4PYOA

Humanized rat comt bound to sah, semi-holo form
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
214
structure length
214
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 77
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pyoA00
5ICCA 1I9GA 1UIRA 4GF5A 2VS1A 4P7JA 1P91A 4GQBA 2AOWA 2HWKA 3T0IA 2ZCJA 1AV6A 2NYUA 2O57A 4G56A 4LWOA 4CKCA 1HNNA 3KPYA 2E5WA 4IKPA 2NNWB 2G70A 1EIZA 2YXLA 4KVZA 2PXCA 5DPMA 1JR4A 2R3SA 5K0LA 3SXJA 4ER6A 2GS9A 5DTRA 5K0JA 1Q0SA 2AN5A 4E30A 3I64A 3HA3A 3MGGA 5CIYA 2I6GA 3SSNA 1FJXA 1EG2A 4OBWA 3KQMA 5EG5A 3AXTA 4YV0A 2IIPA 2B3TA 1VLMA 3E23A 5LQUA 3GRZA 5K0EA 3CJQA 1M0EA 5FHQA 3OFJA 3DH0A 2YTZA 3NWBA 3FUVA 2ADMA 4WVLA 3KU1A 2P40A 5E1OA 1U2ZA 3P2EA 3P71T 3P9NA 1O9HA 3UJ6A 3UZUA 3D2LA 2GAFA 3CKKA 5DM1A 3PFGA 4FT4A 5F2KA 5BW4A 3FTCA 1P39A 3Q7EA 3EVEA 4DCGA 1L9KA 2UYHA 2OYRA 3PB3A 2AN4A 4EKGA 3ORHA 5HIIA 3FZGA 2QRVB 2PVCA 2QYOA 3TQSA 4U7PB 2UYQA 4RTPA 1WS6A 2ZLBA 2JH8A 1R8YA 2P3LA 1SQGA 3AJDA 4GC5A 2PKWA 5FWAA 1VL5A 1WXWA 3DMFA 1H1DA 2H00A 4RTOA 1RI1A 5EPEA 1RJEA 2C7PA 4AZSA 3SX0A 3TMAA 3HNRA 1NW5A 4BP3A 3ER9A 5KQRA 3K6RA 3T7TA 1INLA 4LECA 4PINA 5HIMA 3G88A 4V0QA 5P8WA 3TLJA 4HGZA 2ZWVA 3LCVB 5CCXA 2G1PA 1O9GA 4MWZA 5FQOA 3FTEA 2XYVA 3LCUA 5GWXA 3LSTA 5K03A 3AY0A 3OE5A 2UZ4A 4OA8A 3T7SA 3P9CA 5BXYA 5KQSA 3MTEA 3P8ZA 4QPNA 2GB4A 1EJ0A 3HCEA 2EFJA 3E05A 3S68A 3SR4A 3TKAA 4DQ0A 3I9FA 3BT7A 1MJFA 1XTPA 1QAMA 2PLWA 2V74B 2BR5A 4KDCA 5IKMA 5HEKA 4RTRA 3HEMA 3TM4A 1JG2A 3KQSA 2IDJA 3LGAA 3R9XB 2ZVJA 3HCDA 5T6BA 3ELWA 4PYNA 1I1NA 2AR0A 1G8SA 2PWPA 3FYDA 3JWGA 3Q87B 4GOMD 5EIFA 3SGLA 2XYRA 1RI2A 3HCBA 3GRVA 2PX8A 2YQZA 1R8XA 3KPJA 3LL7A 2ZIEA 4FSDA 1G60A 1TPYA 2ZSUA 4GOLD 1JG3A 1X1AA 4C04A 7MHTA 3C0KA 2AVDA 2ZIFA 3GRUA 3MQ2A 5JR3A 4AUKA 2YUIA 4ER7A 2BR4A 1NT2A 2DULA 1Z3CA 3PS9A 5CVEA 1UFKA 3DR5A 3FPGA 2JHAA 4PYQA 3TKYA 3LDGA 4LG1A 4FT2A 4F85A 1YFJA 1DUSA 3DXZA 2PGXA 3M6XA 5GM2A 2PX5A 4RTSA 1VE3A 2IP2A 2AOUA 3BWBA 4GUAA 3I53A 3HVKA 4DM3A 4EVIA 2O0LA 3BUSA 3KQTA 3UFBA 2YXDA 3TPZA 3I58A 3A4TA 1G55A 5K8VA 2ONZA 3MTIA 2H11A 3SMQA 2AVNA 2PXXA 3HVJA 3M4XA 4YUWA 3M6UA 3TOSA 3F4KA 4YUYA 2AOTB 4M38A 5E8RA 2ERCA 4M37A 2GLUA 1D2GA 3HA7A 4XUCA 3HVHA 2AN3A 3A7EA 3VYWA 1DCTA 4PIMA 1G6Q1 2Z6QA 3GGDA 2ZZKA 3RIEA 2XVAA 1KPIA 2ZZNA 1Y8CA 3EEYA 2VDWA 1JQEA 5K01A 4M7RA 3M6WA 3GO4A 4IV0A 5GM1A 3THRA 1AF7A 2B2CA 3VC2A 1JTEA 1EQAA 3OU7A 5E1MA 2KW5A 4CKBA 2YXEA 3M70A 5DT2A 1PJZA 3RODA 2CL5A 3M33A 4E32A 4HTFA 3P9IA 4X41A 5FUBA 4RTLA 1V39A 3DUWA 5E2AA 2AZTA 2OBFA 3V97A 1VP9A 4POOA 5BW5A 1R74A 1XVAA 2H1RA 4KWCA 4U7TB 1IM8A 5D1HA 5ICGA 3MHTA 1AQIA 4C06A 4YUZA 3CVOA 1NKVA 2NXNA 2C7QA 2QM3A 4RTNA 1NBHA 3FTDA 5ERGB 5FA5A 5M5BA 3P2IA 2IH4A 3G5TA 3UJCA 4RVHA 3PX2A 1RI4A 3OZRA 4F84A 3ER8A 3WSTA 2NP6A 3DULA 2P1DA 4PONA 2CMHA 4ATNA 4MQ4A 1O54A 4IWNA 1XDZA 3BGDA 2OY0A 4CTKA 3KHKA 2IH2A 1L3IA 2ZBQA 4EK9A 3BZBA 1ZQ9A 3SVZA 1ORIA 3DTNA 3H2BA 4RWZA 2CMGA 1M6EX 1X1BA 2G72A 2G71A 3VC1A 4Z2YA 4AX8A 4C03A 3FUTA 5CD1A 2OB1A 3EMBA 5HILA 1HMYA 1D2HA 3TRKA 3FYCA 5E8JA 5HIJA 5ICEA 3FUXA 4FZVA 2ZWAA 4H0NA 4HTFB 5EMKA 5GIOE 3R6TA 5T64A 4A6EA 4C07A 5EKUA 1VP3A 5DLYA 2C7OA 3BWMA 3P97A 4K6MA 4PIPA 5C9ZA 4C08A 2WA2A 3QOXA 4C05A 5ICFA 2IFTA 2PXAA 4P7GA 5LQRA 3EVZA 3FPHA 4X63A 3P2KA 3ELYA 1XXLA 3CGGA 3KQYA 4V0RA 5EGSA 3HVIA 4QQNA 2XVMA 4HC4A 3UA3A 3OCJA 3A26A 3C6MA 5HZMA 5K0CA 5GINE 1FP1D 5CM2Z 5EZSA 4PYJA 3ERCA 1QAQA 2BH2A 1KXZA 4UOEA 1D2CA 2OPBA 4AZWA 3FUUA 5G02A 5LQCA 3EVAA 2VP3A 3JWIA 4GOND 2HMYB 1F3LA 2HV9A 1ORHA 2AS0A 2UYOA 3CJRA 2I62A 3FPFA 3NDJA 4HG2A 2OO3A 4OQEA 4PYLA 4XUEA 4E70A 4KDRA 3PTAA 1XCJA 1VIDA 1SUSA 2PY6A 3BXOA 3G7UA 2G8NA 2PV0A 4PYKA 3TR6A 5GP1A 3FPEA 5EIWA 4RTJA 3LKDA 1JSXA 2JHPA 3MCZA 1DL5A 1EJ6A 5DX1A 4EMSA 4ER3A 1NW3A 3GJYA 1SVUA 1T43A 2FCAA 4PYOA 4RYLA 1XDUA 1JG4A 1N7IA 2YX1A 4FGZA 5E9JA 5GOZA 2IGTA 2NXEA 4RX1A 5FCDA 2B9EA 2NP7A 2Y1XA 2ZTHA 1M6YA 1NW8A 3UWPA 4RV9A 1ZGJA 3X0DA 2N47A 3EVFA 2ZFUA 2PT9A 2I7CA 3EVCA 4PCLA 3ELDA 4PWYA 4PYMA 3DMHA 2OZVA 4DZRA 4LWPA 3EVDA 3ME5A 1IXKA 3GWZA 3NVMB 4P58A 5DTMA 1RJFA 5FHRA 1AQJA 2AOVA 2JG3A 1N2XA 5B1SA 2CKDA 3KQOA 5C1IA 4RTKA 2VDVE 4DA4A 5E1DA 3THSA 2Z6UA 3VSEA 3GRYA 2ESRA 5EMLA 3MAGA 3FTFA 2C7RA 2P7IA 3HCAA 4ZTBA 1NV9A 4GBED 2Z6AA 3LBYA 3NW9A 4R6WA 3GDHA 3ID6C 5DXAA 1VBFA 2JJQA 3KQQA 4KIGA 5FULA 2VDUE 3E8SA 2IDKA 1FP2A 2IPXA 3G2MA 1BC5A 2AOXA 2YVLA 3C3YA 3LX6A 3B3GA 2ZBRA 3BGVA 4PGHA 2PX2A 3UBTA 4X60A 4OX9Y 1N7JA 1NW7A 3R0QA 4GOOD 3UJAA 1VQ1A 1WG8A 1ZKDA 3DLIA 1QAOA 3LCCA 4Y30A 5CVJA 5DM4A 5DM0A 4YMGA 4YUXA 2HNKA 1KYZA 2QY6A 3B5IA 1KIAA 3EEOA 2HTEA 5EOVA 3OPNA 4HRAA 3KR2A 3TM5A 4E33A 2EG5A 1NBIA 1R00A 2NXCA 4RTMA 3LDFA 1KR5A 4X1OA 4EKIA 8MHTA 3G2OA 4OQDA 5LQKA 2XYQA 3GIWA 3BWCA 5K0BA 2BR3A 5FA8A 5EEGA 1JQDA 2B78A 4YMHA 4L7VA 2GA9A 5FTWA 3TFWA 3REOA 3EVGA 4KRGA 4OA5A 5EQJB 1KHHA 4C4AA 3IV6A 3SSMA 2AOUB 1FBNA 4DCMA 1YZHA 2Q41A 5CVUA 2FYTA 4CWAA 4E2ZA 1Q0TA 5EEHA 3LBFA 2FHPA 4JXJA 5FWDA 3GU3A 3UJ7A 1YF3A 3UJ8A 3I5UA 3NMUF 5EMMA 5HOQA 2P35A 3NJRA 3SM3A 2P7HA 4GC9A 1QANA 2V7EA 3OZTA 1ZGAA 3G5LA 5DXJA 1L3BA 3LPMA 3PLAE 2IBTA 1L3CA 3AWIA 4O29A 2OKCA 5BP7A 4X61A 2QRVA 1WXXA 2ZBPA 4RVDA 1KPGA 4E2YA 2EJUA 4PNEA 5K0FA 1NW6A 1YZ3A 1WZNA 1UWVA 2PJDA 1YFLA 3KQWA 2P41A 1XDSA 3PFHA 4E2WA 1SKMA 3KR9A 1X1CA 3P9KA 3UJ9A 4BP1A 1JTFA 3HTXA 1JG1A 2ZULA 3RW9A 4QTUB 3KQPA 2PBFA 3OU6A 5K0GA 2GH1A 2FPOA 3EVBA 3B7PA 4RVFA 3R3HA 3T7RA 2BM8A 1RJGA 1TW3A 4ER0A 1B42A 2FRXA 3HM2A 3L8DA 3E7PA 5HFJA 4E31A 1JSZA 3OFKA 3LDUA 5LR6A 5LQNA 5K0NA 5KVAA 2PSSA 4PYIA 3PT9A 3DXXA 5EKXA 5LQAA 1XJ5A 5EC8A 3OE4A 1ZG3A 1KP9A 3GXOA 2BM9A 4KW7A 5EHGA 4R8RA 3BKXA 1FPQA 4OBXA 1P1BA 3DP7A 4RVGA 4P7FA 5DWQA 1G8AA 2JH9A 3R24A 1YB2A 2GPYA 5K09A 1NV8A 3QOWA 5DTQA 1G38A 3M6VA 3UJDA 3KQVA 1EAMA 3LKZA 3GCZA 1R6AA 4QQKA 3SSOA 5FQNA 4RTQA 2I9KA 5EHIA 3BWYA 5GIPE 3HP7A 1R18A 1SUIA 4QTTB 1KYWA 3IEIA 3DOUA 5E2BA 5F2OA 5F2NA 5JUWA 2BZGA 2P8JA 4F86A 1JQ3A 3JWJA 1BHJA 4DKJA 3PVCA 1BOOA 4RSRA 3FRIA 4P7KA 5CCBA 1ZHFA 4FR0A 3IHTA 2IH5A 4BY9E 1NE2A 3NWEA 4EQZA 3DLCA 4NECA 10MHA 1X1DA 3IYLW 5E9WA 5HIKA 3KKZA 4FS8A 4CKEA 2ZIGA 4KIFA 4BLVA 5KYGA 1F38A 4M36A 3O31A 3PX3A 4MIKA 1YUBA 1L1EA 1X19A 4XCXA 5E9QA 3C6KA 3EGEA 2OXTA 3G2PA 3A25A 3MB5A 4HSGA 4PCAA 5DRYA 2HR1A 3HA5A 1QZZA 3G8BA 3KPUA 5EMJA 3C3PA 3KPVA 3KR0A 1P1CA 5E1BA 5DSXA 2AOTA 4YV2A 4QDJA 1I4WA 3EGVA 3BGIA 2QE6A 2ZZMA 3KPWA 3A7DA 3B89A 3OU2A 3G8AA 5T67A 9MHTA 4AZVA 2NXJA 5EZQA 2ONYA 3CCFA 3DMGA 2ORED 2WK1A 3LECA 3HCCA 4XUDA 1XCLA 4DMGA 1RI5A 2K4MA 2OB2A 3NVKI 3HCFA 5K05A 3EGIA 3EMDA 4BLWA 5IH3A 4CTJA 3G89A 4QVKA 3CJTA 5DX8A 1BKYA 2JHCA 1KPHA 2CWWA 2IBSA 3GNLA 5DM2A 4E2XA 3ELUA 4R05A 5LSAA 4CXMA 5EVJA 3GRRA 4BLUA 2FK7A 2A14A 3MCTA 3U81A 4QPPA 3V8VA 1QYRA 3QV2A 1IY9A 1TW2A 4MHTA 4DF3A 5KS2A 5CVDA 5DX0A 2WA1A 3G2QA 3CBGA 4PGGA 5C0OE 3UJBA 5LQJA 2VZ9A 4ISCA 2EX4A 4HH4A 5CVVA 2O06A 3ANXA 3AXSA 1WY7A 4YV1A 3BKWA 2PWYA 2FK8A 3B3JA 4IV8A 4A6DA 4HGYA 3MERA 3OZSA 3KR1A 3O4FA 1SQFA 1RI3A 3DXYA 3LHDA 2P3OA 4YUVA 4GEKA 4B17A 1MHTA 3NTVA 2YR0A 4FSXA 4ER5A 2UYCA 1RJDA 2F8LA 3O7WA 2R6ZA 3NDIA 3A27A 3FPJA 3FUWA 4MTLA 4WXHA 1PRYA 2B25A 2Y1WA 4AZTA 2LD4A 2ZW9A 3FRHA 2O07A 4Y2HA 5D1NA 5DSTA 5FADA 5U4XA 5CUQA 3EPPA 2PT6A 5DRTA 1OR8A 4R6XA 4QVGA 3UA4A 3B3FA 2EJTA 5H02A 3K0BA 1VPTA 3JWHA 2O05A 2XBMA 4R8SA 2P3QA 4FP9A 2PX4A 3CC8A 2DPMA 5MHTA 4QDKA 1SG9A
chains in the Genus database with same CATH superfamily
3BE4A 1Y8RB 3K15A 3QFFA 4MI9A 5B7GA 4YDQA 4Q05A 4LNHA 1ECCA 1CY8A 1EKXA 2XYPA 4C9BA 2AYYA 3T3EA 3HDQA 1U7TA 4F6RB 5CFRA 4PLVA 3CNEA 5FFNA 5E38A 5C8VA 2Y93A 3KPYA 3SIRA 3M9WA 1BE1A 4MJLA 4D80A 4IH4A 1N2CE 3SXJA 2PXCA 2C7PA 5BY2A 4X91A 4L2IA 5H16A 5JO0A 2AN5A 2D4HA 1ST3A 1LI5A 2GHQA 2VJNA 1X8JA 3SDSA 4B79A 2FPLA 2DETA 3VV3A 4IXWA 3GT0A 3H18A 3QY0A 4C7JA 4XJTA 4Z1OA 3HS3A 2XCSB 2B99A 1SCNE 2NG1A 1VLMA 3IULA 3DWGA 4ZVOA 2N3ZA 1OH6A 4NYIQ 4LMBA 1A4XA 3ZG6A 2I54A 1IZ7A 3UHFA 4MJXA 4XIYA 2AE1A 1TM7E 1Y6JA 4Q7KA 2ZBFA 2PRIA 1YIAA 1JECA 3DKKA 4RF2A 1LJLA 3ECSA 3UZUA 4X54A 3KYCA 1TCAA 1T34A 4J9UE 1H5NA 4N7RA 1P4RA 1UPAA 5EIEA 3FMGA 1ZH6A 2W8BB 2OK7A 3TTXA 2GJ8A 4EJ6A 1WVIA 2DRIA 5SV2A 4ABYA 4EKGA 3FZGA 1QZUA 4CTMA 2W2LA 1ZSVA 2XHEA 2BUCA 1UKAA 4WCFB 1Z7YA 1WB6A 5BYJA 3O6VA 5KMGB 1V8OA 2I7VA 5DYTA 3WYBA 4G0VA 3AONB 3K6JA 5JC8A 4UFOA 1G64A 3VZBA 3C1OA 1MABB 4BP3A 2V6IA 3RUDA 4LBVA 5LOVF 1C0LA 1XLTC 1GG9A 4JLDA 3RIHA 1Z6PA 5C5CA 3WGGA 1NVGA 4HGZA 3IKMB 2VXOA 2ZYDA 3D8SA 2Z56A 4C0QC 1KI7A 2G1PA 3C39A 4LYYA 3E3NA 4KBGA 5D3MA 4EYQA 4AX4A 1AKVA 3V1LA 4DMCA 2O14A 2XYGA 3DZBA 1O08A 2BDEA 3ABSB 4KXFB 4BO5A 1XTPA 3F8SA 3UW3A 3UGJA 4P34A 3A37A 5C4IA 3WKBA 2J6IA 1JDSA 1DOAA 3B38A 3M89A 4KRXA 4M9RA 1GPNA 1I1NA 5EIFA 1JXAA 2X15A 1COZA 2CMDA 4FSDA 5FWXB 4JEUA 1EE2A 2EJBA 3N2KA 2IV3A 1J49A 1TPYA 5T8KA 2WJZB 3TZHA 1II8A 3PC4A 1VYHA 2ATCA 2RHJA 3VZPA 3FTQA 4PSCA 2AVDA 4WKPA 3ZWXA 4CM9A 2XTZA 3HHPA 4OJNA 1UBKS 5EUMA 4HWTA 1ORTA 3HKEA 4J6FA 4BQNA 4EZBA 4H60A 4B7CA 1RHKA 3ZHYA 1I8TA 1GL7A 1FDTA 1I33A 4G01B 3VKHA 3KOOA 3MD9A 2ZBGA 3E35A 3O0TA 3T1TA 1E1LA 1UOEA 4N0EA 4FHDA 2V7WA 4K8RB 5GONB 3ZBPA 5L7WA 1V8FA 2JCGA 4GU5A 4JN6B 2WQ7A 1XJ0A 1ZO8A 2FGJA 1R6UA 2ZJ2A 4GLFA 3RQSA 2W2OA 3IOMA 1SRRA 5TV2A 3KXLA 4BN0A 3DPIA 3F7MA 4R8VA 3A6LA 2A5JA 5ELMA 3TD9A 1KI1A 1KMQA 1Y5LA 3VYSB 8ATCA 5MN5A 2Q5IA 1CZLA 3QBVA 3NOOA 5COBA 2H11A 3X2FA 3ZDYB 3D2AA 3CU5A 3CO5A 4RK7A 3L05A 3OZWA 2ZRJA 3FVQA 2WOOA 5FI3A 5FV7A 1QNFA 1QLWA 1JHXA 1Z45A 2DHCA 3AC0A 2BLNA 2AMFA 2JD0A 4XIIA 1RU3A 1QFYA 1KMHA 2RDMA 3MJHA 1TNDA 2B0JA 2I03A 1BX1A 3JD0A 3R8FA 2K7FA 4CL3A 2IYRA 3OJ0A 4R3UC 4I50F 1NF3A 4TMWA 3AFNA 1ZU5A 1M2JA 3D54D 5DI9A 2IS1A 3PNPA 3WLQA 1KJYA 2YMMA 3IB6A 5CJJA 5H4GA 1UR5A 1VIYA 3EGDB 3FVWA 2E5FA 1TJYA 4IH1A 2HKIA 3ANTA 1JVNA 4RHXA 1OFHA 2CK3D 4EDHA 3RK4A 3OZXA 3VU3A 1E1KA 1XQWA 2QLNA 4B81A 1EB9A 2Q46A 2GO7A 2JAQA 1COWD 3G1TA 1R74A 3G8DA 3WRXA 1J0EA 1TVKA 4EMTA 4LXHA 3FMFA 5EZ6B 2PGLA 4OI4A 2VT3A 2VH5R 1B6RA 2H8KA 5JIBA 4D9IA 3OKAA 1E5LA 3UXMA 2BGWA 2O48X 4LQDA 1SU7A 1K9SA 4RVHA 1NVAA 3H19A 1RI4A 2WJPA 3VVBA 1XO1A 3EZLA 3DULA 1SBCA 2ZDQA 1FUIA 5I8ZA 5IF3A 3WSVA 1DBSA 1EP1B 1O54A 4MQ4A 2VLIA 1CEEA 3GYBA 3RRFA 4C3UA 2HF2A 4FFWA 1P18A 3QE4A 1AMNA 3SOPA 1EX1A 1KO5A 3DDNA 1AKMA 3NYIA 3DM9B 2ZTSA 3HE3A 4OHBA 2WG2A 3F6EX 4IX1A 3GLVA 3U61B 1QF6A 1RQXA 4EJMA 1NP7A 4L95C 4DG9A 5GJWC 4N0PA 3R7SA 4GX0A 2ZAIA 1NMSA 3ANLA 3OY2A 4IOLA 4CM3A 2BBWA 3L7YA 3GJ4A 4GXNA 3FUXA 5HIJA 4RJJA 1T0IA 2GNOA 4QC2A 4A8JB 3D6TB 4CBVA 1I0LA 3IGFA 4DSOA 1AK1A 1T1RA 2MSEB 3MN1A 2H0RA 5L3QB 5B64A 1QHIA 1V8PA 3E4DA 5KSWB 5F98A 5A0VA 3BD8A 3QOXA 1DNPA 2V0CA 1JKJA 5TQ2A 3AVTA 4P81A 1T8UA 1WQ3A 1E96A 3LLVA 4GOKA 2NSJA 4L85A 5ALMA 4A8PA 4C14A 4X63A 4U2DA 5L3SB 5DK4A 4TS3A 5JS8A 1O3YA 1PQPA 5JMPA 2AXEA 1SUPA 3QNWA 5ALRA 1L7EA 2CY0A 2XUDA 3A26A 4PQYA 1J06A 3DCIA 3EFEA 3SHFA 4BRUA 3C5CA 3NKFA 1KZYC 2ONJA 3IELA 4L73A 3FUUA 1THTA 4G0MA 5AW9A 3KKEA 3ROZA 1C1HA 4RUKA 5L4NA 1TCVA 3B6ZA 3ECAA 1O5OA 1BCRB 3F6SA 1CF4A 3TXYA 1HYQA 2CUKA 1YKGA 2XT0A 2ZQYA 3NAGA 4MPJA 1FRQA 3HKDB 1ULUA 1E3QA 1T5LA 5IUNC 4Q1DA 4Q7EA 1ZVVA 3CH4B 3DEIA 4NVRA 1I1HA 5KSYA 3KRTA 2NSLA 3OEYA 3KBOA 2Z43A 1JQAA 4K9QA 3FNBA 3BXHA 4KDEA 3B5EA 1E4OA 3N87A 5LCXA 2VPPA 4HBGA 2B7LA 1Z3IX 3C3MA 3GH1A 4DBLE 2C9MA 2IL1A 3K0AB 5FL3A 4URVR 4ZGWA 2UUCB 1YB1A 4GPBA 3VM6A 2NP7A 1W8IA 3CZQA 4I4TA 1LI4A 1ZGJA 2OZLB 4HH0A 3H5NA 4H7JA 1K5GA 3LYUA 4WBNF 4NOMA 4BXOB 1PSZA 1RKUA 5BSUA 2UZAA 1Y3HA 1P0QA 5HRCA 3DMHA 4FNAA 2HW8A 1B6GA 1W1IA 1CR6A 2E9SA 2C8LA 1IXKA 1UBUS 4V0ME 4OO3A 2P2DA 1FQKA 1NNUA 4I0WB 1CUSA 1FSZA 2BLLA 5J2TF 4EHDA 5CFNA 4W5OA 1O03A 1VRCA 4UMEA 3H4MA 1AZTA 4OM7A 2QLJA 2O8DA 4OXKA 1P7PA 3VR5H 4JSTA 1QRTA 1EAYA 1JYEA 3O91A 3OMLA 4RMNA 1DKPA 4DJAA 3VPSA 1TQHA 5IT0A 2H65A 3GDHA 1UK7A 3CZCA 3IQIX 2FGKA 3S3TA 4QARA 2VDUE 3UYLA 1X86B 2JHFA 1EZ4A 1BD4A 2WKWA 3B3GA 521PA 1ML3A 1JP7A 4J43A 1TF2A 5EINA 1ICIA 4QUEA 4E3ZA 1ISSA 4QT4A 3UT5A 4QOIA 1Y8RA 1JHMA 5IMSA 1ZKDA 2GHIA 3DLIA 1A7KA 3RYFB 3GJ5A 3W3AA 4F6RA 4U00A 3G5MA 4UQLA 3B5IA 1Y3IA 4G26A 1G2IA 2XE8A 4NH0A 4DCCA 3WDLA 2EG5A 1NBIA 1XNRB 8MHTA 4DSUA 1KR5A 3K70D 1BFUA 2GAOA 1FIUA 3T7EA 3ACCA 4OQDA 4GO1A 4S35A 2C5HA 2YWJA 3BF8A 1PKXA 5EZYB 4N12A 3R9KA 4YY3B 3IVCA 4WY8A 4F9GA 5FTWA 4EGJA 1U2DC 1K2VN 4G8DA 2N1MA 4QOGA 4J4TA 4TUYF 2G06A 4Y2SA 3N2IA 3OTHA 2I8AA 4FQ7A 4QBGB 2J31A 5B1EA 3FLAA 4HN2A 5DBFA 1A9PA 4RSGA 5KVCA 4E2ZA 3B7GA 1PR5A 2ID7A 4LY0A 2BRUA 1SXGA 3HUTA 4R1UA 5WRFA 2H2GA 1G7RA 1K9VF 2Q6LA 3FCOA 3S81A 1FJGB 1DXOA 1Z7EA 3WBKA 4EJ0A 4YRSA 5IDQA 5JSHA 2NU9A 2V7EA 3CUEF 1UC5B 4U39A 2Q5QA 5IVIA 2W8BA 1BIFA 5BW8A 3LFTA 2O2EA 4O29A 3QJGA 3RRJA 2OLKA 5CNMA 2O2DA 1WXXA 2ZRCA 3VU8A 3N2NA 1ZINA 1US8B 3WIBA 1G3IA 4I55F 4N3GA 2QTBA 2Q3BA 1TKRA 4RK5A 4EOGA 1BVUA 3DO6A 4PZEA 5KMGA 1S01A 3KQWA 1N2SA 2QPAA 1QLHA 4GGMX 5JXJA 1A8PA 3P9KA 4G5XA 2Q0XA 1MABA 2XUOA 3IO3A 4NY1A 4QYIB 3B1XA 1KP2A 1Z37A 3IPLA 2W6PA 1BE6A 1NFRA 4LTMA 3X2EA 2JKVA 4KQEA 1XZCA 4BMDA 3H13A 1QF7A 3DE3X 5I4CA 4ZOEA 1PQWA 1CJUC 3L8DA 3IAAA 1VL1A 1JN0A 1JSZA 3KAPA 2AG1A 5FORA 1U5BB 5GV7A 4YRAA 3CE6A 4B6OA 4YXWA 3VPHA 5DEIA 4OFWA 2DWCA 4AB1A 1T3HA 3JQGB 1GPYA 2ZSDA 3BKXA 1V9CA 4HMOA 4ZEMA 2HU2A 1ISRA 5BQ3A 4DV4B 3BCSA 1U8YA 2XA9A 4JC8A 4CMEC 4EGFA 3VGJA 5AM4A 2G80A 3DVLA 4AJ1A 1RVDA 1YB2A 2OHHA 4I1UA 3CVXA 3MMNA 3O2NA 3F98A 5FWXA 3C3XA 5GJBA 2YMLA 1GYRA 2AX4A 2DQ4A 4U6QA 1WNFA 1U3WA 4BWVA 1R4ZA 1OHHD 1CUFA 2DLCX 1C3VA 2PYZA 2G82A 3W6OA 3AQ4A 4O3FA 3K70C 3DOUA 4NU0A 4HP8A 4Z2AA 2BZGA 1PS8A 3BJMA 1LDMA 1JQ3A 3IP6A 4FLEA 4ZVMA 2B6NA 1J0DA 2DCUA 2Z3WA 4FYMA 1SFRA 2R5FA 4I1OA 4AULA 4HDSB 4N54A 4V03A 5BQXA 1CQWA 1P61B 3DOOA 1PWEA 4KMRA 3T6KA 4EG8A 2X7JA 5GONA 4BY9E 5IVKA 2G5CA 4QBFA 4OHFA 3DLTA 1M2OA 1Z36A 3OHMA 2ZIGA 1IJEA 5IC5A 3DLAA 4TL7A 3H5RA 2B5WA 2R8RA 4ZZ3A 2RAUA 1I6KA 2YCBA 3KVYA 2I5PO 2VQ3A 2B92A 1SCQA 2VEOA 3EIEA 1C3XA 4LX0A 3KJZA 3G2PA 5AKHA 4M7PA 1M1XB 4XYBA 1SC6A 4AN4A 3PD1A 4BB0A 3AT1A 4HATA 1PNVA 1U8UA 4UE3S 4HI0E 4YV2A 2LCIA 4HOYA 2XB2A 1QIMA 2PVPA 1ADYA 2GERA 1NM5C 4JU9A 5JNUA 5KUTA 2VXBA 3CKMA 4P53A 3C98A 3HA2A 4XYGA 1TU4A 2H54A 2I2FA 4F2WA 4AG5A 2B34A 2XKBA 1YMQA 4NCXA 1TD9A 2PGDA 2K4MA 5CVCA 4DMGA 4F4FA 2HK9A 2FNAA 1OD6A 2A6PA 5T6MA 3A8TA 3WKAA 1ZM4A 1YI1A 3EGDA 3UWDA 1YOVB 4DLRA 1ZK0A 2QRUA 1ETUA 5CLLA 3GEBA 4KRFA 3ES9A 3Q0EA 1QYVA 4ZC1A 4F4JA 1EM8A 4CXMA 4JCOA 1MVOA 2A14A 4G5QA 4QXPA 4XTCS 1PUXA 1V8BA 3ESZA 4ONEA 4DLAA 4DF3A 1CDDA 1ISJA 1Y1RA 4NJEA 3JS5A 2W11A 4TS4A 1KO8A 5IM4F 1K4MA 1ZIPA 2W2TA 3AVOA 3EAQA 3ORFA 4JWKA 4UDYX 5KVSA 4II7A 3WWDA 2PL5A 1JPVA 3CF0A 3VZQA 3QX9A 2WTXA 3DOEA 1P74A 2DUJA 2IZ1A 1CVIA 3LO8A 1WE2A 1YC5A 3H1EA 4IRUB 5IDVA 1QE3A 2YN4A 2ZJ4A 3QVJA 4OGFA 3U13A 1Q15A 2GD1O 3NDIA 2OHJA 5MFPA 3WK4A 5JBNA 3GJSA 2VN8A 4ZAXA 3ZGOA 3N74A 5DRTA 4CLOB 1W2HA 4NARA 5FKJA 3IBSA 4I5EA 4O4HB 2KYRA 1VPTA 1SHLA 1IRIA 1XAJA 2B4KA 2PUDA 1XTVA 4AN1A 1IUKA 4QJ5A 1ZN7A 5JRZA 1FTWA 1C8BA 3CC8A 3KZMA 4EGQA 5EQDA 4F4UA 2BP7B 2Y71A 1PLKA 2QRMA 2FSFA 4BO3A 2OCXA 3V1UA 5ICCA 5L3QA 2PL3A 3F5MA 1ZGGA 1NC3A 1AUXA 4BKPA 1YGPA 4RKWA 3ZKAA 1JFFA 4AZ0A 2DG2A 2VCEA 4PG7A 1G1MA 2G9UA 1TO6A 2XYHA 1JEAA 1LF0A 4KVZA 4Q9AA 1EFKA 5K0LA 3HO8A 4LA4A 2RH9B 1N5IA 4YRLA 2Q99A 5KWJA 2H52A 2ZM5A 1TYZA 4U0JA 5CIYA 2B4TO 3WKEA 3D7NA 1YQDA 1FJXA 4B0OA 3CG0A 2JLSA 5HW0A 1G18A 4MDEA 1T15A 2AB0A 4IW3B 5DHTA 4DYVA 5F3WB 2OVBA 1GITA 1F0PA 3GFFA 3PPVA 5EXSA 3OPVA 3PC7A 3RG2A 5HKAA 1KTIA 3CKLA 1R12A 3GB9A 1DXYA 5CDFA 5KEIA 3GLIB 5AKYA 2GBFA 1PV4A 4BVJA 1VSUA 3VYUB 4B3HA 1PUJA 1ZVKA 2PZMA 3MS4A 4J0QA 3FCAA 4JQCA 1WIWA 1Y4AE 1QYWA 3NJ4A 3ORRA 1Q6YA 1JLRA 1Q0PA 4D99A 2GPSA 1N5KA 4JU8A 2VQSA 3A3YA 4PM4A 3E9CA 4PNHA 3WHLA 1DWPA 2IBMA 2B4AA 4D7AA 4IDBA 2AN4A 1LWOA 4EKDA 4B3GA 3LMKA 3EODA 1NNI1 3FOCA 3BTSA 1KBQA 3G0CA 3K0AA 3KEOA 2I4OA 4ZT2A 4DAEA 1Z7GA 3DTVA 1U4NA 2OBYA 3I62A 2AFHA 3HO6A 4UHJA 2OZLA 5GY7A 1OROA 4GC5A 2YZMA 3B9BA 3DR3A 1WB5A 2VK2A 1RI1A 4X95A 1R0BA 2LGJA 4D9FA 9ABPA 5DGTA 3Q8KA 4UM9D 5BNWA 3T99A 3OH8A 1QQTA 1TQ2A 4CF3A 1XTQA 4L0QA 3PJEA 4GI3A 2ZIZA 4EEXA 3W5DA 3QBDA 3T5TA 3K2IA 1I2CA 3LP6A 4MQEA 4EX6A 4M0EA 3PEYA 1D6MA 1QHXA 1L5VA 4QBTA 1TEVA 1VJDA 5L4SA 2AN1A 3SE0A 2A9VA 2WIBA 3UGQA 1CERA 2FMXA 5A3JA 4RVNA 5ITVA 1QIFA 5HQ3B 2PA3A 2DH6A 2KPOA 1G8SA 3EQ9A 3WDKA 4JV5B 1U7OA 1UMBB 3A1TA 1AXEA 4P4LA 5JQGF 3L5OA 4BNKA 1E3IA 4XSGA 2WIDA 4Q47A 1W94A 5J4HA 1PG0A 5IH7A 4XRRA 5DHRA 2O9JA 4WLOA 5JDIC 5IG2A 3MGCA 3RYFA 3VDMA 2CSUA 2IZ5A 3FWKA 3MQ2A 4Y2GA 4GLJA 3S2GA 2C82A 1ND6A 3HZOA 3EC2A 2R4UA 3IEKA 4KR9A 5DM70 3KLMX 1M6NA 4YP9A 1GU0A 1IJFA 3K3PA 4IPTA 5CX4A 1F0YA 2XEXA 4Q7JB 3IE0A 2NT3A 3DXZA 5DGXA 1WXHA 2II6A 3PEUA 4MMXB 4ECEA 1Z06A 2A0KA 1KORA 2Z0MA 3M4ZA 4GSYA 3HLTA 4J0GA 1HZJA 2Y1OA 1YB7A 3S5JA 2JF0A 3EUWA 2NQ2C 1W44A 1UMCB 2Z30A 4RF5A 1L6RA 1AQUA 3HZHA 4N18A 3N0VA 4EHHA 5FBRB 2Q4TA 1V71A 2Z4SA 3CF4G 9ATCA 3Q9SA 4Y2TA 1C1XA 3AHGA 5J5CA 3HA7A 2QIPA 3AYXB 3O74A 3TJMA 4IHKA 5JT1A 1SVIA 3MMZA 4RJIA 4REQB 3VGPA 5FFFA 2LKCA 3OX1A 1M33A 1US8A 4ENUA 5CFZA 1OUMA 2IYYA 4BV9A 5DP1A 3M6WA 1EK6A 4IG9A 4Y67A 1XD8A 1U7UA 5GM1A 5LA6B 4DQUA 1Y82A 3KUXA 1V6AA 3IP7A 3V4VB 4HB4A 4QYIA 4MX8A 3RODA 3U1BA 2PUVA 3E9ZA 1GNSA 3IAM1 3HJUA 1UXIA 4PO1A 4TKUB 1QIIA 3GC6A 4JLSA 4KQCA 1CEYA 2H4WA 2VCHA 3SP1A 3RTDA 1FFCA 1W76A 1Z4QA 3AHDA 4CCYB 2W6CX 1U5BA 4C06A 1OXVA 2VQDA 3CVOA 2XQGA 4AAYA 1OPXA 5CH3A 5NLLA 3VZRA 1SIBE 2HUPA 5KOHB 3JQGA 3CH6A 3SICE 4HYEA 2PKRA 2FZVA 3LCRA 1E3TA 4NBKA 2AUMA 2P9EA 1NFFA 4G0PA 1GEGA 2GCEA 3GNQA 3PX2A 1P5ZB 3CEJA 1E4YA 2BFEB 3ND5A 4I1SA 4PONA 4H0FA 4XB2A 5EUQB 5HP4A 4L4RA 6Q21A 2X8JB 3C8UA 3TH5A 1BWPA 2D1SA 2PH3A 2J87A 4C0JA 1XK7A 1ZQ9A 3JQ6A 4CW7A 4NE9A 5LXTF 1H6DA 5I7WA 5B3JC 3GIDA 4R2HA 3K16A 7REQB 1BWRA 1P0MA 5HOEA 3MOIA 4KR7A 3WICA 2ODWA 1B16A 3BWDD 2Y66A 3AL3A 4RU1A 1NY5A 5CYFA 2BKVA 5L3RA 3WL7A 1GU1A 4FU0A 4A27A 3TG8A 1N2EA 1FA9A 2OCAA 1QQAA 3SYNA 1V7PC 4HDSA 5HBRA 4H35A 2RGNC 3ZE1B 3DFFA 2WQ6A 2ZDGA 1K5PA 4DYDA 1ID8A 1J9EA 4Z5XA 5M2QA 1E94E 2I1LA 3QVUA 1RZRA 2I4LA 3LY9A 1ZSYA 4HSEA 4A1OA 2H0QA 3TI9A 3G23A 2IPMA 1QFJA 2XNKA 4CCAA 4JBNA 4B7ZA 5KX5B 4OYRA 1IMOA 1KQOA 2HRCA 3AI2A 3ZEAA 3JZIA 2QZSA 2WHEA 2LE0A 3JSAA 2B37A 5CEJA 2A0XA 5CA1B 3JR7A 3VU9A 2XAUA 1JPJA 4GP9A 2QTZA 2M98A 1LTKA 5AMXA 1NJ2A 3B1VA 4XYMA 1UXOA 3CVUA 4BJ6A 4AZWA 2HWUA 2CBGA 3NHUA 1Y4SA 4RMIA 1UCFA 2IV2X 3VNSA 2XMSA 2ID9A 2I62A 2A84A 2AL7A 2ZZMA 2R0QC 1A7JA 1PG5A 4EAAA 1SIWA 3HL0A 1HT0A 3AOEA 2B2NA 1JKFA 3KLOA 5HJ2A 4A5OA 1X80B 3WMFA 5FLEX 5EIWA 3OIVA 3R77A 2RBEA 3DDHA 1J5PA 2XMRA 1JSXA 4BNFA 1OXSC 2C9CA 4PZPA 3QH4A 2ZSBA 3OD1A 1VCIA 4WNCA 4ER3A 1JQBA 2HA0A 5B3KA 1Y8QA 1D0IA 1YS9A 1Z25A 1FE8A 2EERA 3LOPA 4RDCA 1I4OA 4MP3A 1YACA 4YGYA 3T4UA 3FOFC 2QG6A 3GARA 3ZE8A 4YRBA 1KFBB 4MUNA 5AVJA 3VR4A 4AMYA 4D6XA 4QUKA 3QLVA 5DYIA 5KQMA 3BH7A 1ZZEA 2ZFUA 3RFFA 4KLCA 4Y1EA 1CRLA 2FUG6 2I22A 3NR2A 1NVEA 2R84A 4C5AA 5A2QA 1Z0KA 2YV2A 2D54A 3GWZA 3JAKA 1A2OA 1K7EB 2H1WA 3MXOA 2EXXA 3U4MA 2WJ6A 3WS7A 4GVPA 3G1UA 4QPCA 4UHKA 5JJBA 4MWDA 3OCUA 2W6MA 1VDZA 5E6RB 3QNMA 4UPDA 1J90A 2WF7A 1V1MA 1JKXA 1NUPA 2JGJA 3FXAA 2VRCA 4AKTA 4KGDA 4M86A 1EDDA 2P2SA 5G0VA 1FDRA 1LPMA 4LOLA 5IZ4A 4CLOA 1I32A 3H9GA 1EM6A 3BM5A 4N0QA 5AW4A 4QNMA 4O4HA 1NA5A 3ESDA 2FJPA 3KJFA 4CFYA 1UODA 3C3YA 4WACA 4J16A 4PGHA 5KQLA 3ERCA 5FUXA 5JNLA 3P2YA 3TLGB 1N7JA 3R0QA 4YJ3F 2BP7A 1I2BA 1XCBA 3OURA 3U31A 1KA9H 4YECA 1OBVA 1ZLYA 3LY5A 1QAOA 3A14A 2VWPA 2NVWA 4R0MA 4FKZA 4KXMA 4UHFA 4KSBA 3EEOA 5EWJB 1F2VA 2PKQO 1EFVB 2DU8A 4AF8A 3EIUA 4H1TA 5EKDA 2HBZA 1NJSA 2B8NA 4D0GA 4ZFNA 4E5MA 2ZK7A 4CQLB 5MGNA 4IHQA 3DEFA 1DIAA 4P98A 1N6IA 1NWCA 1A3CA 3QVOA 5D5QA 1OFUX 1WPRA 3G02A 2QRGA 3PC8C 4RTOA 1N6LA 4IMJB 4DQDA 2AMYA 1Y5RA 1JIXA 4TOIA 3HUUA 1ZUHA 3TUZC 1Q83A 1K88A 4OGLA 4PN7A 5IP5A 2V6MA 4HEA1 2Q41A 4YMVA 3K0KA 1ZC3A 2R85A 3BCRA 3GLIA 1YS7A 3OSZA 4HAOA 4V0LA 3Q6MA 5A4FS 2DY1A 5ECWA 3VX4A 4M8LA 1U8XX 4XGNA 4Y6OA 4ARAA 1AGNA 2OAQ1 2VCYA 1U31A 5IBRA 2OP0A 3BTOA 2FB9A 4MKRA 4X3PA 2H2WA 3W9BA 5FP0A 2Z5GA 1L3BA 3LPMA 2BI8A 1XSEA 2O1XA 3AWIA 2IWHA 4H4CA 4MQ6A 1Z16A 1LBTA 4PNEA 4YH1A 3JZAA 1I7QB 1OGJA 4KLRA 1JA9A 1SG6A 4YNBA 3HYCA 1WLSA 5AXBA 1SD1A 2IYUA 2RI0A 4OI1A 2P41A 1DBRA 2NAPA 3UJ9A 3KSDO 1JTFA 2R5NA 5B55A 1TJNA 3ND8A 1W29A 3C5HA 2AW3A 2W2MA 4KO4S 4FJ0A 1Z2NX 3JQ9C 1GTMA 3FX2A 2DHRA 3VHLB 3MGAA 3OFNA 3V7NA 4DR4B 4ROTA 1PT6A 5FFMA 2H4YA 3HUFA 3ADPA 2ODQA 4E5DA 2BDUA 1J2JA 1FFDA 4LX8A 1QK5A 4L50A 4PC1A 2Z95A 5LQAA 3WP1B 3EC1A 3CV3A 4XM2A 3E1GA 1A5ZA 2JBAB 1A27A 2CUTA 2INGX 3KD3A 3L8MA 1EX6A 2JH9A 3IAS6 4ARVA 3L8CA 3R24A 2I6FA 5AKGA 3PIDA 3PNOA 3H2HA 2GBIA 3KQVA 3KAJA 3AERB 2VWQA 4DQVA 1TL7C 4RTQA 1PT8A 4JT9A 4JYZA 3NS7A 1Y4UA 3HP7A 3DWEX 3GEDA 4J0KA 1FMFA 3QEMB 4AJNA 2VQEB 2W6QA 3RTGA 3K1AB 1GQQA 4NICA 4Q02A 4PAWA 3EDOA 1VJ5A 4RETA 2PEZA 4AMVA 3WO1A 3GVXA 5EPOA 3ZJ4A 4Y8VA 2FZEA 1CIJA 1SVOA 3N8KA 3W5VA 3IURA 2XBUA 1BE0A 2HADA 3DLCA 2Y68A 1RPAA 5AK6A 1UK6A 5T41A 3ROQA 3F7OA 4BLVA 4EI7A 4WD3A 4PQGA 3TRFA 2Y0CA 2KHZA 3H04A 1C9YA 3QWIA 4RSHA 2XE7A 1YFJA 1TT5B 4NDZA 5U4QA 2XNSA 4YJFB 4GM0A 1YZFA 2F17A 4IO1A 3Q2KA 2IHJA 1UMCA 1XP8A 1NC1A 1Z82A 2CVPA 2PS1A 2Q3FA 1J5XA 2X0NA 1V1RB 1FSGA 4CUZA 1GQSA 1SIUA 1WNTA 1P1CA 5LNK1 3V55A 5E1BA 3TGPA 3R6DA 4UE2A 2VO1A 3BGIA 5IAKA 1DIOB 1NNSA 4IJQA 2MSKA 2WV7A 4C7KA 2XNHA 4MV3A 2IYAA 3OU2A 4AYTA 3FB1A 3ICEA 2C3MA 3LQRA 1M7BA 4O2RA 5E2IA 3RRMA 2FWRA 3O4GA 4IFEA 5KTKA 3T7KA 2ORED 2W6ID 2PDAA 4HUQA 1WCYA 5IXYA 2Q5EA 1RTTA 3DDOA 4OHYA 1UJBA 2GUWA 4X6LA 4MYRA 2ZPAA 3HJFA 1VLZA 3FOBA 1IQPA 4K28A 4D9CA 1JWLA 2O2GA 3CJTA 5AKJA 2MMCA 4JYAB 5FNZA 1H05A 3U40A 2P1RA 3QKWA 2PUGA 1V8ZA 2Q8QA 2ZYAA 4BB5A 2IA5A 4NXMB 1WOYA 5CXUA 1J24A 4TKUA 4ZEWA 3FCXA 3CSSA 1J8YF 3MCTA 4B7XA 3L1IA 3WQQA 1G4HA 2PBLA 1RWNA 1ZH0A 3N5CA 4CCYA 1A98A 2EWMA 2RJ3A 3MINA 2FWJA 3RFCA 3SC3A 3RH0A 4PC3A 3EWNA 1G19A 1XCGB 4TSKA 3E53A 3PC6A 1JIUA 1RMQA 5KOHA 1OWPA 1X1RA 3CYFA 4UHEA 2GYYA 2ECPA 4IV8A 2D5AA 5KTRA 1KOJA 3OZSA 2BFEA 4I4CA 2W22A 5TMDA 1SQFA 1DHTA 2E6KA 2X4LA 3G0GA 4M99A 5EYPB 1U7XA 3OM8A 5DOVA 2JIMA 4L5IA 3AR3A 5CDFE 1X9GA 3H5WA 4UAGA 4RV5A 5C7YA 1TJ3A 1W6RA 3KV3O 4MRVA 2E4XA 2B25A 5BMOA 4D9MA 1IHPA 2RKWA 3UEOA 1HQYE 4EIWA 5BYAA 1Z2AA 5F5XA 4DMLA 2ZYIA 3QLJA 2AHRA 3B3FA 1EVIA 1TUGA 4Z4EA 2JJ2D 1MOZA 1QORA 2OP1A 3B9RA 2NV6A 4R8SA 2HGSA 1T29A 3U3JA 5EJ8A 1TM3E 1T2VA 1CZOA 2C57A 3IAHA 4QASA 4YP5A 3CLRD 4M60A 4BX9A 3B1ZA 4H3HB 3ODGA 5CX1B 1JU4A 1I9GA 1OTYA 2FEXA 2N75A 3P94A 3TX6A 2WEKA 3A9SA 4GKBA 2AOWA 2HJ9A 3OZ7A 2IV7A 4BATA 2VPTA 2WWTA 3AMVA 4L57A 3VO9A 1H1TA 5A04A 5JEEA 3KXKA 1ZRNA 1A96A 1KJWA 1HTTA 4QJ3A 1KI2A 4IKPA 1XVTA 1DC3A 5KX5A 3IKTA 1ZLXA 4F21A 4DBVO 5K0JA 3NONA 5JS7A 4TM8A 2PUFA 2DOKA 4JXKA 3L8ZA 3ORYA 3H5TA 5CA1A 2Y9MB 3HR7A 4Y9DA 3ZW8A 4MGEA 3GRAA 4L8LA 4Z7OB 4UXJA 1HDCA 4KXVA 2AZMA 1D2MA 2BWJA 4QBKA 1SEVA 3LC7O 4NRDA 4V3CA 3DH0A 4TKVA 5B57C 2MMGA 1YH3A 2J0EA 2P27A 5LOVB 4P2BA 4ZVNA 3L7JA 1CZHA 1R4AA 2J9ZB 3DAHA 1A77A 3H9QA 3D2LA 1C4WA 3MWYW 4Q93A 4YRDA 4NS4A 3SXUB 3QUBA 4OJMX 3MAAC 2QQ0A 2Z8YM 1VPWA 4CEJA 3NUGA 2ZWPA 2GARA 1U28C 3DNPA 2IRWA 3T5BA 3IT1A 5I4BA 4Q34A 5EJ7A 3RIGA 2QRVB 1V4VA 1G9XA 1X70A 1TMOA 2HLDD 3GUVA 3MTGA 3N8HA 4IXTA 3V4RA 3GW8A 4XA8A 3AP2A 3GOQA 4G81A 4P0TA 3FGZA 4PS1A 3BICA 1RAGA 1VIVA 1XNHA 5GGYA 4Z7JA 4BNLA 4EY6A 1A9ZA 1QG0A 2PUJA 2RC5A 2VYNA 5EPEA 3WHPA 5JYBA 4AZSA 1LZLA 4WOPA 4F3KA 5COAA 3U19A 5AVRA 3NANA 1QH8B 4JI3B 4HAWA 4EBBA 2GBLA 2YJ6A 5A1TA 5JH7F 4DV3B 1N5RA 1PJSA 1NVUQ 3HEBA 4P4TA 1FTGA 3UC9A 3BMOB 3V9AA 1NP3A 3EAFA 1KERA 4RFSA 2XA1A 2IS2A 3VSCA 4CQNA 3MBIA 2Z98A 3M6LA 1U80A 2PMDA 2P2ZA 3I04A 4UZEA 4BL5A 2VHWA 1F06A 3PQ6A 1Z4OA 1N8TA 3E05A 3BT7A 1IK6A 1AKTA 2FTKE 5ADWA 5JD4A 1GM5A 2IDMA 5JXIA 5JPIA 5H8WA 2IDJA 4A91A 4CZ2A 1Y1LA 3R1IA 3DV0A 3G2JA 5C9ZA 4OF4A 1M8KA 3PPYA 4HADA 2RHCA 3TLGA 1NPDA 2O8NA 4QDXA 2PX8A 1L8OA 3K4QA 2RC6A 3LL7A 1VPEA 2IYXA 4FKBA 4HWRA 1Y3CE 3D3NA 3N76A 1GQRA 3FIUA 3OUZA 4NYMR 1PJAA 3UFXB 4Q3EA 1AV7A 2VTDA 4I9UA 5C1OA 3H16A 1OAAA 3T35A 4N03A 5KTPA 1XD2B 4DARA 1M74A 1SB8A 5GQSA 1V41E 2EEZA 4JSRA 4PQEA 4BASA 4CQMB 1N2IA 1V11A 4G0QA 4YVFA 1VMKA 2FFAA 4CQLA 1YJ8A 4LPSA 1CT9A 1GCIA 1RYYA 3CZ9A 3R3ZA 3ROPA 2EJVA 5A9SB 2QORA 1HT2E 1LB1B 1C9NA 4LMRA 1M0TA 1I80A 5BSGA 2Q07A 5M7EA 1QCCA 2JFWA 3L82B 1EINA 5BSTA 5J40A 1SBIA 4TSFD 4AXXA 3HLYA 3OHSX 1T9AA 4DDHA 1N2GA 5JYCA 4OSPA 1BXRB 3N0WA 5LYYA 4V39A 3PGVA 5ARCA 4Y1FA 1NXWA 2EX0A 2FPMA 2QJOA 2UDPA 1Y7LA 1X7YB 5KREA 4EF6A 2QQEA 3H97A 4YLEA 3F4KA 1V48A 3NGMA 3HSKA 4UBIA 3EXEB 1E7SA 3AY6A 4ZI7A 5E8RA 3RU2A 3THWB 2D6FA 3C7TA 3V6LA 4LYDA 2Q5JA 4P5EA 4RC9A 4DILA 1MX5A 3SU8A 3L0ZA 1MFPA 2W58A 5CURA 1XCPA 5DV9A 4L8FA 2CXSA 3FF4A 5K3BA 3U2QA 1ZD9A 4G6ZA 1I36A 3GP5A 3RFUA 1TLLA 1YNSA 3MWLA 2FMFA 1EA7A 1E63A 4CKBA 2A1UB 5KI6A 2XI4A 4MR8B 3N53A 1MKYA 3M33A 1DO2A 2AGVA 5FOVA 3TNLA 3V5NA 4R2IA 4KWHA 1B26A 1RABA 2AN9A 2AYZA 1SVKA 1NZDA 5ITWA 4O33A 3Q72A 4AQDA 1QDLB 3VDRA 4TTQA 2GHRA 1W2WB 2H1RA 2NV2B 2CJPA 2OENG 4IQ4A 2GF2A 2YBEA 2IIQA 2NXNA 1PK7A 1QKKA 3U16A 5CR9A 2G8LA 1NBHA 2Q3EA 4IHJF 4IWYA 4EENA 1W5SA 2JBAA 3LXMA 4KV9A 4MW2A 3PICA 2Y0BA 4IFIA 4BVBA 4ZICA 4AS2A 3IIIA 1DEOA 3E8XA 3GPBA 2SCUB 4M98A 4A23A 1XQ6A 2YFYA 5FOSA 4F9TA 4Z49A 3OZRA 3GDWA 1SCIA 3CX6A 3FIJA 2Y1KA 1V96A 3NP7A 4YR7A 5LD2B 3HFRA 1O5IA 4GD3Q 3AEUA 5JSFA 1P7ZA 2C7BA 2VA8A 2Y1FA 3L7AA 1Y5NA 1ZU4A 3VR6D 4RD2A 1JSLA 1SK8A 1KGSA 4R3NA 5IYZA 3OECA 1JGTA 3QEMA 3W6PA 1MAWA 1ECJA 3K1AA 1NQWA 3Q3HA 5BUQA 3EMBA 4BZPA 4GUDA 1UWLA 2D1QA 4HNHA 3W7VA 1D2HA 2YYAA 2KS6A 5E8JA 2IX9A 2WJWA 4H31A 4EH1A 5FBVB 1UJ5A 2WTEA 2BC9A 3AI3A 4L5CA 4KXYA 3SZRA 5KU7A 4D6YA 4GR5A 4LQ4A 4F1WA 2H4ZA 4DR3B 3PDHA 4HQRA 4K6MA 4B85A 5BWLA 4DV6B 3UV7A 3KUUA 3SR3A 4CKWB 2IFTA 2HU8A 1GAJA 3LC0A 5LQRA 1C3OB 1FOEB 2ZTLA 1TT5A 1TJ5A 1DFHA 3L0CA 4YJFA 2XQJA 1AD2A 3RNOA 2H8GA 2VH2A 2FF7A 3QG1A 1D3AA 5DBIA 3DNMA 4KO2S 1V1RA 5MN4A 3C6MA 1J0CA 2JAWA 4PYJA 1QTNA 3GUYA 1CS0B 2K2WA 4GW3A 1KP3A 3VUEA 1QKIA 5AW6A 1WQ4A 3OAAD 3BMNB 3DMRA 3SQLA 3LUKA 3SHOA 1ORHA 3IAM6 3H9JA 5CK5A 3M34A 5C0OE 1XMQB 2PO5A 2X41A 2GKOA 4WSOA 4NK4A 3IUPA 1ZMTA 3L0PA 4ZO6A 4BMCA 3EYWA 3CURA 3O03A 2QJFA 5JCOA 3GFRA 2HX1A 5IK2A 5T5QA 3CRW1 4E5NA 1QMGA 3P19A 3FYHA 1G21B 3TQQA 3UB4A 5JCXA 4ENWA 1AY0A 2C9DA 2OQ2A 1DV1A 2B9EA 2ZTHA 4CHTA 2Q4RA 1O6FA 1JHVA 2WWXA 3LRTA 1CUZA 2I7CA 4PLHA 2YHBA 2DZDA 4PYMA 4QGBA 4A36A 4YV7A 1ZOPA 1HURA 2C2YA 4NNPA 1POXA 4PLTA 3UGKA 1ZL0A 5FHRA 5TPZD 1MO2A 5HPYB 3HXMA 2XEDA 1N4DA 2ODEA 1YONA 5EYPA 2J6CA 2VDVE 3GA5A 4TZKA 5FBQB 3TB4A 3DUFB 3WMRA 4EKYA 3GLFB 4X0EA 3ZHRA 3GLIE 2FEWB 1P3Y1 3NVDA 1H8HA 2MIIA 3AUJB 4MW4A 4EPXA 3F3YA 2RHMA 4RQAA 3ESQA 1EUYA 3RI3A 1SPBS 3KCQA 2J46A 1MH9A 4RXMA 4AJOA 4JX8A 2I3DA 4KIGA 2CF6A 1IWOA 4XTRA 5MF6A 2PX3A 4M1YA 1FX0A 4ZEOA 5P21A 4JYBA 4AQ7A 1WBJB 3AX6A 4TZTA 4D9JA 1J00A 2FPXA 4BV8A 2CV0A 3MUOA 2HA5A 4WFJA 1RWWA 4G5YA 4JHLA 5BO5A 2P9TA 4EBFA 1Q20A 3JQBA 4D5EA 3LOQA 4FDMA 4V0NA 1N5LA 5DM0A 3VDXA 5L40A 2R2GA 2F9LA 3VNQA 4D9HA 4YWHA 3AHJA 1FSSA 4KPUA 1EEHA 4DDTA 2E3JA 1NI5A 4YACA 2XRZA 3GYGA 4Q48A 1DUIA 4EKIA 2X5NA 5ED4A 4CCSA 2XUQA 1RAHA 1PQ4A 1CJSA 2H1SA 3H84A 4RMGA 3W5AA 2C88A 1S4QA 3DLHA 4QKQA 2PUBA 1JQDA 3QA9A 4KGZA 2PJRA 4FUTA 1Z5WA 1TVEA 4XVHA 4I55B 2ZXFA 3WGMA 1HSOA 2VP0A 2OFPA 3QVLA 3OTWA 4PYRA 4EY7A 1WABA 5EEHA 4B3CA 2JGDB 1ZM3A 3EMVA 1E1DA 5AVTA 3EPJA 1E1CB 2WPDA 2HHLA 5EJIA 3I5UA 4IEIA 3IX7A 5LOVA 1T3LA 4FYHA 1PGQA 1MAHA 3CE9A 2NTYC 1K6EA 3F6CA 4HDKA 3OZTA 4F46A 3G5LA 4X7MA 2CDRA 5F4ZA 3D5EA 3INGA 2HFKA 1XEFA 4FR5A 5H0IA 4E15A 1DJMA 1FK8A 2G0AA 3H1FA 2QRVA 1HY3A 2YRWA 3KDPA 5KYWB 1GA4A 4IGEA 1PZNA 2ZXEA 4GMFA 4L4UA 1LTQA 4EL0A 2VSFA 1LX7A 3S44A 3RSCA 3STHA 3OOYA 4E2WA 1XDSA 4MQLA 1T8SA 3KZKA 3EB9A 1QH8A 4WY2A 1PZXA 2ZKLA 4QTUB 4HGQA 3L6BA 4KAJA 3BMOA 3K0HA 3FFBA 1QCYA 5JCJA 3OQOA 1G5HA 5DULA 3U6BA 1JRLA 2IHBA 2W48A 4Q3LA 5JTUA 1YQXA 3LYHA 3JPWA 2OT3B 4U2BA 3SQOA 3SIWA 2HT1A 4TQGA 3M1LA 5EKXA 1P19A 1XEXB 4EYGA 2O8FB 3H2SA 4I8IA 1IULA 4MP6A 1MUUA 2C78A 1ZH4A 2YOFA 1QGDA 3K05A 4GE0A 1Z6XA 3URKA 4AWAA 3RSZA 1U8TA 1V1JA 4P7FA 3DLBA 2K6GA 4ROSA 1C4KA 1KU0A 2VP4A 3AUXA 3ZVMA 1M2VB 3PRHA 3IPAA 1FLAA 1F0KA 3UJDA 2CLLB 3NV9A 4OQPA 4LJ9A 4TTRA 2ZUCA 3CW9A 5LDHA 1KYTA 3A9TA 1NONA 1V25A 2OXRA 1GCAA 2QLLA 3B5JA 3LL4A 1EQUA 4QQ8A 3FLBA 4UE6A 3BXPA 3UFXA 2CVQA 2WT8A 4BAGA 1PFQA 3IEIA 1UXKA 5DGDA 4HEA6 1XD2A 3T9CA 4C6TB 5CCEA 621PA 3KP1A 5BWBA 3AP3A 1YAJA 1GPAA 2RFLA 4CQMA 1VKNA 3KG2A 3CXUA 3R7NA 4HB2A 3ASUA 3LVQE 5A0TA 5DE3A 1ESEA 2J9FB 4Y9UA 3FY4A 2QG9A 3AB3A 3TEMA 2GNAA 2LP4Y 2P4HX 2JCXA 2Y27A 1ZYUA 3ELBA 4AJLA 4YAGA 1UXHA 1EK0A 3HGTA 4RS4A 3BORA 2Y2UA 4ZDWA 1DCFA 2FXVA 2YMPA 3SJCA 2COKA 2V1UA 5AKZA 1UC8A 4KFCA 1VE6A 4C21A 3K0CC 2N9UA 4AKGA 3HA5A 1GYPA 1JLSA 1GG8A 1T91A 5JU6A 4LFAB 1B15A 4MA0A 3EXEA 3THWA 1KI3A 2EDAA 4AS3A 3LK7A 1XI2A 2GQ0A 2XTJA 5I9IA 1VRVA 2RARA 4GX5A 3A7DA 4PXAA 2J48A 1OW3B 1QX4A 2X4GA 3L92A 3Q41A 4C0BA 1RHMA 1P7YA 1QTRA 2YV1A 2AH5A 2VNAA 2GTIA 3DMGA 3UAXA 4B31A 2RKBA 3OTGA 3DOFA 4DG8A 2OB2A 4K9DA 4MUMA 1PWXA 2OZKA 3HXQA 2BBOA 3NQ41 4ZXFA 4ACBA 2G1JA 1JPUA 2IHTA 4OXYA 5A6VA 3PXEA 2A1UA 4MR8A 4RHTA 1XLTA 4D96A 2QF7A 1V35A 2PJUA 4OAOA 4E2XA 4MW6A 4MR7B 3X1XA 1TLTA 5F7XA 2QW1A 1IVYA 3U81A 4UNIA 3RC8A 2R5WA 3NC1C 1G5RA 3QV2A 1QVRA 1T4BA 3C43A 1ESZA 3FVTA 3H86A 1N57A 1F1JA 1HDYA 2JPDA 2XMZA 1HKHA 2JDID 3OEEA 4H1WA 1E60A 1VLVA 2WRZA 3GAFA 2DVMA 3NCHA 1NF2A 1AC5A 2WYHA 2EX4A 4MUIA 1AA9A 3KYBA 3REQB 2C84A 3AXSA 2PA0A 1IAVA 4QHYA 5CXQA 1WF6A 4GL4A 5E6UB 3BB3A 5AVUA 1RRFA 2W5UA 2AHOA 5FPKA 1WV0A 4YUVA 1EQ2A 1V95A 4FINA 2FFRA 2BI7A 3O26A 4ND3A 1A71A 4CDMA 2WYIA 3AKYA 5KSZA 5FT9A 4TT3A 3WA7A 3SN6A 3K70B 1MXHA 4O1MA 3UMYA 5JMOA 2H2HA 5TEWA 7ADHA 4JBXA 1HYGA 4YAIA 2HMWA 5F21A 5CB8A 2AMLA 1U0HC 1LQUA 3WRWA 1WUTA 3HBMA 3NDRA 4LN1A 3NDBB 1GSOA 1QG4A 4RD6A 2ASEA 2VOJA 1Q0QA 1MV5A 3FI9A 2WVAA 3LLUA 1R0XA 2CNNA 1U7DA 3BA1A 2UXDB 3A04A 4RM3A 4M83A 1ZL2A 4UU7A 5HK8A 1JHZA 4ZV7A 4F60A 2I7XA 4LWOA 3A32A 1HNNA 1OBHA 1MQ8B 2COEA 5TY0A 3TTWA 5KPDA 4MRRA 1AO0A 3NTLA 2VAXA 1J42A 1RKQA 5AW5A 1JR4A 2AJBA 2JEYA 3IJRA 4RY2A 4MAMA 3FDXA 4BU0A 1DIGA 2FFHA 4E30A 4NMXB 1RQNA 1FCJA 1X8KA 3SKYA 1FP4B 1PDWA 1FS4A 1CS0A 2DHQA 2PK3A 4TV9B 4QZVA 2HZ7A 1KYYA 2DC1A 3BMNA 3L7NA 3HWSA 4WV3A 4WBNA 2IYWA 4OHCA 3UJNA 2YTZA 5ALZA 3CVWA 2VUSA 3IBYA 3IAEA 2OAGA 3LT5A 4TRJA 1EXNA 2EATA 5J2TA 3HB1A 4CFSA 4M8IA 3BREA 1H85A 3AF6A 1PNRA 4XD7D 5A7FA 3EWSA 2Y1LA 2GPAA 2Q1SA 3LWZA 1FJ2A 4LDJA 5ALEA 4CT5A 3BWXA 4JOSA 5BNFA 5C8YB 1I7SB 2ZLBA 2R68A 3WQRA 3I5XA 3AJDA 3UHJA 1MQSA 1ENZA 4L7QA 1OXUA 1CNEA 1YKSA 3O93A 1EWQA 1XE3A 3PFKA 3FI0A 1E9BA 1NY6A 3GJ8A 5E6SB 3LNTA 3ICVA 1F7UA 2YINC 4MS4B 1OXTA 5G0WA 4DSNA 2VJDA 3OIDA 1SXJD 1EFRA 3GLUA 2VJPA 4PGMA 3JQPA 2IY7A 2WAXA 5B58T 1HTWA 1Y1SA 4MWZA 2IELA 2QDKA 5KYUB 2J8ZA 1NURA 3RBXA 3FTEA 3GLFA 3OE5A 1DDGA 4G97A 5HRUA 4D0SA 1Z5OA 5KTMA 1AE1A 3LQ1A 1KI4A 3HCEA 3MNFA 3Q10A 3WLNA 4HDMB 4B09A 2R87A 4OUDA 1EFHA 3NEAA 3TKAA 3LAWA 4QE3A 4QNRA 1FMTA 5UKDA 1JG2A 3LGAA 4CTOA 4DWOA 3JQAD 4H6VA 4TUYA 3KSUA 2AR0A 5AICA 3KB1A 1L4EA 4Z99A 3GRVA 4XZ3A 3KPJA 1C4XA 1IQUA 4YHBA 1NQOA 3VBCA 1UBEA 3DYIA 3TRIA 1KJZA 4A10A 1Q57A 1NQVA 2Q1TA 2ZIFA 4BX2A 1TKBA 4CDGA 4Z7NB 4LFCB 4NG4A 4QYWA 3VC3A 4EUEA 1QRSA 2GBGA 5H3CA 3V80A 2DT8A 2O3SA 2YJTD 1D2NA 5CM9C 4L28A 1FNSA 1RYFA 2JHAA 2YN0A 3KJIA 1KGDA 4XEUA 3BZWA 4X6XA 1MG5A 4EDFA 2XXJA 2XUKA 1G8JA 4O4IF 4HFRA 2ZJBA 4I55A 1M8JA 4CLHA 5D00A 3EBPA 2IHUA 1P77A 4G9BA 4P6VF 1ZA1A 3PQFA 4HN9A 4MHOA 4BWGA 1CHDA 3RS9A 4JMPA 1NLUA 5DP2A 2X3FA 1FUKA 2QQGA 2WSYB 3G5AA 4ZQGA 2HDHA 4BAUA 1E1CA 4R71A 5AJYA 2QVBA 3B6KA 3D8RA 2PRZA 2CK3A 1I13A 4U3JB 5EXTA 5F3DA 4QUIA 1VJGA 3HVHA 5CT5A 1OFGA 4OFZA 4X1IB 1G6Q1 3TW0A 2JW5A 4WCVA 3JU3A 2WHXA 4GPIB 5KYWA 1AO3A 1OWMA 5CMLA 2JCVA 4FYIA 5L3VA 2P9CA 2WWYA 3KOUA 1XAGA 2NO5A 4XIGS 2RGDA 4IV0A 1S2DA 1P1HA 4IOJA 1JTEA 3TN7A 4I1RA 2X19A 2O2YA 4JLPA 2VJLA 4HB3A 1LFAA 1WHTB 3BCUA 3MWDB 5DT2A 4E32A 3I4LA 2R8EA 4KQFA 1P2GA 1B00A 3ETEA 4MNTA 5G1PA 2B7BA 4F0JA 5LXTB 1MU0A 3K2QA 3TTTA 4RL4A 1RCFA 4UCWA 2E1PA 2PHZA 3TMKA 2GO1A 4L3VA 5EJFA 2HMUA 3V4SA 3C4VA 3MCUA 5KNLA 3KK0A 3L8YA 3VZSA 2H4XA 3VH3A 1TAGA 2IUUA 3P5SA 2ZT6A 2XD9A 4CR7A 5K3CA 4DJFC 5AHKA 4F3YA 2BGMA 5KDDA 1G3RA 1CY7A 2QJTA 2RIPA 1DADA 3P2IA 4P32A 4QFCA 4KNYA 4UD6A 4C7BA 2HCRA 4OXNA 1Q6ZA 3PG5A 2V59A 4WESA 2LIPA 3T9BA 3T7AA 2O3UA 2XB8A 4DR6B 4ATNA 4G8CA 2X0IA 4C4OA 3VR1A 2ZB4A 3C7CB 3ZQ6A 3DMYA 4YCAA 3RF7A 2P75A 4GXQA 3H8JA 1Z29A 4JVMA 3ZEIA 4LOAA 4E03A 3LYAA 2DPHA 3L6UA 4AJ9A 4V02A 3D4OA 1O0CA 4AX8A 2Z3ZA 1DKQA 4LVCA 4U63A 4UUAA 4U2EA 1A8QA 3FTPA 1MDBA 3NASA 2XY4A 4HNVA 1ZQ1A 3FGPA 3IUBA 4UUPA 2QPOA 1U90A 2PH1A 4RZSA 3WNDA 4ZT6A 4MS3B 1E6EA 1QHGA 1JLKA 1MAUA 3K1TA 4PAGA 2YDXA 3VQTA 2J9FA 1U2DA 4C30A 3NPAA 4EA8A 3IDSA 1VL0A 4J0HA 2JZNA 4JZKA 4XCQA 3U7JA 5C52B 4C0HA 2DUUA 3C3KA 2CE7A 1MIHA 1U98A 3H7IA 1DKUA 4GP6A 3NGLA 2HV8A 4BOYA 3GAAA 1EVZA 5EGSA 2V55B 4NQRA 1F2TB 3HVIA 3OA2A 4CIDA 2WI8A 4FI3C 3PP8A 4HD8A 4DWVA 2BKAA 3BOSA 1VECA 2GXAA 4BFYA 1D2CA 5HE9A 2PZEA 3WL5A 2D1YA 4BBZA 1F3LA 2D2FA 2HV9A 3CJRA 3I83A 2D5BA 3PTAA 4DR7B 3LBNA 4E70A 5A62A 5IM4A 2O59A 5LZ5A 2NVUA 3QVGB 5EUBA 4UM9B 1WP9A 1Y42X 3ABZA 2EQAA 3BQMB 3FCEA 1UBLS 4LXYA 5G40A 3G0BA 3W34A 2XZLA 3IO5A 3MCAA 2IOYA 4TYMA 1B8PA 2Q21A 2VXCA 3AHHA 4WOKA 4OBBA 2EKLA 4B3IA 2R8XA 3S2YA 1U7PA 1N9GB 4J3NA 4P0QB 1A9TA 1E3WB 1Y3DE 1KE2A 4B6GA 1G5IA 5ELXA 2QHXA 5AKXA 4MI3A 4Q9IA 5FYDA 4HO1X 3Q8LA 1DRVA 1IY1A 4JLKA 5GOTA 3WLEA 3S2UA 2FN4A 3OHPA 2FG7C 2N47A 2WWWA 1JSCA 2OXEA 2YHAA 2WF8A 4BQEA 1O0BA 5IW8A 3EDMA 3WB9A 4C3OB 1CDZA 5IN5A 1QWSA 4F92B 1S9HA 2OZVA 3DF7A 4KIWA 3REQA 3RFXA 4JLAA 4CIBA 1AA6A 5TR9A 4CMEA 3RVDA 5E6UA 1XPOA 1N2XA 4EG6A 3IE1A 1UZLA 1L9XA 1JDVA 2Z6UA 1WZUA 1PJ2A 1ZD2P 5IJXA 2WE7A 3F5FA 5BT8A 1UPCA 3A4LA 5F9FA 5TQ0B 1L4KA 2O4UX 2I34A 1C9MA 4Q4JA 4TWJA 1ZMBA 4GI5A 4O59O 3MXTA 1A88A 1CB0A 1P6QA 4QEKA 5DN9A 2IE8A 3ZD9A 4N8SA 4IIVA 5C1DA 4B4DA 3NIGB 3NM5A 4MV6A 4KB5A 4U6NA 1GN8A 3SYMA 2YJ3A 1E77A 1QM5A 3BMQB 2IHKA 3O1IC 1BW9A 1XQYA 1AKWA 1J23A 2J3DA 3EH2A 4J1QA 4MWBA 4X60A 1MORA 2BSQA 4ARUA 2H4FA 3DB1A 1MVLA 1AZWA 1ECLA 3PEWA 3UHPA 3AM1A 2Q5HA 4DPMA 1J0XO 2RGAA 1BU8A 1XZNA 2IW1A 3GD7A 3OPNA 4JBGA 1RSZA 3MOGA 3ESCA 3H11B 3PF9A 4IGIA 4Q3BA 3EIOA 4RENA 5JI3E 5DCUA 1ZUNB 1FYXA 3CX3A 3VTAA 1KE1A 1HT3A 3EIHA 2JFHA 1WV1A 3NWJA 3TFWA 1FP4A 4JB0A 4ZD6A 4TV9A 4YAUA 3NVAA 1ESMA 4PXYA 1G8YA 1XLWA 3L6DA 1NM5A 4RK0A 3GK3A 4C0SA 5I6DA 1WQ1R 4OYLA 3IEXA 2FYTA 2ADOA 2VLBA 2WQZA 3GV0A 3IMFA 1CETA 4NEQA 3T15A 1E8MA 4ZHSA 3EEBA 3PQ5A 5SICE 4XB1A 2IPNA 4A9AA 5EJ2A 4X3CA 3QVMA 4O2BF 3MK31 1NYRA 3WWYA 1QP7A 1T35A 4MKXA 1QU2A 2X86A 1RHQA 2ZTMA 3A36A 1ZCZA 3NALA 3C74A 1X2BA 4TTIA 1VKJA 4N5MA 4LDRA 3T94A 3BL6A 1W8DA 1VHWA 2JGMA 4FI3F 4J2TA 4X61A 4AL4A 1A2BA 1O6ZA 1E2BA 5BV7A 2VATA 3PK0A 1A5TA 1I3MA 1NVXQ 3TZLA 3WGOA 4DTCA 4AZ3B 3HFSA 2OK8A 3PSAA 3S2FA 2P62A 5CFOA 1X1CA 2H85A 3CSUA 3CR7A 5DNYB 4MS4A 4HFNA 4ILKA 3RLFA 1DPFA 5JQGA 1RXEA 4K9PA 3MAJA 1H94A 4GNKA 3K31A 1CNMA 1H22A 1UQTA 2O7QA 3EVBA 2IHVA 3S1AB 5KYUA 3EZ6A 4E31A 5HS6A 1OHHA 1Z22A 2A5FA 2X22A 3LDUA 2CL7X 4DIFA 4X90A 1TEHA 3DXXA 3EOAI 4MDYA 4WOCA 1P2VA 5J9FA 3T38A 4BZQA 2VBFA 4M8NE 2BN4A 2O0JA 4HWKA 4AROA 2JI6A 4QJ4A 4JT2A 4MP8A 4UUMA 5EWLB 5HKKD 4I2VA 4RBNA 5LQMA 4HUJA 4OLHA 1HOTA 1W48A 2EEPA 4LZAA 1QNLA 3WIUA 1JAYA 3ANSA 1NV8A 5L8VA 4CHGA 1H2AS 4EI2A 2Y0DA 1RXVA 1D07A 1W46A 3BSFA 3FSEA 1Y80A 3OQ1A 4Z51A 4J94A 3HZRA 4OL9A 4HX9A 5AKIA 5G0UA 3F5DA 1DX6A 3L6OO 1S8FA 2FZLA 5TJHA 3PXBA 4DMFA 3ZWWA 3EZXA 4FEAA 3GPCA 5E2BA 5F2NA 5JNWA 5EP2A 4LXGA 3THXA 3ORQA 3GUCA 1GDHA 1EXMA 5M29A 3R20A 3B85A 3PCXA 3N0XA 1I4LD 4W8HA 2G63A 4ZVSA 4BB6A 1G20B 5DYYA 6NULA 3FRIA 1U0GA 4HRYA 2QT9A 2FY8A 2QRKA 5E9WA 4EPWA 2OD7A 4NENB 3AM4A 4RIHA 4PTYA 1UM9B 3QP9A 4JDPA 3L7BA 3RGGA 3R9IA 2ACVA 5DMHA 1X19A 1BSVA 3LP8A 3TDKA 4DNFA 3CPEA 2AX3A 3L0BA 1PSDA 4NV1A 5JSZA 2Q2OA 4WECA 1NYLA 4WLFA 3HJNA 1KZ1A 2E37A 5EMJA 1RXUA 5CDGA 4IFBA 4U3JA 4ZHQB 3LWDA 2FQQA 2QMEA 3WV4A 3UT6A 4R51A 4QDJA 1PL7A 3I5MA 4XOIA 5ENVA 2ZSHA 4X1IA 3DFZA 4A0GA 1ZK2A 1VCNA 4RCZA 2Q50A 4ALMA 4WMLA 2EARA 3M3HA 2J5QA 1SUAA 1X3SA 3CHYA 1MJHA 3GQBB 4O0LA 2PL9A 4FBMA 4K88A 1L6IA 1OI7A 3IDZA 4QUHA 4R0VA 4IIDA 4K5QA 1YL6A 3IBGA 4M1KA 2TMGA 3F3KA 4Q3NA 4RZ2A 5IH3A 1A9OA 1GZVA 3L8HA 3NFYA 2PGIA 1WHTA 1IM5A 3CM0A 3FYUB 1GKLA 3UV6A 2QSUA 4EPRA 4E11A 3OLWA 2V4ZA 3K96A 4OV6B 5H3HA 3NT2A 4II2A 1UANA 5KYTA 1AHHA 5LXTA 4ZVLA 1KWKA 4Z4GA 4LHYA 3ZHTA 1JL3A 3B13B 3O5AA 4OQFA 1CP2A 5DX0A 2E1RA 4Z8YA 3ZHCA 1DQYA 4BNJA 3DZKA 4GAEA 1BJKA 1H2FA 1KJ9A 2X76A 3RHSA 4HH4A 1K6JA 2F2TA 1JXOA 4WX2B 1L4NA 1YS1X 5AVQA 1HG0A 4IVRA 4C6RA 5CCDA 3R4VA 5CLQA 3LHDA 3RIYA 4D81A 1DIHA 2IITA 1A69A 1U3DA 2F48A 2R44A 4P4SA 4AF7A 4F8YA 2NU7B 4OI2A 1GR1A 3A2KA 1RJDA 5JDIA 4B32A 1TK3A 3X1DA 2H2AA 2OMKA 2XLBA 2XMPA 5JSZB 2B35A 1Z35A 3GVIA 3FBTA 4FN5A 4OUKX 1BROA 1YT5A 3OX3A 1FUUA 4LVOA 4JQYA 4P5PA 1G21E 5EAIA 5F12A 1E3LA 2P3QA 3IEMA 4MS3A 2EBHX 3VJRA 4ETNA 1TA0A 1NQUA 1GUYA 5DXFA 4QLBA 4DRYA 3IP5A 1X38A 2XT9A 2Q5OA 1YK0A 3AM3A 1P2BA 3D0OA 3QXJA 4L72A 1C8KA 3ZUPA 5IJ9B 1C7EA 2HWKA 2Z1NA 1HRDA 3B53X 4ALKA 3CLHA 5FEMA 4YRGA 4QXQA 2SKEA 3SDZA 4YT5A 4E13A 1GPKA 1IJKA 1Y3FE 2E5WA 2IPAB 2Q1WA 2HFJA 4Z0TA 1D2EA 4EA7A 4RPKA 3DE2X 5KOJB 3OQIB 2JJMA 5DU2A 3VNRA 2AC4A 2RHLA 2PMWB 3TRJA 3H65A 4BQPA 3E03A 4GX2A 4X66B 3IVXA 1EWYA 1XTUA 2PLNA 3IRVA 4LDZA 3GLFE 5KNBA 2NQ8A 2QOEA 3TDNA 2C2BA 3GT3A 2G67A 1JEJA 5SZHB 4JR1A 1CJMA 3DBIA 2YNMD 1Z8HA 2CB9A 3T3PB 4BGUA 3R3YA 1V3QE 3HMKA 1C80A 3C3CA 3IHWA 3QVGA 4OMFG 1Q3TA 4EHLA 3UJ6A 4BX3A 4HFMA 4M46A 2L17A 5LYJB 1DQPA 4KL8S 5JSKA 3R5JA 5EJ6A 5F2KA 1P39A 3OOWA 4UCQA 1GNPA 3SLRA 2GZSA 3AR9A 1EBFA 4HMPA 3B2EA 3ORHA 2OYRA 3AJEA 3Q7PA 1CC1S 4BUZA 1VHJA 3FKQA 3AZOA 1IPEA 2UYQA 8AT1A 1SD5A 2E6UX 2A0YA 2FSPA 4UU1A 4BFZA 4BUCA 1R5OA 2Q2NA 4J90A 3RSLA 1MGPA 1RWVA 3R3JA 1L1RA 2EBWA 3M4JA 4B33A 1UJ2A 1X77A 2CSXA 4YJ3A 1NX9A 3IVMA 3K6RA 1CU1A 4U1RA 3A3OA 4JK3A 1B8OA 4B76A 2EIXA 4ESOA 4CF7A 2ZUTA 2O7NA 4IDCA 1P0CA 1QOPB 3KFXA 2UZ4A 4GZ3A 3P9CA 3R5HA 4DJJA 3LT2A 1OH5A 3W4IA 5IKXA 2GB4A 2ZYGA 1XRQA 5B3JA 2YJGA 2I99A 5DNWA 3MILA 4UOQA 2I6TA 1X14A 3OLYA 4KI7A 3TM4A 3NBMA 1XYVA 2PNJA 2WJAA 4U7JA 3AVQA 2H9YA 1UBRS 2JGIA 3BMQA 3CLSD 3PU6A 4RQBA 1XDBA 1NUTA 1NUHA 5BV0A 5DIZA 1E9SA 1F2DA 2F67A 2XYRA 1AGYA 3D1VA 2RGNA 3B9QA 4DCUA 1PJ8A 2WU3A 1YBMA 3E81A 5DFAA 3WLMA 2HN9A 4KAXA 2UUAB 3AVVA 2WB2A 1PTKA 4QUJA 1L5LA 5BVHB 5JR3A 2R1ZA 1ULBA 2BR4A 1K3FA 1FQOA 1VSBA 1T2EA 2HA3A 2P9ZA 3DMTC 3B2NA 3H11A 4LZWA 1FF9A 1ZUNA 2G04A 3PS9A 1E7YA 4P4NA 1Q1QA 4HB0A 1JT9A 3BRWA 2B4YA 4BFTA 4L4ZA 1WDMA 2XMQA 3DVQX 3M6XA 2BSXA 3H5LA 4I9NA 1YO6A 1VE3A 4KK3A 2YNMC 2P2NA 4RJKA 1Z0AA 1M2EA 1XZAA 3QOFA 2J30A 3AOGA 4TS1A 2O0LA 3IILA 3M5WA 5TPWA 3WB0A 4EI8A 5JXHA 4EO7A 3U80A 1N7GA 1R9GA 1XFAA 4PHHA 2ZAMA 3R41A 3VPFA 3R75A 5A6SA 2PXXA 3UUGA 3LWBA 3PEVA 1K8XB 4ZPJA 3D6FA 2ILTA 3QIVA 1Q84A 4JITA 3UMSA 1N34B 2P5UA 5IRCD 3HWWA 2LRHA 2ZIWB 4QL3A 1L4LA 1RQGA 1RAFA 2H07A 1GQFA 2VDRB 3LHIA 3QTTA 4XUCA 3RHTA 1DRKA 4NFHA 4PIMA 1Z07A 4ALLA 3A1DA 1N6NA 2BJVA 2ZBEA 1J20A 4IHJB 2QLBA 4LOKA 1E79D 1ORVA 1RZVA 3AR4A 2HIHA 2O4CA 4GRAA 4OREX 4C29A 4FHEA 5A3SA 2VK8A 2ZQZA 3T1YB 3IHKA 5AK5A 3SZGA 3WLFA 4HGRA 4D4MA 1I4DD 2GN1A 4JJ7A 1RWQA 3PHHA 2XCTB 1XQVA 1SOMA 2BHLA 4M53A 4UEJA 1M73E 5AXAA 5BORA 1ZN9A 1ZY2A 3W1WA 1QJCA 3BE5A 1GGHA 4HAZA 1KYVA 5JFOA 4HGNA 3TLMA 1JAIA 4Z4CA 5AKKA 3MYYA 2XDYA 3S1AA 2EFEB 4LHSA 2H59A 1NDUA 5BUCA 1S3FA 1A76A 5FRDA 3P2JA 1NP6A 4B3RB 1OLOA 5BQOA 3N86A 4A1FA 4F5ZA 3W3AD 2CLIB 2X5KO 5GZ1A 3QMMA 2DXIA 1U0EA 3I34X 1Q91A 2JK1A 2O6LA 2DWQA 3I2YX 1Q1EA 5EWLA 4JC5A 2W4MA 1AKUA 3CIOA 4B80A 3PQ4A 4WNYA 5D3KA 2P1DA 2JNWA 2C07A 1K92A 3TZEA 1YU9A 4I1PA 1TFUA 4EA9A 1ADCA 4TXHA 2RHDA 2VPZA 1S8NA 1SKYB 2PMCA 4MOWA 5DYNA 3UK1A 1CUWA 2PUEA 3GLSA 2K5UA 1UUFA 1EX9A 2BGLA 2PZFA 2FZ5A 3EUAA 2NMVA 5E7JA 3D3JA 4DAOA 2IK8A 1X1BA 4RK1A 5IABA 5FDFA 4RHYA 4UVEA 1MIOB 4JZYA 5L6MB 3DCNA 4R16A 1UFOA 2QP3A 2ZWAA 3CB4A 1RWXA 3HUEA 3PC8A 4FCCA 1EBUA 5AM5A 4LDQA 3LLCA 2B83A 2P3SA 1YZGA 1VG8A 2GVDC 2I6QA 3Q7SA 3JAMA 1J25A 4JBIA 2Q3MA 1I2MA 4NENA 1UM9A 3B8EA 4EMBA 1DAGA 4MV9A 1DELA 1MRSA 1QC5A 3EVZA 3FPHA 3JD4A 4BIIA 3D02A 2PT5A 3DEAA 2XCUA 3G82C 1PJTA 3RS4A 3LUCA 2CJXA 5H7XA 2X58A 1N2JA 4RE6A 3LFUA 4X7PA 3DL2A 3R3XA 4PBSA 4XQGA 1ECGA 1XMIA 1XTSA 2V5UA 2VP6A 4C0AC 1EDBA 1JR2A 1S1MA 2IP1A 3GPIA