4PYOA

Humanized rat comt bound to sah, semi-holo form
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
214
structure length
214
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 77
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pyoA00
2XVMA 5ICEA 4Y2HA 3FYDA 3BGVA 5K0NA 4OX9Y 2AVDA 3A4TA 3EVAA 1ZHFA 2IH2A 4MTLA 3BGIA 4U7PB 3PLAE 2CMGA 2PX8A 4ATNA 2G70A 4EVIA 5G02A 2JH9A 1EQAA 4AZSA 4YUWA 3ER8A 2WA1A 3CJQA 3HM2A 5E8RA 1G55A 2ZZKA 2ZIGA 3IV6A 3DH0A 3GRZA 3LPMA 4M36A 3RIEA 1AQJA 3DULA 1RI3A 4PCAA 4RVFA 4YUYA 2G8NA 4RYLA 2JG3A 3UJCA 3UWPA 3ANXA 3LHDA 3KQVA 4GOOD 4P7JA 4OBWA 4RX1A 5EKXA 4E32A 5DX8A 2H1RA 2FK8A 5DM1A 2P40A 2YXLA 4O29A 3BT7A 3KQMA 3SXJA 3UA4A 2G72A 3OZRA 5HOQA 4RSRA 5K0JA 2AVNA 5LSAA 5GIOE 3A7EA 2VP3A 1RJEA 3PTAA 3DXYA 3OPNA 3TQSA 3EEYA 4BLWA 2JJQA 2ZTHA 4F85A 5BW4A 3EMBA 4RVHA 4V0RA 5K0LA 2BR4A 3HA3A 3A25A 3KPUA 3NW9A 2Y1XA 3U81A 4AZWA 3MB5A 3AXTA 4NECA 1BC5A 5P8WA 1X1AA 1KPGA 1N2XA 5F2NA 3FTCA 4RTLA 2ZWAA 2CMHA 4GQBA 2QM3A 3KQPA 3ELYA 3A27A 2JHPA 4FGZA 1L3IA 4RVGA 3SR4A 3BGDA 3GIWA 4DCGA 5GM2A 3M4XA 3HP7A 3KR9A 5C1IA 1JTEA 5K01A 5EMKA 4X1OA 2PT6A 3A26A 2P3LA 2YUIA 3FPFA 4R8SA 1NW5A 3BXOA 3DXZA 5BXYA 3UJAA 4BLUA 1M0EA 3LDFA 3BWCA 1VP9A 4ER5A 2HMYB 3QOWA 2Z6QA 3CCFA 3NDJA 3I5UA 3TMAA 5EEHA 5E1MA 5E9WA 4E2XA 5T67A 3HCCA 5EPEA 4YUXA 2I9KA 5EMLA 4QVGA 3HTXA 3KPVA 4HTFB 5T64A 1DL5A 4YV0A 1WG8A 1EG2A 4M7RA 3HEMA 4KWCA 4GBED 3HNRA 5EKUA 5D1NA 4CWAA 1Z3CA 1FBNA 5FADA 3FUUA 3TPZA 5LQCA 3KQSA 5LQUA 3GO4A 4GUAA 4XCXA 3E7PA 3PFHA 3PX2A 4C07A 4CTKA 3B89A 2UYCA 3NMUF 4P7KA 1QYRA 2G71A 4DQ0A 3FPJA 4GF5A 4YV1A 5CUQA 4PWYA 1RJFA 3TLJA 2I62A 4RTNA 2AOTA 3E8SA 2IIPA 2GLUA 1D2GA 3BUSA 4V0QA 5E1BA 5CCXA 2UYHA 4C06A 2O57A 2N47A 3G2PA 3KPYA 5E2BA 4KIFA 5LR6A 2PBFA 3M6WA 3OZSA 3UFBA 3PT9A 2HWKA 4QPNA 3V97A 2FHPA 5JUWA 3LKZA 1JQEA 5FWAA 1TPYA 1VP3A 1ZGAA 4MWZA 5DM0A 2GS9A 5EIFA 1P91A 5DT2A 4YMGA 3SGLA 3UJ7A 4X60A 4Z2YA 1L1EA 4CKEA 1SQGA 5IH3A 1HMYA 1XXLA 3VYWA 5EHGA 2F8LA 4C04A 5JR3A 2CWWA 3OCJA 3B5IA 5EGSA 3FPHA 1RI1A 1R74A 3EVFA 1NW6A 3A7DA 3FPEA 2XBMA 1R00A 2ZLBA 3FZGA 2WK1A 3LGAA 2A14A 4XUEA 4L7VA 1JSZA 1AF7A 3DLCA 4DKJA 4DMGA 2JHCA 2QY6A 2ZVJA 1QANA 1RI4A 1SUSA 2BR5A 1BKYA 3DMFA 2ONZA 4ZTBA 2ADMA 2IH4A 3AY0A 1XVAA 3THSA 3QV2A 3I58A 3VSEA 3B3GA 3HCAA 4KIGA 3VC1A 3FUVA 4E2ZA 4Y30A 5EC8A 2EX4A 3EVDA 4PYQA 8MHTA 4IKPA 3ELWA 3UBTA 3IEIA 2AOVA 2H00A 1L9KA 3OU2A 3MCTA 1XDSA 2UYQA 3HCDA 1IM8A 1JR4A 3IYLW 4PIPA 1JG1A 3OZTA 2P3OA 4P7GA 1SG9A 1XDZA 2VDWA 3E05A 3HVJA 4F86A 3T7RA 3FRHA 3NVMB 3L8DA 2ERCA 2ZWVA 5DM4A 4KDRA 1ORIA 4GC9A 3OU6A 1U2ZA 5CVUA 5E9QA 5EG5A 2OB2A 5F2KA 2UZ4A 3FTFA 3GRVA 1TW3A 2IDJA 5KVAA 4CTJA 3P2IA 1NW7A 4M37A 4OBXA 3I9FA 1JTFA 2GB4A 2E5WA 4BLVA 5FQOA 2PT9A 1FP2A 2YR0A 3DP7A 3ORHA 5K8VA 1XDUA 5HEKA 1BOOA 3R3HA 2P35A 5LQAA 3EGIA 3QOXA 5LQJA 2I7CA 3EVZA 2OY0A 3HA5A 4PYOA 2G1PA 5DTRA 2AOUA 3P97A 3G2MA 3ELDA 4FT2A 4RV9A 3ER9A 5KYGA 2O06A 2OO3A 3SSOA 2ZCJA 2EJUA 3PVCA 2CL5A 2AOXA 3FUTA 3DOUA 2OZVA 1D2CA 2ZIFA 2AS0A 3ME5A 2Y1WA 1ZGJA 2C7RA 2Q41A 2C7PA 5FTWA 4HGZA 4ER7A 3B3JA 3AJDA 4BY9E 3G89A 2IBTA 3GRYA 1JQDA 3TM4A 2PX5A 1IXKA 4E2WA 3CJRA 1VBFA 1KPIA 4KRGA 5BP7A 4AX8A 3LCCA 3UZUA 2HR1A 2O0LA 2V74B 3VC2A 2AN4A 4GOND 2QRVB 1DUSA 4PYKA 2AN3A 4OQDA 3RODA 2I6GA 3IHTA 4HC4A 1L3CA 3F4KA 3HCBA 5DLYA 4YUVA 3UA3A 4A6DA 4ER0A 1SUIA 5EZQA 4XUCA 2PXCA 4FT4A 1DCTA 1EJ6A 3CBGA 3R6TA 5MHTA 5DRYA 5K0FA 1M6EX 2PXXA 4B17A 4RWZA 2FRXA 4PYNA 3KR1A 1F3LA 2AN5A 2V7EA 1RI2A 3SVZA 2B78A 5DTQA 3BZBA 3KQQA 4BP3A 2XYVA 3LDUA 3SSMA 4QDKA 5C9ZA 4DA4A 1Q0SA 1ZKDA 5EVJA 2YQZA 2IH5A 2WA2A 4EKIA 3NTVA 3THRA 3MCZA 4QQNA 4BP1A 5K0GA 3P71T 3C3PA 5T6BA 3FTDA 4YV2A 3EGVA 2P3QA 3E23A 3M33A 4MIKA 4C4AA 3MAGA 2ZZMA 1YZ3A 3PB3A 4PGGA 5HZMA 2P1DA 2OBFA 3T0IA 3PS9A 3O4FA 1INLA 3TM5A 1WY7A 3HVKA 3FYCA 4RVDA 1SVUA 1WXWA 4HG2A 3K6RA 3MGGA 4QDJA 2GA9A 3T7TA 1ZQ9A 3DLIA 2XVAA 1SQFA 4GOLD 1F38A 5DWQA 5DXJA 5U4XA 4PGHA 2PX4A 2K4MA 3OFJA 5HIIA 2QYOA 5FHQA 2NXNA 5DX1A 2AR0A 3UJ8A 1X1BA 2YTZA 3LCUA 3NJRA 4JXJA 2BZGA 5DRTA 1YFLA 5GM1A 3DMHA 1NT2A 5CVEA 3GNLA 2P7IA 4RTSA 3DXXA 2PSSA 5K03A 5K0EA 2YXEA 4DF3A 2ONYA 3KQYA 4MHTA 4ER6A 4HTFA 3KHKA 1QAQA 4PIMA 4X63A 4EQZA 1JG3A 2XYRA 2ZW9A 2JHAA 2B9EA 3JWIA 4GEKA 4HSGA 5EMJA 3UJDA 1P39A 3EVGA 1AV6A 4CKBA 1V39A 1NE2A 1JG4A 3BKXA 1KYWA 2BM8A 3FTEA 3NVKI 3G7UA 3D2LA 4IV8A 9MHTA 2YXDA 5FCDA 5C0OE 3MHTA 2ZBRA 1KHHA 1KR5A 3EEOA 1G38A 2GH1A 1G60A 4P7FA 1VIDA 2ZBPA 2ZSUA 3LX6A 1RI5A 3P2KA 1KPHA 3EVCA 5GP1A 3MTEA 5CIYA 2C7OA 3B3FA 3JWHA 3LBFA 2ZFUA 3G8AA 1WXXA 2VDVE 4FS8A 3DUWA 2B2CA 2CKDA 1RJDA 1X1CA 3LCVB 3P9CA 4E33A 5ICGA 3G5TA 4PYMA 5FA5A 2LD4A 4GC5A 4FSDA 4CXMA 2P41A 1NW3A 4RTOA 3GGDA 4KVZA 1XJ5A 3GCZA 5EQJB 4LWPA 3AWIA 3UJ6A 3JWJA 4DZRA 3C6MA 2PVCA 5FUBA 5E1DA 3CKKA 1XCJA 3G8BA 4X61A 1I1NA 1KYZA 3CGGA 3WSTA 2ESRA 1EIZA 2PX2A 2OYRA 5CD1A 2KW5A 2QE6A 3BWMA 5KS2A 3OE5A 5E8JA 5H02A 2PY6A 2O05A 3HA7A 3O7WA 2IBSA 2PV0A 5CVVA 3KPJA 3TRKA 5CVDA 4MQ4A 3JWGA 4RTKA 3PFGA 5EOVA 2OB1A 3BKWA 3CC8A 5DTMA 5DM2A 1TW2A 5E1OA 3GU3A 4PYJA 1H1DA 3K0BA 5ICCA 1MJFA 4CKCA 3GDHA 3R9XB 3UJ9A 1P1CA 4FP9A 3FRIA 2PXAA 4FZVA 5FA8A 4EKGA 4A6EA 1I4WA 1R18A 1Y8CA 2IGTA 2NYUA 5FHRA 1PJZA 2B25A 2EJTA 3EVBA 1RJGA 4IV0A 3C0KA 4WVLA 4FSXA 3T7SA 5LQRA 5D1HA 3OFKA 1VE3A 1YFJA 3H2BA 1YF3A 1VQ1A 10MHA 1VPTA 2B3TA 2Z6UA 2VZ9A 5GWXA 5FULA 1AQIA 2PWPA 3MTIA 1B42A 4QTTB 3FUXA 5EMMA 2PWYA 5K0CA 3NDIA 4POOA 2OPBA 3LBYA 5EHIA 1NW8A 1VL5A 3KQTA 3KR0A 3SM3A 2AOWA 4F84A 4RTPA 4HGYA 3GRRA 1FJXA 3M6XA 4PYIA 1XCLA 4P58A 4QPPA 2AZTA 5E2AA 3SSNA 5DPMA 3GXOA 3BWYA 3LKDA 3SX0A 4WXHA 1OR8A 5CCBA 2NP7A 4R8RA 3PX3A 4GOMD 3O31A 2YX1A 4PONA 5ERGB 4YUZA 2JH8A 1D2HA 5M5BA 1ORHA 2AOTB 3HCFA 3MERA 3EVEA 3REOA 3TKYA 4RTRA 1NKVA 3RW9A 3G5LA 2OXTA 1QAOA 5DX0A 3X0DA 2ZBQA 4RTMA 3EGEA 5FWDA 5HIKA 5HILA 5KQSA 1YB2A 1R6AA 3TKAA 3V8VA 5CVJA 1PRYA 5K09A 1FPQA 4OA8A 1T43A 2P7HA 4H0NA 2PLWA 1YZHA 3EMDA 5F2OA 2DPMA 4X41A 2PKWA 4AZVA 2QRVA 5DSTA 5HFJA 5FQNA 2Z6AA 1NV9A 2FCAA 3LDGA 4AUKA 3EPPA 5BW5A 3FUWA 4HRAA 5CM2Z 4KDCA 5E9JA 3AXSA 3G88A 1N7JA 2XYQA 2GAFA 1X1DA 1O54A 2IFTA 2BH2A 2NXJA 4E30A 3KQOA 3GWZA 1QZZA 2GPYA 4KW7A 3SMQA 2IDKA 3HVHA 3TR6A 1SKMA 3DR5A 3KKZA 3KQWA 2PJDA 5HIMA 2ZZNA 2EG5A 2VS1A 3DMGA 2IP2A 3ELUA 3HVIA 1JSXA 1M6YA 4PINA 3LSTA 3NWEA 5DSXA 1VLMA 3M70A 2EFJA 3P8ZA 1FP1D 3P9KA 2UYOA 4HH4A 4OQEA 3Q87B 4K6MA 4E70A 3GRUA 5LQKA 2OKCA 4M38A 3Q7EA 2P8JA 3NWBA 4EMSA 2FK7A 5K0BA 4LG1A 3TOSA 1EJ0A 4G56A 3KR2A 1I9GA 3FPGA 3OE4A 4ER3A 2VDUE 2ORED 4QVKA 4RTQA 4PNEA 5KQRA 4FR0A 1MHTA 1WS6A 3LL7A 5ICFA 4AZTA 3TFWA 2BR3A 1WZNA 3GJYA 2BM9A 1R8YA 3MQ2A 2HV9A 2R6ZA 4R05A 4R6XA 1NBHA 2FYTA 3DTNA 3P9NA 1IY9A 1G6Q1 1ZG3A 3B7PA 4R6WA 4U7TB 1QAMA 3CJTA 1O9HA 1UIRA 3C6KA 4XUDA 5GOZA 5K05A 7MHTA 5LQNA 5GIPE 4E31A 1X19A 2ZULA 4UOEA 1NV8A 2YVLA 4OA5A 1JQ3A 3C3YA 1P1BA 2C7QA 3UJBA 1HNNA 3ERCA 4YMHA 3I64A 2NXCA 5GINE 3LECA 5HIJA 3OU7A 1N7IA 1G8SA 2AOUB 3I53A 1EAMA 2R3SA 3M6UA 4IWNA 2HTEA 2HNKA 1Q0TA 3R24A 1O9GA 2IPXA 4LECA 5EZSA 4E2YA 3P9IA 4QQKA 2O07A 3G2QA 1NBIA 4C08A 1XTPA 3BWBA 1KXZA 2ZIEA 3KPWA 4RTJA 4PCLA 4LWOA 3P2EA 2FPOA 1R8XA 5EIWA 4DCMA 3G2OA 3HCEA 4PYLA 3CVOA 3S68A 1BHJA 1YUBA 5IKMA 1G8AA 2NNWB 1KIAA 2PGXA 3R0QA 5B1SA 1KP9A 3ID6C 1JG2A 2NP6A 3M6VA 2NXEA 4DM3A 4QTUB 1UWVA 4C05A 5EEGA 4C03A 4EK9A 1UFKA 2DULA 1L3BA 5DXAA 4ISCA 3KU1A 2H11A
chains in the Genus database with same CATH superfamily
2F9LA 3V6LA 1VLQA 3KAJA 1EFUA 1FNCA 2CD7A 2CFOA 1NNI1 2AF4C 2PR7A 1ECFA 4MRNA 2JCYA 3EGXB 2BFAA 3OZXA 3WBKA 2OV1A 1AQNA 4MVJI 3LQ4A 3K0KA 3SJBA 2W6CX 4YCMA 1TF7A 4MB0A 3ER8A 2WA1A 1HNWB 1EUZA 3QQ5A 5E8RA 5GJBA 2WMOB 1CVRA 3EMVA 4Y3UA 3ZIAA 4ID3A 1BU5A 2C83A 3LX5A 4FMDF 4LSWA 4A9AA 1L4KA 3HDVA 4HHEA 1R8SA 3IBYA 3O9VA 3QRWA 4RYLA 3WQQA 2N1BA 4Q0MA 4ZO6A 1ACMA 2D06A 1X8XA 3PNQA 5CIQA 5DX8A 1KAEA 4K6OA 3N28A 1TGYA 2JIQA 2XUHA 3CPSA 5DM1A 2ZWMA 2O8CA 1ST3A 4FKMA 2P0AA 3NHMA 3G8CA 4BZQA 1DJMA 1E1RD 3T38A 3W04A 3GP3A 4BLWA 3CPHA 3QKSB 3K8YA 5F9HA 1QP8A 3C74A 1K9VF 2E85A 2ZYRA 4YHHB 1WPQA 4TYPA 1GM5A 2H18A 4CLDA 1CR2A 5HQTA 3G0HA 4BKUA 2C2OA 3BE6A 4WX2B 1GRRA 3USZA 5IYZF 5TE9A 1W6RA 1WPRA 3V2GA 2WKRA 4QRIA 3PC3A 3WKEA 4JI8B 1LF5A 2Q62A 4CGYA 1P61B 4YJ2F 2R97A 3EBPA 4LEIA 3OX3A 4X1OA 4P5DA 3O83A 4LQDA 4YR7A 3AESA 1YWGO 2JAPA 4NS1A 5BXYA 5JBIA 5LSAA 4JLNA 3KM0A 1E7MA 1DFGA 2O1WA 4HS9A 2C99A 1BWPA 5M3BA 4HQNA 5MDHA 3VNAA 2N1MA 1CETA 1XSEA 4GM1A 1ZKMA 1DBRA 4AMVA 1UXJA 4N65A 5B37A 2WAOA 3BJZA 3WSWA 5FWYA 4NFSA 1V95A 1EJBA 1OTXA 4LRUA 1U8YA 1XXHA 1DQRA 3EISA 3MT0A 4JBXA 5ALTA 4BVHA 1SHUX 5FOUA 1ZISA 1UBFA 1XC7A 3ZUPA 3ZE9A 1CNEA 2GETA 5AESA 3WZMA 2W2VA 2SKDA 4TV8F 2VRBA 4IVPA 1QQ5A 3KQSA 1D4ZA 2X0FA 2WSBA 3GRKA 1I7NA 4KAAA 1SQ0A 5ILOA 4FI3C 3OTOB 4LE2A 4QU0A 3T3DA 4IY1A 2PSJA 3G02A 1I6LA 2HU2A 5I9LA 3ESBA 3USES 3DNFA 4PWYA 2Q6OA 1J70A 3M1IA 3QE0A 1T36A 3N75A 2QG6A 1KAQA 1UJBA 1GDDA 4WCVA 4DRXA 4Z6KA 3DC7A 3EIEA 3O91A 1W4AA 1DOHA 2ONCA 2Y1GA 4Q5IA 4C0SA 2C1XA 3UV3A 1EQUA 3LKZA 5A02A 2P4QA 5HBGA 2CB0A 13PKA 3ZLTA 4O4LF 4XM2A 3A04A 3V2IA 3GT0A 4KIWA 4XTRA 2C2GA 3C3KA 3OT1A 1PJAA 2X8BA 3AKYA 4OMUA 3TZEA 2NO7A 2X9QA 2Q29A 3H8VA 4NYMQ 5EHGA 5F7JA 1LJ8A 4KR3A 2QTAA 3VKWA 4BQFA 4JXXA 1GGMA 3GW8A 2IU4A 3PUVA 3RJ5A 4B8YA 2WW8A 4Y6OA 3PK0A 2F3PA 3PQ4A 5BYJA 3TR5A 3ZHRA 1DG1G 1R00A 4DQDA 2H8GA 5ICMA 1Z0KA 2XCUA 4AULA 1B3BA 2OVFA 1RHRA 1CUIA 1IQ0A 1E58A 2O3JA 2V4ZA 4G0XA 1NZFA 3DLCA 4OK3A 2XMGA 5D84A 4R31A 4Z9AA 1VLJA 4JENA 3T0FA 4DKJA 3C39A 4RSGA 3EDRA 3B5EA 4ZEOA 1BKYA 3CR7A 4OOEA 1XQVA 2VPQA 3UC9A 2ONZA 3HWWA 5HWSA 2JZCA 1OF1A 4G63A 4DWOA 3B9QA 2NAPA 4V1CI 3GLHB 2JF0A 1RR6A 3IT1A 1Q19A 4FPXA 2CMDA 2YS6A 5HFNA 4RABA 1WD7A 4C7VA 3IEIA 1Z8FA 1CSEE 4RF3A 1DIGA 2CNOA 3TCNA 1L9KA 3HZZA 4DA9A 3T94A 3HJUA 4ZZIA 3MCTA 5DASA 1AZLA 4IOKA 2XWBF 3LQQA 1P2BA 1XD2A 2P2ZA 5TPZD 1ZFNA 3WGGA 1LV7A 3E05A 3E70C 3NIBA 1R8QA 1NZJA 1F7UA 3PI6A 1SKUA 1H9BA 1V2HE 2L0XA 3J7AC 4IOJA 4RSHA 4PAMA 4HGRA 4HH1A 4PSKA 3N5KA 5EG5A 1GKYA 4MQMA 1QFJA 2PKYX 4N3BA 1RC1A 3BXFA 1MXHA 5G0UA 2ZCUA 5D87A 2YKGA 3RUCA 3IDSA 3WWPA 2GDZA 3PGXA 4RKFA 1X74A 3PGMA 4URZR 3QVOA 1N3BA 3FHCB 2MSCB 4X54A 4AZ0B 5K8VA 3H2JA 1N9ZA 1TQ8A 2LCFA 3B1VA 3I09A 4FUTA 1SCAA 4XAQA 1KZHA 1KJWA 1DTWA 3RSGA 5C7IO 2HDWA 2YHAA 1J2TA 4Q7MB 3T95A 1XCMA 1FFCA 1OASA 2CHGA 2WJ4A 1OVMA 1RBZA 1ZIXA 1E1NA 2XNHA 2I33A 3WMGA 1XEFA 2WIBA 4WCFA 1J2EA 2G09A 2HV8A 3R77A 4L5BA 5DO9A 2X0DA 3WO0A 1UKEA 4WFQA 5KTOA 3UH1A 4GZ3A 2NVUA 3L7BA 1W5FA 1ZWKA 2EL7A 4KDFA 4UU1A 1P4HA 4NNPA 3G0BA 4ND8B 2AS0A 3DP9A 1ZXXA 2EZ4A 4JP8A 4XGIA 3PDUA 5HRCA 4YRTA 1KFBB 4BY9E 4TQ9A 4WE3A 1UBEA 4CMIB 1QCZA 3WXMA 4AP9A 4J6EA 3INTA 2AX3A 3ISTA 3OKPA 4AX8A 1C3LA 3WI7A 4N5LA 4GXNA 3X2SA 1GSAA 1ZOLA 3KS9A 4FVTA 3VC7A 1W1IA 2I6GA 1CP3A 3ZCTA 5HZGA 3OMXA 3KYIB 1DLIA 1EP9A 4JI2B 4S05A 3V34A 2QQEA 4DV2B 3GJ8A 3WGMA 4OTZA 1X87A 1W8IA 2IF2A 4J0DA 5CP8A 5LJLA 1H69A 3K16A 4ZQHA 1NW9B 2I2FA 2J3MA 3E5MA 4IX1A 5ADVA 3AF4A 4NHEA 1PTKA 4IMRA 2IUSA 2DFDA 3PFBA 2Y0BA 5GADl 1B23P 1ZZGA 2GCGA 1AXEA 2H85A 5AM1A 2O19A 4ZANA 4DA7A 2AFIB 1SVIA 2VOJA 3D5TA 5F7OA 2FE1A 1T9GS 3OIDA 2X42A 1Z34A 4LJ5A 5KWVA 1U8XX 4QYXA 5LA6B 3VSDA 4AWXA 3E4DA 2XZLA 5HZMA 1D04A 1ZIDA 4GRIA 5C31A 1WAMA 1HK7A 1ZU4A 4I0WB 2NUAB 1E5TA 3W6UA 1LX6A 1FFEA 1HQCA 2PRIA 2W2LA 2I87A 3KVRA 3TM5A 5IAOA 3HVKA 5FPKA 2NZXA 2YYYA 5FYQA 4KFTA 3K9BA 4MKIA 2O2ZA 2VK2A 1DXOA 1P29A 5LM3A 4X66B 3DT8A 2C9MA 3PXDA 2YV5A 1D6MA 3OQIA 3P0EA 4D79A 4RK4A 3LP6A 4ILEA 5IHXA 4KR7A 1CUDA 3IAAA 4JXJA 4XYBA 1PGNA 4CQJA 1TTPB 3ICVA 3BH0A 1BROA 1ZN8A 3AR9A 1ZINA 1HI9A 3RE1A 1XVTA 3H9GA 1VYUA 1J39A 2ZRLA 1MO3A 3BZUA 3OO0A 4I8IA 3TIXB 2PRKA 2FGKA 3B38A 4DF3A 3AF2A 4NE2A 4NZMA 3KOMA 4IWYA 3M5DA 2ZRJA 1QZXA 1KI3A 3OJCA 1X86B 1NJGA 3L1JA 4FFDA 4URYR 3N0RA 3Q10A 3AVQA 3GLKA 1NE2A 2HDHA 4FCWA 1KO5A 4AO8A 4UHCA 3ZWXA 1VMAA 1XZ8A 1O3YA 1GILA 1XR3A 4AKIA 3L7IA 4GMXA 4GI7A 2EKDA 2MJLA 2G4LA 1Q5PA 2QV0A 3FCXA 4DRZA 1KR5A 1DRVA 1T5IA 3OBBA 1T2DA 1KEKA 4WFJA 4P7FA 1H8HD 1QZ3A 2O7SA 3NEPX 1XF9A 3ESXA 3H1FA 1VSVA 1OUMA 1SOUA 2BF7A 1NSFA 4O2RA 5LP1A 1M2HA 2J0VA 2I7TA 1XEXA 5B36A 5JSUA 3P19A 1U7UA 4JI7B 1GCUA 2VDVE 1YB6A 3BXEA 4N8SA 3SN6A 3ZCXA 1E0AA 3T41A 2QUIA 1Q3KA 3NORA 4YXWA 3UTDA 4R0MA 4WKBA 5JO0A 3PI7A 2VTBB 2GCEA 2A92A 5EESA 1YB1A 4BN5A 4QPCA 2PMCA 1W6UA 3CG0A 3MWGA 1ZN2A 4GC5A 4KP7A 3VNBA 4CM1A 2O4CA 3TQHA 5CDUA 2BFDA 4LWPA 1Z33A 2DSTA 2YQ4A 2Z8YA 4ZT3A 2FLWA 1V16A 3CRVA 1KK2A 3M6FA 4OMFG 3HN7A 4P3XA 4YWJA 1U5AA 1PTJC 4ITRC 1SWWA 2V65A 2ACVA 2KW5A 2OCXA 3JQRA 3W2HA 1P4AA 2NW6A 3QM1A 3EF3A 3OE5A 4PX2A 5IUJC 2VJYA 3PEYA 3R6LA 4KUGA 3I9MA 5JCOA 1W4CA 4UTXA 1NBME 4NG5A 1BVHA 5DNWA 1J8FA 3Q9LA 1PSWA 4X5OA 4EJ6A 5LCXA 4F4FA 2VTKA 1VGQA 3ZWKA 2PA3A 1AGYA 3OQJA 3R9XB 1P60A 2GPAA 1X1SA 4F91B 4N12A 4EH1A 2ODQA 3BB3A 2FZ5A 4KO4S 4EJ2A 3FZNA 3QX8A 1E5XA 1GAEO 1M1YB 2AE2A 2BPOA 3KZNA 1JEQB 4KPYA 1AO3A 1P7CA 1CW2B 2C54A 4XWKA 1VE3A 3GUCA 5E3IA 3HKBA 3BK7A 4F92B 1HF3A 1T10A 3BJMA 5IVHA 4BNUA 4NEQA 1KOLA 4RORA 5EMMA 1VL8A 4JQSA 3MWLA 5KEIA 4WKOA 4HTAA 1QUFA 2V3VA 3MT9A 2XDQB 2W2PA 5A5VA 4EGCB 3DUFB 2QIPA 2FHSA 5CAEB 4HT3B 3B6KA 1G5QA 2PS0A 2Q2NA 1P9NA 1R5NA 1SBYA 2JI8A 1P0FA 2PTGA 2KLHA 5LLSA 5EWMB 5ALQA 3HP1A 4MA5A 5ESWA 3SS9X 3UK0A 5IULC 5AVSA 2AA3A 3HV2A 1EX7A 1Q22A 1OWOA 4NJMB 5AW9A 1ODCA 4M9XA 5LDHA 1PDVA 1SR8A 4PE5B 1GFSA 1DNPA 1NKVA 1U80A 5AVUA 1PQUA 2PBZA 1H1TA 3KHTA 1T3HA 2ZPAA 4H08A 4D3DA 1R15A 4MGHA 2Q3EA 5KQSA 4HWPA 4EJSC 1QLJA 1BD3A 2GAOA 4RADA 2B36A 2ADFA 1J97A 1Q6YA 4B3RB 4BTVA 1H0SA 5EP1A 1WP9A 1Y1TA 2I3DA 1K4MA 1DZIA 3LBIA 4XPZA 4J2HA 4K26A 3RREA 4EYQA 5HPYB 4KFCA 4NCAA 5JRDS 4I55F 3EQ7A 2VPIA 3N8DA 4ZEVA 2JA1A 1PQ4A 4A6XA 1T9DA 4UMDA 3WYGA 1GD1O 3FUWA 4QTXA 2WJZB 1NXOA 1QHHB 2XBUA 4CUZA 3OQHA 4MLDA 1QBGA 2O6HA 1QXSA 3LHFA 4HNUA 3U4QA 4OLBA 5MFPA 1YQWA 4LCJA 1N36B 3GWZA 5C8YB 1A8PA 2VS1A 2PH1A 3AEXA 2JEYA 4GLLA 4UFPA 1JSXA 4JIGA 3ZWNA 3DVQX 4MJ3A 4PLGA 3K1ZA 5BN4B 1ZXBA 2A30A 3EAQA 1I24A 4O4HA 3RT7A 4D82A 1OBHA 5HKOA 2R8EA 4YACA 5KOIA 2QTMA 4BMNA 4E5PA 3NWBA 1CR4A 2PCJA 1DO2A 5FTMA 4D4GA 5LBIA 4EX6A 2C1EA 4D9EA 4F6LA 3OJEA 2MINB 2Q6VA 1Y7IA 4EMBA 1LSOA 1C9EA 1E7RA 2GRAA 3C8DA 1W85A 3FUCA 4K9OA 4Q37A 4Q6WA 4QNMA 5FTNA 2JCSA 4J2TA 1HRKA 3EA5A 2RAFA 3P9SA 5FTLA 4C7OA 1V1RB 4HX9A 2FR0A 3B7PA 2GEFA 3FOCA 4B3HA 2YYZA 3F90A 3N1UA 3NNSA 4TT3A 2IYAA 4ZVVA 1PSDA 1IE3A 1SHLA 5CJJA 1OX6A 2H0QA 1SQ6A 3R7SA 4EI9A 2ZG6A 4EYKA 4BWVA 3THYB 2GPSA 2N42A 4LK2A 3C3YA 2VLIA 3QVGA 4Q1BA 3V8QA 4ENTA 1VE1A 3VO2A 3PXUA 2RGDA 2HXGA 2ZYWX 4EGFA 2D0IA 1S89A 4PYRA 4WH0A 1V8ZA 2RIRA 1RQ2A 4YAGA 5A04A 3AOEC 1G8SA 3QY0A 4JYPA 4IZHA 1ZNXA 2DUJA 2I3BA 2HHAA 2FRVA 4NS4A 2ZIZA 2X7XA 4A6PA 1T2CA 1UWKA 2LXNA 1E5VA 2OE2A 3OZBA 4F38A 5K4AA 1JILA 2O07A 1V3QE 2JBWA 1CVLA 1FFHA 2Z1DA 1JMYA 3MRXA 4QULA 3ANNA 4FCCA 4MI9A 4HN9A 4CN8A 4UTRA 3WYDA 3ONEA 3P2EA 4MB6A 1IQRA 5LL6P 1DMRA 3G2OA 4BEWA 4BUZA 4K03A 1YUBA 2O1EA 4IIJB 5JSQA 1OREA 4MQEB 4P36A 4CODB 5LYJF 3WLOA 1YQEA 5TNXA 4QTUB 4RCYA 4HH3C 2FI1A 4YRJA 4XWWA 2QVBA 4DWJA 1E6KA 3NXKA 1SC3A 4QUJA 1OZHA 5BUZA 1QOPB 1T5TA 3PC6A 2ZOSA 4IL5A 1GVNB 1U0GA 2RAUA 3ABRB 5ALPA 3PEVA 4PLPA 3T5BA 3E81A 3ZZUA 3KSDO 4A23A 4BATA 4O4IF 2IH2A 1ZICA 2HUPA 1WZIA 1PV1A 5E9AA 2B4AA 4NR0A 4F45A 1SK9A 3ITDA 5KTSA 3UOWA 4YUWA 4E5YA 2Z09A 1M2OA 5I4CA 1ZVKA 2G17A 2B37A 3ABSB 5K2MA 2ZIGA 1Q2UA 1TEHA 1O95A 3LD9A 4GR5A 4FYYA 4WWHA 2A9VA 4NE7A 3T3MB 8AT1A 3L4JA 3ZEIA 3A6DA 3WNCA 4D8XA 3X44A 4J0HA 3O8QA 4L1KA 4QUAA 1YNOA 4HDKA 2X2EA 4D4MA 3UJPA 1UAGA 1SPBS 1BX0A 1SOAA 3TDMA 2IA5A 3U37A 2G72A 4F6CA 4DWWA 1JECA 1ZD9A 3C3CA 3DB1A 4IXDA 1WV1A 3OPNA 2EJVA 4UQOA 1CUZA 3EMBA 3ZK7A 3NW9A 4EKEA 3H2ZA 4MDHA 2O3QA 2QRPA 1P74A 4IX9A 4P2BA 1DAOA 1V6AA 2FP4A 2JJ1A 2QGFA 1Z82A 2DLDA 2TYSB 3M9WA 4XFDA 5DTJA 4GQBA 4LJ7A 4UU8A 2EEPA 4EPTA 1M5TA 2F17A 3A27A 5CLQA 3ZLVA 3I01M 4E5DA 4TOIA 1SCBA 1XZPA 1WP4A 4CKWB 2B82A 4II2A 4F3NA 4RVUA 5TC4A 1GTL1 3ROKA 4K8OA 3Q15C 3UHFA 2EHJA 3TRDA 4UE2A 5LU9A 3QTLA 5CXSA 1JSLA 4HUTA 4KRFA 1OTYA 1EA7A 5FUWA 5NULA 1GADO 2PWBA 3SC3A 3DLBA 1WNTA 4TS1A 2KBEA 1BSVA 2RGUA 3RUAA 3ZWDA 4EG5A 3D6AA 1ZX1A 3COVA 2AG8A 3MNFA 1E6WA 5T67A 3JR7A 1LDYA 3P0JA 4RKRA 4MR8A 1M1XB 1IB0A 1G2OA 2NPIA 3IMCA 4JBYA 5FPPA 1E2QA 1QRUA 1S96A 1PWXA 3CH6A 1BDBA 3O21A 4HPJB 2UUCB 1OC2A 3NH9A 5D1NA 5AKKA 3LO5A 4MS3B 2PCLA 2IYFA 3MLBA 2ZUDA 3KSZO 3EFOB 4JR2A 3TYXA 2WNHA 3PX2A 4C0BA 2I4LA 4H0CA 4QUKA 2ZREA 3INNA 4JXZA 1AT1A 1YK0A 4I50B 1EAYA 2DUMA 3NBFA 2IE0A 3AW9A 4ZVUA 1QWSA 4UKDA 3S7TA 4GW3A 3HU1A 3HN6A 4KQWA 3KPYA 1QCDA 2QP4A 2BHRA 3BFPA 4FEEA 1MGOA 1OLXB 3AJ8A 3DBLB 2B30A 3QP9A 5LR6A 2GDJA 1XYVA 3BWXA 3HADA 3ISJA 4MVJG 5LN1A 2LCQA 1BN7A 2Z5GA 4OGGA 4YDSA 4YMGA 2ON6A 1QQ7A 2YDXA 1M1UA 3DD5A 3GJ0A 3IBSA 4MS1A 5CK4A 2FQ1A 1LRKA 4RVNA 2NUTA 3VTAA 2OXCA 4P08A 3JZMA 3OEYA 2A5DA 1H4QA 2F8LA 3NTOA 4JUIA 4MV4A 4AKTA 4RY9A 3CU5A 3IOEA 4HXGA 4M0CA 2IUUA 3RS9A 3UXMA 5L7TA 3ZJ4A 4KRYA 1TYAE 5EUQB 3FDXA 1HMPA 2FU5C 3D02A 2GO1A 1D1TA 1OHHD 2Q5CA 3DZKA 4XVHA 3V48A 5DYYA 2BDEA 4R71A 2WIAA 3GZNB 2ZSEA 4ND2A 1Y8ZA 2GO7A 3L4SO 2XHZA 1NQTA 1SUSA 3O0DA 3IFSA 1YRHA 1U0EA 2JIOA 1HTBA 2XNJA 3GJSA 3GY0A 3H86A 4MPDA 4YFVA 1QTIA 1B73A 1IZ0A 2VBCA 1RXEA 1DZ3A 3IIJA 2FR8A 3PC8A 1KMHA 5J40A 2AQ8A 1ORTA 1T3ZA 4D80A 3Q6NA 1L7MA 3GLHE 3F8SA 4HQKA 1CP2A 5EXDA 2F3TA 2GHQA 4BN4A 4KH1A 3AF0A 1E98A 3MWEB 2XTAA 1ESZA 1GEEA 5TS2A 1Y3FE 1SUDA 4ARZB 3GLGA 4BN0A 1A1VA 1G20A 3LYAA 3VR3A 5DXFA 1IVYA 5JMOA 4J7CA 3JVVA 4GWKA 1MUUA 1FY2A 3D3NA 2ERCA 3BN3A 5F2KA 3H4TA 4BB0A 4ZV4A 3RC7A 1J8VA 1FU7A 1ONOA 1LPMA 1QIIA 3FWKA 4B4KA 4YMIA 5K0ZA 2JGRA 2JHFA 3A4IA 3H9EO 1ND5A 2LW7A 4GOJA 3K0HA 4UBOA 3S2EA 4CL3A 5JEEA 3NEJA 2OAGA 4BGEA 1J0BA 4B7XA 4BJ1A 4QQFA 3GGGA 3ZKAA 2GPBA 4G36A 2XCTB 3R3HA 4CMKA 5LQAA 1DRWA 3UWKA 1N8KA 1XZBA 2H29A 4IIBA 5KDLA 5JZ9A 1SRRA 1GPH1 4TQAA 4DPKA 3ZBUA 4MV8A 3UQYS 1NXPA 4OQNA 3ZNQA 2IPNA 1DWPA 3FVVA 3PGLA 3ZXUB 1E4EB 1HETA 5B3JA 1WF6A 4N82A 3TPFA 5JZSA 1YS2X 2WYHA 4DPMA 3CB4A 1UBNA 2BL4A 4RDCA 3LT1A 3RUDA 1RZRA 1MT0A 2BLLA 5FLYA 1NGSA 1UC9A 3WLRA 3SC2B 2VWQA 5KMGA 2ZU0C 3T9DA 2C4VA 1FRFS 4GPD1 1HE8B 3ZE0B 1PG2A 5DLPA 2PVSA 3L6EA 4N6GA 4HC4A 2GF9A 2PWAA 5EQFA 4V02A 3VSBA 4CI9A 4CLOB 2WG1A 5FOVA 3VPCA 1Z38A 2EFCB 3CFYA 3EGXA 3IXMA 1FQKA 1TJ5A 1U9IC 3QE2A 1NR1A 5DCLA 4CNBA 4WXEA 3PIDA 4MV0A 1ADBA 4HYEA 3F49S 1FFDA 2VP9A 4B6RA 1EVIA 1XL0A 5HKKD 1W30A 4OH7A 4F9EA 2VDOB 4GLJA 5ERYA 3RBZA 4AJNA 4WXPA 3BZBA 1RWKA 3KQQA 2H7CA 2F3UA 4MWSA 1TZ2A 2VH1A 3I5YA 1I2MA 1XOIA 3HLYA 4XM0A 3FD8A 1B16A 4YJGB 1N0UA 2LDXA 1S3FA 3RG8A 3VYVA 1RPAA 4AJEA 4R81A 1NUPA 1TKAA 1YZUA 3LA8A 4DV5B 4C4RA 3RVLA 3RNOA 1E8DA 2QX6A 4RD3A 2XMSA 5DWVA 4PPYA 1JIVA 1B3RA 2H6EA 3CGWA 1CEQA 2P69A 4PG8A 5JPCA 2H4HA 2RBEA 1BMFD 1Z17A 3WFIA 4Q19A 1A69A 2IXGA 2OA0A 1ODTC 2NZ2A 4EX7A 4R2MA 1WQ1R 1JDTA 2KSQA 4HDOB 1XJWA 4UCXA 4L6CA 4HEJA 1T1GA 2VJNA 3A1FA 2ZYAA 2P2YA 5FHQA 4YIKA 1Z8DA 4WJKB 2P90A 1TLLA 3S99A 2B8TA 3UMBA 3VXKA 4IWXA 2J0UB 4QTZA 3TFOA 4ND5A 5DZSA 5LKAA 3L01A 3QBEA 1VKHA 4OF4A 4B83A 1JQAA 2FJUA 4WY2A 3WDLA 3GNLA 5EI5A 1SQSA 2HU7A 5K51A 3K70B 2XGJA 1FB5A 1EFKA 4RBNA 4N3CA 4RQUA 3M83A 1G21A 3VI3B 3CLUD 4RDHA 1G6KA 1OI4A 2PSHA 3O1JC 4QPDA 1E0JA 4PIMA 5DCYA 5TR9A 3RIYA 4OL0A 2A8YA 5JXHA 2JIZA 5DHTA 2VQ6A 3GJXC 3L7KA 1NP6A 3CRW1 3EPLA 2BBWA 4WZ6A 2ODTX 4UEJA 1GQ2A 3SC6A 5ALGA 4BB9A 1RE1A 2D00A 1G38A 1IDN1 2PLFA 4A8JB 4PC6A 2YRXA 4YRCA 3KLOA 1RWVA 5DIFA 4CL2A 5AKXA 2OZKA 3MSXA 3ROXA 1GZVA 4OJKA 4CIWA 2BMEA 3RLFA 1U3CA 2WTEA 2Z1MA 3B2QA 3ENKA 3OP1A 5J5AA 2HZ7A 1EDZA 3DAYA 1I32A 4RPHA 3CWZA 5ILQA 1K92A 1GNLA 1A76A 1QIHA 1TD9A 2XT0A 4FGWA 4TYYA 1B0PA 1I1OA 3BULA 3QV1A 4RD4A 5AI9A 3DB2A 3PQ5A 1VRCA 4OHVA 2O48X 3VMMA 1PFVA 3CH5A 1DGQA 2W4IA 1M6VA 3ZNPA 4DDHA 3I37X 2POCA 1ZDMA 4E7OA 2CCJA 3S7ZA 1WVGA 3NWOA 4F9FA 2WSLA 2XMPA 1IVNA 2V1XA 5CD1A 3NHRA 1V37A 2CHEA 4P3KA 3CX8A 2HIAA 2QK4A 4JLKA 3T4XA 3OPQA 3OICA 4LZLA 4FB5A 1JLLB 1D1QA 2GK4A 1MQ9A 2UYGA 3MGKA 1NI4B 4CMAA 2VTVA 1KY3A 1SBTA 1ZSYA 1H2BA 4KITB 2OZLB 3PTZA 3UANA 5F1PA 5LXTF 3AEQB 3CR8A 3GLHA 3K0BA 1BVYF 3T35A 4DW8A 5H4GA 3GHYA 3B6IA 1T1IA 4FZVA 1THZA 1BS1A 4X8OA 4JUBA 4A6EA 2BTOA 4H4DA 5DU2A 1G5FA 4HCJA 5BSRA 2RHGB 4U6SA 5D1HA 1V25A 1G4UR 1M1YE 3VOAA 2OILA 1VCOA 4B46A 4QDZA 4KG7A 1DS6A 5EXSA 3JQ9C 2G4VA 4L4XA 5EKSA 3QBTA 4JDPA 4OP3A 5CDFE 2VQEB 3ZD9A 2ID8A 4BO8A 2RHCA 5HKLA 2Q5LA 5H9VA 5I47A 3IDZA 4GX1A 3ZZ0A 3W5IA 4ZU1X 1DXYA 3H4MA 4Q3OA 2IIVA 2JGEA 4MO9A 3S2YA 1JT2A 3F3YA 3VTKA 5EJ8A 2I7XA 4EL5A 2BAGA 3RU9A 4AZ0A 1FTQA 4IFTA 4HNRA 4I3GA 2C2YA 4I81A 2HWYA 1EUQA 4G37A 3WK7A 3REGA 1NDUA 2XCQA 5K45A 3B12A 3CKMA 3HCFA 3PKZA 2YYSA 3REOA 4AS2A 4GP9A 5CTAA 2C9YA 1TADA 1FFWA 1Q44A 3RU3A 4WJLA 5HZHA 4ND8A 1JAYA 1KWGA 2OFPA 4X44A 1YB2A 1VG9B 5BSEA 2QMHA 3V8VA 1SIBE 4RPJA 5CVJA 5ANRB 4BV3A 1I6KA 1X9GA 1QDEA 4PZ9A 5FT9A 4CMIA 4DARA 3KWMA 4YNBA 2ANCA 3T1VA 3MYRA 1MBZA 1HYHA 1N2EA 4JY7A 3ADOA 2C78A 1JFTA 2WHPB 2C2BA 3BTUA 4R8KA 1VJDA 2Q0SA 1NV9A 2OTCA 2VJMA 5AOCA 3UGJA 4HRAA 2IODA 3GI1A 5IDXA 3TLKA 1VSUA 4OSPA 2QG9A 1IOVA 3N6XA 4JZKA 5L3ZA 1J90A 5FX2A 3MJDA 1ZOPA 1Y89A 3P9YA 3I9KA 4KV7A 4UUPA 4C4YA 1U7PA 2XCRB 3HVHA 4KQMA 2QWXA 4M8IA 1ECPA 2AV6A 2ZJZA 4W7IA 4ZVQA 3KFXA 1NURA 3CLKA 4Y2UA 3V8BA 2ZTMA 1SKYE 1A9XB 1RXWA 5ALZA 1OQAA 3ASZA 1VLZA 5DMXA 4EO9A 2OUIA 1O9BA 2Y1DA 4F7WA 1QKIA 1JEAA 2AFIA 3PD0A 5MGBA 3OF3A 5K0BA 3ICCA 4LG1A 4F6RA 3JPWA 3FPGA 2GEKA 1L7XA 3INRA 2DKNA 3MRSA 1S02A 4GPTA 5LA6A 2K87A 2W2KB 4GEGA 3PKJA 1WXIA 1TTHA 3VR0A 1TD1A 2NUAA 4M99A 3A6ZA 5M34A 1G16A 1HEUA 2BM9A 1DBIA 2PH5A 3DBRB 3PUWA 4PZPA 4ZCIA 4G1UC 3WIBA 4ZYWA 3KUXA 4UXJA 3K6KA 4BDTA 4CQLB 3IR6A 3KELA 1TC2A 2K7ZA 1T3TA 4KXYA 3IDAA 4BMYA 1PE0A 3KJFA 5DTEA 1WV0A 2YWGA 4RE5A 3T9AA 3W78A 4I4TF 2Q3LA 1XX6A 4YMHA 3LT2A 2CDAA 2I6QA 2JCVA 1CFJA 1ZM4A 2ZT8A 3U1VA 1GL3A 4DLYA 4UU7A 5JADA 2P0EA 4YT8A 3EZ2A 1SXGA 4FJ2A 3K30A 1YZYA 1W4LA 5CDHA 3CCCA 1Z0SA 1PS9A 1WW3A 1JE0A 1JHVA 2RJ3A 3K1TA 1NQAO 3GAZA 3N39C 4DG8A 2QJFA 5CDYA 1XQ6A 1E1MA 1OZ0A 3A9RA 3KO8A 4GMFA 4BCBA 4PLTA 1J8DA 5ALVA 1SC6A 3BL8A 3H75A 1GGNA 1AA9A 3BA6A 3INYA 3GLFE 1G7CA 4HAOA 1Z2OX 4EATA 4JBNA 3T1TA 3SCZA 4DJDC 3LZDA 1SHJA 3RFXA 1T9GR 4ISCA 4LHSA 5F1OA 1LBQA 3I8OA 2XVXA 1L2TA 4ZAZA 4IDQA 2QI9C 4QYWA 5K0NA 2UVPB 4FWBA 4AF8A 3H6GA 4EI8A 5FNZA 4I5IA 3NOOA 3X1JA 3TIIA 4COKA 3PFFA 4L8GA 2BEWB 3KKLA 4OM7A 3ECAA 3A3YA 4TRRA 4MW6A 5FAKA 5JSFA 1IB6A 2FX5A 1CCWA 1WCXA 4Y2SA 5L4LA 4N5DA 2VVTA 3A36A 2MCFA 3LPMA 4CDRA 1ESCA 3JXEA 2WILA 1BX3A 3F7MA 3WGIA 1CRPA 2WNIA 2DHDA 3ML1A 5JS2A 4HUQB 4EZEA 2ZVDA 4GOOD 4N48A 1AB5A 2G9RA 5EKXA 3CNQS 4KQ6A 1D1PA 3K73O 4X90A 2IY8A 2CV2A 2FK8A 4RDIA 3KVVA 4MUGA 4BVJA 3CH7A 3O9ZA 4QGGA 3BXZA 1ZMXA 1LRJA 5FL7D 2PD6A 1U2GC 1C9DB 2FOLA 4UVEA 4YR9A 1LBEA 3ANSA 3NIFB 5BW4A 4C3ZA 4CEIA 3DJYA 5INTA 4QHSA 3G8YA 4N5IX 2FZ4A 3NBUA 4J75A 1EESA 1YZGA 1PZMA 3A6FA 3OEHA 3FDJA 1KJYA 2Y6UA 2YVUA 4JA2A 3T7CA 4QU9A 2GMWA 2JHPA 4MR7B 5EIOA 3ND7A 1WUYA 1EK5A 3R9XA 4JQCA 4Z3DA 2NU8A 4KQJA 4DN6A 4TTAA 2VG8A 1M1YA 3BSFA 3BXOA 3HDHA 1JEQA 3H3JA 1UQTA 1THGA 4H1UA 3OLQA 4Q9NA 5FFNA 3ZVLA 2OK8A 4B4OA 2CXQA 2YJ6A 4BO3A 1DSSG 1VP9A 1NI3A 3LT5A 1F2DA 2G1JA 3R41A 4PRZA 5J2TB 4IHJF 3W3AA 5EEHA 3VC3A 1EVQA 1QGAA 1QQTA 2JIDA 1LPOA 3QVSA 4P9NA 3H97A 4M0MA 1T6ZA 1A1SA 1SAYA 1YQGA 3I0MA 5AHOA 4UQLA 4CEHB 1FX1A 1J0EA 5JQGF 5JIBA 4CM5A 5EKUA 2XDQA 5HUHA 1Q7EA 3DUFA 1KOJA 1P18A 4CWAA 3S8EA 4G0NA 4BECA 3R3YA 3RFTA 4QLOA 4X64B 5CAEA 1BMTA 3A4NA 5LMNB 4EY5A 1G5PA 2PX3A 4B4WA 2G83A 3A1VA 3LLVA 3T1OA 5E6RB 1Z18A 2GD2A 3TR0A 4RKQA 2OKGA 3SBEA 4F1JA 4OCZA 5BNIA 1NXTA 2FH5B 2RBKA 2YJGA 1FVXA 1FS4A 2V7UA 3E8SA 2GCPA 3KUCA 3PBKA 4OH1A 4EP1A 5FOQA 1ISMA 5E2BA 4OX9B 2JVIA 3SQWA 4KIFA 3PZBA 1M7BA 2A1UB 3LTEA 2H7VA 3F74A 4DLNA 3HHPA 2C92A 3RVQA 2IW1A 3L9WA 3IE2A 3FI9A 3HE3A 3KAQA 1KNQA 4RZSA 3FKJA 4CLRB 3D43A 1J20A 5EFZA 3MBIA 4BQEA 1Q0HA 1QJCA 1P19A 3PRJA 3UYKA 4BVAA 3L0CA 2J6HA 4TS3A 1RAIA 2Z4RA 1QHHA 4KTTE 1B00A 4AICA 3AUFA 4IILA 3MIZA 5CXQA 2ZVJA 2B2NA 1VLHA 3DMFA 4K7JA 3HJTA 2X1MA 1KJZA 1NOJA 3BRWA 5C8YA 1C8LA 2FB9A 4GZLA 3PSAA 5AIBA 3SIRA 2Q49A 1J5PA 3S1AA 3FPCA 1XKLA 2YZGA 3GG9A 3LPLA 4C78A 5I8PA 4PSCA 4N49A 3SICE 3SSAA 2FX2A 4YT2A 4G09A 3NNDA 8MHTA 4UREA 4WACA 5BN4A 5CG1A 3HUEA 5KC8A 5KKCA 4XSGA 3E35A 3GIDA 5IKOA 3ICEA 2NMVA 3DLAA 3E2IA 4U2CA 5H8WA 2W93A 2NT4A 3FROA 3EMKA 4BX3A 5IBQA 2MINA 3OE7A 4C6RA 4DS3A 1MRZA 2IZ6A 5LUAA 3WG9A 1GR1A 2SECE 1FMFA 5EMLA 4OQYA 3VPAA 5T4FA 1U2ZA 2P6MA 1V1RA 1QRTA 1U0HC 3DV9A 3HMKA 1SBQA 2H48A 2J0EA 3LXXA 3PR2B 3AIOA 3PRYA 1JTFA 3QBJA 4JYAB 4YO8A 3UQZA 3JY6A 4IFIA 3GV0A 4OKNA 3THYA 1AK1A 1PUXA 1VCNA 3QU5A 3SR3A 4AQDA 5B1YA 2JLQA 3AKCA 1E9FA 2KE5A 4NDZA 3U49A 4G9GA 5J4VA 1NUSA 4PYOA 1LPNA 4QBFA 3THOA 5K8IA 1QQ6A 1SU4A 3MMZA 1DKMA 4FOTA 2Q9BA 1UKBA 3OTHA 1JLHA 1NVFA 4RPCA 5JH7F 2D1QA 5I51A 1PBTA 3EGWA 1UWLA 4F72A 1Z2CA 3NGMA 1JIJA 2FF7A 3FWNA 1D9XA 3UMGA 1D2CA 3B1WA 4UMVA 4Y2YA 2NGRA 3KYCB 3BZWA 4FKBA 1C2TA 2WIGA 1BHSA 1QJ4A 1XTBA 1Z25A 3SQNA 1E6EA 4I1RA 2CNLA 4IIJA 4CR7A 2PX5A 4IDHA 1XQ1A 4B7AA 1KPIA 4MQEA 1ISFA 1C0IA 2WWXA 4FR2A 4HKTA 3WOHA 4CTOA 4TMKA 2AI2A 1HDZA 1XUOA 4OBEA 3I34X 1ZNQO 5TEVA 4V03A 1HT3A 1AUVA 1Z88A 2BI8A 4ZVNA 3PDIB 3TQFA 3UA3A 3WYFA 4QYTA 1CUBA 1XLTC 3F96A 4IPTA 4UUBA 1IATA 3CRZA 4LKOA 1WXHA 4W9NA 5KZMB 2IELA 1X9IA 2BUCA 5FKJA 4KHZA 1N0VC 5ULLA 3TN7A 2XR1A 2EHDA 3X43A 4BZXA 1KQFA 2BFWA 3PFCA 2XJ9A 2PAAA 2JBAA 3JQEA 1KVTA 3KR1A 3T5MA 3BVPA 3TSZA 4M0KA 1Q57A 4OMDA 1MW9X 3A0UA 3F5FA 4ZODA 4BBZA 2CFTA 3HO1A 1MABB 2O54A 3SOPA 3AEUB 4KQEA 4POAA 4OLAA 3QY9A 3CUKA 2WTUA 1ZUNA 3LK7A 4Z53A 2KHZA 2JW5A 1GKLA 4N54A 1FE8A 1VBKA 3MWDA 1YC5A 4ONEA 1IMOA 1TZCA 1U0NA 1YL6A 2ZJ6A 4RH0A 1R4NB 3BA1A 2BJVA 2JFQA 4PQYA 2REQB 5CLGA 4C6HA 2Y0EA 3SZ3A 3V8EA 1DVRA 1RM5A 4ENPA 4FEYA 5DNYB 3Q3IA 2HCFA 3VVCA 1R0YA 4HG2A 2GA9A 2I5PO 4O1IA 1ISGA 1WKCA 1Z4MA 4UEQA 2EJCA 3FSRA 3I39X 2ZAIA 2ZDGA 2V6BA 5AKYA 5IN5A 4ZK6A 4DB4A 3B1XA 4G5GA 4CKWA 3R5HA 3PEFA 1QGOA 3N8HA 1X1BA 4A8HA 4EG6A 2FW9A 1N7HA 2QAJA 1IN1A 3CKYA 2BZGA 1VLLA 2IYYA 3LV8A 4NY1A 4Y2GA 4MROA 1NT2A 4FINA 3MZ0A 4ZARA 3DCNA 3WL7A 4QM6A 1EX6A 2A88A 3T7JA 2R7AA 4NJOA 1FUEA 3HXLA 1FLAA 2NYAA 2PZAA 1BD4A 4JJ7A 1IN5A 5JXGA 2B98A 4DCTA 2A4KA 1REQB 1DEAA 1KI4A 1J9GA 2ZJOA 4PZAA 2CSXA 1IJBA 2HI0A 2EATA 1J1IA 3DQZA 5JCJA 3ADPA 2LKDA 4Y6RA 3LFUA 4MS3A 3L6RA 3G7UA 3W90A 1IC6A 1RWBA 1J2UA 3C45A 3PJFA 5BUCA 1JKMA 4MK4A 3EFOA 4TSKA 3RG2A 5IJ0B 4LDNA 2IYOA 3HWRA 3LUBA 2Z2ZA 3BXPA 1JGTA 4AECA 3P2KA 2XADA 1Y1SA 4I50A 2WE7A 1SC9A 5KCMA 5C8DA 1QMPA 4RMHA 4BUCA 1A5BB 3Q3EA 1A77A 1GRNA 1Q1ZA 1VM6A 3JWHA 3DUWA 4JGGA 2JBHA 3DBLA 1OLXA 2BUBA 2C82A 2GJAA 2X4DA 1HQYE 3BQMB 3Q6MA 3I9JA 4LE1A 4ASUA 4D3XA 2EZ9A 5J2UA 1NBMD 3RH0A 4QOHA 1ZN7A 3O4HA 2QSJA 1EXWA 5FNVB 3SWWA 2IW3A 2QJTA 3FMIA 3PYLA 1D2NA 2FJPA 1P2TA 3AWIA 2OYSA 5BOSB 2TMGA 2YOFA 3OQBA 1GQYA 1RJ9B 1E6MA 1N5RA 2IPAB 3CKKA 5H83A 3ZV4A 4Z7NB 4R1OA 3G5UA 4WECA 2CLFB 3P4XA 2AQIA 1OY1A 4LRYA 5ELMA 2WY2D 2W6JA 1JU4A 3K0CA 1UPAA 3WSTA 2R44A 3LPCA 3V1YA 4YRBA 1IEXA 1L7DA 4QECA 3HJGA 1AGPA 2GN0A 2J3LA 4YJDA 1ODKA 2IY9A 4IH4A 1GITA 2O0MA 2DBYA 2AXQA 1GV0A 2DBVO 3GZNA 3EVTA 4F46A 1RAEA 1RMTA 4G0YA 1ZR2A 3IALA 4MP3A 3KPJA 5AP9A 1RTTA 3SI7A 5A4FS 5JFTA 2HSWA 1OD6A 4LMPA 3GAMA 3HYRA 4Q66C 3TD9A 1DWUA 2OB1A 2PD3A 1AKYA 2WF6A 2GXQA 2OORA 3NJ4A 3GROA 3ROZA 4C14A 2IKQA 3HY3A 4UBIA 2NADA 2AZDA 4GMHA 5KPJA 1DT3A 3UHOA 1QRRA 4PAOA 3ETNA 2XGOA 4MKGA 3TKLA 2H2DA 2JA2A 2X5OA 2IGTA 3SBOA 2PGAA 3HB1A 3L4KA 3G0IA 4FQ7A 3MWEA 1PV2A 4MJXA 4ARZA 3QNUA 2ZJ8A 3S1LA 2C94A 2X40A 1B4DA 4OSOA 2WP8J 3ZH2A 5JWRA 2UXBB 2VP5A 1KQ3A 2VEDA 2YWCA 5H68A 3UUWA 3FFAA 4JLSA 5IAEA 1D5CA 1AQIA 3O4JA 4J1TA 2WRZA 1VJRA 1E79D 3LWNA 2GZHA 2WTBA 4FU0A 2C31A 2QAIA 2BHTA 1UAYA 4H7JA 5FAXA 3W2TA 1UDXA 2D2EA 3D0KA 3PLRA 1U2TA 2JJ2A 4F84A 1XEWX 4PVCA 3KU4A 4B85A 5JVDB 3C14C 4PYIA 3A2MA 1DAMA 1WUTA 3I6YA 4OXIA 4EF6A 5LB2A 4DHEA 1DDGA 1JBEA 3DC2A 1OW3B 2XB4A 4IF4A 1OR8A 4UM9D 4GYJA 1K6EA 2DHQA 4H7EA 1JHUA 4GE3A 1IOZA 1JHRA 5JFGA 4RW0A 4GI3A 2XLCA 4EKDA 3M9LA 4OHZA 2PUEA 1S3GA 2RGNC 1MNAA 4M7OA 3WR5A 2PL9A 1DIRA 4EGSA 1Y9AA 1E4EA 4CBVA 2EERA 2PGOA 2ERYA 4WESB 2XZOA 3TLCA 5FWDA 2HN9A 5HIKA 1OH6A 3WQHA 2JGIA 4BVKA 1ZJJA 1FQJA 3AEYA 2IU0A 2A9RA 4KWHA 1PRYA 2ZPTX 2ZB7A 1F8GA 3DMRA 3N2GB 4Q4LA 4TL6A 5GV7A 2G07A 3SC2A 5IT4A 1HX7A 4XWOA 2X1LA 2WWIA 3ITEA 2BCEA 1GNQA 4LBWA 4NZZA 1T43A 3T8YA 3ZNNA 1CU1A 2IEBA 4K9MA 4AZVA 1C9JA 5AM5A 1AKRA 2FFAA 3QLEA 4HUJA 2G77B 4KBFA 4NV0A 3DQQA 5I9NA 4IEIA 1X39A 2OBMA 5E9JA 2ZRQA 3LIIA 1KEWA 4AIRA 1YZTA 3CN9A 5JDIC 2XAAA 3IIEA 1JDVA 1IZZA 3G1WA 3MF4A 4UTZA 2Q9AA 5AHKA 3TOCA 3T5AA 3ZVKA 2IDKA 2IHKA 3KQWA 1U4SA 2PJDA 3MD9A 4ARUA 4BLQA 3ZHCA 3RYHB 2YZNA 5CJ2A 5IXYA 3D8UA 3ZEAA 1YRQA 2J32A 4B5KA 4LDRA 3HGMA 4FMBB 2BT4A 3SP1A 2E18A 2D8AA 5CTJA 3Q87B 4MKFA 5A5GA 1XHEA 2IZ1A 3II6X 4JLMA 4YJGA 1OFHA 4EA7A 5AK0A 1BS2A 1JPNA 1Z74A 5BSKA 5FYDA 4RTQA 1XAGA 1XMIA 5JNVA 1QFYA 1RSZA 3ZU6A 4P81A 2ZBVA 4OFZA 5EWLB 3HPRA 1F6WA 2HSZA 1JYSA 5J9FA 2PMWB 1M0SA 2GI4A 3ADKA 3HY4A 3P94A 3MSCA 4HVTA 2JFHA 3P9NA 2X58A 4M21A 4G23A 2OLKA 2QXYA 1RQGA 3R2JA 1S2OA 4Y2TA 4Z9YA 5GOTA 2H4YA 2WDZA 3OZDA 1IQPA 3HU3A 3FOZA 4C89A 2VHQA 4QXPA 4JGIA 5IDWA 4AM8A 2GN2A 3HSKA 1E2GA 4KODA 3DMTA 5TMPA 1X2EA 4F2PA 2NXCA 2J0UA 1XTQA 3C1UA 1GQRA 1RLUA 2I03A 3D6NB 4X45A 2A9OA 1WBJB 3GMDA 2DLCX 4DSOA 3BDAA 3QPVA 4LHZA 4N6OA 5DJ5A 2H1LA 3CZRA 1TNDA 3PQ7A 2VXOA 5DMHA 3K8QA 2PL1A 2HNKA 2B1GA 2JI4A 3PLNA 3OIYA 4HX2A 4U9UA 4ENRA 5I45A 1L9XA 5JNLA 1OGYA 1HDGO 5AKHA 1DAPA 1E1QA 2FPXA 3UT5A 3J7TA 3DO8A 4UAJA 3AUJB 1IY0A 2G8LA 4GR9A 4NQRA 4N3NA 3HN2A 1X7XB 4PYLA 5ALOA 3WLAA 4NU0A 3N2IA 5L6MB 3U7RA 1OGIA 3L7CA 3JQ8B 4QWWA 3HXQA 2XVZA 3WGVA 4RHFA 2VNHA 3TD2A 3F7NA 1P4RA 3EXG1 4FCTA 3VZDA 4EK9A 3PYMA 1I1QB 4IHKA 2DPXA 3ANTA 1NFFA 1FDOA 1A98A 1Q7BA 1PGJA 2FSHA 4Y2HA 3FPBA 5EPOA 3RRFA 4A8JA 4AYTA 3ZCRA 3TZKA 5DK6A 2C0PA 4O63O 3U17A 3PLAE 1YE8A 1GPMA 3L0BA 2G70A 4N7BA 1OAOC 2ZR7A 2REOA 3JQPA 3LG2A 4YDHB 4BCCA 2YZ7A 4EHFA 5SY6A 3KJNA 1SKBA 1L7RA 1DE0A 3IQDB 5F1YA 3DFZA 3S44A 1HSOA 4LZZA 2B2XA 4ZXFA 1BXGB 1TVKB 4RS3A 3OFND 2AUNA 5F33A 4YRFA 5IT9A 1NPYA 4O5AA 1QHNA 4IVNA 3C3BA 1IUOA 1RW4A 1SK8A 1F20A 2PR2A 3R5TA 3V1UA 5C18A 4X1IB 1CHNA 3M5CA 2GUGA 3OZRA 3PV0A 4Q3LA 5EIEA 2AVNA 5BR8B 5G3YA 4GI2A 1A4XA 4S0ZA 2LKCA 3TQSA 5KBYA 4P4UA 1J4AA 3C5WP 3KPUA 3WDMA 3FY4A 3D1JA 1JLLA 4HRVA 1MQAA 4LZPA 3KP1A 4RC9A 4LHWA 1MH9A 3GRCA 1NI4A 3KKEA 4CFZA 5H9WA 1Y82A 5C53B 2P91A 1NONA 3DKKA 3GLRA 1YO6A 3QLUA 2FMKA 2VPTA 4RIIA 4Z49A 2JKVA 2OZLA 2ZM6B 3A05A 3LC1O 3EG5A 5K6RA 3D6JA 3AEQA 2Z3WA 4AAYA 3HP7A 1JTEA 2HC9A 4L07A 1JDPA 5HJ5A 2XQIA 2VQFB 1Q14A 3D2BA 2CDBA 1FXWF 3UAVA 2GTIA 3JYLA 4ZKDA 4DMMA 4PW0A 4ZMRA 5BORA 2HMYB 4Q3DA 4TTRA 3CXUA 4E1VA 1N1MA 2L82A 3HDYA 3KBBA 3CNBA 4KWIA 2I2CA 4NYIQ 3JALB 3IC5A 4XW2A 4IQ0A 4BMCA 1DTEA 2G0AA 4GX2A 1EX9A 4HTFB 2DFLA 3NHUA 1QC5B 2IHVA 4FMCF 3KL4A 1PHRA 2NPFA 2A84A 4LSZA 2QUKA 4HFNA 3AHGA 2WTMA 1JL3A 1P0IA 2B69A 1GPJA 2P2NA 2DR0A 3NR2A 2ZGVA 4JT4A 4PSAA 4S35A 4BB5A 3C3AA 3PL5A 4W5RA 3QXHA 2Q5JA 2RHTA 4C4SA 1XZHA 3E9RA 3AY3A 3JTMA 2LTAA 4K81B 1QYRA 1GA6A 1LKZA 2P6OA 4NCXA 4ZVRA 4URXR 5IH7A 4FYJA 4JI0B 3Q7TA 3YASA 1KGSA 3RC3A 5A03A 1JR2A 1J6UA 2P67A 3BE8A 3ADCA 2R00A 3DXFA 1NQVA 3JWEA 4BKPA 3UFBA 5A4MS 4DCSA 1XRMA 1TUGA 2WU8A 5F3WB 5DM0A 1IUPA 3WA6A 2ZVPX 3H87A 3TSOA 2CY0A 2WKWA 2IV7A 3VKHA 5ENVA 2C3UA 2CEAA 2H65A 4ZKEA 1ZA2A 1XVLA 4YGYA 5P21A 1HUQA 3AHJA 2NO1A 5EHXA 3UIEA 2R6CA 3VDQA 4L2IB 3OCJA 4EUSA 2WHPA 2GHIA 2NU6B 1I10A 2PFGA 1GZHB 1MC4A 1US8B 3P32A 2BLNA 2N9UA 3FZGA 3RYCB 2FMIA 4X20B 4LXUA 3FWYA 4B3CA 2JI6A 1IY8A 3UN1A 3DFMA 2BZSA 2VYND 2IYZA 4S0XA 4KKVA 1JFVA 4RU1A 2IL1A 4WOJA 3UB3A 1JV2B 1WMSA 3H4IA 4PHFA 521PA 5DULA 3KQUA 3I58A 1RFLA 4AMYA 4EL0A 4PPNA 5H3HA 2IUYA 2C2MA 3FJYA 3HACA 4UDOA 5LZ5A 4EHAA 5C1PA 1M7GA 2RH8A 3WGJA 4J90A 4PYQA 1A9XA 3VU3A 1SOVA 3I2HA 3MXTA 4CM4B 1T1SA 3SS8A 3EH1A 2CNKA 1Z6XA 1NLFA 2YWFA 3EHEA 4YLYA 5C8ZA 3NVDA 5ES3A 3TW0A 1F4LA 4JNCA 1L8OA 3VOTA 1F06A 2JAWA 2W2KA 2Y71A 4KB5A 2IZ7A 2W83A 2HL6A 3L8YA 4MJLA 3CY6A 3RKUA 1E9DA 1E4YA 2OGTA 1U6IA 1JVBA 2B0CA 3KXIA 4ZK2A 4HAYA 1SG6A 2D0DA 4IKOA 3BILA 4KAJA 1WB5A 4NTZA 1WHTB 4CQLA 4EAQA 2UZAA 2YINC 3LOPA 4LYAA 1A9PA 2UVDA 4KPFC 1CZNA 4P0TA 3QFTA 1XDUA 1XO1A 4KXUA 3QOXA 4B3SB 1IK4A 1RKXA 4L4SA 4WDRA 2YJZA 1U90A 4HYYA 4Q4DA 1WDMA 3LIPA 1TZJA 3SIPA 5BQXA 3ER9A 5AM3A 2XKJE 3QI7A 4CMGA 1PP4A 3IQEA 4LW8A 3L92A 1R6DA 2OCIA 4XWTA 3TQIA 5DYTA 5ESDA 1C14A 3V9AA 2IOFK 2XA2A 2QUAA 4JOCA 3RD5A 4EJSB 2Y27A 5LOVF 1CQIB 1TKBA 3Q2IA 5KYYB 5EGNA 2ALJA 3TM4A 1D09A 4GZ5A 1BFUA 1VIAA 5KUTA 4UARA 2OD7A 4ZICA 1M2WA 2VTEA 4IJQA 4RL4A 4XCVA 4EB3A 4AY5A 2GAIA 4YAKA 4DV0B 4V3CA 5E0KB 3HCBA 2XE6A 1IULA 4UAVA 4GWLA 4M76B 3K9WA 4OBBA 1RQ7A 4TSFA 4HLDA 3WGKA 2UVPA 2WMDA 3HFJA 3SQOA 4QEZA 2ZPUA 4KE7A 5MHTA 3JD2A 4L9WA 1E9BA 1U02A 3ETGA 2FN9A 2XITA 1V43A 3AB3A 3IUYA 2BEWA 2FRXA 3O3OB 3TRJA 1IUNA 3TQOA 3KQKA 4KGZA 5IDQA 1JALA 2C84A 1JJ7A 1K88A 1ORDA 1YDFA 1ZNWA 2FPWA 1QPGA 1AG9A 5HK9A 1QYIA 1J24A 4CT5A 2B78A 2MTBA 1IN6A 3AB7A 3I2GA 2CHQA 4B3TB 1U0TA 1UAAA 4HUQA 4W7SA 3K53A 3MCZA 2R66A 3KTDA 3BL5A 1XZDA 2AXEA 2R1TB 3B6MA 5T6BA 4J4BA 1Z12A 4PTYA 4LRQA 1UBSB 1D2AA 2C07A 4YGXB 2JFYA 5FEMA 4PGGA 1SQ5A 3PNVA 4GKKB 1F0KA 4LX0A 1I2DA 3VJMA 5IWCA 4N03A 2PK3A 4GYKA 1O0SA 5EHZA 3H3FA 3ZR4B 1TJPB 2CNWD 3O26A 2GPTA 3RIMA 2R8PA 3ZQKA 1Q91A 3N07A 2KM1A 4KMSA 4RPGA 4CEJB 2XMRA 1PR2A 5DN6A 4J3FA 3RWBA 3PSHA 1RMQA 4GOLD 1ORRA 1SQFA 3S55A 5LWHA 2Y4NA 3QWHA 3IOYA 1BZYA 2DJ5A 2Z83A 4MR7A 3WFZA 3TE7A 2IIBA 3AI2A 1L4HA 2HKIA 2OCDA 3GF4A 3UJ8A 3HJCA 4KC0A 1ZN9A 4H7KA 1J7KA 1E64A 4AKSA 1T9ZA 1OVGA 2VIIA 3LQRA 3LUGA 4C21A 1DFHA 2D3WA 4BJ5A 2P7IA 3GVIA 4J1QA 2ODEA 4RTSA 4JB2A 2BHSA 1Z0ZA 4QO8A 1Y80A 3B7WA 3BCUA 4ZV7A 4QC2A 3B1KA 4RMGA 2B92A 1NF9A 2O7RA 2YFKA 4I66A 4JLWA 4Q1CA 2NZJA 2OK7A 1Z13A 4HDRB 2JHAA 3FFWA 3AZQA 4FN5A 2QG4A 3Q8WA 3Q98A 5F9MA 3VPXA 3N53A 1JG4A 3A9VA 1KYWA 1O97C 3BKXA 3HRIA 2B1RA 3L4BA 3QUAA 3QVXA 4NP6A 4PGMA 3O47A 3NP9A 4ZDWA 2F3QA 3HCWA 4C3UA 5FCDA 2YQ5A 3HRKA 5DF1A 3TZQA 4DQXA 5FBWB 4E2FA 4F11A 4TGLA 5K3CA 1FU8A 1G60A 1UK7A 4DIDA 1ZI8A 3LJKA 5E6RA 4CYMA 3QEBZ 4X0EA 1ECBA 2ZBPA 2D7JA 4DIKA 4BP8A 3G7NA 1QNLA 3SS7X 2R96A 5FORA 3ZE7A 4TMFA 1F0PA 3ZZMA 5FBQB 4ND3A 1QVRA 1RADA 3H5WA 4RF5A 4QM7A 1KY5A 2Z56A 3N2EA 1PR3A 2A1UA 3JAWB 4YAJA 3R0JA 3WL3A 1BQ4A 2DAPA 1Z28A 2Q3BA 3IX7A 1YVRA 1ZVJA 5I4BA 3VR6D 5G4LA 1PGPA 3EWIA 3IVCA 4NAVA 4YP5A 4DY6A 4L3OA 2FQYA 1TJ3A 3WLFA 1D6NA 3PJDA 4W1RA 1MF7A 4CLRA 4H1WA 3G8BA 4MVJA 1I1NA 1WTCA 2JGAA 3IV9A 4KYIB 4YCDA 3JD1A 3DTVB 2QA5A 3H1PA 4ZT5A 1LSSA 3O3NB 1Y4AE 2CW5A 2H16A 5K3AA 4EAAA 4A15A 4GHWA 1V45E 2ZAGA 5CJPA 1H6CA 2X6TA 3SLGA 3RS5A 3BEDA 1I4EB 1XHLA 3AHHA 4NCHA 3AR3A 3T7KA 3GQBB 5JC8A 1GZ6A 1R0CA 1QTRA 1G4HA 3P26A 1HT2E 3Q6IA 1OKKA 3RNLA 3HMQA 4M1WA 5ENDA 2PZLA 3DZ8A 1TW2A 5J1SB 3WIEA 4CPDA 1T2EA 3HV0A 2Q3FA 4NBWA 4YEDA 3UJ9A 2PUVA 2VAXA 4CW7A 2C57A 5FA8A 3EXIB 4EKGA 4JODA 1I4WA 3X1YA 4RJIA 1NMXA 2D5CA 4KLNA 2GRUA 3OEEA 4M55A 1Z5ZA 1W9MA 1O95C 4FXPA 1KC3A 2WOOA 1ZH6A 1L4MA 3GFOA 4JIMA 1RPJA 4KQIA 5HNKA 1NQXA 2QZPA 4LIPD 4KUEA 1WW2A 3JRWA 3HGQA 4EB8A 2FDXA 1W76A 2P9YA 3AYXB 3DWEX 3KR0A 4KK4A 4X6UA 4DNXA 4ETWA 4OB7A 3LLMA 4QL3A 3M6XA 2AZ4A 5JZOA 1BGWA 4PO3X 2R65A 4H7HA 4QPPA 4D02A 3DDWA 2AZTA 3I1YA 1JPUA 2BELA 3UJHA 1COWA 3WLKX 4WZZA 3SX0A 2WPNA 5FTJA 5LMZA 2PIAA 2GJ4A 4FMDB 1MT3A 1IIRA 3DOOA 1TM3E 5JTTA 4Y0NA 4EG3A 2JH8A 2FPIB 2CLHB 3O4RA 4RZUA 3TKYA 4KNYA 2A9JA 3L8ZA 1AKUA 3I28A 1BS9A 4MUXA 1UBMS 2CB9A 1NDHA 1QAOA 2R79A 4GOXA 1KMIY 4HDMB 4FXOA 5DP2A 1T8UA 1TUIA 5FO0A 3OO1A 3RAJA 1ZC3A 3KSRA 2Z2KA 3TKAA 3KYCA 2Q21A 3F1LA 4HY3A 3EC1A 4EECA 4DXAA 4Y7DA 3EFBA 2NO4A 2YS7A 2XOKA 3ZU3A 2WJ3A 3K32A 2VFAA 4IKEA 4N7RA 3E82A 4D0NA 4E7PA 3BHIA 5DSTA 5HFJA 1PT7A 3RCBA 2FCAA 3TB4A 1CUYA 2WJWA 3ES9A 3PDIA 2DWCA 1A2BA 5IYZB 2CLKB 3MILA 4KRXA 3CN7A 4F5DA 3U62A 2ZI7A 4U63A 4YJ2B 1LDNA 1O54A 2VYCA 4FMPA 4YQEA 3C5EA 1N6RA 1U0SY 2Q3JA 3DMPA 1JG6A 2PQ2A 3B2NA 2C8LA 4H17A 3KT0A 4MO2A 3RSOA 3TRIA 2AJDA 1NXWA 2IP1A 3AP1A 1UBRS 1V8DA 4K6HA 4C5BA 4S2EA 2DR3A 3OZGA 2HXSA 4L5CA 1O77A 4KNWA 3UOGA 3SHTA 2EFJA 2ZB8A 3LDHA 2AG0A 1MABA 2XMZA 3HYCA 2P4UA 2ZSFA 3ZDYB 3RADC 3AEUA 2IXFA 2FUEA 3Q7EA 3ZHUA 3TTWA 1HFWA 3NOQA 3V4FA 5BSFA 3AFGA 2B99A 2PYDA 3HBLA 5E6UB 5KQRA 4CV1A 4O2AF 5E4TA 2VDQB 3EJ6A 4TXMA 3IO3A 3V3TA 4TV8B 4QXRA 5CG2A 3AINA 2GOYA 5LBTA 1R4NA 1T24A 1T8TA 4BVEA 4BUJA 2REQA 3A1UA 3EOAI 2J7PA 3UMJA 4E1AA 1RRCA 5JARA 4FFPA 2QOEA 4KO8A 4DV4B 1JTVA 3ZCVA 4K9LA 4U6NA 1DAFA 5F35A 4EZIA 2YMPA 4C7XA 2LZ0A 5KYTA 2NYVA 3W5JA 1NV8A 1HZZA 1L5FA 4MMZB 4F56A 2H07A 1QRSA 3UJBA 5JAHA 4UCWA 4FHCA 2GZRA 4WPGA 4DMUB 1O87A 1VKJA 1CVIA 5KOHA 1J49A 4O4LB 1UBCA 4R1LA 4B8ZA 3HCRA 1DV2A 4D46A 4IZIA 4OQFA 4DUPA 3UT0A 4DPLA 2Q4DA 1J25A 2QMUA 2F7SA 5K7SA 3IGFA 1NBIA 4PANA 3H9JA 5K20A 5BT8A 3GHHA 2FPOA 1REQA 1F5NA 2L19A 1PLKA 4K0RA 5IKMA 3BTSA 4YRKA 3PDWA 1JG2A 4H27A 1WHSB 4UFOA 3SHFA 4DM3A 3FTPA 3N86A 4N3AA 1UFKA 2QSUA 1BMDA 1L3BA 1JHOA 1R7RA 1OV6A 3GMTA 3RQIA 4WOKA 1M2GA 4AC9A 4EPXA 3ZY4A 1DJQA 2OUKA 3NQ41 2PL3A 2Q50A 5HP4A 3GXBA 3OCUA 3WLHA 2CV1A 3ZC3A 3UENA 2AK3A 2K2QB 4R01A 4EGQA 1I2BA 1XTVA 1R3DA 5J4HA 2XQVA 1DQZA 1EXNA 2DQZA 2R6HA 1KAOA 2Y76A 3EW9A 3Q7SA 4YA6A 5FIUA 5G0SA 4W5NA 3DE4X 2YWHA 2ORWA 4Q4AB 3TLXA 5LVAA 1WW8A 1AQJA 2O7VA 1WPXA 4RVFA 4L72A 4NBNA 5FNVA 4UU0A 3UUFA 2WWVD 3IAHA 5CMLA 5A6SB 3ANXA 3OLVA 2GEBA 4L7QA 3S40A 4CF4A 2OPHA 1KSGA 1I2ZA 3AG6A 3QKWA 1QPZA 2L18A 1RJ9A 2H1HA 2PL5A 3NAQA 1W5AA 3KQMA 3NBKA 4L0MA 2IPLA 3ND6A 4U6QA 4X3CA 3UA4A 3UWMA 1EE2A 2XQJA 5T4EA 2Y2VA 2C5EA 2JJQA 2QX9A 1VG0B 2C5BA 1IBSA 4II7A 2BR4A 4GECA 1NVVR 4RVHA 1Y3BE 3GT4A 4X85A 3ETHA 4OJMX 3X3HA 2IXTA 4ZOQI 1Q1AA 1BDIA 4KQ2A 3B3AA 4Q4HA 2XF8A 4EIWA 2TRSB 2A78A 1E59A 5F9FA 2AC4A 2RHHA 4BMPB 5F2NA 3ONFA 5EYPB 1W581 1MAUA 1O1YA 3TLAA 3CG4A 4K9DA 4R7GA 4RVGA 1ZNYA 4BDSA 3A4MA 3Q0IA 1EB8A 3WV4A 3ZXSA 2TSYB 1SKQA 1PJLA 4XB6B 4XSHA 4LYJA 3R7FA 2J46A 3SHOA 1MB9A 2R2AA 4Z0HO 3SM9A 4MA4A 3GEMA 1RLIA 4IDBA 4CL0A 2C98A 4WLVA 1T4BA 1H5UA 2EDAA 4UUQA 4ZOEA 3OURA 3PDJA 3GJ7A 1OFTA 3DEZA 1OFIA 2JVJA 1JLMA 4CM3A 1J1UA 3KV3O 3QMPA 5THQA 1OXBB 4WNYA 5EPEA 2PV7A 1XKQA 3LC0A 4YJFB 4MDFA 3DYBA 1L4FA 2NZYA 1U9YA 1DL5A 1Q7GA 1IZ7A 3FPLA 1V1MB 3IP1A 1UPBA 1G0NA 4MLZA 3B82A 2BE7A 4URUR 5FUXA 3WX0A 1F4PA 4S3MA 3NC1C 5JVDA 3IIMA 1N3IA 1QE0A 2H51A 4ZVPA 9ABPA 1PNVA 4N8EA 3VAZA 4O3MA 3AVUA 3H2KA 5JE8A 5LP6F 2QNIA 4EVRA 4CTKA 2YV4A 5M2QA 3HDQA 2IUFA 1VL6A 5CUQA 4CCYB 1JQKA 3NIGB 4BCDA 1PK8A 1O89A 2GLUA 5JWOA 1R6BX 3COPA 4MVJP 5BW6B 4D9NA 3GVXA 2JJ8A 1Z4PX 2N47A 2PU7A 1EBUA 3DCJA 3DQPA 3K5WA 4YCCA 1GYPA 1QIDA 3FCAA 2B6NA 4BEBA 2HEGA 4O8CA 2AQHA 2IEAA 3ASUA 1TPYA 5LD2B 5EZ5A 1KO1A 3KUUA 1Y42X 4RQTA 4YRLA 2DECA 3WADA 4KK3A 5KYNA 3N2GA 1MO2A 2CJFA 4JKOA 5A0VA 2OMKA 1ZIOA 2QKYA 1Q1BA 3EH2A 4F3CA 1HMYA 1Q0PA 3GH3A 1VPLA 2BEJA 1ISRA 1X1EA 2GN4A 2X5JO 5HA5A 3CVVA 4TN1A 2CWWA 1YDHA 4NG4A 3G2IA 1T9AA 3MLAA 4H3KB 1B15A 1EVKA 1NW6A 2WBLC 1W4ZA 3QVKA 2QJRA 4KH0A 2ZLBA 4RK0A 3SIXA 2VL7A 2WUDA 4YRZA 1DPGA 1LBIA 3RPEA 4GX5A 3CSDA 2HK7A 3L8MA 4L8LA 1YULA 2ZE7A 2JAUA 1VGRA 1G0OA 1W48A 3VYSB 2ARKA 5F7ZA 2IEDA 3SXUB 4WZAE 1UK8A 2ECPA 2Y05A 3RYHA 1GAJA 1JX6A 4RD6A 3THSA 3TW6A 5HKBA 1U3TA 2DFNA 4ACAA 5IASA 4U00A 3ORSA 2WD8A 4D9CA 3TAHA 3GCGA 4EW1A 3LVRE 4Q34A 1QORA 1M1NB 3K5PA 3PPVA 2BWJA 2R7LA 3DEHA 2X8LA 1KYTA 3HI6A 1GPUA 2WWRA 3ZVMA 4JLVA 1XDZA 5LB4A 1GQQA 1IEVA 3O5AA 2CHUA 4HVAA 3T7RA 1BDHA 2IHBA 4MUNA 5EWLA 2DRIA 4L6AA 3C5HA 1C29B 2BTEA 2X86A 4HQ6A 2XEDA 2ZKIA 4UCFA 1LJLA 3QUQA 5HE9A 4JP5A 5E3HA 2F8MA 2FZLA 4MUMA 1MC5A 4RWEA 4BX8A 3AG5A 2GZ3A 4CTJA 4LVOA 3I61A 1NW7A 1OXTA 1VDMA 4I2VA 4ZVOA 4B34A 3E9NA 2QLFA 4HQOA 2R6AA 2P1ZA 4R69A 3T5GA 1FP2A 3LRXA 1M34B 4OK6A 1B41A 2ECFA 1G59A 5K6TA 4G0OA 4B09A 1XU9A 2A94A 4IH9A 3L18A 1ANKA 2V3CC 3JD4A 5KVVA 1UZMA 4NU5A 4OLFA 3X2FA 1V5GA 5KNCA 2AYZA 2R7MA 1FUIA 3VR2A 2AUMA 3KVYA 1VFNA 4H7DA 2P68A 3N8NA 3GFTA 1YS7A 1EBFA 2GN1A 3O4VA 4I19A 1U0JA 3SSOA 4WA7A 3LC2O 2WMNB 3SBDA 1T0PA 3A2LA 2IYVA 4FEGA 3A3PA 3DOUA 4HB2A 2V03A 3K7EA 4RVOA 5EMHA 4NYJQ 4LOLA 1Y7TA 1N57A 1QH0A 3FGNA 1X7XA 4KLRA 3RV4A 3ULKA 2LP4Y 1YUNA 1JQDA 2FVXA 2ODWA 3KZCA 3AUUA 1DG9A 3CTMA 3QJGA 4KOAA 4JJGA 3JQ8A 4NBSA 3I9LA 4OD0A 3HUUA 4BFVA 4DJEC 1KJ9A 1O6CA 1OAAA 4KSYA 3RHZA 3V1LA 2WVHA 5BUSA 1OXUA 1NWCA 1DUSA