWAA 2ZVJA 3BZBA 3SX0A 5K0BA 3DH0A 5FADA 2H00A 4AZSA 1YF3A 3BKXA 4MTLA 3K6RA 1SKMA 2NXCA 3MQ2A 3E05A 3C3YA 4GOLD 3CVOA 4K6MA 3QOXA 4EQZA 2DPMA 1OR8A 3HEMA 3T0IA 5LR6A 2HTEA 1WXXA 3PFHA 3KPVA 3NDJA 5D1HA 5E2BA 5GOZA 1YFLA 4MHTA 3DULA 3LDGA 4DMGA 2G71A 2G72A 1VP3A 3MTEA 4GF5A 2P3LA 3IV6A 2ORED 2ZBPA 5DRYA 2C7OA 3GRZA 2OYRA 1XXLA 5CVEA 5K0GA 2V7EA
chains in the Genus database with same CATH superfamily
4G07A 4GMDA 3JQGB 4M9ZA 5F4ZA 4V1CB 3ADBA 5EIFA 3JQPA 2R1UA 2ZS7A 5M04A 3R5XA 3TIVA 4JKYA 2FPGA 3B5EA 3CZAA 4JJKA 5EGNA 5ETJA 4W5NA 1XL0A 2Y05A 2B4TO 3GLUA 1OD6A 3H18A 3IEXA 5CB4F 3VZQA 3ESBA 2EHJA 3PDCA 2O8CA 1ZNWA 1KXJA 1XZGA 2FE1A 1C9YA 2FEOA 3G79A 1M2NA 1Z9BA 2PXAA 3PPXA 5EWJB 5FA5A 3RTEA 3RVDA 3I8OA 4BRUA 1YU6A 2JGJA 3WRYA 4G0WA 4BWVA 2O5EA 3OLVA 2KWIA 4WKCA 4UTZA 4G81A 1NA5A 2ODQA 1M5TA 2FNAA 4I9FA 2ECFA 3R6TA 5A7HA 1YK0A 1EWTA 3Q12A 4JY7A 4WTOA 3CLSC 4BN5A 2BZSA 3MW8A 3K0SA 4JYPA 4H7EA 1NQVA 3KUKA 4UBLA 2F43A 4QTUB 4UPEA 1WD5A 2PO7A 3QNWA 2EWWA 4OAQA 3R77A 4FI3C 3IQHX 2Q6VA 3FNRA 1L7QA 1MAUA 5JAIA 3RC2A 4DBZA 4XWOA 2SKCA 3DZ8A 5LDGA 3DOCA 1EFUA 3H6GA 1YMUA 1L5LA 2CT8A 4IYJA 2VHCA 2AW3A 3BSSA 3I2KA 4CM8A 5FPKA 4OM7A 1RSZA 1MJGA 3EOAI 3MWJA 3AHHA 4G8BA 1X7ZB 1YUBA 3P0IA 3W04A 4KNYA 2PRZA 2NU9A 2WBLC 3AUTA 3B7GA 3RYCB 1E1NA 2OESA 3T4EA 5DHUA 1BVYF 4I4TA 4RAOA 3I9V6 5DN6A 4C7XA 1Y6JA 4RCYA 1KXZA 1RZRA 3N76A 1KRHA 1V25A 4L2IA 4AZ3A 4BO2A 5M5BA 5HS6A 3VR3D 1VI5A 5I7HA 1EE2A 1H6DA 4FSXA 3STWA 1V8OA 2P68A 1YNOA 4M7PA 2BFOA 2J9GA 2NQTA 4OYRA 2B4AA 3RUCA 3RU7A 1DEKA 5F9HA 3DC2A 1QFZA 1PK7A 1V41E 3DKIA 4PCLA 4O5AA 1G2OA 4RXUA 2ZTUA 3UWMA 2V7XA 1M2VB 2NO6A 1JR6A 3WGQA 4FYWA 1Z3CA 1G60A 5AHWA 3GA7A 4B3TB 4LKRA 4M8IA 5FEMA 5JZSA 3AG6A 5CJJA 3T5MA 3RT9A 2QE6A 2PXHA 2RI0A 5AIBA 1XB2A 2HIGA 4GPTA 4LYJA 4PM4A 2DM6A 3ILVA 5BVHB 2E85A 1O1YA 1K7XB 1ST2A 2NTEA 2PYIA 3JXEA 3NTVA 4X3PA 5D5PA 5EQFA 5JD3A 1A1VA 3RARA 2P9FA 3LZDA 3OWOA 4LK2A 3TO5A 1S8NA 5M34A 1NBWB 1UKEA 4OJQA 2G1KA 3VU1A 3PHLA 5DBHX 5CXUA 1NOKA 1Q1NA 3OY2A 4UBMA 3P0RA 4Y9DA 4YDHB 4WQMA 1KY2A 4JSRA 4CKCB 3GJ8A 1N5OX 4DXHA 4EA9A 4BLPA 3SE0A 5AVTA 2XZLA 5HCIA 3C74A 2PZFA 2EXXA 1O6ZA 4YA6A 3OPQA 1J21A 5EY5B 4KEAA 5JASA 1Y81A 2GSDA 5C37A 4P4SB 2FLWA 5GV7A 4OH1A 5C1DA 1JYSA 2CXPA 3R1IA 5BR7A 3BD6A 1E2JA 2PRSA 2CMKA 2G5CA 1T2FA 2NXWA 3WMEA 5BYKA 2WMDA 3SFTA 2NT3A 4EARA 4ZAFA 2VNHA 4ER6A 1M7HA 4WBNB 1U2PA 5ISMA 3EQ6A 1I32A 3Q5DA 2EZ9A 2Y0PA 4ME6A 4P3YA 4YAFA 2LKDA 5AOAA 5FQNA 2CY0A 4NFSA 4PS1A 4QIHA 4CTMA 3GJ7A 4TV9A 3OZSA 2C61A 1YI0A 3AV3A 3E9NA 4PZEA 2V6JA 3CGWA 2HSJA 5CTAA 4JUAA 4P98A 1ODIA 1QFSA 2C83A 3RKUA 1COWA 3TM5A 4LEIA 4D1YA 4LF6B 4B7XA 2QMYA 1JXQA 2H2DA 3D8RA 3NEYA 4PANA 5CM9C 1SQ0A 4I4NA 1KYWA 1TQ6A 1FXWF 4HPJB 1NVVR 5TQJA 2A0UA 2BDUA 3JPWA 3Q9SA 1YASA 1TRHA 2DTXA 3S2GA 1SHUX 1AKEA 3QJGA 1XTPA 4XJSA 5BN4B 4E5SA 2E7ZA 4UAJA 2QN6A 3LXMA 1Z2DA 1ZMXA 2YINC 5EERA 1WCIA 1X70A 2WAYA 4EPXA 1QYRA 5C52B 4UAVA 1RC8A 3Q5GA 2OE2A 3NHKA 3M6LA 1EG7A 1O5IA 1YQXA 4M36A 13PKA 1GNPA 2GCPA 4RKQA 3SOPA 1LBQA 4TKMA 3UWKA 3WFIA 2WHEA 1OXBB 4JMPA 3UT6A 3MIIA 2VRNA 3L4JA 3ERCA 3K9CA 5HIMA 4U0KA 1Q17A 4G37A 4OB7A 1N3BA 4WW0A 4YJ2F 2SKEA 3X1MA 4A8PA 2DBZA 3F5QA 2CVQA 1NLZA 1KQPA 2WWGA 2GX6A 1FYXA 2YS7A 3QEMB 3IUMA 4LPSA 1NUQA 3RRMA 3UJAA 4ZIRB 5IX8A 1VIYA 2RHLA 3PF8A 4R9UC 4C1NA 1YS9A 3KQYA 4JQCA 1YZYA 4HNAA 10MHA 4R8RA 3PNMA 3KXKA 4EJFA 4FX2A 4G1UC 2X4IA 2JK1A 3IEPA 2P7IA 3ESRA 2NUBA 2ZJ1A 3PI7A 2V7QD 3I61A 1N1EA 2VBIA 2VK1A 1MIOA 3TAUA 1GQFA 3IQEA 5TR9A 1XBTA 4V0QA 2E2WA 4KQWA 1N5MA 1OAOA 4A7PA 1W36B 2KQUA 2CLHB 1GCGA 3UEOA 1WSDA 2A9JA 3WLQA 1BDHA 3WZLA 2HSEA 5HMMA 3RCBA 4J0KA 4CEJB 3R9XA 4ZO4A 2H18A 5ALVA 4BJ5A 4ZGWA 2WU3A 3W7VA 4NMWA 2AI2A 5IAJA 4B7UA 3BMCB 3GU3A 3CVWA 2V58A 5BV1A 5DGIA 4FB5A 3PBKA 4PEVA 5ECDA 2VLBA 1VKHA 2Q3EA 3ZDDA 2OKGA 1TM1E 4XRGA 2H1OA 1IHXA 1LDYA 3JQFC 3PGJA 2C5AA 3IE2A 1NMEA 4EYKA 1J99A 4YCAA 2O3QA 2WVAA 4RIHA 2CHUA 1DKUA 2NTVA 3ZVKA 4X6YA 3CKMA 4RKYA 4IJ5A 2QN3A 2JVKA 3HKEB 3KZXA 5E3HA 5IU6A 3UHAA 1EI9A 1F8UA 4DR6B 1VJ5A 3OURA 4MWZA 2PJUA 5EZSA 5F35A 3E8SA 1MH1A 1YT5A 3PLRA 2ZJ0A 1R4ZA 4GVXA 3UMYA 1NVAA 1D07A 3CJTA 3Q3IA 4QYMA 5C51B 1UKBA 2C9MA 3LPNA 1Q1BA 1IOWA 4GUDA 5EIBC 3ZTYA 3VPBA 5AVWA 1P39A 2DETA 1VHDA 2YJ3A 1AMOA 4M87A 1F9AA 1Q1GA 4OOFA 2BM0A 2QL6A 3PD7A 4K88A 4FYHA 3E5MA 1VIMA 2KMLA 4I9HA 4OL0A 1VI6A 4WJLA 5TIIA 3NOVA 2IP1A 3ISTA 4M1YA 1OX4B 4N5MA 4EVSA 1QE3A 3K9WA 2QRHA 5CCXA 2E5LB 4TKVB 2A92A 1BGVA 1T9CA 3QMWA 4YP0A 1AH2A 2KJQA 3FY4A 3GRFA 3MYYA 5CNMA 3IBGA 3O4GA 4ZDWA 1L5WA 2X15A 4MS4B 3KBOA 4ZO9A 1NV8A 2WP0A 1JV2B 1GGJA 2GK3A 1Z4OA 4E0BA 5JD6A 2JAWA 2F8TA 3LYUA 4G0QA 4IVNA 1SXJD 2FMIA 2VQFB 2L82A 4K7JA 1J1UA 4F4UA 4Z7JA 1BXGB 1I4WA 1P2VA 2HIHA 2REOA 2CL7X 1V5WA 3UKDA 1SURA 3TZEA 1Q16A 5DIZA 2CHGA 1YHYA 2BFCB 2D7DA 3IV7A 1SBYA 3FD8A 2JFYA 5ALGA 3DTVA 4QQFA 5AXAA 2JVJA 3F5FA 3WKDA 2B4YA 5H8WA 3C5CA 4LYDA 2VDWB 5CU7A 4KTVE 3TMAA 3X2SA 3X0DA 5COQA 3P2IA 4GU5A 4PX3A 2ZI3A 4UQOA 5DB4A 4FGLA 2Q9UA 3F8WA 1IMJA 1I4DD 1BDBA 2GZ1A 3PDHA 4RK1A 1EDDA 4OHFA 4NU5A 3KHTA 1GYQA 2APJA 3IVXA 3PEYA 2CFOA 2CZQA 3IURA 1I9GA 1LX7A 4LXGA 3BRSA 2PUGA 1P19A 5IC5A 3EC2A 3NS7A 4E4RA 1SVSA 4WRRA 3O1JC 1P7CA 1GTZA 2UUAB 1NNI1 3ZIAA 3F7NA 3HFJA 3IXLA 5GGXA 1UKYA 2H0AA 3GBPA 2ADMA 4EQ6A 4PYIA 1ZVQA 1R5OA 3B1JA 1OBFO 3OPYB 3W90A 1S8OA 1DBRA 3E22A 3WLKX 2H3HA 4FOSA 5KAMA 1A9XA 4DUYB 1CB7A 4O6VA 1B8PA 4J7AA 4US1R 4JYBA 3BBLA 5EJ9A 4E5DA 1L4HA 3JVVA 4LS3A 1ZCJA 5FUMA 2VJAA 1HA3A 5IABA 4URHA 2WDPA 2VNSA 4OHBA 2IHNA 3TE7A 3EBPA 3QFCA 2FR1A 3THOA 5KVVA 4I5EA 2CUKA 3H5AA 4QTXA 5G1OA 2VYQA 4GR9A 3P2MA 4KMMA 2F2TA 3LDHA 1LW7A 1JJIA 3SZ3A 1GR1A 2FFJA 2YNMC 4B82A 4EM6A 2Q7XA 2VYCA 1UBKS 2IXDA 2J3HA 1RWPA 2HYIC 1QV6A 1JFRA 1S6YA 3KR0A 4NSNA 1ODSA 2QZZA 3EWAA 5JJLA 1CNMA 3EZ7A 2FWJA 4BLTA 1PSZA 2P3SA 4R6XA 4HB4A 1NXWA 1T0IA 3L5KA 1TRKA 3ABRB 4DIEA 2Q3HA 3ICEA 2ZKIA 3PCXA 1G9SA 2QXYA 1IVNA 3SJCA 5I8WA 1GQRA 2C2MA 5AUNB 4JYZA 3ZGVA 1NTOA 4X5OA 3MAAC 4JL8A 5I7RA 1UT5A 4DLKA 2UAGA 2GTHA 3ADKA 2BGJA 3Q87B 3I04M 1KJQA 1NE7A 4XDHA 4UUAA 5D51S 4PX2A 2ZTLA 3GLFA 3RG2A 1BVUA 2BONA 3FVVA 4V03A 1ZBDA 2O2YA 3KNZA 2ISSD 2PH5A 4LXIA 5LYJA 4BMVA 1Y3BE 3A32A 5REQA 1CUYA 1Y98A 1WM1A 3VZBA 3EGWA 2JH9A 4UJ5A 4FQ5A 5DNDA 4BP8A 4LNAA 1NJ1A 4YJGB 1WBDA 4RVOA 4O8ZA 2NVUB 3MNFA 2HA4A 3FRIA 2XUHA 3BIWA 1GNRA 4GI5A 1TW2A 3H1TA 3VHXA 4BO1A 4BATA 4MPPA 1O57A 4AJOA 1SAYA 3NBZC 2EFCB 4HLDA 2ZWIA 1EQAA 1LWNA 4IZHA 3QTTA 1F4PA 3G9TA 1T3ZA 1K98A 1DV1A 3QWFA 3OE7D 3IR5A 4IQ4A 2ZIZA 2IVZA 2WZBA 4W9RA 1H4TA 4WIAA 5G1NA 2AMJA 1C30A 4YRTA 1ITZA 4OUDA 3HEBA 1G20A 3O3NB 3QQPA 3KJNA 1DX4A 3QBDA 4Z0NA 1N25A 5TS3A 2YFHA 3F4LA 3KU4A 5KVCA 1BU8A 1G98A 1G8FA 1UWVA 3NJ8A 5P8WA 2HF2A 3PLNA 2GD6A 2CWWA 3DEZA 5FWYA 2PXXA 2GA9A 2J09A 3IAS6 4X24A 1FFGA 1S8FA 2ZE5A 1D03A 4AIRA 3A4IA 1W5FA 1Q0SA 5I7EA 1TC1A 2YZNA 2PLRA 4J7XA 3AETA 4FMCB 4MRAA 3HCOA 3U4HA 5A5VA 1N6PA 2V9PA 1OSNA 3IOEA 3K4PA 3DEIA 3PQ3A 4ROTA 2UZ1B 4BLUA 3PNSA 1NNLA 4IDPA 3UC9A 4PQGA 2N42A 2OXFA 2QX9A 4BHTA 2ENUA 3DOJA 2AN5A 4ND5A 3PJRA 4N54A 2NOAA 2F43B 2FWNA 1CF2O 1OF1A 2QJRA 3IE0A 4GPZA 3TAHA 2ZQZA 4URWR 3V4ZA 1T3HA 3HFRA 5FL3A 4M89A 4ND2A 1FU7A 1VL2A 3RVBA 3GLFE 2HRQA 1Z2NX 3KZCA 2CYBA 3PC4A 2NUTB 1TDJA 2IYZA 4FFOA 5ECGC 1M2EA 4P3XA 1Q3TA 2G5TA 5CTJA 1VP9A 2D5CA 4ZRNA 1G3UA 5AKHA 1Y8ZA 1FP2A 4CM8B 4O4IF 2FDXA 2BP7A 1Y3DE 2HM7A 5BQOA 4TUYB 3HYSA 4HLUA 2P9ZA 3JQ9C 2IU0A 1B16A 3PXXA 3EY9A 1U9ZA 1JJBA 1RR6A 2O52A 1D9ZA 4R1LA 2PUAA 1OVGA 1SOAA 1WJGA 1Q50A 4ZPJA 3GUYA 2I03A 4GECA 2ZYRA 2Q7DA 3PUVA 4X8MA 2V0GA 4FQ8A 3EXFA 5LSAA 1G20E 2ZJAA 3B1VA 3OEHA 5DT9A 1Q77A 4IMPA 3EDCA 5JAHA 3D8BA 3W2TA 4O2BA 3ZWPA 3F6SA 3MGCA 1RWVA 2CEKA 3K0KA 4YR9A 1J5XA 2RHRA 4D4LA 4CIAA 5FADA 4LRQA 1W36C 2C5FA 1C9JA 1GA6A 1PVVA 1YR2A 2Z5GA 3BKXA 2F64A 3K6RA 3LFHA 4OVKA 1GT6A 5ESRA 3E05A 1ODTC 3QGMA 5EA2A 4HEQA 5LP6C 4E5KA 3B2QA 4QWMA 1FDIA 1DRWA 1IZ7A 1J9ZA 5DHFA 5EWMA 3ZD6A 2A57A 4I9UA 4B47A 3T4XA 4FE7A 2OCPA 1R5NA 1VP3A 3M5DA 4YRKA 5IAGA 2OYRA 2YDXA 1T2CA 2QQ0A 1AUOA 1Z6GA 3G9ZA 2D8MA 4YAEA 4BFWA 3A6JA 1KVQA 3BB4A 1RMQA 4WK6A 1NVMB 4YJ3B 3K8QA 3CG4A 1H8EA 1ZGGA 2WKRA 1VRWA 3ENNA 3G8DA 4G8JA 5HG0A 5TF4A 2BSAA 2O3JA 4K28A 5AUQA 2FEMA 4EYEA 4UU7A 2ZM5A 3IMCA 1NSFA 2W6NA 5SYNA 1LEHA 1W19A 1XDDA 2GI4A 1PR9A 5AKXA 5GONF 1CHDA 1AX9A 3KE9A 3TKAA 2BFFB 4UBJA 4B17A 1XLUA 2EKBA 1W1IA 2H5JA 3PFNA 4RVUA 3A37A 5AHOA 4AO6A 3KETA 3L2OB 3Q8MA 1BWPA 3SEQA 2P8JA 1NPTO 2OV8A 4ZHQF 5IUNC 1NJ8A 1XJ0A 4OU5A 3C24A 3LLVA 4R7TA 1C0KA 2XE7A 4D25A 4POOA 4TV9B 1IPHA 4NRDA 4QM6A 1L5OA 5LXTA 4UHHA 4DC1A 2VUHB 1KRXA 4F9FA 3QHPA 4FYMA 1N75A 2VPXA 3QXXA 4HO1X 3KDSE 5E6RB 1RJ9A 5ALJA 3SEFA 3ZN2A 4XH9B 3ZW9A 2WILA 1KH3A 5A5EA 3EEYA 2Q07A 1Z26A 3GC6A 3LQ4A 4HBZA 5F1OA 3AL2A 3QOFA 1E3EA 1PEDA 2I6TA 4FJ1A 4GXRA 3K6KA 3LFUA 4RL4A 3C15C 2E4YA 5IPFA 2D0OB 4QPZA 4WD3A 2AJBA 5DSZA 4KC0A 3VHLB 4N82A 3WDLA 1Y3AA 2GPTA 3D7KA 2OHHA 1PJSA 3MOGA 4FFWA 3CLVA 2ETVA 2JATA 3VJRA 1CQPA 5CB4A 3ZU2A 4KLRA 1FX0B 4RJJA 3TS1A 2V3WA 1CY8A 3BL6A 1XYVA 3D6VA 3AF4A 4JOSA 4TTSA 1PYGA 2OPBA 3CX7A 2ODWA 1SIOA 1I2DA 1T4MA 1ZCBA 3DZHA 3HA7A 1J8VA 3IJEB 3KKMA 4OMCA 4NU8X 3UBMA 2C4VA 5KPDA 1ZMRA 3N0VA 4BPRA 2HBZA 4NE9A 4B84A 4ZYWA 4QUJA 2ZCJA 1OWNA 1DELA 4KPGA 2IGBA 3M5CA 3RT1A 1LBIA 3M34A 3ZHZA 4BCDA 4UDYX 1ESNA 4IDDA 5FLEX 5HKKA 4Q3BA 2ZZMA 3NAZA 3WLHA 2QTVB 1H4VB 3DV2A 4IDOA 3RREA 1E79A 1PJ3A 3FPAA 3K16A 2E9SA 3C14C 3H9CA 2WU0A 4YRLA 2P9QA 3WTBA 1EWRA 1DIBA 3L0SA 3M9XA 4QE3A 4G5HA 1J0BA 1M66A 4M0LA 4RV4A 1A7AA 3SS8A 3WIBA 5FWXA 1MIOB 2Z6UA 1PR2A 1QH1A 3JRWA 1J70A 4NMHA 2C31A 1I4EB 5E95A 3NTLA 1P2FA 2WHPA 4MVJI 2VDVE 4BJ3A 3DSRA 3LY5A 2R4UA 5FULA 3VUEA 1MJFA 4WEQA 2KBFA 1FW6A 1PV4A 4QTZA 1G63A 3E9EA 1YV9A 2QWXA 1LI4A 3F6YA 3AUFA 3QPCA 1DPFA 2C3YA 3I2YX 1FZTA 1SUEA 5HKAA 4OFXA 4JX8A 1XR3A 3JWHA 2Q1UA 4AJJA 1KBOA 3BWYA 4GLJA 3UCXA 3ZHBA 2XYPA 1X7WB 3B36A 1XYGA 1XZIA 2JIRA 4O1IA 2JIOA 2ZBFA 2JFBA 3IA2A 1GZ6A 6ABPA 1RPTA 4ZOQI 4BGIA 3QVVA 4B71A 1QFXA 2AJTA 2CLCX 2Z30A 3ZV4A 4K87A 2HLDD 4F5ZA 2CL6X 3IUJA 4DDTA 1YS2X 1AUXA 1IXKA 1MPXA 4PLYA 1TO6A 2IY7A 4AJ1A 5CP8A 3CBQA 2JJ2A 5JNTA 1U2GC 2G9NA 1QZTA 3P9IA 3QU9A 2EJTA 4WLFA 5GZ3A 1TU4A 5AIAA 1R0SA 4NPAA 2QR3A 3BAFA 2C97A 4FHEA 3VI4B 1V3QE 3MG9A 5JVDF 5A6SA 2O6LA 1U8XX 1U5BA 5K01A 3UANA 4FCTA 5IC4A 3AW9A 3NVDA 4NI5A 5BN5B 3LFTA 4JP1A 1V48A 5BMVB 1Y3HA 1JG6A 1HV8A 2PCJA 2X77A 4PIVA 1VA4A 3HCRA 4PLTA 4N1AA 3RC9A 3LJKA 1T5BA 4KSYA 4UHFA 1RKBA 4IWYA 1DBSA 1PDOA 1M73E 1T6ZA 1KMHA 4PAOA 5KNBH 1KY3A 1XDUA 3TLAA 2LR0A 1X7XB 3OCYA 1BKDR 3TBFA 2VHUA 4WCDA 3T7EA 4E2WA 5EQDA 1E9RA 3K1TA 5A2GA 1WMSA 4AY2A 1RBZA 1NWCA 3L43A 2G1UA 3ESYA 2BEWB 4Y0AA 2PJDA 1I7DA 4CEHB 4AYXA 4GRAA 2WK1A 1ZD3A 4Y6LA 4C4SA 2UZ4A 4YUZA 4G0YA 4UMVA 1ZXBA 4TLDA 3VXKA 1WCYA 3MWKA 1KVUA 1QE0A 1ZIOA 4UEKA 5CPBA 5A3QA 5KSOA 1NC3A 5LWQA 4NU6A 1PQPA 2ZJBA 2C29D 3ONVA 3FYTA 2M1ZA 4BX3A 5H4GA 5LD2C 2C5GA 3NAGA 4ZVLA 2GKGA 1QVVA 2QJTA 4QHSA 5CLJA 3DW1X 4B4DA 5F12A 5TMPA 2YRWA 2FMHA 3RWBA 2FRDC 2ZU6A 1HLDA 1GADO 1GPYA 1PQYA 3I2IA 3IERA 4FKMA 2IHVA 3H75A 1EFKA 4H4CA 1PR5A 5AYVA 3AOGA 1M6YA 5F76A 1KDZA 4AJEA 1L7RA 3MWGA 3PC2A 4FDLA 4DT1B 3NBUA 4GP9A 3TL6A 2RK6A 5DT2A 1QJCA 4K6KA 1U0LA 2JDID 3GLVA 4PLZA 1ELOA 2QG4A 1RVDA 4ND6A 4CQMD 2AFHA 3RS4A 1U9CA 2WWXA 3C1AA 2BKAA 3F4BA 3DMYA 3GRUA 2WWRA 1OIWA 4CF7A 2XXAA 1LK5A 1WUIS 2WINI 1NUSA 2B3TA 1PSDA 4OFZA 4M1MA 3WYNA 1R0CA 5I9NA 2AN4A 3O8LA 3ZHYA 3LP6A 4CXMA 3G1WA 1GLVA 4HGRA 1MQ8B 1A8QA 2AOTA 5HJ5A 3T3GA 5JQGA 2VBFA 3P0HA 4R2KA 4U9HS 1YR1A 2I78A 4QREA 5ALPA 3I6MA 1SXJB 1D2RA 1TUBA 2FKNA 4LYHA 2J7PD 5JFOA 1KOLA 3FOCA 1RQNA 1VMKA 2CXUA 1CY1A 3IMEA 5ICFA 5K3OA 1PG2A 1P2UA 2GF0A 2QT1A 3NHPA 4X54A 3RVSA 1FFEA 2A9OA 3A7DA 4JWKA 1RJDA 2WHRA 3HP7A 5DEOA 3S5UA 3HCAA 4RIFA 1J2UA 2HQRA 1OBHA 1EQ2A 4GOOD 2P9HA 2XMCA 2HHJA 4LBVA 4UVIA 3RC3A 4ZICA 2JFPA 1E9SA 1XA4A 1NVTA 2FQWA 2YICA 2LZ0A 2QQGA 3N2KA 3R3HA 3UWDA 1U6JA 1EUQA 2I6QA 3FWPA 1NKSA 4UXJA 3M4NA 3VPGA 5DOZA 1M1ZA 2G9QA 4JJ8A 4CMGA 3ETHA 3ITDA 4AJPA 5HKBA 4WK4B 2R8PA 1W0CA 3WYDA 1G8HA 3LCRA 1GZVA 3KLNA 1PNOA 4N7MA 4RK0A 1MTZA 1O0CA 2Q5CA 1A04A 3O1HB 2FMUA 5CB6A 4HD8A 5CURA 3TXYA 1D2GA 1UZLA 1V37A 5CDSA 3DF9A 2ZSBA 1CRLA 3D2BA 3JU3A 2B98A 1RXWA 3PGXA 5K3DA 1YFJA 1U0JA 3IVCA 3L6CA 1AZTA 1ZIPA 3NHSA 4FONA 3KAKA 4V1CI 4PWZA 2Y4NA 2WV7A 2X40A 4K8OA 3LC0A 1NULA 1MEJA 2GUGA 4G0MA 3ANXA 4NNJA 3LA6A 3NWBA 2PMDA 2LDBA 1KC1A 3CCBA 1LLFA 3VR4A 3CSUA 3VNAA 5DX1A 3QMVA 4RQAA 1QV7A 2ICAA 5KINB 3PUYA 1E2LA 2MIIA 4MV9A 3DEKA 3QFRA 3HWRA 2AJ8A 2HRCA 3GUUA 1OHHA 5K3AA 2ZYIA 2AFHE 3GXBA 2P4QA 3MJTA 5I9IA 4MV7A 3QVSA 2BTQB 4GMHA 3O82A 1ORHA 4MJ7A 1X87A 3O4IA 3AH8A 5AW9A 1GNSA 3AVQA 4MVJM 2JH3A 3GLSA 4EY6A 1I7PA 3DDCA 3AP3A 4PZUA 2H1FA 3DBVO 3EN0A 3RABA 2J6CA 2OP0A 3DM9B 3Q88A 1WXWA 1MC8A 4JWTA 3UHPA 3X2FA 3MIZA 3PNYA 4GLBA 4DNOA 3P9YA 1VJGA 4ZT7A 4LFCB 1AHHA 4ERNA 2AN1A 3IAM1 2QTHA 3AWDA 4ONEA 4HMQA 3SVTA 1MH9A 2R1TB 4CM1A 2ZUWA 1YNSA 1Y5LA 1W6RA 1D4OA 3ELWA 4MCIA 3LBAA 3R5SA 4W7IA 4WFQA 4Y6GB 4O2RA 5DHQA 4YCCA 2Q0QA 4YV1A 1JQ3A 2OGWA 3L6BA 4H35A 4LI3X 4TV8F 3M7IA 3SE7A 2DWCA 5EHGA 2AYZA 5EXDA 4J3NA 3VVCA 4AG6A 4WERA 5IFKA 3NWOA 3UMFA 4YJKA 2XB8A 3EGOA 2BHRA 4GI3A 4ND4A 1TK2A 4LV8B 4BWFB 1GGHA 5COAA 2QVBA 4DOMA 2AZ4A 1V39A 1N2CB 3HR8A 1GFZA 3UK7A 3WTCA 3DTNA 2V59A 3IUNA 4B5KA 2ZZKA 2UZ0A 4GMGA 2MCFA 4LF7B 3D3JA 4KQKA 5DLDA 5JJ5A 3D0QA 4H60A 3BD9A 3PNKA 4QVKA 3FCXA 3IDQA 4TN1A 4TQ9A 1O87A 4NX2A 5JCJA 4CIYA 2WT4A 4G36A 2I1LA 3K0FB 2JIZA 4NCXA 1R6VA 5CIWA 4DA6A 3AVVA 2PZMA 3LX6A 2GHIA 1YIOA 1Z07A 2EU8A 2DF8A 3EXFB 4BX9A 4R1MA 4C88A 3P45A 4X1IB 3ZW8A 2XA1A 2LWIA 1W88A 3E9ZA 4H27A 4TWAA 4X41A 5CVCA 3A04A 4NABA 2AC2A 4CM4A 5GIPE 1QP0A 4MHSA 1C1XA 2FSSA 3BIXA 2XTAA 3A6EA 3H83A 3RB8A 3RFUA 3IAFA 3RSSA 3OJXA 1ISRA 1UQUA 4NEGA 2OZLA 1WOMA 4G5SA 4XR9A 4YP7A 4ERXA 1P9WA 2BHSA 2Z09A 1P0QA 3JQ8B 3TW0A 4C0LA 4MDEA 5ITZA 3NM5A 3H2YA 4S1VA 2V7BA 5EIOA 2ZJ5A 1SKYE 4LDNA 3DDHA 3NYRA 4KN5A 3V1LA 4Y2UA 2QMZA 2RGRA 2AXPA 3ENVA 1K6XA 1N2SA 4M1EA 2P4HX 3ESQA 1MPTA 1XL1A 1KK2A 4RORA 2Z2XA 1K3UB 2GD1O 4OUKX 4QXOA 4RK6A 2IITA 5DM4A 4C43A 1KYIA 3LX5A 2QXUA 2VG8A 3NW9A 1TAUA 2PX0A 3DOIA 4RZIA 2QGZA 1I7QB 4RW0A 4XGNA 5A0FA 3VX4A 4NU0A 5JZ9A 2AOVA 3F46A 3I6QA 3DFKA 2PNJA 3VZSA 3HRHA 2ZKLA 3LDUA 2YW2A 4WPGA 5TMBA 2IF0A 4RESA 3RK1A 4C0JA 1ZVMA 4LTDA 2GNAA 1ZFNA 4ARUA 3GT4A 2NYVA 4F84A 3WXBA 4EHDA 2YYSA 3PA8A 2QV7A 4HFNA 3WI7A 1V35A 2QAGC 1PBNA 2YBDA 1HNWB 2FPSA 3RFFA 1RQ7A 2RH9B 2NU7A 1YE5A 2P79A 5DGDA 5BWNA 3W9SA 4KITB 3R5HA 2HUNA 4LYAA 3SEAA 3WWCA 4EL5A 5FDFA 3AYXB 4CHTA 4X1KB 1S4MA 1ZOLA 3PIDA 3SHOA 3T1QA 3WMXA 4BQIA 4I1RA 1G4AE 4F2PA 4X62B 3ZJVA 2HXYA 1US8A 4FC7A 4BE7B 4U02A 5LXTB 1JDNA 1GRVA 1S5PA 2G9ZA 2R7LA 3BK2A 4D98A 4H1VA 2GHQA 1OV6A 2AQ8A 2BFNA 1PR6A 1E5XA 3LU1A 1VTKA 3ROPA 4HGYA 1IEVA 2Z5VA 4DEVA 5BNWA 2GPNA 1N2ZA 3OTHA 2YZKA 2VPZA 4KDRA 2WNIA 4I5FA 4EGJA 2VXOA 2REXB 1YKFA 4JR1A 4MUFA 4F06A 5IJ9B 3O8OA 3T7TA 3NHAA 2ZI5A 1UWLA 1N7JA 1AQUA 3H8SA 5DM0A 2P2DA 1OLUA 4MINA 4GYYA 5TJHA 5CB4B 3ZIDA 3OA0A 3WLFA 2P30A 4YP5A 5EKTA 4YQEA 2C7GA 3FPKA 2C2YA 1NATA 2H31A 1L5YA 3WS7A 4DRXB 3AI2A 3RUFA 1GG5A 2AV6A 4U7HA 4XW2A 4BMYA 3AF1A 4ZO8A 2J48A 4EECA 3CT4A 1QG6A 2P91A 3OETA 3EUWA 3ZHUA 4BO5A 4H3SA 1M2WA 3EPRA 3EVNA 4S2UA 3SHQA 4LQDA 4C4PA 2OUKA 5ALWA 1AQIA 3X1JA 2RBEA 4Q6BA 3KSZO 4RCZA 4WZBB 2DSNA 2P5UA 4X7BA 3BJZA 5EHZA 4MVYA 3D1VA 3L7MA 4DCUA 2JCXA 3AI3A 1P5ZB 4GP7A 2DOKA 2Z04A 5CMLA 3KDPA 4EATA 1ILEA 1KP3A 3U7FB 3RFVA 3RAPR 1OE0A 2NO1A 3CQ9A 4NPCA 4JN6B 5IN4A 2B35A 2VI5A 5CLFA 4JI3B 3BWXA 4K6MA 4WXRA 4DDMA 3MVEA 1WXXA 2IS2A 3LBIA 1GQYA 1R0KA 2GXSA 4JOCA 4YJHA 5GOZA 3T5PA 3A3OA 4K03A 5IP5A 1V1MB 2JF0A 4XASA 4IM7A 2FR0A 4KTTE 2CBXA 5C80A 1XNGA 3IV6A 3LKBA 4F3TA 2G1AA 2P4UA 3QA3E 3GHHA 4BBPA 5CVEA 2GJSA 3A6KA 4FNAA 1X9HA 4JL5A 2WHYA 4BNTA 3CVJA 3P4YA 2JZOA 3JARB 5C8ZA 3QELB 3VU3A 3GRRA 2WIFA 1ESMA 3OUTA 2NV0A 1DTWA 3GA0A 1N57A 1RI3A 4JYAB 2K7ZA 4XQ0A 1UZNA 4HL6A 1K75A 4ZJPA 3GVXA 4GWGA 2I5PO 3DCYA 4IEIA 4RVHA 4Y0NA 2JRLA 1UBFA 3ZBUA 1HQYE 4TXMA 1WNTA 1QZXA 2V4MA 3FYHA 5A02A 2EVWX 421PA 1AMUA 3P4UA 1PKEA 5DHAA 4TMVA 3FSGA 1XU7A 3BH7A 5FR2A 4V2UA 3OEYA 2B34A 4BP1A 1GTRA 1FFYA 2CHEA 2QVXX 2ZRKA 3RK0A 4ZK6A 4M9SA 4Q1AA 1MV8A 1T9KA 1VCMA 1K63A 2SHKA 5A6SB 2XH8A 3CZ4A 5FUWA 1XQXA 2R00A 2VWPA 4TL8A 1ONOA 2Y67A 5EE5B 1G2IA 3EC1A 4J0FA 4Z0PA 3S4YA 3WGZA 2D7CA 3VC2A 3LHIA 3M8KA 1XRSB 3VYTB 4CVNA 5C4MA 1INLA 1K0FA 1DCMA 4U6SA 5JAPA 1PWEA 1QIHA 2H9AA 4RSMA 1AIPA 2AYXA 3AVTA 3TYXA 3GAMA 2X2OA 5JNSA 4MO9A 4DCOA 4QYTA 1JEJA 4KAFA 1UJBA 4P0TA 1ZJWA 1XRQA 1BN6A 1AT1A 2P6OA 3U0VA 4UNRA 1AK2A 3AMVA 4Z4EA 4YEDA 2OCBA 3JRNA 1IG0A 3VNUA 2O1SA 1JEQB 4RA6B 4HMPA 1C7ZA 3JZDA 3QY9A 2C7QA 2BDTA 3WGHA 4KJZA 4D57A 3H5VA 3PFFA 3EEBA 3K0AB 1G1MA 2XUDA 5K0EA 1I3LA 4AMBA 3ILYA 3HXOA 1LQ2A 1JR2A 1LH0A 1UF9A 2VO1A 3C97A 1FP4A 3EZLA 3K1JA 4ILEA 1DX9A 4L9WA 3DBLB 1M2HA 2R8RA 3Q2KA 3U1TA 4BYMA 4DSUA 4II2A 2XECA 1F51E 4L5AA 1PRYA 2Q1YA 4XPIB 2RKBA 1RLOA 1J7JA 5E1OA 4AKTA 4EL0A 5HA5A 3K3PA 2JD0A 3P71T 2FG6C 3EA0A 4HDMB 4UE6A 5JZBA 5KU7A 2GRUA 3ZZTA 1YDGA 2PRJA 3IKVA 2Q5LA 4QT0A 2FSVA 3ND8A 3NHRA 5AK3A 3R7FA 1MENA 4LF8B 1MGOA 1Z36A 2BGUA 4CLEA 2ZIVB 1T5TA 2PR7A 1HEYA 1O03A 3DBRA 1CZNA 1G4HA 2X8JB 1DAMA 5DKFA 3UQZA 2CBZA 3GQBB 5EPEA 1W34A 2Y4OA 3FOAA 3KKKA 1GWNA 1Z6XA 1X1BA 3ER6A 4RNCA 3EARA 4D4IA 4ACAA 2XXAB 2RH5A 2OORA 3PNQA 1KL7A 5ESDA 5B1HA 2IXAA 2I9KA 1KYTA 2ZB8A 4HSEA 5D6OA 1M72A 3UAWA 5CA1F 5D85A 1L9KA 2WR8A 1NDUA 2B1QA 2E5FA 4KIGA 4YJ2B 4KN8A 1OJLA 3K71B 2R1ZA 3HSSA 4UDOA 5DX8A 2VAVA 5LU8A 7ADHA 3GJYA 1G9TA 2IV7A 4DHEA 1NG1A 4J0HA 5EI5A 3OZVA 5LP6A 4IV0A 4KKXB 4PG8A 2CCKA 1HURA 3GWGA 1E4OA 4R8KA 2HWYA 1DGQA 4G6ZA 1ONNA 4EG0A 2H17A 4RSGA 3PQ8A 1P4HA 5JAMA 1T10A 1Q0PA 2OY0A 4HEA1 4E51A 5KVQA 3VKFA 3PDIA 1S2MA 1SBCA 1BX3A 3DNFA 2PS1A 4BNLA 2UZIR 3TF5A 3A28A 2VN8A 2Z83A 3WP1B 5GIOE 4JUBA 1YZQA 1HFJA 4XWAA 1C5KA 2AZDA 5J4VA 4YRGA 2WZDA 4G2NA 4C3VA 3GLGE 3OT1B 3SU8A 4XUEA 4RLQA 1DPGA 2OGZA 4AIIA 2UZAA 1TA9A 3JASA 3OF3A 3L4SO 3E1SA 4CQMB 1EX7A 3HP4A 3IP9A 3Q3CA 4R1SA 2ZYGA 1IOZA 3IDZA 3JYOA 5ALTA 3CB2A 4BEWA 3QKSB 2QUBA 1RXYA 4J6FA 1JTVA 2OT3B 2GBIA 2IZOA 1P61B 1NMXA 2JFQA 1TKCA 2NVWA 1XEXB 1Z74A 2D74A 2QRNA 1FS5A 2XWSA 3W2IA 3KT6A 1CQZA 1VHTA 2P3QA 1E58A 1HDCA 3URKA 1QHSA 1Q2UA 2QI9F 4MV3A 4OEHA 1KZYC 2O05A 4Y2VA 1PNQA 2YWRA 5CGQB 1N2XA 1UBUS 5KWEA 1GO2A 4PQEA 4NXMB 2HU8A 1Y9ZA 1AKMA 3UA3A 4AFNA 2FSIA 1B6TA 2IYEA 1ACJA 3D3QA 3LUBA 1S2OA 2FOLA 1R15A 4IZOA 2DGDA 3K70D 1H3EA 4RL6A 3RF7A 1EXDA 2J41A 5TV2A 2J9RA 5JMTA 4BV9A 3L0OA 4X63A 2VZ9A 3UJ9A 2YV4A 2JGMA 2ZVPX 3TOZA 1IPEA 5I48A 4DMRA 2AEJA 1T4BA 3LZ6A 1PZNA 3QBVA 4H6PA 3HJRA 2ZTMA 4AB1A 3G9UA 3WNVA 2TRSB 3KKPA 1E7WA 1RLTA 1UOPA 3C5VA 2VCHA 2R25B 3W79A 4AP9A 3NKFA 4N41A 4ZOLF 2H59A 3RLIA 5KOIA 2G3YA 3AI7A 2FEKA 2QRMA 1JJ7A 4MITA 4MWBA 1NSTA 3WY9A 3KYDB 2R5NA 1RHKA 3FWZA 1Z75A 1UOEA 3HBNA 1RRPA 1H0SA 2FWRA 3TRHA 2EBUA 4WZAE 3EGEA 2FX2A 2J4DA 4FZ3A 1EVQA 1KJNA 3ROEA 1WTAA 3X1YA 1NT4A 4Z3OA 1EGHA 2ALJA 3KJEA 1H69A 3FTCA 5EXEA 2QX8A 3AUAA 2XUFA 2ZTVA 3CWCA 4HWPA 3PK0A 1C7EA 2YN0A 3E84A 2VH2A 1KARA 1LD3A 4E07A 5I8ZA 2CXTA 3ADDA 2IV3A 2JLSA 3UFBA 3HI6A 1Q92A 3A4TA 4JLOA 2O2ZA 1TEHA 5ES3A 4BB6A 1Q0HA 1G3MA 2H3EA 3CH5A 1Z5WA 4LZAA 1C7RA 1SUSA 5EKUA 3SLGA 4YAIA 2PSEA 1RRGA 4FK8A 3DAGA 3VJLA 2QF7A 4Q4CA 3QEAZ 4BFCA 1UXJA 2QUIA 2O50A 3ZTTA 4TYWA 3WADA 1VA5A 2W4IA 2W83A 2XEXA 4N8SA 3QNMA 2O2DA 1PGOA 3G2NA 3MT8A 4ABYA 4Y2GA 2BGIA 1U2GA 4QBIA 3NR2A 1KDRA 2O7VA 5ITVA 5FT9A 4NCHA 4BVFA 5DASA 1FYWA 4MQ4A 3DMPA 3QF4A 4DLNA 3U5TA 1FMTA 2W2PA 4DJAA 5DI9A 2O48X 4D02A 2C57A 4JGBA 1F2VA 4ZZIA 1HYGA 2CVHA 3AEZA 4Q4AA 5AHKA 3RRFA 1QFYA 3T7IA 3GP5A 3FOWA 4M53A 4HADA 2QAJA 3LQFA 3M3HA 5JT1A 4LQCA 3WLPA 1KZGB 4V0RA 1QLWA 4J29A 4C6HA 1XC7A 3S7TA 1TVCA 3HN2A 1MJNA 3NPAA 1YS1X 3GZNA 2I2CA 3B1WA 4DXAA 4DNQA 3EAQA 2PM8A 4MLZA 1NI4B 1A4RA 2JIDA 1B0ZA 3QHQA 2ZB7A 1R6BX 4FFVA 1US8B 4YRIA 1EP1B 2B0JA 1JQLB 1JSCA 3BB1A 4KWIA 5LOVF 4KXYA 1REQA 1CIVA 4FOPA 4AJHA 3HM2A 3JWPA 4BAUA 4F3RA 5C5IA 4EBBA 4HUJA 3NDPA 3LUPA 3CRRA 3MMNA 1U4NA 3AWIA 1QG0A 1KVTA 1AURA 5FL7D 2G25A 5EE9A 2PUTA 3RHFA 3MT9A 4FR5A 3W3AD 4L5BA 1QRRA 2IUFA 2ZBRA 1X7YA 2FRDA 4WBSA 1W1UA 3TCXB 1A4XA 3C98A 3WL6A 3H13A 4U7DA 3CU5A 3D3NA 3AHFA 2WSSA 3ML1A 3W4KA 2CW5A 1CYDA 1OLUB 3H4VA 4AJ2A 2XCRB 2IX9A 1O6CA 4MQLA 3LO5A 1XTVA 1U6IA 2PVSA 3FB1A 4NEQA 1TJNA 4GPIB 4WX2B 1XMXA 3SBEA 3TNLA 4CETA 4H6XA 2HYDA 3A2NA 2BEKA 3OZCA 3PEVA 1JXAA 4JUDX 1S3SA 4XX0B 2DTEA 4EAQA 4TTTS 1I6KA 2CXXA 5DOVA 3KPJA 3R24A 2CYCA 4I0WB 4HX9A 1UCFA 2DP4E 2ONKA 3OWHA 4BWYA 1T91A 1E1RD 1Y5MA 3E5NA 3ZOKA 5LPNA 2XLCA 1JEAA 1V5FA 4D0NA 1J90A 4NTZA 2XXBA 3OIWA 2J5BA 2IQIA 3WYAA 4TV8A 1XZEA 3OU7A 4NEHB 3HDHA 1Y4DE 2LIVA 1XQVA 3AUUA 4P22A 2XYRA 5AJZA 4UU0A 4AJ9A 1EINA 5K4GA 5JLJA 1N34B 5FPTA 2I1QA 2OECA 3DMNA 1GUZA 2RJ3A 3E3LA 1TVKA 3BCHA 2IUTA 4KO8A 3AR4A 5FORA 1AM4D 4P54A 3GI1A 3VUFA 5DCUA 1GEGA 1C4KA 4KXXA 2NUAA 2L0XA 1LQTA 5I7AA 1XLTC 4O4IB 2OHVA 4Q21A 2FEAA 4CU2A 3GO4A 1KK1A 3MTGA 2B94A 1ECFA 3BF7A 3AHCA 1P9OA 2JZNA 1GRRA 1V45E 1E61A 1KMQA 3L8GA 3W5JA 3PV0A 4RKWA 2CKDA 1IK6A 4EHBA 3EGCA 1ZUIA 1YBVA 2WSLA 1X7HA 2B1JA 4CTNA 1YFKA 4OREX 1SPXA 2V9CA 1UBJS 2XMGA 4X0EA 4P0QB 5A05A 1M76A 5U4XA 4P31A 1Y33E 1ZD8A 2AOWA 3F9RA 4JU9A 4LF5B 1EVLA 4B8YA 3GGPA 1WKBA 4BKRA 3Q8KA 3QVOA 2G8LA 1W5SA 2IDMA 3HKBB 1IEWA 2ESRA 3WHPA 1K7YA 2V8OA 3AHEA 4AY3A 5LJIA 3C0KA 2PA3A 1PWHA 1XAIA 2PD4A 2W11A 4EVIA 3UMRA 3MSXA 2Z2YA 3LOPA 2IZ0A 3WKCA 4EITA 5JQWA 3VSEA 5C8DA 1Z68A 4FZ5A 4QZVA 1QFJA 4IAOA 5EL0A 1SJ9A 4OI0A 3JVDA 2OBMA 1O54A 4QU5A 3WV4A 2LV8A 1RZ3A 2CNOA 3AERA 1DDGA 1LSUA 5DW3A 3GZ4A 4KQ6A 2Q5OA 5K2MA 5JZVA 4LRTB 2HI0A 1A2QA 1A96A 4Z9FA 1UMCA 5I9LA 3L7CA 4UCWA 3WAGA 1JT2A 4HN4B 3TPZA 3UENA 4Z99A 2CMGA 4S1NA 3BE5A 5JJIA 2LVBA 3BA6A 2G9UA 5GONB 1UBGA 1PW5A 5EXPA 4CF5A 3R7LA 3AONB 4WFJA 1JXOA 3DWEX 2FF7A 1YK1A 4HUQA 4J4BA 1MABA 4EYQA 3WNQA 1MVOA 4EJ6A 4I6JA 5HWSA 3N2LA 5D3ZA 5EFOA 2JAHA 4N12A 4F6RB 2XEDA 3LY8A 2ZS8A 1ZMTA 4G0PA 4B3BA 4ZHQB 4UAUA 1PIWA 4TMFA 5EMLA 4N3CA 1TYEB 3N7AA 3QA9A 5CD9A 3TZ6A 5DW0A 2M1XA 2IEGA 1FP4B 3ANLA 1M1YE 3HUFA 3BBPA 3K5HA 5IARA 1ULHA 1PJBA 4CM7A 4DG8A 5K0BA 2JLVA 1JKFA 1IMOA 5B4UA 2VTBB 1YF3A 1XQYA 4UULA 4P5EA 3UGTA 1NN0A 2XI4A 1JQBA 4GOLD 1UM9A 2WF8A 1IQUA 2W58A 2RGXA 2HQ1A 3JALB 1IEQA 1CV2A 4YYEA 3TUZC 1QOQB 2DQYA 2O1EA 2OLJA 4BUZA 4C1BA 4TRRA 3DAYA 2XB2A 2G72A 4AXXA 2J6BA 1BJRE 4XFJA 2DFTA 2W22A 2X8BA 2A0YA 3MRTA 4O4HF 3GRZA 3O8NA 4B87A 5IAAA 5JZOA 4QYIA 3JZMA 4NJEA 2GGSA 4A16A 4AAYA 4KR7A 1IG3A 1CJBA 1KYZA 4BU1A 3AB7A 3N1UA 4DY4A 1PGQA 2AG5A 1Y63A 3CRZA 2ZTSA 4ARSA 2CUNA 2OAGA 1PYDA 3DUWA 1Y4UA 2OD2A 2V96A 4F4HA 4XM1A 4PFKA 3DFMA 1ZS9A 4XEUA 4JQYA 1A8IA 1SBIA 1NJ6A 1PTJA 1GPNA 1J39A 1RCUA 1RYYA 1YRWA 5ED4A 3KWLA 4KR2A 3B1XA 3DOOA 3O73A 4PV7A 4PAWA 1X1AA 3UATA 4E33A 5CH8A 3PUZA 4EDHA 1KEZA 4Y2HA 2KLBA 1X39A 2YJ5A 3IKJA 2OGUA 1ES9A 3L02A 3OQ6A 1ZN7A 5CXQA 2UUBB 4FCCA 2O5RA 3COZA 2AG6A 4P32A 2DH6A 3D31A 4WLEA 5L95A 2GZSA 4R5MA 1WMBA 5HE8A 3K2BA 1HEUA 1MX3A 4KWTA 5HFJA 3TTWA 4A0FA 1P1IA 1G59A 2BEUB 1J07A 3PB3A 1N6OA 2P2ZA 4PCUA 4BP3A 3DZIA 3IHTA 4WA7A 5ALXA 1NUHA 1W47A 2P1ZA 2QP3A 4X44A 5BSTA 2RD2A 3DKRA 3JPYA 1L7XA 1XP5A 1UBOS 2XUPA 2XQKA 1N92A 2VPWA 2BHLA 3DB1A 3I30X 4OB8A 3SYRA 1NJFA 2QR2A 4RANA 2PWPA 2YJ6A 3N74A 3SZLA 4COOA 4DS3A 4DREA 1SCKA 1ONPA 3T8YA 1MB9A 2NAPA 1VHWA 2QAGA 1V3VA 1HYQA 1T36A 2O57A 2XVMA 3C3EA 3MGGA 3MK31 4A27A 4FIZA 4BNUA 4QJ3A 3B48A 1F48A 2CSUA 2P1DA 2PKYX 2FP4B 3JASB 3K4HA 1F4LA 3CUKA 4BTVA 4YT8A 5C7YA 521PA 3TW6A 4I1PA 3BXOA 5FBRB 3VPFA 2VAXA 4WNAB 4FE3A 1E2IA 5CBPA 5K45A 1EBBA 2QMHA 3DOEA 2JK0A 4ASUD 4D5EA 2DB3A 2ANCA 4B45A 5JJBA 3F6PA 1JMYA 2COUA 1OX5A 4LTNA 4IHJA 2J0UA 3UW1A 1UL1X 721PA 2H2GA 4LV6A 2OP1A 3SKXA 5JVDB 3TUJC 3HA5A 3H9GA 2EC5A 4K05A 4Q15A 4RGBA 3K2QA 4EFNA 4LNUA 1EE9A 5IASA 1L3BA 5JI2E 5KWVA 2O7NA 3PEWA 1KOJA 3OMLA 4CTOA 4XSHA 3Q6MA 1YB4A 4Z0TA 1YZKA 4GO1A 3ZU3A 4BEBA 2QMEA 5JO0A 1IUPA 4RZQA 4Q3NA 2COEA 3BH6A 4D56A 3FVWA 2WUEA 1U4SA 1HX7A 2FK8A 4GUAA 1SELA 8ADHA 1X92A 4TN5A 1AB6A 1AGYA 2ZETA 2F17A 2MHCA 2JGKA 3I01A 2A4KA 1GU0A 2CHQA 3JR3A 4K1XA 4Q4JA 4R7ZA 5AK5A 1FNCA 4PE5B 5HCUA 3U3RA 2R3SA 3VO1A 4A8TA 4F4CA 2NG1A 4Q34A 1I1OA 3P0EA 4R98A 2AL7A 1E1CA 1Y7LA 4X20A 4BVAA 3FUWA 1H2AS 1RU3A 3KK0A 1ORIA 1KJYA 1Y3IA 2ID9A 3H05A 4N65A 5IMBA 1OPXA 1DINA 1XD2A 4KGVA 1T6XA 4X1YB 1RJWA 3EDRA 3G7UA 4ZKEA 4TS1A 1EEHA 4E5PA 4FNMA 3HACA 5E2AA 5HQ3B 1FBNA 2NTYC 3CSDA 3ZK9A 3WK4A 1U0BB 1Q95A 1Z5VA 5KNDA 1PYOA 3ABQB 2CBGA 3LC7O 4M0PA 1CJUC 4DA7A 4MYUA 4QLOA 5F78A 4EDFA 2D5IA 1KC3A 3MINA 1QB7A 4Z1OA 4ZCLA 1JQAA 1PF7E 1GCUA 2E4UA 2OZKA 4QSHA 5ENZA 2GEDA 4C6TA 5JSYA 1SUIA 1CEYA 4JASB 1ODLA 4Z4HA 1QO0A 1LK7A 4KB5A 4KXNA 4N5DA 5FTLA 1E6CA 3CV3A 4P4UA 4TT3A 5A5FA 3KYCB 1EFCA 3K70B 2J0QA 1U2SA 1HYHA 3B3AA 3UGKA 1KMMA 1T1RA 4UU8A 1DAHA 3BWBA 3ZHTA 1XN1A 4RULA 2H7CA 3B3FA 3CINA 3AVPA 1XNJA 3OCCA 2G76A 1NQUA 4EWLA 1AV6A 1P7PA 4KXWA 4NH0A 3W8NA 3LK7A 3A3NA 1WPQA 1T1SA 1DL5A 1E8DA 5DDIP 4C20A 4RPHA 4MS3B 1RPZA 1ZIDA 5BSKA 2QBYA 5EJ2A 4K81B 2UU9B 1XK7A 2CZGA 2Q45A 3QLJA 1U0EA 2WAMA 3EA5A 4NPHA 4U5QA 5FTNA 1LZKA 3GEMA 3KPUA 1TAQA 2VJLA 4FHZA 4MO2A 4B4OA 4Y1EA 3U44B 3GD7A 4P33A 3KQUA 3IJ5A 1FP1D 4CF6A 4JBGA 4O5OA 3TB4A 3ZZMA 1DT3A 4DLSA 4DQ0A 2YOHA 4F3NA 4AN1A 4LZNA 1PJLA 1QF6A 4RA9B 3TKLA 4MV0A 3P9SA 2C9YA 4ZYUA 3L7NA 1T2AA 2EF1A 2FPRA 3I92A 3W5AA 3IBYA 1QHHB 3EQ2A 2GEKA 3OO0A 1OZAA 1CS0B 3V8BA 4XQGA 1A9OA 1LSJA 1GKLA 3MN1A 4MHOA 1ZDMA 3OO1A 4AL4A 1JIUA 1RRKA 4LNHA 4YXFA 1XU4A 4GM4A 5KIAA 4PRZA 1DUVG 3ZDZB 4C0QC 1DEHA 3LIPA 4IXTA 3URMA 3U4MA 1EIZA 1EHIA 1W30A 1X15A 2JI7A 4ZP1A 1KAOA 5DWVA 4LFAB 4PZAA 5EUBA 1YE8A 3HUDA 4GC9A 1ISHA 4OMUA 1VJTA 4KP7A 1REQB 1YI1A 4QVGA 2IRWA 2JLRA 3ZHQA 1Z4NA 1Z3IX 2IP2A 3FLEA 2CGEA 4PZZA 1A82A 3WSVA 1CUSA 1BKYA 1ZQ9A 3K6SA 5FNZA 2V3CC 4Z8XA 3K5IA 5T6MA 3FDIA 1T5DX 4HGZA 2A9KA 1KMIY 4PO1A 3W6NA 4BB9A 2VEDA 4JLAA 1QXSA 4FD2A 1TKBA 4LJ8A 1YDEA 1AKTA 2BFBB 2B8WA 2WM3A 3BK7A 1Y8QA 3G8YA 4WDQA 3LSTA 1RVV1 2GCIA 1E2HA 2FMFA 1RLJA 1R0WA 2W2MA 3KPYA 2R44A 2XUGA 1QYVA 2AYYA 4IIDA 2C54A 2PZGA 4H0CA 4YCSA 2NO4A 4R1TA 3H17A 3OC6A 3WLNA 1RPJA 1C9EA 2HJ9A 4P82A 1L5KA 821PA 1QCCA 1YIDA 5DNWA 1T2DA 1E5QA 3ROGA 1H42A 2QZPA 4W7SA 5B55A 4NBWA 1V7CA 4DB2A 2VS1A 3N75A 1IXSB 5DPMA 3TLKA 2DVMA 3ZK7A 5J47A 5E3JA 5A5DA 2VT6A 4LDZA 5CT5A 5AH0A 4G4SP 2C77A 1SVWA 1NI5A 1BZYA 1GPDG 5FOWA 3IP5A 4TV8B 1E0AA 4DIMA 2WWHA 2F55A 2X0FA 3G0IA 4WOBA 4O4LF 1G291 4JNCA 3PKJA 1BHSA 4GDFA 2GCEA 1PZGA 3CEPB 2VSOA 4NYJQ 3UB2A 3VA7A 3AKZA 3WBJA 4KYVA 4MW5A 5DX0A 1DO2A 1N6HA 3C4QA 2GEJA 1K1EA 2MSDB 2VAPA 1L1QA 3EUEA 2G9VA 3M6UA 3OQNA 4DV3B 1XWFA 3II6X 1NFFA 1QORA 1YJCA 4HB0A 1C9DB 2EIXA 3M6AA 4J8PA 4A4DA 1EH5A 1BXKA 2VH5R 3FPCA 3VBEA 5MN6A 1Q1ZA 2G6BA 4J07A 2RMKA 2RHBA 1IATA 3MLEA 4F21A 1LLUA 3LYAA 4MP6A 1I5OA 3WRVA 4ROSA 1WUHS 2R2AA 1XGKA 1DBVO 3AM4A 1XRJA 3I9FA 5IJZA 2ZUUA 3ENZA 5TF0A 5J2UF 1LI7A 2Z6VA 3GVHA 5TGTA 4L0MA 5EEGA 4JLJA 4CQLB 1KDPA 2H0QA 4LRWA 3V46A 1RCTE 1QWSA 1SOMA 4U7FA 5FCDA 5FBZA 1OZFA 5BN1A 4KE8A 1WX1A 2FW8A 4JLWA 1LJLA 2VHTA 1F0YA 4CPDA 1B43A 4GC5A 3IAEA 3G5UA 1E94E 4I50F 1NF9A 4MH0R 4XRRA 1FUKA 2GCOB 4C05A 1B0AA 4O25A 3BWDD 5EC8A 5FPYA 4DIKA 5T3YA 4L27A 4Q3LA 4TGLA 3RVNA 1ADFA 3NH9A 3NZEA 1U94A 1JFSA 1XMPA 2XB9A 2ES4A 1ZGZA 4EY3A 4YV0A 4FSHA 3M3PA 3N58A 4UJ3A 3PHIA 2GAIA 4DZTA 9GPBA 5AO9A 5TQ0A 1XZCA 3UXEA 1CY6A 1XQWA 2ERYA 5GY7A 5L7YA 2BZGA 4C3ZA 2QTWB 3V2HA 1EXNA 3BRWA 1ZHOA 2FZCA 3OIUA 3Q0TA 1M6NA 3TQSA 4EG1A 2NADA 1ZGAA 1VL1A 4ZI7F 3R5JA 2GWHA 1YDFA 4FFMA 2JHFA 1C1DB 3LQ2A 1LFDB 5DM1A 2QTAA 3MXOA 1Z47A 1EMDA 2ACKA 2IJGX 4ZQCB 5EYPB 2PXCA 5B1YA 2YXLA 1RRCA 4RPLA 3A1FA 4E21A 1CJVC 4G09A 1TMYA 3M6MD 1IU9A 1CE8A 2AZTA 2GB4A 4IY1A 4LCJA 1RWOA 4Q1DA 4QUDA 4E3ZA 2REQB 3GNQA 2E6UX 3C3WA 3QY0A 4FTWA 4R9VA 4TMWA 2BEVA 4HUQB 3JTMA 3KB1A 4OLJA 4TLAA 1JHDA 3RSCA 1T9GS 3H8VA 4EEXA 3DLBA 3AUKA 4CW7A 2EW8A 5ES4B 1JZQA 2JIPA 1KNQA 1RPAA 4CIVA 1JTFA 1JTEA 1UM8A 4YYZA 3KD3A 5D01A 1PL6A 1IUOA 2GK4A 2QSUA 3FYDA 3IAUA 2QSYA 4W9NA 4GMXA 4D9KA 4XSVA 4YNBA 2JJ1A 3PYMA 2Z57A 3NGMA 1D3AA 4GG1A 3JAKA 2Q8NA 5DGHA 1E3DA 2AXEA 2WJPA 3M4YA 3L9XA 5D3MA 3JD0A 1QGUB 3HFSA 3OM8A 3P2EA 4MW1A 4WKPA 3C1UA 4ZMRA 4CV1A 1XTBA 1W29A 5AHRA 1ZMBA 3JAWA 3JS5A 3OX4A 4RQUA 5AVOA 4ZI3A 4GWLA 3SMQA 5HBGA 3Q7PA 3WNZA 1LDEA 1S9HA 3GJTA 4YB8A 4CL2A 1JAXA 4I55F 4F5YA 1ECLA 4K6FA 5IT9A 1RQPA 2CE2X 2X9VA 4IXDA 2H0RA 3KLPX 1M5UA 3IEKA 1BVRA 3SCZA 1VJ0A 4N9WA 1ZPDA 4PLVA 2AOUA 1GNTA 2Z95A 2JKYA 1QE5A 3VAYA 3W06A 2YHIA 1SIWA 4FMBB 1YUMA 4P9NA 4CHGA 5FV4A 3SWWA 3PIRA 3W5IA 4ND8A 4RFSB 4LMRA 2W6JD 4A0GA 4EI9A 4F9GA 2Y0CA 1TLTA 2P5TB 4OBBA 4RPGA 5AKZA 5L4NA 2PSDA 3TQHA 3EXIA 3KCQA 3SY8A 3TE6A 1A4IA 1JQDA 4R9RA 4EHJA 2K7FA 5ALMA 2IYYA 4OXRA 5HF8A 5TJ9A 4A0QA 1F06A 1ZESA 5A9RA 1S7GA 2FETA 1RMYA 1DQZA 1I01A 1YQQA 2C9ZA 3OZTA 3PZRA 1YI8A 4JV5B 1ZIYA 3WWEA 4FXOA 3HA2A 1YB7A 4E4TA 2SCUA 2OSVA 1GAQA 3CF6R 1EFLA 4MA5A 3H04A 3JX9A 4CMIB 5HSGA 3MWEA 4DIFA 3AEYA 5HE9A 5J4LA 3FYUB 3UMCA 1V3UA 2E55A 1AK1A 4WKGA 4I99A 1E1QA 1WPXA 3FIUA 2PQ2A 5DK4A 3SXUB 1E89A 4AJNA 4DADA 2CSXA 4MVWA 1EB8A 1C8VB 5H4HA 3V4PB 5HM6A 1QS0B 3EXHC 2FEXA 5DO9A 3WQHA 5J58A 1TCAA 2E4XA 1K86A 3CKYA 3V80A 3E9RA 1MQ9A 1D6JA 3FOBA 1D04A 3ORFA 2X13A 2ZSUA 2XVXA 4F3CA 5KOJB 2V7VA 4GNKA 2ZBEA 1T36B 5FJIA 4Q9NA 5GOTA 5LDHA 2IBTA 4BNFA 5FXMA 5L3QA 1Y34E 2GM9A 5FI5A 2AI3A 4QXAA 1M2KA 4IKEA 4ZOAA 4EA6A 1MIHA 1H2FA 3E4CA 3FVTA 3I0MA 4ZQHA 2VWGA 1YS7A 1L5SA 3PI6A 4GZ5A 2QVYX 3ZXUB 4A9AA 4DC0A 1BTOA 1OWLA 2VAMA 2OVFA 4BO9A 4G5XA 5J59A 3PPYA 2V5UA 5FOUA 2BI4A 3CW8X 4KE6A 4KX5A 1J49A 3OZBA 1QTQA 2A5GA 1FRFS 2HF8A 1AN9A 2I2XB 4CZ2A 2FB9A 2G4LA 3DMDA 3GT7A 2O8VA 4O0LA 4C0SA 4DAEA 2O7RA 3OCWA 3U3DA 5NLLA 2WTMA 3DBHB 1B8OA 1DXOA 1X1QA 2IW3A 2NQ8A 1U4OA 4L5IA 4MTLA 4N6GA 5SZKB 3ZWXA 4QYSA 2IU6A 3MQ2A 3PVSA 3GPLA 1IY1A 4O2AF 3E5RA 3LX8A 2W5UA 1C2TA 3T0IA 5AXDA 3WLOA 3I12A 1Y4SA 4GVPA 1JHVA 2IOYA 3PC6A 3QWHA 3UUEA 4I1IA 3EW7A 1GHTA 1TM5E 1PD0A 3LUDA 4G5FA 1SCUA 2A3RA 2ZBPA 4LDRA 1YB5A 1Q6YA 3NAQA 4C14A 5HQTA 4DLPA 3I9NA 5I7WA 1AHPA 4G1VA 4DYVA 4C7KA 5DYIA 1XVIA 1X7GA 4ZCRA 1H8HA 1R6UA 3LVFO 4CMEC 4TSFD 2VJYA 3DO8A 4ZA2A 5JC1A 3KQLA 4UVDA 1SCAA 4DG9A 3IPYA 4J16C 1MN6A 4N0DA 1IXZA 4F0JA 1CJKC 1JNYA 1R74A 4EHHA 1MO5A 4GSLA 5ELMA 3TFOA 4RTSA 3I5XA 4MLPA 1O8BA 4RUKA 3R76A 2PD6A 3HKDB 1P6QA 2CFIA 2Q99A 5HBRA 3BOSA 2JEYA 1OT3A 1MX9A 1U0FA 2R6HA 3N8IA 3P1JA 4GLFA 2RAUA 2BF4A 3AJ9A 1EK2A 4IV5A 1IOVA 2VYND 2R7KA 4ENUA 3VVMA 3WJ7A 3FGZA 1IJKA 1RBQA 2ID8A 1FFAA 1XXHA 3N2IA 2XKKA 4Y2SA 1EB9A 1JKIA 4ND7A 1XLTA 2B83A 3GGOA 3QMMA 4X3CA 2VDRB 3O84A 3SI7A 2JBAA 3F9IA 3S44A 1VL5A 4X8LA 4L5JA 5FPHA 4PRYA 3PA6A 4PONA 5AI4A 4AY6A 3OQOA 1ZNZA 2Q3FA 3ELBA 4I5GA 3VYUB 1I7SB 3KXDA 3MCVA 1UBLS 1QZUA 1XF1A 4MPTA 3CLTD 3PUHA 1P73A 4MGEA 3EBLA 5CA1B 3FUXA 3MMSA 4KPEC 5LYYA 4A23A 4QG3A 3OJCA 4NY1A 5BUCA 3KQHA 3ZWNA 2NM0A 4FFBA 1N0HA 3LPLA 2GEBA 2OXRA 2XAAA 1CD5A 1ZUD1 4GYWA 4WH0A 4ZGBA 1LNSA 4AG3A 1OAAA 2WVJA 2XRMA 2WF5A 3EIOA 1PS9A 3GVIA 5FO0A 3JD2A 1YR8A 3DMTC 3W5HA 2HF7A 4J0GA 1ABBA 1DBIA 3CCFA 3GT3A 5AJUA 1ISFA 1JE0A 1Y37A 1E3SA 1T8WA 2PKQO 4UM7A 3WBKA 2Z6AA 1X80A 4PN3A 3CZCA 3JQAD 4CKWA 2IH2A 3ZV6A 1CS4C 2PPLA 1WUTA 3NOOA 3NJRA 1XK6A 3LA8A 4Y67A 5BN3A 4ARCA 4WKNA 5JXWA 2BM8A 1EWVA 1SKAA 5CDHA 5K0NA 2G88A 3O4RA 1JN0A 1A72A 1U9IA 1MNAA 4D26A 3RDPA 4N39A 4QWWA 4JIMA 4FFSA 2WDZA 2OLEA 1WF6A 3C3XA 3VNRA 5DLPA 1JILA 2FK7A 1Y1LA 1MZPA 1XKXA 2Q2OA 3HABA 3KYBA 5E9AA 2Y99A 2VDQB 1SIUA 2AFVA 2X8LA 1YAJA 2RIRA 4UBNA 3ZE0B 3AEUA 4QGGA 1J9EA 2IPMA 2EZ8A 2RDMA 3PG5A 3WMWA 4AMUA 4P35A 4OX9B 2W71A 4CT0A 2VKTA 2Q8PA 2CK3A 1XXHE 1P0MA 1NJ5A 4IIUA 1S3GA 3IIJA 2HWWA 5AOCA 3UT5A 2N1MA 1DRJA 2C99A 4DLYA 5DI3A 3A27A 4DGSA 3KQWA 1KEKA 2FWBA 2X4LA 4QASA 1HT0A 4JA0A 2V0CA 1QVRA 3OLYA 1Q7GA 4E08A 3AF2A 1EFRA 4KK4A 5CA0F 1YMVA 3CONA 1PS8A 4ZQIA 4XVUA 5HIAA 2Z4SA 1QIJA 5BV8A 3A1NA 2HOQA 5K8LA 1FXSA 1PR1A 4XD7D 3SBXA 1WU8A 4G0ZA 4JT8A 1D1PA 3CMCO 3LP8A 4YMWA 2II6A 1NFRA 4IIFA 1H23A 2JAQA 5T4FA 3W4JA 2EG9A 3DVRX 2DJ5A 1K6IA 4YECA 4IDFA 1DDOA 1C81A 3IB6A 2O0JA 1TJ3A 2HNBA 1CQIB 2OCYC 2PAAA 4GX0A 4KQ9A 1YCFA 4V0LA 4B4KA 1G18A 4W8HA 2JGEA 3NCHA 4ZANA 2XGJA 3V7YA 3VMMA 1DMRA 2QIPA 4MWSA 3CHYA 1WRBA 4PYMA 1ECCA 1NVFA 2BFAA 4NCJA 4OKSA 4D81A 4YIHA 2KSQA 5KTRA 4PSCA 3OPVA 1IDN1 5TC4A 5C81A 2NU8B 5L6LB 4FHFA 3IALA 3F67A 1RYHA 4ZOLB 1VHLA 5KQSA 4NV0A 1E69A 1NKTA 4AYTA 4KL8S 3IP3A 4RYDA 3GBVA 4F3KA 2AQKA 5FBWB 3I9V1 3K1AB 4YN3A 1TM4E 4RENA 5K4HA 2P6PA 2G4CA 3H11A 3LK6A 4XDGA 1PGPA 2CNKA 2H16A 3D7NA 3HO1A 4Z0HO 1SCNE 4LRYA 5KC9A 4AP6A 3SN6A 3EHDA 1YCGA 4W5JA 2ZIWB 4F85A 4B0OA 1OGYA 1X94A 1EBFA 5ABPA 5JNRA 1FTNA 4L76A 3Q9UA 1O5OA 2YVLA 1VYHA 4KN9S 1UK9A 2TYSB 3ITNA 1U7TA 3M89A 5AHXA 2CLOB 3AR9A 1WDLA 4LSWA 3ZW7A 1K4YA 3OU6A 5CIQA 5LMUB 3QLUA 4P5DA 1ZL2A 2CL5A 4XQ9A 2IZ6A 4AKHA 3PGLA 4TS4A 1V16A 2G1PA 1JH8A 4CG2A 4NESA 3VISA 2B6NA 1HE8B 2BI7A 2OFWA 3TWOA 7REQB 4MW6A 2HL6A 4ARZA 2C94A 5SV2A 5LKRA 1GCIA 4XIFA 1WY5A 2YRXA 4M1WA 3LBNA 4RVDA 4WGGA 5HK8A 3DXZA 5MN4A 1SBQA 4MV1A 3QV2A 3CW9A 5GZ6A 1ZD5A 3O3OB 1I3KA 2VIIA 1UFOA 1ZK2A 4MUIA 5EHXA 2BGTA 3QW2A 3F4KA 5H82A 2V7GA 3ZC3A 1WHTA 2BH9A 1GAWA 2H07A 1UEXC 3TECE 1T9DA 1ZH6A 1PJTA 4TZ6A 4IFBA 3U81A 4BECA 4BQSA 4J76A 4F38A 3PX2A 3CISA 3FWKA 5FI3A 4Y6RA